08ͤ{i<  ͤ{iIhBzt tͤ{i@@<@T 08ͤ{i<  ͤ{iIhBzt tͤ{i@@<@TU ͤ{it`Aͤ{iͤ{iͤ{i$h ͤ{iͤ{iͤ{iAͤ{iͤ{iͤ{i~A.ͤ{iͤ{iͤ{i`hpAͤ{iͤ{iͤ{iAͤ{iͤ{iͤ{iwAͤ{iͤ{iͤ{iAͤ{iͤ{iͤ{iAͤ{iͤ{iͤ{iAͤ{iͤ{iͤ{imD"ͤ{iͤ{iͤ{i (08@HPX`hpx$Tͤ{iͤ{iͤ{i08@HPX`hpxN$ ͤ{iͤ{iͤ{iK$/ͤ{iͤ{iͤ{iM$,ͤ{iͤ{iͤ{i (08@HPXFAͤ{iͤ{iͤ{iCͤ{iͤ{iͤ{iAͤ{iͤ{iͤ{iAͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i4!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i B!ͤ{iͤ{iͤ{i B!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i"!ͤ{iͤ{iͤ{i"!ͤ{iͤ{iͤ{i"aͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i?\!ͤ{iͤ{iͤ{i>\!ͤ{iͤ{iͤ{i=\!ͤ{iͤ{iͤ{i<\!ͤ{iͤ{iͤ{i;\!ͤ{iͤ{iͤ{i:\!ͤ{iͤ{iͤ{i9\!ͤ{iͤ{iͤ{i8\!ͤ{iͤ{iͤ{i?\!ͤ{iͤ{iͤ{i>\!ͤ{iͤ{iͤ{i=\!ͤ{iͤ{iͤ{i<\!ͤ{iͤ{iͤ{i;\!ͤ{iͤ{iͤ{i:\!ͤ{iͤ{iͤ{i9\!ͤ{iͤ{iͤ{i8\!ͤ{iͤ{iͤ{i:\!ͤ{iͤ{iͤ{i7\!ͤ{iͤ{iͤ{i6\!ͤ{iͤ{iͤ{i5\!ͤ{iͤ{iͤ{i4\!ͤ{iͤ{iͤ{i3\!ͤ{iͤ{iͤ{i2\!ͤ{iͤ{iͤ{i1\!ͤ{iͤ{iͤ{i0\!ͤ{iͤ{iͤ{i7\!ͤ{iͤ{iͤ{i6\!ͤ{iͤ{iͤ{i5\!ͤ{iͤ{iͤ{i4\!ͤ{iͤ{iͤ{i3\!ͤ{iͤ{iͤ{i2\!ͤ{iͤ{iͤ{i1\!ͤ{iͤ{iͤ{i0\!ͤ{iͤ{iͤ{i2\!ͤ{iͤ{iͤ{i/\!ͤ{iͤ{iͤ{i.\!ͤ{iͤ{iͤ{i-\!ͤ{iͤ{iͤ{i,\!ͤ{iͤ{iͤ{i+\!ͤ{iͤ{iͤ{i*\!ͤ{iͤ{iͤ{i)\!ͤ{iͤ{iͤ{i(\!ͤ{iͤ{iͤ{i/\!ͤ{iͤ{iͤ{i.\!ͤ{iͤ{iͤ{i-\!ͤ{iͤ{iͤ{i,\!ͤ{iͤ{iͤ{i+\!ͤ{iͤ{iͤ{i*\!ͤ{iͤ{iͤ{i)\!ͤ{iͤ{iͤ{i(\!ͤ{iͤ{iͤ{i*\!ͤ{iͤ{iͤ{i'\!ͤ{iͤ{iͤ{i&\!ͤ{iͤ{iͤ{i%\!ͤ{iͤ{iͤ{i$\!ͤ{iͤ{iͤ{i#\!ͤ{iͤ{iͤ{i"\!ͤ{iͤ{iͤ{i!\!ͤ{iͤ{iͤ{i \!ͤ{iͤ{iͤ{i'\!ͤ{iͤ{iͤ{i&\!ͤ{iͤ{iͤ{i%\!ͤ{iͤ{iͤ{i$\!ͤ{iͤ{iͤ{i#\!ͤ{iͤ{iͤ{i"\!ͤ{iͤ{iͤ{i!\!ͤ{iͤ{iͤ{i \!ͤ{iͤ{iͤ{i"\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i \!ͤ{iͤ{iͤ{i \!ͤ{iͤ{iͤ{i \!ͤ{iͤ{iͤ{i \!ͤ{iͤ{iͤ{i \!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i \!ͤ{iͤ{iͤ{i \!ͤ{iͤ{iͤ{i \!ͤ{iͤ{iͤ{i \!ͤ{iͤ{iͤ{i \!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i \!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i\!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i$!ͤ{iͤ{iͤ{i4!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i !ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{i?\aͤ{iͤ{iͤ{i>\aͤ{iͤ{iͤ{i=\aͤ{iͤ{iͤ{i<\aͤ{iͤ{iͤ{i;\aͤ{iͤ{iͤ{i:\aͤ{iͤ{iͤ{i9\aͤ{iͤ{iͤ{i8\aͤ{iͤ{iͤ{i?\aͤ{iͤ{iͤ{i>\aͤ{iͤ{iͤ{i=\aͤ{iͤ{iͤ{i<\aͤ{iͤ{iͤ{i;\aͤ{iͤ{iͤ{i:\aͤ{iͤ{iͤ{i9\aͤ{iͤ{iͤ{i8\aͤ{iͤ{iͤ{i:\aͤ{iͤ{iͤ{i7\aͤ{iͤ{iͤ{i6\aͤ{iͤ{iͤ{i5\aͤ{iͤ{iͤ{i4\aͤ{iͤ{iͤ{i3\aͤ{iͤ{iͤ{i2\aͤ{iͤ{iͤ{i1\aͤ{iͤ{iͤ{i0\aͤ{iͤ{iͤ{i7\aͤ{iͤ{iͤ{i6\aͤ{iͤ{iͤ{i5\aͤ{iͤ{iͤ{i4\aͤ{iͤ{iͤ{i3\aͤ{iͤ{iͤ{i2\aͤ{iͤ{iͤ{i1\aͤ{iͤ{iͤ{i0\aͤ{iͤ{iͤ{i2\aͤ{iͤ{iͤ{i/\aͤ{iͤ{iͤ{i.\aͤ{iͤ{iͤ{i-\aͤ{iͤ{iͤ{i,\aͤ{iͤ{iͤ{i+\aͤ{iͤ{iͤ{i*\aͤ{iͤ{iͤ{i)\aͤ{iͤ{iͤ{i(\aͤ{iͤ{iͤ{i/\aͤ{iͤ{iͤ{i.\aͤ{iͤ{iͤ{i-\aͤ{iͤ{iͤ{i,\aͤ{iͤ{iͤ{i+\aͤ{iͤ{iͤ{i*\aͤ{iͤ{iͤ{i)\aͤ{iͤ{iͤ{i(\aͤ{iͤ{iͤ{i*\aͤ{iͤ{iͤ{i'\aͤ{iͤ{iͤ{i&\aͤ{iͤ{iͤ{i%\aͤ{iͤ{iͤ{i$\aͤ{iͤ{iͤ{i#\aͤ{iͤ{iͤ{i"\aͤ{iͤ{iͤ{i!\aͤ{iͤ{iͤ{i \aͤ{iͤ{iͤ{i'\aͤ{iͤ{iͤ{i&\aͤ{iͤ{iͤ{i%\aͤ{iͤ{iͤ{i$\aͤ{iͤ{iͤ{i#\aͤ{iͤ{iͤ{i"\aͤ{iͤ{iͤ{i!\aͤ{iͤ{iͤ{i \aͤ{iͤ{iͤ{i"\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i \aͤ{iͤ{iͤ{i \aͤ{iͤ{iͤ{i \aͤ{iͤ{iͤ{i \aͤ{iͤ{iͤ{i \aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i \aͤ{iͤ{iͤ{i \aͤ{iͤ{iͤ{i \aͤ{iͤ{iͤ{i \aͤ{iͤ{iͤ{i \aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i \aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\aͤ{iͤ{iͤ{i\ !ͤ{iͤ{iͤ{ii!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i B!ͤ{iͤ{iͤ{i B!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{i!ͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{i aͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iaͤ{iͤ{iͤ{iͤ{iͤ{iͤ{ibpf!ͤ{iͤ{iͤ{i $ͤ{iͤ{iͤ{ix$ͤ{iͤ{iͤ{i^$>ͤ{iͤ{iͤ{i{$ͤ{iͤ{iͤ{i$sͤ{iͤ{iͤ{i$ͤ{iͤ{iͤ{iAͤ{iͤ{iͤ{im ͤ{iͤ{iͤ{i$ͤ{iͤ{iͤ{i $ͤ{iͤ{iͤ{iAͤ{iͤ{iͤ{iAͤ{iͤ{iͤ{iAͤ{iͤ{iͤ{iAͤ{iͤ{iͤ{iAͤ{iͤ{iͤ{iAͤ{iͤ{iͤ{iAͤ{iͤ{iͤ{iAͤ{iͤ{iͤ{iAͤ{iͤ{iͤ{iAͤ{iͤ{iͤ{iZ]Z_W2&5dM7~dN["|[{B$g ku#pNxX["$?2gG}kOd{b_BťRsm3/$(qNoneb[u{%fO._R/l X@#abf4'!,\&c#Em.RiL^y<l! p2S([Pǖ#. In6<e1:B%*Mj'/7htNA{<#_&\c MIfhz m"p怖,,0uY0yu[??"+(M`)}=|g+QdmhKA!XC@5 spX,8B s[Q*F7VueHxt= R͞ iv\ jH;d/)=B5dnh"ee聃D4 4U#g,NR$La*t . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4!4 ('!'!)!i%i%l( LL)!i%i%NetBSDKwGPaX NetBSDearmv5hf3D0D 0p@-cIcX2&`? P@-@O-`DDR@@2tH$HM0pWr  iP@tH$H( R k@P px0: S q`0SЍO@P0`0x= 0S(0S  P0S S0p WP P 0S;00 0 pP O0s 8#8T $TDP  PpW1&L:&,pX|dd`:&kH0`  BR` pR RX X/1&2&@- m0 P'dX2& 000/|>&pC-P0-` M؀ @ { A ( `P40 A00{{z &ЍpY@|>&Ԋ%gX2&00@-@ M@  SP  Ѝg t1A-`0Vz P0 @P@TV PC  W@@7l0S@ @0;0P W 0XplV pl0-S XduHp 8@0SV  W Ԋ% hh>&h5O-MpY xvp Z`P` Ѝ p` 0>`$5XP0S 5%0 0 5X0S40S* D$尠Dd00CS0 "@ Pp  @YT `0 @00CS0X"0 X0 )p00p  p@300 80: Sx h+p@ p Qt  X0 0 03$0000x, 00 Q00S(> 0 0 `zQp2 p  000Z H 1(# 6 0P \\P 4 `+X"J 0R 0p0ZZ3r0S P _<Y'  p00R0S ``J0S  0 >(h P <`V k` 0R?o20S 0  0 0R0aP `P hh `0S L,` P0Rt00!P >&Ԋ%X>&>&>&>&>&X2& h1&/>&|>&>&/hN&>&>&0@-MM@ P p  ;0U$C dP TTۍЍ08 P0 (0P XUhԊ%bhmh>&Q@-@ TP DD,P $ 0P@Ԋ%bhyh>&Q@-@ XP HH",P $ 0P@Ԋ%bhh>&@-|j0 hX2&0$/O'0$/N'@-i@-*i@-Ai@-Wie@-1  0R 0 ЍlixO'@-1  0C 0 Ѝ|iN'@-1  04 0 ЍiO'@-1  0% 0 ЍiO'@-0  0 0 ЍiO'@-0  000 ЍON'O'<00/@-0  00 ЍO'iN'<00/@-0  00 ЍO'iO' 0@- 00 $0P@JЍi؎%,0A-MA!q`!X0 p! R0B=0B  P~0H 8 R8B 4!010,!0Ѝ PP =wY0P   0S  0 pP0P      0 3/R ! 7000<040LD0N'O',O'#=ojjTxO'ij%jA ?jj0p@-|@PtP00 R 0p800 p0  B0Sqs O'O'N'0 0 0 /O'N' @-mC X@- @-dC X@-80@-M0@@(3/P $ YH08 : S( 0h 3/ 0P  0 0Ѝ000  1/qph0S 00Xm8@@-@LPЍ@f PЍp@-(`Vp80@ 0 3/PP8003/(Ppk@-@P`P 780 (0(3/@h P*hPЍpN'3 PO-MP`(P,`B  0S9P06 0J S +X0\ 0 X0\ ! R(P0,`R!*0 A N 000+ xpt| L  ЍO0 P % Hpp 81/qp4   ?P p 4 ;h0S4 tp0 0 0 0 "IL0 0 0p0 t 0 p0t 0 %0 0 VU0 "SR x0| 0 x0| ~p0t 0 p0t wx0| 0 [Xx0| n 00 0S04L0婭004 8pX  FЍN'= kN'0kXBkfkR/ R 0 0/\\CC B 0R0012/P/ A A A A  A A  A A A A A A A A PPA AC-MhB0 0  T0 0 8  b ?$ Ÿ ( }/L/AN#b@ DSH n&}//C#bPoPQ`0!d!!4! P ` !V4`4 " BXX P!d4C4`4 " B   !d404`4 # B  d44`4 /0`8p<0@! (K` @d44`4 oЍxO'Mb O'k" y l9lLlclU@-@Rd C- A `00P4 82#&PP0 (1/qp$ 밀pU Ѝ0S0C080$0( 3/P 0 `V`PED0  Y $ p O'XO'؎%l@-MPA P04 00#!8 0 (1/qp$ P9 0080 0( 3/PЍ80 $0(3/PP`#U0:0080p0h( p3/p #U0* ,0P`/RP `N'Xm@-@L M 0Q   0  W ЍO'c"9WO-Mw M0@S. 8S+ #='0|0S( 0| 00k" ! !dx00#| #]|0 dX&\ %Rݍ Ѝ$'|P 0 X0 S 0E0WS06  S  S $0S0 600000S60 060 00 6R`_ R0r0C0C00Q0 0S. ,B< @864  0`P V$  ( ( ,0S 0 $0P000(0040 0S $Y# 5%Hc(0S%0 %00   05 ,0S l50 0d%d\wXH5%pW= ?W09*_ 0  ^_0( $^`_0 ^p004 0 00000 (0$ @<@ 0|@ p`Hw#_W㐶) ` ?W  :$0吣(0c#` 0吃u'00S0 ,0S#$`V 0 !40S I\ /\ * r_0 N^ 0L6 e_ !5# |0 &뜲$0Z`Ё,03  !x0$ ( , o0  !h004 0| 0000@0 (0$ < \1,0S 0`QP V0,ZVp- ?V0)*_ 0  ] _(0 $]^0 ]00,000, 0 l^V㐸* ?V  :^$0V㐓(0吃# ?V  :^ 2!  0 @<  0p 8O'l lm>mvmm%LmmllmmO'&nn~C Cnn}ncnXnn|nnnnvC nB0 TnozC no@-p PP@`D: _P Ѝ`3MU@ op@-XP8@T`@D p ^P<opQ<PpO'A-AP 0$ P0 0 SQ ( $0HP ch d`P, R2DaDqU`0``000Pc 00CS000 Q   0,`0CS0000 (00/U R bcb8 4pD 0$00 0$ 0P'X2& q0R'aQ'"qT0 S 0SP/P/S/@-0P'Q6 p@-XAXT0040S+@! PP P0P`04 PV R@40 0PPU4 ^*00" 0PE`PP 0P4  P U 4P0C SR40P 0P p0R'0P'%Q'Q'p@-@8P0 00@0@00000pQ'Q'G->PP0 b0 ,(&p 0 R`Gvw@0S ( -Pb (9 ?$00 0(0 ~R0V0? 0"wbw8 4@Ђ`ƟX2&a8q0P' qFq 0p@-?0 @0xPPP@[ 0P 00S/S`bt8P ]p0p@ \P(D8<IpQ'Q']qoqcq0P'hP'|qqXqp@-@(P o8PP b\ 0TP~p`U(` 88` 0"p0P'5X2&q@-P4@(P F8P 80800P'DD @-yP $000<0 PT'1&0P'@@-<pPG0`F [stlV000PX_4 0,K00C0Cf 00CS010:0PUP1 ` 00CS0X0 P U Rt0V00P_  00C0S"10 U00CS000 U0P 0@ m_m |{ V 0  00 0 @00S 0S YIT'Q'0R'X2&aQ'Q'rO-M` R0000200010S uܱ@q0`0#0P 00)<T0J?o20ST SRP q0S  RZ  @T  Z     0010S@@  0 10P00CS000 Ѝ S 0P  BR l  @0S Z0 0$Q'Q'Q'T'Q'0R'X2&%rQ'7rA-P0`!SP@^ 0LpP0!S P ^P 0HH<00S0 $0@5X2&Ir`rtT'xrQ'A-Php@`T0S PR^R$ ` 蟤T'X2&}rO-`@ ؀0SP ĐĠİp0 T T R R u0p[P Ѝ PP P   P Pp@T'Q'Q'Q'A-p0`!SP:P@] 0b @ PP0!S FP ]P 0HH&<00S0 UpGPȂ5X2&rrtT'xrO-@bP00CS0Sp0@g ]  0 `001 pTpP@0 pW2tQtTP0PP00rPv]v8 , 00CS010 6 u0P0CS0000 S00 @ X 0000  X0 `0U0$0T p 0 1&T'8S'rX2&r(R'0R'aQ'Q'T'O-pLP0 SPEUP ЍE P C0 0X2b U000P\ h 00C0S 20  0 0CS0L200 [Z 0 PPE C P 000S S 2 `V%0 V00P \x tp 00C00 0CS0@100 0[X 0PFH0P 0 ZPF C V'P尀VP0PP00bP f\ft ptl 00C0m0 P0CS0<00jl00`6(R'Q'0R'X2&aQ'8S'qG-P@`p P`T  0PSP 0@^S00\P0S @\Z ` KP X0 @P*0P00r%r2& r@-@T 00H0 P 0S( 0C00S 0C0 ЍQ'ht@%P0 R  QQP0R/@-: Q'Q6 G-`PP@ X 0S@ @0S# @T@@DT qpP 0S  0 0 nPЍQ'rG-@P tp0SK`HPUP 0 @+PP @Q6 Q'X0000D@- 40aA R    0/d9&rQ'40000 01h@- d9&Q'rG-dRdr@`0 0S0"3(< 0?Y+Y# Y{00 R  % [ 1@s[0"S{ @`` IQV^Y0^Y-Yj @ 0@^Y-Y00@R(Z0 0Ͽ1@s@Z0"SR 0.Y@0 @R /Io@P0 R00R  h@PR 000;Y 00 V@ T0SQ'd9&C (R'sQ6 @-0@00 00U0 P000 ,R;R 0S  S   0;SPpQ'P 0p@-PQS@@R0p`V0C PQ'p@-Pҽ@P JZJ, (X$ p 00X2&aQ 0Q\SA@- /`@-0S* 0@ 000S! PHpP SPP ┽@P 0 S</R/    0  Q'Ȃ(s8( Q 0@30/@-Q'00@- R 0C30Q'A-ppQ1SPS a00S S @10`! S:`Fp00  1S pPa0S ʼ1`0 BRpE`  S`l  TP 0a0CS00   Q'/sX2&aqGshS'( Q 0@30/@-IQ'`01S @-@0!S @LQP /EP /Q'/s7@-A0 R!RUUʐ0\00P@V |xq00CS00+ 0 @ R,] R P Ѝ00!S KP g0 Sڰ 0R0CS0000 0 Q  vP   Q'd9&X2&a[sls?A-O 0 P,0p W !GY\ϟYPPP0  nQ pQ lQ 0 S @ PP1S P PPP0 nR pR lR 00 S1S P P0PP[PP0 nR pR lR 00 S1S gP0 S00P0PP1S 2S 0Sڤ 000@ `PP 0 nR* pR# lR$ 00 S}1Pr PPPೀ0S!S < x?0S 1Sm `P0PPPbM ,0100,0Z0S000@ PN 0!SPH :P00 nR pR lR 00 S*0S ( 4? f0PP1S PP"G@oG`GoobPVWP 1019P P00 nR pR lR 00 S PP RPL nQ pQ lQ 0 S*0S  PP0 PP RP, nQ pQ lQ 0 S20cS2 P0 PP RP P0  nQ pQ lQ 0 S1S @PPPP0 nR pR lR 00 Sx1So P k{P0PP PP` 0 nR pR lR 00 STY]P0PP PR0nQ pQ lQ 00 S 5 PP? = 0  P1p PP,0S `Vn0VkVpppVpW 0 nR pR lR 00 S1SP0PP P0nQ pQ lQ 00 S   0  d P0nQ pQ lQ 00 S   0   RP nQ pQ lQ 0 S2S060S$602P0 PP R l B R0" 0 S1S 2SqW P0000@ 0S0 0`PPz 0 nR- pR& lR' 00 S^1SU1S0!S  `=0S1S d PSS 0S0O 1MP0PPP` gRF  R 0 B RRD `刷@p>R0"S:b(pR0 rR0 U0 SP0 R"R  " R0U0b0  `P00CS00 (P00PP2P02 ZP P <0b200CS00U. !2R00 2#20# 02 0nS- pS" lS& @PP0 nR' pR lR! 00 S1S"!P20 2 2020P0PP P pIPP0SR `V0V pվʈ0 nR pR lR 00 SX1SO^P0PP RPӮ nQ pQ lQ 0 S:8P0 PPd9&Q'C ~sssGs%%ssT'X2&Q6 stI-qtT'hS'ȂN4t(R's%FtQP000P0P@t Y`P 00 00 P0 nR, pR% lR& 00 S1S0!S  ;0S1Sy aWW  0 <P0S0P0PP1S 2SqXP R  l B R0"0 S06PP0010CSQ bP@p P0"S4mPP00 nR pR lR 00 Sx|2 00S ;PPPP0  nQ pQ lQ 0 SZ0S !cPP0S/PPW0 nR pR lR 00 S;P bⲸ2S@ P0PP P/ -@-0 0n ЍЍ/'T'-0^S0]S0]S S]S[S .0L0S>30  Q  ]Q RG-`ጁP@0 SS&tPD(!RGdadqU`0``0,0,P,0P0( $> 00CS010 [S \S @@P`0 S @ 0(a0CS,0p00,a NP0  0@S  0G(R'T'0R'X2&aQ' _tQ'!p@-0 P= P@01SE0p0 SS t`P@0P 00S 0PP0 00P h0T 80}0Q&P0O坷0 ,((R'qT'tT'T''X2&aO-bB0  %R R 0R0H 00CS00r00 Q0&Qn0C0 RʴaqU`0``00?P? 0A0CS0l10G0 P \QH 0 SP 010S lP/ 000S S)00 S [ U 000 PO t00CS0L00 0`00 p<P P(R'U't0R'Q'4S'8S'1&X2&aA-0P0 0p@ W 0 `@P 0 R00R00 1BQN@X @嫳@pN0"S,"@gR000(R'U'sO-ScpгM@00 0GS TcsT`0``00xP|N|` \X00C0+0&SK BR D R: Y J@p RLPONO ]00C0S @Ѝh20   J  BR   0 \SH 1B\C00 BR?ˆr L\ DQ-WpBp@| \   P MD @<f00C0 AQ 0 T0 Tpppp  Pu p BR   @W0 `0CS0(00oq0  bU'0R'Q'X2&aO-M 0@P0P0s <40S  0 0000 (0 _pP ߍ0`CԳ0#2P 00 S pSN(0Y01ڐ Y   $ T$PWMWT PeL  BR +430 # V  BR 200S 00 b )L 0 0(PP.000YX Y   $ $P  BR 200S 0 , K P0 (0 P'0 p1pG Y;xxZ ̱D1PLδ0 ,(?00CS0uX   R   P> 00CS000^`W 004 00S |xP00S 0  K8 KX Q'U'0R'X2&aQ'tO-㴡A0QM0Cp` 01 00C S00`NlЍ& 0 P5 P!` 00000`P00CS000  D[  0S00CS0x00` P  PQ'Q'0R'Q'rU'Q'O-M R B000bsp 0shЍؑ؁0S1  0000 P@  0#੟ɐ Y Fp10S P0000000p0CS0C01;  \" \    " L\ B   @      0C LN Q'%Q'tU'0R' 0! XX0$0Q: 0x! dd0(0$3A[(.A R 0  P 4P0@ A0S00P00P00PP\0.S0S 0!{0P$0 i 0P(0 $ ( R P0P000Ѝ V'7VUUUSV pG-@a!80S v'PP 5*rpW GP(<0SB|(@P G@D( G@G0SM5!0CS0\ⶌ$   完00L0S \0.S0S )@0S40S t7)#Y<0?o20S X (#040 V'eD f5v6vG-`'٭:DP0L0  P0S$00D0H0먔pPP00$ẵp[|4T H0 `F0P 0 \4P D_84X0 s0X00 00dt |  P PRPS W( ?R004(0x |0R S S S3 L0S3 T0Sx3 0Sl3Pd#Q`30VP 00Ѝ10@GS0L00P0 00H00P0L0 0T0X0s0X0 00P0L0T0H0~0 00P0L0T0H00X0t0P00L00T00P0L0 00\00`0c0`00\0^0d0[PPX0<0U080 PP0 D0h l0J0D0h0000000>;(00p$080p$0,p30$00,0.000@0(0 0%0p0"0t00D00h00x00|00000000 0D0@PuE }00@`0S0\0S00S S S0 /0`0St0\0Sh0h0c" V'ht@%D xvX+&1HV'tH0<%;vX2&ThX,80p@-P@T @@\pV' 80p@-P@T @@\pV' L0-SMM\0 '+ pE 0,ލЍ 00 >04@pil0l 0 0  L00S   SXvX2& vV'V'dV'$0\ 0S A >V' X0L0S/0 0 0/0@-M0S    4 ;$pthЍ\0\@ X0R@P0 B ?( 0Ѝ@,V'0V'DV'c"vvLV'vvHV'P `00CS`0p S00 P0S X0X /X1&: S@-  S  S/ I* S  S%|@=1A-`@XPTMp !\@T10S H10S. 00 00,10'kp @0 0 0) 0@0S00S 0: S@Ѝ0p 0R0| x0B?= 0kT00S (V'v0V'DV'c"vV'V'V'V'LV'vHV'dV's@- @P@P `PU00S @GT CЍp0t  Q \0 \@-U (P@$UvV'V'p@-P@Tp0 0C0  $A @C-@4Mt$3 30S`sV4Ѝ0 0C0{ 0XPS !$0S 20Sm 4 "; $p|p ╪0( TH20S 04 $ 20S   0 : SK( "0 08"$410S10S61!0 0H 10S|10S : S0: S u`x81萟 01R(1 B?q< 0 X'Q p| , lDL\,;00S V'`V'(V'0V'vDV'c"v wxV'w@V'QwV'|V'V'V'V'V'LV'vHV'dV'1O-@0S$0010S 10S,0001!0 q0P0S ЍOPa0HQ 0P  0O0`SpQPPU% Ѝ  B 1`0    0S[  L0  $R,   V (V'0V'DV'V'V'% %V'410G-S$0@010S 10S,0000 0 0P@0`VGav렠ppPUG n0 0C0 W ep0$S,  `YpP U`(V'0V'DV'V'V'%0G-P@0T$@0@S 00S,000@0`0娀S㨐@pVG .0 0C0 W ,%p0 00 S p0$S,  Gp` (V'0V'DV'V'%@- M @ p ЍT P 0@  QQ 80 1T dP S  2&0p@-P0S``;@P ;PX A@P8 P*pV'kf'wXC-CM@: 萟P`? ?`T *F0 ⎧pPPCߍw ? @P?w0S ?@EP?oP@6&@-@ 6wX2& 000/V'@-@0 \wX2&-$Mr0P!00Q00! 00 夤 ip嚤$Ѝ "$ H0P 00t0 p0| t Ip\   HHf"$  ,0_V'wwcw Xw xxwwO-@He-MQP VPn @0Sr  LpP 0S P < |t00CS01 p0pЍ0S P PDPpPX z) (4 RlpH0! E0 X 00CS0p YX 0 P 0S  lqPP X0: S MP4P P X0: SPX pPᲣb0S  iP< SPt 5[ $劣P უ0 ˯S , !00 L AI (! 0  A{{zp]:00@0 kP @Kp lhP u?0S >X0;X0X\P 3WP ^?0-S &PXDpPt0S  DRpY@V'ljx hX2&1&c" xd!0`~܍Ѝ~,VP > !0 0E~P> ~,>`Pʨ> ~,5PE0p 0E~PYp  Q `l/04 0EP~>>( /%myxDynyyy00CS0 0 /G-`XDHMp DTD$0@t000000 00 $0S0V"4`0p Q 30Sa3PZHPZ.>0#b/000 0K#P>h#0N/V 00D30p Q  #P0 0="0//V0020"P="0/2000HЍp(0: S T. S+@ P00S`0:0 03V-V)Vq 1X  ?7 3 0~\P F ;0L S0 00 0M3qp=0S0 0V00 V V  1!00!0S ~<0~0VXHPQVS U 6 XPV P 0%V'Y'\%D % (V'Izy$%z)z-%[zm8@''<%}D00S/@-~M0@0S~, P~܍V'%@-0p@$0l00S Ѝ00 020Q =, =.P%V'zL0@- R<-P 0 0 -V'z('zA-pP@` jP@DTP`VA-pP@` 9P@DTP`Vp@-P@Tڬ` 0Q?@Pڄ0  Q @;;S p/@P00T@ <(0, -( m-%V''{={s@-R@T` Va0@$00 ?00S 0CS3P3h<0 S9E-00@ЍpPڀ;;S" 00 0 20Q P?P00@00" @<0S @@:<0ES TT 0$0/<0S*<0S &<0S "<0S $0STڄ00Q BQd,T( L,<(04 7-$%V'^{{T({={{|`1 RS@-MLQ R @!  BR0,ЍQ   RR  RQ     P000S,@  00T0pSp 0L_1Qo 05p T0T1Q/V'%\%H|mw||G-PP`0  ,p@P"ڰAQ"21Q 0P P 0!1Qe;@ ,ЍP P%V'|@-`xAMPh1P0S2 S VPLD!,00ЍV0Ap0p 00Q-; b, P0S(0S 00Q#; ) Pڐ0V 0?}4 l0 ` 0P: 0@ .,00%V' }:}g}}'ym}O-Mr,M R(`RX0E@FP0 0S ሢ000 SJ '0S \  L"pD20 0-40"0"0Tn" ?܍,ЍT ܑ0S =! !!0`14 0S|1pt1 003p@-@P`P p ᝱P $0C, 0p(@-!@ጱP 0/,0 @(G-P0M/S`p//a@P7 匲P. kp /00 sP&  P!00S  P gP0 D[x Ѝ(G-@P 00/S $QP !00Q G ̰ⶏZP,,0 0_`0S \렐p 0P,0S@$<lpH0@48 8@ԑD( (-(7A-M`P@pP5(10S Ѝ 0RP  0RP 0: S&P  P+ 0᫱PW ተP + P W$ 0@D(H= fw:(40@-: SM@=0P - \ 00[ P0 ~p 0: S0 TЍ000 tꑉ:P/  0 fA-`QFZDT@PM+H!081P @$<s1P0SP+(0 0 0 =  "4S `P+` 0Ot 040Ѝ(tS|(tHP% #00 0( (p%l%(O-Z#3(tQJM0 M`p @ 4#0CS0t3t%P d30S аP0: S X P *Z Z30S "0 q"<pS*"0 X 2P @$<댂P RPn( 4`S42T%P PuPay*" 00 + m0S10Sa 4m0C?o2 000! "2SJ>0@@z=0 CᜯzD !Jލ Ѝ  r p G@$<pm ?4S(40R(4 \ \0Q0]0S0(4 00P 00D ((((7׉( (p%~Xl%2/O-Mp@ 0W0DN 00S8 00<0 WPP0C080pG0S `0S * 0R 8 00 x x.  P8 )@0 X2@ ?@eQ*)@0 0嘠P P` lvЍXX  ) ` `@ꎊp((((Rs@-Ѝp@ 0@`P"Qf)< 0$ ЭPX) 0ꦊ(0@-@MPP00<00S =  J"Ѝ0(G-`QM MJP Y@ #p ḭP p 00PP=! SR J(ݍ ЍPJ)8 8= $HL0Q\ J(L00 0QJ(8 PT꽊IzҊA-QP  000p@T+`00CS0rpT0 0S0T@ 0S@ 0  h P 0S@ @@T S P (ܒ%1& (0 0 S@-0@0R00000S0@000S `P PTp 40P((,((( (p@-PP 0S6p `Ӌ@P` !@P0/S000000f PR @@@p<W(h0 RX R  H R/< R/ $R/Q/ (<($(L(`0@-0S L0@0T R S( 0@((~X2&G-@b- 0(MS 0SzB)(Ѝ0 0p5"0C S70|20S X00 00!P 0 000! " E PPp  0!$$! 0!ꓭ  X&(4 : S=  S7  S$  S03 0\! &0H! J ,1,"P7 S  S/  S04=! 0400S -Ё ;ЂЃ"040+0 4ثPE'0d 00  00  X(D (ɋ (~p@-8M@  ]D 0`P` 0U` @ᦖP8Ѝp/9x1A-hM0@S\ hЍAZ`(,="(<lp@1Wpp P0 000008440CSH$0"60"$0( ܭ4 CR+x ӭFhЍB>'TʭS+<  m(c"EW+ ib@-=XM"@p:(ˍ0 IXЍq7@-@Pp wP Q Ѝ00 p I Ѝ0@I0S :R Q/ 0B\/0@ P 0 0B \0@ AB\7@aB\/W@Q/Qq(0C\0S*/ \ 0W!0C0 0C S*CS*/ P@-*0S@L0 ? SR@C:@  ^:R \000C R00 S00 C@ T \A C@T2  0a0C R"  0C\0S*/ \ 02W"!0C0 0C S*CS*80P @-  m//4(zA-@,,PQ U?-QQpW .`:WP 0g?`S A趑Ar0:S@0 R   0`I-(X+&X2&̌/M s@- `%0P PQ10*@PЍp@P mR bR kR%$+ *R xR R wR!$/QP@P$+*$&0!SP@P0PA- 0S`P⸀p N0P T  @R p00T0p0S ,=@P00zPPz("s@-@Q`P0l C300PЍp@00S S@@ PP$0  @D #00(@-G_X2&90 Rr @-/\%@-00G$(G G GDX2&mD>G-pt 5h@\P(p`<$4 0pZ/00 ` O-lM/_oPjd@P$ /0`0P/吏`p0 P@x?x/  @p`?\?A0sQ S  R8/8?00 CRJ٧?zP<N>P ,c>@>0 -R.Q0 00 0|> t>t. l>h>d> >0SPp2@> = 0S>  .00 .0-0==P====-000X=00j=@ T iPPlO| -1 ! ` S=<-<@0=,=<PE < -<-<,<,<,<,x<,<{T< d<{( (p%<((H( ,(4( (%%%%%|%(d%L(D%T((.|Ñp1&Ƒc%nF E P(@(F h%(8(`''=Ҋ'Xo0(W'(( G 0.%7(0P  /(d0P/X0X0 @-P808P:  æF(T(^(X2&A-` @?\, \PA *\.  Q R( [\SPQU  !\@@]^.!Lo \0QS8 /0S 0R0SP/ S QR S0*S S 0PS 0 P0^ p-W pW]W UU @U L(p@-@@0/SN00N PdpPQP`Q*C0CTA"30L0AS*pS1p@-MPMhP/ P 0P0SۍЍp.S@T|`l @ @v (1d  7O-cM M 33 "pW @3]PW10 `00S  g 0 xPa 0`+QRV~   @+  T* R`DV;  \cݍ Ѝ&R* \R%1@\ 0@R R P BR00CR y 0@&P\P   (  BP+T- R* ` V$p0!#MS@ 0 8TS 68TS p 0i 0 x%@T *0S0T00  R S ( 0 }( bX2&|C-`PMM RP  \SP R P0S ۍЍS@P p P ;OP0 Ꮓ  0SჃ\S R PPP ogS PS" SS GS a0| 0pS sS0S080 R @@@꿖ؖ'P(A-PP 0Sp?`pۀ@PL P40 pR `@ @ @u(L0@-@0T  S$ @0@(X2&T1 RP p@-ZDT 4\p \Q Q 0T* ׂ04P  0S/  00p0S/  `00 @0/S000 0D0 R  /(<(L(A-0j40@TPp 00S0o`0 00/S @Tt0T0oP0 SD jp04(<(P(2A-@0PS' 0`.S0.S0S/S \\P 0 Q CR S.R  S.R0S/S > 10S510S ;P:4 CSR ! Q0S 0/S0S.00 ` 00C00S0<0 `V">_ Y P:4Co S Q  S  FP  ! C 0C0T T0A0 B!"00d9&G A-@QpW :h(A-P`@p娀TЍ000S$0S 0 0 0 00! !x<00S l|j|@h( (p%l%h%@-0@P@@0@ A R\ 1  S:0 ЍP`^P ppG-Mⴑ@TY `!PApT 0S @T y@PP T00 0 QC gP5]"` 0! A*00! !QP  Uލ 4P    %P] $0 P  0D 1{( $h(Gt%oޝ1G- pWP `LY @ Vy@P P` ܹPA{{t@T P`P {ΌP$h(H-d0A- @T`pH PATP +@h(Qq@-0C\N \ @N@N@N\*0000L000\:0L0 S  0 - R 0R$R:/0AA-M M RX!0Tq`0 . ^ 00B0/S$ ! 0! -P0ڍЍ@*Q.P ?Q0C PP\P0PC0@0C0  0 P d X 0 P 8 ( 0 d9&o wp@-`0Se\p@ 1e #r@ nPz000p 0ꛞ y00S  /(l0-0^0 SQ 0QP( Q#p@-P0Sp p d0P r   H] @Tp /x%Şp@-`@PpP@Pt{P d0 2L0D L-p00CS,0 0  \%H4b(M-`PpЍ@":J0840K0CS 2  `=0 01  4  d } (l <t @|qp  {=/ 0$  4 =C@2Q! 1Q) ($5Q/^)0)40($84K ARKQ  $ q++   @04(4 :(40/S0004084(49)($ q++@k$( (C-Z4$#0CEM@S$030S`` EߍJ(]J(J(J(D ; 00$0$0<0 0 0 ݍЍp$=G  (p@-@2  PP hp@Bꈢ@-P0-S0S' ៖@P#rrw 0N0p Sl0 CP`P40T Ѝ@p1&-@-0@P   #Ѝ@Ѝ/(p@-@ATp@0 R PTP ` `P`p(-P@-000  x0x 0 0 h@0S \ _U00L0L < ,$ QU Ѝ@ Ѝ/( (((X2&(p@-x僓@PlEhPP \>P p5ᄓ000S  pҢȂ(H(ۢ -P7@-000  0 0 @0 P0S | U00l0l h录 X匪TvD 8展0 T Ѝ0@Ѝ/( (((2&(X2&ץ@-j 囕rX2&0@-MM@P@Mߍ00/SNPxNP ap T\p  0RP 0RP 긥= 000/(@-' X/ X2&A-`q M@T ppIhAPD00CS0>@ Pp< @Y@DOoB0S@ Ѝ0P: S 㑓P 0S >u X S 0 R@@vp x0 pAT0 @00CS040 (3X2&Ac" x1&O-PQAMS 00@<S =S 00@|S0 0@&S0 0@=S0   +R0'  -R0( )%#$0 d9&(N (H((XG G 0 @-(0s@-P0`0}W0`0S@ P 0R@P@8   5P@0 0S00S ( 0ST P000 R  Ѝp((L%ݤ N @-AL ^`X sr^0 \d _1#P? L 0l0̠?00à cΌ SQŒQQP0R0R0P0QPQP !G /O-p`p됰0%SP@q0V0&S T4e! a000 @ P@P@(<0@-4M!@p HT` 0 P@4Ѝ0@P S5WP@V P@ 0 F?P@( P@E VU(7p@-@P0)Sp(O-@,,Mp`TP TS T( T) #T! @$TO "T 0#S@P  +,Ѝ'0DSYA `@V@@P'0ISV'Y00`0`  Hێ T! z!P 0 @@! 0 @PV`'T@@`4 @P @᧎ (sJX7O-M8Pp`l! @h0 X@0DS '00S^^* PU@  0 c 0DS00SY Ѝ` pUU (G C-pᐐ`  0BS0p0@SP! 000 P@@P@@ Ѝ(G-`d0SP@! p000 PP@(@-M@`P>1PL0P  IR NRpp PpEp@@0SP@ $L1Ѝ(PG-P-PP* @0耟0 `0 0R0Cp0W S `Sp00 0 P11Sp0@0PH0@P 0,P@1c"H%@% ((O@P/- 0/SSS00(0@-@PMMMߍ00/S` jp ep  0RP 0RP= p@-`\B0@P 10D0p@n0m0H0"SP VpAAoz(p@-T` RpH0@Q 8 PP  0pp@(%G-pWR 0S)P lB000000000CS020S @T  St S\THbH/m42@000/Sp=FpPJ0S0/p0CS0pppW000000pA0P00 l00/ lRd R00CS0<10S 00CS00W00 pR0S/S0@D00x0@P  R*0000t/S0S P 0/0CS0 pG0S 00CS000L0@I0@F0@((( (H%@%= A-p`@000ƋP 00CS000S W00CS0Pd00S H%@ HW 406 R0S 0O((L%(2G-M6r0@TLS@P 0.S00.S000/SS?X20PpTePZ( ,`V *FPP z` w. E`0Eylh@l0-S0Sp1@T@hRP.ᝋPw 0S p?.P  `P m 0: S W (pj.PXP pW l0S hp N.PЍL%(8$J (%,@-$0Q @ ]Q@(Ap@-L@50P000S LTPP 0Se@@tM 101M00CS00 zM 0 \M0pm<M(l(\%G-PhR@ @1`0V1 @ P ,P  `I\TQp @p0T \0DQjSh00@ p0BP!0 BS@p@00CS00 M 0@0 @T0S 00CS00 L 0 0SZ00CS00 L 0 L 1 0l1@ @ @ @ @ @pp\@@\%-@G A-@ ` PR 0R 0S SLp0S0 R M0S  MU  LTM(l xL Td@00CS00 {L 0 A\LD%((`%XX% 0@-P4 0(40@-@Q M(@-x0@T   @@@@ @S@00S 4060S [Ѝ( (L%-$0@- R    (-@-  0@-(-@@-00 H@-P@` =-@@-  3@-@--@-00{ " ЍЍ/p@-P@o p@-@-   ЍЍ/ L 0P< < @-DL,P / G (0/(p@-@ῈPPPP ؇p` ܇`P ̇p` Ї`p7@-P30@T t0 6 N 0d0@T PTMP0 0 @ 0{N@B Ѝ0(c"L%((B @-`p@PU'n<0P&{ `Fkk&Zg{[[؈06S 00S\ s Ѝo @0t0S0T.S N@(.0    /(s@-@` PTЍp0P0CS0 000 P 0 4@ 00 H 0@-MP @T 0 @@ip E+P   0L@@ip @0 cЍ0 @2h @(%%@-@P 0S0S 4P 000  Ѝ(0G-`S q0P00#p@T0SPf&@D1$@00CS0$10S 1Ѝ00S p Uᲆj<  R S)P00CS00S UA0S呆AUᇆP儆@"(((3G-@P,M^P` U*릐 s)2Q0U2$PP20S H0S 2$PPPU I ^0S|2 0S@*T ^0S<"$0 0 *^0S2 R$0S0S 2F@ P0S $F0S F^0Sd1 R$ R @T$@0S F 0S E 0S E 0S E  0 $ V $0?o2$0Mx0$ R  0S E 8I4ZI ЍL%((H (0(HD%O-M@Pp&*0 @뤀夠夰`?P@ WJ*Vx0$`W T ^0S W LP  0`S *Ѝ(0%L%(P8PG-P* @0䀟0 `0 0R0Cp0W S `Sp00 0 P*}*S p0@y)PD0(00$l*0 $ 0$/H%@% ((A-P@耟0p0`0^0S 0S S00CS0 0 0S 00CS00 00$`0C00CS$` $0 R Ss 0$`S S(L%G- M䑟A^`PV $`c)pWT0尡p0p00WZ 0S- |1|a3HlH H00CS00 oH 0= I00CS00 ]H 0 ?H  K^ $`R 0S S00CS0 p  0S pS00CS0 0$`0C0 () ЍL%(((X%C-$M@쀟 p( 0 0`@T+ 0S0 PU@ 000}P x0 0 SP00U$0 @ R^PU $0($ЍP0((L%G-@,Pp0ESo᪢' 0S$ 1a1d2"H HY.HUH00CS00 G 0 G|aU000$ &PD U@q C0$0  B DPP00CS000S (A900CS000S U0S0SH0H01GPG(0G=GUp'#$L%(X%(Xl{(((420@-IM000000 20S 00S 1Q11GG0@TzG1G⛎PP& |1 1@6>0S @T H1勎 cB@YG8WG1F0S 1 $ Iߍ0A 0 000 0@P00CS0 0@ 0 00x0 =00CS0 0S #Gl!GD0FX00S j@00S d(L%(X%(X((((0@-$M0000 00`^0oSP4P @]'000p\  pr%P 00S )廂=8峂000 p0CS0(00S  a'$ЍL%((?C-@0mM00@H0?_00?0,@0P@ '0o000@@`pPdpTd0lo@0hP 0lP@T 00/Pl 00$0`0S$&`0 S 0D0>60S >0S$0S 00D0$ 01C 0>0S$0S h@T @ xPP H0E7S 'x0R8 @>0S900SE $.000a00,(00 0p(0&p  =&0S(7S%00S 0 0S= 8 l= , Ԃp@ P h=0 KT=8 ,=, R , ,( $P000<=0S @U0 0*P@I.P  @J$ 0 $ R 0ThP ^P 0: Sp  Sd PЍ0IP0 : Sn" PP($ Уp@-Px@x`M$P)00S g"0`)000``00!`"$Ѝp((@-Pd@$0A&0 RP   BQ   (//C-LMk)888 p(0@<P@ `D `$0 ALЍc"\%A-@P`s}pWU L! 00+'p((O-pWA R``%` P0S:S SCEĐ@ @0S(W@  @0T/S/00;_t00 R00P R:R:RPPP@DOY!!@%H% (@@-PM/p .먐PK  0 S@ T9D~p0 @~0!0P 0pWZ0S 0 bT00S ,0S (0 S~p @B! h`P T T T0@@T >0DS ( 1A-@MP`Rk01000  ;p!XZU p@@ Q X@T@QD@ 08AS 00CS00 1@ 0* 00CS00 !@ 0 ЍQ o@@U P000.K 00CS0T00S DU@S@84H (0HQX\%Z((djnp@-P@@Pp 0S%SpP @TT p@-P8@Pp 0RPp@S L0L-  R0S P P\ 0%(G-`@嘀0唐0P0|Up00CS0h00SGA0S0 S 0S00\PPp((%(0A-p0@0`P Q' Q:R @":QR!@P 0`EJ0@S`@?%R00S D$P`0W:SP0R@('%A-`P倀000|Vp00CS0T00SA0Sp001K\@T`(((0A-PSp R+͚`a@T"W p0004`0 @0 0 7]00CS0H00S `P `@ (((p@-P$@Pp0@P0S @-L@000@00 '\00CS000S@^( ((O-PM/`@ 0 P @@@k ('|P00š0 *0S &0S "000V#   P@ a6P @cPM R RA R 0S   0  003 0 03 Z0 R"00в0  *pP7Z { 2 @s 0>00Ѝ H" R," R8pP B0000S R pbQ  0X/R0XZp "P pP t"P R ~ R z(l{P0 * R; R 60@@DN P R  WP@0000S R   BR 9D R5 N3 P(% (X%5(H%(O-`$MPp `x%t2@P, 0S*[ P0 00 P0p0Rp`#0`2|P& ZQF=01 =@$Ѝb@DT@ P  p R  U 01W VYXU' [10 0al 0aS v00@0S v P [>W 00SY0 0 S0 P 0< S0XꯩH ((H \%(%H p@-P|`0000S S@H000 00 00000CS0p00Spp@g((0@-Mt@ 0P0000X0>00{H 00CS0$00S Ѝ0@FЍ0(L%(@-yP 0SHO-`MpP@d$P0cS @@ <DpP vPP VP@ 7 R8cS" +U<rP3QpPA U=< P4 <@<T 00S pB00CS00 *< 0 0@ T  Ѝ 0RPU Dg<d<@X pP`100 0 `G`pl1VD0/OPX81  0 000SZU0WG<xPU;<U~PP[1<UU Ut Ud;} (c"AK ky\%V(H 9mުO-M,B,RpN0 @0`V% VV:V  V /V   BR <` F R \ Ѝx! R  \a[  0000S( @@PwOP@ @8Tp ~ [ /R0/S0wOW 0 BR  R  BR    BR   ~ H%(I (L%8P A-(A0S 0PS0 0aqP0S00 P000EX00CS00S }P 0SRh`hp0P RP000!X000CS00S X((((s@-0!S1Ѝp*S@SP``00 R Q0C R R00C S@ `W@ 0S00S=STL00 <0 R0AD1U0 S 0S<%((A-``pP0@S  R R00PH @(O-MrR@002 00 0$`42嘀0C r4`0 SX@00 000CS0E0S00CS0 20S  HvP*0X00*P-vP SW P 10S10 DC}0@0CS0d10S yЍ\0SHH Z- Z`* V + 0S<@0 NP B?`F@ 0S 0 0 0CS00 S00C0~0000C0 0`F0CS0V0S@@((H%(( (P 1O-0pS0 Ѝ1唱 @100 Z :[X0S @ PxQ@ P PX`% V800V ``@@% T* R" RPP P P@PwP Pr DoPQ` @P@(((%A-XPX@X`P0p00UV0p0CS00S (((p@-PV@WQ0 @ p(Q@-pP0` 0S*00E@`PkPP `R@ Ѝ `0P@@0`SP0S0O-0R0 [1 GR00#S000 B0S0p0 G0 B0T,Ѝp U   p  R00SPhTsN ((H%L% ((0I P ?I (!DO-0M P0 4帔0@0~Q 0 `p0 @Q Q#:Q =Q Q  Q@   4  BR  P AA `3A PW 0S@ЍQ Q@Q =Rp `p(`` L  BR  wp w     BR u   u   BR   z ( R 0BQRQ B  W `   BR  vT v 0AS Q AQ~@P 1  Q @S(~  ;@@ X  7@P  #  ~R =Q0S 00    @(%(H%( (DI t1G-Pf0hAhS 0000T1T0P0H1p ` (pppV0 S000`0`0CS0!0 p0开@ p  0    0  R 000p 0p L%(H%@% ((( @-0n@nH%O-PAP`0$M`FA8q00CS0@0 PP 0@K0K P0 0C0S0CP 90P0 R"Y 0CM0PEPE0000C0$Ѝ0000(H% ((7O-R`P@p[0  0000PPX P X 3 0 E0CP00S HH /-(04  @D,0,0D #~( (H%`%$J foO-Pr0BS,`m@(   R [0  0002``TP `? Tj T Y@0T: 0P[Z  R@0@Y@F0T: 0hPD BU# 2Q0 TQPR D2@Y@FT: HP7 DU0#0 2S 0TS0Q00R D2@ /PY 0S@@T:@PF0D0 0 C00PE0C`F0T00 0 D0C0CS@0 000000C00000000( (H%C-M@Pᬐ`E 00000吀0p0p00CS00 p0@ @ZЍ00p(H%@% (A-Pp@.A00CS00 <. 0 ` V.00CS00 %. 0 ` VS`l.00CS00 . 0` \%6@-뉫@-뉫00S/ R%T0QH0 0Scq o/P0//(%0    B /(A-@P堀0p000` R$ %0 `0T    0 0C@ S000SAO(%((0A-P` @0p0W0 P 0X S S0 000 00 0h0    0 0$PT J00CS0 00SA%(0%((A-bB0 pWcr 0S ;-9-0S@0PP0/miP2b000r0S\00CS00  0S 0X0#S Wi P  OiPn-0  0p0P0 R R A   BR 0E0CS0000`0\00S D-H0,`8 Q%(D%`%L%X%ȫ@-L@00CS00  bp00CS0@Y(@-8P@P 0      00000 0$00%(A-P@`000i$ hV |`0Pj$p0PS H0  0000CS0 00SA (%%((@-p0aM00P0h@PjP(0: S$ 0 shP  ⶿Ph00 0 whh#TohL00CS0,00S Ѝ(,(A-Qd@P0`00 PHpPB<0`00CS000SA((%(p@-`P@00P0#P RI 0S00KI0X 0000CS0p$00Spp@x+%(((0/%p@-@(`(P0SSSp%(Dp@-P@0Sp%(p@-@Pp P0Ppz#0@p% 0 R/% @-@0@1^ `   VpPW  Q Q 00 r B"Q q A,PU 0  0 (5rO%A-R0S20SPB`T p ##ngpp " #HP +1 N PpWgp g 0P ㋖'''g qP gpJ  Gp,J mg P gp~~J  GpssJ "00c'`']'` ( (%Ң`/[L% (0S/p@-@PP1PL1D8a 000P0R 0S"00Dl05#0s  0C?o2^0SPpP JR xP0S *00CS0p\00Spp@  PAoQP (լ5rO((p@-@\P0P00 G@00CS0p00Spp@((O-@TMp R0 TЍO*ؠZ* P`PZ   0SPs  0 S S S P R00S0S@TЍ0S|22 G! R0+  p  !R-   |" h*  0X" ]* 0sT0 H   *00CS0)0 X )؀` 0S 00CS0)0 00CS0)0 | 00CS0)0` 0Z 0Zk)000u  * #40  )  )P S#4I  0 p@ h  \)Ѐ 00Cs 0`F0j& (%5rO7@E|MV[j0 @- S  .^\Q    @S0C $00P0R0S O-PP10 0%SW P 0@S!!Q@ C$0S 0S  R-S %S +S D1@@YZT X@1 r9 002#00S 0S 0p?Sp   P T"@` _ P P b `0@00SJ R Q !" R @%p (G- a 0S Qq0m0@SA @ (А0Sʬ00CS00 R( 0 )0 R  0 S0!( (c"(5rO߭\%jA-pP`4P00Stp10P 0S TjPp pPP gP`W@ P1 1@z(`V Q U` 00S`AJ 0 ^(P00CS0 '0 S 0 000S0 S 0 0( (5rO1\%'800S /@-P ` (8 P  /Q 0SZ// (`060S/P00S/D0Q<0  40 A!0 S00'L% (X% (5rO7G-`Q0SS@00SjZqP000M:@0 C @ @ R0000CS0L10S 4q000$100S010000<>00V00CS000S 0S @pWZ00萠 @0 ZxDꙂ! P00 R @ (((L%A-@S`!1pP@! IU%Tp1@WV2 `1N0SN U 0S0PdPcV 1CpbbF U#R#060S$ K#H#E#VH%E%U 0S pPPb`bP LLmWT 0  V (( ( (L%%(08 N R S  0S  P 㢵L%O-`RBM0p0 pP P Ѝ0S0S "0000@00 !P:TR 0S0L 1 0S1060?o22T97 S 500070S а 0 Р㒺* S :^ 0R Q0  r; R-z!  Z B/o" R" \    P 0 00CS000S \  V@z   BZ/o"  "00(( ( (L%X%( G-pPK@P EP1N0St `B@bcT @^crBp77E o㠠`@0S0S 0S0S.`@Y 0 X 000 8L%%j (A-@w PPT0P 0S iolP@ pP@ ZP@\ot06 R0S@@PX` p9 0 P mA(XL%\%O-`s$M2 PPY30oV &P *P nU pUV ``L3 R ZP$Ѝ3P\!ZpP'0?oQ20S P V P  Q6ZP@@=Y pW  42pP QY QuVP  R(160SG\  \@ /o"/ S [ -(\@ Q 00pd#Pu@T R *  W R "0S  RP 0 S0C 0 a 0 R00YXcX `Z^ R[00V(b(f|E (L% p@-P``a000@ R 0S 81@p C!0S 0 00E1  S h00P0  D@ RQ D@@@Q00R00S J0S|00CS0000S |p(% (5rO(<1p@-Q00@S-$P`0SP00CS00 # 0 $0c@p ))C.a!P$lP000V00CS0@800S #p (X\%%j((@-p 0@0c"(@-@ e @c"p@-`@00  p 0Qp\ PU#00p (O-PRPr@HH 00T$ T 0"  @D@ Ѝ0CS0!)0@T0 R 0S\S0 S`0S S S=S8 " CK 'SI 0 ` D V@!  `0`F V`0#`V !"0 V 0  }00 S$0!"0^ 0   :0 1 }S`V0 0 \0@ $08 "0 (NI %|%îA-@s尃M`TL 0SIPU0|S 0S h##?= 0 BRS8@(#":P(&@`@P@PUV0S 0S pPdTЍ@P8P 0S P wPlPxcPT tid`0DPU@ B0 =0 SPF CyP 9P 6P 3P 0P -P *{xv (WI k p ڮ߮||8H@B!= ήѮ~1Ԯ׮ˮ'sp@-@PTpU0;U 0S 1@ p@-Px`x0PP6 R@N0S@2@@0S@D. 0    p0 p (L%A-0P@`Tp R@ 0N@T P 0S@@]W\0HU 000000V0@  (L%%A-P`p[p P@ 0 A@0 -G-PP- 0M00S _o1s q100 00R00 Sڨ @PЍ~0SE  0 Q S/R C@^ P" Q 000S*  RA ``0S:SV@!00S!@>? @00CS00  0 ( p0SP0@ 000 (`(8 (t($J (>@% (LX%H%C-M@$8T4App``P0S 60SP 0|P( 0^0| P1U00S^0SP60S .0S PP PЍP ^Y8 0 P0C?o200(L%X%`%0%[ (0S/p@-P000&\@PS00CS000S TpP@T` `@V00`T0@0v0S V00T00p@((L%p@-h@P000[P 00CS0 Sp@ 00S W((p@-P@IPU\)p@-:Pc룯@-<P\룯p@-P@=pA-P@P0`S~U0p~00 p0 000CS0h00S 0p000000C000CS000S @%((P0 @-I[m 00C00/ᰯ@%00  000   /@% (p@-@tPt`0000S0000H0 00CS0p,00Spp@00q<(@% ((@-D@ 00040 00CS000S@( ((G-qA0@0000V 0YP0kPSP) 00?0 000E000PS V 00CS0l00SGb E  P0) `<0`00(@% ((T 000@0A00CS0/00S/3(@%(p@-$@P0 0C0C0p@% (p@-(P(`@0@D00C0p@% (( A00C 00 0C0/@% (-A-(M@@`DHpPpPVP u T(01 0P @ @p@DP`U(ЍAЍ/T (01 p@k<0 P Tp껯L4O- DT0!Qp R00C0@R 1 00C0v001`@G 0`"0 !00C0w001 00C0v0`(PB(P00C0y0@0 0"!0C"  0 P$0`2  !!J00pS 21 0僐0C`0@50 0C0  00S 00C002  B )Pp( "10C8#8S1@00C0x00`00C0p0 e00S210"QQ 21Sx0pW 0 l0 m00CS0< 2pP0@D21S;0 0#<R00S2 0S+0SP@ P1P0U1 UP>Y/UP2>P0 |P!000P$@C0 Ѝ@P@0 ,  s0P+0 &P00 0_<P >P &P 00p0pr0 ((0 @0(0-P   p 00@0F0%%H%Q @% (O NJ ((lJ G^v$յ ( (d9&N (K H%R P 0{P B@ 80 <0p }  0D 00 B{Y #PD}P@ 0 0005 }P' @ 0  BR '~  =0 BR@ =0@[0%Yy :Y4 #Y5pt0@ 0 p0I Q  BR J[ 0 @ Rp 0 B p63Pr ᑴPp@< [ B + R:p%pp02!R1S 0GS2@0 Wv /W0`2  !j !v@R n@pYp}Y K/o" R 0#p0CS0p pP@'P023Q  w000`"0 !1  $00G-`Ѐ0@T@@0PU 0@S 0 0   B/o"W`0 0pS 0 q$ 0 0 00%Q @-,P20@-aM0$ 0 1< 001@001|0000SPI1| 1@Q  @@003v dr 0S $Q. 4QG Q 80 1,4  0<  ,0000 0 ]0 0 0 S00aߍ0 t0 `0 DH0 D0 H00S~SS,0ㆿ 0(L%(0%Q H%(c"G- Up0 000 P    x5P$00pJ@("pP 0 R 0.`     00S 0 00@: P0, RP 000@ 00 00 R, RP3 00300 0000    BR   0`0 P 0   CR S0  P P`  ``t 00008 @0C 0 \00\`0 SlɽP X0 R   L|000`0S0 R Ӻ0-0P 0 R000:0  P 0@S P 000x A`@`00P0`c0 P.    00PU# T 0S 0@P000S0P0S@0S 000@Ѝ$00pn0%J ݒ4%L%A-QQ@``p  @0p0 P 0W@ 0q R$@@`DR ( X% R"p0` 4 P /㛱`P 08 000C0@04`Ѝ Q  0Sppp0 00 00 @p 00%%.A- @0P P/ 000 `P o000p0h@`c`@@P 0`0 U000 PPPe``0SU NP0%L%@p@-PP @0 @dP P 000 00Sp qpp0%S  P/0S/80 P/0S Q/0(A-@Pp`00p` P@-` FP:0@ pT@Ś PP ! E Ѝ ?@PEpmjg d  F멨<% 0P/(RQA-pP`%1FVU``P``V@ \E`0 R@!FP P( 0ؼGE0 <%'AA-`@|pPT@Q00C0U U T&@P 0PE(p@-T@T`0P00006&00CS0p00Spp@m(((P0p@-`@TpV@PU PDP(|0p@-P @R QP D0 bP #`D ( Xp<%]p@-@pP0 S0C0 T  DDP 0SD,0O@dA0 T @@p@<%gfff(p@-P`0 Sڜ S D@P t0 R@U Dp׿0S 0 S qD@ɿ0S ( (<%p@-P @0Pp 0  0p(@0@-@ P  R %@SD0( 0 P/ R/(C-M$P0 U00000p#0C@S0` D@P 2@@v  孻V D  D2 R@Ud2T /o"Rm Ch`0"0C@P2V0S' `Cp@! REp8PC4P1 /л 0: SC!00``!l`P!` `V'oPP ' 0B V U0S00! 0 "1P @& 0C00CS000S Ѝ@rsT  0PϾ& 8X(K (<%L% ÷ v(Rp@-@`PP Vp & xFCpPV ;CpV & 0P0 pطpG-` PppW@p  O0PȐ0S TX  >G:   40@ l.V X (T 0S @V@ P\%?c"K Ip@- P@ Bp R  Bp d0 Rp Bp Bp BpI(<%p@-@PpD0 0RPPp03/BPp(O-0$M@@000`p@A 2 p @尲娒V 0S2" 0S2" $Ѝ@0Sp2 R@00CS 0SP P % PBPsPP jT JB0SX hPS3B딡0000P Sk\1 0R  BpPu0C S nn%  O BPP _0S( APP0 RPU A0 400CS0p00S WT0 00`Y20S( (\%t%X% (l(o<%(O-Px#xcxM0@pP P00T#=,p-0U8@D0[T$Sg 0Tq000`V_ %@`00S0SᒶP0SU0SR0sS vS UP0+S -S P ` n< Q, ` R:  з P    #PT 0 @0SA0MЍUF ` p0      "TR x00uu$ 學r   %5S Ap__$ 0@0pX0 N J0 D I-X+&I-q ( (EvK \%͸ A-PQT 00CSPDq10SK R@ 0`0CS00 `01L00<S R 0qL0S 0CS>S RS|l R 00CS0N0 - K  p@-@л0T PR R R& 1S#0 廻PpR!Q QT " "D0600S0T0S 00S0((((L%@-@P @ "P/MP6 @-@P MP 0 wA  4(cQp@-@ 00CS00 P `d 5?U UL?Up!P0P0CS00 `XA-@Pp0`00 T 0000CS0H00SAB0S 00S  @((((L P0  /Q Q0 S//((@-@bM0pS10S 0SPP10SR WUOT T TP160SPPP0SP;x1N0l16 R6`! R20SPP0Q: ᩺p3 0S$ UEoIp' W`RUL@D0>T000 0 00 ?TPx0N R T  DR 60SЍQ Q2 1 @$ (( (L%(PO-@`P呵P pድP ᆵP0@DpSppTPA TyP@DP:P5@<oP, (4  a@P@sSa0S 000 T $00CS030S 8@@T00PpӪTW00 T\W! Hs@P 0E0`P 10STw@ T@@VPT @bP1 R 00STV@ Tx@P@UT X@Q0S 00S 467@@TppYW `ԡ̱PEPe ?P@1 z10S VP`0-S0S`TPhOCW W0S8 _90S4 0@ V0 S R0V00 ;`1 R )T` F00CS0400S Z ,#nc\%p((((hr}B0 X%G-PPp0E` o@㨂 TUG0S 00S 0@0@000CS0 00S @,(((((p@-PD@`02S@20CSp|V02p((40T0P?o20S 0S//((C-p@`1010r!Q0@S10C1 ЍqXPU X2 PᶷP 0S ((( 0?!!R/P/((p@-8P\2Sp@\Bp((0-MM01`"R !R X"R   1 1d"1!d2S ,THPl1, ,KHP L!0,00BH@P$1, a@T0dl>`0P, U @T 0S ~P:00CS0 ! Y=᷷00 0$0(00D>S 00 <4><"!031(((((0@- `"dy((p@-@H6'Pǧ0PPp0C/U00pL p@-T@TP0 0P0 0 0000CS0p00Spp@(D%(A-@R`P`p 3<0PPEUp WD谷0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP000P00 00CS0h00S sDP`000=00C0 (((p@-@P@0SH00Spp@00CS00  D%0D%0D%@-@7PhЍ,-@-  Ѝ Ѝ/-$0@-  ЍЍ/D% -0@-Mh0, @P(0 00SZ0c1 @00DЍ0@Ѝ/G-@'`ṦP$ 0S! pᄢ0S00CS0?0 " v00CS000 " 0S pW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU UPP 00CS00 ' WL D%0QD%@-0@D%@-0rSl\|0G-p0 P0R(0帐@0=00=``F@VPpPER000 S=S B`` R`ĥ`PG @H% (@%0@- 4@ 00C000 0;Ѝ(0P P PR00/0@-@HP^ ^  R0L00N A-( 㴀 R (p`@pW p0S 0QPU  0S 0S   3/P@P00(0Sfp@-@!PUl 0Sp'SPTP@':PP,p@H  EDzXa ĺA-P0@S`p    3/@P@PX %W  p0@=S0U 00 00CS00  0 00CS00 z 0 T im\%!JO-@00pS 00P㜠`V  X0 @PU* ЍY   [ QʁaP`0p((\@0 S =SR/=S/A-`P0S=SPERPU@'̯\0\pV!0@qpT 0S kPVpp@((1@-`0@S @ PPT 0 `G X `姰  `P Ѝ@9DLx07@-@0 0 X.-TPQ  P  , Ѝ0@-00 - PXV #A-p:~P008U@P3 0S0 =lPP U00 .c`cVx᭡P 00 `8iVTᢡP 00 <ᛡP, c 0$00SЍlVቡP 0 0oVP 00 xP b 0(0 Q 0SfP00CSH b0 0 0S8lW MhlXV jr'yj0K00M00P0D0 0C0D080;800,0/(<0Q8 00,,<008 ,0/@0D 9K<@0(080$00= 0D00<00,0/+$@0@-d00$ 8 Ѝ@-@4姾000@-@4埾000@-@(0(S00 0+0,0Ѝ`t p@-@X*PP 3GP[`8<@ D U\`, 87*`O*V0,0pZ@-@4]8h 0,0@-@4S8K 0,0&+@-8 @+l( R o8 ", 8 <  < D ,-D  , /(0S ]@-@8G @0<<@00,0@-$ m+PT Ѝt@-`+PTnt @-U+PTot 0p@-MP`0@-S00(000 0P  P\)P 0( RX  0 0 S40,03/Ѝp@$pW A-@`PpQP-U@QP00  PP0 -U  `0p@-@Px @0P ,pT 80$P< D0TP$ <0<PpxX lY Z [ p@-P @0S *00Pp(Q+  0 BR @-* M- 0 S^0@Q 80^  ? 0  / / ((Dp@-@dP`V P*p`HV4*0* *0(4XO-M`pAX PC U \ *TP D *XP 4 *PW *PU @* P pT,0p zR S [ Z YXW0S@0S 0S<ST00?{[ZYXWP4T <@†{ RS [ZY XW :S 0S0S 0SlPT`7pPP X WU(P6TU P)^R@ 0&T 0~S Tv[TqZ TlY TgX TbWp lT]0SX TTX@0S@ <TS 0S( $TN<S JTO[ TJZ TEY T@X T;W 7R@ 0T 0?S pddT7[T PT2Z@ <T-Y,(T(X T#W}T:SuT0S mT0SeT0S ]T  VT| xOxLT X\XETWH D>TU 0PU$3TUPT;S < S@ SU@S@ S 3  T:v`XS&[& Z+Y0X5W:U?,sP0SSUA ⃴t⁴<S@T[ TZ TY TX TW TUp lT`jBPUdЍ0k,"0d @(T   Q ! '0R녡t! P0 ' U P p!(/^s|rzqy   !('/.78@?GHNOVWfelmt{6IEQXV M=DM@-Y (a%RX2&00@-( Q 0 0 z(Q%(X2&s@-@`[0 00#S@PP0S 8 P00S 0 PЍpXY0S/#Sp@-@,P(p_0P 00p(G@-PRP@ p`np 0R" Ѝ0"S0SO 00SS  00@Od9&@-T]PL0 Ap@0"S-PЍ(@-TBPL0 &p@͠0"SPЍ(p@-Pd@0S 0S 0SS <<U84  S (h000P 0p(W! p@-Px@Ql OᷛP L0 P      pp@ @\ %(0@-@MPP 0SP+H00Ѝ000 0>P0 0 >(VO-PXMp` 0S8;$ ,' P 0S ߍP? 0Q 0S q@  R R@  R@[T WpU: 0S D 9/PV?`0(lU@-0S S S8 4 ЍS$ ЍX-7@-lP$ R`O;@ H$0S p0  O  N Ѝ0((@p@-@P 0Sp@N0PS P00ܰ00Spt@-u@@@ @`P0Sz#00& _ w~X2&C-PMP` 0S100(p0 /pEP" /Q0`@ 0p@5P T0 p+PH$0@@ 00Ѝ>((0A- @LLI& @R<2<<1H#@&( ,<&, 8&0 4&8 0&4 ,&#4R! #&!4S &!4S |&!4S `&!4S D&h!P0S l(&L!T0S T %LPp8W 4ЍAa0S. a``10 % 0 %0US !S| !3  \%0US83  0U $%0x %pP2&\  Jc" $-BB6>) FU8 (G-Q| ,@Qh=P0QP 4QP<0PQ(*80S,00 80<0S804 <0P;PP;P1 QB"8`8X0apSp R t <0R\P 00< S8P0S9`(JQ (CQ @P0S0 BS `a 0h0S  0 S* 0Q*ha 8Z_n(E}DO-;$M p*b 0P$S  ߍS w먲@PT[D0 00@P뉔 4ᨛ0R YSA ("$0f0Qjf/ ᒜ,2!S1Q% RR 䡟 0!,21S 1b"!b$!R! R,"b"!4b4# 0C?o2S  0 p"p`1R8 R,2 @P0 000(4"48#8 R* 0S 0p P 0S 0 p1So   @#1S  f/ 01T T%H ((jVEW}}aWEVc""M(2&A-P@`#pP %R 0R000005S P vL $0f0Q4 L( ((m(p@-@,mP  P$p@,I0@-0S ,(@-P ) (O-@MzM:P 00@ p ^P5 ` ߇XPP00 ŭ0S :RP`( 8@00ᯭ0S``(`受P+V0` (`嬩 Y 90 ,0 0P,0Sl   ,02P P HHἂ(^P,1 XPFV 0SZ 0 0,0P2 @h`(b(RP,00 |KP ,00,0`V 0S,00b<:P,00 $ @8, 1\ , X0P ,0S  S;ǑB0;\V0`(P( /P(x p P(`00,0P,0S ++RP0 0 d*Ɩ P (`00,0uP,0T0 ᵖ P (`00,0dP,0`0 ᤖ P (`00,0SP,0X0 Hᓖ P (`00,0BP,0\0 ႖P }P (`0 0,0+P,0d0 kP (`<5 0,0P,07 pY P (`40,0P,07 {0H P (`40,0P,07| j7 P (`l40,0P,07k Y& P (`00,0P,0x0Z Hp P (`00,0P,0|0I 7 `aF0 S0S  [0Y: Y0  0J 0B뼃(0bSTB 9(`H 2[9  0S(I `3#   0 R M 0 43000"0,0(  00,0 kP PH@, 2![ 0ȰÕN 0;90 0, (0 bS P (0S, H@pݍЍ  R $0$0  QP v$0P0!CK " Ȱݓ 0R ( [ K0 S|1[ 0^0 R  (0 bS Px (0S, 垔 (0Sg  b(tV}fX_ a( (Y(.;O]n~(_ d9&:i>[ 0s@-`PU V  P|<@P hxЍp`PD!Ი<0 ẇ0@ثVz_ x7$00S @-閙00謕%p@-@5S4 0PSP p@'Pp0S 5S 1S HPp5S X `Pp@ LPpD(( PpH((TIedArdA7@-P@0(00(0;_5S * 5S( P00S ,0S005S  Pl-h0hPL5S Ѝ0@ @mP0(WEVfdmd%PX(gd@-@P f/@( 0 Lꬕ%(md0S/!  -3@-P \ P 0S S@@ ᥑP@Ѝ0@ Ѝ/1&@-0@Q2@`  @괕%@-Mp@p0l Q d P0cS CS SS 4êsS00ۍ09(0@-MMd@ PP 00YSP ,塪ۍЍ0nP  0 5(2&@-@M,0 wP vۍ~@-@ 0 @(2&(x@-YMMt@ p\YލЍ<0< S <fEP10YS<0<0xrdA-Fr*@-0gj z gz z4 'z'&z'z{zgzzz{Ѝ57@-P0@ 0$S0S/ *0S' TQBQC0AQ QK00S 8@0 I 000! S0c0A R!| Ѝ0zg{{' Q{ zg{k Q{ { { @9(a @-MT@T0P Q H P 0nS00 yS 帩ۍ9(a P `00CS`0p S00 P0S X0X /X1&C-` 0pP0:@P FpGT@ U @0 @UHZpPFБ 0l Qᒺ V ӐPUP P pX Ѝ&6v$[2&G-MMP`pB$0@S0#!'p- P !P㰤 1P%0  p P  `D(<p P $ nSP  +XቯP}08`D( p P  LSP  0(0`D, xp P H 7SP D0,0`D0 ,p P  "SP 000`D8 p P   SP 080`D4 p P L RP @040`D< Dopu P  RP 0<0`D$Zp` P  RP 04`D$EpK P P RP tv04@`D$X/p5 P  RP $`04`DP p P  RP K0P0`DT P X {RP 80T0ۍЍ1(2&a C˷Ti)In:Zz6O-M M@ۧp PS `V20S0`S/P`P8aEX``0E` 8ġx 00A"S0#1` \p P& A@♐P4s(("  ~P0S  3/ PAP+ ࠰Rx%9.A ip P" 4S@4`S=f/4`P82a0C" 20< S :A "[Ax5|%.A 5pe P0 x5< A B0 qpA`A 0Q<0PADxZ0x5< 0RA| pP 00 00S" P0`(V R s S 00 0 0`PXލ ЍTg%a r˷b *Xg(2&9( - BR0 R !p@-P@ R1!0 0 ̷X0 ƷX0 pX0 \ặ ( Df, 8b0 ,^8 Z4 V< R$N$J$F$BP >T :ᄷp 02Q0S*?X`\PQ (Vlpp@蕅b -BXgzҊO-pᔀ 2MSR R@`aK 8QH ,[E 00   g0`"@`  8 ,   P0"@  0  !R11`  0S 0C R]!SZ0  1 0 0t8QI X <0P+8妎Q* 8 0A0 @~2<0P+8匎Q *ЍO跶0 0 0 0x[ hV< X ЍOЍb -5b c":$M^qA-@Pp(D4@~`8SA蟄 0` 0`( "4`#/A-P @4"40 4"40 `p (l(,,004488<$4"44$4"44<D$4"44$4"44$4"44$4"44DPPTTXXQl`pW(4"48(@4"48d0`PV@P ~ {0T0A0T0A T4"40A(@-@l40Pm08f/oWEVT@-@P TP8#!00Q@kWEV(80@-@0S B08f/E|( 0\ P0//@-DD@0 <>44刵 R 0 2D%X2&P7@-@ PT4P0 08P8 0p0 HA Ѝ0!A9(vd0@?o2P0S@- p`P @P P P P@V@lPH@T@T p0 8 A@@ Ѝ蕒Ȃ7ap9(udP0@-M zdPd@ p H@ 0 400+ +Ѝ09(zd@:KYs@- @p @0  0 0`P   0   0  h0  P0  8Ѝp9(td@|c"*N}p@-( PM@`P Kp  ( V V h PЍp ({H( 0p ,Z@0 m9(}d(@5~d(P0@-M @  {P@ 7@4P4 p0 2@Ѝ09({dЀA-`!吁0@Pp(M00t!p0SPP@AH p  0 @eP qP p` $0Q 00S*@P ?QVW V0 ~ R|0|0 0S(Ѝ00* *D  `@I-X+&9(|d O sVc"izP@-$M 4@P {p t?(G H@ @؀ 0\  ` 4 ;$ 0sp0)`p, PXXTԀ9(wd6xd 'ck<RX2&u}2&PA-M @yP\  yP< a>  00S `P0"S U1r0%*V  H00S pwx00 "R00S p*>PdPd `尀pp0 <!>05Ѝ(Zr9(ydC-p@P` Q =܉Pd@ R;  .p 4=03/ ЍCID%9(X 0 @-=9(P7@- WP@T媉P H᥉P804 p Ѝ0a 9(wdP7@- 54P@, |p Ѝ09(d@@-3(0   ^5X2&O-$M@P` pH0T00X$Ѝ x Dpp= P  5p 0 S T0✐@0SxthZV\ `,W 0 @Dd imp@-@P1P' 0P, 8>0P  =0P 0P{0 P p@p@ 0x@dp@uU@@ڟPptcidyararbmngnts+ OX0D S/ 3C5C$1 4! 8<0/=(0@-,A„QU0%Q ? /@.0@1 ^ L043c 0P0Q ? /@.3P0@1@ 2@D4P5H@=( 213/P/=(A-PT0p(,`J@F,0T@@DA?@?@@=(@-?00@0 (20,20y0P!P30=(> 0R//G-0`p(,BP \ E @PP>W ,20CS(20CS G/0=(1,p@-M@`42S%^  E 82<"@ 0(2,"Ѝp@  מ<"82El@`ʞ,"(2H0X"\4Ѝp@=(%5>g1Es@-P`y  l0SЍp00S@h0"S1Ds@-$M;@0 0 0 0b9c"X2&A-P`0 p @Tʬ~; /,s0d  ? qp  RЍAL`0S`@D@, Ѝ%h~=(A-0ppP@`pl!14P S H d" R S R, 0 }U=(p@-P0@0S( ᏊB01p=(O-TM0(00,0x0$ #0P㈰匠s00@304<000S: (2,3`O(0, 80 808 D$0@?$0 0$0 00  @ D04䂟"dNP :$00( ,04 ᮜ ` RL` $R0 S p200#1-R0" 4LL`P@0v00P00S wP  wP  wP$ u0L00 S? ׄ0< |g2kE%KUP1N\"?C$50㎄P@\2S@0x0XR@x0 X20P@x0 X20UP@x0 X20UP@`L`(0U,0000[ 00S (00,00 0 h?$P @TЍ P @=(%(@(1&y'td9&GJNl-7@-@00CS0 ]AP Pp pt90 P00CS08GA0 Y@o Ѝ0@Ѝ/1&yO-0` p9Pp/B$0e@O 0,qp Ѝ  R ЍOt`0S 0qp `BE,S 0S %=(p@-P@2S t`0n/(2;1!41#41U @0&"UU  p@@PC @܈@Tp=(8G(?(G-@r,,`P Y9` VPpYTLE J$o,ఈ0U !VU ! [E@s_Ps X2  I $! (! "4! 1"8",1!#$s_(P, "!"",!000@0 0 D 0H 0L0 04 8 < 0@v000=(&A-@PXPAds 2F⍈ t B B$*o00C0=(O-Q40 ЍQ^H DaXR XD 0 0!R 0:80Ԣ #ZppWPPUJ U @DQ ČUȌ̌X L X0P0Z 80S yq =(O-P0p0Q`@07 0 $4 Q %C?C0V% 021S 02/ .0 1  Q  32 $450 (, T02Sx Y< ЍPT 21倰[R RS$ [0 0 2S Y [P7Y2p00`@p0[ Y 0S S01S 2SLPD `b/ .040 81 < [S  R#ZY  0S^   BN R@1SO148<$n00C0@@PAy`d1S  P0148<   00P2S. Y  a14a8a<0#d1a#h# 0 S 0(00 ,00(  ,   0|0% 0@PT0p  0V0S 8`@00V(0`S,0 @0m 000 V 0S7X\" 0A}`@@SR 00 RX00 04p ` 0S 00 00 0`) P2 S2S/  2@ 0p S ʼ6! R0Y0 @p`!R (0 \ !A(0D!H!L@!$(,@|21S  "/0.0010T0 3p2044p5 8<0 T @p@ H2(0L2,00800 S- 1S* ( W000P,  00SW0!14!8!<!14!8!<W(p,)(,00L000D(`0 S( 21S$ / .0,40 81 <W ( S  PW 32 $45(, W\(00,0`@ p00 00 0`S0S00 00 0` 2P  LWU6 0`` R0S '0S 0s X2 0 RS 0 \PTo_P$$00D#$0 #(#< 0&4 0&80&< 0 0p `70 @12S` BT0`PX 0 1<Ap 0@@j,2 0C0@0@P`x^(2? 00@@pTTpp0`Fa ?`1<A 0?``@@>,2 0C0@0@`3(20? 0@@)`Fa?`?``0S\ 2S@X @TVJ041SM=(iAc"@(OUFX"tA-p0B42cS P42S   0PEU42S 0S P 42RSfsP:ӓ42S]1!$1(1,ЍA0S\ SL`兄d 0 4rW2S `p` 0YP"PR S0SЍA臓@D 0ЍASP 0Ѝ=(?=(Q*DJfA-@T2 @PL|P G|P B|P@ `p@T 00S p`V@-|PD00S @@ |@P,7W8g(0%A-Pp`@000 0@@@A-p@`T {zxzPP( 0@@@zC-MM0X4 P@ T@D {P$@ {P4 00(03P ](T(0 ,0v@` PF#L44P4S@@(4儃4T0F@p@0l`P5P0 !0P1P 3l0 < 00S#  U8 {p@8 PA , R ,(&< 00\S< 0 0@܍Ѝ0GSʇpIP0S -S@`a=oP00@@4P, R ,A0 NP +{8800  `0 R00S% <10\A40CT!T00C.0S0S0S0S C 0S C CC $QWP4#j h PSe  Pd8g(c"Z@Z]ms4%  w0/,h(0/,h(0/,h(-@-  d  eX2&G-P`pr@0S  0S X| bU YTY0S m0S(@ /,h(ץ-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  @-M Mq@` @PxPݍ Ѝ`!rPp=0D@@rOP0: S0RP00 0PP P81: S P% S  R  rPPp(PPPU rPP$0@P,h( ! 0 u  0L˜ Z,$ z ,(  \l  ,΂0l\ll 0\l lP 00Ql"! CClX 09#! 0 k QP 00 ]PTG-@`PpP0S00S <q.p@q8WO$0S  0S 0S,0( 0  P0S.P  SPpl Q P l0p<0P0Q*l0S 2Sp  l\PP 0 RQ@0 P 0hf@@-XP?`P@@\@#T@TpW @@T`Lm(O-@HHM8p1pP0 0TP0S<0T D0S Ѝ1@ 00`0 D2# ᓲ00 0j Q P P0 W:00 0j Q P PLJ 0 vP<0T 0qBl(O-M@L0S<`@DHp S_P PJ V_oR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T:3Wl(0 A-B?$@[`/p0S In0ES PC sp@@0T?  C0l(0 PK %/l(O-`cM 1V, 01 SP0 S@0P`00D@H0(0$0@@hD0' R$ X0p1#r#<400< 0,40 j<04 QP cߍ0P@@`00D`H0(0$00 Cp`02# , PW00q280pG0L0L08 SD00S   80< 28000,40i<04 QP (100  RR R0(10H0@L0 p0L0B = #lP1 (1 0(11  J   @ ,0B0 H0P 0H S1@0S  ZI@(1 0A@  0I@0;+ q 6P(10(1 0S[ 0@ D D000/os" R$ (00 ,P(0Pr0000$0D0 `SD0! 0CD0D 0㓲" X 0X  PP :X R: U$0`(00`P0 4o UA `i0D\Q U`V$  (   P`( P\0K/r 0x! Qp0q P b QQ0S*0hQh  0  U `$P(Pq000 000 0P`,@P  Q b.0 Ab  @ @bρ G?@ L0C@s PQ*V  04L |1r 8 <|1 0V4 8 <1 , u{]000000U\`0& V$  0 0\T P0000 0(0T 0P0 0 0,@eV 0$ S1S IxQ1PP|!xR \`\P PPL0 sPP|!I6@0|1|QUP0U* 0" 00 0x 1S \P@ I0@ 00001hmPP 1|!R `PPP 1b |10|1#40L0s_?00010I@P30 0Q 00RA U$0(00``P91 S}RhGmP0S 0S \elKR P0S 02S 0S0S} 0\2SK\F|!+xQP qPP00@ s 3 |1P )HXP PPPPPPL0Is0PP@1>@<hlP0PU+ `|1VS /P@ |a``L0Is@`` !RP \PP0 1A@`PP\< K/\pPP05P(. 50Ph00h04U U0@IP0U* 0RPd01S\!0DP %4QP0%8%\0 P0PEd0U03:\@u<P |!d1P Zb" : 00|12P0P0(00`P#P,18 ,80PI 020SP0 S0 ( U$0 0`$0K000 000$00 0,@ D00S< 0,40f<04 QP80,R$0 JPI l(mk m(/Xu+j= G t%IG-@p r W pP'\aPP Ppk( P`^K/8oD08QP0Q:" 0PS00  Q puxPhdP80 "8 R 00 05 !$ul(c%Sp@-@5%SQ%5 %SPQ %UUQQp  0 0Q0 Q 0l(A-`hPp5@ @ 0% Ņq@ŕ\l(O-OMPphP) b5S5@ ET# T 5d 50 ! S!$5"R$%P0S88 jP @TEOߍd:P  RR @`0d B2" 0Ve JQP d &d0P Eh0K/0h0 ?n0D! ,qrd (001 xn j  )n  %n,10,1#40L0sK?000/1001001#40>000310 00 000L0 Ce(%,5QP Hd d0Pl( r(@-@ P 0 5l(0/ r(0/ r(0/ r(-@-    iX2&G-P`p o@0S a 0S X|X U TMY0S 0Sn@ = r(ץ-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  @-M Mq@` @PxPݍ Ѝ`!r#Pp=0D@@rOP0: S0RP00 0PP cP81: S P% S  R  rPPp%PPPU rUPP$0@P r( ! 0 0r(@ Z x X@-(0P  44 0) Ѝ   0v(  0@-4S 3/ : r(@-n00 @ 0 $mn@k r(@-m@Jmmm@O-M$M`pP`"NPX1 b: S/f0P  rR m00pPP W UP 0C P"V|R V  VhPN P P W\1` 0`PIX1: S<V2"<rpPUPV9 0PW00``2! 0$u $ PPt P5im0S3]`P S R Sp`P-p `P`!\1 S R U;Pk`x!|0#"PaY $EPtDpUd( F>PP XND% ܍$ЍJ F F F@ 0`( "4`#/ p@-4"4 04"4 04"4 04"4@0PiM( $0 $(k XXkddhhllppttp p@-4"4 04"4P0@ (M%M"MDDM@@MHHML`LPPTTX~X\{ \`kp` pk p@}kp@-`"Q@Upf@p@-@PLLLLpA-P@M4Q->CL->?n}C@X=X\:\79>L9>:>CL:>CFL 0? AC>LC>mGLFLE~EnFLGL 0X J~pXV}m  $$((,S>,qLS>GmLFjLHHLLPPTTXX\\O-@P`Pp !4"4!14"41  $$((,,00WС\5 S L5sT`0$ $ 0Q`V,1QzTvT`XrX\n\`k`dhdhehplalp^pt[txXxK0[ O`LIpp$5S\5 Sp`0SP%@ Sز ,*%TU 0`( "4`#/+0P0 C@ /p@-@R0 M4 @8 P b"9<Q08u@5ppL0p  0Sls` 1e0 0S %e  000 St:0 02P0 @S$0 `0;9:  \08%@5  L0  0S_h KX-$P20SO Dx0 0 0 000(@$? x0t 60 P 0 IU 01S0 : 00(!( ({xh{y h(u N  DK 0{!0P000 R0T 1AL PIFPC8 G2x0 y1( @( 3 P0h3@1h0w(ly(Hy( w(@%w(w(O-M`@ ) P0H: 0 0@40P$? 0 62쒟2Q { B("( pqsἢQ0< ,#42 0JR wXQp 04  0R  @PЍ( 0J1  0 4 Y: 10S<000D0`1 0` (0kJ 1 010S 10S 0X` `$110010S Xp1p1000 G C8C80_ w(|w(@%Hy(p%py(ly(O-FM MP` X !c넕p@#: 0 h5 R`"0Sg D50S00  000S Fލ Ѝrv00 f1000D0yȤ H0T00X0400 4QpQ\t` #  3XR"0S* L0 00 0 HP! #0000S #v0  0 t.P3 l.P0!"0K 0 : @ 8C80  0 0S "y  P0 !;.P РL00 0R0 H i | 0J0 X0 x20G0  000 B00S,(2jp0 G0 h0G [0 Y0C0#  4 S 0040QpP!u1p 0pqG 0mG0  ks000C0 0 S  @q  0xs00 p   8C80I0000 0 T!0xs  0l00S $w(\ly(v(@%Iy(w(*H(S0w(tC-@PN`HXpaY 10S t10S 00 0T P< ЍC)@D`T> 1 RP1H s0  P PH H0S$00S T  0S t0S G L@ ЍCfX -P L0 ЍTw(w(w(v(@%\w( 0`( "4`#/p@-@HP08200@ 00 .00 @ap w(00S4  /|w( 00S/|w( 00S/B|w(P000R0S<2O-@ pRMPhD R0R0aď080S  C/ S ! R 0C00 0@dἰ? 0p[\5t!S` 0 000 ?@U (  R8 R  040\ P `0/0/0 0 Ѝ  [ T R  P0 0 0080/8w( w(w(%TMeP0O-@P:1 R0* 0v됑吱0 `SxP p* 0 T C:\50 0E00,"1p R 0 0 !Ž p 0pE`0 C c00p0S   0 -0xp 0TE T0  0LE400,00S Ѝ0w(v( w(Ty(ly(#0O-p PQM P*T PW0k:8 `\5 0 0E 00O,"2@ R 0 0 !Ž  @x 0D`0 C c00 d0@C CLA c30B$ 08 Q,040(0PÏP08,10S 1 PpBU809 رPWE 80m,80<01|!0<S0<0<0Ѝ U9  P\E@`EE@f@U @ R T` R <(ట/? 0WTFSV  P Q RF 0X:P`0FQ   Rv( w(T`y(Xy(ly(\y(w(ty( 1G- 0pP `>D   00@ 0S 0 0 80PS `P` 8UH0ZP000PS Z`4 [Q$,$ (,`(PoP8 w(v(ly(+@-@8P 080v(G-ܡP0S100 B?p7Y PAP` 0@`8<@Pp1 ?C\10A0I00 00 0 V0 (p"(p p1 p#(,` W Vp`0PQ&d{0SmP 1@0  XPP00Ϡ^P0d000 Aly( w(y(y(y(y(y(RP0p@-P @?jC800P( 01!SRpy(y(qp@-X`0SpL0LP0@1CA0S000py(y(y( 0 0 /y(O-H0MS MP` 003/ ލ Ѝ40 pP裟00 +0H000 t¿0 @ S 0V  0C0X0x3!0S& h3Q2Qe 0+"  10 6? 0Z0 02"+ 2R20t0S=W=000 Qo ! ZL"$0$j+0P$" " Ry{! { 0! t R1*01 Q5 1000S1H Q B/o" RK `!B0 T +BD}<(P:! RP, P dp 10S0Q 10S 03/     0P  0p`V X8 w(Ty(ly(\y((dw(w(0O-SRM0M 00#4@PU( , : SRލЍ|t \`(5R\<R P  RSU 0 0 ,\s0 B?@`@PA 00S 03 00 XX8ő @5D0LT 031 a> QPP!\P  ? 堒 ? r&0 Xt"t2 0R S \0 S 3 S D(@X X(20p`D2QpQ\tQ`Xd   X 1 R, X&00X0S 0 0 `0\ *L!00ST06 0 S0\ 0㵯 =0 20 00 04$04L3 2$ @  *!?0'h00S  P8 Py& PlЍSq l w(y(Ty(Xy(|w(U (ly(w(x( w(Pw(xw(O-`|2t2PU@Pp00U0 0 Z00 Ѝ0c ?˿R04G 0gC WV@QVg T0U A0 %00100 @ S @T`T0p0T S @`B 0S @ ` T 09  0U2 0 %P 0 PR0 ER`0@S 0 000T000 _%[P000mi w(ly(O-P,4Mp$DW`W0 Xa P0 c0 C003 X 4(!P  4Ѝh9+a p00p0S 4A 400 0? 083@430000!T  : @ @XT00T S @w0S @ & T 0 m 0t$0`00WCc 1 Pf (pP 20020SV 뉑  400 0? 0б 0 ~Q0 sQY@ $0H  10J(Pj 00 400 0? 0 10S4 A0 0000 p0 @0S$0Yd0000o| W z W$p m0 ge00000 A$pWh@ly( w( @-rW zGX2&s@-@P `{0S 0S 0 ЍpO-MlE M`PQ0S 0S @Lp P 0Sލ Ѝ000S  6P J0S 0S r0S mv0SpR 0Spjg 0S\d=0SH^0S 0S(Uj 08Sd s/2#' 00 " "A 0D@? !? 00? 0eP 0bPd!! 0[P0 pP\@0SQ "04 0 R0  0"= 0 , R( 圠*,4ï0A8?S% 78P0<P0Q R0" t0S dPUs @0S @@PUn $0SP@PPDPKH0S  `XCn* l!<xl$|0S ll0p00S00$P 0,0UA:6000S 0S HD1 H0S 0S$0S /P  $P   000(P 0Sl P PP Pw( Db , G i     *!( Z! z! #!O-PH0pS`M W0R0: P 0"p`6 "0 S 10SQ hЍԱԡ 0@ 0 000CSY?00 1> R. x!PP!0  S  @ dP   . 80< 0 @`80<  P0 P0  #`0 S00@ ` R Q\Q\\+Xz(l"w("Ly(Dw(_)"(w(w(""w(00S4  /|w(00S0`( "4`#/|w( 00S/5|w(O-M,M \@Q"[:$0: S`B[ ` p0P" 0P 0 0 00؍,Ѝ`0 (0P L X0P h0S  0  pP I0S, S: z: [   054%00! ?0S S :00/0S 0 S :V00#03*  R00S D:0S7 8  02(:* 0S R &P0P4`Ɵ @U9U)9Q00e0 B?8pQP"x90S  | 0 0l  0$ 0P080S, ZS9V  Z9Pp⨸ U0 00(p UxPP0X ZP (0000@P㫷P8HWDP"$0 S7Q9 80S5  V0;R00*h0S- 7('d0 ( #0 ^P d70S  0` IN @(960S 0h0!60(%R/V+: <V3#\Q RnP   hPpQ^q U PE" #p#]:U PpXh RUPp%Q_'qP tPE! p 10S0AU 0  Z; 0S 1000S x50S 0S 0,  t ?L 0S 1000S 40S 0S    10S0ꊡ 0000 04 $0 S 00  000 0Q$000$0 #600S440S L4P P t@pt30Q00 0pQSLtQPXd00H00S1 0S \30S? \P  0MP2 "0 \00&&p2 0@S0:000S0840/<0a0#QP8`

hR=\NP 0H0HP0`0Ap`MP1PU 0\785  @5D0L 0T 32 b< RP1Q 00 V 80&03/ UV 0 H` P00S ,wd0S@ H0S8  0 # P0L #-Pghly(0x(x(x(y("4w(x(w( w(Xz(w("w("|w(#z$ w(#"ty(`y(|y( #4#w(#[###@w(Dy(hy(w(#$:$m$*5O-pş|M@P,0S%40ALHDLdP T0AX  P5 $00 dtP 0@, R<T5@|Ѝ 1o\%呆( R  `  0`oQ0P P0_ S /  !.0P?00 1> (@` 0 ^%Ϡ<#\ ğ Q  0  D ?0 mP#3 0R< S< 3ȓ0`S0x0@S =0, dK 0t lZ`d30S9 X30S5 L0 S 3 S?X ਁႎ0 % s\@T`S CT0 S\00T0  @T`0VT? @`1 0t20兑A0Y 1XS D 0+ v0P0  " O000Y 0;* 0 0VT0Q@`` @ T\@@R0@3T5Q`1:@Q`$ 0@0倶 00  P k00VT 1PS 兵  P 0R`* A 3Oy( w(TLy((d(w( w(Ty(y(Xy(|w(ly(@y($X2&w(w(U $w($$Xz(%O-`pܐܰ 0M @ 0 0  BRЍ PPU  RQ p @ p R RP Q @ppz(Dw(_) 0`( "4`#/O-lMX N0X0X10T1 LL1LPp 0,0SlЍ0S 0,`@dJ0 `00ట@ 0D RpT0#:I`P 00ASpQ 0 0S\tQ `0S @Pzw( w(pz(@y(;%X2&|w(ly( 0000@/00S4  /|w(00S0`( "4`#/|w( 00S/ 0|w(@:O-M`@@V MP`:0S 0P *S *`0080< 0/[ y JP X P ) % P9`0S 0S L)< P00 (9 #R0p0,0S010009(0 0 4"400< 000800$l 0P @ a  \`. @00C0N M0000S{ J0PuF0$S 0S '00gPx7`} /00S01<,000k94'0 0 4"4'0p 0pp00ppP*0S  1P_ 0 0F4`W%PS ` @  34 ,480< 0 80< @00C0 Ɵ0 00 0Q.*0S  P  0"pWWލ Ѝ0S 80< 080h5 0< S Ts`0 00$000 3^P 0S 80< 0804 0< S U`0 00`S $`  B("( p 3 ᴠ3P@080< 0 80< ,00C0 80R<.PSR $ .R #PPpP3P`080<4\3 R0 *30 0VWP. 0 0qZ P0SHp0AS0S3 00/20S40000(P x2 A#R0؀20 0 #R0tQ& p20Sd20SX 0 P    P000 0 0 #R0 R  0 R>h!hy D10 S& Pc_#R0 š!ȡ0S  0R ؀1P 00 00lPd0`P00C0ZCP<` ly(ty(0w(py(= %#(w(%|w(%&%d%%r%=&%J&%w(q&&&&&k &='w(w(%%&&&''O-WM M'0ASz0t pTPd7 =L HGP 07 00]@  62P 60S 60vV6 :X HK0`06`00夦夶100V0:6 R0S2@`aVnPVtWލ Ѝ4 P P   8B 0S 6 F L@0 R00@(0S Sxp%ZGDH(P* 4 2  B. !  ]e5( 0S W 0]/0D 0S :^(0A.G0SH(G e4([Y,pJp$h4 R@ )xX( I1E, 0 R1 #( Q! R000000!X"!"!Xdxhp4]/0 , R1 #(Q R {{ x@ 0D00Y *( R ,;J2" X(,` Q@Da V!X"XdxhjQ@Da `V { {@0 (0S $ Q P00r|0Sa $!`|\ ld10!00C0DP0 >00000C0!" p.0S@0 0 0C0 00@zk 2'Jw(d'HI'"py(y(y(D}}@y(w(Py({'#(''X2&Hy('w(};'ly(|w(w( ('(00S0`( "4`#/|w(O-MȢȒ0`1C⼲a@Tߍ0S p@FDAG@DPd 0l p`00@00C0 00 R2PU 20S 200S0R0S P0:000RPp  1 QRP@h1 R 00"P <1z00C( P X PH0P00 0`0L00pQpcQTt]X1W`00!Pa p0 0~ 9000y(y(@y(A(X2&w(w(w(Dy(v(c(dIly((!  R1[ 10SJ0!T  0 S@1`0 ? B00 20 !찟00S0H0S 0 04040c/0 P0L 0 8 QT $  $ $ $  L32   ^[0{ {<0 ծPp@ w(y(Ty(Xy(|w(U (Pw(xw(Ly(w((w(00S0`( "4`#/|w(O-lMX xxG`p200,0SlЍ0S 0,P@d\C0$ P000Pp1 0@1  0D R`T04:1AXpX\tX`Xdh  X  @RF X %P 10S  0@P;P 00S  0z 0S  Q\ {{00, K0X!  X  P  @0. w(@y(((X2&w(ly(k w((')@w(O)[)c)O-M式M@PP!n00 F0t0?0SX0S $5S\0SVPPWX0S $Yk S Y Rd?娀pW\ 0P%T਀X僀 H\F00!` 1B`01$dQd0ڈP0C00h01`l0R!B1d0L.0CW P0=SLq QT00H   0S 0h$5p> *P-L>@>0S <0 0ꔭ S0B$5111`R B- 10 0S8 $~0S%  0帐- 00$%BR㩑0`S<B11@%L0 MPP  @ PP 0S <P *堐,<<0S 0 02d0pA?P0;3A?`0 =<0T0.L0E; 0WHQ RX0>F@ @0E8 84<ϠQ bT{ S Q,0 SZ?^@ "P< T;0S @ A>+@B@  C6P; @@ E000$:J*i,::0S U10 0؍ߍ0<00

A! "$5S8?(0W8,(2W42,2<0002SV0@ x S0!!~ 4x0C0 $ST0< TC$!0S\0P CV=SL5s35`!~? X00S-["!>R\ /  X B  R\ ?0  020C02`H0T SD0\ 0$3!΍0 h0DH0lE 0#0AS0000 0"0C 00S\0X00!!!`V0: 0phppPp P`lXX㧁 X姁0 8PPK,2!~00<0S. d)?0 ST0Tpp101"P Rh"!>2 ԐXd?p?0 0 ??000$5S `0|63! 03080H ` H D /D VQ 42!.0$00` S`0?00S0\04 0s w(y(w(w()ly(w(U *))))))ty(Ly(+@y(6*X2&TXy(^*w(w(\y(z(~**y(8 hy(k *w(*$+Pw( w(xw(|w(xy(H+w(w(+y(`++$5S|2!h `0 ppWS $%S0! !42D0D  ,x  x |0  | ("H Hp L3t !n r! T0P3 L!T0 R H  20 0000D0 FP1  P)q1*J)110S 60 020S QL cP 0< ST0T STTUP hFYPt2 L )0< ST0T STT )p"0 020S}0 S\0P S\'P BF+P 0P S\0 S\0(TH\#0 08 ppS $S00S`0" S\0?0 0 S\0 00001D0p` 0Rp/d0W S`0?00 S`0?0001D0pR8 0 S\0 000S8D0;#H  H Xp㵟Y8 0 S\0000S8D0 ;#H H XG-P`@T(0p W @, ,A-A0 5 P0#R%(r`! 10" q0SR 10ak0 a**(t1h10S 0 00SP03Q0S4 T@ 5*< 5(000S 0 0@TP5UA0t0Up Pd0 0S L P<0 0S w(w(%>,Pw(xw(|w(V,&,,w(t,0/tz(0/tz(0/tz(-@-    ]X2&G-P`pA@0S U 0S X|L U TAY0S 0SA@ 1tz(ץ-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  @-M Mq@` @PxPݍ Ѝ`!rPp=0D@@rOsP0: S0RP00 0PP WP81: S P% S  R  rPPpPPPU rIPP$0@Ptz( ! 0 z(@ Z x X@-0P  44 0 Ѝ   ~(  0@-4S 3/ .tz(@-A00 @t 0 $@@@k tz(@-@@@|@@@P/00@-@0S < @ w(,1Q0@?o2P  R7 P0 P0S 0 0SS 000000/ PP  P R ` -X XQTTT 0  000  /TTT8 w(|w(Py(Ty(Xy(T 8t0t 0 0 \5` S\0 X SP0\5L00S/\5, S 0 $ S/0\5/hy(w(T8 T 8w(0p@-000 0 00@P22=000=000X0X0<0<0@0@0\0\0p %H3H3L3L3P3P3T3T3u/% %h p@0p@-000 0 00@P22=000=000X0X0<0<000@0@0\0\0p %H3H3L3L3P3P3T3T3u/% %EEP  %4444K4K4h % 5 5d0d00000-P5BP5H5H5=Ch S>S>p@0 \\L5SXPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//ly(4O-MX hDhhdhP@quP@D@:0 0 P\cpKЍ ?80p  P\HP0S 30S30S tNl3l#0Sd `#SX P L0S @90RS  c*$0S @"\5S2 0\"0C ?o20Qh [ŚX2 0s#p0d p4 0%2 ? .8:010S=,A!Ϡ\<#P  0A ? 0Sd0S 10qh 4$0S %t!\5S\P h10S(\TA4 H!0 0 _80S :P= h0: S TLmPލЍ08H0(hSO )000S ,007 7숟8   ;` 68 08 *[V``Z`P7P`V@ 8P 6Q $P UL8P0 086 R>0 0p 0<&0&0P\7p0p 60pw>0 P0p(2S# *g8P *b8P *.nVXZ hY 4[ 0SW?관X V. 0<  70 <\:P$ V( Q3C ?o6PeP 2S|3%8 S20#"20$#20PA 2S@404040$42`02P$V20A\2@02 M72C`7 `FbA7 0 |6H ? 0`PTT#0\`P`Q=S/0 5P` ( 2RV0 S4S 1c 5*< 5"3 30S 0 0`20S 0P3 0 S` V 10S0d"S`` 0Hz2= C0 ,0"t000 00C`r'? `0(" 8r0S10S10S0=S0S pCq000M ` 0L%000X30P%,:a *!4 l10S yU0 0dy(w(.w(0."w(z(C.S.Hw(v(y(l.e.|y(y(..../A/h//T/O0m000/0<00T00w(1.S)1N11o114!2U222w(w(63_333#(w(4xy(11y22F2c"32py(3ty(ly(w(Pw(xw(|w(374z( w(\4Xy(8w(Ly(4w(4y(0w(y(y(y(y(y(4w(`y(\y(=S$0S) `0 <<00X3P%0* 0 00S 0 00S5 0 >0S sP@a 5*N> 0:#: 5 d1} p10S 0 000S$OPa00* 1] 10S ~0 00<cQ/dPPb 0<0* d2= p20S ^0 0r0S0L%r0L%r0H00q" P 000cH00STNPc*d ,3 830S P,P#0 0 00L40q"  400cL00S&Pc*< 330S (#0 0 0t4 R.0E q\ `PVR d0SPl4d* 440S $0 0 0$d0Q,%R0%45 S R! p0040SPHu*X5d50S |%0 0 00u(0S xQ$ W0S0< x (%0Sv4Pu* 6S60S t0&0 0 08%<5HSR$ ) H00850<SNhPv*~6%60S jF&0 0 0v@%D5LSR$  L00@50DS%9Ppw*O770S ;'0 0 07 70Sx(w0S0Sp0L5sl0Sd `d(000 80L50P5?T5V> X5-0$0B0^1 `@R$@@B!!@H0 000L 00*880S )0 0 0d PWt P1RQڨ0QUڜ l0 0S Pi*9k90S )0 0 00S0 3 6K0S0QQ'` :0 0S| |Pdj*t:9:0S ~Z*0 0 0 K0S K0S  J0S-(Q\KQK H R0P;0 X E~0 ppVaF !` . R ` J0S72 J0Sb]<Q| J0S J0S J0SH  8%L < @%DL<0,5S0SO p t,l000h<0,5<0(5H000/85L0<%0/@5D%4*<<0S ,0 0 0=0S (=0S(4M*D=P=0S 0dmh ,= P: P5= 0S= @ᒠPL Z  6p@TW.  @?00@1>0A@O@@pP.P\7  6,@}|>P* ^ P.0;00 0 S 1> >5 > \>pV>WPppX?  !008 @DT@H4L0d Lc B b"30x`@P Y( 0S  8 H4L0d @ B b"30C60S  6p00_|Pp6B@ ؟T6PL ,Y08& 5000(60S 1S ^2P6  5@ _Q U @ 0`P@@  04 8 <%c#!$c4"t%S T50S \=XP 0 0 f ``0  0 04 8 0PSw0@q0PT pSW0|w( w(4"w(y( 5w(w(.w(y(y(`y(LBAL55#(w(T5*5555 6m$52w(Hy(=6y(y(w(y(^6600S4!!: S *C   S D00S @-4 * R  S//|w(w(6x1p@-`0S d`0@ ㅻT D10S810S,ẻ$1p10ST00S ᩻p@壻&00CS0P U 00CS0 PPYU NU EYU0 P0  0 0 Sw(6"w(\y(6w(w(61&6 2&p@-PD0@0`S ( 0/Pp߸w(6"O-01 (1$100 jP 1 \P 0P  PP.Ppp(H @ FPT`00 XT ዚV ᇚp WP @@ 00py(y( w( 7y(y(0z(O-P10$MϠ,"ˉH  pkP 0H w 330ۺ`(@T 㒺 0h`P$Ѝ? 00 ?  C  P 0 0 0?QR0 0# Ϡ?-0  8固`0@p 0咺y(&7+7|y(Y7 O-pM0P8 0̀P0`Ϡ,"  Z0 Ѝ 0xj@Z ЍO! ? ޗP [ ? S0@`y(Hw( g7 C-`P@U (1D U 0P PP0 0T2p`*0 L@D0T@S   ?8 H4Lđ0Ϭd @  Bt b"31 }0S   %0P00`0@T Ѝy(7c"7Pw( w(|w(\y( 0S/A-@p dQ A0\0 a2Pa0 SR P00@00 0` PЍ w( (\y(`y(@-0P@T@TAd pL `l0̠p `V W @ 0 0 00P@0@00 Ѝ0z( w(7p@-XM`P@X 1 `P @"XЍp 0@-Q0H0@S \00S P7E00<@0P00Pl w(7X77p@-@8`8P0 1$00Sp p@ w(y(|w(0 /@y(\@-^* 0<80@400 01Q0w( 8w( w(%O-\M@pSR D00 00S` P [00CSX \ЍO5`T `B10XYH`o`00D0002 000D0@ p | 00@pDP p ,0F 0/ `@V @:@ p?00F`F@D0@0+ B\ЍO (˷IdI\%2R/C-@=MS|QPG PV㭕PV.10S LD10S0 L5as0倀Sp  10S  00 X0S  00S  # $ $0 \# 0$$ 48$( <@$ D?>L H$C0 5L5s0P500ߍT.8w(U8Xy(|w(0 \P/Q/ 0   Lq,PŒPŃ ,-TPD40S/8$0G-0DP(4 40S1 40S- T0SC 3`3 30SA=S> S*3`30S 0P 0ShSXS TsP`UU00Q AP 0S ?@?*`P"hR0"00S8 lr003Pb0S* x90S* 00RE>0X4* 2p610S {W0 00SCXP10S B1 PQ`1*cX1` H10S N*0 0H10S <B,1 P0*A0`00S ,0t 000S 0dP` 0׶a 0Gty(w(\y(`y(Pw(dy(w(w(8 w(y(ly(xw(|w(y(y(0z(88y(y( 8\ w(9hy(w(9w( (89O-PPMLp8 R<@B0S 0(3 ?P00@TaVa` 0 SQɑY\ } \P  ?``  ? v0 .,",2 0Ri Si r0S 3S  !0? 00S  00S`0 S  0`Up!Ϡ0008 L3R 25  B # R#  B ` 0Q" P*N0`00S 9` ` `Ѝ 0_S  $  B$ $ R$  B   w(8w(Ly(Ty(y(Xy(|w(U ((w(Pw(xw(t0A-P`p`ATR @P<G0S @ .1p0Ay(X9<0 0 1S01/ 0S00/y(`0 5 /H0P 3S P 3S P/// w(^FPO-0(P,p0@4`8 P P0P \ 0 S   0 0 0  0P  0S L0 w0 0 00 0 0 w( (y(Q 0`( "4`#/O-8 0`1 0P0@8Q ЍS@hp8Q Q 00p 0爀ቐpl n n 0` RP/! 0 P  C1  1  @-Tl dl t90` xRo/ 10#/C!000P/  @-Xl pl t90` |R  /  /C! C!/! !/  @-y\l l t90` |R  /  /C! C!/! !/  @-S`l l t9O-$5SX @ lPphU0 01X` 0000$p    @R ![ 10<T+EP 1 @C 0ό2 @D R&p@PP U P W@T @ Ѝ \00@0 0S0 B0G-`RMXr@ PPl P\` `fP P9 4 }p `-0S  )ߍ<0H(00,0 00004008004004 04$0D0(0P WW[  SpUt Mp*h x\ 8 `+ <f 0g $f f f 0,0f0 f `+ p 0`?`a8SmPb   00*P*00  0* 9d@edA9zd@-:{9:999 ::A-@Mp`;@ @p@ݍ P0@0@_T00 ## O-M$M`pP`埲"NPX1 b: S/r%0P  rR ,00pPP [W sUP 0C P"Vs1R V  V'PN YP P W\1` 0J`PIX1: S<V2"GrpPUTPV9 PW00``2! 0$* $⿰PPt ;P5,0Sǰ3]`P S R S㤰p`P-㜰p `P`!\1 S R UPk`x!|0#PaY $PtpUd( FPP XND% ܍$ЍwJ F F F@00S0`( "4`#/|w(G-pX10P0@ʟ 0  X 3#15`05aà121 R0` 0Ppp!0R00S! =% 0%# 0!ZXl000Z T00!ǁ8P,0 w( (y(n:w(2y(:#(w( 00S/ |w(O-,Mp0댡`P@0V000,Ѝ00 ?U0$p$0 0000 P$0S b?$00P0   0  r@ A @`P@*D00S 0 0|w( w(y(Pw(xw(G-p`M0/10SPP@`1@710010000/ 0 0    0P@,P@00 ?U0p15:0 0000 Pp0S 0Ѝ?pp%&` ( Xd00 0a'%y0 S    ly(:w(|w( w(;L;y(O-pP,F,6,64M000cVg` rP !共 U 0ş @Q` 50S ;V 1h0!4p `\cD0S4!! Q 1  (0 00 00 P( Q- a10! 10  t40SI o;0Q(00 0p00`P(0 R7 $\ P\Q \ ("(P"$("(Q !  F( 000lPn3 4ЍtP`3P0QS?  ` e(3$3 ,`Q0 C,0(,0h @PX,*?̲00 ,0R.( 000V0A+Od2  Q,`` (,0!@JP,!S 0  B `㌑!#@  V8 !!R!' 0S& :, R*0( $ {000{,0 0  0(Q `@`P0,00~\000$00?8000P$ 0S g w(,,y(o d;w();;|w(;<-<^FF^;4w(ly( (0 L<2#(d<G-PQA a3AS0a M` 1Pr1100`^00 0000P0PU <Ϋ@p$yp@YU 0001 0}@P  Ѝ0ATP   0S 9    eP@L/P@0 w(,,y(w(y(-<w(<<<w(p@-P0 % .  @Q 0S p# #3 0# #:>0 T0SpP8PHp w(^Fw(<<<"R/G-P `$ 0p` @V` 0Y @`` V`@&!D`( G-P`0 4J% Y0000008#8$#48#8Y\dp 0q0! ## ?@Ѝ :^FF^: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- P0U$PP(,`0p4@*^ :^0 *^*X@40P/ Q\/O-@p0P2#U 1!Q$ ` R J` U9# c! SV Q V3  P! I` P09# c SV!Q V3  P 0  P$ ` U 0 Ѝ=o J O=0A-1àQ`P x0x xx$0Sp@@ P` pFQL @$ @PQ0࠱@=o } O=p@-@P40S:a80Sd0d dd#0C800S   0Ջ00PP80Sp0 m=1o , O==2 ,0S/`0@-@0  L8,嵋0,0080S 0  #0@襋$(==Eo O=,0@-S ,0, ,,#@TP @莋=Xo  O=O-p-\MPU`@8 U810!@3 @#S41@D2s2@Ds1@DS@D50  00 0P U0#03?Z[[UV@D `0P$005Q (ѫO0$0 CD 0 XR @"<p!8pL0(0$0 0H(0 0 `,0`4  0 4$#HP$0 PH40  (00P 0P萫,05S00SUSP3S` 4$`UQᡈ `F0#00<040@00 38p4` <`00HpL`<0@ RS80 0 ,H0 PpT`f@P ,Pd3Qk 0Q 0CQ @MO@ $@$\Ѝ0,03p(0?D00T P  HpL`%VW 60, `S24040S@p( D0) 0 P  X Z ,2,",Z(H [`400 0Q 800800p?(00T 0`RZ@p(0  0 P 80S010!00C800S   0/` 0SP THpPL`P@ T@Pn P0ćT`V@ !;#P` !T@2#00P0V0$0D$(=LBAW>(>jo O=2>p>{o NBAW>>>o m=o  G-0,0S0 !Pሇ@`40S*ӉЍ00qW! 0 W@P   k@Pp=o F O=A-0`c,0@Sl0l h!PpQ H0< D 0P@DT@=o O=>a C-0`c,0(PS0 o!p@Q |0l x@PEU  0P !  0 P P Ѝ=o q O=>s X0sC-@0Ђ D`P 004 0ʩP 08Ѝp$(\y(>X0sC-@0Ђ D`P 004 0ᯩP 0Ѝp$(`y(?0p@-PQ {`@0P Rp   T0`! 猩@P 8Y4P /w(((N?$(??"@-,@P,0S ?00((@-,P ,\  E Ѝ((p@-@PYp0p 0 SX0d0RX c#!$c4"pD006.8 Q#3SRpply(|w( w(27@-0S S2+, R0 ELh `Q tpBPC㟦aQ* Q( H<5P 4,B 5*< 50d30a3B210S . 0 00@ 7.Bp#x3@ Ŝ & 0P xXPA 5*< 50d3 01$10S 0 0@ d3S+ CQ+aQ# 0AS"|P @0a3d3*|0p00S ̵0 0@S Ѝ08w($( w(?"@?Pw(xw(|w((("@D@\@ @-o| O-M`p0@  @bcc 0$0 c# pPc0S@P7# 00" $qp3$寇AtUhUaU bU XP4i0E S00$p$; @" 80 (P 0 @0S ,00#!( `9 P P0V mЍVp FpxP`8 Y pi P`P0V:P0V ZP p90[0T$$0 !' Pp  @L 0 00$ 0S Z(0,  $ 8 xp B @p/ 0 00$ 0S Z(0,  $ 8 [p @0P* |  P0 Pq 0 ! P4| o u@X+&o @@@@@ QA,AG- 0pP@P` V   00000G `00000O-mM0@` P0@004080 0bW, AW- LW% 8勆4剆cW iW0p `$ΏppH40S 0mߍ8 40H4: S@ @0(00,0000408`0P  P 0 0! CTp }p 0Q=  0! $刡匱@P 0V$0 0/S V<<Y``0"<P2P0<0$寃`P 㽤P< py Ȥw <V@H'p n/B  < n?n/ ᒤ0Pp < !$ȅ$0 @#0P!S( 0pSp`V|p 0S `0S  R  R 0S( m0H $8HP`$pF0pM $ 0pF fp>  T 0S  (, PQ S RPQp AX+&Azd@AA BF B9BrBBBBO-P-,M@p`$P("ᙎp($0S0$020S'$p P V 00 0P0Ne 0 fP AP PP `QpP$fp,Ѝ`P 0`P , ?o  00 00 ` p 0P)qp p Up`4CX+&:CPC$p eCUwCG-@pP\!p`:D10S:  p o09 6X $$ lip+ P%W00S $$ \Yp YPPU `fV rV GTP$$ @ =p$Y*X+&CCCC8p D @-Oo| A-@P`pP 4D\ XuT DD o8 >U  AdA dꀶX2&%~@- R0Ѝp` P@cP 0 R SR  R $Â!#0BR R P I-, P/00#01"$#Pp O-@PU \  p U@00P`6 [ `` `7 V `V*!ƌʠ?,͇Q`V*  Q*`V*?!Ì?G-8a8q@ @ 0P^ \ ^0᳀ 0S@ 0S@ 0S@@00\# ?\CTムა :^ *$5@0C6;007;00@R0@U^(PO-`$0P@P 0z'0 0Q P *@ Ѝ ݡPC-P$4 p咓`㓁(`@ 0Q P Ѝ  ᢡP404-0@-  Ѝ Ѝ/-@-00@ 0 Ѝ@ Ѝ/-@-P 4(c  Ѝ Ѝ/ံO-MP`@PЍ Pp P 4S T 0ᨂT0Pp$Q$VP 0S 4S $X 4P S $ ~SpH0!!`000  0 0  0 @P 000 00 0 0 P p1 T`嘖&P$(0,p 0p$S4pS ڠ 0x p"  L0 `0p"WPb 00P0S:DFDjDD2D6DDXDO-$MХ@pPP? 2R 4S  0$Ѝ0m Q Q0   RSRQ"  "S 0 0000 00  0 PP῁4S 0S,  00 000 0 P0P0 <00SS PẐX  , 00`S4S 0$R V P0 RS  0 000P\ H0H 0000 0   H;pF:DUDEE,EIESEeEG-PM`4p@P(@C>dtC@ $$0840; ឺp+p  Epp H4$t: S! W B.L 9p< $4S0 (d,T0.B. )p (d,T0"W(d,T0|4$t0dT 0i (d,T  00$0 UP0p 044S   0 08p 0P Pp|  0Ppu P P 0" RpP5:Ѝ Y0p["EEFEd@EEd@EFFKFgF@-@P 4B BRP ⒠p <W4( aЍ@Ѝd@FF@-@Pp P P+4PS 4 G/GTGA- @PP0T p` `Xp0 pnGG$$ QS40ŲEA8Ѵ#8"( 0 / 0T 00 /$4 0T0 / $4 0T0 /G-`Pp @P0P PP㤐`0`0000ܠU:Ѝ 1000XL0L `̠P1040$ àPU GGc"X2&GqC$$0A@-P@-@ t`RdtЍpP P 4g R 0 I-GGGO-p!PR0_otM`@R(0S00S "R0 U tЍP PU 0SGQD (0QS@!RS R7"R S R.A 40[ P#  7/p ' 7/p 40 T m0 $8  %P P  P HA-@pP`P 5/p 4 5/p 4 HC-(00pS4P Ѝ$d@ 0 4  l 0` 0&0 ( 0`WP 'H;HtHO- 0 0pP댐@T  P ZH V` 0 @I-Pt Hp@-P `@0 Ş@TpPt HO-P܀$Mp `@0吰     Q  t0 p ` X0 X p`204S0  $ЍPt c"HO-PQ04p@ 00` ЍP P0S* E 0`P      04 p p#p p04pp  HHI#I0s@-SX`@ P\0 ?o2R0S ЍpI-G@- iR sR aR p` OzCIp@-P@P (`Pp [pI-lIp@-@T 40`PኻPSppI-IiR@-- 0 aR bR LR( ?sR% tR@P 0P0S`)00p`(j0 II-Ip@-M `@P`H P00͵00y0S s /Ѝpc"IץQG-@MP Q  ЍA~␀ p${`Px hB~0 00  0 `PP  |I}I0JO-$MH@`P ,`$ЍPP 0 0 0 $ Y># P0*Q P0 0?Y S0STP pY0 P pE00 PU 0pop $ {P 0000 0 ppP :|4  ]$\ `  0V,S( 0$84 0`p| $Ĕ%{!#,[PP  {T P R*L0Sh 0p_ L004 0 000 0PM 4$$   $ 0$$@p7 !JQJlJJJJJ00S 0@-C^M E@$A$$E0Q 0(P(Ѝ0 @x("(!&"`#XT 80 @P8X+&t LL,L>LSLjLLL LL0$ 8O-DMP`p4 M븁1<0!Ẅp 0S& ! R"! DЍLRR a0BSS0H10S 8 P ( ᑜ@P  E w4{@ x谟P 4&{ T 0 ̛0@  ! T 0@ @ P@pt LMX+&|eI-pF u 1&ILA-p`(P@yP 0p`P @00! 0$0@-@P$0S z@zO- Lu OOPX2&"P5R R R D@-R R/////P Rp@-0@P S  \ ppB \"Sp 1h h@ \0X ppppppppu u u P,(PO- 0`@PP Ѝ0!S R w0P(Pp0\4SH 00$$4 $0P8 S w R RP304S ڠ0"S1 @㞗0  40 3/p 8 H0 0($  P P 0$ 0 0S (0, PpPWEVPQu P,(*QO-0,MP`p$0 #ፀp@20S$`P 0 0! " pT AT fT W@,ЍsT00$fp0 0 00 0@Rqp 4 `00p x0804S 0 Q1!0  R- R02U1 0S.d RL!L@@1R R8 H0 pp0pW$00(p,0` 0S0 00` 0`Zp p{ 0oo`@ j 0 bp@iDeIQX+&OQPv dv u iQX8QPl(rTsQA-@ĔQM PP An``llph`pPP MЍ'p,   0 [0}QQRG-@PPp% U d4! A~ⴐ崀 p $$ M0 P ! `" $`'p P  00`$B~ 0 0}#R@RQ t3O-M@qPpMPDGC ?;$R 4SЍ4 R $ RQ  S P $ 4RS  0I  U08pP  0S5 P; 0  0A`P ,^ ?o  00 00 `Ip \p 0&p0u | `RwRRRPCeCUwCSp@-8M@P`4 #l040h ~p P00S D 0  pi8Ѝp踣DSX+&~ |  @-H| O-0TMp #$$0@`40#^~pP>20SK@0SD00h@ DP 0SD0SA \^<40$ 400#9qpp, 804<0P$ 0I,0, P bU@OqU H04 8P3pPTЍ$$0 G$(`Vt0Y`0X0 0000 WX0 0 0S$ (0  [ Pz$00(0 00qpp 0 QP Р 0 Zkp , ep p ,  fSX+&| I4| SSSO-C` ILM$@P0$0d%}pP50S DjLЍqP sP @0p0$  0dqpp PP`0$0$$I0P00P 0 00 00h 0N0P(0  0 0(0 040>P 7P 4  0,0$000* & 4PS,00 VU$0SxP0T ᒃ!088 X : U S   0 <0<0P (, S0 R S ,0, S00,0pU000U0   00R 0 00S[W0[ 4SX 4SU $0S$s 4pW4 4` P 4\ "$`0 0S 004 Q $ 0$ R40H L;p 401ST> 0S 0` 0T 00S!Q `$NP$ a@ P PTpT T 0!$ЍP`\| VX+&h| 5p@-M(@,`6#,P X0☤ P00͵00ɒ0S Ò Ѝpc"OVץ@-WM M`p@T4 &Wލ Ѝ0S@ P壒 0$$ 0$$ 0xI 0DxMP x x倒 02txm0 $8 XpTn#D9^XVpVVLX fVW/X[XV@-0@ n 00 0  0Ѝ 1@-Ma qP@Pf0Ѝ@40 0.` p$Ѝ  t!80pp`\X0 0 $ <  P @08 0@TS- Q $m0 8 0 0 ppܑ1S1SxЍ@ϑ2\Q\ TЍ@đ|| VVLCVV VVVV WWVW`CVWc"P `00CS`0p S00 P0S X0X /XԒ1&A-MMP"` 向" 匑Zj2rp@TݍЍ z v `Vk 8l  ! `"0"0BBP M0S91!BBBB?=$ ! @|<#P%$ !L<#& sm0 $8$ # bR@B  0B   H0S 0CS 0L 80L 7WF=WVWOW]WX fcW(WWWc"IX:XV{A-0hMp@ P` @!H"yp420SP+ lP`P a@ PuP xP RЍ@@ dp@@@0S00` P 0S0S \^ 0 Q  b ^,<0pp`V O  K Q pB   `42| hXX+&rX| 7WF=WVWOWX}p@-HM@P`4 q  1D0!xp T  P 00S  0%iR TR LR a0BST plRs0BL~HЍpT p| XXX+&d| 5 k@-0$M\q` 0 0@P!!`C$nP X Ѝ`P[P X00 :9PZ0P 0 XP$$0MPl cX XPP HXP (0MP$c0 >P $0 q 4 Q3@P 4PV0P 4 Pj 500pP0W0000\0S 00 0(0XP 8X0P,0 naPP c`P c$Pv H *>Pp @0 SD00H0 RL0( 0PB` 0qp(  R$4,, 0 qp 0`. Ỉ$4P `$$ᰈ$4P`V X`P' tXP# [d&*X XP `0P$0 $ac`P$ac &? ` 0qpsp =Pt9p o  =P   =P  =P  t =P   =P  @ =P q( =P   =P q/  =P r =P 01S [r/s?p'(Ѳ Ѱ  =P s/t {=P{$$ $4P,X`P b`P  b$$0` :qpS/ p0/l< >Pl <pP < ,A< >P\ <P C=PQ  ==PK < 7=PE (< >P <$ 8 <P5 8 Z* 0 k$ Bp .$ P$4`  0qp`$ Y$ , 800(0 000K(040P08\ p$,` 0$00P00T0  X0`$$qpx$$I$4P0H00L0p`$4'#`xqpm$$+$4P`p+^X+& I-/^`R ^E^]]f^]]^@]^ ^^^}| ~^ _/_!_LC]UA_@Y](]5]D]M]X]e]s]]]~_Z____0@-M@ P '  jQp@ @㪱8 vp(㢱0Ѝ0 `'i`@-SM@P, 0H0P0X0`0h0p0x00 00T 0 0\ 0$ 0d l 04 t0`@pt 0 \00 DL`|`p D Sߍi@%`i1`!i=`@-@    0`( "4`#Ѝ10S/!p@-MPM@P% PA. (01P A!Ax9P 0`0?oS c` 06P ``,$0 0A. 00P0P A SA v0 0A. 00Pl0P AX X4A\000H 0Y4ލЍp?((c"I`R`Y`f`t``s@-6PP 㵰P 㮰 "@`T^ЍpyP  00SUV  e@ `No0 R !=O-M@ Pxpp"v`P"   UP- {XTP:TpP oXp|TP hX `U:P 0"h 0R00  p!  <:Pr 0SohQl @ pal 9X! R R RZ  0PW l Z ` X (s<W 0j0S, @ hᾆP@ `Ḇpd HQ L 40R !01Sp0S 3/p\ U 8 Xᙆp \ [ 5@ `ጆp Ѝ ``ڐ@``ٽ`Xa``,aA-pS@P@TPPS_`P fU\T P TPW^@_T @- ;P ЍA-MP p:@P00p`ЍpP  ➚4 'p !0 R;`i@-@p @A-P`SpP00EWP@?0HW  FA-P`SpP00'WP@:?0*W  Fu@- $f9P00 Ѝp@-8M@ PU9P1!lSP V0 Q0s0S00VPP  S@]Dt Y  oV< PS`|]V8Ѝp3at P] 0@pX%@-p0( 0`P/ R/X%O-0 4M@@ !T 20( Dďpz P(0$`!pSp D@T PoS@ڐAP`@ ptpP`[T000 [  ~ R  P Q R. 0S $P\(P  1/ P s@0S 㡀p "SR(0 SP \ 2/P W0(fɚ;6eNofO-MMPp  U p`%  IpP$ 0Y000$ `-  ᘀpH^ t ዀp Q T̀ @⇀ K p$(Q 廀$_X@T ڔX00@0 0_P墀L 0I @0” ,0@4@Hp 0]0Pd0o 0P 40,@9p<e 44{_(H0S !P31lH0S;I0S8Z`@T 0 3/@: " ⡖M0S:00!  l"啖M0S T=@85w@03/@t JQI0J/NpI0!Sa`"%J` 1 0 d1 T|p 1 d\!1 HD`#%Jp!1 @ t1 x!|1  P@Th 03/@0 3/ݍЍ蒁 `ffJgiWg~isg{ghgX%i.hiBh\hth( hg!hhi0mf3 hhhhhhO-@PpP  p tT XL@VLPT!`~L `P `]PTU D1O0S 'WW|W P.Z  P'  _4P! K0S 0 L0S 0M0S 0 N0SO0`S PPV ~  c hNo(2&@-,MP@xpP L`P( ^ p0S hP 1P00@ @ا0, ʧ,Ѝ`k(8i(l l.l@-P@၏0P 㶧@lG-@RLPP0 1`@ Y㔀OpO?PP  ppP  H@@@^@XlI.  2bl(Ss@-@{L@P-00ЍpOP~O @P <` P]u l(Fs@-@QK@P0 cOPUO@P T` ƏP]u( iЍpmI. ( bl(FA-@"KPP0 `@2Op#OᰛPP {pD >FJN@I. 4 bl(l@-@d S1PP0P PPjL 0 S@@00 >00Ѝlt= bl(X2&l0@-M@bKP]KP XKPtSKP d0P P P P< P>p$㠦Ѝ0mlXl(7i m7@-@ld} P H}DP⚎ P! (} Ѝ0}@XmmA-M`@PK bppP"_(    ᙑ "}p% (( pl"x <@T h8PV}`2PPO} RU T Ѝ0 P <x[@P $@|p э'}u 0R }l)| |` pPpQ}p R%PP} |mIP;ЍAs\Q\ 0Q    1 0P|P0 RSႍ||$ |0` R P U 0pD` P` `8i(i,mX5T (Y( R R["00ZP 000 cPs0"CQn BQj Qf4!<5^ Xpp-XPPX Ჰ  $P KpnZWF  0 Ep? 0STt 1PPX!0ɣ8!100#R0S u0m8\@pG 0 YP@T 0CS0 0 xC0X0^ :T 0CS00wRxC 0 aD\W@DAD\ 7@D@S @00@D@ T030Z+K@YTh lj aHP0RU8 @ 0 0 0`0 m mbbA-X Pp@`P00860P 0 p 0 `P0O-$M`@ HpPX) P W0  Pzp` 0p0   04q-2qXp@- M@P` Q4P aPp@@N Ѝpir@- 8@E$P(0( ( Ѝrt fp@- 8@/$P(0( ( Ѝjrt fp0@-MMP "p@PۍЍ0@N P P+@oP@xNۍЍ0@Ro0S0S1iSs!s@- P@6$P@0@ @@Y Ixp$ΙЍrt Afp0s@- P@$P@0@ @M; Zp 㰙Ѝ( t fpLsO-MM`@ 4 P04 lP7EgE/P㊙7U$0'S`@0 00 `F@( 0R tP~ 0S0'V 0l90h90d9 0`9 0X90T90P P9~p(@!0! P h0 /C BRZ  0  00=C$0Cȟ"!0``F ^v `㬈E0080IcCP S@BAp (80`P0p *p!0h@"0(0(0SD o0$ P0B'S$0؍Ѝ 0 0'S   BS>C0C'S Q:dǟ "!! CR  ##9C0C"!% <'Sǟ"!2.Bǟ>C"" Ɵ"!/B Q 0*Sy S &S  2S% Sq 0S R )Sj&0C'S000S 0 t6Ht0 @o0( 0 B@( R &SopX>Uo 0R 0op0S o0S 0 yo00C!pᩐYP0  @Pgop <ao0S $ZA 04 8 <$S5Ko0S 0Cof OQmv 0S/@-(-@-  5O1O ЍЍ/-@-  'O#O ЍЍ/@-\00S 0  0000 0LNpЍ(#v@-@kHkzkp0m}p HvZvp@-pMPڬ2P0 PS 0P@ 0 0 00 0X Np HlP@@ ((@,P0P4P8P<Blt4  P @R XNHpЍp@aPS00!0310@- Mx 0 ?M@P \- eILPP @ , 0@@,MP 020Ѝ0 %(=@-0 @(l   lipxX2&xbyP@-d0 !X !T@0 60\ (0000/? T i Ph0@-d`  !TD0 60\ ,00 00/? T i P-P040#^4<\$0000/? T i PD0 40#\00Q 00/00? T i P-H 0:# ^4 0Q$0000/? T i P-H 09# ^4 0Q$0000/? T i P 4 <# \,4Q00/00? T i P@- 0:# ^ 0Q0P@d0 :0# TDH#^<0\ ,00$00? T nzzi $0@- 00hP Ѝ8%(%A-P_@p`WЍ P 3M@P p7@-0P@U , QJ Ѝ00zA-@0nS0oS@p p"P`\KP5J0nS0oSKPPKPP'@-&0 Uk,hzX2&O-M M~ 0勰P   -P A0=  P 00 0 PV#  0liP U $i0Sd 8 ^iF{hp^F[FY HH0S i<<00S ggShpDF@R<"< 0h ⇑0S  F0S0S 0 Fe=<<<0IXg : 6gP0Y00F 0 <<00SP  ꃮ@ I  gP0#4*<<00S$ 0S 1 p :F~ PS rJ (t1 $ X{f{ n{!A,7& t{{((w{{{{{Z{{{% {2&|O-MMȠ⨐@ 00 h`rOhPV 2W]0F! U0whpP0S 1Ulh>PPcha0SQ xU'`Xh0SJ P\Rh&` %Mh&P %Hh0S;4!0 P0  P00@P  0S  P@*hލЍO 0 0S 00S U0`  0h0P 0` pUd `0ލЍOh| D c"V&|;|X ((I|[|w|f{||$p@-PQ@@pQ(0opP0p(PA- 0nS0oS0  @P0Dt4EP,WpWDPP`8$E+Gp@,@P@(~=@-# Th+e~X2&O-@M pP"P0PD0@"` P0,"NPp/2 00CS20%|000& 0|0`P0 +0000 0p00*0 &0Z fpHh ;rPdPMP UP4 GP 01e@ P 00 0 00 0< 0~x`|P 00 0 PyPAy 00 0< 0ft[,0t0Z00x0V 0;;0|0ЍI-I-X+&3@/Ė Ԗ (-BMMI^@0 P@M00d  0epL0 Ǐ0 0/  0GZdcBt 7@-P @\E0Lo SϜ 0 㚏 Ѝ0@-@;0P @誏@-@=0P @蜴@- @.E0S 00S0?  nЍp@-@PᅤP0 h0/Sp% p@%@- gc X2&O-`@ Pp(,夐렰0 0000 Op0@DTq oPX0 sxP@&dx9 O4X+&I-I-\ (@-M@A> 0@0D00 p0 ep0S SH G 00,0 0cg/@Vp@-@PP0 ݎ0/SpK% p@G%@-b fjc X2&O-`@ Pp(,夐'렰0 0000 Np0@DTq oPX0 wP@㛎w9 O4X+&I-I-\H (@-M@A> 0@0D00 p0dp-0S SH &&G 00,0 0\c/@Vp@-@PoP0 R0/Sp$ p@$@-WbX2&G-` $p嬐0@P0 Np00@DT oPl0 iwPTZw  bA+jGI-\X+&( (-MM0An @H 0P ,0@cp b dՀp@-@PP0 0/SpP$ p@L$@-g eobX2&O-PM@ P0,dr`T"Mp)@20 R. +x   &  x `!p0 *00)0 &0_ C϶->?n}C@X=X\:\79>ἶ9>:>C᷶:>CFᳶ 0? AC>᪶C>mG᥶FᢶE~EnF᝶G 0X J~pXV}m  $$((,S>,uS>GqFnHHLLPPTTXX\\O-@P`Pp !4"4!14"41  $$((,,00WС\5 S L5sT`0$ $ 0Q`V,5zTvT`XrX\n\`k`dhdhehplalp^pt[txXx޵0[ O`LIpp$5S\5 Sp`0SP%@ Sز ,*%TU 0`( "4`#/+0P0 C@ /p@-@R0 M4 @8 P#` 1R  0  ?<#΋ 0 `x 0`0 C c00 d0`c Ca c0b0 0  0x  \41P0p$Ss $$TGQT`P@U*l 00 ЍO St hhȀ XȐPUP,ꬎ(T(U ޑTTt0p@-`0S[\ @1L00S000000B0E0p蜎(%|0P000/000/B10B1/101/ VX X2&O-pPUM  dϠ 0@Ì `0 150S  C0 R0SL@`Ѝ 0 R` ` 42 b< RV1QV RQQ R  $%R /  l!. 000 0P0C030S30 0C0 0003#0 3#00030SQd  0@ `?400 ST0T00  B 0Pu SX0000W0,d00? 0 0@ `4?  0댠 ,1#  0! ?0 00C000 rS! 4Aϓ8 0 B0 080$ 0C  $$ 0$080Ϧ0C40040 08 ROʌ10S  a dϠ 0@Ì `0 1%ÀQ,  "C^C C!( "^ !&W 080@o0T0@` !  R` _P/  1> ( ꬎ(T(U ޑ= %cX2&O-MMO⾟D`, %5_Q0uPSi`50U|Ux%?D0Shh,/nD ?0?D4hPp؍ߍ 2@ŒD 0L 04;20d04 0{0  00@4T@:T @:T @9T @ 9T @8T @8T@@048#80Up0 0` 40S7{ 3 0 000p0  8`  FZ X &0Z``a 0,oF Ϡ\ß ^/F022292?"""0Pa 2@őD L 00 /4;2UT 0"d00 0 o 0p,2 0r 0` 0W8 Tp`xSi`10TT0/`&22220OD05? 0 04s0hl 0@DE0 L04;d00 0@ `4 <02$2,242( 0 092?  0@ 0@Dő L0 0/4;$0 T*T 0lh d 0@Ì `01m%L((AX%h%o(T(TO--)MM00=0?0,8(0%TD0D`0S> 80pW:,0 0 0 RL(`(X((( \4 P@P`Pó P@ 4 ṳpT3 E嬳p@ `3T@  6SP@ * x6P (`0S0,5 Sx0<0(5002 0,%S0022Q04.TT 0Q&TLtrt" 0 04 0A TT> 040A 4T5 0 4QT, 00 Q*S# 00Q(S 004 QS1 @00T00D-\3SB1\CpېWXpX1X0SHS X0SS0$50 40bH00aL00BϠ850A<ŀϠ@5Dŀ0\P00\T0R380^S`R001S @4pᛐ0 R\0 a $(( %%ђl(x(-Yݓp(P(0(TÔ((%qT|(%h(t(( Q2! dS,QS18$Q<4R:|YS @0\5 ?>C0P4p3x00084$0%<0D0t@B000匐XL5P5|G   ?@8`F ? 9  ?# pp8 PEpG0!/0 p!"0 p4%p8$``05<4Rp`R!11 8400$0$ 0<pS_Px8S @`@0 ?@`0嗰PP* ?@P`(6#R0:`@0- 00 0$50SQ 0PӘ&"P0 ?00 1>00S`0 c2#, SZ QZ3 ?00 1>!00   B^B0<Pp0/2"0$ 0$ ?(Wp1Wp#T0p10G 0pK ? j 0PPB@TP`P 嘀 00B1  B1 R ` U"B !!0 R0CQE0E ?P=0 p똀 0 1 B0S0`0US0  B110S R/e @P`x12 0G<Ĕ84CP0Sp84<Ą-0$5BPSQɑ,pRB@L0 0 000060S|0p ?4HL4P0@0 6@p9' JQK@00 Q<zD7\5?>C0P奁%4tx0]p7(T0#2! a, A3 31  0@`0 04 p  0H$4  $ ( B, @%LV.  R*h ((E < 4(r X @( \ H( ?.@Xt@+@B@A.@B,-8 HupW @40 pKA ,p8d A YZQ  &Z0 {X R A/  pW <$?.t{4Ąß  Rï80\@$D04 0H4( 0Āp@2 R 5#< 5$23dr0S+ ~됺 zz000d0S CQ c6Rc,`P 'z'z {'+SP @ z0犸 08z'(Ȋ (+Sl,P 00 SP0\h!P !0@ 1@ݯ0 pQ0_& 0Sb@ RP QP0 뀠@t9 0J0jF 06n`K$00S>(^F G(\ (1&ht@2&(/SVTP(U  c"TMX(L(V(%nT(\(8 `( h00S<  0 (#1 ,(0+ V.|00S  S 0=S,f0S10$0(1H@0p  OPP04SP0 0R0 S00C0> S< 0,00P0lA 0,0S8 p开8嘥ȿ+" < Q \%`R 0  ᐡ, @400(0 0 @DU@, 4Aཌ<2, R40@ `0```0T0w(tb 0 p ` I20 P$5"S`0 9pR8<00 t x00Sx0x 0\0  1`0  B1$%Rh# R0C00h0$l`0 R#00B1d0 R*0%됃U` p 0 0 0 (0 0C0 (0(0 S 4`R` | $%R l 0! `04 p  R2d\ 4RT T  4P%QXԐ R, d0 0   , 1  8 @ l`Q H0+:H, fP+H6 H00S ,00C."\ ^  00 0?d 2 B< b10 X&SN$01=S,00CU tl010T0010X0 00&S\0?0  0  B  R\ ?0  ` 00C 0  80 C  0C1448000C ST0C0@ ph`l48 QT* B!44 T: $5Sl0h @0 pp^:S $%S0! !H`$p$p(0W0x0S ,4 I d,04  0,4 $p 00`  Vj0S   0帀0 Xx0#`8y X\H># P 0?d @ `0 <k 9\%R i0SP Q``ƌ` $$S $:`R` $%Rl 0! ` p   R2d :RT T  :P%QXԐ R( d0 0O L  F(   8 @  t;R` /  `@$  $ ppS $S00S@0PY뀐 HFS 00@?8p`0x(1fpYU0I@X!@9@000T: 5@$\ Q 0@08(0 > (0d0O@N 0NC n 0p 10SD=0S0 000S.L08CxM = R0ł."\5S 00 0 d 0/ @. `3,0 0$ L0000P0S 0,00C0S0 X>0S lL0S bL>0S 0ញ UL00@P:*0ENP>0SN`E C>`>0S303040404 0#pCVW*DNuV. P\oV.GV0S ?0 PS?\5=S,??^ E?]0 0S 04 ] dLĒH 0@Ì `04 1,$0S0S 04 E d ,04 0K 04K)ݍЍSmfG-`RMXr@ =uPPl tP\` `P P9 4 Kp 0S  Q)ߍ<0H(00,0 00004008004004 04$0D0(0P #W[  {KpUt uKp*h t\9 8 ` < 0* $& "  0,00  ` Kp 0`?`a8SڕePb   00*P*00` ⮯ 0* 9d@edA9zd@-:{9:999 ::A-@Mp`;@ @Cdp@ݍ P0@0@IT00 ## p@-@P-P0 t0/Sp~  p@z R/-G-P `$ 0pȨ@V` 0@`` V`@&!D`( G-P`0 4J< Y0000008#8$#48#8Y\dp 0q0! ## ?@Ѝ :^FF^: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- P0U$PP(,`0p4@*^ :^0 *^*X@O-4MX00\0p0`P`0 ,0 , 0S P 0 -smS2aSMS ASB0Cd0b0CX S0SSU0@0T 0DS d9R$ 0 "P T 8 0U$UQUDT P 0 sS@ @ @U00 @@@ X 0x0  Pr0S00 000 040 P4Ѝ:p ]~@-]( $J_G놖X2&LԦ @-0 @   g 0G-@vP| lPE`0 00000BoH0UB?E ᴀ(\(P0  /PPP\!1cQ\\/p@-TPL`(FV@ d0 P 6V0@ \0<@p(0P  C @->r co`/ጩ s@-PL@` 008&V  @)rЍp(( 7s@-PX00SL0@`ă5#000<&V @ rЍp((( Vh10 PS/C-@PQM@MP`6`@f$a 41 P0p9 0 T:@6S0O@ ᷽D6 DۍЍC+ 0P \ 010 S a8!#4a4# 0^ ;0PT 0+ۍЍ((((( G-@B`p %PP$"$q 0F04( 0 _06# R 0 !uq0 60 0 !dq0006&0>06 0  B 00C0( 6V0:!$``Vp 00$&? 0(0 6 C c0&0 $&?0`L0SV&% 0: S B&0 d ЍG'< ((( v×x%A-Xa00S FT:p3%PP  0 0 A1S0Sr' P @D A01 S p0S @2106&0H'0& 00C00&101 00C 00( O-CM`(HP8G?O8fK  0 Q 3pcQ010!$0_  ᒩ , Z0UC, 00 40 ,0,00 4P L Q 0  0< p$8 F10(- v   00 0 6!< 0(0,, $(200UH,0000@ P  D`0 0H\ d04LPF F 0T0,<<05X0$<0S,i( X<# <PU P]  L 0R V0400& \p# @ \  110B0Hf0F&a෺0PeeC0CP!Pp\p :#P 0   0`Z0C `$00SGj 0 00S ,!*&A P7 h( GF* 0 (p "*=F 6 !"0H& 00 4:rP(pD ZH&{0S^9 R0J0nL  X&' d  rP &X p \ ,p0&s0&$0#0  0vSsp0C 0 0 V0( " B("( 0&`  0rT BRP(0 x0Sw 0Sv00|8|@ p nEPPYP 0R SIq So ׹`P0S ðp7L R d0 P# 0pDu'4oru+U%&0# 0H&哥*6 B6  她 02봦 ώ6w0CU 00C0CS : B਽87! S/~0S0  C02#&0Dx`0 00 Z:0ZG:u3006`  0(01 0c 0 K]U2  060 5&M̵(6ZC:,0USL0S d0 JP V840S X-P6! !!0!!!0 SH$$0 ᓲ" ґ$0 0d$&S: 060& 0u0.hDH 0X5#(0004 DY0SMf`F`VI 30SA DX DD3PUCL0S \08`0 v  PP1j P#T36(D6l0H0p0t0x0C086309Pp`$MD,m K` Dg j┼26CH0p0t0x0Cf&1 #?1# 0RP*d T"<y 0 lP0nPPP"g v0+!`P!] %!P 6 !T!PU:< U+:0U: a#0 X#0 h℀%L0S^`U,!%$%7*p0SL:Wb: 0 6 P(((E(pǘ|%x%,(j(S%QNx(((ƙ(%(\ 1&ht@2&sSV c"MAV P ě%A% H%\(((d 00P Wh %h%*  㓠 p001p1Pp0  !;P `U&0 6`0U/0 h h⑻L0S `0 T1 #'$/%d16BtgH0p0t0x0lB&08020lP d:1 `p2& 0h?Df0?o2UD+u፻&0#6` c2H H0 HDmBCߍXGG-`RMXr@ lPPl kP\` `xP P9 4 hBp K0S   ߍ<0H(00,0 00004008004004 04$0D0(0P BW[  >BpUt 8Bp*h ck\ 8 `Ⱥ < 0 $   0,00  `⤺ Ap 0`?`a8SX\Pb   00*P*00W q 0* 9d@edA9zd@-:{9:999 ::A-@Mp`;@ @[p@ݍ P0@0@J@T00 ## @-`pᎻ  0@Pᆻ00S0?0\ 0S 0 jS\F\GL0 \ gL0 SDKT ЍE%KUJ%FZO%A_0 o$ z@-(HH@P @WB880 , PNBU@"?드 X2&֜A-p`P@*P V 0 ^joG-`RMXr@ jPPl MjP\` `#P P9 4 Ap 0S  ߍ<0H(00,0 00004008004004 04$0D0(0P W[  @pUt @p*h j\ 8 `s <f 0 $   0,00  `O @p 0`?`a8S[Pb   00*P*00HV  0* 9d@edA9zd@-:{9:999 ::A-@Mp`;@ @Yp@ݍ P0@0@>T00 ## -0<\   RS  0 S\9&0 /\)Q@-$ Q:1O-@-MMh V 0d00h00X00|00p000 0\0$0l0(0t02000040<080H030<004P04040F00G00H0040P0050<0p 0S00|0000000S00\?00H R00S <~t0S _Pts|0p 0l0- Sd0h 0>0i/;>pD |0@ Sp0@0OD >P ]pD 0@A/qE`@P\#>pD ?P (ATl0S 1 : S  R 5   w`P`0z W`r`Foobr cPV   gP  b@DPH 3}pTrd0h 0 0d 0Dh0ޮd0h QP  h0@ Fη0S@040x0 0P0T0@0`0,000$0 T0R0 T0R@00@00S@0S100 S0P00RS 00R0 R0S0P0z /廱a+a`0P00 pR  W 000RW 0`S`SV Z T @0S T0S2|0p 0/>0D0 p| 萝쀝pcT* ppv @@0S ?X01?0#*@0bph T0S*Yp_ TpZdh 0[J U  U* >05[R[:\0Sd `!0SV *PX` VU \0 0` V pI`DfP0 $  0  , ` $ ( @ , T 0 P < @ x @ D04 0p`D6>pe 2"okk`0dkp?rp0ok|0k`p0 ደ`V`Q`V\xDU" U U X: U0S <(0S P0S0 0PPRD0(0 0S0S  T*,0 U00S,00,0<0S$ < 0C|<0S*h t<0#SPn<8 $0R0$00S S \H0S H 0CH000 ,0R0,00 0S0`0 0R0 0R400 40R000X0S /5X0PL08& [= n[0PL0 L;pLmb=0P!* R0r4b ᵰ 00W 0S(dR0Lz800S0U00Q$`80V`X5[P0Aಱ,00pSR<Xg'Eৱ[ p⟱p W,0S0p⎱[PPd  ?ℱP U40S 58 R 0 S%PX0L000080 U $0S8`|80$04 8 R Q R8` 40`0S|4V8040 4 R Q R  R V R ```$0S PI 0 PP3P0!01$0,0A$[0U  %1 0$00pA`0[ U U 0s#0 0 U0#"2 U Z* U 0S:<$0V,  U ,0S<,0ꋰ $00p 0S !0 3 Z5s:0%q!  p J0  .? Uha U\abV10A0 ৰ 0S0 0@r"0p 0 0  ,0  @J 0Y 1!XV;@w ŸXڟd9&.O#L/]r#Qu͡&EN?/tТ@wc"Vڣ">FNW_u~b`h@X2&\)ɤgfff4 URRaArrAa U0 U00Q*H [00R H 0 U0 U00 =`Q!A 1 Q",0R0D ;`0SP0S00`0 Ux00x0P0 0S !3# U U00 Y00 00 0 0;000$0 ;,0S ;Z  ;`$; 0S 4;P0T @H;Y T }; 0Sx pv;tt;l02G6pq`P 2dl:&>C5 0 S0|0| 0$02#dl0d U00l 00 00H0 l30R8 00R000\0\0S0 U0@0$0Q #   t  00 4Q0tp0H0( S (40S (0dH)H0 0d(0l;p$00X0S& U!0( R030"S 0R<00d h0-!80< S 8p P < L *(0<0 (0S U0( R00S~ $4 0$00000,00#40*40`00 01@01T01 UP0 @ 0 0$00(0x0,040303)00000 0$ 2?@1c4 04v 08#$0 #(#< 0&0 9 =Q p0QX0S0000to00 0 R  PpT '? D L8p_ P^ ( DH74 R ( 4R  R 0( S7071011l0( $R030#R03S 0$ |CծQ`000S  0! UQ0R0( lR00S \I(0 00 25 010 0P B24 01(00(0S  PP 0`( "4`#/   k B* {S@--f A 8 /eAD00@- 44@4P\P 0B"" `)-@=B')@-  >:7X2&G-@P ` Ա!>0P V0 0  PP G詝*pP`0y&X 0 * +['Hk;[E{7 [ (+S PPP 7 0 @@zj{ k[@  k[+S74Ѝ00B:|k{{'*k[+S7@@?-C6?Y@)`)$=Sd%))ҧp@-㖰j0d2S4`)@0@-0S0@d2S倰`2"R2踭%`)@-@ 081  0*4t1 t t*   <(8(N*0C @3K+ C | Z0#-S<888xS`S?S DSg .@ Y 4 , 0BK+ |00CS00ON)a0CS00 i  קPK 0@P: 0@09  x90Sl90 0K )K = C4  ⱧPK 0 $ PK. 3 K 9 &  ┧PK P 0K. 80  l  z@Puww D80S7    bP]7<07807407007,07(07$07 0707070707 0707070'763 ĥ  2`P-K PP 70Sh'0 0C!0R3 H70S0S K  @PPPh `◥pᔥt0@Pp&  p劥thP@@0X"T  0T\  |pW ppS  0QSL0QU0P@ o0D` X\ X0D S@0S2 @DU1 PP "PPK 0P@0 K. 2K>l%l 0 1줟D@@pP @ XHl K0S$0 0C!0R3 0S0S 0`0}P `0wP c=0 ,C0 0 S;.0l0 T2+ ⫕0  d0d0@4 :HS p 1 01 Q 1 \R \@?p@1cFD0X(H`p3 R  2  Z   tXY   \0T0S4 ?D00D0. L0 SH00H0H P0S  v  P0S* | 5 dh  ҥPcݍЍ W8  Q$  ⿥PPA0S, P =  ⫥P 0  ➥P $  ⒥PP@d0S\X000+ r$48d4 0 ***v*X2&| ; v  *ܭ%@@϶Kd*HEY~ѷ?oո W*x*gfff36vnF= _,{{[k6Ϲ@0@-0iS03S !:HP-h**@-@hh` 00 P @4  0   &(*+3;D)*@-`0@Px0 B0PU1 S2P T0p0S 0@ S<<$4, 0p0 Ѝح%*x*M2&RC-PD1`0B8! Y!tMR!p@  10S 0 tЍ000iS00S 00S  d `P/W @ 0 i P ᖤP000 p 0p3 W@000ح%*d*\2&h*x*ܭ%q`0@- B@T0@T0@1 S2 0P   0S ح%*G-lQ0S `` @P 0S 484a4qP0 0@0C!R! 1S1 5Y TpЀؐP` U0(@P 0E!0R30S u | X00S2 @TP`/00 $ @x*2&w***d*(*O-0B$0 pQ0US P`P PP"/ @P0 D  0S= 0S: P05"  UE  (; V S 0S00V0C?o20SP@Yt PP`30S  /x#0ES0000D30S ЍYK 0 X@00020S >P,0 M/X0000  000SH 0@-/ 0 0@0010S P0 YQA 00 0X@[0000S X0000000S~ @0 0 n RT 0@s0S @ 0 $ @ 0r@WH00S \0 ,}L (.4ꬥ*d*ʺ2& X2&!3P(*r`1A-0S PPLqL@` T0 :41,a PU @T)$PWP@`0S 0D !0R3 P U 0S 0S  |Z.9P0S0S `0S < B.!s@x*2&ʻ*d*(**0A-0S x|P @`pT V @TL$@ 0S$p$00E`@x*2&(*;O-!1 0RR㤑S Gq儡@P 0P0: ЍS DP2`P( 09C -000t PP@:SR  0- Q ]`P0to0 000 t000h*x**2&T**wX2&Լ2O-0S b00 K_ 1࡟P3pP@'0P0p0Y: P0 *@@ $8 W0: R0':,0 R S U :SR00W 030"S P 0000 S 0 SPhw \ X-000P@ Ѝx*2&***X2&C-MM$Q@P0S 7 @p T0:ۍЍ0S '0 BU000@T`PP@p0 , ] Y $  3000PU x*2&**0A-0S |pP` U0(o@TP` 0Q0F00S G@x*2&5*NA-p`P@P m,pEpDorPT 00 0CR?o20S $P dX2&~p@-/0@PO 0Pp SRpL*@-80S$ $00  0 (,(맽P* ˽X2&A-P0`0pO0000 Sڤ/0>+b P0 P<P@O 0 0O0?L*D*%0@- @00咚0@0Ѝs@-@P`P @TZXX +?0 00?w+"+R  + H)Ѝp<X2&$0L<S/ @-騔PD*%2O-@`CMV{ qP@ `0DUCߍ貀TX B/C0 S4(( $j@0PS  b8"#4 b4#04!40010S 0S 0S0000崐{'{{g W:0000Y&*Ȑ0S 0 0S 0 000R*Q p`D+0S L `X0S  ` \***x*2&`tD@-(p @,P(0@0% \3O-p0]MS DDU@c@C < 804#)00RS   #0)arp"& 7YRPP "S*W  0")00RS[  0")t:rpd"lLYPL"L  Pp] HBHHHr0SPY : SVH7`P؀/0 ᬇ10L<aS$ @ ( D {`  8<P  8H\  T Ђ X ` {fP (>*8!88hL/0>+b P< NP P `0?0H @P YP)PD 99  G*L P YPOP|]ߍx*2&*P*h*%վȂD*%5C * XL*xPIL))*X2&%@-$@0 00: S긩*G-@ q `0S+ 'P 00S EP0 S00P R HRڄ00S t)  Y`P 0 Y00:$00S ( )*d*X2&ǿ G-AM`P@m0pP004 0AލG/00 08/P1 00C 0  R+ d T`)0 ⸌ 0 D jnD*= &X2&NwA-MMp00 0/R @`GPP 0S P@ۍЍ D :Მ`D @P 0S P`D* p@-0@ @P  P@p@-@&@3O-tM0 S pp:l00RS\3\  P3P#0'HC4#S<:88tЍO!, ($PL     (+(0p`00&ܢܲ@L<` &(L\0@ |gWI< h`VV#W_ @Pp L<0@'pi0xSiSPcP 0'0@$ 000 'L<0@ *+X`T|L WtЍ0 0C0\10S 0S`%0` S\/&X/&h0SS  r18o10dS X00\ `0a0P!~c 08(&x*2&h**%P*5%X2&D*l*p* :[m~*A-MMp`@PPx 0pGh!hg%@PX T'LOŠ< 0'ۍЍ aD D< %PpUZ%X% U`k 4%p0P '뗠 x'|$0S $p T0TP 4 '~~8 [EX2& D*l**'R|@-3P@-H@4#S 0 = M&0#S 04@C&%0A-@P` 0 P0:t 0hp ?Y0@$a@00S$`V SRꠥ*\*d*v 0S 0 0/ R  /0S0 `0p@-@ PP0*D` ?0Pp UTp$/p蠥**0p@-P@ 0 P0: 0Vx` ?01S 0Hp@F $ P\@P@ p$0ꠥ**@-MMP@T 0``p/VVP   ˚P @T@ۍЍVP @p@-/Pt@P@p00/00@P 0S h0A-P@oC/p 0TD@DZU pD@DP*G-pP`04PSp@P`0PP0C0 T`4 $D@ **G-ᜡ FPTpA`Pt0&(0C0@V$Q@$0( 6ʝ00v`PPEPP vᢘ @$@@(`/Η变` 00 @ `P`P0P p0@0 P $@ **0Rk@-@d00$ D*0@-S@ 0S 0S  0S |0 Psp T` R 8dD0&$ FЀP 0S00*p@-@`PPA0S ? 0P0 @/:P{q0P 0 00p2O-p0lMS ||x20SGl]%PP 00P L>%H0<`000@Q /*` R 0?*a@0Sf@01 $10 8%1 0`008<0@  p%eKTlЍ 00`V@ 0 /0׍` 0 @T`$ q000 0 0$00(S0,00S0(0 0S000$0S0400᪍@0 1S0 0 0ឍ@x*2&l*ȂX2&/****X*\h3C-0MS Yr 0㜁P000 ;000Ѝ  !PP bbd `p$\ 8m#P SS4 $a$( @0@D`P !P :: H$ !1RQ rQS! $0SP P0h}!0 !P`1 D1L1D10S0" 0 AD@(CD(P@\ (00(( CT( (0 P < "< 8 R"8 4 R"4 0 R"0 , R", tH R" x*2&**= X2&RAh**c}**T* 0`( "4`#//$!,%+$#>ꡬꃬ00@-@MT[0Q@X0T L0LP  @  #Ѝ0@Q@*I*X2&0P @-#b 븩*X2&0@-Q 0@T0 R ||ÿM 0AS@ ЍH0H k"PNN( \#%**X2& %m4A-p@@P 0 0S( ` `ց `*EL0@-  Q4 0P ((/#  Ѝ,**_X2&@-0xP 00S@%*S` P@` 40P  $ 0 #Ѝp**X2&0@-@0S 0$P B5/x00SdPP 勑qpH0`P@˛4 0@$" Ѝ`**l**X2&p@-hPh@4S 0SP LL "H H0P0$000R0p 4+** 3*C*0s@-@0PS  40B3/p00S\0 pH0@P`ww4 0`$"YЍp`**l**RX2&p@-P,@P@pP @į \0p@-XP0SpH`@P P  堾*@pX*%*X2&1A-Pa0510pS :p@P 00PRP';P;"P   0"lt-"PT L0 "000@,AX**T**1&pҢ(*C-Mla! wU\ X! 000 @! jU 0A0 !08 !Q  0"Q!/!X. , LU ! 000 `  >U !8#`Rp000F"!t F!d00@ PIЍ8*2&*X2&p*/X*$AO-@`EM08aSP  <<x!80 @00T*0 ?o2Q03S 20S 2 T" ]!0S  Eߍ0S{ 0p0"06 0S 0"p! 0tP>!V- V V:   B B B0 0 v"p0H0S  0. 0P- (PO 0S; \7  B B B0 0 G!  B B B0 0 9@! V     V !p 00S  0@^k D 0S  V     V p p M\ &L x*2&d*]c"%h 2w 0P/00S V'%*P5 O-M M)$ `R P  50S@ލ Ѝ90dUY00@T ?L500RSM <50SI,9S' 5050%5N   嘼E唼床B 00 (4 S B@P$ʤ~zB@9S4 B.|\0  Bh@ T0 XV@30T9 49m  K ijlB 0弰 BPq(4 S Bo R  X3p H  2\JR(@93B0 05030Ȑs3303Ȑs0P 20S )`00-40 S 4|#R Q`SÝ\U J $ S4 }S  w1 )a#090)S )0d(PU <10S1$10S 0 X `y 0W0) B?W00pBS @!W<1<0 8pWJBIBE`FVU //4S 04(0 YB,I*C*h**:dX2&*<T&T- z~%X*d*2&,**hc"V**O-dCd5)SW0pW_R44y`u0SW  0PS9 S00P0S 0S 09 R V?o20SJUMU5D R4 pGW`pVp``\2 RD R: R; 4<ߺ820S>,P:a %+ }909909 Ѝ0 +"+R ! R | fEUY0+5p`PlP d<U T(P`e 0S X P,, :00 ?׌qp V00S |s0S 906;#;S X%tE\+|*X*%d*2&X2&0*G|*x* ^w**'0 O-RBM M@xWtPP P P Bލ ЍDW0S870S ,, 00P 70Si ] "4"42hwh w004488<<HHLLvvvxx||v9^EvEv:^EvE"4"42"4"42T%0A Z 0 0 8b"_"P30S` P [L 0  0#`00 0~20S  20S620S Pّ 0 Z 0 0 8""20S 0 0 m "`e00 0410S 403/  !TCZ00  0X10S00S 0 0 8_\00S  0 4\ 0 3/Z 4   0,c@긩*X2&x*\2&t*l**/ܭ%BJKhKm,*p**" PI`*0*hLM!1@-M(   0 !S= 1 1R 4S5 !4pq04\a0@P/ P0S  R+* SR-P- !0 010000 QP 0PT0 $M P ЍPB0P;C0P|80S050 000 @ 0@0 0긥**T**\|/A@-Mxc0S llhChS0S YWP0#00,p R03 r 0500K rP5"0C590C990C9000slP|n x岳0S \2d"`2Q09T09 <0S 420C90S 20tSN2"CC2 P4&& 0R0%S P  H ;#;S ;0``1 v0@%S ) <0+C? R 0 0B 0S D\P 00S )XI0STP=S 000Ѝx*2&r*%*5X2&*X*T**\*kT*Ih*H***= DWjd***-@-  |+ ЍЍ/X2&x07@-@0PS WP H0 < Ѝ0000S 0  Ѝ0@l*X2&x*2&|0p@-@PU 0P ]]D 0<jp000SP ^l*X2&x*72&p@-@T`P T0:p'P 0S 0@Pꠥ*p@-@PT0*pP 0S 0@TP@-@ 000 0  xl0 dT0 P< 0 <$0@ (  &*KT]fkq*p@-P@P @0 4 0D !0R3 p謥*zX2&p@-P` A00CS0\E@ T 00CS0RE P yTnTyDop0 @00  p0 0 Sꔥ*6 X2&-@- T j*L00S @P@0P`Ѝ@Ѝ/X2&|*6Rs@-`P@00S##P ]]0 iЍpR00S&P HHh0 XL00S8T4 0 `((Bl*X2&x* 2&@- @1 + %P   P  P ~ l $P vl L0\SX 4 P H@0T7X2&^FVh}9,0@-@MPPPP<  P$0$ $Ѝ0P*0@- M@ \0 00& W<A ۍp@-@0S g t00SPdP 0@00|| <p@04000Sp p@l*,X2&x*=2&A-/`1}@P@Dp/Ѝ/SpPP 0 00P0000S@-@0S  0S 0 000h00S@ pP## <@04/000S @&Kbl*,X2&x*2&@-@0S 0 000~d00S@ P 8@00,00S @l*,X2&x*2&@-@0S 0 000Pd00S@ Pƌ 8@00,00S @l*X2&x*2&C-0M.S4P@A`p0/SS 0 0U !           p  x|X  dv 00@ @;Ѝp* c"2:AHQZahA@-;qA-`Axp@P` P Pw;00 S00ЍU00*qp@-BMP` 0 @E CR V kPʤ0FS`0  BލpAS ᝅP0P S00@$P.;⮤*qA-P@`Ⴥ<0 Mp{W ;A*q@-/AP ; Q 0Sg P  P:0/PP `@u{PL 00t1 F0S6 0 00D10@0`aV 105 S:; S0*P 0P@0  0P 08 P 0 1Ѝp_S-S tA`00T H0P0;C*~$d9&B*X*,0@-CM@P0, . 0   CCߍ0K*@- @ R700*S[@-$M0h ` X %@PHpP$ЍPU D0P::V*qp@- M0P P@  ፄ4`  W S Ѝp[* -\M0 P  \Ѝ`Q -CM0(  Cߍ/hp 0`( "4`#/A-pPn0`V  @  0!Sp h 9 J0 `0T  d00 Do*Bp@-@PU U x 0<  $p@{ lP2&^P 7P P X/ //z-M M? )⢭ۍ Ѝ2&4`00CS`0X X0 X /1&C-pQDMDЍC{@p`hP !W200 u0002@0PS0C000@ Rp@T3 W+X( U U    ᦈ  G 0 .   ᖈ  ݈\ .01HH4p8(,p W2& *X*830@-P<0TMS @Q TЍ0@ 31Q 0"0CS0"GTЍ0@b !0S SL 4  h`"d0AS!0H 0S0TЍ0@蛛$    00P1P2P3P4P5PL0hP1 20345PfP# TЍ0@Zj@P=(<$; :9876 P8P1jS$  $}PPxtQ Q mjc^(Y x]TЍ0*  c" հ  % 7p4AN\ai:}`4 Aֲ JO-@RJP P P lu5vf-,MH 0#Q S3#: ,Ѝ P7@-  Q,XqP Ѝ0 v@P .3vPP ⁁P8*8*0@-@QPM (1a! 4aDaS@$0d@Oo@@e% e4eT! 0S01 P Q T%< ʨ @) ,pЍ0%(T h \ %T @ 0 P" $ @  8* t0@-Q `.@!@@QR  08* 8*0s@-@ `R  7*P.uP ,gp0S ,`p|Ѝpp0 !PU U H 04 Ѝp@#Ѝp@%8*8*@-@T T 4 0(  ЍЍ@/Ѝ@8*"!Q p@-P@ T p@<    p@ 0  p@ XQnO-TM0@0"00 p0 @@@$(@PP PP 40 @@P``^U〱@OTЍ`P0 EX y R@x   ;y0P eyP ,\100 0S0C000  Q,P 40p o0 0pi Qt tE l`00CS`0 X v 0@T:TЍOX0 X S%p1&@-00@ Ѝ@-0  8 ЍO-4 P@pa T00SP Ѝ -Q P P P ADPP@D`FRPP@-0@ 00 Ѝ@?@-P XX2&@-%3@-AMQ M`@0Vp0`(aT1T!TP L0P 0($10 yAލ ЍP00 ! !01 K ?t0> B !R 0G%t@P㲃6 6㩃<T0 <uG<@D@`0D0\  @ DDb(*N\Ȃbc"G{D*PV@-D*0@-6S (*.@- lifxcpdm/e@P\" <T_> 6@ 24a}, ,@b.d;8*ҊD*@-銃 CX2&@-0h@  0@ 0\Q0CS @Cd9&p@-@Pp00Sp8PU``p840#U :KXPp0P4P8P P AXPp`P -7@-@0 P0I  0P0S0! B Ѝ0@Ѝ/O-dM@`P 찟P U0E 0 S h dЍp | J ]  ^& !0t  @   0  ` .0 Y0B;P ὁd9&@-@`Pp@"!0# U 0 ph h32` P@TP,&P  Ѝ 6c"-,M⧂L0$0H00D00@0 0<0<  $$0 3<FPX2&-7@-釂`P`@ T@  R 0@   |000 Ѝ0@Ѝ/з%*qp@-PP@ 0S 0CS 23 0 0pvvp@X T 0 0 jj, ,Up0SpJ**z5A- (`p 0 pЍ P 1@P 0 PPpЍAp01Sd0d  0TTp2` 0 0S :`, FwP `*з%c"C-@qM10`Sq1SP1SgV1 V묁XV ЍCVU 1S  L1ЍCqV8:p0S* S S  ΀X HDH $V)ЍC   ⱀX   ⧀X  A` TT ЍCVЍ*з%2&vb` SV4 0Q 000/ *з%G-JMAM1SpQ=3q`0 FP c40 F0 {kpp 0 S JލЍ;X P0A7J. H00G1$L  $H`00P0 P}p"" Lp0S8i1!0 n*&C5A-pTQ`1S1S@1SFV1 S1SV AV1S 0A pV9S D@d0S VA,0  p%1S XQ 1S<A V*з%2&v\A-a M0T 1!0!sr 00 0-04 0*00 0"*ذdO-`bM0弐SP@ tpTp= ,p,0 apXЍ# [ [ H0S   0S@0 3poKpT 1S!1T p 0  T 1!0 00 0     !00 0d,, 0  000!008 0d, , 0 *0@-,M8p0P R/ !!GoP\,Ѝ@`@ @k~(0`0$$0FyvPз%*** G-XM`x@PQ% 0rS P @0  0{.0000x0  0P    RQ  XЍS @0  0P@* A-8Q夁X@`!1  0 0AP!pRS4V0 Q1SV AVS 0A nVp7TPDP@XU H+A 0%V*з%2&0@-P$M@0000 PPp$Ѝ0 R p -d0 0 1S40000 0*4O-XqM 080@ D @CT Ѝ0ZЍO>R`" 1!0 0 @@p Y PP 0 @@ p R Z dd 0T 0CS0<0( **p 0@-P,M@0 08 0 PPgp,Ѝ0 P  F-!! 0Q P0P8 08KQ(F A*з%>O9p@-`M@0 0( 0 ``#p<Ѝp R  -|P10 01SL0L 1S*KP Տ!*з%FO-DMhYp2 0S 0 00 (0bP (P(0 %"`P(` P@PDЍ`(Pv$PP ( $0 PPpDЍO5(` 0v ( 0C$ S  ,v%圡Ppv00Y0S Y 0I0p!0,8,p1!0< 0( (`(Pv ( {( V((0$ 000  00 0 000  00 0P$ 0 0$1SHR"<!!!! G*N%tVC-M⬀`` (p{W0P0 000 0aPPQ ЍPB@P. PP 0  PPp ЍC 0R $ +0W400(00 (P 0SQP v 0Pp~0!00(lP0Slp1S\`D0S U 0 $PN*t%0@-P,M@0080 PPp,Ѝ0 R  {+0 01SP zZj{e[fk0KZe[KK[K+Sy*O-MhrM 00`S@ aPTL  P"C+J@ z !Y:@0@ 0E 8p,oPٍЍ{  'p Yh  +{"QPX8% !*1 210T 1S1!T0 0*T 1!0 0*P6u 0 D^ @&u  0 DpM*з XO-JM┋ M`P@p u03<0u0`400c?c8000S0P0S@TK&1X0 + ;4 0@X욟4S ЪU08* <0: 00U0*:4 0@t:@#TRT 1S h x GRX:X1P pW00  4 g@( d03p0 ,ge,ce䩟 , Ze ,Ve봩倀  , Ne ,Je넩  ,p Betd ,>eT  ,@ 6eH4 ,2e$  , *e ,&e  ,e,eĨ  ,e,e딨  ,et,ed  ,PdlD,d4 , d@,dX $(0 p, d,d 'HQ ( zW`7$R [? 0WS; XQ;X PED0x4H0 1L00 1H`00 D0pMXL0 10@sX&4 0#Q0X00Cs 1SPlzX0@sEWG4 0BWPE X.- XO/HW48SpS㬥 ,Yd,갠Z 0 R(0 R ]P x 0 0 03AP8/$%00D0 Jލ ЍW@  RH 1H0 p"H0S# 0 0 @3SH  `8p$W"RY 0 000@P0@3A4/4pGWpp 0 0 @3SP1R 0) 403001P 0 p 0400 [*&#Y Hy0 S P40Sr 000   $ $ 0 `p8`0㛣#0S P   B ( P R0X0,( 0P$0 ,( w$0H0 Kp0?   H0 ;p0.;㨀H0 H0+ppx0 Sp HNpP H0 p1W 00H0 pH0 ppHp0pH#@P0P pH0 ppp H 0w*%T- c"= %* s*&/7AISWaa. hy8*ȴ з%O-qM쿟`=P`#h@P U#*0T?SD00c/pP0.0809p R  `1`STP`  v00 14Pv 0,@Py- &0S qߍU w 880U  0Sw0SpdrPYPLrP,U 4rP $rP040 rP040 rP rP040 rPy  r PU  jw 8 ẻ80U4`  0SYw0S 4wr P"U  Lw 8 80Up  k0S:w0S1!R00:q{OrP"UZ 080 Rn aBQ@IKKLGJ 5p  -MKIpv 8 ᚼ8 W   Rv R0!P  : <0<00140KS0J  X01S( 4PU U0H?o20SU0H?o20SU0H?o20X0S v 8 L8 W   Rv R0S*  %00140KS% 0400q'p4PU4KU* pov 8 8 W  R^v R `0  0140KS0 }LS01wXu40S(x  Kv 0H0l7X' aXg zXpp4wa,'0 @D@QP900.@8An 4@P8B`8 0V80 R@00@0Y-1 `0400<0,0@Npu  @c40$ 0@ 6@` 68 80 p@T1!0 d6d1",04 @1@S8 0 ut 0H0c?DpD0H @6p_HPp&0 SX ZYt-0E1 d! n`0D00 0``pu P1!0`1p00CS%$%1" = De@P qߍOtor4S 044(0 0,0c?0040(00p`000, 4 _p:X|,q RT=0`0DH Wp@P0=S t#8 R`  IpP 0=Sc <#8 R @_  ;pP 0=S #8 R  qߍOg( T W04@00, 0@WD@.0S T1S( mY-  pP PU- 7 0 0(00,00 03A5/00P9T" Yon(,p@\PW`0,S(P T'&t X(qpF t0"S t 0 SX0T R 00S+ S Sf FP00CsL " \0P LpT00 T0ppUXN0 &p000&00' T00.hpT0*з%Դ |8 $FY}]A)lzFa޴ GJfh) s%h%D$:\8*5s*0t0SK@@T T TC0P 0T00L @p5@0' @00& 00.0000h 0qP;\0 8p XO qߍOs0S\0 \P00p0 0000( , 0Jz@-s@  || lp \d LX <L ,@ 4 yX2&<Jit0p@-P@T`n P  p@4<p@Gs * @-M @ e P( " P9ۍXp@-IMM @`M P IލЍp +P0 0 phP 0S 0S0 0S  6PX,Q*@-M @  PDۍ00 R  PX*H-3MM p@[PPYW`8mP (mP  P 04mP00 S 6P P00 S * P2  t `P` \2P TmP ,ebPP00 U,00P`!0S?VX J1! PtJ P +J1! @dPp10S h 0m 0pzmPPPUX$ P(rU , 0 V, )1PnP`ZZE_oR 0@PPrU  4S J -P ӷp- hX0 PvnXy*>60 + X2&$lDO-MM@`;.@pBp P @ p @0T @0Z:: 0S yލЍ0 0TPP @P@(0HT*20Sa00!1Zp0V90 ZVP |qZ.@lP0 Z@V㟹 0Z ;P aqZ.h@ZoP UqZ.DZfP LqZ. |dedA*~$@-0` 0 0VPP 0 P@H|VP Ѝp@,sP IЍp<  O-@-lM8 400PPPXlЍB0P$0 $ =pP] U  ˶T T T;pTH0l4 0jL6H0P4PT 01H0@4@T 00SZHLZ 4T 0P00 0S0R0S,0 00 $0@` 00@TF*303 03030#L0P(׋$0@`P@(@pW6*00S 0dS0ktDᅄ p  0Xps  ;Ppk P X$mm0H02R 01j0BnS01080S 04 S? ?<0?@0,0S+ 0竸S相/H ?iL0 , JH 0i?H 0Di {D 00{'{(0 0(0<0P00@0@ Bn} 001 0P0Zp\?` 4 $;XJp J?  4!; `$;p P0 0L0k {0` X0{'{Hʟ 0oi 0Pii 0 lPUY@=lmmyDMn}n#*LVavzc"0SP0勤d400kS% Dp $0Ppp $;Xp~ 0@U 04$;`pr `0X PHɏ 0 i 0pi 000@U  0`h 00 0P(0S0fd0kSㅤ7 q 0Ppp3 4X`$;p) 0U 04`$; wp  " A"P00 L0@ A{ {'{ "HpǏ A"0PU  A {0 {'{h 0h 0 hL0 Y@c")/I@-n fX2&A-p@4`S  PT0DPEE$UX  jPV00iP V0-08 P (3MDPE@D* Xp@-P@Q0 0 piP@ R 0S Lo#Pp 8?Y4 00, 0p$a#p%X"++d+`+\+@-2800S ,0,0 p gx"+X"+*G-MTM0S0 DpW,Q44Q`@`$0 n_0A+<P 0  0]ۍЍ0 000nS ?S aS ppS qS|0 | @0h 090L0們@0 -"+"+X"+1&=+`9&1IA-X`0S L00S @P@@0p0pP00=+x"+"+"+T0@-@@J2@00So&,0, 0S00g&"+\"+|"++*RC-PtM` <ş< @ !Q RP ğE R`S Sgt`F0Q ğ ;   T-P ׇ Ä CR ` 0S $ L?l@4 \ P00 4ß@Qk [Q \Q< $Q  DR?` R @T$P \P" P!0 0^\0 1Np$@@$@ l  P\p\0H P 0 P p00$0 R  "DQ"00" t 0Q "F0S 0QX ]Q \QQ0 00DS000S+W`tЍp1A$^? l0HQ pppDW\Q> $Q" 傀ಀ 0R㜁F p1 B!$Q, ltH R' DY  DR R DRڵQ 1 00,Q ]Q 0 $R p0 Q,Q ]Q B + 0R0F p1 B!$Qd lXH R_ pppDW{  DRw RQ =d9&`9&++++X"+ Pp@-@@P@T -|@| |P|`0Sh徏d0 pXk@ P ,0< 8a$0@pp@p% X"+!r+d+)A-@Pp@0S0P0`x0 Rh m R0T @ 0S 4 P@` \+'+"+p%K+P@-,0 E+gP@-,0 9+, P@-,0 -+nP@- , 0 0 +X"++tP@- , 0 0 +X"++P@- v, 0 0 +X"+<+p@-PAM C0 0@00 0S0! -:P7 0S40=PP0 0T00aS` 0` 0R`T0 0 0@0S0@T@ @0Q0 00S0&CAލpP,P0 P @4  9P++++O-1M MP+<4 1ݍ ЍP $9P 4@@/ PZ30S cs؃ 4PPQ /3 ꠃ夓P0S0S `V~`30S5 0@P/ T300<3 0 %,3(3Q 0Q3@OoB0B&Q20S 2 ` 0gP0002`P0 0R R00 R K@P 42H"000 H22Q U1@OoB0% Qy10Su 1@#P0001@h, Bi0  AP0S0X9 ,`V pQ 0S 0S0 0@P+ 0! 000 00Q Q0@OoB0s%Q|00S h0 @ 0P000<0@`+=+ *\"+|"++"+++"+x"++G-JMMPp 70 0@00 0S! 8P+ 0S(0"<PP# T0  1 1 R0 0S0QW`5 p1 0Sd1dEP*L1 @JލЍP @ ! \8PJW#Pʡ0 i0S @$00 R000S0 0!'t0P0]4qp P0ST00@k++++X"+,++0 \ 0 0 0 0 Y+aN 0 0 0 0 N+aȂG-KMMP*x2 KލЍP\"7P H2@@@2000(rdP 2 0S@2壌- )P0 )qaЁ0S 0S 00 2@P -`1@0S p4PH1` %0PP 818!0001 0-0S P+ 0 0 000 T  P_oR ]&t0Q00S 0@0aP0 00d0@` +d=++q+X"+, *\"+|"++x+++\aȂ"+x"+0 @-PAMM `)0 !@PP0 ` pF :S p0 0pppp0+6PAލЍ0S 0 `T+X"+t+aȂ0 P /nCP@-)0$ 00 n0+X"+Pp@-o@P P `hP XP (pU ( P$0 0 BpnCX"+0 @- 0"++P@-((0 00S/0o+"+X"+0 @- 0" '++Pp@-0o0@PP  0S 0 E0S P (0 0pP@`P@ P a4P000 0+CX"+nR"+h"++10 @-Z 0~"++0 @-P 04'++@-(@(0 E 00S0  "+++0 @-5 0"++P00P0SA- /(0 !0ЍPAaq0S000+0S 0S1000PPP00P ,Q7`0H 0H<\04F +"+'+X"+nC*"+0 @- 0 "++0 @- 0)"++P00P0Sp@- '0 0pP`P@<P# 70P 30P xl00?o2`SP@8 8 <00S000+X"+nCE'+ '+_P00P0S@- u'0 ЍP A5P 0~Pd00}S`00S T0T0HlP80 0 00( 0+y"+X"++++p@-0PP00008@Ppp hDp@JP p@#'1@0@ 0S 0y00+<'+X"++P00P0S@- 'P0 ЍP8 4P 0  P0 + +@- P&D1 ЍpP,! 4P 1@@*P0 P` /@Px*0@0 S0 0S P xPl0  Q0S P0 @ 0nP000$0@+d=+ *x"+ +"+@-P&0 ЍP 0Sx H4P 0S0TP0@|P00 ( 04P+%-+C-@`ppPH_oR``P=10S|1| ЍCThaP83&\1 ЍH5U@ 000 (1"T:pX@(PPQ 0RP_p0}5|0 @0OT o`0`P`TT TU@T T7@P \P(0  ЍC+X"+?5+pȂrbdl:_<x@-$MP%2 $ЍPN0S!3P 0 1C`P 00|S 7P zP 0t `l1@h@P) PP 8Q@a@0S 00CS0S :)0 0 S  G3P0 0T0000 \!"Q|00S p0 p 0$0P00D0p@+px=+ *|"+dN:Ȃ_<x"+"+p@-PPMM-%@p1@ۍЍp(`)H@PC@@T( RA/P@;]+PN00S `孇00CS0 U000 0)1p0  0 1rP(t@$+k,'+X"+l"+x0@-M0P 0$`1 Ѝ0PH! 200CS0(P@.0S0P PP P@] bT0S0 @ʴq @P @Ps] bU |0|$T0S 0L @\] jb00 C,+X"+|"+p@-0p@P0 p@P$\0\`0XPS 0S/0S0p@ $00p+++X"+7p@-0`@P0 p@*$L`LP0S.0Sp@(Ɇ x00p++X"+MP00P0S@- $0 ЍP 1P 0hPL00}SH00S <0<哆00P 0 +b"+X"+q+P00P0S@- #0 ЍP 1P 0hPL00}SH00S <0<X00P 0 +b"+X"++@-MMP`+ M@pET` P.+ >MW,+ 8M@0 ۍЍX +@-Pk#@0 ЍP( 71P  +c"@-PP#@0 ЍP( 1P  +@-P5#t0 ЍP 0SP 0P 0S0,8 0P+ SPp@-#@0 p4@0PP0 Pp+"+&0@Sp@-"@0 p4@0PP0 Pp+"+4>Pp@-"@0 p4@0PP0 Pp+"+KPQoP@- "(0 00S@++|"+XQoP@- "H0 <@0S p0S +|"+@-0P@-000P0S }"P0 ЍP@ 4Z@P@$][ k`+]p@- M P]"1 ЍpP! )0P 0"p`1`0S@1D0 0S 1( mP%P0 0S 0@T 0˄%`M@P [ d@ F0@ K0 @ 0@3/H0T 00S00%+X"+f{*T |"+}+t+0 @- 0++0 @- 00'++PA-PPPPU㈀ !00Ppp@h0hPg00P0` 00KT,0PA K++X"+++P7@-A P000?00 Ѝ0P!0P%0SʰP 0 00P00S@ 0 S  @P@00\+ZK0 S +<SK4 5/P++X"+l"+\"+++P@-0oP F!0 0@P P pPX0H P@<00Q$@ 4,0"++nCy"+X"+000 0@-S$000 0 "+"+-+"+000 0@-S$000 0 "+"+?+"+p@-@Pp@0 @- 0Q++0 @- 0^++PG-uR@Pp]P\T- ,`PgTP( ,@PP_s$o$U; W P10S- D1D!0@@ S 4! ,P`KU1`1@W 00S 0 0 S   3$ 0$l0`h0@P`pP `P PP Y Ѝ"+"+"+CX"+n"+"+mlt @-r0+P@-> |0 pRP \00}ST00S H0Hւ@BP40 , 00$ 0+"+X"++++P00P0Ss@- 0 Ѝp0` 0S P@P 0Q R   LK 0Ѝp@菂$Ѝp@>++X"+,+8SPp@-(0 p@0P0Pp+"+A-P0 "0Ѝr0S2]P70S10S 1Oa0@ ` I0封S Cc!!b"  A   c# P0U0C00CS0<\w P?00CS0@8n P7,! I-PS0`p00 P0 b" R  c&0P UR PE 00P0 0 Sp(0L0 0 S+H(+X"+"+T<+T<+T,+1& P00P00@-SM  0 0Ѝ0Pl  ,P 0(qpP@ 0 $0$[U@00+X"+LP00P00@-SM 0 0Ѝ0P ,P 0(qp L0@0P a)4 0%0S 0000+X"+UP@-$0 P+[`@- (0@P0 @ȂX"+hP00P0SA-쀟 00ЍP Y,P 0/`P PPP 0RPaW@^W@@- pUH HH H00zx+rbd P00P0O-SM  C0 ЍP  ,P [ @P@ 0R@Wp`-|0 `@P0H0 Р00000@@0 ++rbd++"+\aPp@- 0 0p`@P|P wP rP@)p0 ` S P6@@ @00 0()0+|' X"+$'+('+A-p`P@Pd0 `AP 008-4 RU0 AX"+"+@- PP   R Ѝ@P   HR  @0S00 Ѝ@`p+и%X"+c"A-0p`P0 AgPPp@P @AP {00 00+X"+%Pp@-GL0 p@00S40p@,(@0P 0NPp++X"+6"+c0@Sp@-'d0 pX00SL0p@D@@0PP0,,Pp'++X"+h"+ @Rp@-l0 p` RT0p@LH@ PP0 ,Pp ++X"+"+O-MMPPQ 3 ٍЍPʴ#EE*P 3cp@Y 3  W`P@T)F0㓄(p @0S (30@ @c0S000 p`J202`0S@$S \S00@# 0!|"  0 #" @00B   BR 0 F )bGF0 EU`0S@iR0@S 0 F)b3F01U`P1~h1 0S x10SL1h`10S ,0~00CS0.  E F0 03/00S 0S 000CS0 S0  )tEt00000h0 Y 0pS7 +H(+T<+X"+3}+d9&p"+f{|"+"+t"+"+@-@P 00P 00P00p0- lM \X00S ZH d0 P000p ["+x"+JX"+*-lM<T00S ZD d0 P,00p ;x"+dX"+*A-@P p0 0C0S13ST `FP@ 0 B RQ@  0 0C0S13p@-@`P:WJP , 0S!PR |,pp@,*`(P %;JP008 ,8S!0R~p@-@P &00PU S XPp00p@-@0`PP<p0 =.0St  h0 Sݟ Ѝ00S 0C @P2'+P/0S/0@-@Q0%Q#0S P   R   07W0C2007W  Bd9&G-pP(P SR@  FPP0   EPN0 0010S / }IPe )`@tIP 0PS(2  `P):`eIP P)P :WIPP000S`UK Ν0S 00S1 @RđRp0 '\ EP0 0 U ))) 0 011 .Ѝ @Pe) `C 0S000v) 0S S St0 0S 0`S@d)H0PU [),P'+"+ "+c" - BR0 R  P R O-M M@t PE$@*EP0DHLP0($0,4D (00,0DHL` 0p 0S 0S X 0Sသ@DDHL`0$(0 0,0`ލ ЍP0V0 0S ;Q@P `P T߿P DڿP4T, O000S V PU@ /aQV@0S CP @0U0C?o20S b4pWp 00C00p0Tp pW HCpPpUP 0S C0P00$ 0R 0.00XE+ BZ0048<03 0 )3 t30S6Zl#l W(@G0P0 $3@@L(:G@0P 0 @@(00 @`i `00PPy P00@tPS 2(P Y0@ 0'T00STeU 0S} W +XmB+X5B+X1BXP+ `B!0 0p4P80L YA+ P0NBE>00002P1@@DcT@@/gG0P  00T+ 0.B 08 04@ 0R 0S10}Sz0S @0S 0S@0P/?PP0Y80<0 @3'/7?l "+|"+'+"+˷+t"+"+q+X2&"+O-jMM@pTltQx|Vύ<84PLH0 !0PP0A6M00 )p7 4A9'H86'0S倜l0sp0st0sx0s0S|0s |[&X>0S0 /OP&&>0S 00SU o 0 0 .=0S |pP' Ui=- <)0S L!){P$.4?4O0 0 )00 LQ /t>0S->@ PR(  @,0 R`\QP<0Y 00|SU pk0St<0Gh Z N T+> = f$l,@ <`0S00  U ;+ 0S 00S 0Pz 0Sw (&pOY`P` 0S :NPSvOX :H B`PW ᛻`0SU 0S[ ,0 0 P#P %~EP  0h![/0d1`1\10A?W/p h10\1S 0S dAT! 0S @PP 0 @Wh0 0 J͙0S 00S P `B%dMNWMύ004!$ 8!0 @!0R ePP0000T\900101$0e/U[`P V?U?00 $ P|P|0S0 $l[U@`PTt  p 0m_0pP8/"PP90S PPhm/ظ@L(P?D ?00S m?/90 S00?o2#PP0 P70S P 0S%P 1S %d7dGpVTO@P3D)@]?87007P 00@T LN ZSP v00@T =N KSP g00PR ~ZP`|tFtP<`|Z'(P<60S'`@T)'+QoV)^$%d9&' * 9 C gV      u    0 1P c  "+  NF Ȃ P  M  ('+1 S f x   +"+@B*  "+"+X"+ +"++"+P 0, uT09QTuP 010Su@P "``P pP P000P P P  "|P40S S WO $40K/CR032 V 0S` !0 0t W5V6ZO Z0 $@"2S"42Q0SM?0!80p2 SMN24 DᵷᲷ0SF20? {u00P 00Sxy43 r|00 P 00S% 30S003u 0st3 @ Q P <mD0S30dslpxxt4 Rlʘ4$KOt4R P N4DP! 44`t0Əs t0t0@T> U   %PDOQ0 0 A 2 R@x BQ0"0C?o2? ;Q ""0A0q0 S ;S0 MLP 0 R RT 0SB0S(0? &"( ,0 R /  T /͡@!͡p0P q"@RD á 0#PP#PP0S0S60S#@P $头'P000/ R0HL0$/0 pwx'x\ X+X\ pd `P`d P #P U  R80S 70S7wP $B0S @DTX80S dX~`0 0S( PZ0S= S E#_8 8`00S0T0S@ sPr I  $P( , pKP8 Uc eH90Se@9 Q `h) Q0x9 )U9#$A 9R.sr . 0A3/@2p:@V  (: R0 @:QP:Cp*p0 0 S )lX'p T&tP%xL$"0S,: 0R.MRuAs0S 囵000S 唵000S 卵000S 况00jލЍ0S 03/0S t00s@- P@;P  ;P0P QЍpΏ`P  ;P 0 FUpKP Ѝp@w 0S S0S $ ;0PP @-M0h 007P P10S 0S00 0 Ѝ(  qQa @T0 S 00S 0s  0 :>P 0 S000Bp@T h(JP 0|S Դ00 0S00 0000D'+|"+H *'+"+pA- M@`p 900000@PzH0P/S:S XqH@ᠴ Pf9D .9p$0 \9/@G@P/:GpP h@~P z Ѝ@/000p0 @@PWp@00l0@@DcT@@0*0@0CcS1S@ +PP00/@-`N,0 @  000UN@"+*@-ONx0 @ d00S X0X0 p <0000S $1N@"+x"+X"+*@-(N@`00S T0T0 p 8 10 10S  N@x"+X"+*l0 @- cX00S L0L0 p i00 101000"+x"+X"+*=+`0- lM@ >Dd }8800 p D6"+< X"+,*0-@lM@! 00 00 0rS sS phd Q8\d 8P00 p 0(d "+=+*+w h  X"+,*q @-`PP@ 0@s8#80@U 0s8#8000@(B(2b!! -P VU 0A0T0Ѝp00CS0 S0 S 0 /O-TMxp|W0ʿ0? p00p 09M0`P0V0W B@ 0 @040SD H 8PZ0S= S Dh0 S00 @P( M0S M0#S M|0Sp `1 R R 0Ha# w>Ltp uTЍ ? 000 $@0 HPPL0S L0#S@DT|0S ld@"\?>$0V 0 `{#M"00 "@B"+X"+O-BM MdEP`P$P QH?0a>0 PPP0p5(`p5P<$; P@+40S5V $ 0D  =0XD S00H00S+(7 0S 0 S     R  T!$PP$p 0 L=@P$p 0tp8|# ap0pSS 00   00Bލ ЍH3@@q30S VW@@c3! =2 0c `W T 20S 5V  R x" R " R W WSl2l <202fW D2000 !00D 1#0U10S CdPRPU [ 1000P T)T 00P0 0 PS@405U dU(T  P W-T 0S1  00 0B>V0`X@40S10S (3/1V0     0QR\@\0 RZ P :/ 10 YS P 9/0F4*Ȃ d +'+P(+"+'+X"+T(+L(+t,'+X ++ d9&"+-A-` @T 0 ЍAЍ/p00$  Pxqn<l0 h -Foa0S@ P 5/iL(+ +*Ȃ ,'+XO-FMs M`@ ( @I I I0$0`30(0$ 0H,@P0P SJʲ0 ႐3 Fލ ЍP0 @,Q(V52@@Ȳ@aGT  d2  P 0 PD0P|2d EP `"`d35T /50S 00S ,, 0d  ePP dB@0S00?o 22P aI06OP6D01@ @$p  h41  D0(66S0d000 d0Aa0PS P P |00S t0 |0(nP@0H @00h,@0?(+"+ ++"+˷X"+i{8+# P(+ȂL(+W k O-JMGMsn0p0얟VXv600S00p }9 P啭X6   t60 9PL僭JލЍ860 00$0 p97S 60SZ6l50S# 䵟0S5 Q U 5R "P 0S 500CS\5|l00l=0S P97S( 5D 58%8q0SX0$000(00000 PL 40000Z40܀C XSX P4`0(  $   dT CP 4L!>\ 0h0d<` ((0#$0$c# $c4"($ <7 $ &R 3^0 R0S R3)0( 408'0P30S@97S00000 0S  0 p呬n008'PP2 0 0080I t0  \G spd 087NPDc 97R^ Ś 0S [R0sO0010S ;70:70?70>7='<@P0S0,< 00 00,x1 eCP!1 R  D 0 0ZP 0S 0097S|0 M0S [[}X  S[00000IQ*"+"+4'+8+}  '+"+X"+ "+|"+"+'+"+ +   T(+0*AS0+ 9Yp 2@-`pBWLM LЍ@Q pP=  p7 00011 0S<0 |q?!((00 Q 00SZ=9Q ='/@#b?!"/}p G0S G0#S 傫PmZ00+0(60 8Rpp G0S G0#S @ p2p 90S0 000 0ILЍ"+"+'+Mb*A-0H`D0 82V p R R B`R RB`b2 Q  ,100EoE?AA?R1 $!$! 1 (!(! t1 ,!,! d1 0!0! T1 4!4! D1 8!8! 41 "+K@-GM +$ @_+ 00+(0,00040E@PL0;@@P@;00; 00=oDD0S>;0SV 080< @ `+ RD00S0H H07P8KN4,41S<$]=P $00|S $P$/ ;@(B0SR $B0 SN $ ): 01RS 41S $00-S0S h: dP:$ PD0S $ GߍR0S : <0sX@0sYIP0080SS00SWx9 t9 X9T00$0S|  T$p FT/00PT90S A0 S$P$A0 S$P$80SD8Q0SPPP=D0S!0S' [+|80S El(P  7P($80sS2(8  9Pw00S  .Pl[000StCP 7 87 R0YKV41SC$4f<P!t7(064! 6 (0p(0Hp 0: S &00&07 R,7'>$00|S @$U((0S$ؤ$64! 6 680$ '((0S6$|x6R P Ŧ06TFP e460SP |50S h50SH5P50S~ 0CS0D0S 5  (p(w6Q$判00%p00(0q(0d5P001!VPL@0 SE|480S 80(3/0(000L0S$4 SDQ  40S 8 4R5 qp `Q%$'`0x0pu3X@$Pj 4 0oi 'P$ !D0S s0 0 @( 0@ P` (T000 0PwsZ,pq P @`@#10 ? 0!%%P0 0 040  P@H0S@ (, pU@000@ ?400?0 SE1(00@N ?,00(00@T!000t 04p@ TL08a0L0 TUA @(, p%P1 R0#Mlz@L `Tc@ 00S 0A<@ (0S 80(3/0"+Z+"++"+\"+\"+0'+,*,'+ p"+X"++"+ = +^\+X`+++ 2&('+ p B#ȂF ++"+o | /0bX"+ QoP@-X@ P0  P 0 @ P(++@-@>0 .ЍQ p@-P,@P@pIP @и%@-P@PDP09 $0R  8 P+OpjT+@-P@PDP0 $0R   P+c"X+0P |@- P@T Wp`W VL\ P  R/ %G-@pM`t9T oTP ЍGFT8,,a,1 (!Q   Q@P| ЍG 8S 0S P pP  0 u@DTЍPx 0 X0   ( 03/ , V-P+ %8 $R!R(R3 R (8 0 Q Q QG (-R ( R (8 "^'  ^ ,QQ(88S08 S08 ( ( 0!R/\^^00^ "^0 00Q8/8S08 S08/P+Ŀ%p@-H@H0 (8@08080$8P  Up$80P+}+=+@-A(8S a0 S &/0) P p p $8S 80pP\ UP 0S ,8S0` (8S 00CS0 0 `0 08' 8$ 0`3/48S 0S 00CS0 S0  P0R H@ ЍpP+im}+1&f{t H P/@-@P(aP Zv@-@@0s,00p T0Coȿ%X"+|4|$0 O-0-KM0* X 0 P 0 0SZP=9 =: k{}`[0 A8  P@ n Ak QP@0K03 3#(p  `#0{t吺[` X 08#S$  f(#`  0S f"`< < 0"f~0` U  S  RS"01 0;f#;Z0S;#;0 d ,@"?;#;0#5 ;0?;#;0@#5;DEM0S@X `U0TQ1QM!0 P EP A Ak{H{7{ZRT!`dYP e! 0P<w<@e; 0 0 0S@ P0S S d @ d0S x00p T.A"+"++"+c"V+Q ++!X"+KߍP@%U[0DE>@-;X0 R0@D00S 8080 p ;@"+x"+X"+-?$M0 0 $Ѝ-4M0 00 000i;P4ЍO-p-MM(EUT " pK4 0 P0 PU0( RPU4d" R 0*Pğ^ $0S 0s\0S &P 40,40S` $1*` $S 06 Z{0 A(# A0f{{zdWdp0 3 3R - B`P  4 BRڒ`\"B 0P# f@#2`4ß 0 R#3SPSs01000 "f0 $` P(0 0SZP=9 =:k{dD2 AP09 A k Q 5 P;!%#3[QO  d 0@!0f !1`P0F|1p fR P 1*!3^4?^03V:t!P00q`100 p ݾ,R0S "%+0!iU< G`0Sf ?`0 0p MߍY@.A+"+'+"++ h+X+c+Qc"$ j t-X"+D'++@~ 0P P0  AL0 A k{I{7{ZUw[0P  pgP<K<`0  ۿ`  տ@-9@Q9@p@-Bd00` pd00CS00hp ,P P00 @R0S"P7Qd`d00CS0*Rp "P \Pd00CS0Ep000S8A PA p0 0 `V>p0 Pc`d00CS0p 0@S P,P \Pd00CS0p `V0 0 p4Pp@+̿%+A-@lp`|P@ .)PP r@P PE m%P@OoB@+O-$UmM0S p>EPd 90S ؜mߍm0.1dPP0͵(4P(0P/S SUpF Pd4P PP P4$0CS0p- P P  P0 PsdL3P P 3P d0p þP 0? ld~hb~dp P 0S d0p P0? D~p P 0S0S dg0 P P d00CS0p`2`[ P Q82<0 0 dAQ 00 p1@S P0S!   Cb"c!   c# 0`S<1Td00CS0p0 dL\00 p P`, ^0!S^0C0 h}P\\ "++T<+c"+ (ZX"+d9&T,+T<+\"+H(+0@- @0SP  #P 0  00@|0  p۞PX0 PҞP40  0ɞP0  d9&+!-00CS0 S0 S 0 /1A-0aS0P0/P3U "P 00.S Pl`1h_`L #T1@P H, #P0T0!0!00(1   !U 0!>A0p000 00000P0 0p0S0000PTl0l0  @U x4 2P$0`[Z'+"+2X(+T(+X"+7T\"+z++`+gd+)+"+c Ydp@-@P 9| 00t 00l lP0h @Q0T0 L0P@D0@ 80@0S, 0pL(+|"++++'+"+"+"+\"+H(+P0 @- <00S 0000 p "+x"+X"+D'+A-@6Qp0S `0S p H00`P>$00000S t`0S p )0000<0uT $ Q6p|"+L(+"++O-`"AM |2 MR0pB h" R S4 P 04 SP 4SPP004Aލ Ѝ$Rg1+ ;004P/S + +{ Pҙꌡ宺pV0們p| 00g000000000S H1ov810Z 1 R100CcSppW000S 0oY 000000ⴻ$RV00v{D}{PP T{ |%P00=+"+x+|"+&+ "++"+\"+Ȃ:N+T(+A-@Q0qS0`00S Q`Ѝ0XEP C%P {0 R 0000@ Pl00}S0s00T 0S$@,X '+"++X"+HT(+d9&+O-4M聟a0AS000qSP Q 1X4ЍPF $.P00l$P00X.P"LD $0P$4A(!0200 000@, 3.P 0 @ P 0$0Dqp00P0}S0s00U 0S(@8'X F'+"+++X"+PyX(+T(+0( (2@-BP+A-`Pɛ`pśT @P @ @P, @㱛A[u@-@P+0 A- 0p0@S0`P07밀P" 4$P 0S 0"S 0S R00`P"S0"S 000ꜽ+'+"+++T(+0@-M M P  @O/Pۍ Ѝ0Pl4/S- @ '/P;0@TP/P= O-@`pPV1@@P`3:.`E.0టP Y/  0-PT@1SZ 0 10S 0*W0 R Ed-0S*00 080 Ѝ+X"+@-3P0P0 @p pP0 0SP0 03@ЍX"+ht@+P  R @- Rx000 0R/`0000/0S < S0C00S/ S/0C"+"+"+"+0@-0 00 R0S R 0Sh0000S b0C("( R@ S0 Ѝ d9&`9& @-`$A0S0 0 0 0!0p 0S:S50P0S0 0 00 0ڸpS0S:S5000l d0TøpTÖ000 $0$᷸p(巖Ѝp('+$'+8C-@㌐pA\`\P ^T1:00"\ \ L 9̠^@2\\WO-`p@A R %R Z0  0 @PcUF 0/U-UA%U  GR0%R0PMU30S2 2"0S0mPE C_o0RGQ .Q\P0mU nU|2G0Sx2l" 0 BQ P082 R 8cU.U00  0" R10S /S0S  0R 01B^0 B A R : ^^/XR \/ B/o" RQ00S 0GSE.U GT]*0SPY*0SPU*@PL0G RS QK 0TE*0/S@*0< QS8*09S2*+0S-*> @ S'*000GS0P#0!|"+p++c"++/A-p`P @zwP0  T  `00T  C+0@ R   `FVp`00CS0 X6 PpTD000`000 T00Uc1&uC-Pp`+0崐@TT r 00)a@x0@P`0 \aL0L 0 P 0 Ѝ}+?X"+1&t"+p"+O-M M@ P<` 00\ <3  P`*,P #\ 30S)  PQ PUP Ͷp10F.@00002,P x"xF0F@h弔ލ Ѝ ኵpp80\ 0嬔 }p \⡔020(PS @ ᨶ(0, 0/(0, fpQ00$S,F␡0I00S 勶0h$Q000SZ=9Q =*/@#b?!"/E )p400S 00#S [00AS  \0 0 PE0 0P?p 0S l00i0 0 psP0\ |PY0<00˷8'+ap '+Mb9dp@-@Pp@ִp@-@`00CS0pP0 @ -00S0`00%00#S V 000p0 PA-p@`pP0 @ 00S0`00/0#S V /00p@-@PP`+P < +Pp0Sp᭓p H >@-@ZP b@-rP@-@.rp P@-P@-0lMPQ@00 00 T  40S P l00 P c0 0c 0 ^PrCcpWX 30S )@)@@ ` L  P 4p`&P@ 0S @P@ ( -  P@( -T0S @P@q( -0SHLt0S 8 0-00$0P XP0 2 2 PP ۔00 @T ( - P ̔0 0@T ( -P lЍ`]DP@z( -T1 1@T1 W0P`V)PP)X000* 00 0P@T|Q PjP'+@'+X"+"+A}>#1&5+2+\"+|"+H(+T<+ }+p"+t"+++7@-P)1 Ѝ0Q0S 1 1yPʐ! 0 CRtA R Sd10R L1P 0S4S(1 0MP 0S 10S 0 0B@ @0@0 @0 @0 @0 @0 00S 0 S+|"++KX"+g"+"+'+v"+"+, d+`+\+++++<+8+4++"+00S!@-0M@, ,0 P0S8sH@0Ѝ0@>"+-A-! %_!3O-PM 〣@ptl`l`'`#P3P {UPE!㽋,cP00CS0'p 00R0S kP18C8S9 P%cP22l18C8S  HJx0 PP 1 P8C8S  P < P^S,18C8S / P 0 S 18C8S <18C8S ݭl18C8S 00 l1  \1/ R L9 U 118C8S WpG(,P`&<18C8S0 㵫 ЍS R   RMP0 UA 0QDDP+t+o $+`++%t+ l+ +m!X++! p@-BMd,@P4P1 Hr&&,! 1  に PP9`1 PP8` 1!%0@-MMP iP(@T?o2P0S ۍЍ0@6P55-d d;PPTۍЍ0@D 5 ᕪ4  ۍЍ0+5"+=""V"b"p@- llP ,@PpTT士Pp@8@ժ %l+'X2&A$ I-&&&' %'Y'' @-亲+@-@M h6" \0P0 H00@10S &" 10S0S@Ѝ′P  00S0@P@0 00S0S 00kP0P@0 S0900 h!P1 + +x+t+X t A-U`V7P@@Pxxpl%0P /Q4 yP {pP@uDN8e0S+ ,5 $5 @5 5 5 R- 5+ 400000@T ,P004@Ѝ0400/S@lP w w w ϥTgHg@ 0Su{Qt0S |p=0#|sp#;00S: x`P`|` R  V \3Q 30Sx l: x$c\3P0S 2Q P o2: @xP2  : xP2 l!: xP2  : xP2  : xPx2 !: xtPX2 ,!: xXP82 <r> 04Ѝ0+%@-`0S@ PG0S 0000q20\@+[) 0s@-l000Ph@` R R l  R  R@4v03/ЍpQ P%+D%XA-` q QAT 0SP Є @P0000 0P P0 P0 xP hh ߥ\R0L@L  "  \ %+*> i)X2&%y+00@-18C8S 0P ㎢%+(0( @-0@ &`++X+p@-BM` P@0 S`0018C8ST01y0 ឥ0Pn00x0 ޢBߍpB/ BR 000P y0001X+%N+`+ 0?o2 0/%H-AM M0r0$0P0000000@00 ỢPڶ0 ȑ ᮢP0SS WS BS 0 +អP  Tcp0S | 1 0S0Y` [18C8S ؠ0S Q      |P Y 0@^S00CS00 S00 P0SLP+PA t++ +%+p@-PH@P@pP P P @% 0/@-韢o/A-@PP p 00CS0 `V PP>yP0 P00XA/ 0S P0000 !0S0R 00 6*D E*A-`AP0E!Sq p0!00CPPSJ0`00CS`0p S X0 X 0P"SP, 㵤0SP`0P0CS`0p SX0 X ! dX!㚤\0 0P0 P000P pPH0"S00PA/<=0 0P0 +1&L 2&XR*h@-0S S S \S ^S R@ B0 000 C@T0 0 B@T1 0 B\10 P P0 Z*A-@tP0 =`P`T PP2 00pPF 0P :5V @P  @0S@0Sؼ.00@yPP? P PPP P 0!SP咢l+h%Ze*p@-M@PP\1   D@P`u00u0ۍp0 x P 0@ 0000S X a  P00 f0 aPL%|*+*p@-`@;PP 0 4Up(PY@pZ7@-@P 9 ء R ѡ ͡@T| Ѝ0(R( d:0Pu P @Op P ,Kk P t+k+f@xt yt o++0@-M@@0(@,0 0 x@P  Ѝ00,x0  PPPP0S 00@SPN +%t+@-鲡(,[++@- @] W媀mP 墀 壟0P3P x剡t凡h 9\ 㐟ㆀ ,徟Ѝt+xt yt ++++f@ ,p@-0M`5PPT 1<18C8S |YxAx}  0 9 0W@ X4R,P( P0F, Rz E A;P 71P` 00(0S q=R 00FS0xh P0Ѝp\XTP D%,t+2&,h",',++T c -,8,G,T,0@- @6t+h-@-Àc-@-廀0 R   ЍЍ/+-@-`0 R   ЍЍ/+A-ARp`P@1T ἞pPJ`@DO-dM @P$}0P 0}0P0 0 880 0(P40P0p`,@@0,@ T R3 U&T ( 0 (d(0啞p ` Z0 000,@ @0_oR,@ 0T ZPPU <v 04 JR (0 R 0S0b 0S  dЍT3 ` 0@D(0,@OG00(0 RR `:0@D(0,@(0 R40@D(0,@x(0@Dp(0,@pWm( pG  (0@Dp(0,@`(0@D t(0,@XWT Q ( Q @D( ,@I F ( Q p >W : "80(+PP (d, R 8 %Q  R P`(2c8@Ht  F  $P T0`000S(2 0(408 TU (0 $(,Q@D0T,@(0UT(0 $(,Qt0(00@DS,@Ts,,,Z ,,+,--#-i 9-K-]-s------.O-lM($8|`5|PVPP*8@ 0[|  0<0hh2 @0`2 @0P 00D@P 8%@P &FPp@0S$("P @ I~G~[ lЍH<`@40S((  Px  , E, 0P¯4 p0>P00>P<  B,$( ( ,0pRQ @(S<`@ 0zCP%<0%800%4000 0'<0'800'40` 00 $ P$@s,} %-1. E.T.f.C-pᐑM00PS@ t*`0` 00 qp@  o?sp _@`0 P1009 pppppW0@ @ Q@Op`6t0` }>=?@` 壝00 S @.  C< 8嫞0ЍC0 %w.....2&B0 A-MpᙝP`ЍAQ}0@: SPPT@z`P00S 00 0hQTP1 p P PU0DsLS<(    k=+...O-]M0 M-SPPP50S ]ލ ЍOv/f]ލ Ѝ@pP$ 00S0W0S 0S ` zpP  @pxz0* R` D RP {PP0fu ᇛ`P W0v: S+ pi h3 P@`P|3h} KBP ph ` 0 0P900 0R  0S0S` - 'P``5v `0S 0 3P |V P `z{ R O<MRK pP Z bP w!1Z[  0 -.*Y˚p`l: 0S'HQv00x!0 ! P: b  0S- ᪚pP  fW ]ލ ЍO{P-Bᩚ 0Sᤚp{P P : R S00 R0S yPPhSX}+ %=/(/ܴ:/f/,H/ t//////901&U0^00 R R /0@-0S0R @ PaPLU APLU @P AC\ 0T000@- @P@@  wP JGP00S D00S 80 -G!iOXg+,L+$%@-Hd@-zPp@-P @|p 000/ +p@-P@0-S@@p GP0Tpp0p@-@0@MS`P0 @ 5 TP@ЍpPU P$ z00PP% +m1 @-@P @-00S@1  +p@-@PPp00Spp@~  +A-p `P@P000 P P0 0Kc"@-@P P0P00S@  +p@-``MPU> 0S; TP2 @@?T/  `00 @ C @ F00 *S 0 000?0`?SXP10FE>QP `Ѝp}1 0@-$M8P0S 0@g@$Ѝ0P%0 0/ +0 R +A-@0QS`0@S` p098p QP@@qp00P00S 0&)ņ(\^# ;#;0bQT |` 0X R p 009 00R0II( ,0@P+,,@-P X00S S9 (,0 @ T P+p0@-@TI0 qp0@ @}01pP+,,p0@-^ 9 @ 0@&)60 P@ ^@TP+0 R& 0@-00S0C(0,S0@ 0S!‚"\0PQU00000@/P+P0001S0 0/\%7@-P R I0 00# Ѝ00R 0@!"0@@qp Ѝ0@`?P+ 30@- 00qp Ѝ80098<@ q|/ 00\ /P+A-`p PP"@ 9 @0@  P09   \ 09 r`A+P+@@A-p`VY@  @ @ 0 qP0 0y0 `T  00q0@A& P++0P /P+\ -P0S0@  / P2:1S0BS /C-@4QM`@|@0S1UA:ЍbS9 .S8 00C S 0  ? "OP >cS@U:>0@0CS000 000C/  0?NP @@@\+\+3,3p@-@P 0SP`pPQ 9P@dPQVPB>h(P0S  p Pd%%D3A-PP`p@ 01S E*0S  R@ *Sn#0S 0Sn0*S0S sS0 dS0 k0C?o21@0@ 0C^S0SP@u0C?o2\+@-TMqL@D N@N<N8NTr,3,!4!!!8!!` ,H,x,X, 0,,% ::p):D:+o:|:::9c":,::+:::+:%; +t,+H+,+U@  U !UQ0-UQ00  \@0#0P2 PR 0 a0CS00 0-P  | 00P= 0Sa0@S @P000S. ,Y{P& 0e`0,0W0@0S 0! g,P 0Sw-P +a0ES000 +P +0 /D: 0*U @U !U<30S 97R0 <430S07S ;07S 00l##E.10@S @0007S9 P 0S S30S PP d0S7 40Sxn ,#0CSPwd ;P $0FcS000 e`!0 S $0!R0)?040S $ "/0 S 4%0!R0)?0 b!R00 !ı50S!R0 !R0 0!ıy v5 p5 !R00 !ıd(60S!R0!R0 0!ıR !R0)?0F60S 60S <`@0 S 0-70S y0 S 0  6!(gR00 !00V 0R eSd0C0<0S d 0!0<0<pP0yiP0b-`Q 0!(8 STP3IcG\80S0SE=> X8@ 8D 8H  qP- 1,9000!R0 0!ıX900d90 00!R0 0!ı 0< `0000!R0 0!ıp ` `<0P 0P0 0!ıP *P s P !p R0p;p;0/>P }0P0 0!ıPs ! R0;;0i0P0 0!ı=`P \ QPXh=qpT 4< gP0P0 0!ı=`Ph A0P0 0!ıP 5 351<`P+)P #!0`0,`LPY(P 00,004 =0=0S:8-T V D10 |p)PP U U ?Vo!P0 >]PP U U !@0 MPP U U E!8>0S H%9PP U U.P6!0P. %(P0 0S .00S>0գ?00 ϠR0  B ? 0 S /00S0?0գ?0/0 H 00\? p?x?0S080k>00S/\+@-@0 S!0O-S`MPp``@ pP Z:T8 00"1 0T S@D0X0@D@Ѝ0  0=80 0 @S/o" R 0CS0 Q  S P R 0T@180 0P R* 00P ~  80 _P ` [0J0C\+O-pZ鰐X& RP H P`Px` [ ``F 0R@ 0R U *0@S0S  Pp;p@-`R P@ ]0P @@@ 0ppM-@Mp @00PC  RT0Ѝ `? `<P ?0? `P<P@7@-@PPe Ѝ00;SP0;S@@O@U AU \00SCBD00SBC0mS$00P#0 L,@+ +p@-P\dpHPV@^8^LP gP @P%C @@A@@T AT T ep00SCBp00SBCp0!@00CQ#t0 DPp@{T ^gP 0S0^  PA0dP fP pipL,@+ +@- @ @+ @-p@++; @-p@++1;2G-pW|PP{ P0`|pЍ\@P 0pqp] ||?SZ ]0F0P 0S0MS0+S0GS 0US 0US0UES0UnS0UdS@0vS cS eS0@UxS 0@Ur0 #@U00Yrp*p++V;p@-`l@PP.;O,*;0XV@` `#;D Op*p+V; 0 + 0 +7@-`P@ PP 0S  P Ѝ0+Po/@- * ЍXA-`QpP P P@P%U0P 0 P l @]T @P 6/P\;8;@-~x 0pl ll0P \ \D0P P<0P@04 4 %%; ;;( ;;;< <<T1C-M0SL @10SH 410SF pP` FPUi0@?o20S@ [PWVUe@ЍPЍC 0@Sd@ 0DSd@ Td@ 0DSd@dT`P fPE!U@@L+H+P+G-@M`0PSS00/ @ R S"\R" :R R D Z Pp P 0H3/0S@00Ѝ( P/@-Íp [' )!\Ѝ00S @  h t)\0PT T W' 8@qp <X,"<H<j<O-@Ġİ`PPPPPp0SWpV  S P0F@p U0 PPUP@ RpP SpP%%p@-@QP 0S R SppQ0 R*A QR 0S:/@ PRS:/p@-`< PPp@pWp@/ 0@-M * x@sr  , PP  000Ѝ0++400S/@-$@P P@,+@-@P  +P/ @-p@&&0@-M@%yPy00S@(aP DP OP AP dP oPi |0t00SЍ0 yPP0 00qpy00@S(+<<8%=O-M,0S 0S b0S@ T z P 4X ЍQ @o Pp 00s pPPP``P# PP  pPPP$0S P``40SWPTPQ ((@'#PP3`00P0`0 xP0`0 .P X ' gZ 0cyP% 20SP `EP   @( YP yY |2 hd2 p EL2p@20WF0b,2P 0S \P ()zP11P %0S (.1 \ <P H7P h1 PYL10S Y 010 (0 $qp 000Sp 0 24P  R0  [ R 0 0P: l X .++0*=p,n=+XB=++, ,+++H+%0,,,%=P0@-@+00@-P &@+=pA-`pP`VYPU@JTZjP0,, 0 +@-|P@0 @ + 0 + 0  +p@-P@!@P Pp@5pp@-@`P(PpVU p@ Pp PpA-@Qp`P `XXUrG-@䠟@P`  @PUЍppPX7EP X8p0SkЍG+@-W00S@ @y+0 R/%R %R0 sR0/@- @PP +==G-`d*d@p00CS0;Pu U   0DIS  3YTX p@P0 P00@- 0P >rA-@0 0Rp@`0S00 R0R@@0`P0S U  OP@00%%O-MpG@ P!`Q[ Z@P[@P) 0 000p0xЍPP P K X P VPAP XP00pWp%%>@-@LpgPPP Ѝ@p@m@@RL0L 0P0`wW @W Ѝkx60 A-PPЍ0S `pD@A@@7VPP D00@ 0`wW !vP\W0v >@-@ @8A-p@`P@0S 耟P@0S0# CV* UR@ R %S0P @# CV* WR   R %S8 P0W@++C-EMPPEߍ@ 0@qp `,uPڬ嬐P ` P:T0S EP @  a0Sp`P  OP@\+,A-kT10S@Fn@1 RpP> (Fa1Pr`o`l``PP0p0000 00`vVP@TpW VpzVW P 0SnVЍ8 VeV@+p+>">%%4>K>0A-0S@` @0P Pqv@p`P>V@;V9V+S>@-@<~P 0yP top0*=@-M@P ᠴPۍ@ ۍ1O-0S# 10SPpP 0 `|R@0 -R` h:P PP DE#@ ЍP  PP 0u U ` UV @T P uX%XutP N@T@P@T 0l000g@`<P(@50SUl,+f:pW>*=0A-`V8@P|!pP0 PЍA"rPo`B@?<@@@ 0 `u`U^U@YUT ЍAЍ+>>-M iuP  @oЍ0@-P@M0SP @ VlV GuPX @Ѝ0@T@0: S *@U,%%@-M@EuP͡00 0Ѝ0@-M0P@ uPh0  R\P0  R\ tu p0St00Ѝ0+++/x@-@P P0@/R@-@ (0@0Th#@(,@-40 R\00S@#@+,h00S /pp@-qp @#qpP@ QPppT+@-P,#P3#0 R/  +O-$Mq0Sw@P`0S\0SOk@HP`@100CS kDP`@ 0S"P`0vu0 @ 0尠00Rᤐ000  00 0k 0 00000000 0000P`HP$Ѝ(,$,+@++H+O-M<`8@p@PV t30Sh30S`o`V D3``F`V`utV-$0S 300CS QP ""Uy"QP ""0S6 F`&+20"`Pt0X 0SJY/Y @ Po"V<"0 40 ut  20S1"0 000 f0 0 10S*P10S v1*qp@PZ "P"P41A}"P  "qp ,10S R"P ЍO0G00 ЍO-V utS 00St001 ?Q*)@P9ut`d@+,,p,$%++,,X%>(,T+,+H00S <0P/000S $0@///+,,@+'G-pP(,`@qP"V 410S(1`V``ut 10S100T T00 0;*`+*00oᨂY J) qp00S@P W ЍG~!Vv V '@+(,,+p,O-M`oP P @,P! ЍO&!qp@PV00SЍO0A!P00 0@YЍ!pP@PX p 0Z qp0 @PT+@+,,A-p` qpP@VЍAw   0@2Ѝp@-8P@0SPpUqp @@+0P  P/(%0P  P/(%@-P@p@-@PptP0S T0 0S @ 00C0QQp@Q  B 0+(%+0/+G-`$qP@U P9 ~Y* QgQU&8Z@\|0 "0XPP00040000( @0@000S < 0P00RP   0(%+P/P // / /00//000////0/0/p@-@4PPP GQ4Pp4/O-M cDa {rPX 0000 0 (MP 0000 0(XQXQ> 00  0 'P*Ѝ=ЍO# <O-4M(0PX0@ ,0utB @P4Ѝ40SU400 ?QW('@PP@dp00 0cp P7jf  ` V0,@ Zp` P P@㴣Pv V}- `6V@P,0S1 h3Z1 @P(L30pW0, 0$ `P" R $0 S S` P P  `VʏZ:P `@T_ @P[ |20S  P0 Y (0 S  %PO 20S @0  1 R00 SA> P Pe p 4ЍO V  P0$ 0PB R \A0 Pp``@1`@P!Z 0 0@P_ V V@P P P P P@Put 0u 0@P_|l00S V V0 0 0S a@Pn`0 ,+T+,,H+p,,x,,,7@-P@P ,0 R  000 Ѝ0H+O-`@++ +,@-p`8 qp P@P 00S p0 Ѝ@/W0 @P%80 %, Ѝ@ p` Ѝx,,>?@- lqp  Ѝp@-P p@`P@@QPp@L  Bqpp@@QPpp@4?@+p@-P@`*P P pP@000S  p@x,@-P @,|P00P @ BO?@+A-p`Eqp`^=qp@PA4Z0 zP0T0A m??,0 R R /@-Md@ M0P0T 0`pl P*`0 l000ۍ Ѝ+?0x*p@-P@@Ppp@-P@ \R ^R3 R   0 tS jSbS4 0CP@S 0" S 0 Q ŸkC PeS  00C00C\T PQ  p2 p@@p1 @@ @@p@@p@@pQ 0xS QSDSK #1SJ BS0 C^Rt!XcldR C&R 0 !@@ 0000 0000 0LS 0 00 060S@@@p0 000 0000 0 00000 R      R Z+ `% +h5? ?c"O-PPAMM@|Pᬕpe!pPS)(pO)00,p<0J)pQpP 5DP8u 4lpP!00 0P0  P  P ,00 ~+P AލЍ Pgh P\0=Z* !Z' <Z 0J^S0͕ 0͕ $ 0kv>Z =R+ =R-b [ =R<Z +Z -Z0Q =Z0 QP0QQ0QCo0S) 0 S(#S 0BS 0R\S 000S@  RG = Z* P+R( PE0P-!$,P3% R R R000#=R00S 0=S P,0E0P0 S0PS   Y PdP  PP 0S 0P ;h%+%p1&???????c"%@Q@r@@$0 RP  /0+0 14/0+$ 0Q/P/ %@-l04 ,    00++++G-P匐剀H@HPT`ppP JT J  ' ! " I I @`匀0+A-@4pP0`S 0P0aP 0+@-@$ 0 @z0+P 0 R   /4,p00S/p@-m\@PPPpP 0S8@pPp  ,0+2lC@-,@FP00$?Ph0 09  5;0@'<'8&4&0&00tC0+vCC+++++P/0/0+p@-0@00P0 0R 0.PPPPPPPPPQQPQ&H&D&@&<&Pp P0 Q000++++++C-P᠁M0@Sp`"p`xx!0 0 0S[0@ 0 1 @,aP00CS9 `PU: 0 Ѝ 0P  Uqr   Q   R l@S `P 0R } yP,tP,p,,,@,0+H%@%<,,0P$0 00S000/p,<,,@,p@-H@P0S0000p01S 0F&P0++Pp@-`0 p@NX10S P@@p(1@0PSP5P/`0P@@S  1CP0 1C"@P 0S000|  0p  0d  0@@Pz 1CP \+0+++++O-MdXC00wvP1S0& 1S8 a 0C# RfY) Q 0 0000P20S P 1wvP  S  ps000ap1U 0S Z 0 S1C10510S)X4 1R.sr0nS`/ S`0F[/ 1R0Ѝ  ` 0rP  00KY1 0[0 `0S% U "% 0R 0Q0tP 0C001萄 S vI  00+,,@+,++T,A-p00PS` HP ` P 80@0@D@ 00@TЍ,0++p@-P@ 02p@A-`HPp@GE$1S 0P $@@L+7@-8PPU Ѝ0@@ @ Ѝ0,0 (! ,!/0+0(! ,! /0+P 0@-P/0+P @-@P$0P/0+P @-i0000/0@-S@ Q) 0S \Q@AOoB@0Sh Q S Q000S0000P9 p@-`@P 0Sp(P pG-phhE0PS`01SP00100P0W PP- U p P Ѝ010S00# pP0,Fd0q#0 ` F$ F#t 1R P@#1 R0,dP0 d0 0  0U*P0C0#0E001VX3 R 3PR 0 ЍG0SS QQ C0  0ЍGRP*pRS 0 0JP 0S0C 0@` 100P0C000jPPUF` 0Q 00}0 PQ_VP P0SPPA0SV_0Sh QPd v 0 ЍG*_V P` V10S t! RS 0  m_PP  P P0 6PPP0  B01S0R4ABቃ@D  pP@DT0CR0S*A8A@DP  0 )0S pA,0+++++H+,,\+, % d+DA-`ApP V P = CP  V10S ! 00|QS 00 0S$8QQ 0XP< R0$1a 0S0S G00S$1R0$aʈPx`P F F)00z$<0u0$10P0 0S $0+,,p+\+L+@-(@0S =\000+G-PApP 0P0U0S = CW`dq, `0S( 0 0S0000Ջ00 0C0S [10S0 0S  N G7 GjY 0 0R  7x00S U d00SX00S D00SX    0++X,T,,,++,<-0 R!  ^ !00+04/0+0 R 00S P@0~0/0P 0/\!4 0 / B  0/0+|,0 /0+qp/G-p`@P?pP 儐u U 0 " 0 W 00V@00CScP P 0P@P0+,,PG-P0P`SPpЀ@ 0@D P V 000U00C0C0y Tʌ'P 0 BJ 0 Q@ @D 0@DSB0+,,G-p@0@`P@0W  S #R0C00C0Ѝ RP   C 0 rpGA-0T@Pq1`EP q 0P 100+G-1p`P0@\\pqp 00R00STDP 0pT@+@+0+p@-@ppP P0S0Cp 8P %@-p 0 %80P/ R/0 0S 0 /x+00 0S/$0$ R x+,C +A-X@ 0S0dS 0(0,`Pp` p U`0x+CX0QH0H 0.4 00/ 0 0+x+ ,A-P@T  ^#0pP4 044 R0@pW T  4`0P ^@Q 0࠱`@ 0x+O-qp1P0PSPU @PP0⼡p`@` V  RXWA  0 V 0 0PW @SU)PA `Y0 0 w W`@TP0 00 0` qp )@PPAp ` W0 0K0 0`qp @TP,x+,,P0G-`pPU0  SXW@ U W0S P)BP @P P`@V0 0 0 000qp0S@P`P``@W 00 000qp0S@P`V@x+,,G-`딐P@?ptu00V00S 0SP@`P@tu TUP@+G-@P匀ሐop0`P80 @p 00 0`Pqp080m?x+,,800S/,00/PP// ,(,00CS0 S0 SWb0 /O-P0-SP   ~ 3\! qm_pF_P_@P0S,@ 0S 0S%@T BR@&_o_"_BBX C A  g0  ЍO*`P @@ @S4 0 AF`@kcC +60 G-@ $P`P,$pppPa `c   @yz  0Z Pp@ ;p Tt |p@hq 80  pCȂ{ +C-`Gqp p_qp@@PPW.Y T0 0 Ѝqp 0 p 0a0@S@-TA0@S<0'@ Ѝ'P( #P   ,X,8,D.Pp@-9 $P" 'P= P !srp p^P 0 &- P& J?06 pPxd0`d0 T0f&@PAP,@mf006p&D+,4?@+X,G-@tPp`4T#0 5T Ta0'000P0p0 ?@6T` P'0,@-o0@-MPh@P  ) sroЍ08!P >00 0 &+,@-HP!sr@Q 0!0 &,@-H sr @@@6P0&6 >0606Ѝ,+G-6@PP`j>T6k.sq 00P6 >06PU p~>P0ЁPP  G P ,+,@-P ,0 0R  +3Dl0l 0@- ^ @^TSa04S '005S #+,,00@- @P QA6R 00,G-X@pP Pj`P>`>p6W @,00S/A- M`A_@pqpp6W @ Ѝ 0 PUP89P P 0 _D,,pLD@-  0mS Ѝ 00 Q @@P 0 S# B PP0P`0 S  Q0 R pV`PPp =pb00@+17@-PU0P( P@ PF0 Ѝ0 00S@PP s=P2l=5 Ѝ0@jH00S@ Ѝ0@ 0,0 0 +[D+}D8%DDD0 +<07@- R ,0,@P?@0 Ѝ0%@+@B,@-P M# @0.S 00S Ѝ 0S0 0 00S000d @h $]P0@ 0R 000@(@D%DD,DEE<07@- R ,0,@P?@00 Ѝ0%+@Bt,@-P M# @0.S ~00S Ѝ 0S0 0 00S000 @h \`P0@ 0R 000@(@굮%AEYEt,oEEE@-@PWP  @ ЍE@-@PP  @ ЍE0Sp@- Sp00S p@t l0p`|P p@qpP@ 0 p@+E,,P07@- S Sl0 Ѝ0XPX0@PP <W@ Ѝ0@ <00 0i %%FP/L0@-@0S 00(0 $ @,+, P7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@P; Ѝ04@P,0, 0 10 %%(,,%,X0/0q,P/\P @P/;@-@S|C plY@0TxSPLHD~@|<z8x@%F#F:FcFFFF3GgGG@--0@dS!@S1 CR&0C  R 0Q0 . Ѝ@A C#R k C Q 0Ѝ        @^P @> 4,GI GHO-`-@MLP00P@*0 S  ?  000C/  0?ppT*000C SY E0!R1PT*0@ S 0,S UH0@ P0EPE1!0C, 0UЍ d+P%T%@-PM MP 0@{ݍ Ѝ@` @;0Spj0 3:| @ݍ ЍU \;W HP :0SM(Y;P%)Hd+T%?HX 4HP@-  0S 0 0ЍP  R lЍX 0L H 0<040800 0000000%%OHsHP@-M 0   0t0c @lyd P 0S>000D ;0Ѝ,0P vtpX,T,}HP @P/h 0 /H+P/00SL,0/@-@0SHH,0/@-,@0S0 0B00Ѝ@,H0/@-,@0S0 0000Ѝ<,H0/400S/(00S/@-qp@0,+P@- 00@ ^S00S00 Ѝ0 %Ip@-P0M % @!`P@@0,S  i0S 0 ,R 0p 0Y0S\ 0Ѝp40@00 00( Y @(,$,!I4IjNIP0@-MO  AQA0S1Ѝ0RS'DSSS 0e C R E C R   C R S -S 1 CR 0CrSdSWS ^S wS     0  E000 0 FK N R WR Q S-00 0  m { ,kII800S ,00S 0P//,$,(,$0P/0 0 0C/,@+(,A-PU  @Ѝ`p@u㈀[P`V 00S0\V0S 0S@`W P @`$V00I\,@-0S08 04*X( Ѝ * XI,I@-Q00P 0R  ЍII@- 7I,P/0S/P 0  //˷oP@-/}D 0LP/, 0@-L   Ѝ,IA-`@P0-S0p00Cp S  P T00W`O-P$M cLP 00S S03/0L0$ЍeL0 @@@Pp 0 R @@-PJ &$PP 0@093@!+P0P0h0 P @0+S9P 7j79P/P0z@ pZ)EaD[@T>0S.nP0S -P00 0 +P0P0PaM   00 p @ =RP    B  Xp00aK[0(!00CpS0 0U ?o200@S 3/T_U 0 [ 0S00S000 RL@<0 0 R 0 eP.00S ,,+\J#JI @-@PM @PU`p0@ tTЍU  i  B U R{  0L"00CS0U0S U3/U@`y 0 LV00SYS_U 0 1  U# U U 0?o20 0?o2P0U U U W0 0S00P0S000 P W 0  0S00S000ESU U U I 0S0mPS000 00SH000V SJJJ +JJ!Kp@-P`@ឺ000C S0 ` 0 B ^ ST00p pS 00 000S/P/,,@-XP@PL0  0S0S  0  03/$@& ЍOôU 0qp  L 0ZqpV Q `P@ ЍH% +@%+@+p@-P@T <0@@@ @p `f+d+@8,,P,,p@-PH@U p@\Qp@(0?o2(08,,]x,,p@-P@Ĺ p0$ 0P !U@px,,O-M,0`70( @40pqD70<0<78 @ 70S 70/S 0Ï0@{t (0, Prs007S(00(00 0,00$0 `000|60(0, rs  T0000S (0S0 00000S0S$Ѝ0H 0C000L0 " 00 000zy+  0Sqpqp0S`+00 00S0 @ y40S PIUPe U 0< 2Pm40S 4L H@0|4Px4U 'VPR `400PP40S <400S0R0S P 4L0SP```L0PH e3PPU7  T  qp R#T0'L0`     h ` D0ND0P T 0P@TX\P* * P ` @ PUaP 0 0`0hP0p`PL0 $P  000 00 L0`$00CS$0P20S r000 00 L0`p408 CPPI h0S8 Z5  `J!` 0C pQ0_00 p0S0' 0 aP0o 00 0S0<1YPPYPUp1) )0S0$0`P0S 0S < @B X0C  BS pa oZ0Yp0Pp0+@+,,(,,,,$,8,,,,,,x,,,H+ +p@-P@ < 0 P !U0p P$@x,,p@-P@᩷ T 0P 0 Up PS @P@x,,p@-@`PV0000S0 r| 00^0tu00 U 0S! 0P tu !R0(PpVp00@00S 0Sp(0(0Sp pp,H%@%P,,,8,,p@-P`uU 0S0P@T0 P@|0 pP(@[0 00000@pp@(0P008,, +@-0PP8,,O-P34Mأ@0 40`p 0P 0 X0S`p$$P4Ѝ0 $ $X0X8< rq ut00T00S04\0`ut 200@_$0ut  sy00 $0Y0$P @ut00V 0S 0$0(00X00$00 0 P#srJ RD R 0E0P 00@PP; 0  <qp@PN ` p%ut \0@P$100@_V `p000/V0V`p ` p @ P0X0  8< Z000rq0S Z0 YP 0 %qp`p000 040*8,,+0@-MP @tu 10 }Ѝ0@-0 ( 00S@8,,,h0p@-@^P HP0 pp000S(0Spp%8,,,@-$@$0S000r @8,,<,,,O-0,M "0Qp 0SGyP pC 00#  `PH Q ,Ѝ,S0S 30S 0S(0S 0(0v0(00P2 X`@PE0qp@P[J)@PutTXPJ1\R0 0#@p HBHb0 0 0(0m0S 0S >20SX` 1``FoZ@P 0 @PX SiX1)`R@Put0`V@P@P 0S 00SL YJhG qp QP 0S 00S3 8,,^],p,,@+,#^0@-$ 00000S@[l ,,,0@-$ 00000S@J갺 ,,,㦪@-鞯8ҿ0 000O00S@3 ,,,@-@P 㼿x0x0Sd㲿㯿P@㫿㨿㥿㢿㟿 + l 1A-@TPP0 ㌿8뱮vƫㄿみ FD{㸫0 @ P`p 0RW 0` ?00]<0 ,00SA",, ++@+ +h,G-pl0P` V @ ĺP 0S 0S S~,,A-` pP!@4=&0Up0P % .&p@-HP@T<0   p 0 ?%=%;%%,,O-AM,b MFp+%W A0 0  PP u0S0000Aލ Ѝ0!S  FPA>004S S S `0PS  00 QP4 M0S  HH P? 0 ^R0 P\ S$R0C 0M00`000 \P0C R  C0%,,O-pQpPpMW M ۍ Ѝ@`S`ETpL3LC  DsD4c yPU Y< 3T V/P2@DhPpp9@ 63 @@ 0 p#W V$x T@ P$T<"0S000P ;04P S@ c1 Pp 0S 1T UP 000000@ 000S @0\0 0@ 0S @00 0Q @ Q0 @0S 00@ 0 S 0 S 0 S  P ? U00`0002,,%1&,,d9&5^ D^0@-@PP P pP `P UBPgB%O^U^\^b^p@-@PAP P @h^u^|1O-M0S" @`0 ЍO`8Pp00 0 Ppxy@`Ѝ00S 000S  0P @`;@ է0 00A0 # # 0S,,,,^,,\0@-PP R^0S @T 0 B,,%\0@-PP R^0S @T L0 B,,%0/,,0/,,00S ;/,,@-NP wAPrAPҢ@-0,,//@-L@I '0p P S0PЍ,,\ QR0* /QS QQ*/0000/@-@P i"000000/0S 0C0//0@-  0#3@PP @0@0@-@ 0PSR? P ߦQ`  P#"` PЍpA-`pP@T@  G-P`"(F$,@p DQP 0$ GdFP@P7P/P?/80@SQ 0@/a0@SQW@Q7@A-`@pR   ?PP@PT*?P #SP0s@-P00 a0C@`S0 PЍp  000@@0 0 0 0 0 0, A-^\^1!0 j ^Q1!0 [\=[^Z ^\00]QQ$ ]Q0\[Q`.FQ5 `@p 0]QV 0@Q0 0 @\\@0[T T nT  \TR  @0\00>,>,^^_ p@-0P @R RP D D <@D@ p@赠 @d9&>,>,&_1C-Qp`Mp넁0@ `P0Y 0 ,,PH D1@<1`40 "j\Y R T R 0 0P@ 0  [R .0B0S83 0  00]RT[T@ 0QT 0QST[@[T0Q[S@,0 R Ѝ>,>,>,C_0G,0@-0M M00P/S $S+ +S00+ 0 0 9S#\S @P0 0 i0IS@P \00ۍ Ѝ00@00 S00@>,>,_Y_O-@T Ѝ0tS bS rS aS @{S000pW G`p 0S0QU 0V:P0 0 PUP @0@ p<0 Iib`P,,hG,>,>,_O-eMo?Mp0 P\W ?/0 &i00 ϟ0S?/0 t0^0L/D? 0PiS ^@/ ? 0 h Q0S 00@00000S 00@0p00pS 0S @P#S ;S 00 P00@FP  P 0S @,S|P0S 00@P  0S  00@aW = -0 Q@pQ< @;Q }Q 0,< 0XP @\P 0`,X< 0xCPU P@0(, < 0D5@ 8 < P <<0 \\^ 0 ^0\ APP00v0I S mP0S 00@PH;0S000+0J=p g:*0 0S 00@l0S 00@`00P0S 00@xQ0S  @P0SH X 1@( u9)0 |RP0U 0 |Pp9p)0 P\XX090)0 Z$ M0P8(0 LJ4%]P M0!0 < 8 SR$0 (  %800H 0$0  PP R00C0 0C S000dX,< X0P7'0 0\RH [IQ␸0S <<00S ,d< 7P00A i 08 [0%] 0   0S 00@\0gSk a9SX0SvS S 0&6 0[08 9R/RR0C8 &R* P 808z\R \ 00BQ0 S 5%0 L S00( 0  \ R5%0 n ;Sf IS00pS wS, iSY 5%0 R00vY, E|%0"S Y4$0 5K  0S 00@<<0 [  RR< S  4 $0  [(40S $ ;p 9  U@P M[ 0S @;S ABg0110P\SS,3,#0 %MD  P2"0 x< @P 0S 00@0@ Hpe`2`"0 0 Hp Y 2 "0 20S%000 S90S 0Sw @;Se }S 1!0 4v)  9099090H 0 p000 XH 0S  p Uke  pYP9 )0     囱!1 ! 00$ (9 09909 ld9&.,6,>,>,_D _%`1`_l````a>, X)aDaQaY,,Xamaaa.,Ubca bbbb,>,hG,G,0G,,G,Idp@-P @"000P @p\%@-@   0@0\%0p@-PPUph<@P 00CS0 lp ykp0 k>,A-lBp` R3 RQ R P$0SV0(  R R W<$0 P,pdP0 P0!;QP$00P0PT0, PP (00S(0 #R nR0V ,0 0200#0$0,0$0Nk( T0R #R nR   RpG QT000(0V0(00P R R0   $Q T0P $w (0V0(0 00  T0(0V0(0>,X@>,Fe@-|@X0  0S 0S00CS0>kp X安0  >,O-M DMX0`Sp00S 0S c3X0X0#\030 `00d0弓XSXP 00CS0 kp XvX %pP0 V0 X PލЍP2 jp0S -:09P 09P p4S :80p0p4S \PP yjP 00\08P|p0`0d0S0000d00S 00Sj 90P  ?c0 2 02.c00S +刞+P P0 c0+z0+Jvwe9Jf|! 09 P*9\PP j@:P\c ( p$ 8\0p !8 0`PS(0x0:PX30d00,p0\`0P l000S SP@  0 l 8(00(03>,Le1&,kC,?,?,peyeXeeekfeȂ@-@P beP@-@@MP bep@-@PPp 0 be@-@P`PP  0&p0 & ЍG,@-M Q qM`0S000@03 0@0S  0Ob 0 0S S ` 0l!:@P *0 w9 PIi0 00ڍЍG,?,?,@-P@  Pxb \0 P`p `P 30P S x a ЍG,eL_G-pA嘁0 0`PU , R:(,>00( &U# \U   0 R`Z &R\R`P , R:(,00(P    "pr P qu PE ,  R:(,00(     0G,d9&A-@P p0R`*W0 0 ӗ 0P P O-0p/pOM 00dPЍ080D?PU 0PH0 \ 0y Py P\^ R2 0S >00C S0 0S4 0 P0 R h>0R*SL>0@o(P0 00H0P 0S40P 0 R =0R=0 0S= 0RR0S0S4 0S8=0@oP 0-=0C>S00L0 R: L ` 0 p``c0800400S|<p<8 00 X\4 00O<0S   +H0SP80S4PU 0`  EP0800A E4 Ԗ0T P !0|  004 0t 0dd  0D;n 0{40 00;0R( <0p f0P 0S P 0 7P2S 0 @⛯`0S0`V: 9$- *00@ \:@˰0S ư8 0` @0 P y0 @0h [0`V: $ `0 0C0 P x0`V:T  `0  ᄠ[ p MP 0`V:`8K8 ~70 aV : ` 0 0m70 SX88 00 @h4 00I<0S  P)408060 P+80S'g4 00#<0S  v80S04p  Gǡ`P <000F pp40< ( 0<0S  VV 0400<068 00 V4 00<0S  >L0 R: L }` 0 pc00p[ R  Q 6 D6@0_4000  P 04`Z Z Z000 G 0Z0 00 V~ Z0 0RP  l0 @0   PQC p0V `XOd@0p0<@<p(0000S \t4 00P<0S  p P[ 80SX0sFL$L3p@0 4^Q0 0  0p V0`0  `?0P  0 RS0 0 p0V R`0 0 !PP04 0j34 0P b3P"0 000S 00P80S0s"n3p 4 0A340P, :3P P RP0v(`<pL(p<80S4X ! 0`Rl0004 0V*0000p pW10  W0 d;0H ! R0O0P pW*0$ ("1 0X`xp@0`h0<@<h`x0h0G0 0X5@>,G,LG,.,r ?,>,lG,2&d%1ht@ ?, f7ff>,f4G, Xc"6&G,xr<0 0R,,0Q 0{Q  .,c"lG,p@-@P`Tp0wS {S sS 0p 2P 0 HC]0`@p 2P `XG-`pQPcPU00!]01 R  @PVAGWp8!p!Q <0A\S00 0  \0 0 00 00 00:Q 0Sp0S X00 0p00 0V 0S`: NpP 000BS 9=G,?f Ff0p@-P@`T P ᅨP, 0S)00 00C?o2S Ppx0 0S00\0 0S00@0 0S00$0 0S00@G, :@-0@- MMP1@P X j\ 1p8b\+ 1 P1ۍЍ0XcfH0  BR R R4 /1&X2&@00CS0 S0 / }41&@-(A0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@5gH,0-01S ^00So^ P0\ S0S Q0S R P0S0S0 00Q R  PE-H,0@-  `Ğ\ @ T\    %R    H,PE-p@-TA0 5S <0S -0,!0<gaP0U&!0! R8  (P T0  ,P K0  4PP {p@㶈00\P P D /04 0)P$$9SpPE- I,H,X2&zp@-@0`  /T  2tDh pdPPT p P000ST @1&X2&sfG,f@-@P P<@P @0?SP@ Gp Ѝ/ZP@OP 0S SH(8c0S_00Z fff@-3 d2;/fX2&0@-@<TQ T00 P20001S R0Slp@TX` T@0$P@ 442T(8  0@+2H,g!gX2&PE-(g4g=gPgZg@- 2. hX2&7@-@P   0S 0@T 00 Ѝ00"S sr@-@P  p ZЍPhA-<0``@c# ^p "RG ^<0c#N 2 Rx%0 0p2#L @ "L /0 0p2#L  "L /0 0p2#L  "L /0 0p2#L  "L /0 0p2#L  "L /0 0p2#L  "L /0 0p2#L "L /0 0p2#L "L /0S00//00//H0H 0p@-@P@!R0 U0 ,פ0P01p謰,,01//00/00/00/00/00/ 0  /8,c 0  /8,00/,00/h00/h00/Vk00/h00/h@-@d,00/@-@茫, 0  /d,, 0  /d,h 0  /d,h/00/00/00/h00/h00/h00/h00/i00/ i00/i00/'i00/4i00/?i00/>i00/Ii00/ᕒ00/00/O00/ 00/00/SisO/gb@-0  0Ѝ@- @+@-,r0$%@-R  +@-,k @-0艮,, @-茡,(0(%@-R 茫,  @-\i @-0a,d, M@-c, @-b, (0(%@-R yd, < @-pD,< @-gA, < C@-^d,< @-VC,  @-MC,  q@-Dl, e@-<, e@-4趣, e@-,蘣, @-$D,  @-芪,  @-B, @- 0,, @-D, @-A,  C@-d, @-, 0$S00 @-, @-@DHP d 0uc" 0@- 0|1.謰,p@- p0 (vP u{TvFa `P 0PSY 2C p5i0 i 堎<W P ,500xP0 qP- >P( dP& <PV 400C`F V$P SuP4P 0CP  @@PPt4P P0S 400C`\{k1SR !0C B/?!1LC]1NSAPN0 P ^A88#8xP  R11@(zP`PxP@a@1S020,(PJ @$3@P, #0@S002P0CP?P <P>P P2P 0PVvP tpP1aB P hu*z1S'ʰ1 B P YuzP 00P1 RE40S 3/e PPP e P,ЍPR0v 2\ 0SpW 0j 3/pd P 0`B P u e `y}e00x00AJ!0 b02P `00P000_y]e I,jX2&vjj?-d9&` ?-jS`9&Rn r  001/I,P0 R0//I,O-PP$p`*@ [ ! : 0P@ Ѝ000 1\$<0P0 000400800<0 <1@000D080H040L0$0<0UP q`, (P1  @I,kP/D0 R/0@-A1 P d< @㤛I,O-0dBp "W`H5g0 00p01 Ѝ0P@P 0S 00@ ['0 0 mP  -W0S  'W000 00 `[0S mP  W000 [0S mP  W W0 00U P0IS0SPPm0 00m0S mt ?C S VPU  !j0Y!0C0S( 23PP PEVI,d9&VUUU @O-$MH0[S0P 0L`Dp> F0Y0 0S 0g Ɇfŕ뤣`PXmYm fm 0@@0@0000. 0ESET0D0T00Ө?0S0 CR C0D S0  0 gAmX 2 f 0  Bྋ9T P0{ P>  PN P P!VUA`E Dm@DP`4hf ef bf@`"PD P AP;  KR !   ` D0E0@0!P1 `V0p00@  d`Yx`F`FV0p00@  DPE@DU`E¨` Y @ @T`— R   BU00000S 000 0 0$ЍO0Y S I,kd9&X2&A-`PlPp `wl@pl@0T `P@ P P0000I,@-@Pp 0 0T0* p@Ѝp0 00㨐t` 0 0 @㊀@t 4P ⚳ ,&I,lh0p@-P@XP0Ps H` R :P 0S@@Q@pu,&I,@-@?0000I,0iI,0iI,-@-@00  Ѝ@ Ѝ/-@-00  Ѝ Ѝ/-@-  ЍЍ/@-@@X@-@X@-pMP@`,0 0( 00 0`Ѝ@- Ѝc"O-M P`@pk@kUjT0 0`P0  D0SPY 0SV L00SRDPPL00PT^y@DO@W ;p ىPSWpV`KЦo`0 S`K0 p@PE0@ :PT0 0Pj00L00D H0T >Z  Jq a vaaЍD 00R00S 0S aL0X3#PpvpP 0 q똰0EDcc >~0 EG%p``PED`ccI,l?-@-,, ($ *Ѝc"@-`$0P@ 0  00 0`Ѝp@- Ѝc"@-pMP@`,0 0x( 00 0`Ѝ@- Ѝc"-@-00a  >Ѝ Ѝ/c"p@-P^j@cjpI,@-7@- @zA6$WPU 2%  削[O00h@PU "%T  yKO00000S$$F Ѝ0<,8,@I,X2&O-CMH@ `PP@ t& @又Pp  POCߍp@T P t0P0X Y \ թ @=R@<ͩ<@10 0+X2&t 1@-nC-0MM 0p@I~`P0 ᇃPP* P AtP 0S0 0  q n HPPqP 0 Q00:0P{ۍЍ0.0P 0 C<0 0=< ,00S/ 0P K@-딣,,,X@-|P P <@("Pq@8 C-@M S@婖00{%P,  ❖00S#{P  f0Sl Y0] M)PeA@Pa"Dy'(Dh*A^&'ЍP@R<O}P'P'20S @`P'.Ap0 $!PW<%} $ X$P 0)AT PxP AP p PP 0i+Q !S0p 7'SpT+ApW3Spp0W3:X# @PQ  R@4Q p0Q  R@@P`Vp003/P,00  h0S  R l 410!8p,,,X@-MM+@(⚁+(bB+(⑁B+X(?PލЍB?P `0 @@@@@ @@@@.&B(> .-MM+ ]P+ %+ U+0 ?P  >ۍЍ 0@-M R1@@@"#P @  P A0$*!PRU)QX&Ѝ0RL00S 3/P 0$003/0$Q*gm@P3P/[P+W@P'_@P# 0P{ (&;{  0S 0_ Z'P 4@P4o0m%(-*00,,b'?-?-@-M Д0@@@>(#P* <@8  TP 00*!R00$Q )@P  0S 0` f'P%()Ѝ,,O-`M  0 0X#*0S ` 0 SS 0gp0 S00C `@X0S :ĐPP @B pQ %S0S iSc %S, dS 0T PsS,200P 0 倠ಠ@ZR  @P %Q0 @0S0 aRT @R$R0PPR@  T 00S 0 ! SD 0 @S$SS0P @U: R R 00 R @ 0QR\P 0S  S t00@Qb0cR^0  3/PW Ѝ 0 d9&7@- @PU ! R oAK00 Ѝ0llP \@ !L : W̔( (0['ꐣ,Ȃ2BMfp@-@Q`T80800P0S0S   0p@s5ꐣ,<,7@- @xPU  J00 Ѝ0PP | d00S wwL L0[nn0 ,|S<,Nr,DX2&s@-`4Q@79iVy _^cx^yct _Sc4nc^5yqe 0Aj@Pxx冷4P ?\?^^ lyЍp?-XҊX2&O--}Mp@` 0 p V5 0S  P RI 0S  xP KhP FxwpPT Pfdb ,I' RX0B? 0>N*P  IPP  I00娎Px壎P; @  T ; :0S :iP : 5#00x4$"0}ߍ38` 3|3 40"!03140`040&2ȋD 0Nj 4T0 T  (0P+00  >"!!0@#  PM  XT $ th2P tt>B0S$@0 gU0 @"QS 1P f2 S0V$2s@T ʒ @>0XC.0@0S@ @  0R0SQ  0S  4 0 P1]wu0  PS $2&,ptbtf@<,,( B,.,,S8?0@-0,M 000000 00P0 00h0 PPP@P DD噵@0Q ,哵,Ѝ0@(i &X2&w<, -O-iMs?!0 Z P 00iߍOЍ/Px2`P<1P 0!00>(`P z[p uP@& [PpT00Z%:HU0P 00GSW 010#S 00PpP@ P')<, -O-0MT@pX   p$p嫣 `V  @P'U` hPP7P@P @H E0ឣPU m0'SP0U*S / NP00 AwX/0 0P 0@ 0 0H0 t|PX1Z * tኢp`PUQBR( \2S022SP0220C2  S |S``  v$00 0( 0 0`0VPMUS-R PPV   0%S @S B B*⷏ 0.S 0 0P1Zp@P^ 0A0 H 0 $R5f>Sov00 (q@0 0 (iPbqb0S  [V0A X0E?o20S dE[_$B[_GbQ H奲DD墲,ێ,Pz`0尪S ؈ W:-8 4e0w=C $ C/z̽ J00z=0pQ>e0 yP400嬈0 40P  U Ur0YR?; 0/tp @*<: R0 :P'P P 0X60,09kPt<|I.d̟ 0  0/P `0< 0 B0u`````UP0ۮ0tl= -D0+lq0k,ݍ<Ѝ>0a X+y| ᛉpP h ᕉPT; p{ 1sS1lS +2 0P%QP ]P;∉pP`~,x*0x*0wopP\8 0\8WV*0yU l*0z\*0}\8@*0|y(:( R0U:$ R *  Q9ɟP \ɟW弩^L9    +X9 @H- A|)0p HA0"sp p=SrL9)10@@ FP 0H0H0A sp  AfYpP( 0W` KPSUppkvF l! JhtH p.~p0<((0~GÈP (很P 幈P 崈P 寈P 媈P 奈Pe0:4JP '0\6S '0,||pP 4l `XPH'<[7S/ '$CT&P<6&A2A~0\8P 6P 5&oP p:4S 5p _P \& 0APڴ  [L\8$&08\8~ pPڀ w  |%8P00Pڀ w  |%8P0040S\80\8Pڀ kw 0S <%8Pڀ\ \w  D|P000S\80\81P0S\80\8p?b4S3P 0@?S @Pp 3+w 0{HR##hRp#xß$`RX#W%R28#   .0S1 P 2@T ᳯt H#Hst#t00S p"X0S d"@}B3S3 UZ #s?00N?C0C l0  0pF0poxPP8A?ێ80EpE,0x ,yP"H pX0S 嗅_!VW5S 5!1x,oobXfa}X60Sp0 <EFV4!S< "0 0 U~ xDI,<,2X2&U (&d9&m4, uBK, CJ,BM,}N,N,ΰ,o ~M,`M,2 -i O,P,N ,GUX]rH"U7aN,\`kv4Ȃ@K,Q, @XhP 01/ c"C-鿏M`@$PmP3S0 p0 p :0 00p@00p~0/0 0P 0P/S/00 0 /S 0/0 P0%R  @ p @0ߍu @-pCM`x@PlP#`0R\PP @ W<00040 `(*PCߍuc"@,D, ꌫ,@-@ @,@-0  0L P @0@ 28 0/P  Ѝ@,̐ B,, 00@-@XMPA0  0@$ P x0x t0E1l@P/Q  0 LL 1 /R@0 @0(vЍ0DI,@,ܐ ,B,@, ,@-M@DYPⅅP  t t0 D 00Sލ`0` `PP0  0@ :00 5d,@,A,,D,,1h,d@-CMbX6S 1P \8lP9XT20S H1\6S 81424"("2 rPP Z10 c`:4S / XU\@aU A10 J:4!SO *00 0 B?|<||1@P) (1l 2`/X,H)0S 8!8"0!00S    @ eP\6S U ?{Cߍ 0 BDI, mΰ,BK,zȂ@K,15XTM,NCJ,BM,imN,H\%1@- @T^ S C @TR 0\0S0 @B_TQ "#0  @ ! 0  @  0  @ S00\RQ @  Q  G-PhM`p 0S%hЍ0 L03/@P 0 @P  Q 1/P @ @@08℠0:/P 0 083/P@@ 0\ P0//!01000/ 00#0//O-`$MPA@T W pŃP00 ~0S 0S0S$ЍP P00 S ⱃS, R ,0S R : 8 80R:P3#///A-@MM` p" *0P pI  Xd5\\ SS=S 8 d3R 40 $0 ڍЍTT,A-`QM p@ VP  PP PЍJPTP t0h@$PU@@T @D :0 @wP:H 0G-Pp0 '"M@puPP А`0 R PЍ 0L03/P  0E놁0 ?D @8$0S P @.r @*r`,Tp@-P`o00S@ 0p@p(0A-!qP0ML0` 3/P< 0t@T 4/@00  0@P 0x $0S  q$0 qT ` q q0S0C,$ #(Ѝ,i X0S/p@-@PI 0000p@3O-p|M@P Y0P,0+`,P|Ѝ ` 0S0 !X V 0S0H L03/P X0p``P , 10000U00 0P100 0<0008 0pP ,0<<0@Dj@0S P 0@  !D00 0S0 !Z Q 0S0H L0 43/4P X0 0 0ꈝ И @-Y P 0P 0Pp PQ` QXPQH "P <080P/,/(//< "dp@-Q4@P0@@DPp 2PpP&p@-P@P  p p00ppN@- d&@-x p&G-@MPP N/ބ p0 0 0S1 0S XP a,P ލ0S 0S1S P P @l0 1h0$1d0(1`0,1>1S nP >8%0>` @e Ԑpp* `$D @ $0Z X 4` B0S 3Si ht O K00<?` `p䀍0-P 0S0)#0C?o27 #3RR  0"R6p7 'Sn`0F'Sn`0pF'S``Vn`0F(P~ 0C QX > 00B,04! `<#c"0`PP  P ,04! ~x<#?`~d2P  @000@A<"0p 0N?P0S Jp  ᣃ ⟃KR ⚃00pK?(0811$1n0 1t00 <@qx1q4pP( {1S%4` ᐠ0!] 0AX 0S,0! <#@  0@ ,0! <#@t 0` z;JYe}DR,QNEFXc"}d9&'Q`@-PM`p 0 PPp @P l 0 PPpT* 8P 7/PЍ  @-0 0P Ѝ䰢 @-0 0PЍD O-aM,MQ0`aݍ,Ѝ@`dPh 6 PP- T0pP, U@"8T+"on b+bgn`}P@``VaV+"Wn+bRn~,P 0 R@3 PUFh0$P 00S 3/p0$QCbbn`Eo`YG_FPE~P 0000!8PP 00S 3/p003/pNo\RP0 0 QUi $P 00S 3/p $QUZ 0` p `` pb.x;8/0  ``px`".;6/0S.   m m0| 0W|`PU  b +`P"  @VP+"mb+K "`P J~P# E~P @~P ;~P 6~P 1~P VxT um  qm` ,|Pw  ,0,X7W,vn 00A-p$0p@` PCAP0 >@ p C 01/@P00pЍpP@00003/003/$AmO-UM M`Mx.0Pe[.W QeH@,D.h4'S[@,0p%SppW 0,0,Uݍ ЍU  n? h4F>D 7\4 04@0Pύ⌗֯N#` 54, Q~W <S D7h4F>D0C2$7\41 [ V?h4F>D0C26A\4 040 000000000 00p@ }0 xp0< 5 5s 1yt0 00 0000 0 0p@ 0< 5 5s qଔT1 @t00, nE "l5@0\qW 42XL1`⺀0Nόpjppr຀q ph \ $t00? 000/0,0S00Ӥ?'N?,$"x@T`0 ,0S E 0S N?,$"T4@pWD4 0}10  A &l "!l lp,1,1 101$10!4141(8H!L1 1$!0L1H!,\6$ 1(1)\,, 1010q$1441>(8@ $$pP  ~ ^zWx! Hp#O0$100$4;P Ap2P p>{T { $1080$102P0 0 0:k0G5  5Sp Ph $003/$`|PK `qH! >,!  5$F0@>S  GPjPA y;?S= $10>C418<10S2 @'` 0bVQ!!10(b/W0,1014181>C0(1}1S0}1$1S ` E@,?-1& ZXx&,0,`,,c"<, _PP$030/0@o//BO- M@MPAD0*!Rp0)Q`U0 $0 Q  P b Pp ,O*l'0d$0 7L$PY(pP 44\,: ܍Ѝ 4p 0n0Spp0 @0 4p0SW00l , Ri  000;x8,9/PV0  ,x8;;/0  ,x8;9/T0S8S "0CS0S "S S/ Pp  R <pWP00P0)l2YP0 U @5' 'pP 0s q&P }d0S !88 ⲑQd0S !8\0 PS !8`0S !v8X0Sl! hSd! 80\ E⇑L0@ DQ\0S ` R  !8V8 r Q lQ{fPu`PoX0 SVPecpQWpph  cꬰ,f t + ,ns H<}1cCOWc[CgO-MeM08*QU"pU{&hh'du@H&\ R X @&0<0 T hQ 6ލЍ5 )qWd nP7 FPq' nP  @ xP' @H0 pX l40y40 PZT P tU Z@D`@ : p PfU   S0SA   0S # 0P00P F0cP14s10H#5:h#h `%\%X%0S H%D%@ 4oup80pP0 0 ,0ST0 S00 P0p800SS40 0  0.x;8:/>P0400ST0LL S>@ S?0(0$ <0%y<0PPL!@  PP ,0$ 40 ( P 9 S-  S `(0{ PP xP00(5S04+^Th14  y0 S r0 n$%Ȱ0ꬰ,Ȃ <,c"Of,4NgXh/ c qv~smOO-BM@MTh Pp ` T@PpT0$(PpppPP@BލЍ䓟M!C3ܣ0@ C!3#$04@(8 :!3@0P@0T@D0<\ P d "!430(30< 8@4v!202000S0 bP  Z 댲夒  8@4Ll20 `2@DDAT L2L"LLz#P <2 4%PI(2(  *20)ATp !0 bP&!$0 U@0S   D#P 0St C0 4@ 0000@;x8 9/P1  W%P !F,%@P 0  o @$$0 v`@'`#W@ Ot  !3Gl m۶[ ,,X c"b @-0`M2 pR !,^RЍ04P0 @ PP@4 xp8;7/P  &PBR,T,(0@- @"!P(@R,@-$@2S  02R,O- @P@BY`P@   PP@ nu0Ec#ะ@pPU* ЍI WP  WP BI@    R0S pd9&@-@00 SP Q P 0 iЍ蘘 O-JMM ؒPp`+z G'zP)NU\baG2PgPXa EGIXK  zvP 0000 !L00P T"XT1P T2X"TPZNT"R0 0XPY 0G,001 010100 0A000P00 xPPPP,P0S9 0S)XJݍЍQUP0 X$1QQP SU T"P 0 003/PT2X"S 0S(0S 0SX(0S003/PT2X"SP0,< ؞ & 0S/p@-@P`!a(0S  R 0Q003/@Qp@w@-@4M`pP0S4Ѝ0 0L03/P 00@ 0pP180/C-`M0MPp PPp@x; 9/PލЍ0A. PPxP;5/P A> o 0@o/b 0!!/X,10/Zup@-@4P0 `d1111pX,O-P䐟䠟䰟@p`0/ C !  !0  Px00S  0 0S 0P1SR0B 0 0`p@P X 00,0 000`00 ЍX, 0@-MP@/.x1, 00 0d000 0X0@@@@@10 00@0 k,PIߍ0 X,O-P4Mp@` 0SpGP `Ppp 0S00V0#S 4Ѝ0L0 3/`P0 L03/P)  0Q R  d0 0P  P  H  , R  T  X $ \ ( ` `, 4@8pTd pA- 0R0 DQHa@ 1QRpB   !LAPAPk0` A0Q     TTAU @@X,fO-pLBMXQU<2PX\1S2\U \QUЍ0C`1`1S^`r001PS \1 XX1! 0`1Vle.X`00 T1f "X w\P6 \ ! w000: S.X1 2 \1`00X1`cP 0 S 0.S Hchp ` XXP\ SX1, 2 $ ebX,0& , T 8  p@-MM`fPoۍЍpP@P+ c P*p+b P*+b P*P' ǻP' p@-&M@(FTnI`Pe5  h< 00,q P (Ud5(U gMi]D @P wލpҊab, O-M@P! c0 ] 0Y봢p`Y  tpP 0 0P0SzߍP W%0]PrP0 a0CS0S p `\Vp08Sڠ0S`p R SX0 0 a00  )p 0X1U0ů0 0s [4+ cp&Y0  @00t00 00S 0 :SP0[h!R@PO zO0㏐ 0S*?0 !CV4a0 & d@edAZ, 1X,@- L@01SP@ 0S 0   X, @- @-G- X1L1L1  DADh9'Q   R 0<1LPDT PPH {pL` wpV !Dpp1 p!opW !T``1 `!gpVpp1 !p!`p<0< W P!P@ЍG   X,( c"@-M@ P @oЍ@-| 0S pP`0 X00T T0PL008 80<{, Ѝ Ѝ䶣,7h,d, j@,A,,@-Ml@p9t)0 0 0T00.00 0 p $0t !ЍX,P @-H;@,$ @ Ҋ:x\-?@-@P  . R4 j%(0@iЍ0@ Ѝ/p@-0  0 P L0L aD@D @08Y( @0 Ѝ@,p B, @,,-3M MX DP0  4qP po3ݍ Ѝ c~-3M M zDP3ݍ Ѝ 0@-M0  0J 0S@Ѝ0h0h h@PX0 PPP00L L0PD@00, ,0P,,l,h,C,d,j@,A,,@-0  0 P <0< 0440}000 0$vЍd,@,C,A,,$ 00!S//Y,$ 00/ P /Y,, 00S0 10 1/Y,X,11<0@ Q !@-0 " !/X,0 10 1/X,@-M/.s, 0lh6 0X 00000@0 ,@ߍ4& X,H 0D /Q/QQ Q/X,4&@-@0 0 0@ZPЍ@- @0S00h,0@-AMlHhP N@ c_  JP<04Px9/d0Aߍ0X,,P@-@ 0P  Ѝ萣,-@-  Ѝ Ѝ/-@-0XX0@P D  * Ѝ@Ѝ/N+X-@-0XX0@P D  * Ѝ@Ѝ/NGXXx0@-P P @@-@mP@ Po\@-@0HoP 0 P  d,A,,@-@04oP 0 P  @,,,QA-@@1@#PP1P#T|p|` Y_P (B(A`*'==E6C66YA3Y?-,7@-@j.P @s 0 Ѝ0X2&0@-EM@DP T^ ~cP0000U (0($x:@fEߍ0,X,˷<@-Md`A ^ P`/^.m410(!x |  /s<&0 00000H0 0 00 00 00 0`` PPpR02Q%rUx:d JGX (](3(JߍX,,0  0&8@-@P !0`RxzHnP 4PP xZt P` 1X .01K@0Pڧ@T i5\X ЍX,0&@-@<%@-0 0x Ѝ@-0 0n Ѝ0@-@M00 000 00WЍp@-P<@0/SpQ mPp@4&@-0 P @,D,G- M@Vp`P'0   P(0 PP0P00P|0 @P P0PySa00ͅ0݅ 000͕0ͅ ЍOkc"8,,Rh,B,pήO-`-,Mk$u@ub[pPd $bePd@T00S@ kPPEUM T1T!TTo$0P0  @$0VSS00Y00S k P E H $a0 0$0   0$ VRR   P # 2R @D p0@Qk `P$ a@,ЍX  G-p`j@PPU  fPP 7/G11PpO-@ M$a`P Ѝp0P 0`w0VSS TP$_a-@-0 0Ѝ Ѝ/HR -@-0 0Ѝ Ѝ/pR A-@PMM``'P ``ep@ F43T0(3T$$c3T & 0So 0CS+PDS0 ) 0 0S9 0S r0S 0S QN@P% h0 X0 @oH2@P 000C?o2 7o00`D(0SލЍ!7SlP1Q! F?@0F@od!H1Py0  0M(N 'W 0S 0S| q0Sx 0Su QN@jP 0  0 @P_F? Q. QFINn4oqC,),l,g O,0&mҊuc"N,D,{j-MM P  P ۍЍ-MM P  P ۍЍ7@-cP% P_P %P0| S0P @GP L0@T Tr Ѝ0 = x0|+R/ @-d|+\0XT0PL0HD0@<08}40X,б,,Ա,[, ,c,P@-@ wu50@?Uꌢ,p@-@MP H(@n0H 000,0@@4P,P$4hPp0: S HjP  ^Z ZZ܍p,fn 8bnQ @P9@Pڤa@ <0PT8|1|!||_mx8<eDQiT1 08808PP  Q )P00S nz<  R t00 00000 000lp@ m(?(0tQ!d,A@,A,,(d, f '0 ,h,8d, O-CM00qSP ` @h0!`T40S`PW!0002 @ @3/@P CߍW! 000{Z 0S.X 0 '@RT W  00 0 * 0S l00S `  P0W0 ! !  000@,B,)ر,DXm(,X,7@-PQ0@ SS 80 000] Ѝ02S   O-PUM$$0 v4Q ԑ 'm#ß0/S_P3s؃C00`/Va3 P QKU|c@ A@ hPKNP @80@1 U y `PP$ 0RP P \^ 0 10S 0S7 0 1S30S OPpG % 2 CH0;S 00a 40 0\ 0R R` 10 1000p]R `01S RB  0 P a0S  /SPR Uߍ` 1 05UX U@P@T tTj,ر,4&X,>j ?-?-@,p@-Ph`@TUapUP`P  p&XG-MM@pLpp@ DMP P0P   .PڍЍ D2P D*P;P *`P ;PU#dR"PPL# 00 K0!~f gP 0=Sp  < ᘲP'#%#W  P P P`tP 4 PPX3 8aȂt20p@-4 P@Gk 0Pp@@-G-@Pp4 4k0pS R p2"4p0QSP pP`p 0S!40Sp  Tk`/0 R/0@-SLM`p@`aP 0S0 L03/P (0! "!P 3/P 0S00LЍ0  1/p@- @PjP  p@P@-@ (@A-P@p`p0S 0pp RA05#Ph00200#X0S0Q #"0hPhp P#"4`V000S 3/0Q #"04P4 A-0IpЍP۾@پ` p pܿ ֿ 0̤`2Vf뚱 t@T d fPLTP <PP @;JYe}Dc"^Pp@-MMP`;  p  @cp FkPBkPۍЍpp@-@P i`L P  0QpPp|d zd@@-M MPp; P`f p  @0P\QPUjPۍ Ѝ edA! 0 02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/@-@p HPi00/00/4\80S0 S001/\80S 0@- ``@0"SR0(SS QU S!0$0S\  0 1Sp@- l@$\ P0"QS:pQQ   P \ Q0\! 0 ,04S8 000803/P,000403/,H0 , 4 T 8 X  40S80S0 S001/S S 8 S S S0/0000, 0R!R@-@ b4 BRp01 408 00803/P,000403/,H0 , 4 T 8 X  000/0O-p4M@ PPp`314ЍO$0 L03/P% Ѐ 0\ p* @D Z["H* 0*P T P , [p h8``pp 0S0P 004Ѝ04,O-P4`ȁȑȡ@ Q 1SQ " 01 r " 0SQVLLSSDSQ R?!S,0S 0S00 0S  p!"00 0  SPH P00P00 0 K`03/P L Q Q  Q R S" $O '   $$  U 0O-Mc(0<00PSp@Bp`00 # 80s 3 0wbh0@l0S@3 `(` 0@  "<0P000ЍW0W*8q @ 0L03/P 2PR  "00 0 00@0002Dp0 0 0bHL0 48 'b00(,(, 00 0bP23U 40p0P<0SPP0 M T00SI0Sj00q p0 0 0 000000  \0 0 00000PX 00808/b0 PpQXQ Q(00,0 0p4 80 \`\p a X0S l^ 0$0p0 0(00,0  04 804p90hk,,=lk,gc"C-``FlM0pSP^H< a0S 3a0S ,a0S%a0Ska0SGa0SHa0SI |a0SJua0SPna0Saga0S`a0S000$ R$000 "0& W40SV4 QQ00Q00Q00S 4 lЍCZ( ,a0SWB@4W?048P Q Q  0 \3003 0`0 (lЍ3003 0`0300 0$h3 0`0 0LS(0p`@ b0 SH0pP0`@SH0pP0`@SH0\000 SH0`000S"H0d0S hP`@((0 @"0 P0  R>0 H0L0 H0L0 H0L0 H0L0 H0L0 lH0L0  TyH0L0@ <rH0L0E $lЍCi!SH0000%0PpG0  d 9/0 00(00 hk," ' $O U c"x ,,   ; ; T% $$ C- pQ0EMPE0@ (000S 0CSEߍh0 3/``0d 9/0 00(00 ``0 0pp07/0@-EM0@0P 3/P 08 00 @@003/Eߍ0@-`,MHP P@0 0 0PP@k00 RS THP pW `P00H P00P0,Ѝ @T@0/W  /00H YPH P00d9&pp@- MP@D0T ` 0  040PP`H0Dd ЍpG-%(M+@PV X TP`H<, VV !R "2 Vr PpP`"pVp$UpWb$U  0 c0 0000 0 0000% 0MppppPP 1 (Ѝ $!( 40C-S,MPJ S S S ,!S SB @P? q``o`X 0+(% e"000  00000 0 00 0 0M`P f80S<,Ѝ ! %  O-P(AM@0pP U !b p<#`0!(<#@ U`P $P 7O00 P P N000PZ!@ 0 A@BA  |!@Pt00dC  L!0[-  (!0 RD`~p]P@!@3@]`0 -@DPb @0  -U!ʨ@   P,.P嬠Y 00@p `PDXAߍ!00PRPV c",hk,Ll,NҊ`5O-p-0M<@$zP TP,0 `P%Q 4 0@0D  U 0$ p0pC 0@D @0 0[D 0S , S00 00@ Q`42PP00(4 0 4P00 0A000 00PPPL*o0S@82P 0P40 0H03/0S0P, p p0C @P0D P000ŋ`@0SP`P 1(0p(1QPP ! B B2"PQ% ,0H ,0R BH" a, a 0 R80pPn 0 R01(1#0ഁ000Ѝ<0X ∑0L0 3/ 00X0 ,b0  * 0 P  1@0 B )R R9PR Q0r Q0CFS0TR000US0a0Ѝ@0 pp 9PT00U00Ha@0 \%41R7 (R3 !R/ R-R H ` ` 0R 0R`[XoFT00U00V HW @y9P0 /S`Sp`` [XtT00U0,`0P!l, l,l,c"T8 Ttm, 8Tp,, O-0MSأ@pЍ`  W0 @0 P0S% cS2 %MS) CS, GS R 0VP PSS! W+0C?o20S 000 00SmS sS gSR 0R RO-OM M400 00 P00 <0 0PP0@@00P P(0 0H03/000400 0!6 0R 0 ( 03/ 0`` S08 d&PX&a0XU\a`0$080,&00,00$0 h(`p0JpD0HWX0h05R0p0lh Y `Vp Sh P`U Th HPUh BVU 00D0 TPndb_]0`000@ S40P0O>0=C0H0<0dP000D0 004U$xhUT0 R  P~n0 000H0P0 F0PT0S %xoWP 0S80Q00`Q0S 0 L0aA3/P 0P P  2/``dF pBX!ZP0?UUP 0 Z [ Q P <0 S@0 D  R8X# a`0"$0$0,0(0,0$0!$0倒 DX 0VU 0xlO0  0IU` 04A F0?UȐ 0 7x0h00l01 0Ht0p^D+#F+ FL L0 S*pV 0 TmU 00l0 Tm0@ TmP0+,0$ Q00Q03S (0A"PL?tp 0 P &E00P3/` 0``APQ5VP04PT1(/ Oލ Ѝ 0 Z C 0 [ ? Z 8,, SV3 i0#@-@! 0$   0 P 0"ġ0S 0$ O-Mp( ,P|@`1/0@T0P5@PZ@TP0 0lT 0peTpW U T 0YTY00 @$P $ W<000$08<8p 0` S04 $i$a0LL0d00h04O0l0d Z pW P޿d QpQؿd KWJ 0 Pl qom3$ 0X0 0p0p0 0\p@0800<00#pWP0, R)  Tl0 0p@0T0 F0pTP0P =pUPP6 $Ѝ L 0 PqlT0 0S! 0S4 `Q00Q0S 0 L0aA3/Pb  0开0S S 0%PTrp; 0U%PJ003/%B0K0 p01( 0R, Q ( , W (p,  R\ 0Wp(0S,0 0>9003/p 0Xpd0%WQXcpE0 Z00 Dy+p 0SpW000 0Cpÿ D0%SpWP傿0W000 000W 000$0=,SV,03 0@-@M@0L0 3/P" ! !WQ 0 0 SS@Ѝp@-MMM`P; `@P X C iMލЍp{dЀ@-@P HiTP <dTP ,_To :p@-08M@ ! 0`P 0 @@wP8Ѝp C 01/@P  0Q$AHL Q>0 R 0S P P 0$003/$qꬰ,#0pQ@-s #"T R0//s@-(@T@ЍpH坻0P噻0 w003/@P/@-tMQ`P Q@0 p@@(P  90@Tp@tЍT0 @T0x p0p d p `P P a@坻㛵@, .,D(P,]k/@- l@i%///@-0@Q sr@o?0 \ 0P000@-4M@0  TP0PUVP0U 000 0 0 04Ѝ0贐,//A-pP@`VT0S0S XPPH0P$1U(P0U00 0X0`p@(,0SR00/p@-@PN<0<`P" 6D0# A@$!p,,A-`8P@PpP( @ A긐,@-fi@-0@-AM  S0p 0S YJPPL00@ôT 44 0|( xAߍ0cd,h1G-`1MP@1!Pt1t10pppl5`PBL@UD 0[_ ߍ ὚@P +fN O@P 0=SN ?A@0 @0 T@  @P t0 LFP P CF@ 9:t<, X1A-@1P%`p1!PP0P0P`P`P0 D F 00[g<,9:/%GZrp@-M0020000`0P0@P @T 1X 1T1O/1 0jP1O/1 Ѝp ;R$0 @- P O,@-CM` P@RP p0 0`弳0S1O/1 Cߍ5Sl| |p pdPX \\X[0S D T81, 1d,c,,-M;Jp@-P@U!1 1  p,1p@-P`P@ 0  p@Np@-P@[P $11P N/ pZV1p@-@PC1(1 P1 1 piV@-0@ZC-aM@.pMRTV PS2彸PPG aߍP V}P L"Q080E0"0HlP ",@2X , M 0n, L ,X1N?L0 !0, P P|1|10 tAtaPpU U UgP10$0PU@8!88A`,ppP0S S  @Q 0 0`P@)P0@h8 B`8   & 0F 0 0 p000  ᜵,@zc,5{<,=9:l&,,c,d,,?-?-l @l KA-P$pPa@P-@T E ?制P( 0 2P 0 .D P M@uoЍW``uX < 0`GȂ<,W  u h//O-c@T Ѝ@T@T) ^' P@ U[Z [Сԑ YZ PUPE P P$P@ P$@0"/,O-L0P  `Ra BQQ pQQ 0@S:p @-H.0RH #@-;0@-@P4M0S!1PP Q*  P +U 0@S Q 0S4Ѝ0 ,p@-0@ ^T00PUPU' \$ST ݵp 2@Q^U@.P@@ $ $ 0 00C 0p0 8 ~p@-,@P8O0P ;pA-@D`DPp0ST0ԗ@0"T 0!, 00S@- /,`,C-ẋ(pX,P0`@$ 0АYĐY T  T:\0WaU U VP P 0,U Ѝ :V0   &+@-@P 0  M@ )! 0@-@0Sh 0T0"S D0 <00R( T4 0,,,G-Ph`0Sp;@S S 2@1+1:X p  QBp\T.@T&RQ0000(Q $6J Q 0S T v9: 0@1 00 0TRTR"01 ,{p@-P@u@op1O-@0pSP` 0 PQQQS RK0VȰСr0 $P 0 0"00=0(Q $I01, X#Q  F vQ 090  R [ R pR L0L LL R# Ѝ  W1Q:`0, 8! p@-PL@0S!U 0E p(0"PE0U055403 0(2#p,,,40@-@0SfDP0@0ӕ,!A-PA`0ST!U 0E p@0SV Ѝ 4 U(0@⬳`P 0`4p0@00 ]M` 0PpH p̳ `< P00'p(0,0`,,,s h1A-P0pS@`  0PQQA S90 #M2  0r !Rv?000  ! (0V$0X3,00S0001RPp0S0 00 0W1S` ,P@- @x00S T ]LЍ=X0O-SMM2"K\0@S2"`0S2"bd0S2p"h0Sx2T"tH 80SLᕴ80S 84 SRN80S , 70pHPASTPPEP @3@`P. @   \00`0d  00h X p h;S \L!L@0߻P@_oRݍЍ0 :S 000a 1 00 0 0 0C0 ;0CS||Pp V! 2 K c ~  d9& Ȃ     !X@ P  1  O-TM0$00(0040 0800000,0 0 <0 0$$ 0!$00(0 00p @ @P 0ST`DP @`Q0[ [ !1R  nF [`RP`XP` P40$ S80( 004 8R0$0( P 0XX0S$ $ `;PS S2P11: 0S D 00PA`^U:PU2QP0 Đ(Q $.G,0S ! 0S E ,v07<0P1 0$ 0 0 0 S 0  0S 0$ TЍUQUB"01 ,{p@-@TP0S!R+)r00 S @ 0N Dp ,O--BM MXt\0@P 0P(` ; PpBލ ЍH0 BP Q 0   d00 )0 0v0$0!`4X00 pvP0F`F0;S  PDPV +RQ 0P \Q SC0Rpʨ0S R2 S - S/ S0S00000000`0 P 0S  Z6 0 R$ ?!o 0$ S0S 0$ P0jedAf O-DMhPl`tPDЍ%@P >$p6# S0 D P`;#S0Dp0 d00`0\ h0x00Xm P$`P`t0(08 Hq000 00 00p;p! @-`X0S0 gH\0@S0 h`0S0x id0Sp0\ jh0SX0@ kpP S 0&ß Ѝ X! 2 K c ~ O-MpD001PUЍ䠟䰟`PE 0S Y0@  0 0 p1/Q S@@@  Q  Q @ 0@0R0 0p1/P @,p!A-Pp@`0S P8p0 S7/P 0403/P 0D03/P0403/A-d@p`P1S 3/`V@Td0@@T0P0S@000S4000S(0000A,p!,,p!!!p@-@4`4P0Sp@10S 3/@,,0 0#0/0@0/p@-@8Pq, 00080sp` ^/ 4R R0 0`40$ Rp `083/<0 0"0`P0000X0S 3/ 0P001S01 0S0P000 8 00//00/00/00/10/Q@-@@@ 0A0003/@P   @XC-`BEM0SP;0׮p HC0SήAC0StǮ :C0S 3C0S@幮,C0S(岮%C0Sk㫮C0S00$ R!000 $% % F   0 0  qd 00吥p`嵨@ 0弤8 @,0p`$0`4 4!0 ` 40000 f0,0 pB0$10֧0$10\Ч\0d00h0@ 0l0`pLA00S<p0  PÁt ,l3 000000 000 0  080pp` 3d,0\l0S> S@; SN`p%P H3/P 0p0072|0 00p L03/P x0| 0 00S 00CS`p 0SV 0崧=P2Q }eЍGP$00SZ 3/@@OoBS P00&0 1@0@!Rx!@!x@|@pPpt@|t0S|0X*@.P PQ 0!R@x 0T:x0S@ 嘧t@OoB@|0xT:@ꬰ,; ! ,,L h Rc"08Ҋ  , u$7 <,S >SO-[?UM,0844@8 ` D 'pP "PU Uߍ0P P 00PF30 40S 0RB 80S8(1SI 1<00H ,HLAP4#0?4  H@$#; $kqn @0P⪦PI@T 2"B 00!P0S 3/Pt20 SU0%0c@D0`t T2R= 1@Y,N 4H@`/(HD! @<#P`T@P ` :@ :,:,00 0040^ @ዧ z:   , 倧 o:, wᘦd:40P1:1!> @0 000000 00000 0Qp` D-D0S0 5#7Q[T Y fdb0`v ႣY,,c" Д no ! G-JMM/0`@0PP++P& 0S" h"`0R!p//9P T` H 0@T* /R  P:@@m+* P:/@?0 `H,P+0: S pW @>00ꨠ|! PJ>0@0/SjH!0+ * S{P`+* P*6P 0/S`0oo`bS 9p90&000 SV|+G* P*+A* P*yP?@t?@`oJލЍ=   @-*@-M @PЍ(0  :@P / P FD0S:$c(#"c  8#8S G-`Z%PPp X`p*@P"Ѝ0S @x :Pd0 QpL. P Xp $0 @堭 'S   A-Mp `PXP HP4+)1@P@ 0s@ @Py+J)rJ.0Vj+J)xcJ.P0GL[P @PP|<R, 7PPsg+J)CJ.0'PPcW+Ju)3 JB`+ PPL@+、J])hp0`!0J>P 0.P UT ލP@[+J1)JPPpJ.@0ͬ+) ìP h lJ>⼬PT         9  + 8 I H t& +   H /00/00/00/00/0@-4M@0#|0$P 07P` +P0T0670 PT P @(4Ѝ0,SV,,O-MA Ad2,000PB,0 0000/ 80s0`0P, p $  ?(0$0K 0s$00 0$h5 S`@ @`o@0S 80< 03/P0p80<P Ѝpv'80s D@0 0 0Q:8`0S0` L0$3/$P & [P T0T2y@X"&(@N@@,0S:0x,"(0PBP@0@00 +0@080s=0 0@( Y W|Ѝ#R!@&(00\1 05`!00 XTq@!0(P R P@ )!0 0 h0 @ 0400t0S00XTH00P0 P@| 0(@h p@8q 3/P, g *    # 0@-)@M:0 p\*4 +Ҡ@,ϠP 0*ŠP -㾠 F 0.㴠0  0|Ѝ0!0P80 S+P ,㘠P & Ҋ,!9 , A- @"(0M :( x0PQ2d2 5  L! H! D!, 1 0 8!8 @`0$ P$p 0PUp 0S0p\(Pp,P(FAᷝ(00FC0Ѝ0`0 PCp0 L03/P 000P 0p0  UPp0 !  O-p4@`00Y)Z]p !!џPV 0p  0 P 09Q 0S  h%00,0 84p $0T0 0X05p0 P,[.[ P Q  050 P8q84p T$00Q[ 0  Q QPPZ 00 00 Ѝl2O-M04p@$P ` PP $0 Sz22@|x 1 0100 0A00000@l̙l9x0SS(*PPL p0(P嚡!1P0PA x 0R`( b ",0x  B 8 8 0 8凝Ph lY,0( 040x0?o21000Ѝ0&#ꬰ, u O-pᨑ娱,M@0S0 /00  I0S,Ѝ/S  a/00P`p0U1(ᦞ`P p㙑!埞PP PP%0(` 1`Q8 M80400,00`T00 X08`尟0100& 4p0P _奞 P&E`,WO-\M@P4 p`儰80 SU 0 Q$0S   $ pܝPd9\ЍO*.P38  P%0#p#K*,9v`00000YF(0S` ` 0 RH03/0p``0[ 80s ȟ0 Q0 0 \0  BR0S0pS 0[p08 r  *   * PU0'0U " [P R 0S  0*2 PP p00 . P 0$ PU$0[00  [tp0 PU[n0[( !P$: p00 00$0 0 $0 0pS 0pW 1pWZ 0 p 0P Z$0 0 S*0 0S  01 00#0 P4S 0U PpСZ050@ D Z0)  Z$ R Rp 0S  S0 0Q0000 00000000 \Ѝ,PT P 0Sp  0 ,4P80 TQ 0X 803/P0  0, 0( 0R T RR0  0 ,0S P @0 0 0 , R 0R  `xR  2P` 2P 0 Q ``T R T  R X `( 0SY0( L03/P <00S D0SS000(( pAL0( 3/P 80<00S (0, S004 Q 0( `M0Q =0G0[^80s[ 0*0 PQ 0N[pq! 0 QQ 80s 0  00UPppy0  R 0S  0g0 @p0  0  .4,!,أ,! O-@-M`,p0 40PVY pepPT Pp0Z:`PU`J6ERUA 6&z400#h R 0  80s0`F`pHU p 5h0S 00  80spHY pPp 5h0l0 0L03/, 00Y:pPpFp0 0P80l5ЍOp0H03/,08$ $( 0RPP$P(0<00WR:< R4*,0, 0$` 0S `0S< p$`Sp $ PR( P`$ (0/PU` P0 Sb@D S [0S 0 8P`p0VT:00S40000040,0(pWr틟8`0[:8`pp)p < p00<<* `8q ,0,( 0L03/0 0000 0V `V0$0( 0S ` $ (07/`V`P p0l  008,0,p(p<0yS 0| 1/0 0P SR 08到 0;/`0P~0H03/v8P0@00D00Z|*p 0<0 `80s_00\ <0 0RV04@ RD0  0H3/PB $ <0 %P 0 0X 80T,3/00T00X0 0\0$0`0(0d0,00 03/p 0L0 3/008 000@0 `0[ `0  . V00 400Pm۶N !]~ 4,! 0 0Q4 0ppP80s00  h0S l Y|* 0L03/Po !0 儐X09/Pe Λ000400$00(0 0$0 0S(0   0H3/P, X$ 0 03/p8  0L03/ pPpP$0( 0S pP(0$  . W00 40000400$00(0 0$0( 0c<,$ 0 0 0  0H3/P0`p 0R04$( $ R( 0  0H3/P+ $ %P 0 0X 0T80,3/00T00X0 0\0$0`0(0d0,0T0S ,0S| P0 P  R0P0t000400$00(0 0$0( 0c<,$ 0 0 0  0H3/PP80s0 00- Q ( 0 S% 0 Rj80X T,3/00T00X0 0\0$0`0(0d0,0 0Sz 3/p^p0`0W:0p Sn:Pp`,0 0Um:8哙P  0$ $0S p 0p0 SpJ`P 80  p0R:pYP Y:PpW 00U0#S ap`ЍL0 3/P@D0 RP RP 0 L03/040T0S ,0S P0 P  R0P0ꌀ 8/ #"08,0,0 L03/P 00p开8S  8y\ X W08P@DH0Pd00   8 rp0h p`o!8p 40U 00 0S 0P*` p 2_80s0 L0 3/P 0400H0,8 00,0+$0T00X0pPF 00 80sh p 1P=p@-@P(M'(0Sc(`,`b000P0 F0 0PP` p P(XP,(}(P(Ѝp000,,噕(q0,`(P?- RH ,O-`XM)1$qS W W(!0 "@PЍ00> p C 0 1/pP0$q Q 0 >  1/@P@p 0X: @1XS<1@1\1HL1X\1Pp(, !L#0`@ 0$'8Y '0 S0 W %&, R0N80000,  0 0@0;80000  0'\喗0,0H(H0P00T0(0P X0L0W0 000850p0  %  %  P%,  (P 0 %<  5 000000 000 00X0app Q<5P,09ᦔXpW* 0GS0.>( CP$ 00S H @3/4pGWp@ 0 L03/P 00S 0Sp003/0pH03/ 0! P7/P%$%$)@0 QIYb @J@DpH L0 YZ03/ 0 0TQ  01/ 0S 2".$Є  0<P 0k Hp0  @D@儀 0X60X< Plw,0S$,pP p@H0 0H008L0P 3/P p0`0 0`0080P 8/00@D@H,pP 0,QQTQ@Dp pT Q  Q0p p@08L0P 3/P `00`00p80P 7/00P  P 0000000 0P 000hꬰ,,c"p408Ҋ ,  u$7 ! !~  @-} 0@Pp`4M#@0S $d0 L03/P 80< 0 ` 80< 8PUV`4Ѝ R00S 0 //O-@0SpP 0< #80s#    ` 002.  ؠ`0SQ,  R) 0 0#Q! Q0 2.<{# 8 0 r  1# 000 S   7$ 1 SR8C801/,0! /,p@-@$P x1SP 003/p@x1|P$ 0SO-KMM~p@㻞G<0`DPI;0S K2 @,0=.,0 0 o=(0< 5#Pⴋ 娫 K@T80 00U 0 00000@0萍0 I@@@@0 pK܍ЍIQ+R*o=(0<2#8 ;c&@@ u-O-M0M,0t1`l@0pP 0S (0 S> 9 H-00 0 <0.%"P@~40k`0V,p0 0000000U 0 0000000p0 0岑p`ލЍG⊎,0S*< !,00+C#X0S000C0C0000S0 0,0B$P, u-@-@-0  !<$10(10,1P001.@-@{-0 0! 0O-4M\`XThp(0P  啒"\ @,@;/,P R7P 9PpK H-p WpF2 >- "0  00 0(0 0 0`jB(04ЍO/Pr4Ѝ[;0p@-@Q*P傓 0  P{40 Ppu<0h p@ PTl80 P@f,0 P`00 p!' ) *+p@-PBM `@N 2 V`PA0 P8 Bߍp`-00PS'0`"40Pp`80S80P8 < X0S4!ڳ@$0  P\0 `0S ij@ `d0Ph0Sڴ ⴳ@l0Sڌ ⪳@p0SL ⠳@T`˒t0P^!9 : ;=K>?  A BCEp@-`M<P@ᯒ   1U%PDPK0 @00S    8PU@叒 0 #P凒0 ܍p(0Sx  H@h,0SP  >@D00S4  4@$^! / 12 3p@-0M01P@Q#J 0`N   0S (0Sp v  r,`VH ܍p4' 0`N  ] 0S (0S  S  O,`VP$0 P 0 P0 Pt0 P`0 PL0 P 0 ! X    C-`RGM8 C"\0S0 `F`| a0p⇞ 0S UL Q`,p WV o$ I` u00"  `"ᛑߍ@ 0  0S  # `PV 1 `SN0  `Ґ 0  0S @0S @ ߍCW<0040!00倱@0Fo$ 0DL03/00 N0S !0f{D` 0S , 8`Y40p x Q0X 8 < RFO    7 0 /@6@^ 0  m R0_ 0  !' p8 |  C &XI W w_ .a @-x @)+0 @0p0d#@ bi @-@ @)000(0,0000d@ Mꐯr @-`dQKM0@sP!   0n1!S=0DKߍ0@ 00 @@0,P(@UTpp (`0 ᘰ0  0`0`pRCPNC"XZX2Y 0DPp幍 @Pe@0 $N,ЍPp嫍1PeS` 1S !N !!f@p@d⒍ P0Pp劍1PeS` ネ01S  1SxH!0B@p0@d 1S 1S$1 !2@p@d 1S 1S(1 "@p@d 1S 1S,1 @p|@d 1S 1S01L @p@@d,p`!F!,SVX O-0`QWMdv01 @T&0P 0T&<)460S ((000S'6L@TP| }1AS 0S@  1P11$P |X003/$}1S}Ax0 00 x 01!+Q9  Q 4  0(%X⎭0S/X&0 ΃}!΃L )!6<1,!X  X"0S0b㄁0b/& 0x0S 0XX0y"0 P}!11VUj @<T0e"@T30S D 00D0C 000H30S >D00H0P3@L00P00 0000T0D030S D 00D0p@ 2%b"`0""  %X2}/ 0 S"0C 1šWߍ %0 p2 0@00 0)1S080.$0X80p$P! 0 SL0X 3/P h W pW 00%$1/pt0S _PWC0A00M  000?% 0" $!  8 0X L03/P ht0S 0_Sʚ  0% 0" 0 0p@080 0S0,,y ,,`, 8 7Ա,!! ,б,! #|3 K60S/O-@MU腟 MpPi 0 0x Rp#`R0ZDad80  @Q D0 \PY P TPC 8%8o % i`V800(0S$$BX00,0S$ޫ$BK0000Sڔ$ѫt$B>0+ 0 d0B/P `ὠx 00 0; Q <0 Sn0y0!#媫#B0#0 0=,0Sn0y0⚫#B0 00;8 R3#0㉫T#B0l#0 0=<0Sn0y0y#B( K 0 R #j"B 0 R "\"B0x 6#0= 0Sڨ"L`"Bx 00 0=$0Sh";"B0 00=(0S0",!B0x 6#0=00S!!Bx 00 0=40Sڴ! \!Bx0 00=80S|! !Bi0x 6#0;! I1P/S L(⪉0(0 00b0SvU () &0S `P 00!15:%  ᵐP r Q 0, ($! d$ 墐P`0 0 8a4Q101V,D,0, c"  + 7 y 0S@0@-S@00 0S/H,2 O-EM 2@PT P0 x2Pp |1S$ $P| 003/P ,2P $  Eߍ$0 R P 01/0P 003/P A10SW aPPD  <0 040000,00800 pP@2@0S- $P* 0 x0D 0Ա,, ,tD,б,Z,C A-0M$^@ QP`p@0 L03/P 0 @p$ 0S0Ѝ 0Q@#*11P0\  R'l1@h1@T@0SP-D1@1^0P@@T @ T6 @pW3dpW0V82# @  R @ RD RV @  @H0p W P^ TXV ,0"0P0 0R,0Ό R8<0Ա,,б,,,,\0p@-T00P DPPp0AS@  1SAw`,,0,0@-P$4M0@L0 3/P T  0P  0S4Ѝ00^@ ^T 0SR2",p0\ Q0/\P  ^U Q0000@-,O-GMMz0l7d2@`(T H2 00V 0 000000P0@@@@ @E0Zp@a(< ](G܍Ѝ$1SpA08 L03/P `7Z Z ZT7S p$ 0ST7S8 P P PP C 01/P ,00 H$L Q>ꬰ,80S 0 @-/᛽!m 7 G-`ᔐ唠@PX0r2 S80S00 00 S80S0|1 P%S$1S00 0VUp@-8M`8 @ jT P $QvD$00S U  0|1 08Ѝp~P FP P Q K P 2 z P ,A-M|8 P&U`ЍFP $A003/0 R   01/`P 003/@P$a0H03/0 `pXDD2 08 8/PD> 0!! `7# 0 3/P"0#"#0 03/p 0` L03/ܾt ͺp` 0SWp`?`B414!440<0S P L3/00 L03/P @0D t0Rxp`00 L03/P @0D t0R 4 d00`RP  v00`p 0Sv P  0|1 0@`!! 7 ,G-`RMXr@ 8PPl P\` `RP P9 4 ᠟p 0S  L}ߍ<0H(00,0 00004008004004 04$0D0(0P zwW[  vpUt pp*h \4m 8 ` <R 0%S $!S S S 0,0S0 S ` p 0`?`a8SڐPb   00*P*00մ  0* 9d@edA9zd@-:{9:999 ::A-@Mp`;@ @>p@ݍ P0@0@ႝT00 ##  /O-4MFpT(t,$ X\p&`AT  0%YY 0 0<R. R 0Xpp @P R$ P#2Q4ЍS< 00 Y+Q X( Q   0T pTp 0pWW 0 0Y084p<  ,(W \^ Z9 RR  Z$ 0 Y000 00TpTp 0ypWW  00 R R\p\ ؀0@-4MP!! 0 P P P@4Ѝ0 00P/S0D0SD/0- 0S^0$^ (H P@  @ \@0P00@0/A-`@@

 R0 >h!^000㛓#000X    ,b( [: {T  ^P ؀!\R 00 0Sx 0 0<0< H0S< < 0! yd|dd9&l{dЀ !{  0$\ (00t S S  S00/Q 0P/0S 0S P//!R808 88@-R )r0@/ !{ 80R*@-0M@"P0 0! 0!  P0Ѝ/00S/,P`p@-@(P0S0S0< 4 p,@-@0S,A-@lP0ST 0S` @ <0P@`PV@,Ss@-@P ' `yP }Ѝp8nP }d`P ( PP )P` QP KP(  CP` Dx9PhWPP 0SP` P )`P @00@0    ' - 4  !@-  ǁP ڈ{ P yЍXWW0S  0t${Py@  !tO-M M@@P;B/$@pPz(` F̙pt \p00@@Q$D0S8 R( y0 PY0D04@T,4@0@T30@T00 0 ҽF z P P    0wP  p 00#ᬁ؀2y@0V  00#l #ᚁ000G  `#HP܍ Ѝ04 040RP8< 8<0RPy0( S 00#jPDD :P x#\P@h Y Y#HOP@m  P #P0&$ D0S(0 D Sx0S؃  0 0 0 `@00t#Y@#000@40 D `d@c j { ̳ 3 @-M0 0Xu 0@S|( @qxPXwT x@08⍘8  P 0  MЍpsi !{ @-Kv0SЍ@-M@ uT0  CR$00S ЍwA-@lP0ST 0S` @f  y0U0Q0SpPX y`X x0P00`0S  ` ` P,00W80@00<0 P0$000(000S L k P sPP H!u$0S(00,uVލЍ` D0pp0<00008``#404S``V L Pp0p`00S00PP 0P0 0@50 ( 0!$00(0080 0<0$0500D0.;`W0 PpUP PPTP P X`0prT`PP,tᐓ0S 4 R 000 0#ᦰ0P 0S ጰ뼀 08$ <0S P 0$ 0800S`P ϔP`\0S 040 Q\8<0 Q\ P   9P` ! !{ ,  , tV VV4 !|d@-a0P0P,,7@-@ P00l 0 0f 0 0` 000 P   S Ѝ0O-LMp`@ P8J 80 6(080C 붳 6⼳= 붣  B⾣@A3 0sS) 0lSq` 80P8 6# p)G0$0F0 0E00D00C00B00 (0 x0p 8,0,0P P 0'"0 p LЍpW0`Vpp !_YC-`P`PT\0(Ѝp!0SQP ؁1/T 00c O-DM  0000 00 0 zp 00 4`Ro04`800,00$ (0  fp ,08<\@?! ( _5#Z<P0$P00p/2#*_.08 RP0 \X C PTuU G" ?P1 0HL R0@ p ?  |0 y`/G$'@ T R@`000 00 0  p 0S #"01# 0?04 SQY H0V`00P0pYkXUDЍ謰,/C-`@4M0`} p\ X \^ PRPR VS  RQ \R   0   pЍO- ! @-1` QPp@-@pP0S0ST 0DSTPS$D  p# @0p ,,08S^5/,,p@- @ 0(  P0R0PS 00Sj KppM-NM`<Р@Pp Lp`0  p `ቋ000 ;ۤPP@ ᖋp&Nލ"  ydG-xM` ✐堠@pSP! !0@P 0S PU 0 R<D1D!DD00S 00" !P@&P0 0S0H L03/P HL 0RPPT $0RP0 0  x@04/@xЍY Y ZL   YZ( ( 긋 !  O-pBM M@P`/0;( P<@0P0P0iP) Y $;$  h P!14"S5 0Sjto@ mU01U01Bލ Ѝ 0h0P0  h?XY$0 0I0,jj?X Y 0oS 1 SR 1S  RS1S1S p2?R_0Q  @0 0@QD 0H 0LD0!1F41Q 04 8 <" 0PS@@Q Q' Q0PUTi 0"0S0S0@0hP P `@@=02s 2 02@F @DURX A- 0MHL`Pp h1h!hhPh@P( T00 0R`0 !?020!20Q02p 04 pi0Ѝ 0S" $0Q00 L03/P Q P 0Q 0 SD S003/ ! >,P/@-\ @  0 2BS20D0C@AuOvO0w.#8\0 A- P0\\@@ \ 8\ @T h@ `Č `Ȍ `̌b` ` p SČpȌ`! 2/ ``~``a0q1P ip`T8uBpP08} ^\ 0Sp`82S04@1111111110 8l2~`S@0 P P0c0@SP0 0HL R   ? H ?E/Z[d0P @10`d ἐ 09/0P@\Ѝ ,G-p0@PH8L041\`  S ^ ?Y R  0\ X0?Pࠡ࠱000^ 0 G/謰,>00@-M 410@810!a0 P00 0Lua0 J0PU ! 5/5Ѝ0謰,@- Hb@ ހ@-@  0Hc" X2&@-@@0s,00p ra0Co& --?$M0 0 K$Ѝ-4M0 00 000P4ЍO-p-MMDUс " pȁp4 Ѐ0 `0 `V00( 0R0`V00"R 0*`ğ`S0S 0s 0SMߍ0S P 0 `b30SP #1⢁Px#S 04 Ү{0 A(6<# Ae{{zdWdp0ᅁ3 2R - BPP   BRڒ"B " e"2gPŸ 0 R#3SPgShr0100 T"eM0 $P P(0 0SZP=9 =:pk{ޮ1 AP09f A k Qr 5 P;!%#3ZQ/ q  d 0@!0e P! $1PP0& peS P *!5"%+0! V 5 P0Se ؀P0 0p CY@.A - - - -4h -X -c -Qc"x!jt - -@~ 0P M0 A HD0 A k{I{7{jV0P x  ᑀp὞gP<<`᳞ 0 }P  w@-t@vp@SRG-@  e700pP ą`P:X:00X 0KP @-Pp@`P0S -S :S S 000`  0 )P00 ЍU0S T  _Pd9&p@-@P~p  `~@~U700@pp@-P 4`~p@  g~P~@p@-M@ p$ ЍG-`p@T2 P  P0IPE ~PP& PE0P @ R R0 RR00#R0;R0S Q \Q  "Q0# #QS0 @-3M M Jp 3ݍ Ѝ p@-P R`@0 @ R0 00S ] UPE P3ЍpA-@Pp p`" j 0W0 |0WxX Uh0X`0 P U <0H  0@ 0hAЍ P 04c"T \ = d @-`0tM0FP?o2p @p ~p} @~p h2S~p L0V#4 - tЍh"}pp@-P@@~pPpp0 p@-@ }0 S " 0PUPUp@^0S   0 0S ^^0S   0 0S ^^A-pM@PU `0S@PE7  N0P00ۍXڎ700S @ Q@BPE@C000  pLr0S n0#S @UX |!   @-MP @  |p8lۍP  !h1p@-0SM` LLЍp@@>  <P  0 !   |p0 S 09S .Ѝp0 S   000 00P0 PS l0@ k pDLj  Ѝp@p !!  p@-@$`P^[Pp0 @ `P0 002 0pSp@-PxM@`  >j0 0g|p@) U|p$  O|p I|p  C|p  P L0   p(0xЍpt 1|!  0 0 s@->@P`<p @t0 p``X0 )p <0@  pЍp$! p@-@PqP  {01CpP`qpI {0#1/pp@-pM0 p @ {p{@pЍO-QMM700ۍЍ   Z ` @V ^{@pP` @-`R00 Ѝ0Pp@STn[@PT  Q*R@00 S   0 0S0 S *[P `\\  00000 0` @@0P  @-@ @ !L1p@-S@T1S"d1S,RU6lRUppbV7lF\lbp1CA\L10CL1SP:\0P11C4\T10CT1SX-\0X11C'\d10Cd1Sh \0h1]2,P0C2bV\bPp2,P0Cp27@-@0 PP$ H1 0D1-0@80@ CB Ѝ0@8 Ѝ0Q@-@  z  bzP p 00`b Ѝ@ Q @40 P pЍ@M Ѝ ! Q@-@  J  WzP p 002 Ѝ@ 1S70|[1YP| 01 @40 pЍ@ Ѝ (! t0@-M0@Q0$)p Ѝ  9! 081/@-@du&P0S  P 0800L0S S@\&  0,p@-\M@ Q t0  0p\Ѝ 0@-800@@? P@-@~p t10cSt14 Ѝ@ @0d  Ѝ' DQ7@-@  ,, _ Byp z Py Ѝ0@ P 11P,|1@ R  |%pAQP |`00CS`0X t|@X0 Ep 0< Ѝ0@B X0 X Ѝ0 K!2&1& p@-PDQypp@00 @)zp p@Uy(= p@-P@ ` 0x8 , [=U\% 0[ 0 008 , 81pp@y M E p@-`<1P:<1x1S0p0@Tp 0S   ʌ0@-@T 0S @C-p`,X0$:0P   1000  qH,`Q 0a(!"4a4# 0'F0 >Q & P X  h080cP040 Ѝ 0b"!4b4# 0S %/0p@-8P`J040 :0:G@ PpP  Pp%pp@-8a P0S t`QP  -+t R P 0S ;T: 0S 0<" ЍA" ЍB ] o   !  0, 0@-@x P $ La@ L0p@-S`@P 08PU $00P   81 0800S>? $0080S  p, A p p@!@-@@O-`-M@0IR@pPT0Ѝ zP R+W& 080 C F"0  Z0800 >X  R @@ FX   7 C-`HMa0@  ЍPPe p0 P , qupnP1 P P2 P7 TlP@ P8!887@p$R! ,Q0S000 0M 00  ` x}D!\10B0H1x=l l<xF 4Pʍ! 2  "  *    -   3    @-@  ,up oP<1 ,(,u0,1ЍPDH0<1 P$6 %!g   Q/@-@  0S@qC-`@ xf @P+00@ 0S  ay0 Sx   0@ Ѝ0  pPt~< @P @00PEU  x ) PP 0S  )$0$0> > R **X 5 0S .@0 S   000x1  @  0SP P 080 S   0  4!  A-M0 P0 0E0!@0Egup 00`+t`pQw~07S z0 S X d0E 0\!`1  `Px1  ލ ' R PpP0 S   x 0pP 0 PPUUxx x x1p  P  0S 0|$0 PK!  W <PQ@-@  ll6*p 07S@\0 S 0VS0S@l _!A-`R@M@p PP U 70 0@ЍASP"R 0S 0 'r>XU$  *P 0S <0 *O p \ <0E <V>P  *@ЍA@Ѝq!l   O-@P$MpP  P 00A. $ЍOPw P000 P`P`PVQ`P  PE  0PE 00[PPIcTPPP P00#3Zp`r 8118100x1pW*  rPx1pF 81181kP NP00 6PP4PPUPpP xP 0: 0 nP P ` 0S 0 0p  P YY p 000 0S 0 0pW81181$Ѝ  P YY  op 00W0 0 0 :0C WUx1  0 2  R @ [ P W @(00 0Ƞ0  UB U  H0Ƞ0UB ;6 0S W xx0P 0S ``W`ʁ'`0x x      X+&% !@->@T( 4"4p P`0="@4"4 04W QL L0 b"!4b4# 0%@> * >0@D Ѝ耼p1p@-SMP"!` "$@P T 0p1!V R 0S X\myPP Df@tAtЍpp>0S O0x1@T l1S E  @>0S@ 8`l1S   {0 @ PbP 0 @  B00.#p ,l1S   X! +  W 0 R/ 1/ -/A-@P 1 !  PSXp0 RqP 0`0Sq000S \ \ 0 S   000S00@00P10 paU0OPm !G{  0P@-p0p ppq 100P R&0   Um !{ p@-`@TP\@@^0S\*\@\0 0SZ0 5Pk9 <R0p@-M`@Pq (0x`p`FSЍ R*p 0  B\ L *R B  ʚ;G-PP $L1L!LLY@10!<`41V(@p 1!0 S0 R S,   @T0@T 0 S4  0(p `Q ,00@,@O@P0S 0S0 @@m !{  ʚ; @-@^]00 Ѝ ^   ʚ;@-0 Ѝ@-P`p@j,p0 000"#l ЍMb@Bp@-P(0 PUPUR PU PTP,PP@PP4PP4\pQ@ m !{ P 0 )@-0PT0/m /!{ P0 @-0T0/m :!{ //P@-(0( ((@008< D0m F!{ @-,MP` ~10U@0$00 0@p000 0<0S +op,Ѝ8010C>S00@( ( 03(00@000 0<0S80 np @ m Z!Y{ @-XO@P EppIP@0  0  (0,  0004 P0-s@-@T0P0Ѝp@Ѝ/ r Pp @/o" R 0Q000p n00C0PPU 0`0HP0HPLPU0 P(P0P0V00 S   0O0 S ,  0O0 S 4  0O@-@@OC-@PM b夂pT0SY 00C01@0S D3/\2\"\\(PU0S Pf0S R=0 S ,  003/00400P4P+!0 P0V0U0S/ L0 S*H ᩥP% HLH0 R |Q    00   CCU 0 HgM0SP(pw0S} s`ЍT0u0S 0S   ,! Q 03/PEU[ YW -m l!{ @-8 0)(@ /p@ t@ЍX2&A-M`M4Psp Io0 op@ m@ۍЍ4F P P  ӣ#P@@#C 4,0 @4   Q&X2&-@-  Ѝ Ѝ/@-MMP`@0 p nP  0pۍЍ-@-  Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  l ЍЍ/-@-  ЍЍ/-@-  V ЍЍ/-@-  ЍЍ/-@-  @ ЍЍ/0/& 0p/P&@-M Mx lp P@;00 dSV V00@ۍ Ѝ$Pp0 4Nd&X0/&@-@ @QP4 @KP&p@-@`Ph;T ޤ4  PP   6PT V00pp&X2&+P@-@Pv9>=@M@-@ p !mp !mp`@-q@ l01p l01@ mp@-MP@`   n0X mp 1@ R! (0 p`Ѝpii$0 /L0s P/P  //@-\M>PUV0P0\ЍU700@` pR0 PU B0>00 0<0  ,> I PP> *f @-@T=@Q/Z@-@T >@0P/- R 0 R00^ PG-`P M.0(0S @ P P P:`P 0!00 0  0S80 00 Ѝ080 00S # P`p  P`0P 0iS.S  P`|0S4 040:Sd9&0@-@PDM QP@T 00p@DЍ0U  P @0S@-`@MPpTЍ 0S P 0S0Qp   <@P @-x000Q/Px1P/$0/@-M@    0 mlpЍ~iO-YM `F/@H9X0IpPpYߍ0pL 0S 0S PP@ Y ?P @T0SL03P 0@S0@S@@T1S X1 ⓒPAT1S@\1S`1 ⅒P5\1 S S R@L1SP1 tP&L1SPC_oRPU@+P04S 0s0P?AB@@$P00SLQU GJPPdh1 4P Pd1UP H@ `  * 0[$0D  H! `0 S x9X001H \0kp X0 RB000S0 15S4 S  CR.T XX @@RS! y R02 > 0*>81 000S p S 0 S `@@0?H0cp 0P0H0}>H0 @70000LPPPx!No B is @ A-p M X`P00 @R  RT T 1 # 0@ @ QPUx!@T00 Ѝ R @jiȀ- 5S @00 5A 0% 1@ A  + A+": A !9 R50,@-`pᩈ@P@ Ѝ ᄠ0PXYJWJ pQ,'P PP!@-`R$MpP 0S0U00$Ѝ/*@P 0 00 0  0S hU 7PP0 T/00DU 7  O-@`0"Sp0W"SpG` Y PP u 700 ЍTUYP T0000W YT X0#0%*T X3#: 0\S^0PxSmS0S< bS ST Tn C R T0 `T 00T 0T 0000 0    00 PP 0S& T  H0 `P0A\0SP0S  yHT PT0P!d9&P /0 S S /S/P0/S S S/0/O-M hPPЍO=`P ЍOI@Y@S   pW IFPP   (P Q0A00Ѝ=0@S. /P( 0S $@PH@`@G0P 0 @ 0 0 @ @! p@-@ H`P 0SH$`P PP(0S $H0(0$0p,` P,` PO-@/4M10CXP`pSt00pHU- 9 `Pp$<P@  ➞P7 7  '$ !/P`0@T\0S @U0 @5 0H050U+ H0xt>0P KH0 E@PA t014ЍEP 0 1Ap 0S vP%H01@U  CUH070 0  pX P! .R@  0R77@0U   0pP  H RU H0@1S@H000zU HP00p ,0 00 0 L,0S< _ czU ,0!00 0 |,0S J Uw <1D8b0w4儒0000 0 PPP00 0 P p@ 0  @P 8 UI <18b0w4儒00p00 0 PP00 0 P0@  H0:0H P0<0UH# 0S /2`P /-`P00 V /0P0 Q00<0000H060U ,0 00 0 L,0HST  Ah 0A  ap$  P 4@AK0  U uU ,P 0SU0 pH0 50fh0 50,0 % 00 0 ~,00,Yp5$ UePePU700 50 $ 5'@p 0 *  0 |p P H0@40U 0S 4S 04S0:006S 06S090PU, ,0 00 0 PK,0HS <U H0P SPH0;00H090U `$ l`,pP C`P 0%>f CFH0Q7;0UlQ NP0l1 |GP0l1 d@P0l1 P p E0PHp1tH000~UH10 2xPH0 2p PH 0 2h  P PH Z H000TH020OU D 0pP(_ H0 S;70<H0207H0602H0;0-H080(UV <1#8b0w4儒00 0 P000 0 P0P@0PU2 <18∂04gr000 0 P00 0 PP00 0 wPp@0  @U ="PH < p_PWH0p000S P0<00 DP WH p P  4PWHp  d 'P P !P < P ( PWH  BlxPQ ~ ($upp 00v! &( " ? {M l  3! $ O! % ]! a! e! j! r! ! ! ! ! ! ! ! ! ! ! " " "" '" 6" C" c" " " " " # "# 5# F# U# n# , # # @Y# o# , , @$ $ 8$ , Ld# , j, q, w, , , , , , , , c, " , , F# !\\Y$ s$ $ $ $ $ $ $ ,p 00pP $ ( H,8  }P B cP*WH[ B $p pP (( ( H$8  LP  BX 2P l ,PW ,0 00 0D H,0HSy  P /o"Bi ($|P/H P0(0יPp 7$ ! (0'0K ($^Pb/H  P0(0PR 7$ ! (0 '0-U[ H0'X U X!H020H0 000T0H000H000 H0 00H0 00(07600 2R / **450S00T01=5 =5H00U <1(0@0P@470'kP P0SxgU H$CXP$U 81 800 (0 00 0 H(0`S, 6`( "4`4# ,,0H0800 PP0 0 P 0 0H010zH010uH000pH050kH050fH000aH,';,[UYH090SAK3O\ 00` U0y Z@AKοOAK OAKҿO"Uf \0@T$(@ ;`P  ,00{G,0S (/PP8  :pP00]P  ,00 XG,XCPPpP`=7PCP`PpPh 0CPjPpPX  `CPfPpP  uCPlPpP  gCP`, aCPi& [CPl   : zl?o2= , sW8 @@CPb T:CP`Y p ]-CPc 'CP "CP` CP` CP` CP `  CP@` CPh BPd 0BPe DBPe l \BPe pBPl BPg BPg BPlw BPlq BP f Wv ZP0$, pPP", EADPP00BpPb rpP  R  R 0,PS0P , S%00 0$0(00XH`  p @ 6 dZ`0P ʎJZ\0PZ ZUp HP70P7H0"800H080H07 00H070}U .6P0h2uh2S H000jH070eU o`P 00v`lHp؀GP P PVGC P P91Ȁ05H0400H030+H, 4,%H020 UN H0 rpHd .H000 H000H0@00U1 ,0 00 0 UE,0HS U ,0 00 0 @E,0HS| yU ,0 00 0 +E,0HS, d Y$ $ O-pPУ8@` P SP `nV<1X ЍOR$ RZ8 ,0840 ЍOM Ѝ! O-S$M`04 0@ QpP  8Ȑ̀ ⨠娰<1H0  00YFp0`   h   P` U (   $ЍX+&% $ !I-A-PQH 1pS`01S`5x1hS`8  ??$?0g47S90?8g<7S:8y?@gD7S;@s?HgL7S<Hm?(k?Ah?g? 1`P`?^?1`PW?X  DP T0 ST47,`0C47<7,`0C<7yD7,`0CD7rL7,`0CL7O-MDM`P 0=P<exP E$3&7 E000 0000 0P70P7) HE000 0:00 3000%0  Op ] +8 0 E@@ 0@0 E+ 01 P#Z \0Y,=P0047`(P3 @5:_ ؍DЍDSP iPA0 D  D 0 0 DDP078247204<',0Rᓸ 28>@D',0Rᓸ ,@|>H'0l"L'87<7@7D7p"H7L708 0p  l0@0S R R P\R @0@ R #P0 00 y?o200p0S0pp@0p DDwP 0 0# L00dDP P0( %8 ] P9P4 Z#dh )pP"($$0@0S 0 S S0P\S 00@ p:0  ᣄPphqd|Pd p@ P 0S P   P 0S P Ppp0 0#  Pu Xs0D00D000 0 g0 S E:$ E000X!`!0 -@ !!% tH 9% 0Q//Q *///G-p0000@P `P` Y 0 0 R:@CS@D"@3X HG,U( IGpA-TpW0 ,T`@V0 L0LS @sP X X| |00 S HH0P 0RS ' !' ( p@-P @Pp<@-p@-@Pp PPpT0 p@1@-0@*T @00T0S0 @- ( %!' T0A-p `R0080810@: PP?1W U t0  t0 +p@0S hp0S @p? @U4 bC.P P @$T T0Rt0t 0SqPt0 t0 88fPT0$0x x0R\ ^@RP50S @) ) !) 0) ) ?) A-`PP c_@T T0Sp@Qp@- M0 zT0S0 PU|0h xPc_`@P H 0  Z  Ѝp( 2!' ( N) f) G-0MPp $   @P 781@0A 81S(P  0Ѝ |B u@T|   nT0 R0 0800, P T8p 0SS90SSPT0c {|  `P7 R|0   P @T T0R88xPY0Sx x0R E& @T H00XXWPR :P T T0R88FPq6p#0VS tc_ @TG 0SS`-90SS)PT00S8 0 H0*: S R   p 0S 0S W@0T 00,F @P<!!L!u) ) ) ) U!Q00@-1@LS? @q@dRl@̠ BR001 BS@P@-404 4;_0S /00) p!) P@-404 4QJ0S y/00) ~!) P@-L0L L}50S So^/00) !) P@-H0H H0S SpB/00) !) P@-L0L L0S S,0@o'/00) !)  ^p@-@Q0 RP0 _0`S0 SQ 0h Xp@p0 p@W0 p@H%) !{) ) 60P@-x0x xxQl0\ i P R !P BR #@࡮@) !) * p@-PP M0 0S@T 0d($"4d4#@c@Ood@T $S 0@0 Ѝp/0h`Q G0000P 0 ) !) 8 -* 'A-0S00@Pd` pW c/0000Pp 0  8 -(* !n) P@-808 88Q,0 v!>000) !) B* @-@QX!O* C-TM@` P `gp) 0 g ````g 1 pW0`pV& g 0 0 W@ gT  @TЍ00C>S00`"P!@03@000C>S00p"P!@03@0!!!!-3@- P mp@Ѝ0@ Ѝ/@pp@-@RP`@p0Sp ppW* A-0Pp@`S:0SS 0   RS* R0 W`V1S* zP a 0@DpR: Q * !]* q* O-A TMP` zyB@PA(@081 Z  xp 00fȀP `P [P VP QP LP |GP lBpPpZ T Ep @61@ R 0;p 0;1#3G0 800 00%%)p L0S% S% p H p P p $  p q| pw P0S t00$Q0p 8 pe x0Sz 811L10x1[sWp M qPw p@ PP 00Dd lp0 \ p* %P %P0 x1`2@ p X00SXppW0h 1SP p@$弾#P |p iVp upp$Px lp~ 0S P fQ [ T  2Wp  r")Wp4P| /Pw *Pr %Pm  P P X00S 0Sa!Za!Wpb%P `V%R_ pZw0Sc  pl 0t!pTdpQ0SS  @ ypW 0$8!pCNPpH 1 R=Z  P; ЍZ p prH!* *  0,  ] *  E * !+ + + f i"+ /+ ;+ I+ T+ ]+ <!r+ + + + '* * * g+ X + +  5 p@-@Ppp p@uRRA-P`p@@L0s  S  U@ p@@@dW0S R H R U p  * 0,Q p@-P0U@S 00pH *P@?@T:p/+ 2&@-`PM1pSAT  p@lbЍ\ PЍ@!R 0$  00 p@ @a@V 0 !p@/`P Ip0S lt00#40 PP D SP 6( 0(Q!+ + b!, wm!+ + A-PP 0S 1 p@ 0S @@q00 S U   ^ @ .S0.SY0_S-S```&00  @RE"0T0 0D0d9& @- @0P P'T00Q  FDP `00CS`0p S00 P0S X0X /XU1&p@-h1@SPZrPPE @p ⋸0.SSPP \P LP < P 0  .᜽PPW, p@-@P'Uc 0 T0 tT0 dT0  T T0H/@,8)0& (#@        S0  S0  S0 S0 S Np@t IPb, " ?Yoi, p, v, ~, , , , , , , , , , , , , , 2& 0(HLǒ -\ lp Q^ ,\ ,@-QMM@pPv]0p0 0SQލЍA. !. t l0Sp`0SPE@E p 0S:0@D0 ,  , O--,MlhpP. p|`  R@P2 0S   j,P$P@P@ X^P$0X2200,Ѝ P,P, R P,PE0S p R* 0j20 d7$ R, R P Q7$ R R ,Pp!@P !!!- - P/ P/Q0@-00@Pb^ .^^Q\0Q CL \0@0Q C B\  00/O-MpP@`UQ:T 0T00D0S00V`F@@V00ЍPW"0$?S 0[ PW RPPUT  P70 0  .0@I0 0IU:D X0 0 `TT  DSPO-`0 2"@p Y*QP T V700 Ѝ%P`F@p  00T V 00  P     @3 \Eo   ' U/U$W\U0 T VPPT V\%0P00PP`F@pT V `FPpd9&{!G-RMMPLHp`p< @=pE  %Rp V=bp `=4 RpTG    x0 Ip P; IfP 8I/   -RލЍ   20V002 0I@ p  p@P0P@T*p0S4 p` @T* T 0 Qp @ p    H0X$#$("( HQpn @   Hr0Xd$#$(B(   He04!c#!$ c$" mQpN @@  HR 0b"!4b$#  HEK   .0I/P+ `I/DQp% 0S @00SP%D5Qp00X  H ZA-p @MTP 嫴ЍR` R 00P0S 0 -0 0t00#Q0 3$ 0V 0  0O,- - O-4MX@p 0S\`d` (0S:0 p20"4ЍO3 0  ,   xp0,0 ,0SPCD ,<`p 00"0,h/4ЍP V0 00!00  , p0Gp00X!0h `F,P 0 S(0SVP$ (0S(00 0$ `;/P $P(0 S0 0`F0$00 (000$ ;/(0SP, $0R0, 0 (0S ,  09,P!G- Q- W* Y- - - p@-P`@P 0S $`P(0Sp,` P,` P  0N0@-MMP+ p P0@ۍЍ0;0 C@P S,P @- PΠ R00\L  ^@-Q00P`PV0 V=`V xЍp@@T   0x@ `DPЍp`Vx1@P ~0>0S *QP PU@P PPb`_/0P@-000 00"Q$0 @ O- ((!- - A-` (M?00>0@SP  '00x B0dpp 0t0 0 01 0 0S0S|0@0|0 0  X00Qx0 xPT (Ѝ0 8 0=0S 0xPT A-@`|VPFPPP2Xp`Ex,P x倂|"x20 V0  n|20|2@-Mp@`P! ] (Y (BX( 8pMPU@ T700@Ѝ i///0@-M @ z*PPЍ0 3"Qp 00000)*Mp00000@ Mplp 00  0"Mp< {p <. 2(!. . (. p@-QUp@p K,0x1p@,@-GM>`V P00Gߍ@PF/ 9  0嬱 ph0 1`0 DF?M> *P0 F?M ii@-@MP4@ $P P@ЍD(!Q@0@ @@@-0SSP`///F. d(!- $0 /Lp/Q @-@?t0@0Q00@-,M@P(  S  <T Lp 0 00S p,Ѝ08i(p@-MP@ / ` *   (PLPЍp:iO-PQMM<3<#<<&T0S,3#pW3#@H`#0J01801\0t0P0 0K`T0`V3P 0P0T00T0` P T0X00T00T0PT0 0T0VP00P0YP0 < 0| P0 x ;P0R h0x 0h00|0P00`T0T0 (@)@@FF@T0  弱 T0R B   @ Y@ X1F0FᶰF @T0  YI @T0 0F0FᶰF @T0  XP UPEPPP@ D$("(Jp`ݍЍ  ;  YI @( o(!- ( N)  C-`Mp"0` 0$` 0 ,pP @T@+Ѝ`Y*PPA 0 ,pT0 S '+ `@`T*x0V*D00+T00V:0 (P|P@ () }Y 0@Px(!@-DM`@ pP@    ᰯ !> U 134  R2$ $@0  DЍUi@i|@-QM@  00p |20 x2"JЍ@-]MM`@F#P_Ip PP VR 000S0S S SS wR0S H^pVPS CQRS 0  Vxp@P V$0 Bp 0S$H` 1 l Jp 5 $ L 80Su S S00,0S  R000@0S  R00@ H @ 0 H!>50H \0VJp\90S 501S hhQc0 0 0 00 0 0p`URZ1S SN F F]ލЍRIx@P= @0 3P0 0- H)@JTY$0S! HM PPN0 0~Qii@(!V. @- 00 000 0 +Ѝ(!2S/2S00/@-@@V002@-S0@0 @@V0002S  u/(!A-PM`p (PCP((@P. 0LL`0Hp00! wI HPpo0Sp  Ip PU0S p H.)@! (( fIp | P_Ip 7/PP TIp &P Ѝ@. . qB@. lBpBfB@0O-0@p`M0PU  G0S2P    P崡 00S U 1!Z0  P000P0 PPP0PU:000000x Ѝ@-  H ЍgB0p@-M2S@P`x (VP@0  `(H00ލp@  (!B@-P`2$MS@p0  0*004%40 0 0p`F$Ѝ@-@!G I(@F(@-@pp xHp`~B 0`( "4`#/R00@-0@ ^ 0 # R 00P0p@-@^P T-00p``0@D^"000œ\p@Tp0,O-QRM@@001`Q V00ЍP0p Q :8Q@SI 딂\> \ plP p,lP U  Z4\[Wpp\X @ Q*S0C 0 &P 0 0B  0 S2X00cSc@-@ 000P 0S00 Ѝ@-@ 000nP 0S uЍ@-@ 000YP  R a Ѝ@-@\0S \0\0@-@`q0`E0`00@-8@$@0p@-800P@ >Q &T$0x1 RpR 0S TT0Q  ꂔT0800 >0S p@ . A-p`KP%P@00<000S@ (0? @0K0cScO-@IMḀȐpqp0< FIߍ0RS* R? ;0 000K CZ%PP d0S  GRW ( Q  R (Qh 0 0000200> 0BS0* 呿 0370 RS00 T' $0K0 `C70$`Q 0 DPW WdP h  Q x'/$ [\7 FQL @p$Q DQW R <0S @FT60 <0 : @W 0FS80 0 -@ G 032ၠ:0 0d 5S 0 FS+00 %A C 50@W 00  0FSw20 0 @8 R  FRh3    0FSY 7000  2@,0" R07,04'R SI E F P41(1"<1815%#8108ZW (1S 0 F0S"=00(  ⪾(100@0S W0 2S 0 FS <0 0 " ⑾ 20@W0081 0 Z00 FR P0@  y 2S P 0 FSQ0Y0 2 0 0000Y00 @  @W 00  ^00FSt00pp@x 6S 0`FS^00 &A 1 60@yW,=(, "  P W: ART ,00,S P R:(, "   PW: ART^ ,000D0C0W00FSP9000 0C4 < 1ҽ@ 4S Y 0 FS8M00 $A ⿽ 40@B?S7= B?S7q 00PD0 KS:KUKe 0 S0P0"1N C0F R 0   ᓽ @>0 08  ]$Z X. . cSc25/ :/ 7@-P\ R&@P\m0S x0x08  Ѝ0PP @0@ p T&S/ d)!< A-PR1! @ `80P pC R0 00 R0 6 30 00 P0 0:000 P00;000 P006000yP00ЍP 00000000 0]p00 0Qp0 00`/ q)!n/ C-P@MT a"P@, 000`0001H0i0P0 0 븀x0`  (y#0(10< P !P( # @B  ) 0ta !P( ``(1  ( {0(t!pu0+"70 (P  0  >``` P( `(1" (> *>Qߍ 0*   {)!/ / @-0p M$M0i0PS`n 1 !p Ap@"0S i p ۍ$Ѝi@ Q0 Pp 8QQ0500 0bpPy P(f / 1&$/ )!/ @- 0080@P PU@ 0S@ W `P@Ѝp ̻00O-IMPpHLPL `PR X1 0@PIߍOz"0,0t"600 0400 0 P` p00,0S2 V30a2@0 0!,0 T=`0 tP ={`@PIߍO@=0 P \VT` \`00T=D0 ` I=P 0 )!и@0 0 ɫ20 G-P@pQbP,`,2S#PU`,@ ,xBPT`xB, Q 0S,9 $jB @P,`0)!G0 ?0 RC-00`pP@T:Ep T  X ⢑00U *ݻ"0 0p Ѝ0R0  κ @'=L0 Bp  =@ Bp( p@-RMM000PS`B S@ 00 0ppۍЍpt p p `F D<, Bp VX@- 81S Q S0 000 LPЍ R Q0# DPD30O-S4M@ h@@ `0 0_0P o0 00 0 P 3 00 y0 P3 0 0S0@0k00T0{ @P0t 00 0 `Pk 0 $ ( eXcpP  ,$(,8`P@ X0⣡  Q*׺"00pP 0$00S $ɹ h0j  ,(役xt$f(c,8` P@0 Sh0` 0h0  0304Ѝ 00 !0 pPz @ uZt $₹ ,~,0pS 6P@,0$S  S St 0P !R "Rp( $(,8zP@ O0 c"S0 O-PM0@0400``2 ##`pp#`W9 pW6l0S,0S0`r,0v 2S0`80w,0v 847S0`lr,0v p"Rr0,p802 S0p0g,47S E;| 0 pߍ0$000 `2$Pp$`  `$*; 0 p $`v  0 p 00 `2(0p  ; 0 p(;| 0 p#0z0P,04l0<40 pl#0k@0"04,040 p]f`]c`d``k,0 !P !904ǜ R6, `"N`P, 00`1,0,0G0 0 ` kX, 00}R0S 0A00P 0H` ` 0 ,L,p1S  ,0 !P !`" P ,0 0L00` 0 )p,`w0 0 0 0 0 0 @0 0p@-PUp@0L0pp@- MP#&p 0` 0 0 `@>p=@ Ѝp 0 `>p ` 0)`>p  z0U 0;100~>p@-@pP`V8!(0-080000&0S  0R  Kdp`H Ѝ@ @00 p Ѝ@ Ѝ)! O-`@p 0帀SP$H` A000 0 0000 ``0 Р0 `  $9 00003H081v H= ЍO4<0 $9 0003@0St3H000s$80409 LrS< 0008 R":kg{{'{z40S& zkg{{'{ z0S+d0S( $0P$h0!R900 .R::kg{{'{*zM8 S zTkg{{'{* z?$/900 !H0S0SU h R 0R<0S 0S11H000s8040 P14 ZP18 TP|10 N804 d00@0S0i8 00.0 p ̀h`0 : P0 10S00Hf T P 0dh0 ЍO Ѝ??0 1 * 1 =1 D1 L1 g1 2 1 1 o8 $2 ,h82 f2 |2  +2 22 A-P@T 0S0A `hp` |  S 0i0-hP 0S <0S $l8  _ .p0  p pp000 00p0 pH  00 0$0 F#5 FAd0h02 O-RpP\M@`$P X0 #3P 0 RT000 p` hPP. dL0S0 0@S@0#/L0} ?I00P X0 "2P 0 Rzgjzzz{T0d0S  $h P $[ <Y y' `20\200(4"<10,00000<00@0,0D00 <$P(P Q48`LPPPTPH0:p_ pX 0 0PPN  6h0&h 0x100(4"<8#8  10 E00`0 @008d#l `0 P00\ 0k`v t04S 1S0810 p \ X  @0\Ѝ7S zD2 )!2 2 CDC2 %3 23 3  @-`pP@`0 h0X $7S R h0@Z0 < ` 6 0 Ѝ@$0   73 2 5 c3 p@- P@$ \0 00L0p@}3  p@-PUp00CSp@0D 9$6  (00,0L0p@,3  p@- `P@p800  B\00L 00<0L008 %p@ 3 3  UXA-@P` h 0R 00 P3 j081HA p` P08!(0 A|P     Ph0h hh尲 0 d0 P0 $A3 %4 .4 U4 *! n/ h00h0 C-@p0 PR  R $ RP508Ȁ ` 6  )i@0S PP  P0 _ lH81 0S; 0 S<$P4  C0 <`0  @ R 0P ЍG 0PS 0 PD0A 0 00 0SЍGЍ*! 4 cSc4  4 5 h0p@-800P@  D h00h00L0p@ Vi(5 P5  \/0S/0> d0S  0R/;. / O-M00000PS`@pTQ 0 ЍOu> R*,P 0S 07S ǚ ǚ Y  S3  X!  Q 0 S:500 0p00 0 ЍOV Y 0 0Cs0'0S0 S0L0  p    0 0P 40 F0SY0A060@ 600 0Jp0 0  `P  "0 S 081`piH6@P RP0S0 0<S<0P0Ѝ 0    0} 0PY6S700S00 l00 0P Rl532Y@0L%KSK?305^70 Y0S0  e P   [ iL0 x4 @0S Y0 % 2)  Br  Br$0 0 $ 0 0P   0 ;Y 5 0 3 @S R@00 D$0Y<0<0818 ?  ; 0 P0P4 000Р 00 0 0P00S* >P *  p峯 @ 0yЍO6600 0<P08 0S * hP   p儯`81 R000 0 0000H ``l0d\0S   d!0-YP 0 8 R $1@ЍOOY 0 ^Y 0 .0Sh00 00 P0 PY0 "1  tЍO6 g5 5 5 5 5 5 5 0 5 5  6 76  J6 a6 6 B6 (*!* |6 6 6 6 p@-@l PTX1 p@0HuD N`\P d  p@s`$7 O-` 0Px1@pTT 0S R T0S> R* ᜋP$  0 D@77 O-,M@`P Q0 ,ЍO"`F DVWP0@SS 0SP0t#tx'xVI:PQUE0VB:  ၮ"4"48#8S50V2:1 S/ 0 0P!' f0S 0000<`10a  & ! P 0  0,Ѝ G 0 B 68*!Z7 y7 p@-Q` M\@MP  0000x p 0S TH  ۍЍp0 X`V \@T D*!$A- p`@PAlmPUP0 A0Dm0S0 A\0S0 AQ*!7 G-M0MN0 ;p`p D Pd`8倭0480EL80H8$0ED80@X@8<8 \\ 7W0` 0E 063p ݍ0Ѝ`^*!   p@-P@T ge c(a_@x1S0pSq ='302p !302G022p R Rp07@-PX0B @P 0S40>8 Q0'Q'+  A R "'     0  Ѝ0@8}z  P<gjzz+Sa$0@  Ѝ0zD7 <p@-@P0 0Uph0Spp@+<O-`P@T Q Pd0S  0 E0pd0 ЍP0AQ 0S 0P 3/  08p|0#  帐81- 8 0 $ 0R0hd`h08 R0, 00C0 }-0800<0  P`00 g00 0S $0 pWp:#<0 2 0 0 R0H0@Sj 00ppW\0H0H\t   pT007  7 1 ,0`( "4`4#S /0 @Rp@-700pPQ0`PE `@@d@ $,b pP/<0`( "4`43Z!R 2S///P/P/Q 0\R/ 0\/P/-000P b8"#4b4# 0Sx1@-@T P@x10S/ R0 " /Px10S/ R0 " /PP/h0SdP//0 SRQ RoQ /Q P/Ph0h   RQ P/@0 RP/R/@o//cScx1C-`@TMT. 0S pW$ P N PP@0Sh0S d0S4$|4d0 0S PPTЍ|0d 0|00 00d0 00090O ݝP] ՝ PU9$0 00 PP 00d8dX w ⭝PP ͝|0d 0|0Xx)U" 8WPMP ªh| Pfp{0S 2P 8- P  IU` P < 0$Q S "  Q  MPp h  5< 0S  h,pP: t0<0t00 00 80 dQYx X P 9}Ux pP (ȐY $0% h  5< 0  $0<0|<!u8 k*!*8 8 8 p@-PP1!֨ Dp`01S 0S 0S 0S  `0 @T 0Q0 PSP 0U d0S0h0d0p@B* {*!8 8 p@-@T P>P@0(p*!G-Pp`P@Ѝ0E @P00 4@P 00000P00 000+ p1 0 v0$00PP+0 Lpc0S p0 0CP  0@R 0 0000@@*!( t`9 49 @-@T PQ0 8 00*:SR h0S dP HH` Ѝ>$` dp P (0Q,0Q  A `P z800000( ,0?P0S 0 h dW $0Q 0h0d`0SH.F9 g9 0S/0S/   O-MP<`RH0@8 0xP00ЍpP P0 U@ UP R R R0 P 0S8Y0000000Cs p@UЍOC4 @PЍO    p @@0 0*0$  J/ S*!( 0S/G-P@M T 0p `xQ/00 0@0 0 @e@ЍP/@-@TP@0 S   0p@-@PPP 000p裢 P 00p0000 S0 @00:S 0S @\S000@:S @@ -d9&0@-P:P@A0 P\:R \:\P@\\ @R0/& 0@-@AP:\|\00\0S^ 0N:PP |P P O-CM M 0d4 !Sp$  SO0E`VK `0P0E@ PPg 00pCލ Ѝ@@;04pW 40p(0= P 0 `R0 :R `d4@0  0(8804 PF0P {0S , p PP ;000P p 0S#00 0Ɲ8`p@Z +8,0P R 0,0SF @ @ ,0P 0O008`0 SWC @DpW:SY @\Sp S Spp00T:C @DP  0SQ f,Np0@P0 0 Y@ S 0#SS `P@@0x[ P:0p0e= p0 R0 :R0 0KI 00S B:S:0 00IS! PBP[0i @D0J`FP @ 0S ,9 ` 002 @ ` P D,0  ,0@PE P0S +$ D0A00T*0 PP 0P:SVr@ -&@-0  0 Ѝ@-(@ P t]0 0@ -C-MBM000pS 0S`! \0S)  R&    RA^0C R[ |0Pv Ps @ ?] Q0.P ލЍ |0P P 0@P$]0 PP U P-P   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R 0 A0SPZ\R    B{:R|R  @ -d9&p@-@PDp@NG-`= @P@ d PiR 00@^S0S:SQ @0 R0FAd7 P= \S@0S:S: 0C\ 00C Z @ 00CY0TS @ ASBC\ 00bC ^\ 00:0 0 0 Pd 0:SS0AR0@A P p Pd *!*!A-p= `P@ d^ P`FPd0ӥ 00@0S @Ad P Pd0 :RRAS@A P @-@# P 00S 00XS@ 00A ^a0ASW0AA0AS70A\2" @-04@0P ,PX -9 G-A0SRPp`ʏ (PU00Ѝ %P00CS0[ Pp0  Y( ]P , P P00SW  R00S 0σ47,P R   S@T PR   R X --` -@0@-0S |P cPX --@-@ZP08GX -p@-P@PPp-[PpX -@-@EP Q 087S@T X --p@-SP@ P@p p@-@P * 087S@T X --O-pPW`@P @ ЍZ K P 喟PT  RT@ Z //////O-@4r00SRP` 4 PU00 Ѝ  P00CS0Z Pp0 0 ٢l Z >PD 8 P `P00SX00 S yP LP00S  jP  dP | ^P ` XP H RP 0 LP$ :㛓P-@-04@0P 4*P-9 X0@-0S H@ ;000D@IP0DЍP--@-@`0P0`Sp 0.P PP Ѝ-@-@P08D-p@-P@PPpYPp-A-P @`pPЍ0 (084SPUP @-@- 0 00B;P Ѝ-A-P @`plPЍ0 (084SPUP @-@- 0 00B;P Ѝ-@    /A-0@@`P@0 (Gp00D0& SQ' 0@/0PA/A/O-@PDopDpG``b0Y:0z  Z # 0@@DU 0DA\0:Z: [=0 S: p `$ Ѝ `p-A-@`Pp?  '9 '3 &-A &00@-A^ 0 n$ P/o b2 0.0AT d$ Pon N$  A000R0@-0TM00`p<` @Pp TT0 9(p<@ ;<0@404 4/,00S 0TЍ&9 -A-@` 0s P0'0p0pGWp0P'P @P @pT0 @@PP @-p@-?@004@ppG0SkX$0S` D%0ß0 R 40><L 0 @TC3^ B00@  C31X  02` 3 d ! \C2 h00C0'0hS8 0t 0 00$\\:%H`| <1 ,`9PPDpAލЍ华pP &P 00PpWA C9RQ 0000&000%0}0L 0 R0Cu0s0Sp00$0k00S0Ce0cL 0 BR^0 0S0CX 0VL 0 BRQ00'0L00(0G00)0B00*0=000 0土d0d :/1, !ljP 0H0-&*!: 4=<+!@-X-: : 0H0S/-0P /-@-P@ADM|0`S)0S&%0S S f%0P 0P@ DЍ $%pW*P 0 000幐0pS%pV@ U`0p.X0X 7/0S 0SP 0 P0DЍ@蔐-X-&9 G-dqP@0L P12C1b05R0 0 0&0S  $h0S*0s0PE`1``d0 R1 *! q ` `  !`` 0R00J0S0PS ؐ&0S,P O,@GI--!\  0L0#0-t0@-M  L0@31 ^AP 0C! 0Ѝl⬏- @-L 0 0@11D ^Q       -A-@@bM0u L0 @2# p PW%cP_  Bc p\  Z$0 HD@,X#10000 2R01   000 S" V00 S / ЍA X 1(4/00~X1威0 ẘSV Q`ЍQ0S mЍAg`\c  Z㾜 l@l%0S  Z㬜 b00@-+!A-`QM0S 00S` @P9 0s$@Ѝ ✏pW   @唏嵏00|0pS0S a@PpK#00pFV@@B#P 00T l@帎`pW 0S:S* 0\ }00ppp-X-O-`PqL10PSU$,@T,P@P6 h0d 0B1 `P 1ⶎh L0C R P!050%Pd @T: 9 坎0 p[L0CY1T*Q@@-G-qT0So:\0`S& 2 c@Oo @d(0d$0P0@U1 0S.   B 0PN %Q * RG  ᳛0B408@S 1:X 0@D8C 003 c0< ?o@@D@  ᨎPP  ȎPNPP  0 @ S :   b1"0!00000P00,0P-&A-p0@@ `P PP00`Pl P@%Q *0S  @-$00S:@-@@R-@-P`P U(0SP@P )@T \0@CT0T 4/^ 00'0S 0, ( @ !Ѝp-&c": =O-$MPpPdE00U0SPc )Z@ <3@434 4/W(0Sp0eWD@XU0XU5 0PPW00 # 30+*[@C@dQR: =L5yP KL ` $ J2 10X0D30 2%Q a*0S ^Z^1)Z @\ 1@崛1 ꆁ`K K:1X0<0< J 0 @D@ T1 L0 43   @[ [@K@@d PP P00P K D K0@D   ߌ%Q   60@P0'0S 0T 0p) $Ѝ*0S  -&c"; X; @-=@-M@p0aPD(0SWTP )@T: 0@&0 4/0#880 ϕP0Up@P  '0S 0 ( @Ѝr@P %Q|0S0S P 00-&c"; =O-@QT$Mp(0S@ P wP'0S  p@P$ЍW !0T`M\0T*P* 0`0?o 0c  `o `S PP T 1b*Ǚ@4 T!P030#P0S X $200301S%T#2Q FZD*0T00S<PP 00PPP0 0#  0|0S0S @ Pp偋<k`0<0 0 $pP ċPP% 0   D  岋%T#2Q JZ*0T00S  DUKP )PU @0@<0< 4/PP0 004-=&@-c"; @-@H0'0S 0 00 0T Ѝ@Ѝ-=H////$&/$&000/d9&000/d9&000 /d9&000/d9&000/d9&000/d9&000/d9&000 /d9&000 /d9&000@/d9&000/d9&000 /d9&Q P00Q////////0P/ R//A-`Pp@0 P @U*0Q R* /0/6&` 0 0CS0 S P 0 /p@-P0`@fPp@ Tp,!0A S010//,!0P/!R/P/P/Qa/P/0000 /d9&P/ 0S S//0R/0000/`9&000/\9&7@-@PD@P 40R0PP 0  Ѝ0c" < X2&PQ 0S///\&0 3P /c"*40 ACP 0AB0P CSoPS//O-M@X @ЍOSQ`pu rTp 04S`\k P0@`S@T~WlЍ_Uᚔ!` v`PE`0r>T 04SJ:`\H  T  QX Q(      Z P    ET0`[T?o20S@ 2@ @0R @T`0-@0S S @0V @ X 1@@V X*  00`00P 09!A!00S00/"X9&{< 00S00/!,&< ///@-@H3D*P ٗ(  (@VX2&vץ-@-  Ѝ Ѝ/ -@-  ЍЍ/ -@-  ЍЍ/ ///@-  Ѝ@-  Ѝ0-@-  ЍЍ/ //////P/ @-P 0A p00ЍQ@P b@ p@-@P0 `P  \*. Q  Rp R  (  p 0 B d9&l-qA-P @p`>3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p@-0 00z Ѝ0S/1>3 !/0S 000/l-0S*p@- @PR P p Pp/0S/p@-P0 @R`*0 PQp0Pp0S/0@-0C@ 0 0  (  ( 0 S/! ^R/0@- @0 0  $  $ A-P0S@`$0aH U ( U ( S 01 BpC B!|0`A-PRp `@{P 0!G000A-@P`p0 SV1 V00W W0Sc0P 0 B 0  BV  B* "M A! AC`0 F  B8  B "/ A & pG`P  B0Z  Bv`FpGPo`FPAA!A-@aP0S0<R&*1 21<0S0 0PPR0 ,S*!!!0 0R0 ,S(!!!,p (Q0P A, (0 ,P6&`9&\9&A-P` P0PS\ ]\ xp@BX T 0| hPPp|&0@-S@* Q 0S0000 [Q.Q000 S:0S008000R .R ]R00l-< 08 C800/`Q'Q!//d9&0A-sMp00@P` p0000pSp 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0SN u P0( S,* R)\\&|\#00 |R 0S |0 3/000Q R R0SS*|\0 Q QQ S: 0S   B 0  BЍ 0S 0 c 0000  B 0B B0m0 "0 00 0Wl-p@-P4`@b@P@p TpA!Q 010//A!,1p@-@0PS0<Q:1,1 R40S"`$0V):8p1PS58 0#p(00<^ 00^ 0S8opU 0! R R0 0P`6&`9&\9&O-@P 0RMp\  P&  @ގ P 000Ѝ 0@  OPP ЍO 0 PS@ \ 0 00<00S*^Q0R08 ]R00-R @@g Q* ]R -RS\V0]Sj-R0 Sc:0S006000S80S 00000〦 0 hSFh ,VKX ,0Sq40Sn$0Sk<0Sh(0pwd  0(` pc 0@`F p@ Uh 00C0c-R [RS :R =R} 0S: N .S0,S00``0-S]S0S00``40\ 0 IY0 S:0`S00`0S00``E0 ɑ0I{P  0 (SB(0<R$  NP    t P $0  0$ 峠S0tS00``0-S]S0`S00`=  0 S:0`S00`0S0 -RZ QW]QT -Z00  YI 0S. Y0`S 00`0S0<Y00 Z0S  Z40 9NP  .  uI400!0ⱐᲠ40  7P0S 00100  *P  %P (B(N [ 0]SS0<V*0P80 P <0S P Hp00勰P00 0  EB#ЍORW =RT ]RQR :R ]R001< < 6&l-d9&`9&\9& 0p@- 0(M@! 00 x l0R 0`0]00000P0 `P(Ѝp(Ѝp@d9&`9&\9&0A-``Pp\U@ [U_0V:0dS00`00 4\U=*Ux .U; 0Sf0 `S xAPu 844U\ 0CUUt0SU 0`B }t  t 0 D OU &83U F 0  , 0000h308@0S* *Q2  0  B  BA   B0|  B5Ѝ 0  0S 0S 00t200}PT\QR {RO00j0SP;* ,R8 Q 6 2000/ UU0 R  !   h0 S*R\Q}Q00 S*0R S\Q }Q 0<00S 00$Eo/JU @0` V1@`(p 0 S *R \R0)S ) \a V 1L  0 S *R \R )R003 0S00000+l-)>{^ ]d9&0@-``P?Q@ $0A  R % S 0^Q [Q \Q 0S Ѝ{Q |Q720V:0S00500 @0` V1@`(P ?0 S*0)S  ) V 1L  ,0 Sf:0S00l4000 S**@?PQ{PR ($  "!,Q 0S 00300\0 0S 00300?P  *P 0 B-  B   B0!  B0Sw* *B?RP {Rp Qm 3000f b 0)Sa  0  $  $  0  (  (   0   0p000<20to kmi0V:0aS00`00<Q >Q x`$P |O &   B 0  B  BZ  B. "Q A% l0 S`0* ,R-  0000< V0 R   0 S*}Q00A R 0}Q 6000S 00A!l-d9&^ ]0S G-`M pQpG SpL/@P 6W:| Ѝ<PPP P $PPxP @BP 0   uPP6   $ ( , 0P4 8 < @ D t| 0000L R:0S005000 S8:  0A 0HJP0S 00,50000Y`  p0 P>3S! 1Ss Sp S <0RQ00p< 0 g  SV S<0RpQp< 000p000Q S S SS7 S S3 *S >SQP>3S S& "S 00 0\ S:_00PS, 0E10S*P8H0@0CU00C0 RB  \ U B!U  E 1U, X0C ^ဗ!1L0XRU!U!  R0>P P PS 00 000@0000 0H @ R00d000 K 80S@ 0Q10CRZ/TUUva0{al-Ee,1p@-@0PS0<Q:1,1 R40S"`$0V):8p1PS58 0#p(00<^ 00^ 0S8opU 0! R R0 0wP`6&`9&\9&0p@-P0@SQʡ@P80 p<0S P pH0@0@P(00Ppp@6&`9&\9&O-P-MLP0@p0H #W # 2RS T| z>#R  Rz R R Rg 0pR0R T` 0PgY Rm & R *Ra &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Rb R 0R  _ R Q R* TQ_RoQ_ B00/o00"P _Q0R TЍ0@P T @00S00 0S000S00t 0S*0S0T S00S 00S4 000_\0S 0S00L 0S *0T _0S 0R0S \0 _\oP0S00S* T00000_R0W0 S  _0S 0R0S0p>3p1># R{ 0G  a>#RJ RT RV R ^R Ra R 0>c0D2H0 00 P0 0 A>c pr8 pRd[2 A T0,  fP%0a !0R@pH00 0 P>cp0A0!RH{AH >3 0G  gP 0G>#`0 @ [P01!># R 0 p`>c`1>3"S`F 0 D>c2 H00 0 6P0 0 ( \(d9&2? O-P0Q,@p` V >\# (\ \Y \F \Q `P \Y \[ P >\^ \ \J \04\ \ \9 "\\ \I \ 0K \ &\{.\' *\ \08#8S \ {N ^0s 0@0s08#8S{0[00>@4N5>5. `F`FPV00@>N>0> \0C~>!0>#0 R@u @O-4M0\00(0, 0 00$002   0 @X = Q  0 R  R  PZ$P  (    R    ``S  R  Uj k V pw p (B( _U RQ v   _V R up  (B(   _U R w v  _V RQ ppX u0^ v  (B(    _V _UQO  X 0FPyu   p$ V    upv  w( ppu  v X pX qX0wo u`  _VX 3"  Q$,ZS (  X `M P0#v  _PU PRPU00000S 0R0 4Ѝw_Uw^RwOu2d9&O-pMP`80U:Ѝ0!>3S S8 S6>S1 0 800 0@YS  D>31># R 0800 0@~Y_  DS S- S* S( @` PS 0 b800 0@YY  DSU S S 0>#0FϠ2@P0  =P0  0P P 0, 0VPP   W` 0 PE >#P   0 0T  0Q>SP!>#"RPEP0>#2  F O-P-MLP0@p0H #W # 2RS T| z>#R  Rz R R Rg 0pR0R T` 0PgY Rm & R *Ra &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Rb R 0R  _ R Q R* TQ_RoQ_ B00/o00"P _Q0R TЍ0@P T @00S00 0S000S00t 0S*0S0T S00S 00S4 000_\0S 0S00L 0S *0T _0S 0R0S \0 _\oP0S00S* T00000_R0W0 S  _0S 0R0S0p>3p1># R{ 0G  a>#RJ RT RV R ^R Ra R 0>c0D2H0 00 P0 0 A>c pr8 pRd[2 A T0,  \bP%0a !0R@pH00 0 P>cp0A0!RH{AH >3 0G  gP 0G>#`0 @ [P01!># R 0 p`>c`1>3"S`F 0 D>c2 H00 0 6P0 0 ( \(d9&2? O-,@pP W`> ^* +^` ^i ^O ^a pP ^o ^Y  GP A^x ^ ^` ^07^ ^0* ^G "^ ^l ^ R m ^0 &^y$.^03 *^ ^ ("(R0 ^ y  ȠLȠ \0 00 r0     0s08#8Sy0 ("(RY 0>0 E00  R?o20SpG pGP t0 00> 0 0 0i 000>301> \00 0>000 1>3 SLO-u!d9&O-pMP`80U:Ѝ0!>3S S8 S6>S1 0 800 0@~YS  D>31># R 0k800 0@bY_  DS S- S* S( @` PS 0 F800 0@=Y  DSU S S 0>#0FϠ2@P0  !P0  0P P 0 0VPP   W` 0 PE >#P   0 0T  0Q>SP!>#"RPEP0>#2  F O-u!d9&O-pMP`80U:Ѝ0!>3S S8 S6>S1 0 800 0@~YS  D>31># R 0k800 0@bY_  DS S- S* S( @` PS 0 F800 0@=Y  DSU S S 0>#0FϠ2@P0  !P0  0P P 0 0VPP   W` 0 PE >#P   0 0T  0Q>SP!>#"RPEP0>#2  F O-P-MLP0@p0H #W # 2RS T| z>#R  Rz R R Rg 0pR0R T` 0PgY Rm & R *Ra &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Rb R 0R  _ R Q R* TQ_RoQ_ B00/o00"P _Q0R TЍ0@P T @00S00 0S000S00t 0S*0S0T S00S 00S4 000_\0S 0S00L 0S *0T _0S 0R0S \0 _\oP0S00S* T00000_R0W0 S  _0S 0R0S0p>3p1># R{ 0G  a>#RJ RT RV R ^R Ra R 0>c0D2H0 00 P0 0 A>c pr8 pRd[2 A T0,  h[P%0a !0R@pH00 0 P>cp0A0!RH{AH >3 0G  gP 0G>#`0 @ [P01!># R 0 p`>c`1>3"S`F 0 D>c2 H00 0 6P0 0 ( \(d9&2? O--lM%PQ0t @%Qo ppl        Q 0"RS. 0 YO,Q 4^ 8[ <``F0` 0Z01S` 0s vQBo \R 0C1!S` `0qx0 0Q[ 0000,@4H80<@ ; PP  TX0\ L0`_} Vd 00 S`FY10`0 0 ,`NP XD0S 00D0 ,>`PD00D0 0R < 0JS : NZ PZ Z `p3`XD0SZ 4P ,0@P4 pj,0@ 0S%00D ;0$00D0 ,LP5DQ/*0 F0,0D`P% 00 0,P0HP 00000D0 ,H0SPHDhX 8 D0`F0C0X?4@` 0 ,0@`\ 2ŁŁ XP4P HP PR [S. 0 Y),Q~ 4^e 8[b <``F0` 0Z"01S` 0s vQBo \R 0C1!S` `0Kw0eE6& 0Q00000 V,@40H08 <@P0T0X0\0 00S`FY10`0 0 ,`P XD0S7 00D0 ,r`PD00D0 [ ` 0R< 0JS: /Y PZ`XD0Se 4P,0@P4  p4P HP lЍ,0@ 0S%00D ;0$00D0 ,[P5DQ/*0 F0,0D`P% 00 0,P0HP 00000D0 ,H0SnPHD_X 8 D0`F0C0X?4@` 0 ,0@`\ 2ŁŁ XPpS0 0 Y,Q 4^s 80 0So <``F0`$0Z"01S`$0s vQBo \R 0C1!S` `01v0$0Q000 0,@4H80<@PP T X 0\ L0`{V 00S`FY1*0`0 0 ,`4P XD0Sd 00D0 ,$`PD00D0 0 S` 0P< JP:$0 X $0PZ`XD0SX 4P,0@P4 ,0@ 0S%00D ;0$00D0 ,4P5DV/0 F0,0D`P% 00 0,P0HP 00000D0 ,H0SSPHuDjX 8 D0`F0C0X?4@` 0 ,0@` V 2 (11( XPppp pnpl-Ѝ///@- // //p@-08P00@S PpfP px-7@-@0P0S TP Ѝ0P x-@-@P 0S u@P/1kP 00 0/ / 00 0 0 0/////0P  P@-0 /F? x->? P P/ /$P0/ 2#0/SO-,MP`TpP0`pR0X@$*$0S$00f 0Z0000\0 0 0 R0$ό030#QZ^A2  # T P@PY*0 0 0T 0C2@TPT  # 3S R0 YR00J 0S1\0S# 0, Q 0S 0YSr 0 0C 0100R 0!03S  [;[ 00,Ѝ P0030#P 0#S 0 RS#0 S 0R #3SQ  PR# 0 B 00Y00S  000CS 000G 0S  AX 00S 00JS 0 0 SDH S0" 0{0 C R9SB0 S H$0 0CR0%2 L _1000S 0!03S 00C 0t0 S 0 0(^ @ $ $0PS$0C[ 0SW  00,Ѝ 0R3Z0B\\00S SC @PTP>: 0; $ $ 20f4 p Q@-0M(,4`@0  P#U `0`/"`o R?#0.o^,AU-00ĵЍpFW`&-M{ {zЍLQ@-0M(,@0  P#U` `0`/"`o R?#0.o^,AUU-00ĵЍpFW`&LG-0M@p`0W PV P%Y P.X PmZ PNx P4  cW Pf   c cV+  c cY  ct cX5Z! L }c< xcЍYXZ-  gc bc  Yc TcЍ Kc FcZVY  PЍG8  ( 8  O-PQ0 Mh0dR00p0`  0 @P @0S nSc a0CS0sPL sPF  ЍsPzZ V000U000sPLZ V070U070@sPZ| V000U000psPZ V000U000ZW V080U0800oS RsPU000V000~0@D?sP 09sP 3sPiZL V080U080]"sP~ sP sPSZ8 V000U000@U080V0807U000V000.U070V070%U000V000 ЍU080V080U000V000rPZw ZprP XrP h h <   , $ $ A- `M0 0 !!0@PH@>SHPPP PPP7"`!P`03 pP0  p+ 0 @wp@ -wp@  p@@@dHw P*wBwP@w 0P9wP`Ѝ4w00@hŸO-1MM   @PD04 "( p C. `.pX@D;8 (@Q0Sl pıđp  ` ᬱ00 $ %0!`t0p@ !0 PP 0S Rv001ݍЍv0S 0K0S R PWp 0e8D<4! @ P0 0`0Z  0F10h,R @1ݍЍp FtH` gt0@-M0P  Qp ;Zp@ P& d Ѝ00 0Ѝ0@A-@@0s- PP0P 0,p` I``00`KvppX`p Av``00`5v 008@@8p@-@PCM0 /eP2 pPA ` @v00t2 @ 0F0 Fj0S VS00 SCލpt@@0Su@\0\ 0P@0  P@1:u?00@u00@6 p@-MQMP4@SZ TE /ePB QP0s+ pP QaP` 0u+pO @ 0@bkqpF @ p? ۍЍp/0si/,00p! +-`eu@0 P@0 | P@1:xu?00@p 04ku0#S6p@ bu00^u@[u@6=5|=5$G %@<4@ H @-rP`O-$(X,p.S`P@+Wu00Sb [0 0OYP: $" 2Q > !"04x"3S20*rW00Sa [0 0!Y P : )" 2Q >@AQ!Ou0 {0Qq w{` Y P : 4#0"Q . ![0 0XP:t' 00{S' w{Q e 0XP:  4#0"Q .@AQ!O[0 0X P :[y'@w{ 0XPy: 0ᚔ)Z@0S20n2" U%> "Ww{T X P \:4# IT0S20R2">" R01Q"Oi 0S20XC"""""""""""p@-@M@ P, `P 0!Eq1pP 02P''O-MP lP04 X 0 @,PPXPlPTP\PpPtPxP|PPx |pp( $pp < l00<008`0PPSSX01S 0 S 1=S 0 S1,!R 0SXv ,001S 0 S A!,!R0( S:t08$0px |0plx0(0|0pt $0p 0VP<\p LS *Q !OT d! X*0C 3S00< G {{GP 01C /AGPT P   00%Xp X Ps$0SP F$DЍ00[pG* 0C!R Q!,! R@( Qt08$0p|0xpx0(0|0p $0ptF 8p0V1<PS. ȟ ,!\ ^( S*P0 0X8P 01<p \ ,\Vt08$0px |0@x ( | pt0@$ pP4  N6?0,^0w <P0r  0=R< l< @%0Dh0H(00(0000,00,0> G 3,0PIP S G"x&  RQ9G#0 S0G P\'0sG `0d   0 Q0*0^*{ r0s{P T80< D000@ h0 0$% 0S 000000(00(0,00,0(00(0$Q0P S %R" :"  R#Ό01"?!x"0$00$0 00 00000S <\ X  NR HL\ @0Dh 0R{AP{{$hv `&=0P 0v> 0`0?d000P0?T0080?<00@0?D00H0?L00/X00\ 0 00#MP0L dSH0 G`0G0Gd G 000#2( R 0S $0S' 2S0 :646 0Ÿ! 0Ϡ!>! 2#1110N 0pP<0d2@#! (1#@ 1110N 0  ΌD !` R<l?, | 0/  "1? A D  D @0<0S H0Q 004 0 2 0< Q00:P0 0<R$0h00c 0<0@g< "0RD01H0<0@ #:6 00" 0Ϡ">! 2#< 1110N 0  ΌD ! R@$?, 4 0/  "1? A D  D <0@ S0H Q0#0  0C0  BQ $0 h00$%l 0dR  P~<@ \@@@Qm&<0P0T8<J  \0a Q00000SUPT8< 4G !/ G! 0 ) ! 0 #0S(0S9 `5d0 Q00/: c 0<@g%20SD000@0H<L#:@6 00!$Ϡ0!>! 0H!!!0C" . D @" 0D, P<8? D 0/  "1? A    @< P0LD \0#G0000$02p rp t t   0 RR  0 & G% G RQ#!G RQG# &|(0<0S$0@000<\=QH NRL0X\q<0@0@0D0h]0 000 0V0 0S Pj#Rd Ra  \QU% 8<&3 dP(  01) :60 0!$Ϡ0! !>@)0!!!0C 0Phh)! /.P P@<΁!@? < "AL00 h00H%00<0@ C00 00S ^0  $0h0 C0000S ^ 0@D h0 BQ0 D00@ h0  \ps; 0 *R" O-Mp@$0l4l`00+l0W0 T$ 0 2c1  ?<0UPP O 0v> 0`0?d00 0P0?T0 080?0 <00 4@$@$$%"0000  000T ;0h0PK 0TP dP< P= $`Pg0Sd Raʰ  R]ʸ  RY 0 0] 0S0`@dp?O$@T'pET0}Np0`@dp00k0@D HPv^D PEJ000000 0H0!00R0SX0 0h080000R4 t PQlpx|PP\RSY Y  h'@p| Ux Zt 0Sp0Xl0[h0 Rwt XXڼ8弸0>C 0CP0p00@t0p`VPu x0S 8kpt00 0800@4p0 h00 0eP |0( x PZv> 00! 0#/!! !./ B 0S!?.P  PɊ 00#1?Lv.C BAQS| \xt Ptj00 qp  A 0~qp `pV@P 0R?o20Sj00ߍ 0j0h00 qp@pS Q#! !pY@1NRp. h0 P0,P_000 `0  ZR 0`S 00@ tj0 0h@ekj0S 0V0ZS0 dh` I ?PhT0A ?8h<09 ?@hD01 ?HhL0)$`X\XZP Q`"jT00j0S@Tpj0S? 0ß園"b^2):##c2S# \TP-j<9PP 0l#0dT0HP30@pCi0h8P000 `0@4pP ? /( Rß&0Q 0Z/0 #10">/ 0 C!a0C0 0"#0R"P#. X#0,nX10( #ΌQà3\!=30S C! B^ D 0 E1qp> @p(pSPwi#00ti0S @㼀p h %@pei00@pߍ輀X) XXʕ 0Qi0 Q  s!P CiT00@i0S10(` #ΌQ0"c01 2c1@Tf$iT00| lS)\P(\ ףvɻ %I$@-@=T $p|yTat X00 R 0 R 0Q/  /   |  DQ p@-0l` SPPH 0@#  T\  Q p/  H  Q j.0 0#  Q/x 00Ɠ\ 0@-o>lP 0@" \ 0 / A-@P `p@P0% P @PPA-`X@@P pjNP0& P @PP A-`X@@DP pH@P0& uP @PPO-` M 9 pP8 찟` nJPP P @ & KP @P0S  Ѝz P W a M0p0S, A-PpQ `@Q P 0@DDB(000S  7@- M`ppPP( g  00S@ g0"S" 0p000S0 7/ Ѝg0"S1Ds\0pT000S @ Ѝ1Ds$  kT 4| @-@I G@DO-MP@Up  PP2SPR m PV P` A T @ vP) 0nS: P= WP0 p0Q Q mP P I0 B"q S000KP Ѝt0 00 S Ѝ0oSP  9l 3O-BMM@pf 0 0'SP:VPP  SPm00x`UP C @P@`K7( 0PPp @0P0  0PP p 0@P!  0dQ PkPUPp`  pw ?0 aP| @PP0 PpN +tǦP )PI Gnf 00BލЍP/U ` P p;Xf0SJ  PP P0H00 PPp9  P8fl 0 0PPL! 0 )0 0%f( 0 0Pf! 0 00Y^00/f 0 0PPe  P0 0Pze\ 0 0PPpT L D3  zd@ 01 t \ - M 0  PЍ- M> 0  PЍ- M? 0  PЍ8-0M  0JPЍx --n( 0P    0/ 00xp@-PPU@pie,0,0? `0  6/p( p@-POU@pQe,0,0? `0  6/p @-U @P 0003/t @- @P 0003/4h p@-PU?o20S@p000 3/$ A-P`UV00P00S@ 0 0p0 7/pԽ p@-PU?o20S@p000 3/ p@-P`@Ppd(0( 0@p@/p p@-P@P p 0 00 3/ptD -@- M  vp@(0(003/ Ѝ@ Ѝ/ @-vp@0003/ G-@- M 00`P "Y0Sp Ѝnd4040 P@:/88 G-@- M 00`P *0Sp ЍCd4040 P@:/ܻ 10!Ph/////x/p/h/`/X/P/H/@/8/0/(/ ///////////////////( ̻ 0 \ L 8 T   ػ Ļ t \ L 8 $  غ ĺ | l  X @-@$ MP05505#0%A0!0%P$00$0Ѝ R/,0p@-S@p(P$ARp$0S* >$0( 0C\ 0 CR$ *0#$00S 53$07$05 0$0(0, 0 !PpO-DM@Y@fP , p@a Z P a@O Z Z8$0P$ 0@Y Q< `@@ QQ3 Q0 S0A1@ 8 ,0R h S 5,3407,050,00 00 Q, P0Ç0,  0, 0 Qa@Q8,0P p S 5>37,05  50Q,0g 0 CQ * 0CQ,*0#  ,0 0,0S 537,05 50S 5,07,05 50S,0YR0#0C RL00C F5$0qS 5<37,058`0,0f[= A/o" R  F[:AoP  f[ AA0@ \Q{b0 0,0S 5#37,05 50,0 QS 57,05 50S,0 R0#0C R00CP,@DЍQj p` 0FQ)Q* AR bQY fQ ?R0@SP p7r bp@S B:p: # C,s 0c0#80 S ,0 S 5,3407,05 50,0FQ0 00,S Q 507,50 , 0 5SQ05= 3 7,5 0 ,Mb@0`fN2$0?Qa R^  2! a, A0! @ `3 8 Q,Q 5<37,5 5,8Q,  P,  , Q0@ `0 _P$ P! QP3 ``` VRQI[  R `S` 0P`0\ P\=Q,0 S 57,05 50,000 R,0 Q ,0 0,0 R`0S 5<37,05 50,00804Q 5,347,5 5,y ?R0@S@`0%#jo%#jxv!%ju-M{00{Ѝp@-MP@` 00 4/ЍpG-PRM\  `UpP*a@/PP D1< 000pp Ѝ80S  1 00< 0 pp`0S Ѝ贠 `0S 0 < @x0< 000@ pp`0S`00`00Գ d X ` 4 (@- @MЍNO-EM MaX@Pp+`E,K Y0P@)T 0 Y@0PT 0 l0EAP J JUEލ ЍZ`00Eލ ЍS`00p @-`@M pP\[P) /Y R rR  P   0@ P@,ЍP  rR 0rST 0 @0 Ѝ@y` 0 \  4 A-` @p 0P/S /XP @0 Sp 0 S E ^p@-IMM@`PP p 0: S X0 0up IލЍp_O00@IލЍp_00x p@-IMM@`PP p 0: S X0 0Jp IލЍp_O00@IލЍp_00 - M 0  PЍP 80Q 0 08080//p@-@P PP` ץ @PP u PP  p@* PPp-40- M,0   ЍЍ/0IDP --M  Ѝ Ѝ// -@-MN<@@P 00  0Ѝ@Ѝ/HD0-@- M@NP  Ѝ@Ѝ/O-`Pq,Mp;  PR$ Ppp @P$@"PX P@ 0 @XP N ,Ѝ000:Q!0P00,Ѝ HTp@-0(MP `o& (Ѝp0 0 FDp@-@`PuNpp p@808 0p@-(M P` H& (ЍpdFDHp@-P@0 0@`  ONpp p@mFDp@-(M@PANp  &8 ](ЍpX@-@P0 0,M`P )Np & E,Ѝ|EDC-PP,M/ ``FV` @R p V `@0 @T M,Ѝ00 0:2 0,ЍETp@-0(MP `% (Ѝp0 0 CDp@-@`PMpp p@808 0p@-(M P` % (ЍpCDHp@-P@0 0@`  Mpp p@yLCDp@-(M@PMp n%8 i(ЍpX@-@P0 0,M`P wMp V% Q,ЍBD P $ Q80 8@-M80@08 Ѝ880/LL0000 0<Q 80880Ѝ/TBlP/0@- M@0@00S 00000 X x PP  d00B/P00 Ѝ0@KP,;|A,((D 3O-0MPP 0 @D `p@ P P00U pp00C Z 2ATT00  RF LD@D T]:[ 2 0000~`K L0 V0 W8 \2ATT 0`Fs 0Ry L  0% 0 B0SH L0Ѝ V0  0  }L ` 0 0pHX;0S2 0 eLv 0 B@  0 B  BSL`FtY  B 0  BCL 0 z 8L 0 0S B 000Ѝ 0 ]@ 0 0 =Dp@-@P Lpp p@0RS00 /D0D0p@- P@ Kpp p@<D808 0 QR00 /<<Dp@-`@PKpT T   p@php@-P X @ 00`KpTT  p@p;D"O-P M q 1D`00 SH,0?e@Qpa A10A1[10GPp`u ,  PPDEQ "$(Qp|0Ap7 @[0 S8 0?# R R!R@[u`p ,0 0 00NC11P00P0,0@ Ѝ@ $;0 00u9DD0D 0@-00 @T AP80@0808@-@P @P80@080-M0 Ѝ-M0 ЍO-PؿiM ̑Ёqf Q`P@ P?`K͌U P\?K͌T P?F͌(1S P>F͌(Y P>C͌ X {PL>JB͌8W jP>̌1S XP=^B͌`=@ 0S708x H0PP `P, P  P P P P P` P@@ (P PpP (qP PD PxP'( Q780H0x100CS00000C(0h00Lp P 0QP ,0 `0p@ , W @  gpV/!01AQ 0 0 @T @T, W   @@daXhP 0Y Piߍ P 1 S ,0 0 0 !1S 0D 0| 0?p00J,(00PpL!!\V( @  B  $48p< [$ 00A00@S9 00a1 P Ua PU, [000 P,0匐0Yp$0p1P,@`@P㘼P ` V ,@0@S 48p<PP 00 0R 0'LpP1L0׿0P@X1@ @P0Ͽ0P0$001T0ȿ0PP1P PX00P0000ṿ(,p A8 P40P0@AT 0<O< U, p@PW 0g1pY@10P00 `00V00 `xV,0W0 P `ܰ少[@`@PP  ` V @pY @ P @T 0 P8 U`T,p40@T`0 (!  A A$@ 4 p,`0[T0, q q000 p`8@<\V 0f1`W10 @ 00 P00U00 PU,0 V0 @ PqZ0P@ 㜻P  P U `W 8@<\@7P,0@0 0 ,0pG0H W0A10D|aD>pU( `V( V( V( V (  V,( JV8( VD( ^VQ,0 1@-( `BU0,p4@A,   ,0@0H T0封"1D|Q=p T Pu[3p,`4 TP2 00RV 0Sf ,00 [D k! 0 SW !L011@ @ T @0T,00 0 @(0 pPCT,`4 0 ,01 , 0@ H 0T1D|=p! 0R1B@P㢺0P @T  0 P (0 SQ(0 00CP, P08T0 X" 0 0 B00 S3 0 a0T !1 @Tap @嶼T,000 @,0,0Q@ 0@1P`PL0P: `V  0PP$0SA ,00 $p1@T d!@W3 !P011D ` V `pV,0 0 0 `Tq[V` ` [  0 0P,p40 0 (0 SW(0 00C,p @0 [# 0 0 B0!0@SB 0a0X !1H P U a P!U,000 P,0|!0RP0P1 `@㵹0P `V  0 @ p3 00R80000S p,`4 O-`YM|0cS PAX3? 0K͌00 00S 3?HPK͌0H00S2?p`F͌(0p00S|x2?@F͌(000Sp,2?pC͌ 000 Sd1?耍B͌8 000 SX1?̌  0110SL1?<1NB͌ 0810 @iYߍ 00"0Sk HP0Sv p`0S @ 0S p0 S 耍 0 S  10S N T$T0 D@-<@M $( ,Ѝ D0 D@-<@M $( ,Ѝ\ D`0` 0 R/DDQ 4Q(00?H/ D|$T0P0/ D @  R 0  R$ 00?H/|$0P08 A-D   R'P?UH0@aaS@T,p10 0D   C(   S@T,  R 00/ |$0 0 Dl P  `0H?30\ -@@  D\,00D//|$O-P␲4M  0pS4Ѝ%PD H0 L ! 0 0|!0:|@Pq 0`D0ZP`@P0Z0 T㜷0P V@H 0`@:1 0?3Q |QN D pH0L  00|"(0S:!:`P0S R,@P@RP 0 l: @RP0`S4ЍP U|00 E0Px ``0T `@004  00`Pd @|``|$0 0 LD`0` 0p@- PU 0@S pP7eppDp@-@P 0PS YP Npp0P0& H -? \| 0DR0S  0R0000 0\$( /|$0 0  D 0 0 /pO-MpRp2P0@`0Vu T":L"@"4"("2 2 $ 2 T 00 1 X 00 1 \ 1 ` 0 0 1 l  1pmp00pnpp@z20吲唢園 $0TX0\` 0lm0n e1Q0' 0 0  pЍ|0x0t0p0l0h0d0`000X000P0L00 0D0 @000 h<0,$DC-pP␂M@ | `P {h2@0@Z  @03""BBB {6`@"C{@@ÅCC̵PU CD pP 1pK 0p RZ @B0 @@@(P9 0 @@@(P. yp* $p& p0 @(P  ?'f(000S :3S ЍP ZB2S@ T嶷ᴷ`h0S,=@pPc4Xs A-Z`pPp ZB2S@ T[S凷具000 R A} A x@@-+ hQhP@EM`_0  S*<10#  !!!- !!!!>  !< !^ v : !' !.{_ !| !o !* !Q>{ R pp1 R 0S8ЍQ L0 0 0CEl00TЍ!f0L<0l 0 S/ᬧO-`Dt@M[p+㑷(($ XE0CS0S4;3G LP*40H @08p{8 t%p{ġ\T(ÂLLßDDßP<<ß44ßx,,ß ߂ß@ßÂ`h"Ÿ! ⼁!: R 0S1810S XけЍQ d2 0 0[DLr'>ppGl`( [O(@ T (0Ѝ>㼶@ <㶶 ^㳶v㰶#㭶x:㪶'㧶#㤶0# 0堶H#㝶p-㚶-㗶`_㔶|㑶o㎶p㋶r㈶yㅶzザ{@||h}y`a| p %Ц+!,!-!.%0%f&i%j%k %l%m<%n#qs%t~$%#up4%#vr,%d"wy{#%e"`"|oxz<H00p@-0'N[( N(@(0SpO-M4g47`,0 Jҭp7划00 7 `0P `00 S00U0S}U p @00  4` S  00 4 `0 s 00bR$ 4S4 0((&0 0Ѝ$0 s 00bRS4 0㋰ ?<21 R R3 $ ` r  aR$ $ Qt l   P5U0pS  p! @00 4 ` $R{ 4 0 0 ; 0m $Q B q/ 0 ;0 ^p4 S S040ST 4 0r0  cR0$0GU  p p P p0np P 440 s 00bR43 $0$ 0fS t30l3#`[ pS 83003#`L p3 0 B ` 40q0cR 4S02$0$ r0 0C aR?o$2#R p SM p  0 s 00bR40 ;0 㽴p P `R pa 40 s 00bR4 4$R40 s 00bR40 ;0  围 pE `Q q 4 00 0q0cR  0`  Ѝ 100 ?c p; 000 ?c pv/` 0 `00! 0= 4 00 40 s 00bR 44 ` 4pĵA<QT(td 80p@-P@ 0 PL TT TpO-@Pd4`DM0 8 p$Qq  :Q#R3Z 300S 8G<P@P@P@x@-@GP `GP FP10S. 0! P:0@S0S0[S0mS S@ 0S 1CQ'0@S ;S 00C S0000@S0@S mS 0C;S P 000@S;Co0@^ (^ O-P0\fS`MpHvpJP T0 pr(ʍ"(0I"Rp (0$00 03SJ:PK ҰT@:P ɰ XRڄ5$|50T l5"00\4S03P00S5 p0S2 4S, 4S 0d%V、匑Tp"2 2Pm 4p2Z& LQU# P P ڋP a^oH5S4S 4S0?o2 K04Ytx2 PtX  FP3Zx2  FPx2?;~0x2V  vFPx278x23X|2 PV t3|2gЍ0 D $l h $ <% p 0$0(0LXi PFP Y IFP Z# BFPp2?;~0p2|20P?0 r("(0H"Rpp2Z00T @8 300 -?!p 0 ЍpԑDl l0 00S X  8Q Q @ ,@ /&R//pDH H0 00S 4  !R@ ,@ //D`0P0 T 0008!R !R @0<@0/6S//ᔐ<0P0 0 0001S@0<@0//$l0l 000S X *" (Q Q @ ,@ /&R//؏D$0$ 000S @ /\DP X0:20(!R !R @0<@0/6S//0P @ /A-@Ppp" 80  P P`p  i D000T $000S0謎LL0 - 0?o20QQP TD,0, 0 RP00T00/᠍DA-@P``$ 80 ! QP~p P eT  800PU  000S0`0 0 ꨌD?o2?PRPT //PP00T00/,0, 0000P/P/$,0, 0000P/P/O-@Pd30Y Q T# PU D#00SH04SPPQP0pGP0HS``HpHW, 0 ^  1  !!.pGPI@Ye0pS a[0 SqU,0 !0D|000 P0pP`a`0IS`IX`a,1 \  0  !!a.pW`YH0pSa>0 S:,0 !0D|000P0qpI PX 00C /0HSP 1TX[00CS``[TY0IS`YPY0 0CPYꨋ|0 0 (Dp@-@Pp`P0P0C(, ,1C B00R00@UpP 0S 0@//P 0S 0@//P/P/P/P /P/P/(!O-PP , 10, 0DS 1H`?c``  AAp0@!qW#갑@W0 8 0| 0p@ P@ 0@00C `2̆0 00ꘅD\000S  Q R P 0!00//2d2-(^Q,0 , R1S ^^1S ^@O-MA!1@ 0Q4p, @p P `0S" S#A 00 0C ```P 00(00(00S00C0T0 03/p 0PS@(  Ѝ1pd100(0A-S$'p`4@P(0PS@Q Qa ppQ p 0P(0@Spp(0S/p@-`@0P (0@SpP0@-0^ 0 @ Q@R0h/O-@ M`P VTppD0S  00C(00@00 T0@ 0 S `&, 0 S@p  Rᰁ@`pD姓 ` | p Ѝ@0 S RR Ѝ,P d,00P `00V  ppG , B,(pqqA0 ` T` 0Dp4P ,00 G@p`4 0Tp `0Dt@U   PB   0SQ 0 0PC $ 00\R <@U 0 BQ 0C R G-@Ph 0Sp: P PR E PPQPEPUP ` `R F `0`S W0` XP0`F`V` pW 1 $p00SC 807`PL! R@! P( 4! R# $! R  R 000S1Q0/P00` 0S0  0V(W ѳ`F`V`0X0P`UPW`V``0 @p 0 $p0PEPUP ~D0@ PQ0 /$ $\/ P/|A-PQða@`؜1Pp0$ TY 10 0 QTD$ 0R U ESpL @10 0 QTD$ 0R U EAp: u0 0D  Q SC$ 0R U E+p$ 0$@ P0*@0B0TP @T 80@Tp` 0Q{D0A-PQÈP0P`@0*$ P uT00pW  0TyP- 0S* 0@- \&@T!\8x ƌ8 t ,0A@0@PU 0P0U00 S0/0?o2?=XA-P$@0S00â?4 0\/@0 T`A pB 0S%0^! 0S0X K"@0 0 0 9@U/P 80Q@0@08080//A-P 0 BS0@( p`0,,0 0CA1!0 0t`@0S( 8XE?*0@-0B  80 P R00 8  $P R  R0 00S00!R0$R0 R d1S0800800080$O-RQ M40z`pٍ@Ps 0ሰ(эP,o PP0^ X4% 0080!0Sa0 ` `8 < X$p@0H0|0L P0T`7 4!8 \0`0d0h0l0p0 Ѝ㶎P4, 㔍P& :"R- 0 R80SJ 0  V 0P 0PʬR Ѝ Ἇẏ ḏᶏ@ Ѝᮏ A-@P0QM(PD QpAR`    B P2 \/X* P%ʤ,APP  D0HRD0000H p0$`!bP@0SЍPЍps@-M @ 0Ѝ@-M @ 0Ѝ- M ЍO-M@ā` HP`JU@p_WNVPED   0  PI 㪏L1D00S*Y p$`(D0@0S0p`0,0U00 D0U@pC@`C0Y Ѝ00H00H0t  P PEP` V IIP ЍP @q|$000@-@PM0 pp  00C  ?o2 0 mPP <Ѝ0PЍ0oDH@- @  0M 0LЍ$o-QPDM00  ( 0@4ЍnP8 /0@-0CM 00 @0C0 0 0D NЍQP<O-DM@hlp0tx`PP RK TNP@[ B^@D࠳UEpAPpWAA^APU0E pCPpW\[4AAA!p @lp0,00@0@0*l@0 @ V 0 000@ X@* p0Y  DЍ   Q Pp X@* 0Q0 00C0CmO- 0@000DL0 0  0SO (@@000h0S80@080 L00S$0>, 0(0\ ,0!0 8C8  S^LPQL00 (00SCL00SW ( R), LP S800,0 1G$00Q$0 0\ 0(0AQ 0 , S(0 0 00,1$00 04 S 80pLH0@0D00|00p 0SL01H@804 0,0000t,04 0Y 0Y 000S`S0F0Q804 0,00 1 1 01IY0Cڸ@LHPQP  YqH @ R  T000P P 00 SPS P*0 R00S 00P ɟ`V0 0CS SjpO 0 AS0 S P0P ` P R  0R  `9,00Se@ Q0C0] 0 S00( 0S(00000 0 S(00 R0 000:3s P  RP   `   (`R r @HDHT,0Q0 L000Sdl8, 0@000h0S(00S80y00S3 80r 7r 8, 0`V 00PU0 0CS<0 HDD<0NN Œ Č Ȍ N LL\mɟ`V?A8 T0T T@00D R 0 R PP! YR  uY $Rj  0E0 ~0pb   0E  @000$R , |6@  _@000!R 6x; 8000Vz00C000C05, 00SA0X *1h"0 , 50H 0 8  0 4P, @ 0ep$`t00S000 @0p 111qWP4$0 @00 00S~ 0 5# X0:h280V @ t40S 0S@4, 0pQ0A0 0C0 10 0 SPP 1 11RY@z RRQ] 0    U,Q Q !PB#`F p0p`P@ !?3 pGWaFP `/p @ 0  L H P 0P0P00} XX0P0P0;^O L00S6(080 } 800  L,10  p`dЍ80LL008 0080@080- R d1SdЍ( 0 09x \0, p0, Q0A`0Ջ8`! ,\)PY @W,,0 | $ rdtll@YP P0@, QLJ   8@,@ APX@T `P `pPT` P0 `, @ pPAP(UD EDP  P! Y   @@T` Q0B0CP`P P8p0 CQN @0p  0@4$<0S P 0,0[1,01`w @@[`o P  XPn0$0S000 $X00@4< pPLPA\L0(0 0R( ,0, ` pJz5 @Z0,  \F `0v8 0(00@ 0Cy(@ 0 080 0 w 0XPx    0Q0000CP4` 0X0H0800D\#  LP 80P0帀L Z J D| p~Pb d1S_ , H5@  pUP:X XP@ V@DT H HHE@H00:  80R0,`0A0000X0C 00@P ` 40 0E00 PU U R0 R  X R RR)0SE 0 RAA  ;, @` H0  `@0 0p;0 `00P  +0@` 0 B00 0P v  Q@ 0`00 0 @000P  T P$ , (=@ 000 @000P" , |=0 0  0 A R! U =, @@p0 0p1S U >, @`@0 0PL5S 0 0RU l>, @@p0 0Lp00 0  :@000D, >@ 0`C00`0 $@000tW + q 0 U@`; 0 0LaP2Pj @00 pRU xʕH%Rl0 @@TI 0$ppP@<@U; <PP$p@`0 0H`%UnH50S0X0S* 0 0 0 0, @p@0 0H` U~00 0  @000jP$pPb=Kl(p@-@PPMP0 0`0 R    80x t000 0 00P 0  Ѝp80 D000 0 B/ 0C?0Ѝp60 005DC-@P⨐M 048! \` d0hlp`PpP_80  D000 0 B0C 0/? 0ЍЍ5@-@P @T(!G-PP 7 1D00SHp0?sppS/, ` !a@aT :#| cp @V0 S0( ?3 S 0S1S0 S  40 003D 0R" 0R0 0#0  -QR ^ Q QR 0P //op@-PP @0 @T $`U0 VP `aVp`}0P 0@PUpT` @IT @pp ! !@-@P@3T R/0A-p,SP` @T @T0`SP RQ A0@ ", "Q//@-pQ'`P@0D "! "T "! "U ^ 0N "! "\^`WP@@-@@@0S W$0P0C$0MO-M:z*0p$P( ,pP `*00\c S@@s  nRXan HR@ @j`40IS0c0@T ^ጰOoB@TP AA  RT0)\ 0  |  bR\ `)` R&P) R! CP'(I@, 4R S[80S $ 0P00B$0X @C, 4R CPg S ^\ p( 00Q P80, H04(0RK0((H 0@0( ~ $P)0S700S00l0S$ 0 S! , 40R$0l P, 0S  p0P$0@P$X70 R(,Ѝ<7 0( X$(00 SB G @ `5 & (00 S5$&P0C (00xP0S 4$0P0C$0*x&  l&@ 0,@(@ R 50060, 40RofF`@0,0 $P,40 P@0(@Sg 00 CRcڴ%%  pp% x%@ 0p(`Y ʡ| `nR`F`V,00P0S  $ 0P00B$0X@@aV  @ Q[Q $ 0(@0C,000 0CS[ pH40,@4!0,01010zd4`000 P ^$ $@$#@ P(@h0 Rv ,,Zq  P+ x# ? l# (@$@ ?#R W( , #\ $6 (@  P 10(@$ R )$@ P  @ lP "  20,  , k40 S [ (L2 0$ ,B@0S $ 0P00B$0 $ 00P0 ! 뼱 00(`V7ڨA@ 10(`0 V0|!0`Fx P(`0S $ 0P00B$0,@%A@0S $ 0P00B$0 ,@l/XhtHX0`\LtT(O-lsl3phC@00 M S *4000400c`(,P Zn34@3`0T'#0C S402PL좟 >0@DS(00S0 0l0S R "0 0 204@,P0T0hP \RP0 @P 0( 0CS RP 20 0 P1040 ,( Ѝ00S00h0S00}1 0T0  P,P@ ᨹ@1(`0 R*T$ !P00 @T 0 R 0 P$ 00 00l P @T00,P0 0( p0  04@SRCPE@D4@P,K 00SL004PP$0xh\lH (@- 004 (,<(@- 004 (,|1|!0O- p *⨒YX!X P!0P[& Z( 0S!,ppG`P@0   R    P0 P00P0`SYPU0,@a@DSQa@U S@00 0 Q  ST 0, 0 00 08QD0S0l%R h%R /!R!RtP/P// 0 000 0P/G-MupP/ 5` 80s2 hD  SP̠r HR!1S85@050 50 `\P 400 ~0P 400 s40 0:p@00@00l%R h%R 0ʀl20 h"T0s# 20T0$,,h"h"+h"h"+h"h"*h" h"*h"@h")h"h")h" h28h20SJ\Q*gnSt@ Q _SP9 Q ZmSV2 Q iSPV+ Q j`S`" Q _SP Q kS` Q[PS ڃ0Y[=20  0S R!=@-pBt000 0SD"D2 R8Ÿ8 =01U+ 2bA`PU" 0S 100S H0 0YH0 ,N 0Q  Y,PUЍY 0   0 0 00R0 0 !R 0ʀl20 0 !R 0ʀl2%R t5S 0ʀl2Sp Sn Sl Sj Sh Sf STc,,l,\1P0PP PKPK 8 QD\B @- 00ʃlœ\ 1:t“ '@T tƒ'> 'tƒ A\ B\ ^tƒ    //,?!1P0= 00` P7ʀ:l2 S3030 /@ P0000CS000000000000000000/l7@-P@M@&\\ Y #3t P P 00 &000 0 iЍDl`P -P\P Y # /0 0 |  0S h h0 8=0!H00 R/@-  t,((1 @-00*l"R !@@ R  ,Ǡ 0:'.tB00 R @R  AR  T,0 000:h/p@-P@0@`M0*l"R R &Ѝp`   P H000 40@ 00 @ &Ѝplx02C-00$RS MP@ "2` @  "0S 1#{0 Q  l"R R, !`@ '( v@ Ѝ1=00QM0SJ\1`20lL100 C0剑Q:20h1=00Q!0S0`20 000 #0剑Q:20t 000 0`0`U0!Q 00`I0!Q l0 0 0/|0| 0p@- @00CS0 S 0 S P00 pP00p@-0CS@0 S 0 S P00pP0000 0p@-00Pv@p p@-Pv@p 0 00S  @-@J Q P\,Q    @/H D0P JP\@-\,AP /P/0S/p@-    A BJR@Q`,PTa@@@AR  Rp03O-0PP`$MC@ V vpP 0h#0C S-000$ЍpT0 S80  2 0@˳  B@DT p`$ЍIɟ,0 AA!R1A0 CQc(^01H1H1PWZ0!! ! :  `J T0@ ?Zq $`P@ rP, @ T  @ PW0(@p TDI0WD@0 (0C\00Cb$Ѝ\ X@ @  D0|0_p H0001@D T `V `tV ``  @~` 00 0 Dp@-@Pppp@@0@0p@- P@ ppp@hDX6O-0lM@P,0 g Q 0pu`P^ P+r0P0X W  0P <0R0 080ąP 0@SF00800`P0S P0 0 0PEPUS 080 00PS0P<0< ,5 000`Pp0 @R <0T R8 / 0<00800C?800u0P`F*uPY`00 !u, h480 pP pbK 080 `0`p8ppP P8 0E<,Q4pQpP Qձpp( X< R!! B qH" RW`!: pG UH0< S8 8 `< (P4@p$0,0 1400H0p@0 @0 0D"PU<$0 (Q0 0C0 Ss 0( 0C04 Q00SP{ 80 0B t,0"8 P α0PI00 08p0l8 0n800C?80lt0pGP0C00S`FT_t0pP0000C0P00 0PS8 0E!q Xi 0 0H000ᰡH XD0|0p"slЍ80< p` 0<0T pR0`<0 yPo 0;slЍ`~r0 0 ZDp@-@`Ppp p@L J0 0 BDDp@-@Ppp p@5Hp@-P@0 0@`  pp p@!DD0D0p@- P@ pp p@ D0p@-0P `@0000 0PP`U1000C1.V P*U /UpR00ppP00 0PEP``@O-SؑM D@HP 0T p @` 0Z  A 4/ 0[ 8 $[0<SD100.0S0!10>0P 0@0 0}00 0GP8  #8 S R0 0?P4/ZXЍ0G\8  #8 S R@0p0wpP4/pW4$Q# @-@M  R ! R "R pP^ 0 0 @`Ѝ/@-0QM   S S PpP$<R@ @ 6Ѝ<@- M@0 @!ЍL0L0 @-@ 0 ,M@  Ѝ蠲 p@-B\\@0N ^\1  @ %  ^ ,\'\{ X"LB!!N0 ("!! L0 }p % !  ; { \PU@ 0 ER7d!@`PP   P0 B! {c\ "0  '  p @ p %X  + {p\\:\ c @QO-$M JnPE@PP 0@%pp 0 6S pp; @`\,S 0  @000 S  P~%S+0LGS00 %0i\@0 `f` 00#1.Q0*Q 0 S @0 SPQ0% p  0  @0d\% 00 @ d @ 0 S4p300 0D 0   0  00 < @ / 0 0@D0  @00{0 S[o  00P$Ѝ0 SQ0%  p  0   0 @%@  c  t 0 SQ 0% p    0  V0% +c@ @  00@Q0 S0 0 @0  0" T 0@40  0 @0  0 T0 S\R$ W. 0C00 S $0< o>0 / 0 w0`f S` 0S0\S 0 Sa0 000H ,p@-@P0P`M0S SP!  00 0Pl 0 Q00Q H  < x0  Ѝp 0TA-M0PSL!00@0@P0S? 0  ` !~r!!`"bNL LL 0 0210B q0P pW$P@WP 0fSPЍЍ 0Ѝ`NgA-M0PSL!00@0@p0SE c 0 ` { !^RRN  L !0 120B Q0P pW$P@TP 0nSPЍ"0ЍЍXkL>G-M0S!0 0`0@0S[  0p P  T1T I $L0!b!bI4ቐ გ1c1cL0 0Ã#3cl 10B qUP)0< X" pW $@r0sSAP @WXV @T nPPPЍЍl-?L*S0 O-TMltkPPPQ ,$   0: 0 @P= 5e000` 0: @P 0S  R 0Z I #Z =Z =P  00pP0 p WQZ p K0 0X*Sl0P0 0S, 00    ZP  :nY P Xmq0,0@ 0|s8 l3$ 112cAL3L112c B L00'pr!qpC 0yqP  0 p@B `@Hp, @W 0S  m = @P0P m WP00TЍ  0   !$p΀‚ €‚ N G !1 qrpB qPJ  @:p 0ll \1 $ ϊ0K $$N04!b1c$!b1c0N K 00  0ɉ)1i1c1B뉑P 0tS0cS0Spp@ < pPVY rl00vtgݵN`kL>*S-?LT9 A-pP`0\ %\0@pS sS lS P0\UUW h000@1CP0PCV`1E !W00O-Z A0J =R* =S00C?QRp  Wp1PW -.R0 XZD cJQ   Rp| PA0JlRpY PA0Ja0J Ro11OSr00qߍI@[/hP 00040hP, 000#pRp  Pp1l X   QU PEQQQ W! 340`0 R,R*P  0Ap 40P040 P PPp1  \1SB 0C111S? Z! J 02( R 'ZPOQ0S'Sl! 0S'S'SX AT 0DS11a x7@D!&J0qAVZ ຠ `OTb1p@ aAl!AT @DAAAa0J RA0JS3J Aؕ 0000 0 B10 OQ6 10}RRl1  R}R}RP!R[ 1h BY!u A400 P1`Q,*P  0ዊpa 40040l10J Rg1lp1OS!!0Pl1XAT @D`1AP OT1a@0A1B0Sl00l0 0St00t060S&   ?R ;R P0S %S0 01S/ 0C11AT, 400 Q,,*P  4 @ , 40,0PPp1DA0JS30J1OS!0l100@1@`hPx 400`,Vp p2hPm 400p,000S   ?R ;RN eRQf P0S %S0 0AT @D1! AOTA 01!0l1`V ```&``VP``P``ø`@oobP``V ``@Q AIQ AAT6 @D1!Z!oA媢Vp p2qhP 400p,PWn0`0h`00d01 0&J GZ @ppV00R00xN!J0o ᪢0F00*A0 0vV@``pO`V@`pJ@`fpF@opB`@p>@oopb9td' $ V8Z- - M00 ЍЍ/- -M0 0Ѝ Ѝ/- - M00 ЍЍ/00/`zA-PQMp@ 0S XA {gP P` 0v0) V T~ 00 +PP0T0h 00ЍT  0 0 R T Tp߱P0S T`8 ϱ( ᡈp 0S R 8(C8B((0 000ST00P ]g  8C8(0P Pg  8C80TT@4d7 9 $9 8 8 ht@xt8 H8 7 (7 7 0R@- ME@P Ѝ0A-pPEP U) @T`0DV 0PS |@PV  P oO-PRM pQ 00Ѝ@ `Pc % Pc Pd `%0 ES  fP  P p  0PPP0PS  PP  0S  P  0Sq 0S 0PS 뼐Y$ P Sg$%fP !fP fP c뼰 0$[PP "  [ $@P L 8C(CnR sR fRR0S  V R00000@H$H TP 0:  $0S 0C8#80 P p0    V0Y P`Y 00pa 뼠PZi 쑟  ༰ 8C8PR 0VJ *ZPK  PU; o`嫲  PEX%X U !  X ` *  `0 00 R0V00j0S00   0/V  R000W\f  !eP$( |0(C-@Q!PMp` 0e P b00_0S< @ЍRPP  p0 p  R 0S 0LP@ P@" @Ѝ , 0 `P  LPP+ P*PP004|0 tO-M M0p0:S$0S:S@ 0PS:S``E[ P!*  `0  kP 0P:S ۍ Ѝ@ۍ ЍC-PŸMM p@`t(P2 0/SB ͣP eY PD RO P 0 ۍЍC\0P L! ᎅP4,0P 0S/S pP QeX0 ۍЍC0  PۍЍ  p 0i/e XW P0P 0 $ۍЍ404 0 $L- - t- d- \- - t4, P, G-p`@P  _PeU  VP `P@P>P @T P  0@010GP -@- M@00 Ѝ@ Ѝ//E Ѝ@ Ѝ/@-@ddd@dd d0d@d 0p@-S@M 0  Ѝp0`P0 0  00` 0 Ѝp 0p@-PS@:pS cP!p!bC- M P@U pᬐ`0fV@@PU   W0 nV sV ~ PU  @0s00 Ѝ R@@@O- M PU( `pfSPU  U t@8C80@P 0nS sS  @@PU@@600 Ѝ 0S00PA-P% Ppp R,R    0S,S@Ba`P    `00pp@' @t C-p M@`P(P:pWa*nUB sUc fUH0D Y2R4 @ bP( H0D@ pH0@0 H0H0nUp@0 H PY sU> fU' L00L0 Ѝ @EP Ѝ@P &a 0S0080W < 80H0@ HL00L0 80z400H0@ 400tH0@04 H00lH04 0H0L00L0 @H0R ,0 0XH00H040, R0 0LH00H0\ % % 0O-M@0[ ` Z p p(080H0`P; P  `00  ἀ0 [0   0 pZ0 0   0 0 0 @ 0@Ѝ 1 !00@- 0 @S0 0S0:PA_oRQ@ \T  0S0Q@000@T0\SET00 0S00S00褿A-`P0PUM@p"S& ~aP !P  ᴀ~00V0  ps  00 0ЍPЍ_ p]  O-P@ 04M 0#P  b`Y`5   p.a0P  01 b`| @P  @a0P a4Ѝ  0 a a,0Y (0 0$0,0% T@ ,`, AR   0S00XPw Y  Tr  " aLp W@H @ D L G ,` $fX7  0 @P- pW;  BHDDnXDH sX  "0 S   ,@ 00 ^a4Ѝ  B $ Na$@_<_@R p A-P`0`VM@p(S, P`P$ A`  㶀P0 00PG00 0? 0 0 0ЍPЍ^0@-P pW M@`R `P 0 `0  00P 00 0 ЍP Ѝ^O-LM<0 <H*0 0,, 0@P| ||P0`0PP p00YPXV |P?x9PWPm_PP @ @P W 0V 0,P $ 0p100#$0$90400 0IyX 0s 0PQ ,P 0S $ .S  ROS9 = WP# R@PV nhFhv 0n P Dd_D00S P P$ 0   0S v 0! 000 000 0 n0=0TS 0  0 00 0S(00W8 ( ._8 0S)`<PLЍ @0@S' Hx00 000 000 f0Pr[J (p`@V 0 Vp 0P: '\VQ,W%U^VP< P@U P0%0HS y  0lP (p70 FQ4E F/R) ` pV@ V,h%`  @ ` @ ,%,  / P P``P` p(]8 ]@T@@B`  4X Y~0 0MPDP0 80k80P p` P P P P P P P 0 80E80P P?U P#v 0 S00Pp`@ 0AP, 0  80W80V0@A T@@p`I 0 00000000 s0P (p`@ Hx` hFhv8 @0n JPK 0S00 EPA}qPRVp uP8p0 0(p)՜P00P hFhv0 0@s 0 P 0 Pl 0   0 a c^LЍ 0~  xO0| 0 mDd< g> p%2 & `    ,     P/b$P00//0@-MP0 @0^S!1l!1"b2cNL 00$@B!A@C0DPЍ0gݵNp P0`0K?//p@-MP0 @0nPcl b N00PEK 20$AB@C1d PЍp>kL$0P00?//p@-M`r0 @@?MD@DP0ec`E $`L0b!b4!b ER1c1cL 0P0@$D$C!d!bA@C1PЍp-?L*S4p@-0MP0`2@P 0Ѝp], 0 0S Q20Ѝp1!0G-@q0PP03 0 4`S 0`02,0PP00|Q``  VPe`EȄQ  V|0`0ȇ`H00fe@-@P \\\ \$\,\\,00!R  !d 001/dd001P//Ld@X @--@X@X0@00s@ H !PJI HH @pp@- @-D(M4@ @`4P0R kU{F{{!00 (ЍpP P # 0U 0 k {Ukkf!00 P ~P P# 0U0  0"uP  0cP0O30{U 0kk cP  0cP0L20U 0:2Ũ2""NPh  0cP0x20U 0t 0"<P7  0cP0t4 0U " *P5  0cP0x10kU 0 !]1""OJP(  p0cP0ʘ 0U " P b0cP0d10U 0<1""P  P0cP0 10U 00""P  >0cP0<00U 0-0""P8  ,0cP0Eʘ00U 0 0"P  ??p $ l G | <   l 0cP0(00 0 <0<0U" P  0cP0xp00{U 0kk wP\  0cP0ʐ30{U 0kk- eP  0cP0qL30U 0b<3""SP@  0cP0O 30U 0@2""APG  0cP020U 02""/P  0cP0Hʈ20U 09l2""P-  z0cP0D20{U 0{  P  i0cP020u{U 0{ P<  X0cP0!10U 01""P  F0cP0ʀ10uU 0 P4  50cP0n@10U 0_1""PW  #0cP0)00U 00""P  0cP0ʸ00U 00""P  0cP0Et00U 0680""P   L  G   d | x   T  \   0cP0$00 0U0", iPt  0cP0h00 0U0" WPr  0cP0ʬ00{*Rk 0F{U{ BPk  0cP0\30U 0y3""0PS  0cP030U 083""P  {0cP020U 02"" P  i0cP0_ʐ20U 0P2""P-  W0cP0PP20 0U0" P  E0cP0 20 0U0" P  30cP010ekU 0{{x P}  !0cP0ʄ10U 0`1""PK  0cP0 810?U 0$ P`  0cP0b00U 0S0""P  0cP0fʴ 0U "4 {P  0cP0Np00 0U0" iP   X   G` 8    | DŽ @ L  0cP04L00U 0%\0""9P   0cP0ʌ00 0U0" 'P  !P  ~0000 U"2"00 o1010s 101 U""00 \P10X10`1 U""00 L101 U""00 ?10{Ukk!00 230303 U"!"00 "\30T30[L3 U"!00 (30u 3 U""00 20202 U"!00 20202 U"h!00 20Z20x20 L2 U"D!00 H206@20h2 U"!00 201 U"x"00 10101 U":h!00 10,10_X1 U"X"00 p101 U"wK!00 @10i810010Q( 10q0 U"2!00 o00{Ukk "!00 _00L0 U""00 R00 0  8  X  , l D $ {Ukk!00 #30z3 "ZI _I 3 "U"00 t30{Ukk!00 D30{Ukk!00 30\"00 "00 " " A ́ :PI S @ "00 "00 !00 !00 kk{!00 v"00 q"00 l!00 g"00 b"00 ]"00 X!00 kkQ!00 L"00 0Sg D!00 0S0 <!00 y0S 4!00 q0S ,!00 iP  c0S !00 [0S !00 S0S "00 K0S !00 C0S] "00 ;0S= !00 3-DT! @ L  $ 0S "00 0S !00 0S !00 0S !00 0S !00 0S !00 0S) !00 0S  !00 0S !00 0S !00 0S !00 0S !00 0S !00 0S~ x"00 0S p"00 0S h!00 0S `!00 0S X!00 0S P"00 0S H!00 2 H "pP !H H 3 "0SO.!00 k0S &!00 cx# ip# |"00 X"00 S"00 N "00 I"00 D"00 ?"00 :"00 5"00 0"00 +"00 &I mI |2""2l0 02L0 0 2,0 0@2 0 0\20 0820 020 010 01l0 0"1L0 0M1,0 0zz!00 P10 0mU,10 0d\10 0[;0 @@0 N>0l0 0E?8  Ǡ t x  P p x `  4 h 4 (x 0P0 040p0 0 2X00 0|00 0`0 @@U0 s0 @@H0 100 0u,1P0 0,P1 @@)0 o!00 10 0!10 010 0G2 @@(0 82 @@X0 l2t0 0~20 0u+@!A*?B0CS Ϡ-S)!R#  S Q0 {+C 7G 03S S 0A.B B03200P1046nT kȠȠ+S 0+C{6F{7 +S0+C/ /P 0S $0S 0S P? @4@P//A-0Pp8`P' , R( 0"0, 4000R40G@BT@! V @D8 ,0400G,0 4 00(  @(4/P8,0S0Q 400 @-P0 R 0 `  ) S. p T P $<@ :+˃4?0P R $ R  R S /0?00T?0$ R&4000  0`@>@0U 0PEd@T$0S`0  0@=`0U 0PEd@T$0S  &$   0   0c 0t $ @R`xP=`0Us 0PEd@Tf8?N?P?5?0 J?`zM? H?A?L? L l X :?;?0p0P00X0?0X00 p0tP 40040  @u 450050f8 0p0P0X 0㽯X0tp0 (0$$(0P1 80080E80080 0c"[SR: 3@ 0@l0(H9@0D(@ `d p T  \ \  h {P 900900S90:Cp@-@'PP80S $ (2/$0(3/00pPA-@`PP@p0 QR 408 B 4 08@V000PA-@`PpP 0R| S  P00S  : 70S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /X#X3 C- M0P000@P`^-@\3 R < 00 2#  00S "$< @0 P0cA Q # 2RN  S=P0Sd2 R @< 00 2#\p0@< l0^ppW} H Q0c& R#2Q3 S"Q0S Q*0 P  Q*0P  Q:0pSp R*0Q  R*0Q  R:0l00p0C0l0pSp)x 000 0P,04P0p0 p0 0 0 30 Ѝl0Sppl0 @@@ ˈDcS???\`P 0S $0S 0S P?,A4 BR/ Q /@o/A?A-pW`P 0!(`3/@P] 8X: (0 ( 03/PM 8 8!P S>0Rp*p  BS>00p0(0 #88@oRS B P T X B T p 0Bp8 yp uP S>0Rp*pS. 0A p oR$0(3/P 0S $0S 0S P ?,B4 BR/: +/P 0S $0S  R 0P0?0@@/O-M@ @㬰PX 0C00$P $`0p sRpW0- p p0 Ѝ0` Q`V00p=J\S30b608#8P0X 00C∀ R"P @X\!\ 0!01 002T 0# T 0SЍ0W0T0S Ѝ 0D?o240%R00S0020 0(0@0 ,000@(,04@ 0 B80 0 0$ 0PU?PU@PUAP0UAPR@oPP 0CX20;(8ӗ1Ӆ1&=tPxl0PfPEN N0NxtPAPWNl0:8HPXT!D`4PᵀH@ᰀ00SxAPPh`l \0S8 B0<l0\000Sm tP `H0P` R P lp"p  G R lp` h0S:l R1#P0 6SF \0P8 Bl0\00PЍl08  :R&ƃP&ƃP&Ɠ) )hP\0P8 Bl0\0~00SЍhIO-tdt`,M Pt \l 80H00XT0#D04@@QH0  ,0BA?C0CP`PƙYp00B8#( ƙ#<0ƙ3@0 B0(1I>RX30;"8ӗ1Ӆ1&=  `tQL \ R㠆l@80XpT`tR` l H 07#0H0Xl \0P8 B Jl0\000S,Ѝ806&6!Ɖ909t6l L Qtl \e /t0 S` R S; SY`l r (l `m 00400D @$H0 A   @`@ Pl @!0 PPH0P  `  @P$ll R1#\ Q \P80 B0 l0\0l0P,Ѝ\P80 B0 l0\0Y00S,ЍCO-@ ,0K[ 01PQM  o 蔟   PBS0U000u 0 0 0B 0 %B  0B 0 #40B V \0U8`1 |\0 0  PE B    \0UW %6*0Q1A4:\0l` p`F0 S P!P1UP!U:Spp   W  B0  0 PUp` , 8 RKAƋ3,l &\ PUp`l& RƋ5V`(0'

 0001&=  &6`Rt0l 0C `t0l u\0S8 B0 l0\0O00S8#  #800#"0 2B0 0 0 0 0 S0 S 00R01 00 q00 R000 0 0&*W6: &R \ R80l0 C 0 B 0=L0DC0C t0S*l0\06y\0l S8  B0 l0\000S10f\ R80l0 C  A-`pPTqP@B Q00V0SI0S: (0sT Q 1@0@!A00000 |0`cp( 0S*t l00\ R$6S S L D0 B C~060@D0 0!1 0Rpp  p@-@3PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0$ (2/qV0P0pPO- Mp`80S04< 08Q1S00PP 0 0S{ $0Ss wpVjV`F0HSs0FSRo WmZkYFo᫲[dV @!( `4/@Pi !@  X  P "L  BT *   A0`, `4 ( P6/ `, 8(6/ `L @(6/j 0 D(3/68 R! ( @ R% D PR! 00C60p删$0 ЍO|v `fp00$0` (0} Ѝ8  40 000& -M 0 0 AЍA-PCU_8 `p! 0(3/@PR T!@ 0, (P3/ 0, z8(3/ 0L @(3/ 0 D(3/08P. @ R+ D SR% , 8 ~, @@ yL DD t&!o0 0C006& 0&;> 0$0;/FO-@QM R0p  0S " !,"pDP` p@00 + p % *0 @p'0 @$000Q  B1;`,:)7(463041 R P%BQ` p@!0A " Q"$, !!   R!,  " " Q"$,     R ! P%%   R,!@S4T@ RPR aR,d&P%PN&, QR,T% R%, QR,T% R%, QR,T% ^%,  C @0S |0 " !S," ЍL ""pR1C2PvFJLE EDDDdDC A-PR` @pPp 011   0" C  .P p@1   0" C !&B A-PR` @pPp 011   0" C  .P p@1   0" C !& B p@-@P |`|`P@P 01ē1   0" C  @pPp@@0 #400k.06S0 k΁ς 1O- p:PTU$0!`Q U @0ς!\KU` ẠZ 1 @1:  V:0Q=0^  pQ Q Z @O-@ 00 0p0 1Z \Q ⵟ 0100W0 X.0[ A  װ& 0А#"^& 6 2#60 SZ+ ೞ0JYJ Q LG⋰@ 0p@Q0C Y> 0@N0A0 \0000C0/ LQ @00^ P0 00U00S@ T R 000 R0@ T<ЍW@  xyQ / !02@X1Z Gೠ6;#6pQ^p N00=C-@TppR!ಐN0+m^\hT( Y!. Q A^0 pR% \LANpR 9 ^0@ Tp9  \ʰ Q ^0 Rp^0@ Q ^0 pQ^0 p^0@ Tp@@  @O-MⲰ[00Rv!+z   k@T`[0 Y ANP@>d8Y#8WD@ 000 #4060cUS8#8 P >b8Y#8 000#406 B 0cUS8#8@DHR$H&"0("(P P  0#4PP0&0bTC8 B#8V0&7 V0Q PV  ANk`P弦P0ᾐ:`i8Z#8`I 0 00#4 0编0iUS8 #8 R0἖P`U0S P U`0^ `0 V \0ʀP` TH P尐P eY*P0帠PE0#406P0cY ) UV BU@X%Xk>PP@P.V@nR$ N D0Qi PU ` k Pᶐ>i8Z#8I0 00#4 060cUS8#8 ^S B@P.k>@P.V@nR$ N 0Q$ PV(0S `0 _28 #8 P `0^0  U4 `P 0SЍ@@DH$Hk>PV㸐V @DH$H>k.V0v `0 %0S `0 0S `0 ^ U P   @ Mʀ6O-SM 4004`003k^0 0300300 !A 9@b8 T#8@p000@p#406 B 0c^&6S6 @ 编0`$0 pḀ9n8 Z#8 0N 00#4 060cX8#8qX tq@DH$H>phW8#8挥pH000p#4060cTC8#8 BR@@@CqԕrԅAqಀph>Y8#8H000#4060cWs8#8 p0@sWz `D B("(>@g8T#8?@000@#406pGp0cR#6 Sv\kN&02Pa8R#8  P`0`00 @#4PP0&A0b^8 #8k0&Ѝ 0&0p0v, >>>>>0 0@-&̀+ ; J(0,+8; k> G$ˀ0 0&)0S0 0xS0 0LSI00&&&&DʀA-Pk@8` R   pp "$ &bS1 B k>&0  8#̠   4##<V0 0 000*60@-S S00k@@6 0C60k>@@@!PPƂ00@-k6 # S("(00@P P 0 #4@@06 c\  ( 0C"(k΁ S 600@PP  0@@@#406 0CS6 S00k.@@6 0C60 k>@@ @"$PP Ɓ0O-0 QR M@Y, R 0)p&]#P+}(+z0N  q/ ! RF@P j   Q& R \3 "[$k 0("( Z:38#80 00#40缦0jR#8 J#8+ ZB!(:ἦ 8#8kΆ000#4 0缦0jQ8 J#8 ! Z:ἦ8#8kΆ000#4 0缦0jQ38 J#8@! Z:ἦ8#8kΆ000#4 0缦0jQ J!PMk>⼦ / ! Z! ! 缦jR! J!^ἦ 2 / Mx  \ P+R +R ,RE R  Q ,Q3 "[R&k R0i 2 8#8000 #40&0bP8 B#8pk0&N.V G.0 0R0 0xS0  0LSI>X&&&& Ѝ R3 "&][Pj 0 ЍOi 8#8#8#8!88#8!28 #8631:Ɠ0@-PV Ɠ!DPV @Ɠ@QF !6@o0ƓAƃDQ  !I.Ì!ܕ"܅&  /0S A-P 0@ Cp`R%/yara0S A- `@0 CpPMU %,0PP0%/tcid0@- M@ (Mp  P Ѝ0 Ѝ00 0 Ѝ00@- M@ Mp D  P Ѝ0 Ѝ00 0 Ѝ0yara0@- M@ Lp D  P Ѝ0 Ѝ00 0 Ѝ0tcid- M Ѝ- M Ѝtcidp@-@P}%0PPptcidp@-@Pq%$0P p00ploobp@-P`P@PP  P$p@-@j@ @-@d@ @-@^@ @-@X@# @-@R@@ @-@L@O @-@F@l @-@@@ @-@:@ @-@4@ @-@.@ @-@(@ @-@"@ @-@@@-@@(@-@@;@-@ @S@-@@j@-@@@-@@p@-P` @PP  GP$pp@-P` @PP  5P$pp@-P`~ @PP  #P#pp@-P`l @PP  P#pp@-P`0PX @PP  P#pp@-P`F @PP  P#pp@-P`4 @PP  P#pp@-P`" @PP  P#pp@-P` @PP  P#pp@-P`0P @PP  Pp#pp@-P` @PP  P^#pp@-P` @PP  }PL#pp@-P` @PP  kP:#pp@-P` @PP  YP(#pp@-P`0P @PP  EP#pp@-P` @PP  3P#pp@-P` @PP  !P"pp@-P` @PP  P"pp@-P`p @PP  P"pp@-P`0P\ @PP  P"pp@-P@g#(0P pD0P 0pgntsp@-P`@PP  P"pp@-P`@PP  P"pp@-`PM@2#<P pP U patadp@-P`O@PP  PZ"pp@-P`^@PP  yPH"pA-P@"X0P p'`P  P `)gntsp@-P@"(0P p0P 0pgntsp@-P`A@PP  8P"pp@-P`5@PP  'P!pp@-@RP P!pp@-@ P"$0P p00ploobp@-P`z@PP   P!pp@-Pj@PP !P!p@-@ @ @-@ @ @-@~ @! @-@x @> @-@r @[ @-@l @j @-@f @ @-@` @ @-@Z @ @-@T @ @-@N @ @-@H @ @-@B @ @-@< @+ @-@6 @C @-@0 @V @-@* @n @-@$ @ @-@ @ @-@ @ p@-P`@PP  2 P1!p0p@-P@PP l P !pp@-P`@PP   P!p0p@-P@PP I P pp@-P`w@PP  P p0p@-Pe@PP & P pp@-P`T@PP  P p0p@-PB@PP  P pp@-P`0P/@PP  P pp@-P0P@PP P pp@-P` @PP  P p0p@-P@PP Pn pp@-P`@PP  ]P\ p0p@-P@PP PK pp@-P`@PP  :P9 p0p@-P@PP tP( pp@-P`@PP  P p0p@-P@PP QP pp@-P`0P}@PP  Ppp@-P0Pj@PP +Ppp@-P`q@PP  Pp p@-P_@PP Ppp@-P`N@PP  Pp p@-P<@PP Ppp@-P`+@PP  Pp p@-P@PP Pvpp@-P`@PP  ePdp p@-P@PP PSpp@-P`0P@PP  @P?pp@-P0P@PP yP-pp@-P`@PP  Pp p@-P@PP VP pp@-P`@PP  Pp p@-P@PP 3Ppp@-P`y@PP  Pp p@-Pg@PP Ppp@-P`V@PP  Pp p@-PD@PP Ppp@-P`0P1@PP  Ppp@-P0P@PP P{pp@-PJ@*(0P p0P 0pgntsp@-P`@PP  YPXpp@-P@PP PIpp@-P`w@PP  9P8pp@-Pg@PP uP)pp@-`P@<P pgP U Upatadp@-P`@PP  Ppp@-P`@PP  Ppp@-P @PP (Ppp@-P @PP PpA-P@zX0P Lp'#`P  cP `n%gntsp@-P|@\(0P p90P 0pgntsp@-P`@PP  Ppp@-P@PP P{pp@-P`@PP  kPjpp@-P@PP P[pp@-@QP PQpp@-@RP HPGpp@-@0 P $$p@PP"#0S #p#0괅@- @@"` P 0R @-P Q o//w w P 0 0 t@-韼(2 H2 @-P Q @@ @0@ 0 f㊼( (0( 0 gぼT$2 1 0(2 1 0S p@- X@`@@PxPpP p@ ꜴPA-P`pl# "@P  P` pp|"˯P` us"U @>$j"5$2$hp@-P @`%PphP p@b@- !@P $ =0 0 0 A-pP !@P"  *0 0 0 ŷP!`P  ` P0 000 ,0< ֻ@ꤲ/ / /@-@P @ g 0 0X ⻻4/ . }-A-M `V $P0 PC@P]!pP  0PC =ЍAЍ/ЍAЍ/ 0 0t ∻L|. - U& @-@P T@  0 0X m- |- }p@-@P x0 0 0R0 P!0P Q ;$ p@pp\4r p@-@P `0 0 0R P 0P Q $ p@pȯq P/0 0 0R /PP/<0 0 0R0/P///$@q 0P p@-  o QP  QQ #/Юp P/ 0 0 0R/H@-@P \0 0 0R   0P Q #00p P/00 0 0RP///ᜭo A-PPM 00 0/o"P R Ѝ R0 p 0 p@ `P 0 S  R H  B pP` ~"  00L|E n n A-@PM 0 0 0R ЍQP 0 + 0p `P 0S d  PuB pP` G"000( (0( $0 .PD m () ( ; P H0-0 0/o"^ R  R/XP/D0 0 0R /@-P Yom P/D0 0 0R /@-P Bo꠪l P p00 0/o"\ R RP Q $ Q /D8l ,l fP 40 0 0RP /ᴩk f(0A-SM`.P@U Ѝ0 PP JpP 00 0P* S'P0S0"Q00 +@P X 0 0 0 @Ѝ( P e!ꌨ( P 00#0 0 P 0S S R/P/ R0/  @-I @ghh\vav0p@-S(M- {@ S  P{ EA` `P KP U(ЍpX  (ЍpD P { &A(0( (0 $ Lp$ $ @$ x$ $@-@ u@-$@@uH 00 S 0 P :\03#/S 0 P \0///A-Pa`˫@P (ApP  Ძ@P  W@, ,0, (0 _Zt$T" X" M 00 S 0 P :\03#/S 0 P \0///0@-M @P  @ Ѝ00@-M @P  @ xЍ00@-M @P  @ jЍ00@-M @P  @ \Ѝ0@-@P ,0 0 0R/ /P/0 0 0R / 00 !S R!* R0*/ - ^0 : 0P0*  R*/@@/ / 䤢P $0 0 0R //ἡP $0 0 0R //ᄡP $0 0 0R //LP $0 0 0R //P/h0 0 0R / 00 !R0* /  P 5*/ܠP/h0 0 0R / 00 ! R0* /  P 1*/`P/x0 0 0R / 00 !R0* / - ^ :P/x0 0 0R / 00 !R0* / - ^ :XP/@0 0 0R / 0 0 S /̞P/x0 0 0R / 00 !R0* / - ^ :xP/h0 0 0R / 00 !R0* /  P 5*/P/h0 0 0R / 00 ! R0* /  P 1*/pP/x0 0 0R / 00 !R0* / - ^ :P/@0 0 0R / 0 0 S /hP/`0 0 0R / 00 ! R0* /  \ 5*/P/`0 0 0R / 00 !R0* / \ 1*/᠛P/d0 0 0R / 00 !S/ / P %:/,P/d0 0 0R / 00 !S/ / P %:/ᴚP/P0 0 0R / 00 R/! /<P/d0 0 0R / 00 !S/ / P %:/ؙP/`0 0 0R / 00 ! R0* /  \ 5*/`P/`0 0 0R / 00 !R0* / \ 1*/P/d0 0 0R / 00 !S/ / P %:/xP/P0 0 0R / 00 R/! / P H0-0 0/o"^ R  R/᜗P/L \ /  JQ\/@P/L \ /  JQ\/P/P \ / Q/S/Q\/ဖP/P \ / Q/S/Q\/C-M0PP0p00 00 pS Ѝ(@Y` +0B' 0R0xSG  `0Ps%*0 00 0S  P Ѝ蝶 ?0Ps:0"Sꌶ0"S  qp 0 00 P v q0"S O-MM(@PH100 p0$`0(0 00[ Q`$ 0 `;/0 `P Mߍ P0 3/P 00 $ 0 :/P 000 PMߍ 0p@-PP0:A@L7LT#H0a`L8 0L0WL8V @#88#8P0p ^pO-KM3 `0 0R@ @@@$@@@(@0 0C0S5 0fSQ ="SE [Sl2 0 @3/P 0p0 0 ̠<P p0S !S$0-S-P00S00PP -P 0-P P 0>P 000/SR `,`0 S S0p p S :S 0 S S0GU0 RzP0/S7 0(00>S: SA 0S p03  0B0SR 0 S S6 S4 /S 0 S S,/S >S S`FVx0Su `Vp0(00>Spj 0  $ 00 0  S =SB0"SP0SM   0"R "R R@C$ >R;0 p G-MX@`pI P dV W$ P[ <PT &P@ aR lR gR' qR uR oR  tR ;R@" tRT Ѝ mR8 pR oR sR ;R@' tR ;R@>P P"Pp \P@ V   WP UP PS00S@Ѝ pR ;R@  uR[RD\ BR  ;R@<{  @!1 0 P"R /R  0hP 0 +("( R:Y ~ Y +     SP40 Re \Rb  uR^ 9 PX +  PS6I0     0 # <  P,!*-"-  ƠP  *  (  ""0 . ".  ~ d   ŸO-` M @ 0D0S<_SS @S  0>S 0 T  @P (0SP  R @] ЍT T$ @SPV` iP @P ` ^Px0S  0S   \ ;  DG-P-MȒ`@PL ,6pC N8pF 0F fppSp>D0 ȗPP 6u&  0  p `8Ѝ00d0 ࢗp``7`Ѝ 6`Ao/A-PP yP`p @W@P@@O@P p480,p0P4080<0蔁pP  @-@ 5DP@-$@@ ♢$PḬ⴬@-@@O-4@T ,p` ᡬP @D¤@@`T P礀Qㅑ@0@ @@0 3PZ PZ P  @-R 0P< P 4Q ,  D D0D 0 ), ,0, (0 d \(@ p@-M@4 00R1SP,0SFR 1`V. P` 0 0FP 40, 0C40P& `ЍpS( R{ЍpЍp 0 0D Z㯮p p0p l0D ⦮\ \0\ 0D c㝮D D0D @0D ┮  y  0liA-P`,pS@P W 0 !᭯,@0`~,@0`C-`0SM@PpF  Pd00Ѝ! 0mP ,0SU ! 0bP ,0S(0S00 0@P 0S>0S0"S40:S +0}S "S000"S 2P  ,P d @@ 0eP , ,0, (0\ (9 8  0p@-S \  Q @PPp 0  0 z\ T 0S 40 00$ $0$ 0 @-骭(z 4 4 @-R , B04 P @ @ @0@ <0 ⏭, ,0, (0 ↭ Xt |480O-M@ Ѝ@Pp* `P @ p @ЍĒ o ∠`P0 004QY  4 ,R\ 牱Q1v  萪 P 0YIV  B B!,0 ` 04 p<0 04 <0 W`,VM<V7V+Y& 唡@ ? ` ; 4`P( 5 30,S<SS= dP2 @<0 0`p4 <0y<! ⱔ,0` \Y` |,x x0x t0F/⼬d d0d 0,W㳬L L0L 0 㪬 -G|wFL  2(  `p@-@PPP0S L  Q<0  0p@A 0  0K/}uP Dp@-@P 0`0VAPP p p0 0  0@S<0  0pPp( (0( $0K/Nu(, T0O-S M@PR z`40SM x `;P@ ЍP pP 00S 0q 200PX 0S. @0R* P# [` P 0P 0S P'j X H` ЍOpP 0  03/P  40R 1#PP 0 0U/⺫4 00C 0P `@zh h0h d0U/⡫T T0T 0]/㘫$tsd) rD |r  |d@-@ᥟ0,S<SS 0  0 lx@ hPG-V pP0`WSW@6 404 S @  S3 F000,0 100,0$ 100,0, P   @ ?o2\0S0S P@P :  404 SS@  @D D0D @0c/0 000 ,0c/pd @$!@ D7G-PS @- Y`' T 1p 0R  ' % 004 00R% NP  0S 0 GTd d0d `0i/⴪0,S0 000 ,0F/⣪n, H1 L G-PP' 0 0R"pG4`P 4 R @,0儡ᄑ1  ,04 儑@ 0T:80804 )`m0P 0  Q@-P80080/lp@-P@ 80080p@p@-@P 80 0R@ pP4@pdlp@-@P \0 0R@ p`P00S@#:p@lp@-P@@pA-PP 0 0R4p`40S @40@S ,0 P8 `pkA-@P 0`0VpP0S |P @T @ @0@ 0]/ĩ@@yjl ,0A-`P 0P0/o"Q@@T @0R p^ I@P @T S@ 0  0]/㊩j DH0P \@- ^ 400\@/ 0  0F/kTi l 0P @-ox@ T\ @\400\@/ 0  0F/Bhd $ @-PP M @1 0R Ѝ`@80  Ѝ@ P 4 0R S!*,\&0 B!p@400C40<00<0P N h h0h d0s/T T0T P0s/@ @0@ <0s/(h@ u Pv @w0P/4  ?o2\0S/0@ S/f0P D- ?o2 ^0S 0 S+ /\fP/0 0@0R/fP/0 0@0R/e P H0-0@0/o"^ R  R /ek 0S /A-`@PpP (0Sp &0P  pA`d `>dO-0S@9 0@S7  `R P. X8qPp@? P 9 P 3 P HXPU0UU !B< #1 0@?,B PO 0 0 s X% X0@#r 1]P7 0 03/P0  40R 1#`P' `P 00C 0@P  @ꀐ  pG \ \0\ 0 ?8 808 0 3NMX\M l <40S 0C40/ 0  0 @-댭 0p@-S \  Q @PPp 0  0 lL Pip@-@P 0`0VP0S R<0  0p@D D0D @0 ѡ0 000 ,0 ȡKh hD DwG-S p)W@ `V 0P 0R 00 ^V` XV 0S  Gr@ @0@ <0F/∡0,SJD A-PP 0 0R(4pP 40S @,0a, 40a@T:8 8 40pI@-P80080p@-@P 80 0R@ pP0@p@D D0D @0S/}0 000 ,0S/tF ` <p@-@P H0 0R@ p`P@pEA-PP1 0R`@4P%80,0!qW% P P ,0P < 0@ 40< AlAD D0D 0W/, ,0, (0W/ dEx T 0P D- ?o2 ^0S 0 Sg/,D0S /p@-`P@cP (0S p p@ xC  \C0 //@-UP0 0 p㷟h O-IMP  @T p `0 R 2/0 U\ P X @ 8/@0 p;PV @T!1 0 ゟ003/X@ 8/Z UZ Z X" 000 R 2/0 U' P70S+ 03/P. Z :/ UX 0 0( @ 0 0 7Iߍ 0 0( , 0 0( #Z :/[ 0 03/X X0X 0( 뜤  p D  hԢ hP0/O-MM(p@ ]T 000 000R+`P$  T%0 `P4  0@ 4/@P`P@003/0 @ePMߍT00 0P $ 0R000 Mߍ0 000 ,0H ⒞ R00ܠ t # 0/0/@-@@A-pPM`P1 @T. K0@0W  WN 0/RA 0CW /RW  W0 0/Q B H!0C@T@!  @0 0.0 0 0 S* mnp@  $U _P %N&@XPۍS?00@ۍ S0$p g%Pe%D1%p %p 6P$@( p@-R 0@S PR :   Pp0P  , 0`0` `0 9֝L0L L0 :Ν808 80 ;Ɲp輿t ̿T 4 p@-@Q PPpQp0A-SMz@`PA7 Q <Q& >Q &Q a`Q PЍP QЍ|a&`Q ~PPa&`Q rPPU q/UpU"0E'S0rP\\P WP PU /U\U fPnPtPbPUx 0 l% QQ 3P0 000 0 #L|  $ 0S p@-P@ Pp 0@Sp/p@-@QP Q PpQ p@0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Q>p@ 0 0@ Ⱌ T4#0p@-S+@PPU Q PpQp<Pp/P PQ P Q>p@ 0 0` Qs dD0p@-SG@`PU Q Q aP<\Pp PU Q PP QPU Q CP QpPQ 6P Q/.P >p@( 0 0| 됗 cA-PP_ 0Q ppXpW`U@PQ  PJ <V`p p0 8/PP`<``Q P P 0S (P P PPP P P P 0 P꼖 3h3p@-P@PP  %Pӝ`ϝ`p |{011/A-\@`pP \1S 0 €  P 1.P1 `p P 0808 80 Ab$0$ $0 BZ뤶ؕ ж @-@^ P ^%QRS  T00ENQRS"  TŒ 00 0 0 Z G-@R0(M0QP P 0 ` p Pt p `JT0?o20S00(Ѝp`0 ꤵp@- M`P@00 0 00 0 0     SЍp0@- M0P@  000      S Ѝ0 0p@-Pb"!4Mb4# `@0ě 4 40Ἓ 4 40ᴛ 0     SЍp0@- M0P@᝛ l,0p.l ᒛ 4!40⋛0$!$       P Ѝ0p@-@P(MP`/ 0S, R00$P (Ѝp0-S 0 0 0 0 0  0 0 0 0 X P0V00(Ѝp@ R 0S V00@@- @T00@-@ p00T0&!0'!0(!S"!@-@T @-@T000 000S/@-ԛL<t000 000S/@-ě <t000 000S/@-㴛;t000 000S/@-㤛;t000 000S/@-㔛L;t000 000S/@-ㄛ ;t000 000S/@-t:t000 000S/@-d:t000 000S/@-TL:t000 000S/@-D :t @- @?^ʎ0 !00@S  \px ? ? lR ! 0^ < 0  0^ \#p001/001/t0 01 /X0S@-@1/00/T0T0p@-@ P`\ |PppКd8t/ 000 000S-/@-㾚-7t@-000 000S/@-㫚7tAo//p0@-@ MP 8 P  Ѝ0 0 0 ;௘vt(t (p@-@M P  P pЍ(0( (0 ;㒘wt@ p0@-P M@ T T T  0 Ѝ08 @  Ѝ0 0 0 :itt `p@-@ ,@ y  0 0 8S^t ( 0p@-@PP (P$Pp0 0 7>ش p@-@PP (Pp0 0 7+ꌴ تp@-@PP $Pp0 0 7@d @-@P  Y.<+ < 00 0 ;ȳ h@-@P ( 0 0 7(脳ć L@-@P $ 0 0 7ח$< ,R/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@ P//-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/8@-@Pቒ8000 0@0 !0#2 /UUUU3333  ԑp@-PQ@t : Sj H Sd a Sp  S?c r0-0!-w- R00E ?Rx  -  l r - w- Q  8 'Qx-$1r-@w- T% Tt0 T-x   p Ss  Sw S?lQ s! R0s  S  0TS S?bAa-$0$ $0 9DpP O-P4A@:  dpPA PA  ệpP% 00f` 0@T' 5P0=S AP` AT BX!  hBD0D D0 > 004- hh"h2C-@`M 0P@D H0LP@g X`P ㈐@@@@@峗pk pp 㬗p` n{ P  {j{{8p[ X0p 0S00R4@8@<@@00000;-0o-r-0\-H1H000@0 00+-X  #ꊗ0S op@ c _  ЍoЍ @f0 0 E ? ;+O-PMp 0GW"S00` 0w@P-TPh +T@`0? ǿ 0 C{ 0 ;{ P! @00D Pa0DSW0DA0DS"70DWu X: Q\ SP P"000T9 W0 0 p 0 U00S 0 |S 0F0 Ѝ0S U 0@ 0`000S   Ѝ p夀夐 p XR A B0A PR `@X0X X0 ?㒔SWp pqW ꙙz 00M 00Ѝ2<&/O-PMp 0GW"S00` 0w@$P-TPh +T@`0? ǿ 0 sz 0 kz P! @00D Pa0DSW0DA0DS"70DWu X: Q\ SP P"000T9 W0 0 p 0 U00S 0 |S 0F0 Ѝ0S U 0@ 0`000S   Ѝ p夀夐 p XR A B0A PR `@X0X X0 ?“SWp pqW ꙙdlw l00M 00Ѝ2"/O-M8@<ЍP@0P@0 Y( @@P PU 5P 0  0 2  ᨅ @Pt@P@h0h h0 P0 0/R xx؟xHPxQ $x,x- Mb ЍC-`|!|1 !M0M@PP0<80J 04p0040 41p†PP !1 0 <8 30;!ݍЍ ]00 0Pp嬑PP@T Cn`0 P8T商PᬆP @T@tq404 440 nN/t~,yO 4y!1 A-@P0!M`0<80c Q P00 4 1 VP?4p l1pJ P3T00 $ ( ,  0 0 pp@PP!@T Cn`0 P8T)P@P @T@0S  B p0 0 <8 30!ݍ`00PH H0H D0 .` }wXM w$wO-@$FM`4 M 0PQ␴t嘤0d40 T V [ ZX ( 0H0d ;0ZP0S 0H PW 0 P(00anP N$PyPt$BWk , Pk(9,7DnP $/W ,+ b X#P3 0 d4 30Fލ Ѝ, 0P3 PPt / 6P@ @W  E0Sw SU2"0 @ 8xx W\0X MP(( @"2  0 TB!1  0V9!1  0[0!1 0_&! 0 80$0Sd / ẂT! 0 P  8,1,!0 @ 8 z@  {- sXuuuu|u|uJ \uJ t|J tXJ tsy,J sszJ sTs{I s,s$tjjssI rH rH rH r@-PX!X1 0M`P@000:  T p T0U0P @A@P@ 0 0 0 30*ЍE/000U00000P 4"48#80L L0L 0( "$P  P,xF P [Pk6 00h h0h 0@ Y}L L0L 0@ X}~#8lQX`QTQ" XkdO" O|"( ,IP |IG-p!@1M 0砐 040 U$e]PF0Q W0Cp +@P1  iPUo0 ;u0 U@ @P  VU0PUo0}@}@  o 0 0 4 30܍}P}TP  0sQ}p xP|`!!- M0 Ѝ@-P 0 0dMpP`0\00    %X P0 0 \0 30 dЍ0 000 0 {l! FF/?O- M0@Q000 0S @ Tx|TX a! pP.b"? a. *b i!*DPP\@]!  "P dX$%T\dT%``.lČfH&bȌ̌$DLfD$Li.`  i,-a.d`ia` hh(&d@plhphd&%gX'%T\gT%$l͌hx(b!aA"8'tp @|ht'aA$i) `&@(l"<`t`i(aa.%jh*M`&dlQ l jd&Px "lQ%P d  'ix)  l!!'t| it' "(] n(|d!. i)dd!"*hH($Di*LhD$ + e.  '0,k+.-ak.eq! `&p*eq'4͌epiX)b!} %Tl\iT%, ( ,(o&@$O$,`ba,`H@@@ba& g,`hH($D !LhD$,++ ,+0 ,+...$吠bj*. j."$ " (,+, $ , 4P%++H (" m_%_%` ,P gQ PO$O$gQ%f P $@gA , $@..@].apf!O͌@f.e! OfA O@lea,`?ea&e1ꯠP* )!P@,`(o)_(0P(P **P!!! n,*pyM !`nQ 0 P%P =d  ]n,c1d#!.... 4 0 $ ͌e# dq .O,p/$/"p/"  O$O$4 O$leq, @O@p'?p(aA,}e1@$n_@a1. P0#0_% ,, _%_% M_% g.$P_aQ)0_% !/!,_%_%_%(PX=dAg$_P*㝉cQ$魊i P%䗟 ៉gw Pc.p )O$  O$'O$(' wO$],@jA.cq@$@ ?'?#$ 0/# 0''坉?'eQ0jq%?0 p'p?j1i%诊_o%o&Mo&} . dA$`_%i1$0#_%` 0ദ_%PogQ$iaP%Po&,((=o&(no&o&g.o `(]O ca.午gA`&eQcq%`Op'@@ pmc1 /'/"./", ... 0 ' 'M'h%uf! h!f10/  Pd1f1d! 0]?h1 $`d `10f0.,,4..-. $(`e`e d@Ϡ0,`!! ,,4=,be bχM` cbc ePd,pcd b/p"++0/"/"/"`d( `! c?  #`!o!`$`?#?#`͌?#n`0n1 -0dlAnA0lO=`A`bAlAbOnA4`O.O$$@..@.cA pbAca`OlAϠ`,(@))@ ,,aAcA paqpOmbAp`A aA`! O}cA, fA0P`Af10OaA_!-_% 0_%4,P(P!!!$PgAfA0gO`A @O   ,= bgb돉fcbca`ꏉ g`acaqpP菉b /c!0O$0O$㟠?')?# )*0?#*)' m) P?'0`1' Pϋa1` 0P捈fa0忋`!&a "= - 地 h&⿋` !c1h#  l( ⿋ ⿠o+,PL o&o&_ꯂ$`` +o `b1# LyZnܼb4 44 30 0#+⯊< +/ L 뿉⟉h⏠ 0()t )O/ 匐 (⟉ abb!! "= `!-!c1` `#P b1#0# 0a=bAb!!`! "! $Q @-c1(O`A`# b1# 0# 0a=bpb!!`!!$@ " -`c1`#b1# 0# 0 abb!!( "L@= `!-!菄c1``# ͌8<@plDPbb!# "0\"0`2  0 0 30Ѝ2"0 v0SY2"0 vP@-@P TT 0LLL   004 404 0 v#EgܺvT2< 3p3G-PPp`8 W, 10.!00% "0 ?0%0?S @@h  w 0hS@H"p ` *0V@@p`F  GvwH H0H 0 fv, ,0, 0 \v$ 2T2 |2,2!1 p@-PP0M@0 00A TJ  R00113 R0 0~? S ``4` 0~? S |U PE "001<3 R0 |0 0 0 30Ѝpd d0d `0( uTH H0H D0( u딭1,  10X 00 0 0@-@P0MP000' U  0 @  "" 0S0(0p d0 0 0 30Ѝ0)<PP000 00 FuЫ D.\ /G-p!M@1M 0砐 050(U,e&PG0R W0DA +@P2  PUo0 ;u0 UB @P  U0PUo0_w@ [w@  n 0 0 5 30 ܍ЍJwPFwTP  0lQPJp pP|` 먪- M0  Ѝ@-P 0 0lMpP`0d00 "   "X P0 0 d0 30 lЍ0 000 0 t묨\ <,,{$0 k $0{0k/ܺvT2#EgO-0|M@@ 8u @/LPp8`pPp, p'+phkg| `<뺅Th,`&P !`l[kP@a lK+P%@$P 8@g[h[DHhKh )k!.h \ 隠fl j (nHla$j ,L͠kˌkd . @艠eg g*Pp` a n,+aTddKdi{ꨠfpf p' pl +@Hhkxe{ `e`&lP `K 4XnKn`!+\llˋlj[mikPiP% Pa$+ Pg\h[h) `ɠ`ˌ` d. +d` a at霠jjfn,* (X hgghpꨠddKl{ p'epl@ g}n{+n<@@ffK`k*`&i`pllk+lˎ`@dIeKej['hP% Pt+[`[` Dani+iˌ hd g&+lʠhˌ;h+ )Tkjf+% f+"j P i#M(a, ,$ a+n Hꬠge+   g+e( d dpX+)l hlpfd+ !kK*@ f+kK$nDp@ +` ik n+`&T`dL< eKj{(p Me+j{'ph$lkly`k{h+$ kˌh+"P! P`[*j+d'P%P jd,\i[ L8&a it.ˠhˌ g" n`lhg* %f ꬠDd`)b , db iaLఉ @.eKhg a@$l*@gl!KfK`dp)n{fp8` p'bpj `ze{bkj(MѼ`$ik$e`& `h\l`+!P l[`+" L(j+a[(Pja[%lnk Pनt'd [@`[n,h" `h.X \̠ iˌipab% & ag b+ h ` d M,ќf$d ! d뼠hhXeK.0H @MeK$ь @$ggI\pbKb; l+s "Mx |b-$pf+f{D`n+ ndn*hlj`eek`P nTk(X\芠Pnn[<0!`;0#M08$l;l@p"a{Ìp'MȌp̌ `$y`{`` pdk&`nČiȌkǩkˌj) HP#b[nČP%iȌdP̌ dˌh tZmČƌ͌3a[aˌ\@@ncK$ j @ jf,LKm3bKbt n$g.lɠ(hˌ,  h+i!< m$&-3 cc+X0n4e(8f<  0f;`+" D0舠m46g`=`30g;dk&`<0)n48i+p<p0Ti;l{'ࠔjekp00 en;#@ 0xt`{PP `a[%p PcpmnܼvmzNSaP<@nKi[%Pze\mb[ &cK vg@b.cK$D @lJiK`% hhi ,`!f+  hd "฀ac e$ ce)H+g+gtp0.l;zt0#imx`0v|d! p`{d(lpc88P:i`4i 0 ``(-i0PP$P#P!i`pi 0``(iP P \P @ diilЍlЍ'N(0( (0 HYlPR R@B @- M PZtqt1p`@PP@@T 0Q P Ѝ$ wZP @ Ѝ@ kZP"0S- -S?@0 0000 `   V RP +R@@D!0DSX AZP0S +S!@?@!@ lt F$YX ?P L0P00 1 R/@P/!R/؃0@>S 00 00//l@-Mp @m``PW P0D>S 0!3100 0mЍ>SH 0!3100m00m00 /-p@-McmP@U@0 ` ` wPx0x 08 R;0Ѝp@Ѝ/0 a0P( ( Y<pMLM TLA-@PP`p= =U( X0ES! S0+0E0VP00V&2!0` 0`00+WP -W =W00V-00h00+0+0`00@@00000 00 ]k00,  p@-PP@F }l@T$d7(`0p00000@G@@  @ 0a0GS00]l00Zl@/Vl@`TЍ+W = W0 -S0000 0P X B R = GS/o"!!   ( P:0,`(l , l R(""@,`0 @(  ( 0S" (p W:,`lp ,k0S"@(ppG,`p(pW 0[ 0I00X00p(ppW ,WpPxS(P Y0,`kP ,k Rp"@(P0PE,`P(P   kP(=W +0GR?o20S# Y,`k P,fk0SF(P"2PE,` @P(PU 0[ 0I00X00P0(P 0 U:,`k P,Bk0S"(P"2PE,` @P(P0X0 00() KR;%I?#I0!0 KR<I Yk $0@K$00SPMk0"SF  U*(@ T:,`Ck @, eeH0P R@ O-P4M\p@Pu WiX0S- `00 S 5/000 00!S5+0 0 00!WaW0] Y[ X00Ud5S`500 0 0 0@P0` (0`0p5`0$0X,a 0S30`hW A, 0``VW ,@P(05#[0xQ` 2P X $ 0 8%*&  # #.ğ BPU 3 2#0!/#1##ʂ0# 00`V4Ѝ3+00 00!o3/0 00!hh30$0H\.Ld0a#0L0|2pST @ P, ` !k``P 0V ^ ,@Px ^}[`"$:600%$0D"%><!!!0C,"0TAP%"$A0O#QX00 0 0$00?S%4 P! (`1T101! T$?01>! R01"_0A`(0 x10X00`d(0@t0P`d(0 {+`  R1s AP5!Q4 0A` X0A0PE$0 `0P 0 f`4`4 0 @ 09Ud 0 @ 08Kd` GzG0Q)\(\x SQl X O-PP M@`o Tw V Hp0T:R P- Ÿ P2 1L PPq@pQ @T*RP P 1L P R 0Q_ SQ Ѝl P @ @0L0\? 0 \ @ p R@p\ p W R:\#Yp 0 0 cT0 0 cV0 0 cvp,@ \?[*!]-T ( x Pp@-@PP U p@IX X0X 0 kcU8 808 40 `cp@vIH  hEG-P@U T^ Pp ppq W00"1gP: ;Pc 0Sb 0 R 0C ` PP0 XA V  00S0 0 Q 0  ! 00S3*_oRe`VP( U ! c 0 0 bTt t0t p0 b\ \0\  0Gbd00P` p4 x (TA-P!1 M0M@P`040$ QE U9  00S0 0@ $03/H!@1 0 4 30GۍЍQq1p$p0 bV U$ 0 0 G~b 0 0$ tb 0 0$ jb0 0cbp p0p H0$ Yb9\_^з lC l ED D DO-MMMp&0|6 Pp0 TDe040f XC 0SL VU 㰰%dUe0U@@ R R 50B?o2 000RU$00S0E0 @y0S0000SfV X0+0N 0@ 03/[o 0@ 0000,00G(00 3/ P   0S00* y 0.S Z~00S Wx:0S 0S , P80: S $ wP (0JQ/030J1 1000 @P}000$0 000S  0P)80: S%V 00S 0  000S0 P@T  00S0gc4/P/ 0,0" $2 MލЍ  0.S0Sn 0.S}j0S  0@0N  2/0S0@  000.SQ ` P J0 @P@ @r  2/0H(100+$000  `P0!1 4 0`p0b R 0 [F0L!L1L 0, `0S(!(1( $, 0`V ! 1  , 0` 0 , 0`0|$ %QHb0/ 0 0@ 0 3/0q F F0j}0]]*xYL` / Tܰ   @ @O-P#`3 KM0MPؔܤp040; WD VM YV \] /\@ 0@ \/\0 U'"2 0 4 30KލЍRb/\;/00`/\U\- pp"p2p @ 0+`WP"P2P L@ 0 `V4"424 0@ 0`Y"2 @ 0 `@`p `7P 0   R  T 0T/S 0: S+ S 0 0 0 0 `X# +00S0 0@ (03/0S0: ST/03010301:d R0ꨰ`0 `H 0_0G0 _a/0 0ᲰD8VUH  `m 4nĭ ToD SDO-M$M %5 0P`P0003 UE @0~S<    pH 0S/S;RR 0B0 4ZS 0H*0 ;P4S 00C PR3 IR*00S;R) 0X @H p S   儤儴 *S1 0@00S ?S! [S!^H QM00 S@000XS 0H , R @ 0<@Ⲑ 0 0R  R QR Რ@  +PW@PU P#<3 0 0 30ۍ$Ѝ@\0 D SP 0]S2!^0m 0]S 0 00-S]Q 0]S  0@< 0T20u  0BW 0R S0BW 0R S@d 0 Q{  001A0 NY0 [0!^0  @E  p 4xN0Pp H *; P =0$10QqAp@P0 2^U 0X +^ 0 0P !^ 0 0X ^0 0^d0X  ^@1@/8R?**O[-]!p P d @lO-`QMM@p R W T  D ^I^ @P}\ @\ [\ {\PU PE0]\\ \8(/PPލЍ ]RRRF 0@Q`0,^* [^ ]RR6R` T: `{^0 }^S0CV  B00S08( N0 SV 0F0C  0j^0 0 @ ]RR ]RR x| |0| xd 0G]X WdX X0X d 0F:]X< <0< 8d 00]L긢  p\ p@-@PM`P( V1 0  0 S 30{S 0\ {\ 0 P Ѝp0}S0S Ѝp@rd d0d 0p \VD D0D 0p \^ 0 L , hA-MMp`@P00P00 0< 0000000 < 0 ; S \00  ލЍ⌀ @R0B \ 0 \\ 0\@9 ލЍ$ $0$ | 0\\@ xp@-`P Pp@0T1@D 0CPP E@T*A000p 0  0 X\ D0S$ - *S ?0C\S0P0S Q 0S 0 0/ᔞ 0 RT 0@-@"RC ^ 0QP BP'  R7 "R- 0 @\R "R  R&   0BS0 R 000 R "R @0 #  0 @ .R0\000/t p@-`$Q$P 1 QM0MR050 4 0 0 5 30-QލЍp  @, 0  p x @EO 0\PD8  0P0_XCC̜ x\5C-0$eP`M F500S tE @p#S!8_]0 p墲P$ 0S %P @ 0SE]0SЍt `p  0@S0 04 0  0Sx t倄倔p 0fS0fS 00#3R0 4$ 0000@SV 0oS 0oS0nS 00#3R0 # 000 XP 00#3R0 p# 000 WP 00#3R0 # 000 WP( 00#3R05 " 000 0#S 20@ R@@tLP00Ѝ0 S S\ WP 00#3R0 " 0@00q  WP  WP2 00#3R0) ! 0 00T 00#3R0 ! 000ElP X0@S0 @  RWP =QL  0P00 @WP=Q 0 0@0 աK  0P0 0`B<$|D $TX0$P Lh (p@-PP xWP f@PLPPP 400p( (0( 0 IY` (0@-,@@P00O-`(@8 0M0008pP00P UVYTy 4 OpJ09, BZW +U Ux 0 2c1100p0 0p 00S> A0$0 0  0p P2`[<000S[  ZUZ P'D7 0 0 30Ѝ `s?0l0` 㰈pp  PWpJ 0BQ #S P BQ #S Q BQ #S V BQ #S S BQ #S R BQ #S I BQ #S  H BQ #S G BQ #S7 L BQ #SO M BQ #SE N BQ #S; O BQ #S4 D BQ #S E BQ #S F BQ #R 0S:U 0p0S8 Rg BD{ᘿP 0`000  00  H$   (40000   $   30000S0 @  # 00   pW p[ pOZ00@IZ@W 0Z BZ000S :Z 002ZY 0 [ )Z00@#Z@00hp00,(@ (@(00,0vX }[  ㈽Pk0Sz[u+Xο1!0 _WKY00Y  Spph Jpz0`00[0`0 0SCT Tqp 5Y*0p0a0 Y0SY00T pr0S06  pH`00C0*  p<pSpPpMi[@ 7pFkp1pkC::x9P @h  pĺ-0 Mˠ0 Ѝp@-@|`M`Q P0ˠ 0P ЍpF9pP ͼP Ѝp,A-P`@ A@0S(A@Q0,pPpPR 3M@@姼 P p0 @BA QA  p0 p0 ,0, ,0 <Vpl< @p@-p`pP`P@T T0T0 R@@޼p*P00Ӽ X<A-`p@p@Pż0S x@@\R R"@\෼W@P00X@᥼L@- 0 0 p@-`MPF@P 0S!L 0V ! wU@Ѝp e0P  R 0QPG B&R 4( RS% S @  S& J S E S  A 0 A 6ޝt A 0d՝X A ;̶P؇ \,|\h0D 85O-BMM00$$5$u$$%0p 0 0 $ 000 0000+0 ጝP 40 4"CP P@\ P 0S p400#S \ P 0S 8d84`0`\ P 0S d4`0`\ P 0S 3 0   \ 0P 0S Np30\ 0P 0S Apd30\3PE0 +BDD3 0`0P\ @P 0S QPP[[ xRP200xS| "|2 0 4 30BލЍR@P\ ePx 0S \200#SL \ VP 0S $2$R0P\ HP_ 0S 100xS0xS0S) 10 0sS?0wS<0!S 71Q0P \  0P 0S od10\ 0P 0S o410(10P" 0 $0xS0S {00  00 0000QP+8 P  Lw\4X)p x D,` l\\d hp@-d@@0S P Hp@P@P 4P ;p p@-@P$ P0P 4P ԜPPyQP SPph`h`qPLp4 404 0 0TtX@Xlh p@-@P$ P0P 4P PP?QP Pph`h`7PLչp4 404 0 SpXp~ 0p@-0\PP 4P bp<`<` P@৹ṕ@-@@P( 004O-@PL$M p 0S Wp 9P` 0 0p 0V;  8000?Q WQN *Q0@0 8000*S' .Q S /S$" /REPP$Ѝ[S5 \S/ 0S@0?Sc S *S0@V0*SV0 ' *S0  0*S [P$Ѝ[QLpW /W| 0p!S^SV J  Ɵ  P 000@ 0]S2^ -Py 0]S00S /SD .SDB 0S} = 0U/S:w\Qv 0@r/P P]S /S \S$ S] -P8 0QV]P 0XJ q  0@PR ?=P@ P0V@0S 00T+ 0-S T~VP]P0 | P]P \P^ S0S00@00  $ P   R   U/R S /S pT 0-S T@00vQ@0QRS@00]SQ-P ]Go0⨂\ V@T S0TF 0X q R[WP 0X q  0@PVH2H"H0 {Q0S:(2("(0 |Q1Ql0 @w^a 0-S5 ^03 Q@OSp GpP@0V0  ! @T3 0 Pc/T @0 0 0 @@T S0T0_ /LC/0]S_ /Sc \S@#PPv \Xhv 0@0P@-@ P ^S 0 Q 8Q b ?o2c آp@-@lPdNP X^NP T00pT 00p+S 0 p蠢O-M! 0 "  pc P   10 230Zߍ ~PT 0 \p H  p P7 R @;` 0  0P ҷP& PP 0 DpP 0 )P0@T*p@ Q 0 'pP R - R  PO-M! 0 "  pc P   Z X10 230Zߍ PT 0 p H  P7 R @;` 0  0P JP& PP 0 pP 0 P0@T*p@ 6Q 0 pP %R - R  0O-M! 0 "  ipc P   ҷ з10 230Zߍ nPT 0 Fp H  ` P7 R @;` 0  0P ¶P& PP 0 .pP 0 P0@T*p@ P 0 pP Q - R  p pp@-`P@P@ \PPpPP pl p@-`P@P@ PPpPvP phl p@-`P@P@ :PPpP]P pl 0 00 4-H- M0 S0 00 0 0 0 00\100M\ 0    R8 00 0 0 30KH Ѝ/l-H- M0 S0 00 0 0 0 00\100M\ 0    R 8 00 0 0 30KH Ѝ/| -- M0 0*(--M  --M  A-PPp`p V" Q @Q TPD@t0 0000AQiL0L L0 N404 40 vN0܍h ė̗h 0P R   0//d<'<7 O-@P0KPpX00X0  : P & X00X0P E@ p0< (0 p0 00p 5 0,   p x5 04 lE @ ,PP"D50壵4  ep0% ,00 E@ 80U `ap `,p8404D0< B40 @@p 540 p *`4`0 p <4<0 p 40 pP 30 pT 30 p  3002#8"03002#8&03002#8*0p3002#8.0\3p003#820D3 0* 0 0" R   $p ID 0 p  D`   DR\ 0q[@  1-)%!p     (p    p  2r00p`I⺘2\p#80@"0  !@x@@p005T0A1@ 00墴!0 0 40 30,<Ѝ Yp10p!   PD$IPX00X0!1 0 hL:p T<pT@D،@ЕtX4$ l\lh@@lē|hT@(DXWEVT a $ p@-@P> 0S0 G0@0T9  T04 0R/Q T:\% 0 \/RT0C"0C/QT :0 BPU0P!Tp00p`@@PX M0<@@0/S (@@ @@X@0aa`pRA-M@PG(a`0P: !0C p0 00    0 b0C S&0pM0 00S`@ 0S 0SM0"S &4# Ѝ V1r0:M00$Pk^ O@-@P1 0S* IG@T. 0T)  /Q0C T !@# *0P@/S 0 B@T@!p0 0L  TD@8@0/S @^^O-0DM 000p 800S DЍp@-`P1p P@pp V U p^@p`UP p` VO|Q?o 0?oA-@c^?c^' ^./ "(0C0;:P@5$&pc`c&0gCh5(5D0c1c  10 /0 @- /(0  +C0 @ 7+C 0/0E0E0C00 {+C$0 G{6+C{7 Q/0E0E0C /0P!Qo oC-@@`T?`T* T? 1?1>(@04!50;:`P6&`p`3x@y66U`1p 010000 /0 @- /,0k{   +C 0/A0C0C00[k {{+C{7 Q/A0C0C J|@ @-yp A Jq@ @-np J;@ @-8p J0@ @--pPP `@-L00p@-@PP  (p@ 0 0 1JvV p@-P@` 8Ppp@-P@ 8Ppp@-P@`D 8Ppp@-MPP`V q@T |00JЍp 0 : _1p@`$ $ U 00 R |d,@-K00 0S@"<(0#/"br1 0!@0lR0cR0A1R 0< 0 B``C/  "bQ0"Q$I)\P ףA-P0E \lp`0LPSa0@E: T@@ X@TS^!:O-p(BP`D @v7P PXY  P A-p@  1M00`0S 00S \P#P3.000R`0@ p `0 0 2 30ߍPP @@ @R(@$O-`Pd 00YP(<Ѝ0 P( 00 0U` 00S SG 0 @P$ph08P pC @ D P6P  X R0 0 @P$p0 pC @C P6P X R0 (000@ 000@(Y(P(PzX0  GS( } +Sx -S0`000 PP䅐ಐ,P:U V P( 2c2c2 ,S \0c$00P 0(0v50 ,P(]U0X0,0h000C0 P6P4 {CP 6PP( 0(P 0  R7,0Y0!0 @ /Y- 0  0 0: 00P(/0 ,0c0,?0S,0111v>C 0C,0P(   /"b!!A0,0 Y0 00 000<: ,00:,,0 v>C 0CY0P( 00 050 ,P(0PY%S(P 0,, ,0 0C0P( 00 0Y` 0 0 SP(E 0 0 0Y 0  0 09 00ZP(Y{Y80 0IP(=0 P( Y 0P( X8,, ,0 0CY0P(m 00 0y0 P(_ 00 0k 0,},0!/A!b!b0C 0P( G 0 B0 SZ`(`R0Y0:<7 00P(A c0,S0S, P(: 0<0?2c11!, 0  0 0 000Y60 0P(Y;0 nP 00 S 00Y((P40  P()(P000c0 ,P( 00 000  R 0s @p 0 @00v0 PP `8 0@aa0K1c B  B00  000  /#b!!"A ğK/"bP 3:bQ # 3P b4l$  Q0 00 00 0 %0@0?3c112A #K?###cR 3:#cR # 3 00 0010!00C0 0 0@WP7 R0PR00G0PY @$p(P& 00 00PY @$p(P 00 0P,  /#b!!"A0 K/"bQ:2bS0#03  x 1 01 B00DRd , 0 40N0 S0(0!0`@YPO"  FP@ 0 40N Q@(P0Ps 0(P0 0(PP @ ACLC  \^JS S  0 0#3P0 z H(/o"PzX (PUSX ZSP @  0 0$0t0P0(0<0Q Q~l'||n$IzP)\(\ ףG G G E ȋQ10PE0,P` ( P& Pd!/"b!C;R, a2ba12TQ(tP ``@CP(fMP P(P @j @0C2c2c2P$00( (0  @_ 0 @Y~YP(  00 0ShYP(  00 00@>0S; 00@70S 0@0 Db0`,0 0 0P , P(01(000C.$0y,^2000c^\0M0c P  0P , aP(00(000C.$00 0R<# `  0P d#,   P b((0$ ;00M 00Ѝ 1A-0QPHP P M@O Q&T10 P1%@4@@\p . R ! vΌ @p `U! Ѝ0 P0  @@a L p `UET 0 ЍH DE00? ? *oLo@oXogfffdoo@-0M@ 0P 00Ѝ@-0M@0P v00Ѝ@-lP@jTp@-PH!H1 00Mp`@0,00= U2   P00Q Q Q N 0 0 ,0 30#0Ѝp ? :E 0 \0\ \0 ; CD0D D0 :Ct,t,t,`< 8m|U< mp@-@PP U 0DPp P @pD0D D0 7BU(0( (0 8Bl< ll; lG-pP`' X/ Y k>V @P0PES  R  D_*0PEV R  RS0@0D@ D0D D0 HBX(0( (0 IBk; kk: kR@- 0BAs @Q 0CR 0C@O-PP┡ M pU WC 3@PI 4PI  3p`M =4101S Y4 Ѝ030P@3P- 0 0P s30 0  0C0=   )Cl0l lD0 BD3D00808 80 C Bl44j9 j`8 i@-RQM @PЍTT C@ЍЍC 00O-`!p1- M⠁0 Mp@P050G x1PR ppJ @\CX0 ^00pt嵧0C O00 T>v6qύˠ@Ѝ,0  (@P #5 P 0 0 5 30ݍ Ѝd0d d0 D~AC00@{C00U8dO6 g$$0 M000 Ѝ{--M  nЍ Ѝ/ -- M0 0 ЍЍ/O-@P␒M p` X X00?6400P @ P 00 00P ! !  E1XPG *5VP WU V[XPVppPpW` C 0`f0` ဦpP `PFPPP1 0 0@W`!00!1 006 Ѝ尨0XPC0 P P006 Ѝ0 @`?pPP V 8pP `P@0@ @0 ?@bL\h4 eeP@3 d@-@ MP6(0S2 30 `(0` 1/qp0Pp)  0 0 PUR <0PU66 ЍPPTp 0S  0CP!6XB00Pp6@-P M6(0S: 30 "p(0p 1/qp0@`/  0 0 @ToR <0@To51`V ЍP@T` 0S  0C@oBT005B005p@-PPE 4A0S5 @Tp1 Rp0P00 ħ P 0S P0座 0c0(嵧 0P0 尧0 S,P 4P 8P p@蜧T0T T0 M?0Sp000 00 K?eE\a/ ,a`x/ ap@-P$@@ᩥTp@袥\v@- @@ᛥT@蕥$vhp@-,PPᎥ U@ᇥpu4@-@PQMPE 1 `0 Pp00S   0 XR0@ @ S8 <$ \80CS0D0 S0^U*:Ѝ\   "^  U #R.S*@ 0A a 0C0 0 F#? "U #RPEUU E0 0Q@$_`- $_4  R  *4 8/ȱ 0X\S 040:8 R РS /TvqxB@-Pp`@L@L0@@D尀 U   (T@-P`@@0 "A-pP|`@P( T0  0 SSS0 S00 S 0050000005%0 v>T5%0 l>|%0 0  00L50000  8 70L0 20-V00 ^V00;\ 40000 00B0!0000LS0 100C0 0?V`00 0 00000 \ \ 00y $40000  70L0 0 h", 3010P;\ cP3`b0001dP0j R SXc\Qx3 0100 M \; =\H \7 00C00L S h0100C09"00 0 0  Y 00L0f" 0W0C0_2 F0nR! \0F?o2%500%0F?o2300&0F?o24 00=`Foob%d 00!0 0   00L0! 0W0C0 0 #\ 0 0 00Pk00L 0 0000 0 0 0 0 0 0\ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0dP@cP'dP<00L000L00<00uP00p0+ p\+ \\+ t\) ) T) P' O-MR@p 8 0SA XPJ TP 0 0`0 @F0PCT@D 00X `R)R) V 0@F 0#>00ЍU 00 0 0/}<0Sl l0l h/0< R @T  0E0Ѝ>00z% $ UU$ UXU0  00  H[A-@ R`P0Sn !"#b! DQqU> 0S$ RT 10 R RO 2/!1 00U00' 1/0P p $@(0081003/0P !p0 $@60V0 00 R (㮡000P3/0P! U  R  SV  0SX㦢P000U P/>3|iħXih,Zh\h=A-@R`P 0Sm !#b!b DQqU> 0S$ RT 10 R RO 2/!1 0 0U00' 1/0P p $@\(00810 03/0P !p0 $@0V0 00 R (00 0P3/0P! U   R  SV  0SP00 0U 4g|gfW̤HffA-@P| P6`Px rpPh  00^c<!"#b!0CaqV8 X p]8PXU $001p00S '\1003/P00> 000$0(100S100S 3/! 000``0S 000S 3/000(zP` p  0000SxㄡP0000H0003/P 0갣/>3d8dlc=LcA-@P{ Pe6`Pw rp Pg  00^c<!#b!b0CaqV8 X p7PXU $001p00S 2'\1003/P00> 000$0(100S100S 3/! 000``0S 000S 3/000(P` p  000$0SP0 $000D0003/P 0HbPa a`SR: G-P000pS` 3/0Y @IOP T0 0 0 0 Y @IOP ١ TT0 0 H H0 0p`P   /`̞L_8SR; G-P000pS` 3/00 Y @IP T0 0 0 0  Y @IP TT0 0 H H0 0p` P $  /h_xh,^O-PPM M Q \ /\E $P.5P:p/\ p P/ `K`\o @ /RR.\)  B R/0 D 0i: I c pd 0: S$  S/ L/o" R/\ @  DQ7 .PQ X0  [K/R 0W0[0娐 !uḿP-U  4   RW  :0/\0#p0@ /R0 X0/ ލ Ѝ@  ͠ލ Ѝ.00: X 0/ ?     bPE:00:>00:00:00:?00:00A-@P Q MP`\P᤟p@P >P`V :0"S t:00@p@- PHaM`=  144QP00  P; 0^0% 0@0 :^0@S \S 0@ S @ 0:S:^ ^000ЍpL0P "<0 0  C: 0 @tp@-@P`P3 V( 0Pp:P @R0R P:U P0@Sp P P@Rp:UR:Rp@0@ @0 7(0( (0 7xID PI,;  ,I00/Wp@-@PP" U+ 0PER R:Q|Q00Q0S"P0@|R  :RRpT T0T P0 7U8 808 0 7p8 8:8H  6 HO-M M ( 0P8$ p00D40u 0S~ 0S 0S t4!S S\h`P PP5  pP 00S RDP 0P#/DP ` P@U"0 S* Z :S `\S S S 0T:H>@DP U@p +̽P`0P SZj[@00#QQ 8P6P00@S0 6000040 p(0,P= P 0:R~ pR0t4@00 0(<Q G<4`PC pP> :00`00 [00S  e@`P  پ 0 P- PgPu0S៞00`Y@D*0 S :S `b[ ` @f `b 0:R& PR0 0E`F00S:S:00` F0H[0 D0=  9 f0 @Cy `# pP H @DIpGrP @ p ,P pU  D0AX0$0p#3 0 D4 30ݍ ЍP@ IPp#J8 00%@ ɛpP X3@00@S0,P`UA `PU0;S= &8@"8@00"2 0 60S"2 0 B60Sw"2 0 50Snp"p2p l 05d 圼 嘼0@Ὕ0S> 0401 D>> \,=@-4@@ P n0 000؊O-`(($M  M0pP ( 0 V 3C0 @R` 0S S P@T 0S  @P 0 0 C R |3000#30:Q0#Q0S(  0R\Sz 83@0 T  P 1P  0 0P0 нP 2 0   >0S00S\S00 RAP 0S7\S5 00S1 :S000 0 S4So A 00S :S|S@0@ A@0S'!1 0 8 30Y ލ Ѝ  @P 0 0 C`1 0 Y P @P @@$QP P @ 1 0   0LP 5 0 04 4 0 04 40 0qP\ \ @Y@$D<x1P0/ 99t 9t9p@-PP@ T `` P 00 0x0 0p@   T T0T P0@ 3T8 808 0@ 3D D*D8 \88A-`P@P T Ux = c@P dP 0:SS   Pr`pd \S@+  R0 0:SS ^S0S:S 0 R0@AdgPi 0:SS`d A0R@A0,`0S:S 0C^BC@2P 0@0@^1 0@P0 0 0 00:00'`P( 0 0 0L 3| 0 0L 3Tox x0x t0L 3e@ @ؚ@4 008  $5 '5p 5p5A-`P@PH TQ U: = `Pe db@Pg 0:SSpppdP0:SS   \0@@AdἙPI pd@ \D@ATp)᪙Pp@ლ4 0 0X 2 0 0X 2T 0 0X 2 0 0X F~2pwP @@M@r4 00 ,3$ %3"| 3|3#T 3\3p@-`PP@4 U= T& # P? 00S 00XS@<,00A  RaPAU70AA AW0AR^p| |0| x0d #2d d0d `0d 2UH H0H D0d 2p l21s #1q 11rO-pT# P3AM M 0@P`0(0 0 0S2 -/4 #PP9 P0D 8T 쒟  0冸300CS0 F B =0:S 84So30S300T"<2 0 (0 30 K("P( 0B.K:SS B000$ 8T S#衟 440<4 0 S BKJ ; /04$ (4I2<4 0'$CxB>K0CP 04 8 0S:SZD H R0 0  Q!0 A00M@04@0]2 0:S Q3 00UiPe0 0 E<1J0 :SS008$ 0:SS00 @ (K0 p1X10$/ /d0 0@-0 蜘-H-M0 S0 00 0 0 @0  00^100M^ 0@    RL00 剷@ 00 0 0 30KH Ѝ/X@4@-I$@@00l-y`-O-P"2 @`0,M0$00㐗d20 R\ 00@`pR 0 IP Z p jP p J :$ 0J0PP0 S#: 1% U10 r 1$4S1$!@00 PbP0S "<100S (!0 0 $0 306 ,Ѝ U r pP Р P 5SX0(, VT00#    =-PP P0SRN:TA{ *0 0$00 @8 0 0 1 30sߍd0d d0 G.VH0H H0 H.@L  && X&$$0 M000 ЍԏO-pM/0? P0030_ Wg 000!R !X P  z)P4%X 00S)00 R .> 0 3 30 ߍ. `0zS 000P0C0 pXgP o@0 0 <)P P0C SRP =- 0 a.W=- 0 W.a`0`F p0p0S8@0  )P* 0P0CS00000偼0S0p0@0 0 (0P 0C P0 SP 00 pg0p0SP 0Sb0 0_00S 0p000Sp000b  0 P\PY+PS  PO00SVp!p3`0 S`0 RP 0P0 0`00020p0S 00hʠ@0^T@pp,(0c.TIN 0', 0$0 0$`-QX ]QP0 ` Q8 @$00!0SVp!p3@0 0h:00`P0 P$ 0C 0 `p.0  ̕p PTPpG@0SW `P 0@00:0偼0S 'P /00SF0p00p0S00 P 08pG0Wcp8pFWᬈ mp!@΍p(H0 +0BMS00 [m0H0 00CS0a000pWH%\0XS 00 ( 0% 0        0H0 0(0L0 P0000F SK*N (@宔`Vp0,',7 0 $'(` 0p>(00S BP V ,$00SNV`@ T@0  R  R=  0 BV0 5 RP/0pH  R{ @0H  R'  `V B   H 00 0SP HX A 0p0 0000P00pLHHHQF@$ꐏ` ( <$@$ $ J  <  $ j ` cd $p `pG00P0W0S`J 0000P T0p00$@00@ 0LpP00( I P4 0C 0 +0 p P p/ p 0S $0 PS0pS`F V  P0 0@00[NP ($@X T 0@0 0]0S=P [($@  ( 0pI00 =l00 8V.$   ]R R@Pp00@0 0m00Ps$ ( n$ 4X @WP0 0NP 00,p004@fP P P P Pa P 3#0 )000C ,0N[ 0$@(j ` @vV @ ](0\0LH0\ 0P-@0 `!V`p ,X@0Tp@H0 c$H0P`V B   H  0SqP H0 p H00CP\X0p0p50@LpP0 00 1$V?o20SX 0p B0V 0\ R:PV0 $P O P 0C ?0C B*. 0(  囑p0 P s PX P`Fp0S P [[ (0 {/(0 SA-@P`p0 #P@-` MHP@p<0P000  P ЍwA-@Q@R`Px v ,200S8 0P1S010t G000P`$ pW@0PD ᭏PP` 0 )00P0 0 C `C000f0  Q  Q*RQ3 <0@08 00 0B`0FP&00P0 P 00+ B #A ?#@ 0#T0T T0 `U(} B0 `w< p p@-@P ᜀPp0@-P$L MT` 0S pW 0 7/@P Ѝ*@ Ѝ$0$ $0 8(0p  0 00M 0Ѝdt0A-P$LMT`p 0S $X 0 8/@P Ѝ)@ Ѝ( (0( 0 p'0$  00M 00Ѝ|s0A-P$LMT`p 0S (X 0 8/@P Ѝ)@ Ѝ( (0( 0, y'0( L  00M 00Ѝr0A-P$LMT`p 0S 4X 0 8/@P Ѝt)@ Ѝ( (0( 0D c'04  00M 00ЍqO-MD@@`PVp` T6 0US`$[G 0SD `VA 0 6/0S+ $l @V 0S HZ 0 :/@PЍ)@Ѝ0$lV 0 0 '0H 0 0 [&0h h0h 0h J&0`D D0D \ 0}&t xD $ ( (@- @MsЍo0@-P$L MT` 0S 8pW 0 7/@P Ѝ(@ Ѝ( (0( 0 &08p |0 00M 0Ѝn@-Pp`i(t@t0@l@ ᔯU  a@0 st$ XXn(H>0ܬO-$M03`0H0 U 0P 0u 3p000ʿ0P0! B0 b8<B p  UQPE @4B 0L3@0S0 MTT  MT  ^DQ #2!Q   "  R  R  \000!#300@ 00@00 @0`PU*$Ѝ@0 0M  00P- S@0^^?0 0`0  P 0J ZS0 { 0J ZSw R @ \1 0000 $Ѝ0\  v  `0\  f  `0\  r  `0\  s  `000C0S\000000 0``0\  a  `0\  b  `0\  t  `y0\  n  `r0反0PU 0 D RQ0\  @`bm\ qA- Q@Pp` ᔍP=0D! D?o2]R0S h0$"0 !@1= 0 V V 01 P0 A: `: A-P@p`P.T T p0! D32 0 A_T <0$"0@ !1% (0D,TSI6,: O-`x(pt8SM 0PP0D10T8t0 0x10 ?o2V0S Y W w@yP  r0P0 0 0S00 p1#0@S Pt%T, U T 0 1 # P00? PPl@T`P @  S%TP 0@T0P 0HC1S@1@! <0 `'0P$0@ p 6%0S V <0$ 0C BP$0ap1  H6* 0 0  Rp1  6' 0 0  Rp1 00p1 00p1 00p1 "00p1@\00p100Tp1  PP@T`{Pl5l%l0 #@KL5L%LL0 # 㼊0P 07 00L5%0 z# $TPNx4$0 #4$0 #Y4$0 # ꤔ T (P$Pp `@T- 0 P9/P%00$婋始 ᥋壋,$3 0 D1 30 Sߍ$0 <6p< $`ᇌaDГ (P``}0S@v 00S  W$Tw U| 0 0p,40@ 0, 0`P( L l7 ,P`O@@@Q@TAO ( [O* 2,@) 04(Aq  00,0 0R,0' 00 0000S00 00 0,4P0 0S0"7 000$P v0S 0Sd 0d1!0 "~pV20 0#T4!%00I1 `0 PP@0 CQ rXP 0Y,* $ PU@ P \P0 SPU@ @ @N5$ 0000$0hg T<   l$` ,,< ( \cP( L@- M@(  @0 @ 80 0P@ 0 30 Ѝm^^@- M@, @0(0 w@ 80 0P@ 0 30 ЍBL^^p@-@QM`P0 0 `PRЍp0@-@RMP0 0( P<Ѝ0-M 000 ,Ѝ-M $Ѝ-M $(Ѝ@- M@ @d0 D 80 0P@ 0 30 ЍD\( [@- M@  @0(0 D <0 0P@ 0 30 Ѝ [@[0@-@QMP0 M0$  PЍ0 0@-@RMP0 60$   Ѝ0| p@-0@QMP0`0 0$  `qЍp -M00  `Ѝ -M ( OЍ -M ( $>ЍT -$M 0 0˧$ЍO-MMn)`< R 9A P p@0  @Fp IBTIp`$pT ` 'P 0 ST U Έ ܍Ѝ" R U ˆ mPP" "00@@-p@-PP@ D!!!!@0P0 @p0 0  yA-`P@PD T% $0S:0@@T(0 0 E R "( pO"0S$ 0 0 ?{ $0S%*z"( p3r"0S$ , ,0, (0 ^ ܻ h tx@-PPM@`q ,0PXPH00IPW0: S Se  SЍP P 9+P 1"p0`P@*"0` \0`D`@.S0H08< 0L R$0L R 8< \P@D V^0 0U  :0]0S \040. SЍ!p $p  Ѝ( (0( 0 : D TXA-pP`P% ,0N@P \0 00X0 0 0P$05%0`4@P0\X0@ 0  0$ \ hl@-`QM@ ᩧpp-  8<0RP@D0RP !P00V Ѝpp ሧpPm!@i!@ЍPPЍO-`P4M(u ,00P0(0t S , @C0SOoB 0 0P0 0 ,0 0PP0,0 00C /R 000,00$00 ,PHL0000p00 R 0$0 0500W000p@@# P ,0  0.Sn P  '@P XG0 0L00, 0 0S5050S 0SK 0S 0E,0\00 0 0$ \0| t R0@PS000B 02H00#0Q 000PPS0 0u P 0 0y0P0S , 0$000 0H,0 0\00 05~0S 0.S P00 00/  00$0T,P0Sp,0A 0 S: Y $ 0U0: (0YS6L0S,00 S-" P& ,0 <%,0O Pp"WE  P,0%<,0p4Ѝ0 00P 00$ 00BUYg (0SY 4ЍOm" P  0^5P05 00,0 00C /R~ 0P00S  \R   B  0SL0S0{ \R   B   R00L Rk 0 00 )S050$0$0UC L0S,00S (0S05SiP b0$0SU "D TTO-`P MPp U0D@Pv PV(p,P X P9UP1QP UdPYR PPO [L PP P[!  PO P\ 1  L,  PWU0 PpP[WX HpP P0 %,0N X  P U @ ЍPUP1X0000 ! 1  0< ` 0 0H Kc E P!P P0 %,0 p,00,0 P , 0  X` P (,Tp@-PP5 0S %#L R6@T@L 0Rᇄ@T @偄TP {y,0 t@p(E0@p@ <T T0T P0X @`+SV x`  A-PP @TQ ,0,NQ Q% R ``@T 0L0S 5S0T $4 0d  BQR@' @D Q\ 5`V `V`05,0$ P ,0<,0@`V   <,0`V`P@,0   ^P@ 50 $ 5@T 0   0S00 ,0 C/P0/0 \ }@Q"2 0d Tf@啃L0s~ ,0 `L0SR 5 ,0(YPt(VH,0OP00\p ,0B/wP W? `5 300 00@hS !P/ 05 PU,0 RDp(6 505G,0 $0S005@=@n(0S P +,0 ۡp( 5058``4`(ߡ0`-0 $ 5'0 $ 5 L   U\ĝPp@-@P T UUp  0 pH H0H 0p ", ,0, (0p Х @ A-PP`E L'p@,0 $5 S8 S@T @嫂T V,0`<,0L0`S00/S , @ `00 Kpp@ MUPR, ,0, (0| Cꄛ< HL1p@-@PPP 0P0S 0`00SSp@&(~({(y(G$0$ $0 Bbh>t  1 0A-P (M\`@ @Ppp 00 0@+ P% 0 0CS%0 p0 0 0 4 5;1:(Ѝ 0@0<0"0 0(Ѝ0= l P 0 00M 0Ѝl<p@-@PP P PpPp0 0 *L (p@-@PP U p@P0P P0 BU404 4C0 p@ ̡ p@-@PP U p@P0P P0 BU404 4C0 p@d \4 <O-PMp 0GW"S00` 0w@IP-TPh +T@`0? ǿ 0  0  P! @00D Pa0DSW0DA0DS"70DWu X: Q\ SP EP"000T9 W0 0 p 0 U00S 0 |S 0F0 Ѝ0S U 0@ 0`000S   Ѝ p夀夐 p XR A B0A PR `@X0X X0 ?SWp pqW ꙙX 00M 00Ѝ27/@-LMp`@$0 P 00P LЍ`0  LЍC-P!1 M0M`0p0<0(~t @PU h1 0S ~P(0 ~ <P( 1R P$P PP( 0 0 < 30)ލЍ0 娀R 0 P P0nS`P0S  20W@PSPQP(U~(#'HP66tnfs$6uniop@-`P@Ӟp@  P@P p.`ٞ*`p`@-@P @(0( (F0 @( ,@-M @"p 0: S  ᦞp  HЍ00Ѝ3O-0-,M$@`0@ P;#;S%1pp{V00Sx00w e0$0P@P`0  U 0 *~ 0@Px `FP@` 0p ep P@PE0S7 PUS0  Y*0Pp R   U T 0G UA}PP @Vi 0`0D00@ @$0,Ѝ0 B000 $00S$0p0|P R  0! p F p @ 10 001[ 200 p 0 0 S 0S[ HP p 0S  [ ~T0T T0 | @PP p3 p@-P ~ @T @~T0 0pp@-@PP U  p@ D0D D0 :U(0( (0 ;p4 px H/O-pP M0@`& X. @T fP W P5@1 P1 5* P 8/P  00[W@D:P PU ЍD0D DD0 X,0, ,,0  r `sO-PLMp@< [ TW> <000D $0{P [ <0Sy 0PD0W`p000G< 0 000p `;/Ppp Xd*  0 b @( `P RPp`,004PZ` ;/P  R ,0VB^P5P1@1*`Ip ;/P  R <0 @I 0 @W@ 0Y:W0@  Y:p I0;/0P  <0 0I 00 p' R` P0S <0pP00Z ` P@000CSv 00`  F Q0#03Q0SU (p, 04P8` Pp ;/ P0 P0R` pp`;/ PZ PW  0X$0 S 0 U 0 EU B  3  S0 0 SQ1:(p,04P8` 0S"*$Q R0B0C0 00W0|@D 0pS+ 0Pi< 0 p`<0 S<  }LЍ <` UE 0N W00 Y ( 0  S``V 0`S`j @p@pPꊠ W@[` ;/ PP @ pT00 501 *p`p ;/ PPT: ` 0PX$0DSa0 U 0 EU B  3   S 0C 0 JU 0 U0E0C"030 00c   S & @0PCUP00p 0;/0 P0UpJp a%;/ P`pZ0 P00 JU0 U0E0C"030 00c   R 0Q$ @0JS J 0 0Q $0S 0 Q 0AA0 $0`S 0JQ 0 A <0SD  0`0 P`( <0 0I 0p' 0W dPh `R^ 0  0{ 0  0x[]x x0x  0yS\ \0\ X 0Y00X '0 P l܉ h@&- M0 00& Ѝpp@-@ PU 00S  RQ Qp y0P{ P { 0pD0D 0 Rp@-@(xyP(syp "tp@-PPM`% @T@T T0 Q 0QP `` 0`P 0 RЍp0 0 i0܇ `p@-MP@+PUP`0S$005000 0   ȚP& p" PQ! 0 00CR 000S 0S$0Ѝp00`$0L0L 0 Rp@-@(xP(xptA-p`@PP0 00S (xP   (x0S tP   0S `(x0S 00Tt0@-@PMP  0! P}  0P{p@ @Ѝ0l0 ShP0 0 <ZL (X!X1p@- @0(MT0$00: 0PS` RT= 0TS@ 0 0 $0 303(Ѝp (0!@$R0@0T$0B0S 0S ( !0$ R0 P <0 0 $0 30(Ѝp@ 0 |\0P@- D  R4   lh 0P@- XS HH@ r0( ( @A-`PpPp@ U! T 0 F0P^ 000\ LL0L L0 ?U000 00 @Pp <x\ T00@-01@UT0P 0 !0P00@-01@UT0P 0 !0|@X0@-@UTQP  0 0!0P00@-01@UT0P 0 !0x000/ᨼ/ᔼ000/ြ00 0/l0P /0-@PQ@0/0P /0P /000S |0| 00 9/X0  \\ $0 /0mNAp8 A- `PV(Ep@0 Ï@hC12c` P@ R0h0h 00 PQPP@@U0P10\_ Nкpp@-PD@@ v0S,000P p@ |vT$1A-@Q`pP`FP | jv0lS AA0U0HU8!8 0p000 0 Jv?UU @P P0p0p@ ^  B0B10U  ?ࠃࠓPT0T TT0 @` vꜺܹl(\hx{ tYp1A-@PppG8 `1#P #Qu0S PFÀ@@A00 0 0!,UPPP t0&&``` dd00A @uD D0D 0 ȸlz Pz p@-$@@ @uPupж'p@-@P PP P @p@p0 0 At괕hy \A-PPp` @P# P# uP  P@3*X"00@S004 404 0 VCE00@x Q:// BQ://@G-04!00S(03 0p00Q= AQ@P``P000QЀ @P  P 0R@ vTl@0@S v000  B B!G`TTp@-@P P8sPpU0 =Sp=Spp$lp@-@P PPP@Ppp@v 0 0 Ht@P0@,@-0t@P0@訯,@-"t@P0@p0!@-@!0!1100 000Q000 0#0, 0# 00!R0Q0  0R000p@-P@1`%S 0p 1# R  " R     Qp@PP@1`%S 1 S  \  1   p@Q Q      p000 0/A- Up `QU @ @E 7/P@G-Tp `AT P PD 7/PX PPHPG-Tp `AT P PD 7/PX PPHPG-P@U`pV1S @P@E  8/P?@P@@@0@ģYC !Qp    / @ q  0W000 @0S@0  pPT1S1 S Do 000  q@@0@@@ @@p p  qQ0 @-@"P 0 PCQ0  0 R QP 0@/0p@-P`@T0] \ = R=    T0"] \h0000000000 0#0 0#0000`0`000T ^pp@fR1 /o"!T0#00#00!04 000T p`^`  T 0V0pp@7Q `T ` R\ ! O-p`pP$ Q@@P0QpG@`X V 0PaaEq0Oq00pG.wTaX@Z_B $i 004 D00. @-,@@0@P0S@0M-`@P@_}P(p0@aap0O:q00ZO.TTaXPB, ,0( 0  ,@l0p@-05S PhqP0SZ sX@ 0CR\Wqp@T P VP@Eqx0/p@-@P $PrP r$rP ~rp@{r0 0 @f HMp@-PP@ T $0! 0p@/L L0L 0 { T, ,0, 0 p  f Ԛؚe ܚp@-@PM$ $`0. t  PP  P pp(R00S 3/Ѝp0 03/( (0( 0( Z7 de \e ęЙC-DM$p 0RP 00(00@` $1 ]PP 0 (0V,00S 3/DЍ ,0 0 (3/ ?PP A-PPM@) T2 0S Ѝ$@ 0 P q00 `4pP gЍ00&pL L0L H0< T0 000 ,0< $c ԗܗb O-p`"`\2 0yM(010p@bH H0H 0 X, ,0, 0 W~V V p@-PP@" T+ Pp 'bP 0S S3`P p@-`p0p@/L L0L 0( wGT, ,0, 0( x<U 8U P|p@-@PP U  p@+bL L0L 0< g!U, ,0, 0< hDU U ,0@-PP M@ T# _P Ѝ0aP 0Sp00 bP P0P 0L T0 000 0L XT $,T Pp@-PP@! T*  0Q  p_P }aP _P _P p@_L L0L 0\ T, ,0, 0\ PS $S XG-PP@H T  R# R `V$ V  0 ````q pl P 0r R R1 00 0 `V00 0`V 0| R0 F0R$  0  0 0l I<x 0  `5 00 00 0000 0 `R d%Q Q |  @-/ 0SAS/0-$(0@# A  A A A0/p@-PQ@`2 V' T ^ 0S^  S 0RR00p@@Tp@0@ @0 ;(0( (0 :,4P htP ܄C-@!P1 0MpP`030L TA A< XP7 :Y` 10S d!\1 0 3 30Nߍ(#@- R? R0 ! m p0S hp% 0 0 0 0 P0 0 G  D  RP R0 HTN pN tO-IM,M`p$@PPJ d4 0I $000 pW W0  $4 I0$ 0 30Iݍ,Ѝ0 SJ=00SX302 2 0? J=00岰h} 4#+4J8#8  ֋ zJ- 0S p0UV  SV S RNJ=0012 0000嚏:00H0 ,0 7TP @,VU  W3 0S_0S  0S0s S0S RJ= 0 J=00[WK O<  WP_ 0SJ hf1a! 4a4#Q #< <0J8 0J=00x0 Po J- 0SJ=  0orS SwJ͍0 ~%Z! 00S_LP P P J=00W0  hWPJ͍TP ݨHM 4L cPO-`<$@84 0MQP@pDH0000$0C S0#3 0 0 30Ѝ#3 0 0 30H0 D@pЍOWXc 4"4 T#8#8 ᯊpPT0S RK 4"4$!$("( "8#8 DPT7VT00QWX00 R0SX 0Sd S2YP00SL"0 kT@@O 00QWX00VT;{! 0  P X: pYp 1嘡嘱 P0 pY@D 0   ,T00? 4!0  piT 1i #Y70PpP0 p  T00?pW@D 0 D P^T[pB\  xH p<}|P|{<{|({|zPzzO-`!p1 0IM0107 P@p/ P PW PWD L0@S0h 0&h00a 00  0P 0 0 1 30!Iߍ Z z0VX 0S GP 0 0<hXA-@ 0P`px0 { 0P -p@-MP`P@@P@T 0S  R0S )#P@PЍp!PPЍpp@-@P PuX%Xp0 0 @HRA v0S/ AA. 0C.S .R Q P-S Q P_S /@-0S0@SO 0RM 0^G @PTO 0S`V DDp Wf U` \# DPD`VR S`/ @@@0T*R^00^00S 0 0 0R0C?o20SJS 0R 0^ 006 S0S0^ U. \2 D0D@T 0U& \ D`DPVS` D@D0T\U \ D`DPVS 0R`V\0Sp@-0d M."P0'  @ 0R0 0S  R la  haR 0Sd .P 00 Ѝp 0S S0S,  R R R  R/@-/ 0 S /0S S/ 00S S/0S/ //0@-@P M 0S PP 0PF@0S0S 0S  Ѝ0$0$ $0 nX< |q@-pQM @Q`P Q Ѝ0SSp P*(4"<8#8V R" R  `0S Ѝ Ѝ00S S<0 P 0  pSp@-PP`@ V T! 0pXPpx x0x t0 1V\ \0\ X0 &T@ @0@ <0 : ood: o|o8: $JPoO-M`C @80:0 0ᶀI\pP0  03/P 0@&<00&, SS 0040R0SY pWp@`$`4(48X#8C 0,P: P00(Tq*0C 0\`Pg0  03/P_ @\\`\V `M40S?&<00S !Z?\z` \\@X50 0[0P4   @0 P,  b0P( $D0$0D0Q d $RʆY $R 0 00 Z &<00 Si 0J'ZS@00S00(`Z,PH Yw D4H 0 P 8pph@  dY5 {0 0{%%{ E{000000UP ("P!0P R R 0   `R cYVw 80LE0S3 [00[0020 0&<00S1@᫁@PX 8(5$%0 5s (0S #0S c[00@ $0R wZ? ZZdZ @y@PX[(0S <0C80D\G Z<0 C,0P@ 0P,0(00(030@@T@[@@dp@01z00 Z@P"0  03/P Y 00 S @@p p80RCP.@a&<0@ X $0 %eTHĶ0+ `P* _h_ * _8_) 0__) < <0< 0DD !$0S\ \0\ 0dD 0S| |0| D 0 80`RC`P.@@0%.pJeX@p0p ;D0jZD0P`0 0 R  Q QY Q 0w괠O-PSM$04 0@0D10K``P G`pP $0  0r8X0`00pS0  PO 000 FPK @@PX 0  5Pebcb@#|3 0 D1 30SߍY 00zpZ00 Q0 0 .Q0Q RS% d! St*+ 0 P0b.b @S Rd! Sf*.[ 0 PYO-@`pVPM 3 0 S_ `PL 0H0L0P0T0X0\0`0(0,0004080<0@00( SHC S$ S0(,pLp0 00h0Pl0h0 0000 d1S Ѝ,pᄀ넀xXtAY00>YP P P,pdpHP h08 H0  < 0 S6 1 0T0 06P  0 p+ P0{0((00000,0 0 {$0P`Z 0 Sd1SdXO 00S!(" lWO-p"`2 0 @00@$0 `` pY;9 i2 I520Y0 0 S   S  R  R Q\}  ^ \Q/o" S R0S 0 PQ -0 0S Q0S %0P 0 9P:  B  0 (C(PBY 0( P p0`4P8p`P,@<Y 0S@TF 0S[ 0S S 00SC P(0 05= RBP R? R<0S0S `;0S%PUD;35 \ ^ ; 00U Q  P \ ^  R R  # p' Y P` 0S   0?S C" 0c6#PY  ^i #\S㔐Q^'@ pTp0S 0` p$p@ T ;4 d2 D52H 0SE0 S > S PR  PO @0P0 0`P`&0e/0 8(0 YP @`( 0@S0`P@T $PP@P ]]T$PY@T@ pTu W 0/0 `P 0PU`VX \PS 臟PpH0!L0 0PPHP$p1_PPPB ]0S: 0S ] 0`@\'\7\ Xy/0QRSP㔐  P   P \R?o20S b R㔐P NP\IR PLV `$p(,PP00 00SqP@T0 ,6$p0(,PpP S 00 0 P@T 0S00S`;`9  0 wP pY 0'}P-{0 P R 00S R00W  P5 0 uPY 00S)$S㔐R 0S |$|4| 0t}/ 00n4P ,@ p0`\RSQ \@` T" PP@ \\TS㔐b ``\@  0, 0P  0P ` @P \\Y@4#434 0,0 ` `S_] Pn\`00ZP 0 PP]PP HpW0!@%`!!:PY@P  H HFwH`L WP @L@*@` @\$"0 (`h$P` ,W 0@VP` @GHV댠 pW0|0E0B l0 0 0  Tp`h !|P zPU0ED $0D{P00EJ$H|$0U St S 8^ $P"/г8آLL <  +Ḭ GFcX FpEu,8Ii Q D 0P03 P Q$P0Q W : rzh,pt0(`0 q" 00S0 0[H@P P0U 0Py[P0U q[0$p(,P`z$PEb.>> fp {P1x00x0 K[L@`@H`P0U00L0P7[P`O-PLMa Zj  븱Q P@   `P00 PG p0p R R R0 T@|0P p R ((0(  *P00 V pW Y 00  YppWV$@LЍTT T0T P0".Z8 808 40".4*0*X ?p>h , p>D>i G-XMp@NyP `P@ y00  ` 0XyP 40S0- XЍ OP {ZF  0;yP jZ8<8 .P 4PPvR 0 ?>O-MV 0:   ?0hS@H"p ` *60V@@p`F  GH H0H 0 , ,0, 0 T --, l-$!$1 p@-PP0M@0 00( T1 `  !? 7R8 bx b$   0 0 0 30X Ѝp@;` `0` 0 vT@ @0@ 0 kK x T, (,C-8802 M,"0 P00  `p 0R @  0XS @@0 T .. 0N l!\1 0 0 30 ЍT  0A a 00C 80BS.R ^V* 00ߒRP 0FS0 S S^*0X 0n(."4n4#0000@^0 8< 4^*0 8<괉؈- McP ЍH!H1p@- @0(MT0$00B  `RP?o2T0S8 0T0R0S A 0 0 $0 30((Ѝp J(0!@$R0@0T$0B0S \@0S ( !0$ R0DL4 A-P!1 0rM`Pp010: UB @X0^00pAtAIR0OR0,1TA Ό 00 LQP5  0 0{pP& 0@(SP 0 0 1 30 rߍ0 0 <Uh0h h0 = P S00 0P0ߑȅB  ' &$$0 M000 Ѝ  -- M0 0y ЍЍ/-4 -M, 0 0 iЍ Ѝ/᠃p@- MPo| |@|0`  @  P` @X@rPuU  ЍpPXD(LL1 @- 0M`!000sp P@ G 0 sp 1r@ 0 0 0 30'Ѝ#rPpW @@T PU 0SP@`T[U00@.Ăi8 0p@-P0@ 0 p0S(0PS(P,PS 0t0PP 0.P 00 0p88NtP 00 0pp# x# 0@-@ 0 0 0 0 0 _ 0 0 00@-P M @0R 00P 0 2B?o2 c0 Ѝ0Y3 00 0p@-@P 0U0 0pp@-@PR0PPR(0PR(P,PpO-p0Pi `Pb 0@00 S S0 S S pPPQ 00d P[(4"<8#805 $@P 0P00S S S@ 0AS AQ@P$ 0 PS0000\QP  PPU@Q@P!X8O-P Mp@,0(Sx:  :(T] 20 T0T 00SP 0 RJ@D@T0`E   RA 0@D@D0`0S* T0T 0 1  @D@T`G 00S#0A S00 ᫎ0S000  ⚎0S$ p@Q0ppQ(0pQ(p,p@ ЍPP  (,@(  Ѝ0 00@- M@P   p P  Ѝ0 0$  0$0 P Ѝ09p 0$0$ 2 Ѝ0O-PTMe Ep@,P @0 ppRPd,N`P` 0 ppRPU,PPU0@ \ \G \Q \C pp 0U00S NP. p0 0 0@ ` R  R2 R[ R 0 @U ` 0 P 0JX0L 0 TЍ @\L@ 0U  0⼰  0 ` ` SPE0h u4 E0 :0; 0Y= S81P3 P#S41PE2s2PEsSPE0i W0 E0 809 PEPE0i EU0 8PPEPE0h 4U4 :P 080 4:00 @-pMmp) @op, `0v0 0 0 @Pmu l00 @P Ѝm00@Ѝnum / p@-\ ,@\ \ Q :\ :Ap00p00A-@$MPJ P 0( T 42~|:pB8N87 @8nj;p$`137<Ǡ  B- @0NQ  Q  000<8 A90><à 0 (0 AЍ00 01 0H 0 0@-S@ 3/@NO-M@Y Qs 0`  @ AA! B B&"@@" AA! B B""@@a AAu! B L B \᧗" 00\ |3 L0 1 00p0` 0`Ff& G B$"II࢖)0F 0C)6# B B("IA!0C0C1# B B%"AA!0 Ѝ ZTr `   P 0 p 0 J 0 E! G B$"0C0C6#AA#! B B("0C0C2#AAa! B Bu"0C0C Z㧗# 0Z " Z Z 0 00  0 0 p 0`\\ 1L0 10`ZZ- Z) Z+ 0 pn 0`p0L0 1 0p0`fZd Z Z Z0d0`YHp`F8p`0|0x0t0l0hy7 l @-@P  @)L0 0 /%P 1p@- 0@P0 00D@1011.T 0@\0 S@ P p0  00C1000L   00LDLh ʚ; C- M`Pp&ᕗpaapGQaQNLL0\0  M@ N (  Ѝ̤ QX 2Ÿ0@-` 0P 0C0@@@m 0@@@f 0C0 @@@@E 0@@@> 0pC0@@.SM 0@00@000@ 0pp@qE0Cp2Spl 2S 000 @ @  @000n l `Ad Dn l lAp00@  0pGqqAp00  0pGq@p0000pG00 @ @@jfp O-XM`P'M< 稄 |$ `!P@@ 7R@@T0L07dI0P40 0 0 h&6 0 @ < P0D060H00U000p0,0 0  OP00T00S <0`1  D0PU 0P 0U VH lV0h0S 䵟 ,0U?p5P00P 0U7 W,0?p50= 0Q8 Wd0 l@V,0? )R ,U4pP0p   6P*4 +40 pT4P0 p40 p8p4@p80 )0SJP H0P40[(0 $3 0 |4 30ݍЍ_3P0 `s^0S 00T00S <0`1   Lp k40S T#2 0 |4 304ݍЍOJp$P,0!?0"( kUX" 8 " \```PT@Xk@F`DV?xT 04  S D$#$*D(H"($H3 Z 8k pJ Jk T0 P2L p0 J00 .J* T@F0 `DnVT@X\``ꌱ0   `Zl0 X 0 R@10d` `ppG pGZkT0 d`<0L p0 K00 .K* Tʴ++L 8k= dc@DjXLWWHl< hl`$_4 h.xX O-tM@@ `CVPPh0P 0 Pp 0 0 `14,Sἴᾤ0   (6< 0 V 1806< 0B>PPU  0R4008 0j`1S   ;`1S0 0 0 PJ0 0 P7P P }P$0 0 qP0 0 eP0 0 YP0 0 MP0 0 BP`1SxYz < P]p0pW  0R  09jLpW 0pW  0Rx  0&j9pWf 0pWa  0R0 ,0j&pWGpWD 0 PS00 j`1S   0 ` 0 `@0 `0 `, 000 0I tЍ   Y _2P 0 &001p0 001p0 001p0 xx1p0 L itЍ tЍ 0 q10 j0 c 0 \0 U 0N0 Gx0 @\DLP4Nl,L\0`tT4 @-`0AM 0M@p 0 40 0 Z?PP0S iD 80 0 4 30AލЍ.$ՅTLT0,@- M@ pp P/?`PP 0S@  Ѝ00S.S 0S Ѝp@-Px AM p00 ` $ 0 @P 8 ,0 0 4 30Aލp膅LSS0p@-S@` P0 @S NePV 00pV00p@-@ M`pPU 0PU  0\W 00 Ѝ_00P0 `W00 ЍXp@-@MP`0S 0 @S 0S@V00ЍpO00@0 PV00Ѝp0@- MP[0@0@0@T  0U Ѝ0l00 PU:H@@ Ѝ08800 P@~ Ѝ0tF,@LWQp@-`M x00<@!P 0PU  0VЍp_40P0 `VЍp @@EL,Ep@-MP0@0@=@T  0UЍpt00 P1U:P@@Ѝp@`@0``0 P @ЍpEUt0@-@ M Te  T T 1 D0R  T8 2@TP |QTP Ѝ0TM  T/  TJ DQ TP 3^41P0( @T T: QTP PTP PTP P TP PPPPPPPPPPPPPPPPPPxPPpPPhPP`PPXPPꪻ XL$(,(,$dD@-@:( nP2. 0 (e0@- MP!h0h@0@B>@T  0U Ѝ0O,0@0 PS Ѝ0A$@Mp@-@ML ` 0 Q0PP@0<00 00. 4T @D E000T H0 0 <0 30 @Ѝp@Ѝ/.0 T2ꂃKKO-@Mp@@ = ` P0 Q ЍSq SR@@ -R 0 0+R0  0h300 00 B10 11 .R 000 @T@0✑)SQ 000R#3@0SQ #3 00R0#03!3 T$ (<0(80(40%<0%4 0)< 0%()4 0)(0 P 0R0P 0T00@0SP 000R#3@0SP #3 00R0#03!3 T  0T00@0 S\ 000Q#3@0S\ #3 00Q0#03 3 T   00 Q @0N0000D00 0 0 >JO-Q dM0 R 8 $ Č(Ȍ , 0̌ 0 0    $  fcPc$ЍC-`@P@ MPpOP @U aP@ W @ Ѝ @P@t0 0000 1 0P!)0S0Y@OoB@#7AC-`@P@ MPpx@P @U `P@ W @ Ѝ :@P@t0 0000 0P:!0S0Y@OoB@#6`x@p@-@P00CS0 S  P 0` PpRd`0 0CS0S P 0 /:d0@-M@?0 0O00 !R !PMЍ0p@-@@0S"0@0Q R"  004S PpR Q R 8 @0Q    54>Hp@-@@P@0P`0pp 00,p@X03@=H(D D0 p@-@`P0pp0,p@<HHH0 A-@pP0`p0 A<HC-P0 M0`psp@ HD@ <80  @Ѝ 98<HxC-Pp0  M0`pIp@ (0  @ Ѝ 9;H0 0 /;H0 0 /:H 0 0 M ЍZ:HXA-pP0 M0@P` p 0 p=Ѝ:H0 00M0Ѝ8:HxC-Pp0  M0`pp@ (0  <@ Ѝ Y9:HC-Px0 M0`pp@ 400  B@Ѝ 59|9H<@- @  $M0 Ѝ8HH0H 0p@-@0pP p@% 9p8H,,0 ( M00 0ЍaP8H? R) p@-P`@V /P 0S.S  0@S \S 0SBp0S @Dp DU!B2p/@-P0pSp M@` 0T 0C0 ЍL0L 0p0<0<0 7/0 0 D7 O-pM`@PpM WC*00V>:Y ` <1<0 p pA `P 0 p- 0 p& 0Z p `0 p F0?V0S0 0 =Ѝl0 op 5000000ЍhȤ (O-M 0(0=000=<00 0P D8 @ 0 ]P` 0S@; H = 0< P@ 0 bT:p 0,00Hk= P 0= 440U@P U *( ? 000=0 8/0`Hk= 0PE$P=00∀HP=d 0P >` 0P p , 0`%p =000S==000Sb -0 = 0 BR p  R 0S .S 0S 0S00S.S-x<<< 0-< RX, P@ C=0;@+A0X 10"3A C0;u<10X,` 0L\xT8 4tE+܇ %*p(pL 4 0D  == ====   htVUUU0LTL `0$ȃ Ђ P=000+SE =<00SE@0@d 0 0u`P0  2p  0 d e0  $p 0@T0DKI*xQ `pPTDK> 0d 0 0G0  p< 040 BP0DK 0T*rPp\Z `PP 0$VM  R @0 Y$ f0d   0  p @T0-< 2!?C0 Sd0 p@ 0 p=<00SH n2p0d D;3 0 P`0  pl <040@C 0 P`$P^0 tpV 0 P`PMH=<00S -P4< 00  P9-4< 0$004d 0 0  Apk"=<00Sw -4< 0t=@  <<0 ~ 1@1@<`( 0Y00DX50T P@0 p -< 5B !?C0 S0 p(=<00S^ 005d 0 * 0  p `VLpD5 1RCP `@ $ @@@@= 0Hp 0% 4WP *( x60@@60 4/$0pG= 0p0VHD 0 S@P0 p @P<040pP`@C 0 P`4Pn0 pf 0 P`#P]0 spU 0DK 00CSt 70=<00S0 H[= @ 0 0}%T` *( 48X04p00l80 7/=P@D` @ 00H[08d 0 s 0  2p 0YD2*xp`0p@ DPY V 0  p `0d  @E 0  p `F@P 0Y 0 p< @P040 B@PP 0 p PDK0 0@0H0@ 8 8= 00P@ p:( t  0P0:0 5/P`0*@1p0:Z0DK{ 0 p< p040 Bp9Ps$ 0 pk DkDK`\0PD[ d 0 0  spU J0PD[ 0d  0  apC 00P -0` *0;d 0` 0  Jp, Ht=<00SP,0 S00=<00S L0@d 0 0f `P0  #p 0p00d D; 0S 0  p  0 d E 0  p D= 0DR =<00SO /@/P/0P0@2 D;=0 `p0 p < 040 B`puPH< 040 BgP0Dk 0PCUhQ@p@T 1 W2 70d  0  p|=<00S d/@`/p?@@02 D P`0 {p] 0  PU |O@0 DgpI 0  PB 0 DVp8 0  @0P0 0D;0 Cp% < 040 B@`Pc=<00S 0 C? 0l=<00S< 040 BP0D 0 S@/ C 100 Sz0 p00 H{= ` 0 0#fV@ *( >0P00>0 5/0-p`F H{D`T0 p0 H{= ` 0 0"7V@ *( = 0P00=0 5/0-p`F H{D`-0 = R -=< 0-x=< 0 0 C`=0 0 CP=0P$ 0 PU0D[:=<0- =< 0P  `P%VV |pP@ 0T00 EepG 00d0V0@D0 Wp8P<  @PNT~Ts $|pP` 0V00 E9p 00f0T0`F\0 +p ;d 0 `] 0  p U `l[PVDK  0d 0 0E 0  p=<00S-;< 07-j0`pD{ 0 Pp :d 0P  0 P p  0 p X 0 p - 0 P`Dp = 0H{` PPV *( 9 0|0090 9/p=H{ `Fp `` 00 `ps h 0 pk `- 0 D P, |p^ =H{ ` 0PPTV *( 800080 9/p=H{ `Fp `` 00 `p4 |0 Jp, !-0 D P@=p =H{ ` 0]PPV *( 700070 9/p=H{ `Fp `` 00 `Ep 0  p ,@0 DK PTp = 0HkP @PU *( 6 0p0060 7/p=`PE PHkP` 00 p 0 Pp 0 pX0 HK= ` 0 0 $V*5( $ 0`060 6/0 HK= ` 0 0 V*$5(  0`05 0 6/0 pZb 0 Ch50`0 spT A,0d D 5 00  _p@0 Vp8  PDK 0 Po0 Fp( <0dPC0@`DK@p0 5p 040 @pP0DK 0S 0 pI+` @DKXSd P0 Jp0  p +@DKB0d  60  p +0d D;D3 0$0  p < 040 BpPD  0PC 2 iP`&P rpP@ 0T0 0 Ep 00d0V0@D# 0 pH2H"0 <0 p rp@ 0@Y0Dl:P  &@PZTT qpP` 0V0 0 Ezp\ 00f0T0`F 0 jpKVH0 _p@(0 Vp8 qp10LؿP`L@kȽt8D<D0ĹtH4ԸxL8|P<жTHԴ<Ȫ\̵d8pl*Lıܥȥ@8ldȯȢ\$hԡm VL0 p h00d  )0  p0 p ppn 0C00T0 p0 p qpyV(0 pZpTT0 pt0 p qp=<0!1 0+J X0X! ##1 0  +J X-- +J XX" !"  +J XX  #  +J X,- +J XX! "  +J X 00;J 0^p@ PUD ,@- R MA L  ,@@0(@;@ Ĝ0 ЍYM-(040 1 2Ѝ/A-PS`1p@@W0 V:0 $4"48#80@PU *)P@(00T0T0@DT0S,0, ,0 lP@t k G-0PU!::0` @4$#4T00 0p4$#40  @T#0 T4Ġ#400S X T0 $( ,0 P @n(00QA-Mp$0PS@` 0(010$,0v(`V|0Sx(0S! 0, $P(0, V3100(Pi,0 \, d0U4#4 00,004#40,T(0P0T(0 S0P$0Q0 ( ,0Ѝ0F P5, (` , Q/:04800XS: 0ST.C+S^/+  ` 0000   0 C R 7ࠃ0ࠓ0CR 00000   0 C R7 0 0C20L0L L0 ?8404 40 >/t  ] hfd] DA-p`@LWP. T @00V 0Px0PV0 G.`U` P7000 200p0 S700W0 U00 0   0gD\ D/o////@-DM` @ 0p0 < 2 20 RPl.00000C0< 00 0 <0 30DЍkl  O- Mdr 0\婒'`rDB( 0 rgqC0ሀB " RP C@$A i!dP @3@CG*TNXWnY1Z$* @ 0 Sp: [ @B0?R0SJ  Ѝ @ 0 H|p# W0Y[0S    00000000S 0 WYp@@ 0 DN p XW  0 MAp Y L0L L0 e Ѝ @ꉈ%I$: 4 PؚX A-`pP0S-@ T 0D0@D0C .R T  S\RT  S0C\R@D @0. 0 @@( 0 0p@- M0P @0 80p k`d p YJo4 (0 0 8 30ލpnj  0-@- M0@R0  rLPP * Ѝ@Ѝ/ + Ѝ@Ѝ/UjPRp@- `@PrPaP0 ?p@4LOT00pPRp@- `@PPP?P0 ?p@L-200pp@-@Q `P0PP0 ?p@K 00pp@-P@KP  p@ p@p@-@P 0PS <0S P 00p00pQP@- 0R R  00p@-PP Q@ @Q Q Q ARt032 00pP @pP Qp@-@P PxP  U 40,E0S 00p UPpp@-@PTp (0":k0cSp: A pO-0 -tMP@0 Z+pup@`50S @P/008% 0<0-X000X 00H S0 100H < 0H P-\\Ё0H4010X @X `V @ ER>    0S PtЍ P EXG  sV P<00<0P1 $5AH˝L%{D1 {* [{56*R:s 1 $Z ER   <0B @  1 0 ۟kf{G " 00S0S:0:G{G??A5??tE <|B NaAhQ,PjP{8 k{'d lT@0{S0 0G{1R <00X  0 <0 =@0@ @{ǻJ{ǻ3 $SQ 0$@ TPR 5r@sD 0H5&L @  @R[PQk{{* Up{ L( k`Q Q4QK`7HpLL{@{0S0H000S0S0SL X{m@GsEsCs As ?sU  1m{ *0S  0Q$}@j\  nP`0\ 46$ oLHV$ (0 S \H0 H{{7{P&XH00SL 46S00jS^ *k&0B:H{{{ |tP% tPU L T00jS5?55??P9? H00rL 46Sm000kSi0S0Sc EtPW tPLYڀ0U0: kS87S@rrr r rRS<H0S \: = H}{@{7@{{4HpHk+UH D10jS#knP \ Y6C#::L00H0p1Q 006L00H0\H0  @  0 00M 0ЍF$ CA-@PU `O0Sp @ ᷺P 0S U@Dp@-P@cP_P0 S :pSSp 0R:pp808 80 e;$0$ $0 f3|d; ||D; |A-P`.@+T*'P/ #P4 pPW 0P P B $$P W 0 P l l0l 0 CT T0T 0 D< <0< 0 E޼@: |{: {{9 {h{00 @-@PDQO-^ 4A`@Pp  0S 00CS 0\V0 S  RYWppXpQpW\`\\U0 SP\p(9 Q@-P-r-0w00-0x000舾 00胾000S wS -S rS  0S /xS /  @-P@20 0V 0 P P//0S/ S S/0S/0S/@-@0@0T S R RT/ ?/PP/ ?PQ/?SQ $0$ $0 p@-ٻ/x 6 (x ??SS $0$ $0 p@-Ż/w5 w?S S S`/Q/AQ/Q Q/?0 H0H H0 p@-韻Q/?S0?/0?/(w$5 @wQP00 / /@-鹽 0  A-6!P 0`0H@pᨽ Pb`塽0S蛽Pp#뗽Pp@-@P M` P0ES  a Ѝ 偽 p;`z0S   0 0 Zdu3 up@-@PpP Q 0S P.#0PS(#p@%#A-@Pp X P@PE@X ``P`( (0( 0 '`2 ttO- M` V" p@IV P8 @P0SV F!ଢ`F0 `1 Ѝ Ѝ "` -\ x  010C. *  $    1 RA-P(M`p |@ 0 @0@0 P0 0Pb P@ 0 (Ѝ0 t0  X00 5CS  A/0cS#:'3R31 3:0CS!2# 0p@-@PP U Pp S 0\\0 0pD0D D0 L[U(0( (0 MQJ/ qJl/ qO-PM`p 0FV"S00 0] P@P-UO +UP0+ ¶pU"<,@P00E Qa0ESW0EA0ES70EVt \SQ @0U1 V* @ 00DA B QR cp `> S0T3 W  0p|| p 0`@> p PPL1L!L0 ?㤸0p 0>00D,00XS W#0p 0 000XS W pp p 0A0C0B QSWpP pf0p 0> 0W 0@ p p0@ p 4333333-( (k00M 00Ѝꐵ  r  Q0?0S @-#^-- Mv ЍЍ/G-P`pP WX 00`F! R !V6  ЫP 0PE (`V PUU@@pPP X4 00ĭ  @@PE  P00紭 000@00ᩭT0T T0 BӷW808 80 Cɷᑭ:% h-t% gA-P`᝹H@H0@@@p @U  U A( (|8p@-@P_00CS0 S  P 0` PVp%A`@-@P = 0`00@<0 0 6h+# f- M? ' Ѝ 0 0@-PP0 M@000 T#   P 0 0 0  E| t0 0 0 30 Ѝ0T0T TT0 +T<0< <<0 !]묱 8 ?# eM?" eNA-pP@`( T1 V: 0S 0S0P00 00S0 00000 R` F`Q000x x0x 0 6ݶTX X0X T0 ҶV< <0< 80 Ƕ! dd! d\da! td0dbO-p#@3 0OM″0410PP`1 dh`0 V Vw Z.` qP 30 00 [ .Q Q\.Q b :0 N 0PY [ 00:[.[#4O[0Q.SI Yg0IS00`0 0IZ 00 0W \ 0 P00 ` `0 0C SB: >0   ` 0 +00,/00P!@1 0 41 30GOߍ:[ 000$0( @,幱0 000 0 `P P00 ZW0000 0 ( 0@<4 MPPF U.Rz  :ᮧP n[  Ԭ X 4L ta  /`BO-`PM@p  0W0p W0^( 0=PC (5000 00 P @ ppP 00 0 "P > Q Q 0` @V 0`VI:`F0V:\`FW @pt pZ`FF R ;0 0 ^00@ߍ Q Q0 S S   团 pP ` Q PG aPC T :  *@DP  0RP@- #[{0fpp X  [`F Kq  `F  W e ᦰ Z V P0 0`P `p R R R RU T * +P p RP?(@D PPV @`V2 P( !T>: `P  ֱP T014 @1:p 0 @ 00 0p; 0 @ 0 @0`P_]' 0@ 0@ 0 PP P 0` @3^0 F|[^@-@d!d1 0LM`P0D00E Dp0PS, @.0 P' U' qp0 0 0  :P   0  0 0 D0 30LЍ:Pppp M@ T@ @0@ <0L Y봥 |Z, Yx +$YA-PPM@6 p`p@T( X pp00卯  0:P  0  Ѝ|pp @T ЍG:P @, ,0, (0\ ಳ CdC0 P*W O-UMM( *0|: 0tz0L50`P|5pxU別0 (0S 0 S00W :0$0(0P,0  0 @[ S#p`P ,U0)09 0 L5 30YUލЍ50 0 P0 $03/P @[:0CoᨂS  Rl  P0 `PPP0,4'4Wp8#8X uD PT4R pPHL@8< `\ T]*`P0C 0 ``PR0 $03/PJ @ Y(  @ T`0@ 0S4<0S 0 S  R08P0 0S!0S H0S0P傮P0X`*\0L 0R *P  ̳H0`0H0LPZ84H0S , 0d0L P0QH RXK p XPHp `BZO[ P0 0 00PW ! R  ȠLȠQo \ V SppQPW  WX0 B@GAq 0SPSPڰP!^P"@Qp`0S 0 ,0`@D @PC0@P0CS`@:Dp` @KL0X C0 0CS`:=040$0S?0@0 s@Pe0 w VB@ǭX00`VX@ `0@庞``(PM S  C'SRG 0.P 0`P 0`%/4#3 0l (0SW#3 l 0M(0P04D0,0\?R00 @P0 9 VT D0,1Q;*,`PhP P`Pa0 CR00Q 84,`@PPpK0`P CR00@T@=P`@6$03/P `r.,0D(`C 0T0|0Pv  , D00D0DQx0 ((7PH0 @P0 E VH0S0P T D0,1Q=*,0P,0X@LP~,  0x%uz   N:81p`V `p+)P 0  0`!L1 0 <0 30GDЍ(5PE P Pp =PBE P0 0 0  0N 0 Lp `pP 000  0 000000pSp`4 X p@-M`@P 808 0 0 ɠgЍp؜@-M@ ((  9Ѝ耜@-M@` pկPP0@0 ) <0< 0  0 p@ԯЍ(0@- MPP@T x 0 P00 000 T 9 @ Ѝ0@Tz 00C-@PaM`P^ Uf !0 `   p0S  H  0C ^0 .SQW 0@ Ѝ0 XR   9S 4 @ pG W 0  RU 8 <04 c#!$c4" 0h0h h0 m UL0L L0 n @S   t =L =O-P#3 0,M@Q`0$00 UN Pj PX`0:V000 0m Vo @ß0 0 P @`0  ᖞP ^ PUY @ZpWP  p$`WJ(4"<00S W0G@ S0 s fP ᚭHHrH2p04 JᇬV VV / 0 "1 0 $0 30p,Ѝ!1 0 $0 30e,ЍO`:V@ p 0P :ZBU8 0S 0$ S$!, `P$$$q p 04 I8U V V 0@ -OT0@ 0$ 0 0@ =0S@\p$`j `.V0p$`WP\QWh x x ;$8 < : t<:@-P!1 0,M@P`0$00& V.  00  0 p 3P* x 0 0 $0 30,Ѝƭ 0 X0X X0 h㵫V<0< <0 i㫫Q t9x p 8H 8O-ptMT%0P5 Q 0@0l00 W P P/ / 0 %4 0 l0 305tЍdT4`P0 IpTx T 0S4 0c$4 0 Z 0 4$ ( , 0 4 8  001@ R@0`S U P Q 0S0@S Pt0Su00 Y0S @\T<000j0:0@0T0` 0= Zf 0Sf* 0CR00_:᠗o"2 0 l0 30 tЍO@PPUE*0: T00S Cl"H0 2[P3@T` 0Z00S RZ  @T`0zu YPs S 0 S P0@o Pb0SD: 0 Y Y Y@D!0Q 0 H P )y8 @R0`P`P0 HlW Tr T0 auA@$0[& + TP'p 0;/qp 00P @ P 00 0 00᫟Ѝƞp  1 P0 Q+ L WZ p  01P 00 0 SM  00 0;/qp 00PPßQ <PU;0 {0p ;/qp0P r 00 0PUßR <0PUß`X0p\ Rh00cX0P[NS  00Q] <P800CPU0& Z  "  RPLP0Pe? P ;/qp? 00  P @ P 00 0Z 00 bP(0 S%: PE u AJ 0C09PPT 0S  0CPß<1Sc B P_^p0Q ^ QC Y(00H0S 0Q* 0F S0S 0 `  0AS"`!0@T`0\0Yp 00-(00@$ЍAT{0S@A@"@pZ @0Ġ?  0^0A>Sp0pS000^ 0AA^ AN[ ^( SQ0SP9 Zp? 0.$ @C /Q R 0 0R/꾝00@G0?Q0S 0 0R/⦛~ Vs*p*Y P HP @ @0@ <-0AHB A A- `0 0M P0 10@0 (qp 0 p0 (0 0 1 30ލAA ck p>cP0 0 ?4APp>c00DY00XS UPpb 0M00XS UpbPPp>c 0>U0@PP/@ p>cP433 , h00M 00ЍL8 A-`,!(1 0rMPPp010, V4 @X0^00pAtA0O0 TA0Ό`p 00`L PP'0 @t0 0 1 30rߍX0X X0 F㵘V<0< <0 G㫘>8 `7  `p $$0 M000 Ѝ6  -- M0 0 ЍЍ/-4 -M, 0 0 Ѝ Ѝ/P6 O-@SM ^ YXd 0pS000!R !3  PP E`#3`9P*Q30A 0#1#2#4#8 < P:   <0 A 0U0 pQ QP 0@pQ 0S  ЍT000@00808 80 @ 0000x ,A-@`Pp㶍0 yP᷍$0$ 0 M Ѝz3 P0 0p@-00St@@@pdddPP@PJ@P 0000 03 t p@-P@ᰙ p@A-Pp`ᅙp@p0@h@  U  }5<0   A 2 (|96A-P p@` F  000 a@P p@-@P僔Ppp@O-M@b@R`PX D$B@pw r@0p RD 00nd 1P[ 0S` P U [0@Z P 0@[P 0`V P:Z 0S@ DqDDp P #)-0PS.0%0a000S 000  000 000 t000G P00H H0H D0 ⅕4tdX A-pP8  0S@`$ 0`S @0PP0S `V @P 0@V0*00 |\@ 0@ P 0 000 ,0 1T{z 4<O-RlM 0 04 吀0 R X $`000Sa# 0S00 #3 0 4 4 0;P Yژs嘳3@0p P0V^ p p @QS  QN P0S h @p $ 3/0  0PY@@RPJ00SS" 00C0T@lЍB@@@0|20\ 0 00SN  RHH2( 0 @ (,0 @p 0TTP 0S 0@00D00 0@0P 0 S PW @@p(0pS, @ , 0f R7 1S@X$$1( 0 @ (,0P6 0 0( &90S X 0 0( +@lЍ 0 0( @X(  (,0!( ty$ yPy@ px ,x\ w| , vț X $b\ aC-@"`<2 8Ÿ0M000P/"b1?2cQ 11QAQ@PϠl R QE00å?8@  PP 0 0C@aa0C0C Cr  \\.N2?#c!!"N . ! bQ.5:bQ- 1p.#c!!2N0 ] 0@ S[ 0Yv0 `R 0o S `k 0@ E``0 S0C0  B1=Q/0A!b0\P  @YG0 `R 0@ S 0,  B1<Q/0A!b0\P  @Y'0 `R 0 S40 @` <Q0 0\P  @]Y0 `R 0 S0 @`t;Q0 0\P  @5Y0 `R 0 Sd/1 ; b !PQ0 0\P  @Y0 `R 0 SE:Q0 0\P  @Y0 `R 0 Y- t80 @q`@0 @`9 Q0 0\P  @Yt0 `R 0m StQ!/ b !P  d)0 \P0  @YT0 `R 0M S)Q0 0\P  @Y;0 `R 04 S Q ((0 \P0  @zY!0 `R 0 SUP&UP",(Q0 0\P  @YY0 `R 0 S7Q0 0\P  @AY0 `R 0 Sp040080 0<00@00D00000 0 P0@('\P Y0 `R 0 SJ 0@K0@ S0ŘY0 `R 0 S3Y@t0 `R 0 S$00&@2?2c  1R11Aãd0Sâ/c1S0c05\P0 Ym0 `R 0f S 0@0   0  900 S0R05`N0045\P0 @YB0 `R 0; S0 @`-0\PS004 0 @xY0 `R 0 SY@X0 `R 0 S,0 @` 0@S0 @ 8qp qp 0 @Rdp3 0S-Q LS@ b83Q< #Y"300"bLR YD `Q \P Y0 `R 0 Y*0 @r`0@S !YI0`Q0| R`xUQP 0@Sp P  P Y 0 S `Q0PX0@ @`O0@ Sd 1hYF0 `R 0? Y0@ST 1Y30 `R 0, Y 0@bG`122d3c@Bz:E.€Q_uk9"mnףp= ףty Sc$IųQ\(\u t Q)\(\s c 0S0 ):60 0($0(>! 0)Q` _P!!!0C0 YÏ(" ?00 #2>PVX c 0% ):60 0($0(>! 0!‚)a!!!0C00!YoÏ(" ?00 #2>[?G'PE@@Gp1#! +"Q 10,U#1 ?0 25:$20 #4"".<2Q D2 30 #1d0T\`"2? B4sppp0/SX0 is c 0㻆"):60 0($0"(>)Q!!!0C"0Y_("Z0%R^PVXPo`v c 0㓆0#&: 600+$0+.P3& 1110Bh#`V:+"#2 >t3P0 PcRP@ U0#V B!a!b0CX0 c 0Y$):60 0($0!(>@$ 0‚!!!0C0\$)YÏx4(" ?00 #2>0r/D B  1?A1c1c0R@ 0B05@ @ 502c,%2c2A@" "b1C S/  0@ p0\X%`;#吅  00u!ό#1 W?0|:5&  +4Ϡ! 5+111A V 1# 00! C2 ! 02">"`V0t&`000  @000TP@DP0S@ @0 @ 0$ Ѝ& vc 0 ៅ'):60 0($0'(>$!!!0C4'0Y)("0,".L<0@0P<0000' 0 P<0@0PT 0 O-@P`Mp 0S+  U 0&ZP? PŸ01# 00 0 Q 0  ! P i00Ѝ0 S! 01P0 U 0UPz? !01#. 0!U00 R㨡!h&0pP l6m&NR'0  Z0S  `*` ϠϬq^Z R pS}$ $  WPE&@@$[i( V.i5:IPI%^ 3#adO0RS@HXEW``  p x@F@Fp pX%HpH@@H嬘@'Q_Y$AXO@P1:H.BXN xT3#dPPS@X0 p0HP@1S\p WPE 0": 600,0!,>00C|0Rh?#00 nC1( ၢᡍ $ 0R0`&^ `3`#`a P p WPE  Uʰ6 00c\S;Q$0(080p P`P@Lp40#XTv YV V0eQ#`? 00?0S 8@<V 80<8`<  05/PT `0Z\ QAX Q=T Q9P Q5L Q1 p0pS P Q% Q!S, Rgl0Sd Q 0 SJ1F P,Ppexp0S  BrI00Ѝ#XTxt[ @8@<8 <0RwSR SR V@ 0vYV? `V8`080+ 0A +PW 0P㧮0p Z*Z:Z$4Z4*Z\4E$*Zo#Z1 "*Z$!ZZ$ ! *ZZ *Z Z$Č*ZZ *ZJZ$Z`*Z *Z$ Z*Z D*Z$ JZ 1\RI}QG*1YE @ $"@ @$$  `,@T7^E 0FC 9 0PS-pY00ç0@T x)`9 F0 0 30EFۍߍ0/S ;0BQ 0R/S  7P  H@J00bP UU PS PRQ  @3 `4ODp$(,00U; \0 4 Q"<$1^p) ⁑YN R`!X@0( $ \͌Tv Q0\ \0$0\4 \$!?8:Z Sd0I08*S R_ R_ P 8ZCPR L|p@W P 0NE+C;E?.h @a0X`@@X P0X00 @PW a0兡`rP  p^P0/SW0/ST, P)0/Sv KF̋h R Q R RRRRRQ 像BN h $0 N$0 h    $Q(J(Ph@ P ` p,00(0S- \0 4 Q"<$1YpV QZ$`P @ p0\ \04 \$0\$!? JZ (P,00 $ P F̋S n"1 R 0oS0" !0S  0H0B 02 0SIL01 R  0Sj !0S R`@2dn01S oPW@0W.0 S -<=0- @0 R s Q t̔<\07 0 A+- h@0PbTb``U0SZ0@?`c0SP⅑QPYP }SCPPA@QM0`0 RW@ 0# C !p@pP  /B 00Nh 0 0P0W @0|Y T像B'<02$ ' @ 0 Y hhNO-|M0P<S 0@S >S 0S >Sp@0GS@|ЍS*S0S -S0 C R0p@0GSH`P Z 0S0ƒ 01 "hh0倂 [ OX1000\11 001[ <[ 0`S0S >S@H 9 bN h&lpt h P*[[ -[00K S@JQ@Q,Q ;Q^HNL d ;Q,Qc QwH^(- P m6Shi`@019mo\@ `Ko`PhiR`@L)apkhtlug.  N  @h@ @݁ @ P 1 0 0V1  0F|P00 P ,R d0(0P RH0Lch`pugtl& 0 0$` ش؄`$, p!bQ0:bQ, # 3!d "b"ba/ ppcWY0ht[Q0` K  4L tP  Q3K`p#0 ă `,p bP#:bP # 3!d "b"b#/ cP`cs \pP  0@#\+" 4#0#,#` !c  ,p R 0 ՘"0` D 4p<@@ p`,8@Z"28#!BcRf:|"cRD 0#031d "b"b#ZTV 0@S 0*XŸ Ysc Q,  \Gce Q!Q*S ?0101c0 p/ 00c@`(0X$ 3$ (. ! 00 Z  Z0`Y,<@@ g.f  0`,<@l HQ B°!p` TN )\(\ ף{8M P38L A-pQ@Y 0Sl ɀ001N  hh6l6>`P3`P 0:S  cP `VpFPPU N hkP0T`VNLg@`_ S T 0:S*S+0C013ZS@Sa0CS`P H @- 4@4@P@ vG 0 00P/ t,0, 000S  J/d t`} P/ ?4} P/@-@@ @6@3} @-\FPN<h0(0Ѝp ! L3/L2S @00P2S T? # 3T #0R00P0P@T@@P20CP2P2SU PrU Ѝ\00P2S `@T 0400P2Sܱ̱H A-l!`h1 0M0100P0Q0S@P1 V9 T@p`0 80xq|qQ8OT8@D@@@΀TA `pP1`LPP90@ 0 0 1 30ލp0p p0 P'xVT0T T0 QxzT 0  ( Hpp- Xp(KH- 0p0- 0 M Ѝl @ - -M00$  0 0 0 xЍЍ/, 0--M0 jЍЍ/0 0p@-@PXm`00CS`0p S  P X0` X PXmpXZ`ꬳ (\ \0 `00CS`0p S P X0 X /X ; (-40- M,0  Xx ЍЍ/ᘲ (-8 -M0 00 XЍ Ѝ/P (G-@SpP] 0S:X' (S" WH !m0` V V,* Yx0p0J000PQ`JyT000@00 `pp`0P/0`VpC0 00 l ,x0 0SJ 0 00l0 0 Qw0 0 =wIsPX0X X0 v0 0Cl Is7() $l|*) lk( k--M  Ѝ Ѝ/ -- M0 0 ЍЍ/@-PPaM`@8 .pP& k@P# [0P S00p@$ 0,0 0 ( 0 0 ЍUx0000@Ѝ 0mЍ808 80 >v| 8HLj' Tj@-@P :l 0#C@>l0 0 ;hv'& iR^@-Fp@-@QPJ 00!R ! 00! \ P 0B RQ`' Q0AP R 0 U00SpiP#iP `iP 0\0\ \0 Wv 00B808 80 <v x 00hL% h|&% hA- R` P$@ R0 0,°0` 0  a0R00SH PA@\`20[ 1!pP  w0S<0[ 1!prP  w0S p w0SB0[ 1!pT w0S,0[ 1!pE[O[Mw0S0[ 1!p4 P>   w0S pT 0[ 1!p@@PZ@P"Z P PP 00B S01 00B 0B P$R w0S p% 0[ 1!p0 *R# 0B Q@ 00B SP i  w0S  p q  w0S op  ;  w0SV0[ 1!pw0S Rp 0[ 1!pw]0S0[ 1!pw0S0[ 1!p~wR0S0[ 1!pqw0S pw40S0[ 1!pXw0S0[ 1!pK pu pn pgs R  0 0pZ  [@ 1, pJ pC  w0S p6 0[ 1!p  w0S0[ 1!p I w 0S p J w0S0[ 1!p }pD vpp T  jp$ cp \pI Up)_ w0S0[ 1!p] w0S0[ 1!p , wy0S )p 0[ 1!poE w0S p$R_0@' p7 w60S py 0[ 1!p@w0Sj0[ 1!p3w0S pXw`0S pL@ wC0S p? 0[ 1!p  w0S p* 0[ 1!p p P  pC p pD |p P  0B Qc@ 0B 0B P$R= w' R 0Z0p @0[ 1!p P  P  P  P  P  P  P  P q0 S p 0[ 1@!m P |$R@00 P q P l} Pz gx Pu bs Pp ]n Pk Xi Pf Sd Pa N_ P\ IZ PW DU PR ?P PM :K PH 5F PC 0A P> +< P9 &7 P4 !2 P/ -! ""  P( & P# ! P w0S p 0[ 1!p P  P  P  P  P O-oMMD @/0P0? PL@0060 D0S 0P00!R !0s00d00 O 0SL   RR l $/0 0 D   ܰ00040, h0 \0 0G?@$匰H `00@T `%T @T0PFU~ 0pJ0(0QPPu pT 0P `@r01(0 `0 0EZS00POdP3   R00s D0SR P=*X1RRrXOX`>pTQ`C.$q0N@Q(8 0<D,TPDDlD PK`P `cP` `0@ 0@00300EpPqp00E S$U (pS1 U {UP \b000P$|0 040S 40倠0@0S 00 00ZZ +; 0 6 30  oލЍUY +;   0o@U`Q pQ@m@PrXT8@ 0P( PR00S<00儐0 BRQP 0G0^0X@DTg L 0 R`p0 1  ( PBU;S<0 0000$@T0S{ awaU` 0 P X0@ 10, S000SL0100 p | L0x00t0 `P x 0BH00?V0XH | r !Sv 40S <w0P40 ,pt0S-0r0|080s P00 00$ . 0 R +0    h   d 0 R   0|@TL H  4 pC @s0<0\0 , R MRd  d`0!"0 , 0f 0dppG,Q0 `bSdp`F00dppG`pG,,0B<P-0  P0 St [000P kS0 [000P`r0Sg 0rQ00[0PK$LS [0P>$P400NS `Urxn`0P@p0X@T@8@@0S80Sp0pS@@X%n$p``@HX 0\`0S T[000PHX0 t0P0  .@  RZ ,0P 0P0 0  SL0, L0Ϡ 0Sq-0r00S P @,TX  쯟/s@  XP@@P@T 8pUT`ڐU@ PEI@D0Q 0T8 BXX ڐ0Q@0SXpApWWڌ 0p`P@JZ R Q Z PYJZ$@0P` pT 0^p0_S0 Z000P5$0S*0$Zc-$ @⌀JZX 0R@0 S cZ000P 0 VZ0P$u-=  0h ,<   0hl`S0$3R ,0PV SL0,  !00L P, 0 P  0.S0 Z000P$0 _4`@X0T0@010\Myo\ { P8 @TX@ `""   . B Q/h;2#0/0 0 !.BϠ # *@ Qʯ P  A0F,FP# 8 `P QP Y <N8""P 8@N@8@ @ `N, BP(Q B JQ/P2#΂0/ 00,# $!L Q. ! A0  @8ϠBP!.u|)|9|  0t "gx00CH0 S0]$0 ,, s 0< 0 <M,dp\ ,P`pG`, @0mj} ^G ,  r0RoP @W@  a R ,0PϠ? 000SQ8+U;b ^E ,0r 0SϠP SL000 ,pL0`p, @0@jM ^ ,  r0RP @0PSL , 0101,0@0pML ,0&    S ,S09$0+;% ^ ,0r 0SϠP `U0ڌf`0p@P0rXT8z\0S 8  B0S0S S0p\8 TX@_4`@@e`S0$0S  L000 ,pL000e`j S! |0s7 H00S0$051SF 000S00G00$B@ 00 ER0 nn"!  00Bh00?R0ST 0h Srp@p_4`X@T@8@PPX0P$ 80SpH0pS@0H00$0W000P W000P ^ 0, SrP  l PS,L10L , SL0, @@L0,p0^x 0S r`P @^a 0, SrpP ^{ 0S r` R! ,0P1 adR  ,Pw W000P *{W@000P !000 a` Q`&  .! FQ 0#e 0 M 60 c`39!\MW@000P S  L000 ,pL0006W000P L0 RrL0@ L0 R rL0B@ 010h0X@Tdp@pG,t& & #  1l030P" -X-xX*) %   `( d D8\h>S 1(0P`tp x0@ RppS 00C?@0^S$0bt@d@pp$p⌀@DT4 0Rp0 S  V000PK0 080w_4`@X0T0L000 L0qPSJ V000PB *!0  P@0 |@_?P P:eP 0p@B 0 @00L 0L ,pL0PL0L0 00rRL0X0 P[L0P00L0#bL0 00rRL00 PDPD#D3D 0L cx00CH0{XP8p\V`!6L0L26040e 0 0SL0,L0 00, H 8 BR@ d@`gU 0P$L0 RrL0nL0 RrL0/|$|4| D 0cSl , ,p1h > 00$ Rv ,P1^z ,0r`0S @I^j  ,R!r0k9^ ,0r`0S @1^;  ,R!r0<l@@L0PL0 >AL0PL0USk|@$0O,&,6, 8 0"cL0 RrL0 dL0 RrL0L0 R rL0P @p &6  0bx B0?V0H  @ S,L0L0 00, 0D 0p 0S#L0 ( L0 L0PL0Ϡ&T 0P|@$4L0 RrL0L0 RrL0L0PL0L0 RrL0L0 RϠrL0 @dL0 RϠrL0W @W 0@00V0X0T0+0S* P,pP`00E SIpqp00A S$Q0!S- 10P`Xd 0 0C  S,L0L0 00, 0D 0pfS,L01` `0,, L00D 0pP 0SL0  L0 p,Py겔@-` MHP@pW<0P000 PW Ѝt\ A-@P`pW0 PWO--@0pj/ 030P   O{(0:j0S 0Q0Q Q p 0S0$0G$&R00$0?0!**R8 0P000$02100@0S@(@P5 p0 0[0S0SU $G00S Y Y P  z0P0 4[4 0090 0pG04a^ pl0G040S @(@ 9U Z$01PP000 0009 0 00400@- M@P`:] p 8\UT 0S*%P  (\@#]p Ѝ @@\]p Ѝ$S ]T@p ]@P :#46*0/Q /46*0/P@-@00 R@P@Rp@-P`0@0R@*0Pp@  R 0 R Vp@ !0@<0O- M@SX@DPa`101 06WYq`": 06  R0 R0 W *00S 00CX:X@D* R @  P  00S 0S W0*!1R 0CX:X@D* R @` Ѝ0- UM0,@P.0L10H[k {k{d 0 v      \\P= Ƞ@-@-@-p@-`P@ TP 0FP R @P  [00pP P(0( (0 ?YPpP`p@-@P U`gPP  Zp0 0 :Y-M Ѝp@-@ P` !LNV !@Ap- M2 ЍP/L -2M")2b3c1@2`1  05ЍC0@-@PMP 0 00 0 Pp`Ѝ00 0 ;rYꬽx0p@-@Q r  P p0 S 1P p PP   ! JZ @0O-M`pDG@0D0Q0P+5X! @0S Sj @   b 0P16 P T@@  0  WT` ЍW Qz@ 0Q AX00@P00  j 0`00QB@`VRTQ`p0 0"!` b  V0 ZT@P@0Q=W 0000! @TQG 0P02@0~  000Z"000@000, @g 0Se0T0 2aPPlv"! 0#000 0 0 @ 0j`@Pp !R/0S 0C0/ 0RA-@P'`Bp1W@* R0C@C   XV X@p@p0 `f360@p1W@:b Q PPO-p -M0  S '0l0x0 0 Pt0-P000P00 00@ S0,0s `@ a`0`Ft@00@ STT!Ђ 0 B0SpЍ 0 S0 EP 00Sl 0 $@ < SW ?o240$ 0R0$0jTpg{p TGڬ5j0f1k5ZT 0 S 0SC %0dS{ 0|  pDpW 0Sp ,%W 1  @pPxK |0p0 pLW|0T |0 0p|0  A R8 ( QrpCW px Wpp\ws0p000,0( S|  800S(08000 0$ 00M `۟<0 﫟T˟ﻟ 0H0 0DS?<040 B 0S0$ L0D@] P  H ! %Xx0R P x   !Xp@|P PD0P 0 X$0<0 ( @pC0D$ U00XS Q0Y j00Q )Q 0Ѝ|<^0 n 2>0 00 R)AoᨂX 0v Q>0?0l1 c 0R:j O-M<0p 凷HJH:@`00S 000S 0P0S EA R[ % @E  \  P 0PS8 Z@@@Ѝ @0Q[V R 0 BPS10W ^@0D0CSڣ0SoP [ JT 0 TD\ @N Q T   @T 0CC10B1P0DS0 SE@TS@DTDX`  `R ߰ BP[10@0+S -S0 R: R800BA\ @@!~s 000AS0B[0bZE^ @d\ [ 0 S S80S 000 0 b@0P"00IZ@0E^0[ @T0 QL 0SP00S P3 4^E *@C $`P D21 `2 Q\` T00 00S@0T@DUQVD`b 21 8PE 8 @0T0 T1 T@00@0PS  Z PEP R, 0 R Q 00PS00= 0@0@E GP 0 C0 RZ@Rh@DU 0S{ S SUUv E Pq PP@"00ЍSn Sh S4 `Pb@00@0 00V@ !NT 0 PeS5 00@0saF PeP\  0 S S GO@"00ЍP?0PS- @ l@0 Ѝ80S@V 0S S S@80S000L080S80S  0h800c8080S `T0D  RP!@I0@0  B0 Q@[ 0Q S@߰ P[A1@0[80S@[- Z0b, E^  000@0E80S 0  BR "@w0@03880S P `Z ^  0`p"1P 50PS@ @ p  /A-`0P R#@pn3 ^P 0 W`00 p 0U@PEPT 0 BP `@ pVp  0 BP0U@98C-- M @KU0  B00C2S6cА*ZKE̐*kWzkG@{ Ѝ@-@0AC^ 0S R0A  S@-A *@\LLT D B @ M0"S1 1  !2R / 3RS/00 0 c R\0\0 a c R8080 A c R/$\0A-@T0000bQ1 !0U2. n" p(  U2.0D10C#0R0! 0U U0D1 0CC!S R 0 P@-@M: Q @ 0R Q @ЍA-P$a$1`pM0S3 U10AT !0S 000ṱ 2@T  0S00 0Ѝ  @00D1S@000ᑱ0S 000ሱX thh\ 0p@-@P0p R pPQ`00App@=D `i80 0QApp@] th0  ,0#10/!Q#8Q#4  00/Q #2#01  //1A-`P@  1,0@Up00p 0S1pP@P#pP   ! Kk`gP081#3S412ss /"r3J / R//@-@P0@0O-0Z  @S MpP; PaU* F B  PK  ^ !*0I0C X00 ZP`V 060Y00ZP`T@T 06S @ ЍG-0䁟PpS%Q@Y A@iV'10SQ`P] 10i1000000S p1D @P4 P1 p@T `P@T10SfP@$ 000S 00@T 0C  pP@h0iV0S <0 ,0R0i tqhyG-P`0b@Tᡢڃ0TP$ Zp  }J p0  a !  \2)R0L`0C\0030 `-pG  \`#-0P!1^$23\ *G-`@0P@DT  !1QE*32\ H*@@P`Pp @q!P@0 0S 0S W 0G`WL3 PP`R@ H0 0S3# R0 B B  02NS cP 0 00P` A-@PQ`pE: 0` P0T @ *\ l1 0ET56 501 P56 +C0T `6<5#11<?@-`- M@P@P  46!z60:S W  0 C.G B 50c 0 Ѝ u0P c2# RW C>C0C01` Ѝ00S/0 R /@-p`aM@`PB L1P5PP3 1pP-0S  Q6 p 0: S/=P  8#80 @0 $ 0, ( 0 0Ѝ^J00Ѝ<0T0T T0 EIHKJ00GJO00 8Hjs\(p@-@P =00CS00 P=pP0 0 =Hns@-@P 00CS00 @ 0  0 IGrG8rdqp@-@P8 0S> W=P00 P! !' 0S 3/PP೼000P @ P X00 00R00`aa;=d0`` 0pC:P404 40 8ZG\I 0P0kLp@-@P 00!R !+P 0C 0 0 ;6G4ko@-@P 0 0 S @}:0 0 ;Gjlohp@-@PQPP 100S3 0  US 4000S8 0"$0 3/0:0P6p00P @ P î00< R 800p;0PbL]%:P006;h h0h 0 JF 0 @0 0pH 000@00 <mHiح-Ѝ/@-@^S S S  \0 @k @0 @ohH00 0 @v6@000 0 0000/@P@- 0At @fH41Sx O-@ MM Q 5/0Q PP $d |@ h|0g'( $g* ph ` 0 Pp$   T`  8 X| lp`0 tP  !p$%d),P 8 $10-` (4 td8 T59ċ<= "< # &'(* (+p. x/`2 |h3P6 lX7: \; >, ȋ? $l` ̌+$a(!`+" 0 b"a +4k+b$! 8 ,` k"!$  Q 0pmP4Q 0pmP*Q 0pmP Q 0pmPPQ 0pmP YMߍFOFp,qMߍ/aTQ@-P @41S  P mP0FA-4!@ pPP/1S 0L1匬 @P!公GPPPUQMoPP uPQp CkW Fp_oRFpFppp@-@P PSpPA-@`P] VapPPQ V0E ( Q Q Q Q Q Q'  Ǡ   Ǡ  V Ǡ Ǡ Ǡ  V FPD FPSSO-P M1 Sz$aVp$q q(SSp A`TR X`D ( Pʀ ರ[ `(q^ 0 @P A Ѝ C$oB/0S" (tr ₰^ Q `VH$8 S pVpGp@(VK ($ 1 AT$$(0 [ `(0 A^& S :0 ? @PE@@,A \$Q(!r8 V(, T001000 eC([$;(~( Q 0 0 KC$`@$A a(T夰0 :C0P(1` 0 `sP\ [ px$S`ؠ8`Hvv_O-,M R0  1 rp3/,0 (Q0 P{ @`P@P^$$P 0BZB  @PUpWW 0 `PS @R㲀K PUJ[Mp p,Ѝ 0 rPPu6  $`Mr$`P  0 h`P) @R㲀 BP  | P^ ^4 ^%  iP 0  mPp@ P`@@,Ѝ 0 l@ P@⁠Ằ[ PಐU 0I   iP(A DR 1V(Q0  rP 0@-@ 0! \ @!9D,3D00,1S@-@0 @  $D00,1R@-@1  0@D, D ,!O-`᜙0S ]M9 pPwᚨ@P Uq   @{ C0S 0  p/  ,p  8p4 0 1 DB@ B P XP /V  PpW4p^ Z !3[@ @8([[@47>P3 0Ʉ  D H p $jP00 A G, <0(  QPVY[ gP  0p pt 0~ V% 0S" A/ 1*$ <)$p++ *<(),<('4 '<.0<.,4,<0!4<!< 0!4<!$0 #<$!<($0!4<!(,!4<!,0!4<!400#<4!<840!4<!8<0#<<!< <08 8 8 4  4  | pp ̀ 4 (  ( $4 |($  p, p0 ,0p4$( ,, 0484 48 x< @ < +4  8| + ̂0BP]ߍtŸ 0(01P D qG90! N}Vq QU0 aPP$4Q$厥Pc 1!@A p `Ppp `Pp]ߍAAQvA[1 p  48p D @@ ~@A00S 0ڹA00A@PqAPn APAPdf0aAA^@ Ta t$P,O-@(P`P5f10pSp(P6 R ؑP. ( ,0 [ D`D` S`1005,`5Ojꂡ ߤP ر & J@ &ؑ@-@ 13/, (Q0@-@Q 000 2*A 0 O-SfM `$ [pW  8/ 4/G?O00000 0000I.0%P00KPh0h h0d s=w?q尀 880b1t,H<*@-`@MpPP  .00U' `P$ 0S r?(p0 f# 2 pЍ .Ѝ .pЍ%?00p 2/QA-@M .$4,.,80!<004.T"48<08#80CSP!4< Ġ!l 4 ̌8 0<04 80<"04"80< 0*0(S"( SR~  B("(p`p0#$ 0F0VP   =0  '  P        P  0  V/0 0 0 0 0   0 0  0  0  00   0ЍR 0B8#8P P0#0BR0``      UЍ<0< <0 b< 0(0S"( S8C 2/QA-@6 10CSP* 8 R#8 RZ ,$ 4,,,80  'X e'@P  ' ' @I ) ⴒ9긑0 (0 @崒2H)X) @: 0 b%6 @ 2 " 0 b6, @崒 8#8Y4 X0H 1' '@Pt 1ᴐX0C S㣰):1!0 b51ᴐቐ  10@! ' &@PN  60C 0) / 0H))01!0@崐 ^' &@P( 10CS㣀:t0t t0 b5\0\ \0 b51qq0o`/ol+ llk+|kLj)Xj(j)8jp@-@`PP a0 00(0`00Q(0pO-p@D&`@6 0LMPP0D00  '00 2eV  a700%5 0 D0 30jLЍ0w R*R* p 0<0<0 0@0$0;60 0S PVk 1S6  ;&P䑄/  0尡0 0!00 BR{?ⰰ0弰:1S 0[S P 0弐ᰰ00 00S !& @ P 0崐V` S0! 10CS,*0 P 20 2p(i g0w Qv %`P] 0 p N&P BR㢰* 8#8Y* C00C H1! 0C8 !#(!!#Ȇ 040/(0  0RL 1S RR  RYG   & 20 2 JZ㪠r* *J [f P`N0V㰐0`0 2 f Sc % ~p 0 0S0,004000000(p(01 S0"1! {0!10CSP"*8#80C S 0!{/Ⱀ10 0 b4]0 )ἐᰐ0`0500\0\ \0 b3D0D D0 b3  c|#cdc #tc@c"PcO-(0Mp O @aP0fl0PP P FP i*1X J%8(Z"(1a@%X0  Q1R@@10CS㣰Q* 0K8#8S0C8#80 V !S10C1(0  0R/ Ѝ @Q! R b0 `(0p+  0   PT p 0 0 p1 S0C1ȁ434#40 bE3T? Y4 0I 1pP(00(0V QPEUP*0EY*0 p1Pv YQFQPEUP*X%XPEY Vp崑 (00(0;10CS0I*S @```0 `p崑$P Q $PP  @PAP_(00 (0}$ 1  1 #PPl 1P0CS㣠>*0J 1fP(00  ^$0 0 b20 1pNP(00(00 X%X0 bPE2 UnQPEUP:x0x x0 b2s`0` `0 b2  $j` `t^<^^(^]]]|]p@-@PQQp x#P 00 #Q k#P 0 0#ppO-P,a V0Fo 1S#@P" `Vp0ഀ0  px 10CS08#8*S0SX PiP 1!0 b 2  H 1 Fp(8V㴠(!p1  0 S001Rpp10CS㣰8*0K8#8S  C("( 0 S81#810W10C1 q# R ZP 0!10! 0  P W# Q#(0( (0 b1[[@ZPZO-pP$M0@S  5#00 2T T 300$Ѝ(  @i 0⬷嬧07 0 0  `P`  R ^8#8Y *P0 Pg1 "0C @fT㴐:b 0 K1Aᴐ@DT@* 0H$H @DS0COo0B 0 Zp@ 0S0C@0  P 10CS0T*8#8SXP@ )"pP 10CS0*8#8SI 1 (10CS0@ *8#8S$P "h "cTx*H$HT|PX 20 2$Ѝ050%00 b0T n"5%0 b0 a"T` Y"0 0 P'  0SF ㄔ @`S= 0 0S ;"q, W@  @@DV M ,"q Wv 0G 1!P A`W@DT@:#0 br03#0 bi0 " " s!pPR Pr D3D#D0 bK00(3(#(0 bA08@W1@H $H @01` 1 0@1@`01! X 00 0UXS 00 I;w0. T:+[) P0K/S  000P0: S 0000S0I S0?00(1(!(0 X.QP PV# 4- np!00SY  \0 RK Y  P000W ᯶p x᮶P 0@om뤑 G $ OR Q0P:Q0Q:/@-m@-@@ፔ $ @ D= p@-@P# +P$ } p@cn< d0@-0 M @ 0  @媗P 0S  Ѝ@ ND< O-dM@\0P T 0+0KY 0Y[~$@렃   CBAAAA,Ÿ,2 O- M0p@`000㈀  + !0 @  S P ]뤱  @ ?P^ቐ    @PF +ZZ0 D 0300F P  `P0 0e @@E P0f0`00d X (0 0 0 30Ѝx̀ @D- - - ~ 00@- 4M0P0,009 @T d 0T T H0 0 ,0 304Ѝ0$ vl@`~  - ~ (!(1 A- Q0HM@P0D00 p `gV( 0VJ   p`VV 0V  I :h X0 0 D0 30 HЍ$ +$ &} @, + | 0 C-04MP`0,00,'`@ pW:T p 0T 'T H0 0 ,0 304Ѝ$ ߏd| * { 0 0@-,M0 0$00~ P@ T ` 0T P D0 0 $0 30,Ѝ0$ 걏t{ * { 0 @-pQ0,MP0$00 M ` @T 0T x l0 0 $0 30,ЍP P0P 0 q)$ vJz X) Tz :T:A-pP @` 8M11 X0  P 0@0S   L Ƞ,Ƞ P00 000  0ЍS)!1 0C8##Ȅ00P ` 0  * $P 0 0 0[O-q@pGW|*8#8 P11aP`Fp`5 VO*X%X`ChP0&0岑ᶑ PqPpG p WG*X%X&X00 000  0OiWx'x=*W 00("(RP:Vh&h *V   8#8SP:1 0 0b( 0 0 b(1 0 0b(h h0h 0b}(L0L LL0 t(y6$6t55H55 5566O-,M01P0CS0P0ᰐ/*A0@D8@8 08#8T0-*0S> H$H0D04$00 00 @p`0 0$PY P P0ES(0001P0PP0Yo0V 0@  `PhU&hj*P 0H$HS0SZ 000pxV'x:@@T$P*8#8!01(0  0R 1 S0"8!#8!1!V 0 0C0 1őYP0P 0Ӂ0C00< V*0S 0P0sP@ V@ HB$HQ01Y00 0(0"(Sm*0Vj YPU:|2| 0'01 P0P PP  j01P0 PP 0`TP   Ƞ,Ƞ` @ h0&h@HV$H@TN*8#8 Y !08#808 #81,Ѝ   Ƞ,Ƞ   Ƞ,ȠpGx'x@@T$P=: 0  0)'30 0  0' 0 0b't t0t  0 '`0pY13/1/1x/0P/T1C-Mp`E@P' @PP"  0   Ƞ  ,Ƞ 0 !! 0 04000000 ^@PЍЍO-M@ 8pPPO 0 0 رR 00㲱 1 1`0CS㣰H* 8#8V: ر 8`PH 00 0000000Q0㲱1 P 0 0<0 00 !r'VC@PЍ<Ѝ000100@P4 404 0bI& P,,O-`0\MS0:℀p3< @0‐P(0$  n@T XN*1 #0C8 #  b#Ȅ 0  0 0<S@@ a,^p  8008 00,0F 1Pd `V 0`h0 &h0CcS00 p㰑1 0CS'*0$ S 00(0pP `VP 00 0 00CS001!R p0p  0  00#0VS00 0 IY㩐* )ቐ 0 0 0 LTPH0PH2/ 00W p0 01p0 pp ,0!0 B(S"8110  p"      0<00@pS- 0S 2  0 M   a0S @ L3@ 00 , 0 S<@p    \Ѝ3<S00 01040封HX㨀 *004 1pCx0'x(0qqᰁpHX㨀*0(03<S00 01040封H⨀X(*X 0 08#8S:00H4 (0 岁ᴁqpGpWx'x*W 0 08#8S:00T#(@\ IY㩐i* 8#8V * ("( B``F H 1`01001p@  . *@ $  Z`V<@p "   p    Dl%D xP 0 0 0각HX㨀r*(ሀ10406각HX㨀\*(ሀ1040R!1 0b7$ 2  03 +';@N00t!t1t 0b$X!X1X 0b$*X1X!X0 bu";  91!0 bc"0PK{0) 1 0p1pP01 c0P@D1H $H @U0PE10Z!08#80 !8" DT$4x(0@R0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/000/D @-@P , "@ (" 0"2O-$M p0P`  (@$\0 0 p 0p pP`@ "l(,"$l$" %  0f  X Ơ d,  .d, 0! \ p p P`@ 0 !b!!    !`.  . "  @X!)!   $Ơ c,c,.    000 00 0 0 00 000000 00$Ѝh 0G-1?p@P` @g(X, " 0P0 0$0@`F0($0`2#?V@F?p@pp& 0$ <@P U 0$ ?@PP?`V (! 0$ a0 0$ ?V@F?@(p@ ! 0$ <@P U 0$ ?`@?V PC-@P MP) $ap6?`V&7 )m!`0(0 `!W``Āapa8!#4a4# 0!Y@h  ЍCJ! 08R(@R )@ b=!(`8 5!)8 b/!(`R @-G/ @-@-@P 0 b!@ (! 0"R @-(/r @-@-@P 4@ B! P 0$$L O-LM( 6,p0`00( 4^_~?<$P,< @$ 0H@0@8`8@40P`pp  00$(0 P00p`$P`p,0 4 e0%)'&ɠnj)000000%  &') "ˠČ ˠČ "  (0 00#0')  ,  ! 0 0 Ϡ' . (̠Ì  ! $ $ ,  ,  ,0 T(03`0~?008`@P p480   @0  @$ 0p0 01!  Q!声#$ ,኿+* / 3< ( +1牑 0媃(३1p>ဦ*1砹 1ᅶ>%S 0#] P% #$7$ ᇑ90#  ..YW([T0#P P[T(P  P%0P P P%P 0!(pP00,p/!~,! rp', /!!0 (,#p'\ )S  $( "P p P% p PP%4pP8p p0 4PR8 P(,P]<` 000 0 00 0 0 000 000 00000 00 0$0P(0$P0(0,000,0008 400 408 <0 0<0LЍp@-@@DQPU  0pRPQp bHPPo QBP0P0H @ p@FR Q b,PP;p $@0G-1p@P` gPX? _@0D 0 #@0D  H00H0L00L0`FP`P6VFppp@0D ;  SP@0D *H0L 0 H0L UPP`V P @0D a0 #@0D H0L 0 H0L VF Pp @0D ;  SP@0D *H0L 0 H0L U`‐V PR @-t/G-@PM ,PH8 I `p ` U@ zЍ@-@P 4@  Pk 0$$,R @-</nG-@PM PH(  `p ` U@ AЍ 0` a!, a c,/0@-M0<P0 P9 8@0;P4zP DP7E@05P'7P %ڰ7P 0P0@ 00v P0H 商p Hߍ0700ߍ0?CP 0P@  @0H jp HP ߍ0D0@ 00 P EDCB5P0@ PH A!50pH<,+*)(&}% @RPA@  0@ 00PVp\XGbF^P0@ 00P' 60@ 00P (0@ 00P "H6P H,P 0@ 00DP 0@ 004Pv 0@ 00&P      d0/00 0H p h0  00 0H pt D ?m kige c=@00S,[X_0@ 00P6 E|0@ 00P( 7D4 , XNNdl$ id{G-8M(`pP {{=P@W@V@U@T4 0S !Q4 0S3 Q!-VM W0`c U pq P\L 0 020  @ 8Ѝ0S[  Qq {0 0h2{`" P0x ! ("(R  #m:VW$ Upm P`10   0 0UU0  P R& U  Pl\ P0 0VvW0 UpM 1 P0  `  | y00 Rx000 ҃P0SQ 0Sx Ya @`U] PS`0P0  S G FF \  d< 0 P0  7p@-G0@T 03/@T&4PP "00@T 03/@T\+pH00@T 03/@T$ p h $ ( @-M@@P Ѝ{ 0 { Mp P000 00 ACH-M 0ЍO-@Rp M ഁУP  `C80 S" 0SL: f0  0Z 0"80S8  0Q@0 P 00 Ѝ 2  Z  00  00 0 P 00  |P00 2  iP   bP  000 0@-P RM@PQ    s/ r? DP 1013/Ѝ00 0@-P U1!^ 0C B^ \ L0D0p@-0P`U1!^ 0F BS @\ `fpUpC- MP @`( ``0pV!ؑI@ T`1 `! @D z T@ p PP Ѝ ЍpP p`O-Mq  PpG  0O PU @P U`1`!  E[  0PU0 , ЍЍ@- M` @  P 0 q@pG @DP @PPW : Ѝ Ѝ gP/0@ 0A0SS*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R*0@/p@-@Pp00Sp8PUp4002U!*4080`P2U:~080pO-@R"2 0|M`P0t00] 00S80S p`"X2 0 t0 30|Ѝ4P  i|P8~ 01 0#\ $`0P  8 0 0# Xp; P&8Z> !10! ` 04 4^ 08P  R8P84P@P`0XP:A@8t~ 0801248 Q:0 S P8_~P8|P 8 ` 0pP 8p00lP8A~hP8md00ph=X0  0 @D O-M$ ) 09 @,0@020D2(0S} pWw 0H"4SnSl90Wo 400l0h00~0P . Sd e  S h` I dPP& EX 0 *0h0 0 00 @0S000 R!@Q  :SY 0S c/d Z c/V0 0U X@  0 S  0S$ R000H2S708 R400W 4p\ p0r4040p0l눐4`02{ 0 ` ~pA 0PW:: w` 77's07_U04PP8 W00S  0 \' YPPU PEWY0– 2\8 Q(( Q :PS 0 SR7@T 00$0S  N00@8Q 4Y  [` TpJ 0S8 0 5 VP 0到SqT2 c/00< SG 0 SR@T 00$0S ,0S ! $0(0S (0@Tp 9 0到S c/d g R   P 0 SRPU 00$0S  ?00 0 SR@T t00$ R 00"00#3 0 2 30ߍc/d &  p 8Qc 0 SR@T G00$0S  00@Jc/d@0h@ .rX *2 `0 R(S Uᅀ00*PHY`l2 08`0p4p@|Trp/;|p`0 S ((Wࠓࠃ\^` `0\$|\440 0 8 8 \R \P0` @ eP 0 SR@TF h00A@ @ h3`y(0PP `  8@P@@ ` W x@  0 SR @T 00$0S  @ 껹 -    @' x ` A-P`@M@`@`py000,00(0 00aPyЍ 0 ! ƒC1p@-S@P  0P ! "0 2pp@p@-@P` VP(p0-P@  P 0S RP0/P*0    PP0/0/R00 B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/(!(1@- 0MQ020# 0S0* /!PR*  R @ 1@0Q R Q*Q  Rh `0 0 2 30ߍ@ 40 0 2 30ߍ@8 A $  /O-p?o2P00#R00,MSP NWC  00$00 R 0   00SW 0SS0嘣#f 0 00@C(S0 #@P!  7/ P7/P_ 0S 0 00P`cPU0? E B R Q @F"`B`FV`!V Y*0SE* Sb:P 0C0 0000S0  Rᘣ#R0@@ 0 P   P7/ 0P 0@  ` @U* 7/PX X 0 0R0X 00  0 @0# 0P0 0 XP  SX0 00Pd" Q0P0 S*S: X  QX E ^ @F"`B`FV`!V C  B+7/P  7/Pz 0 S 0SS0#! 0 R 0S0壀S0嘣# 0 0 X Bv`S 0P1  0 07/` P 7/P0H 07/` Px7/Pڅ0`DP 7/ P^7/P 7/P^P$0@ " Q0 C  7/P @0@0Sz,Ѝ! ^ @F"`B`FV`!V  B&a`V P 0  %P 0 C07/PL 7/PPD7/P 7/P~7/Pl  7/P d0@S@8 & 7/Pe  7/PN0 0@0哤$ T P@`c⃰ @Z}* @  Tt@ 7/PlU U   0 Y00 #0Q0 @0@ @0 m(0( (0 l|Dh\- M0 00 Ѝ(R Q0P:Q0Q:x@-麵 4A-SMP@  $3/dp0 : QP0 0u4P4S  $3/000Ѝ00A-pd 4V:@T@T 0P0 S  00 S  0"v@P0`0dp@A A-`M p|@P0: SxuPP ˅P@ P 0 tdЍE00PЍ( $$4/p@-P$0r0" @`Pp$U04 0B0   0R 1  00 0p 0% 0A  ( 0@-SN  00AS 0v4O-S M|@Ap⇁0PS`*0S'  TP [ P0 00! Q    0     Ѝ P@ 0  QP30 0t$R P1)L000000S@p 0 q 0p4 S   $3/ Ѝ o00 Ѝi00eO000Q 000A/0@-S@  R   0 &v0S!vp@-P@T @T 0 `pp@TӔP`p  0S S/P/$(0#   @// / ////@-@ RM`P:Q !S@Ѝ0 0p P Gq @ЍT000@00O-PP X 0S L K 0SH p@ap-[0T B,B R`  0S7*V5* 000&P<0@D0CS0 T0@p@pT  T 1 !,03/P00CS@D03PQQ    D R !,0 3/`Pʼ@00 "R(  0 T`1 `!0PVQlRO,0 3/`PY R 00CS@D0 T@0Tp   P @V`! !0 0C 0   BR @pZT `@ 0`V:s0P 00``F0``G  0Y0C00 00oP   0 0C 0 ` 000YP nd0d d0 G XH0H H0 H 00Z 00V`p@-PP& 0 `V @@D00T`0@T` ,0 3/Pʼ0@00pD0Spp@/0 0 Zv 40p@-PP0 -@t@ -p@^ 00, Pr r@rp R0  R/ S/p@-@P QP; 100S" 0  R 0   p/  0R00  0 0c 0p0 P @P s0 0 $0 ,0, ,0 < p( <$~@-PP0qMp`@* V2 T: p   P0 :CoR  S L 0( 0R  ; 0 Ѝ;0t0t t0  VX0X X0  T<0< <0   }d"2 @-@PR0lM0d00P= 0 C 00  l"`2 0 d0 30lЍ ~0`0S' pp0PR " WP00_0pS p ?PP000!1 0 |: 0S!$p @4PC \10F LL10/R 0 p8{ 0 0{4{{ 0SP ` 000p p00` pp| |0| 0 `SPðx T  D{<dTЍ<p@-@0MPp00TaqV( q0T1S O#q0T1Sq0`q00 UTX!\!R Ѝp@p\!q00Ѝp@p00UX\! X\!0 000S/| t0 0p@- PUp@0p00TQq0`U TQUP vppX1P0X1qq0T0`X1P th0h 0 R/@-@0[p0 X10CSX1 @RpOT1p0 @Kp t0 000S/g4 t0 0 R/p@-@0P2pU00 \AQ\ X! BRX! p@"p`9q00OT!{p00p@p t\ \0 -4M0 0,008 00 0 ,0 304Ѝүd 8 p@-@QP  (p@ 0 0 9 t,@P{ O-M8@@ 00DA B QR cp `> S0T3 W  0p|| p 0`@> p PPL1L!L0 ?I0p 0>00D,00XS W#0p 0 000XS W pp p 0A0C0B QSWpP pf0p 0> 0W 0@ p p0@ p 4333333h|x00M 00Ѝ$ @-M0 | @  OP 8 ,0 0 0 30Ѝ詬d9  0< S0 0 /@-@ ,v0 S 0,/00@-uH0 S8 0 / 00@- u0 S 0,/00@-@uH0 S8 0  / 00(@-p t0 S 0, /000@-\tH0 S8 0 / 00<@-G\ Ht0 S 0,/00D@-3sH0 S8 0 / 00P@- s0 S 0,/00X@- TsH0 S8 0 / 00d@- s0 S 0,/00l@-rH0 S8 0 / 00x@-p \r0 S 0,/00@- rH0 S8 0  / 00@- q0 S 0, /00@-hqH0 S8 0 / 00@-z( q0 S 0, /00@-fpH0 S8 0 @/ 00@-Q pp0 S 0,@/00@-= pH0 S8 0 / 00@-( o0 S 0,/00@-|oH0 S8 0  / 00@-< (o0 S 0, /00@-nD0 S4 0 / 00@- n0 S 0,/00@-07Qm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ / 0@-@P  000 / RC/A 0\R#R! R/ 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/0///Q R Q/U/Q0 R Q/00/Q- S 0S  P0 000S00@-Q @P' TS0 C0 ^@DP \T^0L Q^ PPP 00QPS @R S Q0 S00  / 00/U/S 00R0Q0 / 0U0/Q0@-" S$ @P0C S@ PP QP @\ 0@0@UP0@0@-Q @P ST Q@DP  ST PUPQ P00S@Q RU // Q#/  //s R PS  00/ 00/U/ 00/SR  Q 0/ 0U0/ 00/0/R  -/p@-@RP` R V  U  R 0 p0 0 a8gQRp@-`@P 0S0 000 000S0 0p 0   0f R S 0Q0 0S00/ 00/0 // Q#/Q- S$ PQ PP0C S00UPP-Q S0S P 0000S00 @-M0| @00000jj00d f4 ,0 0 0 30Ѝ 8 -BM MRč dd  X @   P㈆2   H0@- @-`x@t"pr M Mp $( PrN TG <<"  P,",R @$@ P`0 t!1 0 $8 30jލ ЍBn!` @0p [ 00 xB^P.`!0 iL100@A@ 0 0 0 P \ AL+\ \^  \\\\\@10 ą ТGd 0Tb6 b 0 J0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A @@-00M>R@ 0 000P001 200 :P0ЍM000@@- 0M@>S   "0!,03,0 P0Ѝ)00@-@L@L0 00/ 0(0(0-M 0 0AЍ -- M0 0 ЍЍ/4 40 00S 0M00Ѝ/, t@-@p@-0@ ,pZpP]0Pp4 ////// } //1O-0p,MWP`  m1 0  0 (05/,Ѝ7@PM 0S XXX S0 S0S3*0! 00S S( S000S  0S S * RpC 0QW 0020 0 0 0 00t0t t0 R0X0X X0 H@\H4 lZDZĘ//O-M,0< 00000P0Q0S Y [ 00< 0 0 0<00$00%SSppSL  `0p HZR X 9 ,0 `P,@0  S     Q  R0 [ ʄPU* R [ Ԅ ʄ`V* 0BS0C [ ʄ0S*0 H0 H R :  c  \ rSh{- R@0%%%!:0Z0Ņ`% 0C RZ%ȅP  dV0  d/*00  D@D` prpo@pl0  , 0r *X] 0 H R 0^0100 H R? T|P @ T S 00 P  BS0  cP`C 0H p2 $P p x SPS#P@ p`0)  0P  Q C Z'* 0[ʅ Q   BR B0 [ʄ R* 0M F   0lX pp|      Sp+\{$0S P@`0 0P  Q Z 5 4p ~,   S@ 0  d0R\ @RC0?T0SPA`B  0`Sf       +  o P hpe R  _{\ z,  |U P ys   S ǣp@! ""d    S       R-0 P0000pEP`@00  BR B R) R. Z  04P4PP 0n  BR B  [ʄ R* R\ [ R   RR R f        BR B80`P@000 Z0J0@#3 0 0 30Ѝ     |@   , 0  D @A [  y 0 R*' `  0P`@ 4R PP  6 @. + @( "(z  "@ (B(pp-\A@@ !  p   Ps 0 0Y 0 0@    0 ? pT0  0<֟pH DZ4ZWP``UW@0S1 S qP l P;O-_M M0*0: 0@P050VK0UU: 0P`p-, d!0  d!5. 0`1q1110QPP{  0πʏ yp d10 d1 vP% `P /S`0SH _DPL p\ S S00 PpP0S SR#3:0 0CQS0 0CQS000008sP ~?0}o80 0p+0t2P 1#S;S 0x(S# 0l(So 0`(S> 0T(S 0H(S0 88R00sS1 S S0 ( 7R1 S S0S00 S S SS@@ `0 R_A00P@0Q"0A'A+S? P7R1 S S 00R00S 0P0 S S00 @@0S S p50@ @@@@@00@00806uO0 %0G ?Pd4P R`P 0$4P 0R@l @L0d!S 0 0 2d1p Qp @|^1 |rp x0ό`0S W`0`SHPDHp .Sp0SWP`.pGWV 005P $ +0$00t4 0 5 30_ލ Ѝ4 Rq W W Z|$| 0$00  (,`` V V` VV00;V0SJ`V 4 @0p ;V  00@`V  MPP 0 0P 8 Q$h!=P ``V;V d#0 00@`V;V  0 0P 8 Zl`(,`| 2R1 S S0Sq00 S S SS@@f `P SQ _AH P@`0DPS \ S S00 QP0S R:0 SQ 0 SQ000004;}__P.P `Q!0x3!|3p dDPDQ La`8qQ4`- dP 8 Qh!- qPC-k`P@9pZ2  H Pꂎ 6xUHUL1 domasearnamesortoption Tin43ertRpPP8{ list  chLLL p@- 1hP@lHMP ^  T 000HЍpp Qx#r c}pV p !X0x0 0pPT $000HЍpX~A-P RP@0p`  R  @P  R0`\ R 0 0O-0PQM@0 X4X0.q0P 0 pM0P0 (P0$   @  8P mPY& RP  0 !#Y㴰pGj 0`P `P zmP ` R YP@Z`V% 0 0 pG`Q P* $@P@  a Q `U pG #Y 7[  0 \O00`Qߍ P $@0` `FQ*$ @1!0 bZ  徟 ` 0 Q0 :0 AQ1 :@ACp㴐R F pZ@Dp p$ Y  2U @D ) (  ( @DpW  Z   mY  0  N0 0 0 ~ 0 00Nw S 0 p& HlXG@0@ 0@-@P @]/ 0 0po ! (0( 0@-@P+00o 00/! @-@P @7/00o @-@P 00p@-@PP  P 0  p 0  0 |Dp@-@PMP. `0 0oPP0 QP i7PȞ 0  ЍpЍp 0  Ѝp( (0( $0$ M ,C@-`PtA M@J h!h1 dQ0 Pp 0 RpGS< `Pp> ЍA@kP 0kP 0S@ @R kP  A0

0ഐS0FI S)0 0 B B0V F B 0D 0\ Ƞ.,Ƞ0P0000 0@ @@T*80`F0C@J`80000 Y 4)G3$ $0$  0T0G-`M( yPXPpL P;S<03%R @@zz0 L l3< 0 >p P4,0SJ 2 R ,  0#, ##$\A A0AW@U00X0;(0H8#80ᴀЍP009\S <0 PJ,0S0S !Q #$ 000#$ P0A 0S$S8#8 C( 0"( 0 0 0  Xx0p&@0@y @0@P P0P 0H 0O004 t p  61Sp@-@M P=aP8 0P,000(P8ЍpN?Ѝp/G-P0"M(2M 0` p0 002Wpx @^ 1 R2Y< *5S0@ZZZ 0/, L. l3.<  0=pE WO\!L1 0  0 30H؍ЍU8 0`J8 Ⴈ8000S   "4<Ġ"< ̌Q0Z0 "Q Ct7p`@0Z@0O00|1 1 O-P  `X<@P H1嫲p0q1  J{08 10000N`ⴜA40O-Sp M@`0S0040000 PD $ 0B;110C0 X0M ^ Q 0 Q @0 SX!B! 0PR|   R 0S  "  0!2#$ S C$ U@  UX SRRS5X%XpUk 0 Pc 000@@℠0ᄐ000ಀXbH0PIᲀ0@ ЍXD  $ U D ^ RP1 PD D00CD0 0 10CRW  B Q" 8#8ᅅ0X%XP!@ 0C 0$ 10C0S  "0e Q 0S 0^KPM Ѝ1 H\00 0  0 q@0B YPUڬ0S 녅0P!D PD 8#8TPU PHD充AD$XTL|HO-M@P`V 3pQ3⾐ Yj*W'PP @`V Q0p  V\Q  Y 0PPЍ0S `0@ 00S#@P 0S 00 000S_ 0P00080080ЍO艕 0008(8q40PЍ0 L0000[ 0p 02 0 0C8#80  0唼 [8: 00C0+ᰰ  ` `  0 Y0:0 I0ಐ00ര | |0| 0t0 0\ \0\ X0 0D D0D 0 <0 0Hpq$@}Du 0A-% !@ ::`0$0CQ @3A@D$0@N0qPW T002!@$!A艛pP 0  < 0a WO-@ P 6UP0tM p 0P(0v 0  P4 n (X0%X 000 00`0SHH00@0@ 0 \ EP) λ  I  ᲐP R@ڴ R  ED @Ĕ0I Ƞ ,ȠP AL  H+P(0 4P`@AH$HQ 0,0080X0$0<00CS@H$H@0S*<0A0A8#8 @YᲀT@0:0@I@0, 0ഐ0{0P,0 R 80S* 80<0 ,080 RD*Q^P0@00Q0 00 RPP ` 000@H$HQ<08#80 ᳠Z100S B CX TP\'0S$0Q0 00 R 0P 0R 0 $0K 000 $PBQ0b80S 88,00`00 00 0 P)d0 0S% `P0U$0 h0`S,0 80q 0B8#8 Y@02:0 I 0( `ഐ0004 000tЍ( 0,0800 <0S80SㄠB,0x800 <0H\ \0\ 0L U0< <0< 0X 0ܾ, O- @T1T@0 pS0P`@D%P : Z9P( [  8#8R40 Q 0 S(!$10$10 10 0S0NP 0 P0S 0>P  00S 1$10$1y00O-M@YP000X00 ``FV*:S 1 !*p `p pGx'x  F0 pF000H00 B 00p0@000 ``FVB*hY0&hR Vp `!pGx'x ι0I`h&h08#8አG0Zp01`*0ಠ0`0p00TPP' Y```0S`00F2"0 y02"0 000S`00FЍ``FVi*hX&hR LLL2 0 0 00000``FVG*hX&h9 Vp1p!8#8 R0C8#8p  ` `Fh&hN0Hpx'x08#8ቐF0Y`01p*0ಐ0X0`p00 00PP @Ѝ0 u00 0 k0 0 b0 0 eY00 0 kN0`t0t t0 bClDh8к\8\h8P G-0p`@PRI 0S 0ӖU@ {TP5 0X RK R Q00S00ô0000 0A8#8R0 BY001"*("(00 000JUU800C80| 剐BY001*d 3P P0P  0D 0R0ಐ BR O-` @0 T @@DH( $HR1(PXv0P(  M`JPP# @0T @@DH( $HT pW  T P  OPPPA-`P@0T @ Tp Q Q\PTG-@P `R  R  0 R @PR#  00 SᲀR; 0@S \> R0 ȕP  0 0(!S$! 10$1\0 ᴕP 0 㼐ᲀ@p 0p 0 S 10@Rx ἐᓕ'xP $10 $1(!00O- @1T@0 p0CS0 M@DP`!P 7 P6P' 0 0 cP 8#8R0 @ Ѝ0 0S0GP 0 0P000@- M@ Pp10 Ѝ0O-@Mp 00 pH`pb   PPM0STD0Z 00 @@  0 pWO0 @ pGW 0K*0@p 0@000S  p0C8p#8W㲀Ḱ0=*0p00ᴀXPP D0ZPPЍ0 ᷔP 0  0 0 00 pl l0l h 0T T0T 0L 0hf@X` }@G-`"2 00M0,00w?0 @Rpq2SP:0JSM P P崀2Spp1!pp BRJ:0CS㣠o* 8#8X * 8#80C 00C%1!0C8# ∀! #(@ 2 0 2ccX2&O-@$MpVa6xTx$>pd4dD0q$4SO 0! 0 0jSpC  ~BP b0@S3S103 333 $$3 $ $3  3 $$3 $p3 ($`3 $,$X?<3 $e8 4U$Ѝ $40$0($0,$0$0 R20`V! P  2RUPP(2 p000Sh宄P\R0 p0 00CS0z  p` RF(4S VZ  4S8 0V$0R0S  2U6@) 0@ 1000`006@IU0`00 c 4S !LU6@ 4S $`p ` V V ,4S ^`p I`p4S VM`p -|`p `000 ^r`p V@?0`_jc"A dX+&L:&kI-2&dX2&1&d9&,p xXddO-@Mph``TP4 @@004#439p: RPGP P F`f0@ 3 hP>  2H@ PPxPePXP dP0 02@00t0!C!-\\ R0C0<20pW WT  R/ Y |PPXPPqT! ``P "  }PP* ᲮP"0SQ tg|YhqPP Sp@`< V|%,1 B R 0S V X _ 0S X  R 7/P  R 0$ 4 |$ 4 \YPc"be%A I-X+&seeeeeA XO-yMP*_3Hx0`00 00( ;p8`K[( 0RJ Sp 00 0 T{vPePRPGPaf0@S(H0@ SaP0000 0`0 00 `00``0 0`0` 00 `0$``(`,`S7 0S 0SZQK 0aQ4_Q q'ܶ P M6pP/W  0 10S Rp0S &0S0@0@P0P/S Q 0: S00! [sQn0: S 00000#/W00S %'{0S0(00S00JpW   #0P0J `50 0"n0P @/P05 %0CS0$ `3 m i `p2PP0S z0Ss 00   B R\ L` V, `Q' /0 c 0D0 P@` 0P` J/R  S/R/  # C  R:  ` D/ t3 0S S/R$ 0\SR& LQ0sX/ HL!R\0X\!R\ $X00: S  C C `Q0: S P1: S  : S!  Sm  Se |^ S^ S L0S !_PL,0SJ ! QQE0(尥 0Z Z80 S801!Q pPPP1: S 00Z0S 80X!0CS!80T1T!T]PR X0O e0S !_0S !_ЫN[ (0S0S 0 0 }Pp!yc"|>&A eX+&e'fA ̊%kfԊ%0}fA fefffgMg>&mgA 6ggA ?gXO-P@\X1H&}9p<868V@,Fk`P60Pf a0S0 xy PNP :Qa4P080540HPaP0%/(0@*aPP8XyP0X T5T%HPNP8P H04 0, %43/00000P84 9ya4q 0P01`PP (`P 0 P0 b@0D 0 0cP0; S @,0(D 2#!H8 01/0TP0P( OC@2PP P0*Os帓0 CS 01#Sa`P0 0( ,S* BD"!0 0 `8PU H003/pz0SDfH0803/p(^PP  h`0ld 0 GS * X 0 $03/0  0-Q3  R L-a0 0 -1/ -P0 0 0 0 `0d 0 `0d P0$ ,!p` 0,ذܠ0Z[   P  00h0 l 0 h0l   00 R0a0 0013/s S_ S>_XP\`0O ( (0, PU`00 XP\`> ;Lc"kX+&C N',؎%O'kkN'XO'k`O'X \ O'k[TxO-MM[/sMGw' 7p 0 Q 0  pH0(0`7G@-Pn0@00$0<00D00000$0100000$000,00$0;0H00L00$060(00P00 00T00080S P~wPU R0nR oRP0<0,`P  ,P8ew`P,PPP{ OKRN , 0|5 PnaP`p4 1SzH0S?80S<@0S9 P0SP nP4PD0S 0$, + w P44X(D`尠pXV 0PU 0040D0S aލЍS ,0SP s P㨠=`0@0S0H0S 0  FcP P 3R㓵(F  P3m W` 40Z ZP l3  \I,P TT @0`F40P _MPP gcPPT0S*+0: SXcPPP4 01!P4L  0R p 0e0P T0Sx H R 0 T0SH"D pFcP4T0S 2  YX 8SU # WpVJ  ."  ."  $."  (,." 04   8<   @D   HL  3]P `  `P40SP8`c"O'I-ooHC 00/ P$C@T B0p/SX/sP20 S:PD p` & pc"V'xX+&xA-`@MP DU4 08 kIP  H aIP  H WIP  yH MIP  oHl奱h30d3PPP P$P( <30P+(  P3( P7( P;( P?P(  PP( P P8$@Ѝ(P (PP"'(0S (P(0S (P(0S (P(0S (Pq0S WGP|!0S0S gp T`PLa @1R`JPU 0E /R  &P(wPU  00,0/00_&0 0CS0P0$0v00S xqw0s00q(X2&P((M\%= ]qϘW'tG V'p@-@PTs)`LP PP `| h1ph00SVuPwq맳P Z$寳 0@ Fc"MX+&2&1&kO-MPTh<)`F`pX&61p D6@X/,60S ЍfP WP! PP p `RP dP vP iP00p `rPxP pp0p0p$pxdq [,1@ES ᶵV8e  0P0S$0P`S 0S@ pP܄ 3PP40S p A@[*0/S /qP0.S0S .S0SZ<=4  0  R @ 50C SN00$S P Pb) 00$ @X) 0p0S $ ?RR00R0SV1 $ B)  0SX  P  0!0 0C0~ oFP 0S' $0S 5S 0S 0SGP0 0] 0 04XX  弲PQE0SJP D0S 0S= 0?S9 0SDS ( 00PU F$0P S`0S;H$0: S R r S /o" R 0: SeEP0S  XP SE 0SF ᴲP 0S 0?S |0Sc"(X+&̂KG eXУG-P@R4'`p$!/p 1 R1 0C@pP :DpP vP0p`ꋳEP $p0S hVP /P 0S 0S nEP4#p0S Jc"wX+&(X0@-TM 㞿 70 $ DEPE@FU0E0T0D00 0DP00mC'M3P OP 30S S S" 30S!  R h#6 R L#!SRL3E(3 ! ,3 003 3 3 20S (2 20S 0S'002@T$ 0"P@|B00CS00  0 @ 0S60016 R0S 10S< 0PT<001 10SQ 10SM(t1`1PNP10S L10S h1 \1 u0S >160S 4~@ 1 DE01˹(S   0S0F0S 00tq0Sh 0S 00gP@@To (c"xL%((((((8$J X%`%(%(tI C-PM KQ%b2@@@0 S p hW"-pC 0 L1 0Pl7h DPTw"Px DP<o"88 DP$g"T7 0DS 00S8 0xL@?Q0D0@0 0Q%@0SV L yPQm!a0@S0@qCP dm@@L #P P yP 0@0 00 @L#L$0@0 00 0 JPLyD0S lx :DPX!Bc"X+&\+&Bt @ht@t@d9&[ I-Xgt@-xPoBAO-MpoP$!%Խ@T`@@@ @0o0C?o203#K*p3 X XT 0S9 Z`7 [``3  mRPGPP O`3H@ P`hP dP fP00vP003@0 0`00`k0T 00B0 S; : ]P" @K A0S #S(d<2  ȝ`P5 044#p@P/k0Sw '. D0P0  0pp  CCp l0S<0 0@00tl50C S?0 0S $ p,%p 0 R qX  Pp P    3/P00 S  $ p% |p[p000S #@c"(%mX+&v[ I-[ e(eeXO-M M`p*WlI^^ W50 0 52W5005V900 #P P 숟ѷPQ kA0@6S0Y S~(+pQd QX 0,(LȟS SS 8k05505 00505057 ኷P  ᄷP 7ꐷ pJ0"S lkH p 60"S  p'0"S P 06kp|0z05000001 00 00g0e0c ^< ^  ^ QS00 00055UU " ?Y5S50`FV%R" 2) 0%0;[pPp%5S 0AP80: S0558%0IS00YV05V"4$04P0Ap`VPpPP q@`$iB&%lN(q\D0000 00?$PP#2 ?x@(@t@@ũd0P` s 0S #Pjp@V"cA0#S ?*A ~K0E?o2? ? `V<KBPPf/Ϲq`oqV !PP@hiA厬00CS0 qP Pp PNU0 P00CS0q0 VM!0S:00S:0#%2V51;!1S)1S 9PdPh!iB6&%t'VAP <gP! ^!P0V0<  P(i0`FV|P@+jP  f/勹 <T   P(0 D` [ 8I-!WIZs%X+&(\ ) ]qXȂ(1&6$+ =,xD2&md(P@-(0 P `P@@p@ pp+`00CS`0T A@T ЍX0 X @Y+9(c 1&6v2&O-dM@` $t؄Ǹ P 04 $02)0p$p@DTlUU!Z rUdUd 0>0p@$@/itPcPSP PPʄ+d @" nP tP0 aPP dU4 RU SU" QU040  hpUY [/lUT f+  $ML$ ?p< dЍ $?$ ?ph 828 ?p( 89 8"Y  HT@DPPp`  0`TE\8 {?pL P 8"8!(  p"0]X!  P Q !rh 0P0phTKp 0S@??3x08*]P8 p0PU ,8   P P P0ZS  +`V ?  ?0Pꀰ倐`QI-X+&~DD{D|D(.;JYe}DvX X2&yaratcidO-0-OaM`p22242222322$ .'pj>"42`FS 20000b2p^S Rl2SVV10 dbV%L0 ``p LpP L0 ``ppd2S PS>PX0: S0d2232d2o``Sn`}0 X=WPpn:0S4 f0 zPRP3P/P+S@'P<1@P A@P<P00j000\0 ,2V,00SP T;g<P0d2M042J02G02D02A02>[@ @=>Taߍ02.202*02;/PᙧP000S @+p$ 0 0[ / ᇧPP000S  .+p 0$0U /uP000S +p萝f*0Z2000 0B B(tP 000S 3 S;3p*LZ00 0` tP 000SX"\2R(RX2Y/ .P P N=PX0: S9  PP /P L) 0]PfJ[;PPX U;;;=p X:{\10  [ *;[ !14(S;̲03T 8  <803M,87 P 0@B PR[ 2SX 2S0 0sT  l;pd2SL <pV X!\1 w\1X! 0 \)02T7,2P7(@(%Fr=(pF(RS 2"0g 2PSB`d $ 0   0/2S2 bV/0@tW'@2S)P" :0 0?(@ )P 1!` V!0Tp2<<23S *2hAS``t2S 28$)0 z)P ,~,,u'x)P `0` 0"[(,00!0`,"Q(? 0,! 0 `0("E((N'Q)P j ᵭ`gb F0@T5 @ET @@O谝P` 2000S&TV"0 .0sLP 9 2z 8: dP7 `V3 (:TT ":P"20"0^+PXp+PlDjit1&(@(y!O-ME M-0P 00P`00PPP@ 0$"p0040pV4$+5 ލ ЍyPcP PP! TP& ?P4P Lo:F7@$d0@S0000000 )0 000000S : pPrb00[ 22 FP>20SH )R Q(nQoQ 0)#0|PPu "200"@P'  P" P   bU.; P-Rp@.P FD"D8PBr70R300  1YpWH ` jK/P ጫPZ1!8Zr\@P4\Z?o20S@ +\ `@T jK`PHj/aP8 8p.  $7(>04P`CQښ. .a0C 2 0a8g(I-X+& Li X2&i Pg(Hg(YZ ^56YZ(w(I-z(&"="X+&̷(k !Wli!!!!!S%!"\" O-@MP8@BbL(奫PUPE10ů vPlP,HP1 TP3@ ` a6p@&e  (Dqp@Y0 S U < <0Z@tt _h2m@ P`L" gp8 R 0S00S!0  1 ,0Q E,0P0S  (  0@3P@B00-SG 800$0@ p0喔@P@Ѝ$0W0|1 4?$040P ?000R0Sp h```8 p\0Sү0S 00 0@@`p @$@ P@` r 0 3/p T) I--P@u HPX+&Lu TP+ hP%@-44,$0$00 Ѝ,%(O-@M -P`,@< F8 07`p8^ Vp Qp ^5 R 0ᙌ,0P T4p80P\80l,pdH X64EU(5@uDuIH吅Bh%cp0( 5O005SO 05- + 0(0,00(00 0  EPHPP$[^>zS `SNS7 AS( CSPt 0干0pR,aC QWS4$  ㉣$ 3RD +K L J sO 05N H3 W WpM H $0%Ls0!0 0  [$0S@ ]I 2Wppi zS ekSLSa"m0C S\00rUrSXm3PH0SI0SO005SP L#PL ( 4p8 (0S 0C !P @P!M@ܶ៮p``Bp!? P|!9 Pd! 0S1H! 3/ 0h@ PT`P24 P$1$!$ HR #0 ph PP 0 j 00 pX%(0%h% i@(%8i%X+& ]dx%H% I-Qi`%bi %sii ``ii*:bigڐb iiiɁ iui jm@-QP ]@38 (@-HH @<<,0400 Ѝꌞ%(X(D@-HH@<<,0400 Ѝ%((@-t@t Աh0(,б ֱ(Ա0Hͱ8@ȱ@040DZ0ٱ8αЍ@ܱ̇(% ( G-`M2P,TP&2P0 p) P2\2@P L2HH2<"0@<2P 44'z ]3 H̄p HQ 2P  a@1  p00 @ p0 @ 080<0@0D00 0000P0 0 80$@0P  8c1 HL@P@T@X@\@HP¬ H㾬111 0400,0( ,00@@0Pp¬PPUPh0PP 0/`Ѝxd(xv:xwx ?x,cCxZx% h<x(O-\FMX6`pP(` 08& p$6U K V0S@`@0VoP 0SЍuPfPFP RPZ 5g@PP0P 0 h[0#S P` $B$00S`  $6$00S`?P {[0#S (nP $$0(0S x $$0(0S|00y0P -Pe2q `2q [2 2` @s0KSq01CP 1 @Q 0cR pR bRJ [JK[g0Y`[J0^00I?o20P00 U.Ux U,P 8 8 0,3/8 RPSX >@00S_ v0P| R00C?o20SV\ _ꑫ0 $00,0$00S 0U00S 0 y0S0P000010Sy1 0S 0儦0 P 0 0 Q0s  h1000T,0 008>1P0S& SR 0@0@0 #  R S &0P(0s  0p10S / 0Z0I-@%yX+&(0 }yyeyXyy zyCzd9&0zVzO-P'M⤦ M@`p$PP&p-p6pp0@DT00S 0C 0T T!qC@Py XG PAU/p`.0S  fAP+ a@P5P5pP50S $PX dYTP %000P00p៥P ᚥP ᕥP"P PpᅥP P( Y}p q\CP\q/Y00 000#0 00$000 P@(PPPczY (P(Y@X zn1 PmP(!hfP( MS@`P p "0 0P@(`p` qBP 00 00$00 0@PSP uSPSP mSP @PP @P 0P!<g@PY P( M@p` P( +F /~Pm``=V!:r0 0&.p` d!d/P0.0SDࠟ00 000$00 0 0P0@(p /p..0Pa0SJ(S'- 29S!S8 1Z/Y R`P'ݍ Ѝ蜔 |X+&((@}+ I-|,7Ww||X |}8(zd@(edAp@-P@;p@-P@;Op@-P@;@-Tp@-P@;6p@-P@z;~pp@-P@p;ApO-nM M0p800`4Pɨ6P 0D~0 P 0PF  >R~p>(0$  p@5= 10>0S=D$R$r R  $t}Bt $Jd<$.m`|0A: @ x0<$0(0J-p0, W`PEB@D4T@@0$0<@᧣P< $ឣP  x< h< $$r $lL| ᇣP0< $0 00 H 0 ,=0 L0(0  0,;0@q W; ;$h00 0 0 \;Z0p0!0 0 $; L080(0 P 0*:$>00!0  0 :(000!0 0 |:,"00(0 0 D:0\:@0:0S  P l: 000X  !00 0 0 :00!0 0 s:00!0 0 eD940X0c 0 0 W@: 0 0!0 ` 0 I888Ĩ@0S C.(0 @PV?ᖢP0@4 ᏢP@ 8(VX8@(ၢPD40 zPD40D4 H ? 0P(0u \800 1 @1 08Cd7@P00\7 000  OH7 G: PP/ P QV0S 0T470 04001<4 4*8T[-* PEU UYx V⤥ ⠥0.` 0 PS 4S<4Y1 H4L$0 V,p5j?HL4P80ԕS $E~G?8GHtLW0.= 0 $?)pp5WLHt4SH$L4R0% 5+pP  V,p  4S@  ?pP = U  FPt%;PEPPX%XV,p (:: S0%4) $R*@P%4MpP$  l脟0HPpWZc$R0 >$0@0p!$Tk = t,0MP,0 r04 QP LP$403m`Tk 40S0X44S.=0@+$R)SR' (8 # *~'bP 0T40SP 3T#0S T4Sh P\3 c(8p+"ŸR H$L4P*`Up 0p L4H/0#! 0[pH2 C  U$0- ;atp~|x z ,0P0X   T!L4HqϠ0#4S 0+?W \ p0$$4RT SQ  W   0) 0p pWS  !S0$Qf +S0$0 Q$ Qq8*mH(bj X+&(UI-!WX2&<6,Ofӽd9& ҏ1HkN%(_v+ W(̉gCzP(ڊU( '. hƋڋ=%Ќ|K  w'5HL$ P,} P+P *+0$PiS0[ 4S$EhP 44崀S04144 0S @4S 0 0@4,4S $4R#1ѣ1,400 (0dUu a)t ])0S 0+cp@% P' 0!d|*;]P`E}H+ DsP9+-XQ :$4+041$4+AT4S$ *$"d0|t*))))P)\4$8: H4d<$4: x00@ 0+)paZ_|zP Z +hPoPN  <{p  T< > 9 +-0( !O-MIi M0p4,( JpP_8`4pGs04WZ hƢ  ¢YaB 4S<44S $$4R0`\((pP  h*p8  4 SP,0S x$0T t$W0 0N $0HpW$ t1SE $$4P>*`RZU CU5l7DPEUPPbPEUUPP6 ('8#80( R&0C Rn ("(R044s04b0|0 0 0 q6T0DV0(0 l0,c0@E H00 0 , 0Q500*0 +0E )00*0 +0900!0  0-00c 0 |0 !@500!0 L 0,00 1 1 40(40SJR00;d$ UB0P0D$?Rh )p 4S 'PP$p$I`P#X P (@P@4(0(00`V Z<000 \p"#7$p = 0םP0 r04 ۝P ֝P #0Q3}p$p4S804Sl 1S !1B0"H 0S8ⳝP (3"$b1p1   $Ĕ!<#:XpX2   Q$ qp1P| c 4 $$s(4ST 0(?W   $tR $4'S  4%͜X0; 4 $$ W  0&0pmQpW㱜X0:S Q4S  0 ရ &0S Z &%!l㇜X0⫱〜X+( I-X+&z(Ch| x%6OӽHkNWݖڊ(F 'g` Ƌڋ=O-GM MP`h h0t@,$p40PEPEUqT@@5P3D04030033I(3 Jp00,p0T3000D30804@3@#7(3 /@ 3 'D2 H2"20L02" d2p"Dp2P"{$T2 p00V02 Wi2 p00X1!W1 `Op0x0p0d1 &p㸐%  4qp0 S D 0Z P0SΠ0SPT0 A/᎐P 0$ 0 0 @x&xD@PO Gލ Ѝ2 X X+&I-`}ߜ.O#Ģ/@O^W-POoO-` -M@p L`K@h&TUPO ]&P2%p`7}%%pP `2@@4$ pI 0{0@{{SH{{S ]%P{{ZU%P<;SN%Pݻ QS $<S<  AG8 ({:S[d(;t X30P2pGS<+10X2#(30S" C@4P 09 0$3 PP 3P  Q R 2O 0;8;08; 00l2H2P0"2 P R  (x{ l+S O42 PP 2 R / < X 0< 0: 0 N@0 010@;F 0@0 00 008;0t1 PP \1 R /@ 1P& 00z 00w 09t1 PP 0 PR` x0 P\P 0 R @RD xh?{Gz?eA`RMb@AϨ )9UƪX+&&?\zͩߩ)Ñ)I-c"`)H)d9&A)rD)~Ф)l)E`)˫))4̭%$0)K 0; 000  0 0 000 0P> 0 P R  Xp<00 ,Dd wP 0: 0 l>t|1!.8@ Z12@TȌp Ťpp ňppBPt  N 0@ 1@  0@TcPe 0C Sb0400000,00(00$00 0000000000 000000 00&[ 0pR@ @@$̂WA $q8;  00L0 1$p28; 00L0 #$pP$8; 004L0 $p8; 00lL0 $p pC  |0 x; D0 y;z+/0;0; ; '0cy;0z;(0x;+8@ppL0 #Pl;"0#10@00 0`K`QH D `   `0 #PnK0S ``K0 #P(a 0  00D5 #PTTd )0d h'$``p5x%p#P5%`#F`!2(1kkkk,a0a4aU0 0P````儝-<;SVb#>˟@ /QzL{ k A::۟SN#@ QVz{ k A9I:`"2RgdD' { h30S 0 ' L N@^IN2 X0弅!pV00 ʎ@+M0@W0 00Dl#@\2 ppW T p02 "P L4"0:CS0L"`KpkL1堋CA{8ZA {'NjGޗ@8țINU{X({*!PU7 0S3  @f0T0xT000p+t`!pP М0S P"t;<000[ W1 0 | #d2"SS% 0 " $@-C6?8~A@@))t2&))Q)X2&)%< `G1 PS. 2R`2嶐0C(4"<8#8Y``0R?Ld0 0 0 d20 "  |  `^`0l0hd?ph{3{7@{{{{{ {  M 4)4#0à3@0h2 0h22d0@#Wp |0H $#$<0(0"(0@02 0BS; (SC; = 0;j"p@0S:0#l2!(0H0C8C8S!* 0 0H 8(#8$"(L" 0 @N1币  hߚh⑚;    0;-" 0W|0H $#$<0(00"(@0\p0V 0$1 JwP<0[AW 0 0RZW|0H $#$<0(00"(@0( 0 0D lH!p0WpH!@!p)%¬=)2&D)r4 ,  ĭ$ 0CS00 P \0Q00p! x|0#!!0ꋟp@0|xt0 vPW T0 mPN 03Q0V! I!0 OP0 0$#$0(#"(!5!0 ;P +!0 1Pl 0 (P Q Q 40r,p 0 P  t0  P 0 P 0 P 0 P 0 Pl 0 P H0 P $ 05 10Sl ES` S W|0H $#$<0(00"(@0p HDXpЮ $6[ izϯ.{G]Űհ#V5=)LKQSIZ0KWI7Lg DDBD0J0ZD0 I0) 0K J0KN  QJY0KWD01ʸ+Y uP WD0 3 D0J C 4 ḛɘWT" pDDD0I0YD0 0J #1 KJ W O-M`Py0@-S@ḔP-3 @ ̣p#p*30SP a`F0P[:PQ9 KJP9 iD H4兔P@ 3 C d0@S L@p20S+K@HGG 0ޒ 0KHX `rHY':@`P7P`4b 2 R - F0 S ! U+ 0 2!{00!0uW]|yvs pyp84 op͘0S uW2u` ]p0S뱘@PK0p@ 0G Vt]bu`qD* X+&X ds̱ޱc"%b;O-PAM Mq@`뼦VP ن6P000-S% @P PG0@K p0\Z "`F00S@DDA@D`u%hp ,0S@bLP53 Q  ȑP -00 `@Z-00  D0B5S0  00S :GP5G0 04P .G0000|4004 0S hG P4  00 8P ~  300S Pl0$0g0(0d0,0a#t0Cp ?o2R0S0$0'P"tPXx@Da0@ET03@00`FrS= RS iS1 ZtS xSg묢Բ +h0p 0@00@00S   0Y^^0S ;8< Q (0 B/S 劺&(0S  0@m ..0S (0S |i10x 0V`S @XZh(0S 4P 0@>XO9JpP+ 0 pPUV.P*]q0 '?:I-\t*ح%NܴX+&X2&x:%@2&i= |&ƵPO-LM'NnP .p=,# PER a0: @@0SCEvPcPSP TP LP d0@S00D003030800H00 30$30(30,30<00",050)@0,0 p qW3SO)P  @ Px< P/P LЍOQ 3S J 00p,04 8<@ 0RWS[0ZSPQPD  0gS @,;{0 0EY0P aR @L0Y S E0-S0 @ 3R: "00: ` P00 \:00 H:43043{0830<3@30@3ppzzyyx||{U,0 U ,0 U ,0 U ,0 U ,0  0 0U ,0  L00L0U , U S SX0X0(0CS0 P0D#8 D#<#  P Q0P0083 a00bX0X0X 0W@0W0W00,0  1 ,0 ᫭P PiH0Sx'xx0>@PH0ST'TH02,0 XS`X `43S`ᷔp峔/faWF cW1 gW0Bp㥔03S\0S^ 0gS$ H0S!Y 0|&  Pp00S_ XZWZV 0S00  ,M0K4I8G<E@CDAWLЍ0000H3p0P xH30`pYD30& 4 004 SSCP 0C00 ,0  4    0R:400,R0t ,00 R B pp y<0S $3S 4p0 00 R B    0y< Q $0Q p0 40 R B    0y< Q $0Q p0 80 R B    0}y< Q $0Qn p0 @0 R B    0ey< Q $0Q\ p0  <0 R B    0My< Q $0QJ p<0pGSz $3S0S Q  D0S\@ p707S ~ ,800'c<sr=S  f  x      WڀpD0S 00S 0S  Q 0   xtpW 8 30(#0<   *3  X+&(ݨ . F dc"Z %@*p* H*P*X*`*h*8* { *l60 ץ0**7DR`q~mG-PXMpU%PHh  BDP b0@SS0p80 6h(pT80U H0$60(60,6006046060860<60@60D60H6$&R 4&<  <&,&R 8&R K4&R <&R 06h'Sdd=QaSHPA87=CP 卍WP0S f P 0000P6T&0 L`9P\-P061 r(VUupXF0+SDp(86 000 <0 0/015T& P 0p00 :XP00G00Xpឋl5 @P 00 B00C2#S0d0P0 00 B00C2#d Pv>C 0C0U U0@0 B "00 00A 1#P10C0 00A00C 1#P 0 00A00C 1#P0 00 B 00C2#0k04qp 0P 0PQT3@CJZp=V 0S  50 `PEPW a W pGW R $Sw ,0< sW p*I-X+& з%!JX*2&C-Mp`FPPEUx%Ep5U@U`F V/@T x.P h)P aP tP(5 R A,%  PV 0S A@D P`V  tP@PA@3PzP0S<0S000S00S00S00S00S 000#pPU 3 `V= V30SU7 0S4000000S@0000000 0 37 0Ss<0Sn00Si2傉P0$0:^0S 0SX`V UURtmP dhP lcPC UB U US@2PEUOPPUI Q LPB k= U2 @U U70000  . U,7PJj!00000  P   $0S    p qp*[@8T  0"600"$0($P @P |܈Ph* X+&>I-X2&y, XU.>nvC-Ma M@Pp!p10S Q༑PE R ލ ЍRP fP74pg{&Pd <WOJQP1 JSP/0: S2  S)J OP0 JN@n` 0D4S00` Z;0S phJ %PJ @PJ0@*X+&XRC-GMM  .0xLup<P<8h h<8X@8DX`{X<`{`XdXhXpXtXXXXXXXXXHhLhPhThXh\hxxxP0D80l8"=C0 8:{PP   nwP:? 0<\lK  %{P t;t <{@P dP,; T(X剌D@̇0P+TX8$ {:P  0S:*,Jh8S <PU JhX zP@ 娇OoB:p m\*:8(p dP 0Z`T`hXOPdh0 *PJp`<0 <*pPUI0  I* 0 0C 001W0܌ \:  \8T0PP>0 XPF0P) S%00|0 gphP9Tv XaP8 h(n8XP8 T(X(d `.P8 h(b40EDS00d8 (H8 X(T(48 ,8 8P 00S~ `8d ;7, ,, ,q7 ,m7 H(i[8P\7, \]l7 L(YW+[v PR:?@ 0$7 P(G7W[pdžP|78 11bG01/΅01$1ghECA(N#2Rolp`d Pa Q18C8S me^qЁ`h  lQ00S ci P +`P3?o20S R=?o20 P Pl )i18C8S 0! SS 0Rg  \ch=S` 0 0000l i18C8S n`jx+Rd*)))X+&d9&)+)9 ''2&)%%**+@+ ))X\9&c"h @-@`PHPp1  hqh!EpT10SAG41P? p1) +P &P0 nPbP 9P0P  c0@ S0VP  00@0T0 D0  40  op0S[d+q 0X+&VdUd X2&w0 %A-`4C00P@0$ 0!=sP0 0˂P00{Vzt|ݣygp埘市P000"SP _U 0+0C0S!PP !\p<ᔂPEP ڏP 0SҏP10ˏ P10Q `U 0S׸ԓPܑɓOPEl10S `10PfUHQr0S,1,DP#+PQwqi"P{qp 000000Sƹ* 㟸㎸uȇꈓPP`0S PPt00S8+0,bd0DK 06-000<+,1,%p/1,$,S1,,O-pP?LDBD``<"p(2 0 qQ "pPpGe*fuP`P GP IP EP }0   a0@S0000,\ 3eX+&dX2&I-2&ddd.,kO-Mpl-zP`e5P4,LL@(4/~40P@ 00 0?P#0X00@T,`P@@#p=30HXBE[p 0S hAt@P zX@P D3DD + -R R -R iQeRQiR kR eR" ""sPPPEP IPF -PF G2Q@"P00p2p\2`L20P^U0S ?SPP20`^V0S ?S``10@^T~0S{ ?S@@w1100ljhꐱ<00 \ (0 `0d !1R, S` \0  0Z $, ,AaP ?Y  = 0SI   <S`0S   Rڰ1\0 1" x0x7H,g:@-d9&gX+&khgg>h%m%r% I-gggPE-ht@H,gX2&ggggt_gpgO-@LMPp`@"p1 UV! Pp 4gP uP GP `0S@0000T PUP   p !3P0P 0S U3 p U  p T C p V p|3PU LQ TrP@P 0P@"3 I-chX+&jhX|h= hhk,hO-0〥M0x5@@p5p%@l5P d5b@pT5b/LELeX8%050%0E5,%,5`0`0rP]  }P P @nmPC DP3 fP5 CP6 apP7 rP$"p,o9h( P00: S0S00+4iPP, pnP 00SW p3 3 Cg@`00긓帳`p*gW pP  ;?xSTT0 @KZPP D oP 1og ! E i 0@00P@UP@`P 'V ((P,@44`(PV,@0h((P,@404`V(P,@@((P,@4`BV(P# 0 0S0 0 00 0  p " W-J@P ?@ >00=$1"91lnP Y /0Q fc80 Ѝpx,(,h,c8,0,`, ,,d,8,, X2&Ze{,<,I-, HL?-,W |[ W ,= Z 34,,@I,O-poM,e@,0  8@0 @$pPT4 W\Y  4pP 0  P(0: S) 0T0Z0S㸠f Y \ ➔P@PD   >P  py  lyP: Pf@Pq 4pUaUbPEUPzU" x!0 l 0  00 0<30 1 ( 0x300t@r pT 0!0 02QX 000sX%X "p0P0 0P* Pt%ePPh!!l A N !011]Z"00P 1 aх [P"  5P0S 㽅 괁0S 㴅`0 0/X0 N(`p0 0  Q   S  R#4p U`Pꂁ0S T  MV^p@ -h!i X+&Xt     I-h^ 2&ht@ H    x 4 & O-0MPp00@|k|Pp le|P\\Xkߍ(@*.3,?X1(?P0/201 2211$R("T122pXpQp^I&[0nZ000l. 0`>ap:0Pn0C 0 0R080 h峘0 l10 B1!1pq0 ၧZPPh0[ = 0ZoR =-00+0 80 =0YSVPMP 6P@ ?P7 4PH@=N@PfP j@P=P=0X1hj<$hVPȼ0V30 [0000z00u0 奒Podl\i0 pVP 0P 匒0$P^ 兒0 RႦ0 PP 0 p1 k84'000`1Zp`` 垗ʘ1STP w6 ፩#቉:0P @@ @0 Tp  qp n(  0 R 0P819:\*`1d L \p,< QZP-$ (010S  0oy 0P`Y) Y)  +x)0 |`00` M 8x9x @彔͔p$T  X d 0S` ( (PO 0S tZo F0080`8"/0  O 0 2s$8"/0 A2sc!"# 7p: 0<奖 CP# 凖 F 008 @p 138ᆖ-PXzLw7 @叒p0S h剖 0HX 0S<0S ~0  Q 8 0 'zp~0S &d_p~0S &0R P q |HutPrl! 0 G 0 Sp<7 ybp3 P $.0$A>0 0T1^6T @pyXu$0 T1N5T @ p p Kbp P 000Rl)圓T徕0@00 P 0 0 @40 pP F$ $# 43Np +(p引4 @岑p8展!R`14`11P0d$}!]0P!砕00!R00SRd1m`1Z  R! Q01Y; Jᒖ`1 I1pW4180; X >< 490Ҕ(,(1PU 0S 2 PkP 0S  ʊ 0S *p R080SX R   (001?0 S   0p`VVaZД0@0@so_hIdnE00    !V h  & % $ !X+&c"  !!I-     !z  @   4= !  ; ^ w  j f         1 i  < G t  >s }       &  M t 2&  Q/0@-0t h P ^0JZ1g@7 0 0$010꬇| X(1O-0bM! Mb  [ !1 b0 0 30_bݍ Ѝ"m` t( Hp  0 #G \ $r{` ; 0$ 00G +x(80G( G p x8_S0쀟00 0000 @G P0 wP x8#`@#[*wP0l8 40G PU P0l8 40G PI H<`J(TJ0ƒ S$*0@- R P@ 0\ R^ H00"@<0 0 0^ 00"@0/Оp@-`hAh1M@0``T!0P1 0H 0 0!  0 nQPp 0SЍp 0 AP000 0 AP 0 0 0 AP 0 0 | |0 AP` `0 0 Ѝp` p`` ` d_ P4_ @-M   Ѝдh  Q/X-M  0 p 0 S 0 0 Ѝ 6 /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b*/*/*/*/c|*/2y*/v*/s*/9p*/m*/j*/8g*/d*/a*/^*/[*/ X*/U*/R*/0O*/QL*/I*/)F*/{C*/|@*/#=*/):*/=7*/4*/1*/".*/+*/(*/%*/"*/////^*/*/*/<*/ */ */*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */!*/ **/ *Q/=*/*/*/(*/$  0*/Y */*/ */*/*/}*/Kz*/Ww*/+/jr*/Oo*/hl*/ii*/vf*/c*/ `*/]*/Z*/W*/T*/Q*/pP/< /G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*Q/"*/*/*/6*/*///*//7 */>*/4T*/@-@y@*/*/*/*/ps_strings missing %juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeara.m.pmp.m.dstmnnoonmiddayiqvwututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!csp != &blank/usr/src/lib/libcurses/refresh.cunknownbel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangeacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error unknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat1.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON/usr/src/common/lib/libprop/prop_number.c%llirpn == pnintegerarray!((*cp) == '\0')/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNELSIOCS80211hidessidsocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)IEEE80211_IOC_FRAGTHRESHOLDIEEE80211_IOC_RTSTHRESHOLD RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: unknown standard formatCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %u%s: can't write sector %u180320360640720123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctlatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvp%s: unknown mode. TYPE %s %sTYPE %sContinue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20260115NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Can't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! timed out at eol chars transferred in can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %sopen: %s%s is not a regular fileusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDtiso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARSLESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadtildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileTag not found%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread commandbranch%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 11.99.5 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.5 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.5 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.99.5 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.99.5 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog11.99.5xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv5hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv5hf/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failed executing: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:854: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICbase32dtbgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdm/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %u %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartmanlvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorparts->geo_sec != 0t != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interface%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duideloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6vsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %srt != NULL&ctx->froutes != rtsrt->rt_ifp != NULLaddingchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIASepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/etc/group/etc/master.passwd: (malloc) Error in munmap(): JPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSHTVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d Wdtc`w$)~f, cWcccHH{̲xc`cĻcĻvxcccc(cX4 c |c Dc`cddd(d8.d8aL+7(5) 9dUqU9d Z8d Z?axpAd$z`|Jdhau܇#Rd dUdd[ddwO,bd,~nԠgdtldxܪsd >c// //////////"'+16!**33 $(*,. pushdnepopdnedj(jiL@@jj@@jjj6  jjt@@sd8t@@junblock and -DNO_CONV?txl \llll%,l2llllll8lllllllllll l"(/ll5ll;100 0prtstatTTT(IT@TTTI(1TITTT1vHY|#Gp(f#>|UjUsage: %s [-] [-ESsx] [-p string] [name] 49;9?ACEG9?@NI$2Vkks{PATH=G   6:> vtjPED[[[[DJQ[@kˮ~1׮ήѮԮ&&abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'(0t(1`(1(8(0(0ݻ(0(0z(0L>>0>&*->>>7;W[_cccc $/:EN%% ,0 K A) AS01 /  V i> Ȃd`[H^W >![~1!Jk                  #= ~x6 (_0Z4z?(8 ̳ٽ<;0Pv@P}x%%+<GߔP{`eýk+ }ʽlѽi׽̌hI߽$ %%%%%""%% """"""&"" $$++BBBBB99BB>IKMOQS    2.*0(, 4 <]7\[  x  ;6:lL$$&x$Ex$##t$$$r%5 &# &%&(', l&$#F%s&ע&EIMQV#U3^#]3e2d3k3j# @+s@658@OWH @f+!>(/ C$CC$C @$@ , zr@ _fmt| @ ====0==0=9 % /"&),FBXi|~@@@@ @@@!@&@-@5@< @:@@@I@Q@X]cjrx~@@ $.4:AIPW _]n~&D`s~f>BGOTZ`fmtx'Z~,2AIfpzfZ*: &.6<@G[QZajs| f>BGOTZ`fmtx'Z~,2AIfpzfZ*:CXCXXSXCXXKXXXXCf>BGOTZ`fmtx'Z~,2AIfpzfZ*: 147:'@*TMP-1  ,],Bcv  = h  cNs !\\#\\$&\\1\\23\\4\\566\\8A9G9N:g;<=@ABCBDiEFGHJLMNOPQR&S@TIUQViW\acdef#g6h6i6p=q\\s\\t\\uSv\\wYxm&Gg (:Qm'GO@\\\\\\\\\ #6CUo +@]u8Sn\\\\ 5\\Hx\\A 9Z][-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]ccgIfpzfZ*:returning to single-user after filesystem check readDosDirSectionreturning to single-user after filesystem check `gw*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~? wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_read  3%@B8%h >%%D@%@@0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-B K&K-K@KKKyKKKKK!Ld%KKKEKKYe%@IO9OGOZOoOOOOF^b`dro  p $p 8p t u Pv | | 4| H|  h| | | |  u (   IfpzfZ*:QPv%@],Bcv  = h  cNs !\\#\\$&\\1\\23\\4\\566\\8A9G9N:g;<=@ABCBDiEFGHJLMNOPQR&S@TIUQViW\acdef#g6h6i6p=q\\s\\t\\uSv\\wYxm&Gg (:Qm'GO@\\\\\\\\\ #6CUo +@]u8Sn\\\\ 5\\Hx\\AT{%@Px<~ė%@T̗%@UlЗ%@ Lԗ%'!#%AZ   XX%}%@ ̳l%SFH0eC9ZSFU0eC?ZHah!IdontNeedEFIIZNZ(s*K>;@XZ|nQn- q+cZoZ|nQn- q+~ZZ|nQn- q+ZZ|nQn- q+ZZ|nQn- q+Z:=rGy=iG}ZZ;Mt?ZZmWC 3KOOZ[yD<#*=([[YbBRuoqr"[1[3Dh&@[H[\ M}-[[l[@Mjy֬}[[-чH[-чH[ZIчH[IчH[IчHZ[2IчH\L6 %?a\\S'@ )Ѹ%\,\*1@ )ѸF\1x )ѸK\U\ST.qBHo6֯ie\p\ %@^%backupstore_gptstore_tbl9d%@in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercapsb b/b[%+-/EYYYYYYYYsetifflagssetifprefixlensetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandsetifmetricsetifmtusetifnetmaskusagestatusfi printallmaindo_setifpreferencedo_setifcapshziș%%Dyiٽٽٽx%`%@ٽٽx%5, %. `%`؜%iڐ%~b0%jLx%lh%kXx% k%k% klx%klx%1k(IWlJq׍IώFZzÏ 3Xxߐ&Kp%s: can't read disk label; disk type must be specified%s partition type is not `%s' WTWTbSS /+-$ ")7IKWco| -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinit  #'+3;CKSW_goy@uBCFILĝNѝOSabc)e=fOhikmn͞oܞrsu @:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:@@@h pp p p O,` @  $1м|^t0 Non-system disk Press any key to reboot bj #'@PSVgmp>Gey  "$&(*,     @=1&)-191J1[^1a      &C]u,95/ fũ©)+S QJNtIpIlIhIdI`I\IXITI %!%%%#   &8808Yy8QI8y6A8 888ymeq*,y"yyy8y4888882($88.%"DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY 2\Bj UPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdef       " % ( +8/& PFPF0* XXX,,x<< vO  " "&bitmask_print4-9COUgjOw &xx@N^f^z^^ ,0LWjq  8=cuz||bitmask_scan9,  !&ADGINPSV]bg9?LhLLL2hw.disknamesfetch_url5`sendrequestrecvrequest2B_{ "*.>PTdjc"***************************************************************************************************************************************************************************************************************************************A]9>plEt9Vx'1HBHHHP ,:EMT]eit| NetBSD gzip 20260107 0000000)  " $#!%Z^\`[_]a.CH @j18RnMkkk=kkkk>ddddddd+1YMX]G;btH'2;z?5 'ug PD]o!by9GJ]/6ePQWDbQ=,g =,g : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. 2&*.)/35;!#%'+-1]8;2"$&(*, " $ & 1!4]W$F -7=QSd+AHddddddddddddddddddddddddd dDMdVdd_qddvddddd--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for datac"V$n   {m$ b$*-5?B5}}}}}}>}}[g}}}}}F}b}}}}}}}}}}}}}}}}K}}Ubn}}s}*}R}}}\  . ' &26: #&/)  #&- ),/ $     "2( &" ,B,c"@,c",,,!),FQd,n}A,u,c"#,c"",c",D,,,c",l,C, ,piD,#pi@,4d,=c,KSb,nyc,ua,c",c"~,,,c",,u,c",c",collectuEsP=====NBIfpzfZ*:NAME=gc~cmount_disks>    "#$%      "#$%&'()*+. str_arg_substget_available_cds"-IfpzfZ*: edit_fs_type_ext' $O U    $$ T% ; ; 1L e u edit_and_check_label IfpzfZ*:disklabel_freedisklabel_set_part_infodisklabel_write_to_diskijzHs  l ` ~ l z w $x z v v 8 <~  | y Hr x Њ @r 8r x w Hw { w disklabel_change_geomp!!! %7outer_fill_part_menu_optsedit_outer_partsselect_part_schemerD----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_default " %2RAHXblv%/9#AJPV\bhck;258 7:=@C  %0VPS[^agl"'6;Cir{/=O_o %(5%;@XZ|nQn- q+cZoZ|nQn- q+~ZZ|nQn- q+ZZ|nQn- q+ZZ|nQn- q+Z:=rGy=iG}ZZ;Mt?ZZmWC 3KOOZ[yD<#*=([[YbBRuoqr"[1[3Dh&@[H[\ M}-[[l[@Mjy֬}[[-чH[-чH[ZIчH[IчH[IчHZ[2IчH\L6 %?a\\S'@ )Ѹ%\,\*1@ )ѸF\1x )ѸK\U\ST.qBHo6֯ie\p\@ T g  G[ A k     mbr_get_generic_part_typembr_init_default_alignmentsmbr_create_newp!X!L!\$\ԋ0 ԓ`Ĕ\8 \lܢxtȳ4, 4h<mbr_get_part_devicembr_read_from_diskwrite_mbrmbr_write_to_diskinside_ext_partadjust_ext_partmbr_add_partmbr_free!***************************************************************************************************************************************************************************************************************************************c"control_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_start7#&))뙙 dhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_reportssiddhcpcd_readdump2:Ldhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2025 Roy Marplesmain duid_geteloop_event_addeloop_event_deleteeloop_q_timeout_addeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_signal_maskeloop_startif_discover qqqqqqqqqqqqqTZ_~2 2-q_222qqqqqqqq.4jn22v2:2?K{23HqjQ22qqq#-v(qv q$M).CXmsplitvadd_environparse_option b*cd?el f@% g h? i3jkL% l5, mV% nFo]% ps\qrh% so% A+t uw% |% v% w6 x% zdy% A% B% Ch D% E% F% G% H! I`J% K% LKM% N% O% P& QST & U& V& W(& X2& Z 1A& 4J& 6S& 9% |t~d& }o& m& v& & & & & & & & & & & & & # & & c, " & & ' ' ' +' )' 2' 0' 8' E' 0( K' Q' Y' ^' n' $ w' B% ' ' ' ' ' ' default_configread_configrt_compare_proto4`4`]]rt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_recvrtl^l^rt_buildrt_deletep]p]sa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_inith",  ), 3, <, `H G, script_buftoenv+' % 2' , make_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_oslrg. m. q. v. z. . if_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @CDHDdhcp_openbpfget_leasedhcp_initread_leaselog_dhcp8 "8 .8 cs=8 dhcp_boundI8 6 R8 Z8 $. 5 b8 =1 j8 dhcp_informdhcp_start1dhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifa OOOOOOO OOOO'O4O>COHOMOOOOOOOOOOOOO OOOO!O.O;@OEOJl0l000\0\0VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B; ST; 8T; XTxT; T< TT< TU%< 8U< XUBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~< l9&< (1!09!"< (5!89!; ; ; ; < < @%< < """cs_pathvX+<  bc_base_maxc" bc_dim_maxc" bc_scale_maxc" bc_string_maxc" coll_weights_maxc" expr_nest_max c" line_maxc"  re_dup_maxc"  posix2_version c"  posix2_c_bindc"  posix2_c_devc"  posix2_char_termc" posix2_fort_devc" posix2_fort_runc" posix2_localedefc" posix2_sw_devc" posix2_upec" stream_maxc" tzname_maxc" atexit_maxc"aaaaae%JaaaaaaT[; ; 8; ܚ; $< Ȝl< %< X<  B 1 >7iea  m"nQLr_ VB$$s} !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: -o %s: option not supported`]ZWTQNKHEB?<96 0-*'$!c3 d38- sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU HeNKmakech    #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef'++9L.DDϲ;15MS7) |;p%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9,1nny:mWnC!n75VPLHD?;9/-11)15-1$1ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>ca'''''''''''''''''''''''''''gm''aj'''''X'X'''dspbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K| {`ijXFo]H" 64" TB00r | {`ijXFo]H" 64" TB00r " 0C0,8M(*w\m:j kP`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     @@ !1Aa  0@`M #+3;CScs inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_cstringprop_string_create_nocopyprop_string_create_formatprop_string_append_cstring_prop_number_externalize_prop_number_alloc2;85_prop_xml_intern_find_tag_prop_intern_decode_string_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dict_keysym_put_prop_dict_keysym_allocprop_dictionary_set_prop_dictionary_iterator_reset_locked_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equals_prop_dictionary_internalize_continue_prop_dictionary_remove6_prop_data_externalizeABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_equalsprop_data_data_prop_data_internalizetruefalse_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_removeprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_extern_append_char_prop_extern_append_encoded_cstring_prop_extern_append_start_tag_prop_extern_append_end_tag_prop_extern_append_empty_tag _prop_stack_push_prop_stack_pop_tcsetpgrp_tcgetpgrp_tcflush_tcdrain_cfsetspeed_cfsetospeed_cfsetispeed_cfmakeraw_cfgetospeed_cfgetispeedstrmode_unsetenv_int_strtouq_l_int__strtoull_l_int__strtou_l ` F g n t__strsuftollxpermute_args_getopt_longgetopt_internalunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s_getoptatolatofmemstream_seeksetbuffersetlinebufsetbufmkdtempfwidefsetposfpurgefgetposfgetc_regerror__icheckhost__gethostlooprshrcmdrresvport_af_addrrresvportresrcmdorcmd_afrcmd_af__ivaliduser_sairuserok_saruseroklink_addr0123456789abcdef_ether_ntoa_ether_aton_ether_line %x:%x:%x:%x:%x:%x %256s _ether_ntohost_ether_hostton_MD5End0123456789abcdef_MD5File_MD5Data_SHA1End0123456789abcdef_SHA1Data_SHA1Transform_SHA1Init_SHA1Update_SHA1Final_RMD160End0123456789abcdef_RMD160Data_uname_ttyname_r_times   +(&Y > < 9ZZZaddcmd_getmodecompress_mode_sethostname_popenpopenve_pclose_initgroupskMGTPEBKMGTPEKMGTPEBkMGTPEhumanize_numbermatchcompareglobextendg_Ctocg_lstatglob3g_opendirglob2g_statglob0globtildeglobexp2globexp1_glob_globfree%%%%%%%%%%%%%%%%%%%%%%%/_getttyent_getttynam_getpassfd_getmntinfo##: _getfsspec_getfsfilefnmatchxgettype_getdiskbyname/$$$$)$$$-$+creatTLS allocation failed, terminating >R5xh:/|6 "~R5IA5WEnn~;Zx0Nm<[y1OnSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec_tcsetattrwcscmp_stresep_setenv_vdprintf_lsetvbuf_regfree_inet_networkCof\$u0LDD????????J^YaTO|wrmhcGunvisAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~fts_pallocfts_sortfts_statfts_allocfts_build_fts_openfts_maxarglen_fts_close_fts_read_fts_set_fts_children_closedir  khwcschr_strcoll_l_int__strtoumax_l_opendir_initdir_alphasortinsertionsort_mergesort_rsetup_seekdir_unlocked_getdomainname @_strncasecmp_initstate_setstate?getenv_getenv_r__freeenvvar__canoverwriteenvvarauthunix_destroyauthunix_marshalmarshal_new_authauthunix_validate_authunix_create_xdr_authunix_parms_xdr_array_xdr_rejected_reply_xdr_opaque_auth_xdr_accepted_reply_xdr_des_block_xdr_replymsg_xdr_callhdr_seterr_replyacceptedrejected_strtok_rz Q ip6_parsenumeric_filenoØŘstr2numberget_canonnameres_queryNres_querydomainNget_aigetanswergethostby*.getanswer: asked for "%s", got "%s"res_searchNexplore_numericget_portmatch_freeaddrinfo_getaddrinfoaddrconfigip6_str2scopeid)&_yphostent_gethtent_getservbyname_r_MD5Init_MD5Update_MD5Final @_vasprintf_l_getifaddrs"_freeifaddrsNBCDB atoi**!!**!!SPDGJM d'@Bʚ;__dn_count_labelsAtLLB9t+CB'@ջ- #charstraddname0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuv__ns_sprintrrf__ns_skiprr__b64_ntopABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/__b64_pton _inet_nsap_addr_inet_nsap_ntoa__ns_format_ttl=dm54ؗҜ<3#I9=D2[%Cod(h4)$ _posix1e_acl_entry_compare_acl_differs_acl_brand_as_sl_add_sl_find  5_strsep_int_strtoul_l_int__strtoll_lfgetsrewindmap_v4v6_addressmap_v4v6_hostentgethostbyname_internal_yp_hostent_yp_gethtbyaddr_yp_gethtbynamegetanswergethostby*.getanswer: asked for "%s", got "%s"_dns_gethtbyname_dns_gethtbyaddrgethostbyname_rgethostbyaddr_rinet_pton40123456789abcdef0123456789ABCDEF_inet_ptoninet_pton6inet_ntop4_inet_ntopinet_ntop6_fseeko_fparseln__fgetstr_xdr_int_xdr_u_int_xdr_long_xdr_u_long_xdr_int32_t_xdr_u_int32_t_xdr_short_xdr_u_short_xdr_int16_t_xdr_u_int16_t_xdr_char_xdr_u_char_xdr_bool_xdr_enum_xdr_opaque_xdr_bytes_xdr_netobj_xdr_union_xdr_string_xdr_wrapstring_xdr_int64_t_xdr_u_int64_t_xdr_hyper_xdr_u_hyper_xdr_longlong_t_xdr_u_longlong_t__dn_skipname0123456789__ns_name_ntop  __ns_name_ntol__ns_name_unpack2dn_find__ns_name_pack_int_strtol_l_vsprintf_l__getdelim_nsdbtaddsrc_nsdbtdump_nsdbtput_nsdispatch^SOR7vr]kkgI72 X%02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04d-00mn /usr/share/zoneinfo/Etc/UTC_strcasecmpbsearch__cxa_atexit_internal__cxa_atexit_vsnprintf_lfreadfopenferror__swbuf333333333JiJJ yYZJjJJJjzZZ [jC-@OOOOOOOOO g.Fp g'ad1PS0123456789abcdef0123456789ABCDEF__vfprintf_unlocked_l__sbprintfexponent^gYce\Q_strndup_strdup_gethostname" !#&(*-/14}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDؗҜ<3#I9=D2[%Cod( 7yACnF?O8M20HwZm1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHGuC?951-)%!}yjfb^CK|EE1In gYWIC<:$$$$$$$$$$$$:::$$$$$$$$$$$$$$$$$$$$$$$$$_getpagesizeqsort_r__sfvwrite__sflush__swsetup*!*!__swhatbuf__smakebuf_tcgetattr_int__strtoi_l__sread__swrite__sseek__sclose_int__strtoimax_lCisalnumisalnum_lisalphaisalpha_lisblankisblank_liscntrliscntrl_lisdigitisdigit_lisgraphisgraph_lislowerislower_lisprintisprint_lispunctispunct_lisspaceisspace_lisupperisupper_lisxdigitisxdigit_ltouppertoupper_ltolowertolower_lc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB _citrus_NONE_stdenc_mbtowc_citrus_NONE_stdenc_mbtocs# dl_iterate_phdr_setup333333333wE<< 0123456789ABCDEF0123456789abcdef_vsnprintf_ss_fwalk__res_nmkquery__res_nopt__res_nopt_rdata/&_hf_gethtbyname2_hf_gethtbyname_hf_gethtbyaddrD!*07 _nsaddsrctomap ]:[=             WEEEdg          DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::clearerrF7Z77<7O__rec_dleafNEXTINDEXNEXTINDEXputpair__delpair__get_page__add_ovflpagesqueeze_key__free_ovflpageugly_split__split_page__big_insert__big_delete__big_splitN??S??E?NEXTINDEXx|lh ,4<@HPX d l t    N`'`L<  `  (0 8 / @ D L T \ d l t |                     < < xh ,L TS ,T h3    X T L   @ L l  P \&      l 0@J p     <8B x    ,, hh     XX X X` $ , 0 4 <D HL PT X L .\ ` / d h \l  t  |               0 00 0t  `0r!u!9hv!py!xd~! >> > > >\l\8x\8!,!!!!LLgntsXTX rbmnhtcid|$@0 3LLyekd$P49,atad loob4<,!,!4!4!yaraP$*("!`\M90<T`x    <H `P% lx ,\8Dhlt| DLlx $ ,8HTddhlp0!TX\`0! $,48<DHPT\ldhpx (08@HPX`hpx$0DT`lx <Tl(<Pdx,@Th|0!w0wx0ĕԕ08P0ĕԕ8 !!!! &l(t(((()()D)h)))))*4*'& & & \( d(h(\(d(66777$7,77(51/0 000040P0X0h0l00000 00 W0 00 00 011(1,1<1@1H1L1`1h1|1111111101/1311112$24282D2H2h2l2 22!22"22#22$<3%386&(53'83@3)\3`3*d3d3+h3l3,33-33.33/330331332443 4,47@4D4c\4`4x444444444445$5,5#2D5$<\5%3l5&x5|5'83-(55)\355555p+87<7D7H75P7`,......///,/4/~ bj8jhcfhkœlՓmooppp%q/r&ut6v)w>wKxtx z[dzSB٣CJdOnP}STVyVXZZĔٔ   ld(iX'8k,iX'm iLiLpj(4q$qr,i,q8v iLiL< ٔ Ĕ /dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbin(}-+?=###%%%} ( (fapxEV~eFI)iL5lmCnfpóbʳuҳk۳q,sh6v-VVx(@=`%D%d ˷$YD0[]iZđ_0Z/ZP$nZ_s[t5lY}oZ)28MW {luxc"u>c"Duxc"\zԁc"x, c"\0t ws$%*  ... ...,,rAABC-Dc"M*MQc"MPS T3T V3VXXX0YFYM\^_Dز̍ X}ax%3a8 P%AabCdhlNsuvW:w:z%%%%%č QjԘ%T% j% j L Kj% \j (jč aj%t%č j%%č %jܙ%ě%č L l3 cL / L C L l; r L @ L l L |H L 1 FL HB L F xL l L  L D; L ? nL 8 $L = L  }L H ѽL 2 ̳L $I -L t L + 6L D L F ˷L t @$!5R9 0 _ O N Q <<""!P <"D( >") t") p#* |2# $C# Ce#! +e#! c# .# # #% #% s#$$ ?#L= ##% H+\Ef+FVP(caRlss(h(+ !"$'(+-.03569: ((Rd9_(((xlCYt++++++++|++++++++tip.record  /etc/phones*!*d$*+*$*<*a*+*a*+a+\xl~*aCY+!A*d*+a+*a+O( **tZa*+<(a+*Hj+Z6+kQ%8+7DAa(+>& +d(+x+/+d9+t+@+dup+I+, (P+T+WVaR+^+/bin/sh0c"3333334, '4, 0474?474J474Q474]474d474o4z447447447447444444444474474574574574574&574-5749574A574M5~T5^5f5o5v5}5v555555@[5555555, 53\+6746z4)64U6464646v56665-75I7i7q77~75757578f5^8%b%T% %z  * . ` d f o 04?4sz _##)#*#######%%&&H&S&&&&&&&&&&&&&&&&&&&&&&&&&&&'' ' '('('L'L'N'N'S'U'W'W'''''''++P+P+U+U+....////000>0A00001/11111112 2G2P2MNƤ`|0RTfhk`oooopՌ"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp| ( ( ) ) oK_pp0J#%')-Y[ : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----*0-000ooprt} %&,,ĨŨ&-GQ).1256CCLL|| /vz      8 : ? ?   $ ' FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB@4@4G4U4jj0k6kOoOooooo-0Fgi{BD6;luu!#$&*06DJ%%%%%%%%""%%%% e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ    l h b  w  i x X       0  $  k  j [<==== is a directory is not a regular file (use -f to see it)(%(% (A$ AA'A]3A?A"KA>VAcA~rA;}A O7A A A A#A2A8A AA A(\ BB!"B+B9=BGBHQB&f\B)hBrB5{BeB:BD%BB6[B4AB B+B,B-B.C*CC?+CEx2C/>C/LC'XCF?eC @Z@i~ +@@ @f@6@@@ @ @ @@WmkRkRkYcWbkCkc kG ky wb YMYrWca%,IKjKKb%@,d KKB%,KLc%,?LjLjLd%,LL%A,LLD%(e Lex%,MM.Mfp%,NMfMFh%,MMg`%,MMNhX%,LNeNiP%,d NNNjH%^ NNJ@%!p,O!Ok8%Ha 0%Ha K(%h,9O^OL %l,|OOm%,OOOn%",OOPo%] !PO%0^ ,Pp%H`c P%c q%,7P_PPr%",PPPs%!,6QNQS%!,kQ{Qt%a QT%b Qu%,QQQV%d w%"x,QRLRx%(h RRX%A,RRy%,RRz%,S+S"x%i JS~p%!|,SSwS?h%4k #`%8` SSX%A,SSP%`,SSH%d,T@T@%\,\TT8%(tj T0%P,TT(%L,lk U2UNU %H,k tUU%D,UU%$@,k UV%$<,l $V:V%8,ZVtV%!4,VV%!0,Ll VV%!,,V W%(m 9W%! ,HW\W%,vWW%,WW%n W%, X3X%,TXhX% ,XX%l X%!,XX%,YBY%,kYYY%,YZZx%,.ZeZZZZZZZ\ZXZ[[$[6[!H[T[^[h[r[[[[[[[[[[[H[[DA[ \\?"\4\ p=\M\a\s\%y\O]\\\\\\\\\\\]]!]!A4]V@]M]8Z] , (press RETURN)f %%%tags643{}abcdDgGhHilnNpPqrs tw xy !:#=>,>,-e^H-i^C-k^UK&L&! &3 % &c"|& c"\&<4 c" L& ( & }&  <& & c"F <&4 , c"F% .  % l%L%c"F% T/ c"F%\ / c"F,% D0 c"F% 0  %# \%k ,%c"F %L L* c"F %N h+ $ %; %\%7 c"2$%kH c"2$%kc"2$L%kc"  %c" %c" %c" L%c" %[%Zcl%uc"F,%jL1 c"F%f- c"F%j| 1 X6 x6 6 u\& ,   h " u2 6 46 ` u2 e2 d<& g3 h,& \2 ^`3 ]3 _3   LC, C@ T Sih i 'i 4i ?i >i Ii id ix h h( h< hP L& 2 3 3 W Q6 Rd S% TXD e 0  O$ P QL Rd S TU V% x  y <03 =2 >P3 ?p3 , h h    t$ # 5 5 l S@3  | \ , $ #  | 4 T\ k )k  Kk  , h h \k2 k2 k3 k3 ! 3 @    x2   d 4 4 d5 l2  p4 4 @5 j3 k`2  5 5 T2 c  3 2 H2 t 2 <2 ,  P4 4 5 4 02 0     t ,% $ P 8 3 2       | ` H 0   D T d ( u4 H!  !    2 1   &! '! (! )p! ! P" X ," " %! " " t" " `"  L wt     < wd 7lXlhlwlh{lVc }lllllll_n|nipqsstgt*u:uLuJ[Yauduguuvw yRzoz|zLXnzzzzz{{0{J{s{{||||}6'}H}V}}}}(dN~p\~c~{~~~~"|%Do,SMՊ~4Hix4͎J~REZΐ 9EW ߒ-cΓmPߖ&adKϚa~ 1\$DImܞ*9HVluŸ؟(?VhWBܢУ0.E !9WkШk(4ASdv۩1fpz6LǪΪ۪/DXʯetͫҫ۫x*3BW#coȬ׬ݮ°VݲB% "'1=F[ʳ3a˴ յյ϶0Qͷ &(y,UtIZ 2l» (I]qI}F~OӽhvA [8@ DU`v)S0VLY^q~đ&C˝@A JJper~*5Vj D9@}%`MFp' s IaLC +;QqZn  */9BSgn ")09CTd L%:K]zq| .:DIN`sIL 7HP[|s$2=JV[hw 2jhyN/i 8h   Zu/ u 1ƽ  } Fj`0  10&\'("))*+.,6.1/ftp@ d,ow@:x vj 6>Ll #m ?l 7@k Qj A1g B6g C;g D Vkpi E Cg F g G [g H g If c"Yf c"f c"Ğ   1u4 1e8 u4 W e t           ]dC\ ]C\  . 1 = c"c"c"c"c"c"c"c"c"C< < < < < < $. < < Z< Z  Z < < < < /c < = :=  = = = 5 = =  = ;$= 4(= ,= R^0=  >4= [5 8= !I= "X= #d= $p= %}= &= '= (= )= *= += ,= -= -= .= .a/> /*01= 2= 3= 4> 5k6> 7 > 8> 9> :> ;"> <1> ==> >O> ?]> @k> [a\> \> ]> ^> ^> _> _> `> {> {? |? }? }[~.?   -dd-ddTdd:dd:dd ( 4@<@H`PXd8DLT#\#d#l#p#x$$$$$%%%%%&&&'''( (( ),)8)@*P*\*d+p+|+,,,,----.../// 6;(;40@0L0T1`1l<t<==>>?22233397 8:04<4H4P5\5h p! " # $ % & ' ( ) * . + , - / $0 41 @2 L3 \4 h5 t6 7 8 9 : ; < = > ?  @!@"@#@$@(%@4&@@'@L)@X*@d+@p&`|'`,@-@.@/@0@(`1@2@3@)`$4@05@@6@P7@`8@p9@:@*`;@<@=@>@?@ `!`+` ,`0"`@#`P-``$`p.`/`%`CCDDEEFFcc ddele #(#4&D&T0dtx| $8Dlptx|4@ D P@T@H*`hpx   @@@@@@`` $ ,@0PNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[Sž,&,&,&-& {% 33UU33UU33UU1&Txp-&2&Tx.& X2&Tx@0&2&1&q-7X7`7h7p77tx7`|777x   @  333333333333333333333333333333333333 33 33\6&33 33l"l"- 0000000000000000 .33333333337&7&7& (root)`33%C`"`"`"`"`"`"`"(-!p%d%%%%""""9&dtx̯ܯ̪Ъت DT,@|خhثService unavailable]L(A,aeabi"5TE  ;P7xܭoAYrV`.T`0 AP:D"MP(onѽ$ $_vXyu3q*_TѕN׎Ȼr".7YDY403gqg'37;0j[1VoG݉Xm5K9_k.rø_\|p-.{s>XχOr_"-gw>/;A>q8.ϳJw"_:[y㵌|kyV^}Tp)k*bL ׽3z;o.\4}iqa~ć| c(Sk\#Z??ۼfsmG"ȯEzډ|Z?ݮF>GiREQ 1 Dso 747d ̼qpvp-M}qy!p[\+HU h8gl{x 6 j;#!r]x:F|f1ɠɇ&ndDJPj,r!, Ur>vU+Zramdiskbin.debugMa.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf.gnu_debuglink / B4H88RPi%)!Vi%)!$bi%)!gi%)!ttL%LH!Xy%J!p:&!:&!@XX.!p!-H!!!MSGTXTS627 5032 5057 5074 5096 5099 5104 5112 5119 5127 5135 5138 5141 5144 5148 5160 5169 5182 5211 5226 5769 5803 6486 6774 7482 7538 7612 7708 7883 7906 7929 7935 7944 7966 7970 7974 7977 7980 8085 8288 8527 8968 9406 9441 9456 9468 9474 9486 9535 9555 9595 9612 9629 9644 9691 9729 9777 9859 9983 10119 10160 10198 10235 10270 10280 10329 10479 10485 10490 10494 10514 10624 10644 10650 10664 10676 10687 10724 10758 10782 10884 10921 10943 11042 11097 11155 11166 11182 11234 11402 11609 11780 11844 11896 12167 12716 13244 13675 14013 14346 14459 14474 14483 14643 14814 14964 15128 15151 15175 15190 15265 15405 15582 15737 15749 15829 15930 15976 16002 16072 16083 16092 16105 16131 16146 16162 16175 16230 16241 16256 16460 16693 16722 16737 16806 16880 16953 16983 17021 17075 17494 17520 17549 17653 17759 17944 18056 18171 18275 18962 19221 19361 19397 19567 19608 19744 19767 19804 19849 20100 20196 20250 20349 20360 20397 20434 20461 20470 20504 20511 20536 20563 20598 20612 20626 20655 20669 20686 20695 20717 20735 20752 20763 20782 20808 20826 20849 20866 20881 20896 20914 20941 20968 20990 21029 21047 21079 21307 21381 21424 21470 21617 21773 21817 22096 22123 22482 22666 22818 22999 23146 23304 23325 23373 23383 23391 23402 23413 23423 23430 23445 23457 23494 23524 23563 23616 23674 23695 23702 23721 23742 23749 23771 23793 23813 23835 23866 23903 23925 23939 23985 24014 24048 24088 24123 24151 24199 24208 24217 24222 24231 24240 24257 24261 24266 24272 24276 24314 24323 24350 24370 24393 24412 24439 24461 24493 24509 24514 24524 24547 24569 24586 24603 24616 24625 24634 24640 24667 24674 24698 24719 24743 24756 24775 24800 24823 24839 24845 24857 24887 24895 24935 24946 24957 24968 24985 25002 25016 25033 25249 25553 26001 26217 26481 26753 26805 26841 26877 26928 26945 26983 26997 27004 27021 27024 27029 27038 27050 27061 27070 27091 27133 27171 27187 27218 27243 27278 27334 27374 27395 27415 27456 27485 27533 27766 27801 28008 28027 28064 28125 28163 28202 28358 28373 28419 28467 28490 28526 28536 28546 28557 28562 28625 28673 28717 28778 28811 28912 28930 29069 29091 29214 29228 29238 29261 29366 29422 29538 29569 29574 29600 29639 29649 29692 29702 29718 29733 29751 29774 29804 29825 29851 30048 30091 30095 30101 30107 30112 30123 30137 30166 30198 30210 30257 30307 30347 30374 30390 30399 30442 30448 30456 30460 30480 30497 30509 30540 30796 30845 31421 31448 31480 31508 31560 31566 31572 31577 31598 31614 31636 31665 31806 31940 31953 32089 32091 32093 32095 32112 32125 32143 32170 32174 32180 32185 32193 32199 32239 32241 32251 32266 32283 32317 32349 32387 32416 32445 32467 32510 32536 32580 32716 32718 32798 32844 32892 32997 33099 33138 33205 33212 33273 33337 33341 33348 33470 33539 33827 33965 34106 34187 34234 34240 34263 34309 34312 34338 34381 34446 34508 34578 34646 34739 34958 34983 34987 35023 35041 35069 35111 35155 35219 35269 35345 35367 35419 35463 35502 35536 35566 35597 35622 35631 35643 35651 35662 35674 35693 35717 35766 35783 35807 35850 36172 36175 36189 36202 36214 36221 36232 36239 36246 36255 36265 36282 36298 36348 36356 36364 36374 36385 36403 36420 36441 36463 36472 36482 36509 36515 36525 36544 36560 36578 36598 36607 36618 36625 36642 36661 36682 36692 36709 36715 36731 36746 36761 36782 36804 36823 36833 36838 36843 36861 36880 36899 36905 36924 36944 36964 36982 36987 36993 37010 37026 37047 37060 37068 37088 37112 37129 37137 37148 37169 37175 37187 37209 37223 37232 37253 37271 37280 37314 37337 37364 37396 37419 37439 37450 37482 37498 37509 37522 37545 37567 38075 38105 38136 38164 38178 38379 38601 38768 38855 38872 38890 38907 38936 38983 38994 39013 39035 39114 39306 39334 39452 39474 39615 39634 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-11.99.5. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? - wd: SATA, ATA oder IDE - sd: SCSI oder USB-Speicher - ld: NVMe (z.B. M.2-Karte), SD/MMC-Karte oder virtueller Speicher Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis (leer lassen, um abzubrechen)?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-11.99.5 ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-11.99.5 ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-11.99.5 ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-11.99.5 ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-11.99.5 InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-11.99.5 ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPHTTPSNFSCD-ROM / DVD / Medium mit AbbilddateiDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzDas Verzeichnis, in das die alten a.out-Bibliotheken gesichert werden sollten, konnte nicht erstellt werden. Bitte starten Sie die Aktualisierung erneut und stellen Sie sicher, dass alle Dateisysteme gemountet sind.Eins der Verzeichnisse /emul/aout oder /emul war ein symbolischer Link, der auf ein nicht-gemountetes Dateisystem verwies. Der Link wurde mit einer '.old' Erweiterung versehen. Sobald Ihr aktualisiertes System gestartet ist, mssen Sie das neu erstellte /emul/aout mit dem alten Verzeichnis abgleichen. Sendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd (Secure Shell daemon) aktivierenntpd aktivierenntpdate beim Starten ausfhrenMulticast DNS aktivierenxdm (X Display Manager) aktivierencgd aktivieren (kryptografische Laufwerkskonfiguration)lvm (Logical Volume Manager) aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte Partitionierung (Software-RAID, ...)Partitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen? So knnen Sie 'su' verwenden, um Superuser zu werden.Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden? Wenn Sie von einer Diskette gebootet haben, knnen Sie diese jetzt entfernen. Kann den Bootblock des Filecores nicht lesen Kann die RISCiX Partitionstabelle nicht lesen Keine NetBSD Partition in der RISCiX Partitionstabelle gefunden - erstellen eines Labels nicht mglich. Keine NetBSD Partition gefunden (eine Nur-Filecore Platte?) - erstellen eines Labels nicht mglich. Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm rmdir sh stty sync . .. dhcpcd.confgroup master.passwd netconfig protocolsservicesMSGTXTS627 5032 5070 5087 5102 5105 5108 5113 5121 5129 5137 5140 5143 5152 5164 5176 5185 5194 5220 5231 5766 5793 6359 6659 7300 7347 7460 7553 7587 7606 7624 7632 7641 7666 7670 7674 7677 7680 7802 7987 8215 8735 9086 9115 9128 9141 9146 9166 9185 9206 9265 9282 9296 9318 9363 9389 9430 9508 9626 9740 9794 9823 9855 9894 9900 9933 10056 10063 10067 10075 10099 10181 10187 10194 10206 10220 10229 10262 10281 10293 10403 10465 10484 10603 10654 10706 10718 10737 10789 10993 11201 11392 11452 11501 11767 12225 12890 13312 13634 14059 14191 14223 14235 14413 14610 14771 14905 14925 14958 14972 15041 15154 15326 15461 15481 15593 15685 15708 15731 15790 15805 15826 15841 15862 15882 15907 15921 15945 15957 15975 16185 16435 16456 16472 16525 16593 16666 16703 16729 16805 17262 17288 17310 17417 17524 17725 17798 17882 17982 18477 18715 18866 18900 19035 19079 19218 19259 19304 19351 19595 19728 19790 19884 19889 19923 19957 19972 20000 20033 20040 20065 20083 20109 20116 20131 20146 20166 20206 20223 20243 20264 20286 20301 20321 20343 20358 20371 20385 20397 20409 20423 20446 20469 20487 20530 20581 20618 20803 20866 20902 20951 21042 21172 21225 21485 21532 21893 22043 22212 22352 22472 22604 22644 22691 22701 22709 22719 22727 22738 22749 22763 22788 22829 22862 22895 22930 22984 23009 23028 23050 23055 23061 23090 23107 23134 23152 23173 23195 23214 23224 23254 23280 23307 23356 23384 23411 23464 23474 23484 23490 23500 23509 23529 23533 23538 23544 23548 23583 23592 23623 23640 23667 23688 23708 23727 23753 23766 23774 23790 23821 23852 23873 23899 23912 23920 23931 23937 23961 23971 23983 24001 24012 24032 24048 24074 24096 24112 24124 24144 24170 24176 24206 24220 24234 24257 24276 24295 24313 24331 24554 24860 25278 25479 25719 25903 25981 26036 26103 26143 26166 26200 26211 26219 26242 26245 26248 26254 26265 26277 26290 26320 26364 26377 26390 26427 26441 26452 26463 26474 26491 26502 26549 26572 26621 26862 26895 27150 27171 27204 27257 27283 27310 27466 27472 27515 27535 27554 27583 27590 27597 27604 27609 27658 27696 27730 27787 27815 27860 27877 27978 27983 28060 28074 28084 28108 28231 28312 28422 28450 28455 28471 28500 28508 28549 28556 28570 28583 28591 28610 28643 28663 28683 28899 28930 28935 28942 28949 28953 28967 28979 28994 29027 29040 29095 29153 29189 29207 29225 29243 29280 29286 29294 29298 29319 29336 29347 29369 29547 29591 30293 30317 30351 30370 30415 30422 30429 30433 30457 30468 30473 30536 30657 30780 30793 30927 30929 30931 30933 30943 30952 30965 30992 30996 31002 31007 31016 31021 31048 31050 31063 31075 31090 31118 31162 31209 31225 31247 31258 31291 31311 31360 31460 31462 31527 31576 31625 31729 31827 31868 31959 31966 32027 32091 32096 32102 32211 32270 32521 32662 32789 32857 32894 32901 32928 32974 32977 32998 33043 33094 33153 33222 33269 33374 33517 33542 33546 33580 33597 33621 33673 33724 33796 33862 33960 33977 34008 34044 34078 34102 34126 34159 34179 34189 34197 34205 34215 34226 34240 34266 34314 34337 34357 34398 34697 34700 34714 34726 34733 34752 34766 34773 34780 34789 34799 34816 34832 34880 34888 34896 34906 34917 34935 34952 34971 34991 34998 35015 35032 35039 35052 35087 35104 35123 35143 35153 35169 35182 35200 35220 35241 35251 35271 35291 35304 35323 35336 35360 35383 35396 35407 35412 35419 35437 35456 35475 35483 35502 35522 35547 35565 35572 35579 35592 35601 35622 35635 35643 35663 35691 35708 35714 35725 35756 35764 35777 35799 35821 35830 35851 35869 35876 35899 35918 35945 35963 35983 35996 36011 36032 36046 36053 36067 36082 36101 36646 36679 36707 36736 36744 36781 37093 37270 37347 37364 37382 37397 37419 37469 37479 37496 37518 37577 37735 37759 37889 37914 38040 38058 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-11.99.5. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-11.99.5 ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-11.99.5 ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-11.99.5 completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-11.99.5. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-11.99.5Salir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-11.99.5Ejecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si ha iniciado desde disquette, ahora debera retirar el disco. No se puede leer el bloque de arranque filecore No se puede leer la tabla de particiones RISCiX No se ha encontrado ninguna particin NetBSD en la tabla de particiones RISCiX - No se puede etiquetar No se ha encontrado ninguna particion NetBSD (disco solo de filecore?) - No se puede etiquetar Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): NcleoThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located. umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS627 5032 5068 5085 5100 5104 5108 5113 5124 5130 5136 5139 5142 5145 5149 5161 5173 5183 5213 5225 5654 5681 6257 6617 7302 7363 7441 7536 7576 7598 7616 7622 7631 7657 7661 7665 7668 7671 7793 7978 8206 8735 9153 9182 9195 9208 9215 9235 9254 9277 9320 9340 9359 9382 9426 9455 9496 9562 9674 9788 9842 9871 9903 9942 9948 9981 10059 10065 10069 10074 10115 10252 10262 10270 10289 10303 10312 10344 10385 10398 10523 10581 10600 10719 10775 10827 10838 10854 10893 11143 11315 11487 11542 11577 11826 12229 12527 12794 13155 13335 13654 13674 13687 13876 14020 14216 14350 14370 14403 14422 14523 14678 14866 15053 15073 15152 15250 15288 15311 15401 15422 15445 15464 15488 15518 15562 15595 15618 15630 15648 15916 16235 16266 16301 16365 16440 16510 16541 16571 16663 17154 17184 17201 17341 17482 17679 17798 17945 18112 18670 18966 19147 19192 19355 19409 19544 19580 19640 19690 19981 20090 20147 20244 20249 20284 20319 20334 20358 20391 20396 20421 20437 20460 20467 20484 20499 20518 20550 20554 20574 20592 20604 20617 20635 20659 20677 20696 20723 20750 20762 20783 20813 20843 20868 20901 20936 20974 21227 21296 21351 21412 21530 21689 21743 22004 22055 22431 22586 22730 22870 22978 23163 23193 23236 23246 23254 23264 23276 23297 23306 23312 23344 23384 23420 23458 23495 23543 23567 23579 23593 23601 23609 23636 23653 23682 23703 23726 23735 23754 23766 23810 23848 23875 23919 23947 23974 24027 24038 24049 24056 24066 24075 24109 24113 24118 24124 24128 24163 24173 24203 24226 24255 24277 24299 24321 24348 24360 24372 24391 24425 24458 24479 24503 24516 24528 24541 24547 24573 24583 24594 24618 24628 24648 24668 24685 24711 24735 24748 24768 24802 24809 24838 24861 24884 24900 24915 24930 24945 24959 25147 25452 25883 26074 26309 26497 26539 26589 26643 26691 26713 26754 26765 26773 26797 26801 26805 26814 26825 26836 26851 26882 26928 26941 26954 26984 26998 27010 27022 27034 27052 27075 27120 27143 27203 27455 27482 27744 27762 27789 27838 27868 27899 28031 28038 28087 28110 28134 28163 28171 28181 28189 28194 28247 28296 28336 28402 28435 28479 28502 28603 28608 28685 28699 28709 28733 28856 28937 29047 29075 29080 29096 29125 29133 29174 29182 29196 29209 29217 29236 29269 29289 29309 29525 29556 29576 29582 29589 29593 29608 29627 29653 29662 29674 29728 29786 29821 29840 29857 29869 29904 29910 29918 29922 29943 29960 29971 29996 30174 30228 30919 30938 30973 31003 31049 31055 31062 31066 31090 31106 31112 31187 31337 31456 31469 31537 31539 31541 31543 31553 31566 31583 31610 31614 31620 31625 31634 31639 31666 31668 31681 31693 31708 31736 31780 31827 31843 31865 31876 31909 31929 31978 32078 32080 32156 32211 32261 32360 32455 32503 32593 32600 32661 32725 32730 32736 32839 32891 33137 33298 33453 33524 33577 33584 33611 33661 33664 33685 33731 33786 33845 33914 33961 34066 34209 34234 34238 34272 34289 34327 34380 34420 34496 34561 34655 34676 34714 34754 34790 34814 34837 34876 34906 34913 34922 34930 34938 34952 34968 34996 35048 35065 35086 35130 35472 35476 35491 35502 35510 35529 35541 35548 35555 35564 35574 35591 35607 35661 35669 35677 35687 35698 35716 35733 35749 35767 35774 35792 35809 35816 35826 35857 35876 35895 35915 35925 35944 35957 35977 35997 36018 36028 36047 36066 36076 36093 36107 36130 36154 36167 36177 36182 36186 36204 36223 36242 36247 36266 36286 36311 36326 36330 36337 36347 36356 36377 36391 36399 36419 36445 36462 36470 36481 36512 36517 36530 36552 36567 36576 36597 36615 36624 36668 36692 36719 36734 36751 36765 36796 36820 36851 36858 36872 36887 36906 37451 37484 37512 37541 37549 37586 37898 38075 38152 38169 38187 38202 38224 38274 38284 38301 38323 38382 38540 38564 38694 38719 38845 38863 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-11.99.5. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-11.99.5 est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-11.99.5 est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-11.99.5 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-11.99.5 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-11.99.5 Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-11.99.5Excuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si vous avez dmarr sur une disquette, vous pouvez maintenant la retirer. Impossible de lire le contenu du secteur de dmarrage Impossible de lire la table de partitions RISCiX Aucune partition NetBSD trouve dans la table de partitions RISCiX. Impossible de crer un label. Aucune partition NetBSD trouve (disque filecore uniquement ?). Impossible de crer un label. Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationditerGroupeMSGTXTS627 5032 5073 5089 5107 5111 5115 5125 5134 5140 5146 5149 5152 5161 5171 5184 5192 5203 5228 5240 5748 5780 6272 6561 7106 7152 7256 7342 7378 7393 7411 7419 7427 7454 7458 7462 7465 7468 7579 7764 7992 8468 8802 8831 8846 8861 8869 8883 8901 8922 8973 8989 8999 9019 9065 9095 9148 9205 9316 9437 9481 9514 9553 9587 9594 9627 9704 9710 9717 9724 9753 9865 9871 9882 9899 9916 9925 9954 9966 9976 10077 10139 10159 10279 10316 10372 10386 10407 10444 10654 10829 10978 11013 11065 11281 11594 12117 12478 12768 13161 13296 13309 13320 13466 13645 13776 13910 13930 13963 13982 14065 14180 14321 14446 14460 14568 14661 14690 14710 14786 14803 14821 14837 14856 14876 14893 14905 14931 14943 14961 15162 15401 15428 15445 15501 15563 15623 15654 15678 15737 16083 16113 16130 16238 16348 16488 16562 16638 16716 17208 17428 17539 17570 17697 17733 17861 17888 17928 17974 18190 18314 18382 18482 18487 18523 18559 18573 18596 18629 18633 18658 18677 18703 18708 18723 18738 18757 18782 18794 18816 18833 18846 18858 18876 18900 18915 18932 18945 18956 18967 18987 19016 19045 19069 19104 19139 19166 19353 19402 19434 19482 19579 19712 19758 19950 19980 20302 20431 20571 20711 20828 20963 21007 21050 21058 21068 21080 21092 21100 21111 21138 21172 21207 21238 21273 21309 21356 21376 21393 21411 21416 21423 21448 21464 21485 21502 21519 21537 21554 21567 21598 21623 21654 21685 21720 21747 21800 21810 21820 21826 21835 21843 21858 21862 21867 21873 21877 21912 21922 21951 21967 21993 22010 22029 22050 22066 22079 22084 22092 22107 22133 22152 22180 22198 22209 22215 22221 22242 22252 22263 22281 22303 22320 22333 22354 22374 22394 22405 22418 22440 22447 22472 22487 22507 22519 22536 22553 22573 22592 22769 23053 23363 23543 23754 23942 24008 24055 24110 24154 24174 24203 24215 24221 24237 24241 24245 24253 24263 24275 24290 24309 24345 24356 24367 24406 24418 24428 24438 24448 24464 24482 24531 24552 24597 24841 24867 25121 25136 25162 25219 25253 25288 25430 25447 25496 25517 25533 25562 25567 25572 25578 25583 25622 25657 25687 25742 25775 25821 25835 25914 25919 25973 25987 25997 26021 26107 26155 26261 26295 26302 26317 26344 26353 26392 26399 26421 26440 26456 26474 26506 26525 26542 26699 26730 26737 26746 26754 26761 26775 26793 26812 26822 26834 26875 26920 26949 26970 26993 27012 27050 27056 27064 27068 27089 27106 27115 27134 27280 27322 27832 27840 27864 27882 27926 27931 27936 27940 27971 27984 27993 28039 28165 28256 28268 28332 28334 28336 28338 28348 28362 28377 28404 28408 28414 28419 28428 28433 28460 28462 28477 28488 28503 28531 28575 28622 28638 28660 28671 28704 28724 28773 28873 28875 28943 28983 29028 29103 29169 29204 29285 29292 29353 29417 29424 29430 29529 29585 29861 29985 30096 30158 30196 30204 30226 30275 30278 30299 30344 30399 30458 30527 30574 30679 30822 30847 30851 30885 30901 30926 30974 31010 31071 31125 31206 31228 31267 31304 31336 31360 31387 31413 31427 31435 31445 31453 31467 31480 31492 31516 31557 31583 31600 31629 31953 31956 31970 31982 31988 32004 32016 32023 32030 32039 32049 32066 32082 32125 32133 32141 32151 32162 32180 32197 32210 32236 32243 32251 32268 32276 32293 32317 32336 32355 32374 32384 32395 32409 32427 32447 32467 32476 32499 32519 32530 32545 32557 32576 32595 32606 32616 32621 32627 32645 32664 32683 32690 32709 32729 32754 32771 32777 32785 32795 32807 32828 32844 32852 32872 32892 32914 32922 32933 32956 32963 32977 32999 33016 33025 33046 33064 33073 33104 33120 33147 33166 33186 33204 33225 33239 33259 33266 33285 33300 33319 33864 33897 33925 33954 33962 33999 34311 34488 34565 34582 34600 34615 34637 34687 34697 34714 34736 34795 34953 34977 35107 35132 35258 35276 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-11.99.5. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-11.99.5 zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-11.99.5 zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-11.99.5 zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-11.99.5 zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-11.99.5Wyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-11.99.5Uruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPHTTPSNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Jesli uruchomiles komputer z dyskietki, mozesz ja teraz wyciagnac. Nie moge przeczytac bootbloku filecore Nie moge przeczytac tablicy partycji RISCiX Nie znalazlem partycji NetBSD w tablicy partycji RISCiX - Nie moge nazwac Nie znalazlem partycji NetBSD (dysk filecore?) - Nie moge nazwac Instalowanie bootblokow na %s.... Partycje NetBSD na dysku %s wygladaja teraz tak (Rozmiary i Przesuniecia w %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766:  . ..zerowd3pwd3owd3nwd3mwd3lwd3kwd3jwd3iwd3hwd3g wd3f!wd3e"wd3d#wd3c$wd3b%wd3a& wd3'wd2p(wd2o)wd2n*wd2m+wd2l,wd2k-wd2j.wd2i/wd2h0wd2g1wd2f2wd2e3wd2d4wd2c5wd2b6wd2a7 wd28wd1p9wd1o:wd1n;wd1m<wd1l=wd1k>wd1j?wd1i@wd1hAwd1gBwd1fCwd1eDwd1dEwd1cFwd1bGwd1aH wd1Iwd0pJwd0oKwd0nLwd0mMwd0lNwd0kOwd0jPwd0iQwd0hRwd0gSwd0fTwd0eUwd0dVwd0cWwd0bXwd0aY wd0Zurandom[ttypf\ttype]ttypd^ttypc_ttypb`ttypaattyp9bttyp8cttyp7dttyp6ettyp5fttyp4gttyp3httyp2ittyp1jttyp0ktty01ltty00m ttynstdoutostdinpstderrq st1r st0ssd3ptsd3ousd3nvsd3mwsd3lxsd3kysd3jzsd3i{sd3h|sd3g}sd3f~sd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2a sd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2krwd2jrwd2irwd2hrwd2grwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1erwd1drwd1crwd1brwd1arwd1rwd0prwd0orwd0nrwd0mrwd0lrwd0krwd0jrwd0irwd0hrwd0grwd0frwd0erwd0drwd0crwd0brwd0arwd0rst1rst0rsd3prsd3orsd3nrsd3mrsd3lrsd3krsd3jrsd3irsd3hrsd3grsd3frsd3e rsd3d rsd3c rsd3b rsd3a rsd3rsd2prsd2orsd2nrsd2mrsd2lrsd2krsd2jrsd2irsd2hrsd2grsd2frsd2ersd2drsd2crsd2brsd2arsd2rsd1p rsd1o!rsd1n"rsd1m#rsd1l$rsd1k%rsd1j&rsd1i'rsd1h(rsd1g)rsd1f*rsd1e+rsd1d,rsd1c-rsd1b.rsd1a/rsd10rsd0p1rsd0o2rsd0n3rsd0m4rsd0l5rsd0k6rsd0j7rsd0i8rsd0h9rsd0g:rsd0f;rsd0e<rsd0d=rsd0c>rsd0b?rsd0a@rsd0Armd1cBrmd1aCrmd1Drmd0cErmd0aFrmd0Grld7pHrld7oIrld7nJrld7mKrld7lLrld7kMrld7jNrld7iOrld7hPrld7gQrld7fRrld7eSrld7dTrld7cUrld7bVrld7aWrld7Xrld6pYrld6oZrld6n[rld6m\rld6l]rld6k^rld6j_rld6i`rld6harld6gbrld6fcrld6edrld6derld6cfrld6bgrld6ahrld6irld5pjrld5okrld5nlrld5mmrld5lnrld5korld5jprld5iqrld5hrrld5gsrld5ftrld5eurld5dvrld5cwrld5bxrld5ayrld5zrld4p{rld4o|rld4n}rld4m~rld4lrld4krld4jrld4irld4hrld4grld4frld4erld4drld4crld4brld4arld4rld3prld3orld3nrld3mrld3lrld3krld3jrld3irld3hrld3grld3frld3erld3drld3crld3brld3arld3rld2prld2orld2nrld2mrld2lrld2krld2jrld2irld2hrld2grld2frld2erld2drld2crld2brld2arld2rld1prld1orld1nrld1mrld1lrld1krld1jrld1irld1hrld1grld1frld1erld1drld1crld1brld1arld1rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rflash7rflash6rflash5rflash4rflash3rflash2rflash1rflash0rfd1prfd1orfd1nrfd1mrfd1lrfd1krfd1jrfd1irfd1hrfd1grfd1frfd1erfd1drfd1crfd1brfd1arfd1rfd0prfd0orfd0nrfd0mrfd0lrfd0krfd0jrfd0irfd0hrfd0grfd0frfd0erfd0drfd0crfd0brfd0arfd0rdk7rdk6rdk5rdk4rdk3rdk2rdk1rdk0rcd1crcd1arcd1rcd0crcd0arcd0randomptypf ptype ptypd ptypc ptypb ptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0 memmd1cmd1a  md1!md0c"md0a# md0$ld7p%ld7o&ld7n'ld7m(ld7l)ld7k*ld7j+ld7i,ld7h-ld7g.ld7f/ld7e0ld7d1ld7c2ld7b3ld7a4 ld75ld6p6ld6o7ld6n8ld6m9ld6l:ld6k;ld6j<ld6i=ld6h>ld6g?ld6f@ld6eAld6dBld6cCld6bDld6aE ld6Fld5pGld5oHld5nIld5mJld5lKld5kLld5jMld5iNld5hOld5gPld5fQld5eRld5dSld5cTld5bUld5aV ld5Wld4pXld4oYld4nZld4m[ld4l\ld4k]ld4j^ld4i_ld4h`ld4gald4fbld4ecld4ddld4celd4bfld4ag ld4hld3pild3ojld3nkld3mlld3lmld3knld3jold3ipld3hqld3grld3fsld3etld3duld3cvld3bwld3ax ld3yld2pzld2o{ld2n|ld2m}ld2l~ld2kld2jld2ild2hld2gld2fld2eld2dld2cld2bld2a ld2ld1pld1old1nld1mld1lld1kld1jld1ild1hld1gld1fld1eld1dld1cld1bld1a ld1ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullflash7flash6flash5flash4flash3flash2flash1flash0fd1pfd1ofd1nfd1mfd1lfd1kfd1jfd1ifd1hfd1gfd1ffd1efd1dfd1cfd1bfd1a fd1fd0pfd0ofd0nfd0mfd0lfd0kfd0jfd0ifd0hfd0gfd0ffd0efd0dfd0cfd0bfd0a fd0est1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drvctldrum dk7 dk6 dk5 dk4 dk3 dk2 dk1 dk0consttyconsolecd1ccd1a cd1cd0ccd0a cd0 bpf0 bpf ...# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin  . .. dhcpcd-hooksdhcpcd-run-hooks# $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use fi done # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  . ..20-resolv.conf 30-hostnamen $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime if [ -n "$rdnsstime" ]; then ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers if [ -n "$rdnss" ]; then new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi fi fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime if [ -n "$dnssltime" ]; then ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search if [ -n "$dnssl" ]; then new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi fi fi # Break when we don't have either [ -z "$rdnsstime" ] && [ -z "$dnssltime" ] && return 1 j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf retur# Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dkctl drvctl fdisk fsck fsck_ffs  fsck_msdos gpt halt ifconfig init mknod mount  mount_cd9660  mount_ext2fs  mount_ffs  mount_kernfs  mount_mfs  mount_msdos  mount_nfs  mount_tmpfs newfs  newfs_ext2fs  newfs_msdos ping reboot restore route rrestore shutdown slattach swapctl sysctl dumount ... ... . .. binmdecsbinshare . .. cu ftp gunzip gzcat gzip less more progress sed tar tip Htset ... . .. chroot . ..misc ... . .. db log  run spool ... ...  ...  . .. lock  . ..