'VJ6LiF0z3sNetBSD/earmv5 ramdisk 08Fi<  Fi2GQt tFi@@<@T 08Fi<  Fi2GQt tFi@@<@TU Fit`AFiFiFi$h FiFiFiAFiFiFiA.FiFiFiAFiFiFiAFiFiFiAFiFiFiAFiFiFiAFiFiFiAFiFiFimDPB"FiFiFi (08@HPX`hpx0$wFiFiFiPX`hpxN$0FiFiFiK$/FiFiFi (0M$JFiFiFi8@HPX`hpxFAFiFiFiCFiFiFiAFiFiFiAFiFiFi!FiFiFi aFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFi aFiFiFi aFiFiFi aFiFiFi aFiFiFi aFiFiFiaFiFiFiaFiFiFiaFiFiFi aFiFiFi aFiFiFi aFiFiFi aFiFiFi aFiFiFiaFiFiFi aFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFi!FiFiFi4!FiFiFi!FiFiFi!FiFiFi !FiFiFi !FiFiFi !FiFiFi !FiFiFi !FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi B!FiFiFi B!FiFiFi!FiFiFi"!FiFiFi"!FiFiFi"aFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFi aFiFiFi aFiFiFi aFiFiFi aFiFiFi aFiFiFiaFiFiFiaFiFiFiaFiFiFi aFiFiFi aFiFiFi aFiFiFi aFiFiFi aFiFiFiaFiFiFi aFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi !FiFiFi !FiFiFi !FiFiFi !FiFiFi !FiFiFi!FiFiFi!FiFiFi!FiFiFi !FiFiFi !FiFiFi !FiFiFi !FiFiFi !FiFiFi!FiFiFi !FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi !FiFiFi !FiFiFi !FiFiFi !FiFiFi !FiFiFi!FiFiFi!FiFiFi!FiFiFi !FiFiFi !FiFiFi !FiFiFi !FiFiFi !FiFiFi!FiFiFi !FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi !FiFiFi!FiFiFi !FiFiFi!FiFiFi!FiFiFi!FiFiFi?\!FiFiFi>\!FiFiFi=\!FiFiFi<\!FiFiFi;\!FiFiFi:\!FiFiFi9\!FiFiFi8\!FiFiFi?\!FiFiFi>\!FiFiFi=\!FiFiFi<\!FiFiFi;\!FiFiFi:\!FiFiFi9\!FiFiFi8\!FiFiFi:\!FiFiFi7\!FiFiFi6\!FiFiFi5\!FiFiFi4\!FiFiFi3\!FiFiFi2\!FiFiFi1\!FiFiFi0\!FiFiFi7\!FiFiFi6\!FiFiFi5\!FiFiFi4\!FiFiFi3\!FiFiFi2\!FiFiFi1\!FiFiFi0\!FiFiFi2\!FiFiFi/\!FiFiFi.\!FiFiFi-\!FiFiFi,\!FiFiFi+\!FiFiFi*\!FiFiFi)\!FiFiFi(\!FiFiFi/\!FiFiFi.\!FiFiFi-\!FiFiFi,\!FiFiFi+\!FiFiFi*\!FiFiFi)\!FiFiFi(\!FiFiFi*\!FiFiFi'\!FiFiFi&\!FiFiFi%\!FiFiFi$\!FiFiFi#\!FiFiFi"\!FiFiFi!\!FiFiFi \!FiFiFi'\!FiFiFi&\!FiFiFi%\!FiFiFi$\!FiFiFi#\!FiFiFi"\!FiFiFi!\!FiFiFi \!FiFiFi"\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi \!FiFiFi \!FiFiFi \!FiFiFi \!FiFiFi \!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi \!FiFiFi \!FiFiFi \!FiFiFi \!FiFiFi \!FiFiFi\!FiFiFi \!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi !FiFiFi !FiFiFi !FiFiFi !FiFiFi !FiFiFi!FiFiFi!FiFiFi!FiFiFi !FiFiFi !FiFiFi !FiFiFi !FiFiFi !FiFiFi!FiFiFi !FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi !FiFiFi!FiFiFi !FiFiFi!FiFiFi!FiFiFi$!FiFiFi4!FiFiFi!FiFiFi!FiFiFi !FiFiFi !FiFiFi !FiFiFi !FiFiFi !FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFiaFiFiFiaFiFiFi!FiFiFi!FiFiFi!FiFiFiaFiFiFi aFiFiFiaFiFiFi aFiFiFiaFiFiFiaFiFiFiaFiFiFi?\aFiFiFi>\aFiFiFi=\aFiFiFi<\aFiFiFi;\aFiFiFi:\aFiFiFi9\aFiFiFi8\aFiFiFi?\aFiFiFi>\aFiFiFi=\aFiFiFi<\aFiFiFi;\aFiFiFi:\aFiFiFi9\aFiFiFi8\aFiFiFi:\aFiFiFi7\aFiFiFi6\aFiFiFi5\aFiFiFi4\aFiFiFi3\aFiFiFi2\aFiFiFi1\aFiFiFi0\aFiFiFi7\aFiFiFi6\aFiFiFi5\aFiFiFi4\aFiFiFi3\aFiFiFi2\aFiFiFi1\aFiFiFi0\aFiFiFi2\aFiFiFi/\aFiFiFi.\aFiFiFi-\aFiFiFi,\aFiFiFi+\aFiFiFi*\aFiFiFi)\aFiFiFi(\aFiFiFi/\aFiFiFi.\aFiFiFi-\aFiFiFi,\aFiFiFi+\aFiFiFi*\aFiFiFi)\aFiFiFi(\aFiFiFi*\aFiFiFi'\aFiFiFi&\aFiFiFi%\aFiFiFi$\aFiFiFi#\aFiFiFi"\aFiFiFi!\aFiFiFi \aFiFiFi'\aFiFiFi&\aFiFiFi%\aFiFiFi$\aFiFiFi#\aFiFiFi"\aFiFiFi!\aFiFiFi \aFiFiFi"\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi \aFiFiFi \aFiFiFi \aFiFiFi \aFiFiFi \aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi \aFiFiFi \aFiFiFi \aFiFiFi \aFiFiFi \aFiFiFi\aFiFiFi \aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\ !FiFiFii!FiFiFi!FiFiFi!FiFiFi aFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFi aFiFiFi aFiFiFi aFiFiFi aFiFiFi aFiFiFiaFiFiFiaFiFiFiaFiFiFi aFiFiFi aFiFiFi aFiFiFi aFiFiFi aFiFiFiaFiFiFi aFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFi!FiFiFi!FiFiFiaFiFiFiaFiFiFi!FiFiFi!FiFiFi!FiFiFi B!FiFiFi B!FiFiFi!FiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFi!FiFiFi!FiFiFiaFiFiFi aFiFiFiaFiFiFi aFiFiFiaFiFiFiaFiFiFiFiFiFibpf!FiFiFi $FiFiFi$FiFiFi~$>FiFiFi$FiFiFi$sFiFiFi$FiFiFiAFiFiFim FiFiFi$FiFiFi $FiFiFiAFiFiFiAFiFiFiAFiFiFiAFiFiFiAFiFiFiAFiFiFiAFiFiFiAFiFiFiAFiFiFiAFiFiFiF?T{&}Oj?`gN)U]ֲ_ I =ZN[w}ub1 ac;bU#. > UP5`R u,`" vg 'IKtOe!gUP[MK:yk>);㈂9RA:=;E!4eҟWG fo3B~c@GA pc>4Z'%{T1'*3գoă{rtaz فBGfCR[.Տ 'IͰ-mاQ.)H0eG)UKbJ<295’ Oь\RIc?eSy0e> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4X?"4 (h!h!0k!0%0%h( HH0k!0%0%NetBSDPKwGPaXNetBSDearmv54p@-D0D 0@`Qp(@P`F`F&a03/T@p$$$A-`0`` 0PpU(pGpG@Pq`P03/T@0US #H$X@-lPQMK \!\1 P`0 0R0819  0S  /S 0S10S8 0p ZpG2 pG0@3'q1*03/T@Y p0pWH2H0@3(1*03/T@ )d 0 P0 0$ 0d$DX$$px% @-l llPd@P L0v`POU $&P @nys&| 7 P@-@O-`@@R@<2tHM$H0pWr wP@tH$H(l R @P 1p0: S C`0SЍ@P0`0x= 0S(0S  P0S S0p WP  0S;00 0 epP 0s 8#8T pTDmP   )PpW(s&{&i=á{&H0`  BR` pR RX X/(s&s&@-|0 ($s& 000/&G-؀P x0M@ x# \0+`p p# 0,3+P0 Ѝ&Y@T%s&@-@ M00@  P  Ѝ#A-` l1V0zP 0 @P@TV PC g W@@7{0S@ W@0;0P W 0Xp{V p{0-S Xd7Hp 4@0SV  W T%:0&DO-5MpY xp `P` Ѝ  Yp` 0`$5XP0S 5%0 0 5X0S40S* D$尠D;00CS0 1@ Pp  @YT 8`0 @00CS0X10 X0 tp00]p p@300 80: SxA h+p@ p Qt  X0 0, 03($0000x 00 Q00S> 0 0 `a`p2  p 0Z 1(#00 H  0P \\KP 4 `+X"J 0R 0n0ZZ3r0S P !Y' Fp00 R0S `` 0S  0 <(dJ P <`V k`0 ?oR20S 0  0 0R0P `;P hh`0S H,` P0Rt00!fP &T%=&& &&&s&P(s&Il&&&_9&,&0&0@-MM@P  p  ;0U$C d:P TTۍЍ08 P ,(0P XT%&Q@-@ TP DDd,P $ 0P@T%&Q@-@ XP HHE0"LP $ 0P@T%&@-^y0 Y뾥s&0$/'0$/P'@-}D@-xZ@-sq@-n뇦t@-1   0j 0 Ѝ䜦'@-1   0[ 0 Ѝ䬦P'@-1   0L 0 Ѝ並'@-0   0= 0 ЍĦ@'@-0   0.00 ЍP''<00/@-0   00 Ѝ䐐'ۦP'<00/@-0   00 Ѝ䐐''@-1  ,0  0_ ЍH' 0@- 00 $0P@JЍ X%,0A-`M!A!qX0 p! R0B=0B  P<0H 8 R8B 4!010,!0ЍvPP =`h0P   0S  0 pP0P      0 3/R ! 7000<040LbD0P'''4#=pP'BU, oק0p@-|@PtP00 R 0p800 p0  B0Sqs T''P'0 0 0 /'P'@- > =@-@- < =@-@-80M@0(@3/P $ H08 : S( 0h 3/P   00 0Ѝ00 0 1/qpw0S 00=m8@@-@[PЍ@\ PЍp@-(`Vp80@  03/PP8003/(Pp3@-@P`P }80 (0(3/@w P pwPЍp@'O-3 PMP`(P,`B  0S9P06 0J S +X0\ 0 X0\ ! R(P0,`R!*0 A] 000+ xpt| ][  ЍO0 P % pHp 81/qp4 C ?P p 4 ,w0S4 tp0 0 0 0 "[0 0 0p0 t 0 p0t 0 %0 0 VU0 "SR x0| 0 x0| ~p0t 0 p0t wx0| 0 [Xx0| n 00 0S04L0g004 8pX  FЍ@'r] <P'`=rR/ R 0 0 /\\CC  B0R0012/P/  AA  AA  A A  A A  AA  AA  AA P AAC-lBM0 0  PF0 0  0> ? Ÿ$  ( }/L/AN#b@ DSH n&}//C#bPoPQ`0!!!! d 4 !P`(4o4  " BXX P!d44o4 " B   !d44o4 # B  d44o4 /0mo8p<@0! Y` d @44o4 Ѝ'Mb'$_ Pi|U@-@RsRC- A `00P4 2#&P8P0 (1/qp$ 㬀pU Ѝ0S0C080 $0(3/P 0 `V`PE@0  Y $ - '='X%ͩ@-TAM P04 00#!8 ( 01/qp$ wP9 0080 0( 3/PЍ80 $0(3/PP`#U0:0p080l0( p 3/p #U0* ,0P/`RP `P'=m@-@L M 0Q   0   ^ЍX'_iO-xM0@S M. 8S+ #='0|0S( 000| =" ! !6x00# #/|0 h*& \%$ݍ Ѝ('|r_ 0 X0 S 0E0 WS06  S  S $0S0 600000S60 060 00 6REn R0r0C0C00Q0 0S. ,B< @<68$0`P V$  ( ( ,0S 0 $0P000(0040 0S $Y# 5%'r(0S%0 %00   0 5,0S p5p%0 0h`zXʑH5%pW= ?W09*n 0 mn0 ($m`n0  mp004 0 0000 0@$ (0<@ 0@ p`|LI#n됶W㐚) ` ?W :$0吣(0c#` 0吃u'00S1 ,0S #($`V 0 !40S \ /\ * Sn0  0m 0 Hn !5#  |0堲Ё$0Z`,03  !w0$ ( , n0  !g004 0| 0000@0 (0$ <\1,0S 0`QP V0,ZVp- ?V0)*m 0 lm0 ($lm0  l00,000 0, lm됸V㐩* ?V :m$0V㐓(0吃# ?V :m 2!  0 @<  0p W:X' 4nת`%F )l'Vի Cë«ɫ őwm 8 &?@-pe PP`@@ mP Ѝ`3MU@Pp@-XP8@T`@D p mP<opQ<PpX'A-AP 0P$ 0 0 SQ ( $0P rh d`P, R2DaDqU`0``000Pmr p00CS000 Q   0,`0CS0000 (00/U R >rW8 4AD 0$00 0$ 谑's&<' 'RT0 S 0SP/P/S/@- 谑's p@-XAXT0040S+@! PPP P`04 0PV R@40P 0PU4 ^*00" `0PEP P0P4  P U 4 P0CSR40PP 0 p谓''d%0' 'p@-pPG0`F [stlV000PXn4 0,K00C0Cf 00CS010:PU 0P1` 00CS0Y%0 P U Rt0V00Pqn  t00C0S"10 U00CS000 U0P 0@ Inb |L V 0 00 0 @00S 0S YI' ''s& '8'>O-$RM` 0000100010S u@0Աq`0#0P 00)<0J?oT20ST SRP 媅0S  RZ  @T  Z     0010S@@  0 1P000CS000 Ѝ S 0P  BR l  @0S Z0 0$ '8'0''4''s&U 'gA-0P!S`P@{m 0}LpP0!S P _mx 0HHaH#<00S ,U$0@es&y'4'A-P@dp`T0S P.mG$ 1 \'s&O-`@ ؀P0S p0 T T R R u0p[P Ѝ PP P   P Pp@'0'8' 'A-p0`!SPP@l 0b @ PP0!S P l 0HHH'#<00S ,UpGPes&ׯ'O-@P b 00CS0T#p0@g }l  0`001 pTpP@0 pW2tQtTP0PP00gPRlk8 U, 00CS010 6 u0P0CS0000 S0 0 @ X 000 0 T0 `0U0$0T p 0 (s&''s&'' '8''O-PpP0 SPEUP ЍE P 0C0 X2 Ub000Pk h 00C0S 20  0 0CS0L200 j Z0 P CPE P 000S S 2 `V% V000P kx tp 00C00 0CS0@100 0hjX 0PFHP0 0Z CPF V'P尀VP0PP00WP Bk[t pEl 00C0m0 P0CS0<00jl00`6ꨓ' ''s& ''G-P@`p hP`T  0PS廂P 0@^S00\P0S @\Z \ZP X0 @P*0P00 l%s&K? @-T @000 <EP 0S( 0C00S 0C0 Ѝ 'ht@h%P0 R  QQP0R/@- :  's G-P`P@ X 0S@ @0S# @T@@DT qpP 0S 0 0 PЍ '$G-@P tp0SK`HPUP 0 @+P @Ps 'X0000@-@ 40aA R    0/z&- '40000 01h@- z& '-G-dRdr@`0 0S0 "3( 80?Y+Y# Y{00 R  % i 1@si0"S{ @`` IQV^Y0^Y-Yj @ 0@^Y-Y00@R(i0 01@s@i0"SR 0.Y@0 @R /Io@P0 R00R  h@PR 00;Y0 00 V@ T0S 'z& 'Ds 0@-@00 00UP0 000 ,R;R 0S  S   0;SPp ' p@-P@0QS@@R0p`V P0C 'p@-PǾ@P &i?, ()$ p 00s&Q 0Q\S@-A /`@-0S*  0@000S! PKpP bPP ≾@P 0 S</R/    , 0  'Xu( Q 0@30/@- '00@- R 0C30 'A-ppQ1SPS a00S S P4!`0`00`0S0P S@P0.S0 S 0@00`P 00CS0#0 m W  aT0100CS00 ;pP '(s&G-AP 0pRpGWR0`0`030` 001S 0100CS0H89 P00CS0' 0S   P 0Sp`0 0`0R00 00C0p00  $`p 'G-p0A0 SRXPBp0GB`pPPU,000P 00CS0'0  W  pP 0圑0CS00`PU*P` 'G-A 0`0P0e P 00CS0-0 o& 0FSbp _1S 0PEP0Cp00100CS0 'O-LB`0pS52P UC!0SR0XPPP00=PF 0Q0CS00MO fPP\00`F`0rP0   P*  0!0CS0P(P*SP; 0堑0 S- S   Pf v00CS00  0堑0CS00  e0PyP 's&A-ApaV&ʐ0l00峽PPf 300CS00  0a0CSQ0 QF Ee0S 0`0F0 0\S0pS0 p 's&0G-D0!10ZPpЍ0S0  $SPPPPQP@10`! S:`Fp00  1S p^a0S `10 BRpE` S`l   IP 0a0CS00   '_s&w'( Q 0@30/@-I '`01S @-0@!S @/`P /TP / ' _7@-A0 R!RUUʐ0\00P@d |xq00CS00+ 0 @ R,] R P Ѝ00!S KP #k0 Sڰ 0R0CS0000 0 Q  vP   'z&s&?A-O 0 P0,p W !GY\ϟYPPP0  nQ pQ lQ 0 S @ PP1S P PPP0 nR pR lR 00 S1S P P0PP[PP0 nR pR lR 00 S1S gP0 S00P0PP1S 2S 0Sڤ 000@ `PP 0 nR* pR# lR$ 00 S}1Pr PPPೀ0S!S 4 \N0S 1Sm `P0PPPbM 010,0,0Z0S000@ PN 0!SPH :P00 nR pR lR 00 S*0S $ N i0PP1S PP"G@oG`GooPbVWP 1019P P00 nR pR lR 00 S PP RPL nQ pQ lQ 0 S*0S  !P0 PP RP, nQ pQ lQ 0 S20cS2 P0 PP RP P0  nQ pQ lQ 0 S1S @PPPP0 nR pR lR 00 Sx1So P k{P0PP PP` 0 nR pR lR 00 STY]P0PP PR0nQ pQ lQ 00 S 5 PP? = 0  P1p PP,0S `Vn0VkVpppVpW 0 nR pR lR 00 S1SP0PP P0nQ pQ lQ 00 S   0  d P0nQ pQ lQ 00 S   0   RP nQ pQ lQ 0 S2S060S$602P0 PP R l B R0" 0 S1S 2SqW P0000@ 0S0 0`PPz 0 nR- pR& lR' 00 S^1SU1S0!S DL0S1S d PSS 0S0O 1MP0PPP` gRF  R 0 B Rqa `<E@p>ga0"S:b(pR0 rR0 U0 SP0 R"R  " R0U0b0  `P00CS00 (P00PP2P02 ZP P  0b200CS00U. !2R00 2#20# 02 0nS- pS" lS& @PP0 nR' pR lR! 00 S1S"!P20 2 2020P0PP P pIPP0SR `V0V pվʈ0 nR pR lR 00 SX1SO^P0PP RPӮ nQ pQ lQ 0 S:8P0 PPz& 'ހ Űذwx%t%$'s&s "7-$K''~ d'Dh%0 vQP000P0P@t Y`P 00 00 P0 nR, pR% lR& 00 S1S0!S J0S1Sy aWW  0 <P0S0P0PP1S 2SqXP R  l B R0"0 S06PP0010CS_ P崹 b@p _0"S4mPP00 nR pR lR 00 Sx|2 00S ;PPPP0  nQ pQ lQ 0 SZ0S cPP0S/PPW0 nR pR lR 00 S;P eƺ2S@ P0PP P/ -@- 00> ЍЍ/'$'-0^S0]S0]S S]S[S .0L0S>30  Q  ]Q RG-鐁`P@0 SS&tPD(!RGdadqU`0``0,0!P, _%( $ 00CS010 [S \S @@P`0 S @ 0(a0CS,0p00,a ] L0 0@S G 0ꨓ'$''s& '.ر8'p@-!0 P= P@01SE0p0 SS t`P@0P 00SP0P00 P0 h0T H0r0QP0y^咸0 ,|(ꨓ'$$' '''s&O-bB0  %R R 0R0H 00CS00r00 Q0&Qn0C0 RʴaqU`0``004P? 0A0CS0l10G 0P \QH 0 SP 010S lP/ 000S S)00 S [ U 000P ] t00CS0L00 0`00Pp8 Pꨓ'X'K' '''(s&s&0A-P0 0p@ W 0 `@P 0 R00R00 1BQ]@ @Ph@p]0"S,"@gR000ꨓ'X'DO-@SMpcȳ00 0GS TcsT`0``00mPX]q` \[X00C0+0&SK BR D R: Y J@p RAP+]D .00C0S @Ѝh20   J  BR   0 \SH 1B\C00 BR?ˆr L\ DQ-WppB@ \ p P \D @<f00C0 AQ 0 T0 Tpppp  嶳Pu p BR   @W0 `0CS0(00oq 0 bX'' 's&O-M 0@P0P0s <40S 0 0 000 (0rpP ߍ0P0`#2Cij 00 S pSN(0Y01 Y  $ IP$3\LT P6L  B R+430 # V  BR 200S 0 0b [ 0 0(PP.00Y0 Y L $ P$  BR 200S 0 , Z P0 (0 P'0 p1pG Y;xxZ P@1[õ0 ,(?00C0SuX   R    P> 00CS000^`W 004 00S |xP00S 0  iZ 4 dZX 8'X''s& 'O-pᬡA0M0CQ` 01 00C S00`NlЍ&  0P5 P!` 00000`P00CS000  D[  0S00CS0x00` P  P('4'','$X' 'O-RB0M00bsp 0shЍؑ؁0S 1 0000 P@  0#⩟ɐ Y Fp10S P0p0000000CS0C01;  \" \   " L\ B  @      0C LN 0't%4'l'''' 'A- `P 0 0Cs 0x 0 p0 l   AC^  00@pT @ 0l'4't%0'G-@p0 PR` 0 P(S%0  d P 0 ,(l's&@-Y0 .s&O-eGM0PS@pM$Q403/P v0: SY00W +cD P8:Y?0P0: S 0SP0: S 0S 0S 0/S&P70p0oTP- P 0#ve PvO+D0P ]D#PQ]P /jFP/dFP oT0P+I [(H Z% U8.0. 0PT9.0. 0P @DP ^ PT1RP o R00S$ 0SS 0: SOPN 6  0WG=00 04K WG=00J0SP. TqtJXG DX00CS0 p Pp  pYW pX0 X p00CS00 0S P0SGݍЍ0c ?o25000 8x'P = @ s&4s&A(s&O\\S0\\SX X0p@-@P@@DDT ` U H H0Rp@\\SppX 0Xp@-@P@@DDT ` U HH Qp@\\ySppX X0p@-0P0@44T ` U 8 80Rp@\\_SppX 0Xp@-0P0@44T ` U 88 Qp@\\DSppX X0p@-PPP@TTT ` U X X0Rp@\\*SppX 0Xp@-PPP@TTT ` U XX Qp@\\SppX0X @-ppt t0\@ ^0@\\RX 0X@-pptt \@ ^ @\\R5S %R R S R SSh -^L^S R 0/0/0000ꠗ'O-QMTh @ `u @ 0@0 @0L0@@ @@D@H@,@0@<@@@4@8@5 SS$|\ 0 !00`V0S9 0 0刐0L0St 40D0800$0S00( ,00B?P$p)pP,0S d @?C000@$0D0p0H0D0pP0$ppP$0S00<00@0#0ppP,0S  @?CZ㸰张 0x#ppP 0\#ppP0 \ 0C0CQ0B003/040 0S 弮YT R}S0~ 00 R0! 0L0S XP, x0|R0 D ,0 0\HD5H 5 <P !p \t @@  < * R(" $\  " & P 4 04080080 0Sb Q> 0 !XlX0$0Q: 0 t!dbd0(0$P[(P 0R  P 4P0)@P0S00P00P00PPa\0.S0S~ 0!. 0P$0 0P(0 $ ( R P0 P000Ѝ蠗'"5tVUUU6 ^G-@a!80S y*PP ;-rpW GS+<0SB|+@P U@G+U@U0S5!0CS0\s$   k00L0S \0.S0S ,@0S40S t,#<0Y?o20S X (040ꠗ'̘ ΁ ã"efG-`ήIP0DL0 P0S$00D0H0P0pP㔔0$̷p[|4T H0 `F0P 0 \8P wb84X0 s0X00 00dt |  P PRPS W{( ?R004(0x |0R S S S3 L0S3 T0Sx3 0Sl3Pd#Q`30V L 00Ѝ10@GS0L00P0 00H00P0L0 0T0X0s0X0 00P0L0T0H0~0 00P0L0T0H00X0t0P00L00T00P0L0 00\00`0c0`00\0^0d0[PPX0<0U080 PP0 D0h l0J0D0h0000000>;(00p$080p$0,p30$00,0.000@0(0 0%0p0"0t00D00h00x00|00000000 0D0@PQT wM00@`0S0\0S00S S S0 /0`0St0\0Sh0h0_'ht@|%Ձ l&nȗ'h\h%ks&t  xL80p@-@PT @@\p'X 80p@-@PT @@\p'X -L0MSM\0 + pS0 ލЍ 00 >04@p:l0l 0 0  L00S   $=̳s&@ ٳ' ''$0\ 0S '@ =0L0S/0 0 0/@-00 SM    4 $;pphЍ\0\@ X0R@P0 B ?7 0Ѝ@꬗''ė'_̗'޳ȗ'P `00CS`0p S00 P0S X0X /X(s&: S@-  S  S/ I* S  S%|@=A-|1`@pTXPM !\@T10S H10S. 00 00,10'p 3 l@0 0 0) 0@0S00S 0: S@Ѝ0p 0R0| x0B?hL 0<T00S ꨗ''ė'_1' '''̗'ȗ''s@- P@@P `PU00S @GT CЍp0t  Q \0 \@-U (P@$U  '('p@-P@Tp0 0C0  $A @C-@4M003,30S`sV4Ѝ0 0C0v 0XPS !$0S 20Sh  4 "; $Dp\| ⨬0( `T20S 0@ 0,20S  x0 : SF0( " 08"$4e10SP ;1!0 0P 10S10S : S0: S z`}T1 L1RD1 B?ZK 0 .'Q p , l\,00S 00S (''''ė'_19'B'I'' '''̗'ȗ'''1O-0S$0@010S 10S,0001!0 q0P0S ЍOPa0HQ q0P 0 `0SpNQPPU% Ѝ  B 10`    0S[  L0  $R,   V ꨗ''ė'''|%%('410G-S$0@010S 10S,0000 0 0P=0`VG^pP儠UG k0 0C0 W bp0S$,  `YpP R`ꨗ''ė'''|%0G-@0T$@0@SP 00S,000@p0`0夀S㤐@VG +0 0C0 W ,"p0 00 S p0S$,  Dp` ꨗ''ė''|%@- M @ p ЍT P 0@  QQ  00g@T VP S  s&0p@-0PS``I@P JP POAץ@P4G  Pp 'W=C-CM@I `N NPȐ`T *F 0
pPPCߍw ? P@Nw0S ?@7P?oP@tx&@-O fs& 000/4'@-O0 댴s&-$M0P!00Q00! 00]< rpS$Ѝ "$ 0P 00t0 p0|t Rp\   HH "$  ,04'ٴӴ֠޴? =:>O-L@PQM Pm ^O0Sq  `<P 0S 5P  Kd00CS00 pp/`Ѝ0S P XP `P`(〈1 04 Rt$tp x0) 0 p W 00CS0p pYW 0 P 0S  tAXRP `0: S P8XC P .`0: SpP` `Pmc0S x P@ GPS y[ ,EP >0˯S ,!00  1W 0! 0 pwp|z80H0 P 8x tP LN0S `0;`0`P P 5N0-S  ݦCPT`Ph0S  <sP`4'FPs&(s&_? Pl=|Y@_s@-@ `PP10P  U (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HЍpU \@0 gP4@%G-A~M0MSP 0p`E 0E}0PMd! 0`~܍Ѝ~,P M !0 0E~PM ~,`PʀM ~,vP0pE 0E~PYp  mQ \q/0 00EPVM>$ /%mL,tǶ00CS0 0 /G-\D`HMp I0008T8$8t0000 00 $0S0V"4`0p Q 30Sa3PZPZM0#g/000 0K|#PL0`#S/V 00D30p Q   #P0 0L0"4/V0020"PL0"/2000HЍp(0: S P. S+@ P00S`0:0 03V-V)V q 1X  ?E 3 0~\P F ;0L S0 00 0,BqphL0S0 0V00 V V  1!00!0S ~<0~0VXHPQVS U E XPV P 0%X'('% %D(x'y$%>Y%m8@''%}D00S/@-4@~M0S~, P~܍X'%0@-p@$0l00S Ѝ00 0A0Q K, B.P%X'L0@- R8-P 0 0 -X'ܷtE('A-pP@` P@DTP`VA-pP@` zP@DTP`Vp@-P@T0` Q@P 0 Q @;;S pp@P00T@ lK(0( -( r-%X''Lms@-R@T` V0a@$00 ?00S 0CS3P3@K0 S9J-00@ЍpPڀ;;S" 00 0@0Q P? P00@00" K0S @@K0ES TT 0$0K0SK0S J0S J0S $0STڄ00Q Q`,T( H,J(00 <-$%X'E(mF`1 RS@-PQM R @!  BR0,ЍQ   RR  RQ     P000S, @ 00pT0pS 0L>@Qo 0Cp T03@Q/X'%%xm׹G-P`0 P ,p@P"ڰAQ"@Q 0P P 0@Q=J@ ,ЍP P%X' @-|A`MPh1P0S2 S VPLD&,00ЍV0App0 ?0QJ g, P0S(0S 0?Q#I ) Pڐ0V 0?]C l0 ` 0XPI 0< 3,00%X';j'ǶmݺO-rM,M R(`RX0E@FPk0 0S 0 00 SJ'0S \  L"H2p00 C0("~0"xTn" ?܍,ЍT ܑ0S =! !`!0`ZC =0S|1pt1 00B 04!A0@!,14q0(`0娀01 (0JC0* $00 $0 B 0 l  0  `B T%s&X'E( 'W $tE("0'F('CX\'%mC-XRXb0TBS0000 Ѝ440 0 0S 2r0S 2 f: 0S KpP (0: S0 0 p10S10S PP r0 0 0S(q<\` 1 .:00 0S000p000 S(00(000 P@0S 3000S 0CP 0+0P0 A 0`m9H%('X'DE(E(@E(LE(tE(x'%E(λE(ջ 'ڻ'A-MM$ *P@H#*E P4H"*RB$0`SE 0`B0S2*pGCP{ BCPv 0 s S( -h)d)`2Dr00CSPP)H)D)@)<)8)P(CP0000) 1 `ލЍ)0S  R  sS SS YSP )yS|) qp)l)<)P,BP 0S8 4BP( QA1P )0S({)WPP }vP0000)b)TE(%X' F(tE(%%Ou% 0X r] @E(нMt  /00@-@DpOp`%O-q\ Lt0S(P1`@PPP"@U(L0 R1V10S .)@DT  A,0d#0UPTP)PV0S p )@X`ꓢ" @2/PL0 !ᒣ#, 05%%('%@)'E(G-鈑0@`pP@FcU PppWP<(PЍPT10S (Pp@ 0$03/0PP " R T @ AH,P 80| 3/PPPTT00S\ T(R <003/P 202E(('e%0')'Կ@-AMP/M3@P+ p`p4P/0P0 Uh0h (AލЍT0_"cA/0P0 000 `(4'(('<00CS0 0 /0O-S$M00`Y P$ЍP0,03/P00忞T30 S,@C@s2PPPP 0030SY PV 20S ? P P x4 CSR ^P8 , PE7"( H0/S6PM? AI+X m 10S  P0S !S 0l!202;/P K ,  41  0S a0S 11004 `]0D0 3/`( 0S 0S 0VP0x0CP0%P!P0403/OE(E(0'DE(E(TE(HE(0'4'5'E(LE(('@E('@-@@PE( y'>('@-p @@E d'@-@pD0 V'@p@-MPOp@D0S  0C0D `9p 0: S@S NS ЍpD`C-M~pЍa0H03/P0 03/PlplA]P@ 0AS0@0 a3/PE0 0P)3P/P &P0/SP*> A&*0 0006@ mDt &0(03/ XIkI0 PE(0'4'5's&(s&TE(O-MpЍe0H03/P0 03/PaPD50 S 05P (D%&50SuJGBP 0(03/ |P 0AS0@0 a3/P|4C003PP H4 CP(40S  KP T 0 0  @P 0R S = $ `0Sd003p0St00PUP pS`3`0Sd00/S7PN=, AJ) S0 0  P0SW 0S = $ `0Sd002p0St000S "SD 0 l 4S P d20ShT20S Pl4S S1 0CS+0PS'ı U K0S! Q0S 100= $ `0Sd0P  x1 H^ X RP$PP ,1P40 P Eg @ ;/0S0S P0S 000[\000*4S 0S 0E(D(%E(0'TE('E(4'E(E('0''5'E(E(DE(LE(|E(%@E(G- R@p T T 0 $@H03/P0 03/P0SB0 X Pqa0 09p1MP \P: 0 P0(03/P@!P0 0 @0S 0 00OP@& QsP0 0g p0 0S TP \0 CX APE(*E(DE(E(0'@E(LE(λTE(tE(W'T0@-0S^PP 00H03/P@E(E(0O-M MT崐 $0, P`%l'@-0@000S R ~ R~<Àʂ;;S 'O-`=Pp TYM[$  00 0 @   0(`>@20S%0P-[`,2 1p PP10S 00$ $ P `P[?:8|!!R?0d!!(00,0$ P@?:8!!0 S 0P ( R M0Q0P Yߍ= 00 SR 0*($!0`P ?:8P l!@D0 !RP *0( E(%'yA-@(0S`pP匀QP 0$ 000 00/ 0$ 0S0(0Pb 0 '%E(dE(0C- 0 Ѝ0a 00CϠP 0P  0 pO0 "8A$W@ 1P 0PU@$ P@0 0$ U0 00CS p0 P S  00 UP@0'G-pP`pV 0BPiPPEUP@@  O=`Fp'O-钽M00`0PQp@葟 0(P/Y0 0㤁$0T0 0 BR#- P U5T0+\1@00S0T0S 0 :4S  > 0!b ?T0 00 $0-PUP0 0Ѝ R 00Q0 \ 0 R   R\00@To 'E(6G-A`#RPp㌡O0S5  Up 0) <000SPER0 A 0P! 0p 0P0U00pPF0P0 000/`F p h<00`00Q bQ P0 S  PF'%`dE(E(p@-0@0PpP E;0Pp@|'%A-`PlplU@0@DTj@P U@0 !<00`PE'%G-P`ကpU0@0@DTG@PğU 0@0 ;0@UP0 `'%O-pMM =@ P`;\1 0S XP<:8$!5 U00 J(6 0 BR P#?U0 P0PU0o0'PJ<8h @D 0RP J(L J<80 `MߍE(y'% Q/p@-JTUPPt<0P PpPh<4$ R0 40p8D(0@-PM@ Ph00S Ѝ0 $ R\ 04 0R\ GE($0@-MP @PЍ000S0: SxH7PPU <0D reP 0-<0 E(r] SLE(0@-M@, 0000S# Q0S 10S MP'0S% X0 ?A3c000S&!h0 ?A3c0 P ;0NS ;0X Ѝ0;0< 0S 3p%%Mbnp@-@P`(P p P $0%-;0 pLE(@-!@P 0-{;0@ LE(G-P0`/Sp/M/C+@P7 P. kp /00 P&  P!00S  (P P0 DZx ЍE(G-@P 00/S $QP $00Q  G ⥐ZP;0 0b`0S k렐p0  P:0S@$<lp@D0o,40 ;@ÒD8D( FE(]LE(gA-M`P@p+P5(10S Ѝ 0RP  0RP 0: S5P KP:0 PW ȿP : P W0 @E(xr] 0@-:(4@: SM=0P - \ 00[ P0 p 0: S ,WЍ000  t:P/  0 fA-`QFZDT@=P#:0@!81P @$<sP10SP+(0 0 0 0 00! "4S `-P9`0 RGّ0p 40Ѝ(tS|(tHPd b00 0E(E(%%8D(O-Z#Q30` @ (tJM Mp4#0CS0t3t4P d30S P0: S X P 9Z Z30S 0 "q"{pS90 "X 2P @$<P RPn (4`S42T4P @Pu⾿PaO9 0"0 + l0S10Sa 4m0C?o2 000! "2SJ>0@@z=0 C۾zW @$Jލ Ѝ  8r p G@$<pm ?4S(4R0(4 \ QX00]0S0(4 00P 00# tE(CE(E(gE(E(%ջ%0b/O-p@M 0W0DN 00S08 0<0 WPP0C080pG0S 0`S * 0R 08 0 x x.  P8 8@0 X2@ @?B.Q*8@0 0嘠P P` hyЍXX  # ` `@F(F( F(F(Rs@-Ѝp@ 0@`P-Q<808  P.80 HD(0@-@MPP700<00S  = J"Ѝ0HE(G-`QM MJP㠔@ Y #p P 0p 0PP=! SR J(ݍ Ѝ^PJ78 ;= $HL0Q\ J(L0 00-QJ78 PTy#A-QP 000p@T+`00CS0mpT0 0S0T@ 0S@ 0 d P 0S@ @T@ S P LD(\%(s& XD(0 0 S00@-@R00000S0@000S `P LWp 40PE(E(LD(E( =HE(p@-PP 0S|9p `Œ@P` 0@P0/S000000f PR @@@plLD(h0 RX R  H R/< R/ $R/Q/ LD(E(E(E(`0@-0S }L0@0T R S$ ٲ0@HE(LD(s&O-b@ 04MS0S zB>0m PP p0 0p4Ѝ5h"0C S.0P20S 0X0(00!P0 000" "  0!$$! 0!㓽K Xm5($ * R=  R7  R$  R03 0T! ! 0J (! $1$v1P7 R  R/  R $-0400S ̈́!!" # "040+04 P60\ 00  0 0 XLD(* HE(1 tE(ջEp@-8M@  )D 0`P`⬎U`$ $ @ 0iP8Ѝp_iA-t1hM0@S ThЍAh'`Z(;="(<p@I1WpP0 0000p084 ⼱40CSH$0"60"$宱0( 婱4 CR+x ᠱ*'hЍB>'P嗱S+<  pDE(_ui @-@XM="p:(ڏ0 NXЍ7@-@Pp V)P Q Ѝ0 0k M Ѝ0@M0S :R Q/ 0B\/0@ P 0 0B \0@ AB\7@aB\/W@Q/Qq(0C\0S*/ \ 0W!0C0 0C S*CS*/ P@-*0S@L0 ? SR@C:@  ^:R \000C R00 S00 C@ T \A C@T2  0a0C R"  0C\0S*/ \ 02W"!0C0 0C S*CS*80P @-  r//E(A-@((PQ U?-QQpW $:WP`0 4?`S AœA耖0:S@0 R  0 `ꈊ-pD(l&s&/,/s@- `+0P PQ10*@PЍp@P mR bR kR%$+ *R xR R wR!$/QP@P$+*$&0!SP@P0PA- 0S`Pp ?0P  T @R p00T0p0S ,d#@P0=0^#PPkxD()Rs@-@X`P0l C300PЍp@00S S@@PP 0 @D X200xD(@-  K+s&i0 Rr @-/%@-00J$(J J Js&tnG-p p8@d\P*p`30, uZ/00 `X 5O-lM/ _Po h@P$ `P0`p/刏0/ P0@  p?p/@p`?\?A0sQ S  R8?8/00 CRJ?zP<N>P ,c>@>0 -R.Q0 00 0|> t>t. l>h>d> >0SPp2 <>  = 0S > 0.0 .0-0==P====-000X=00j=@ T ZPPlT| -1 ! ` S=<-<@0=,=<PE < -<-<,<,<,<,x<,<{T< d<{05p7 P00 P@00Jp`FW$Pp@P,PPP. @P$ C,PpW! @:,P䈟 'P rPPPuZ Po{PZh\,P h0S  v( ,P 4 +P  @`707C0C0'  7bp B;K&06 70 0i 嵬W0d0?oT0cQD00CS0R -EH7zRB00ᘃ@D@86P (- 6@  |6@ 5@ 5  6 @ 5%  5@@  t6@  5L p5LpT5ş0xC0d RK aR eB P Q,% %00%000 00K_4ZPJX l5J S \5I N 4I IHG< 00 50L044PH8  G#L#G3#| 3G ꔃ4 T ,tNG  d4F <3T< *P00F <Pc2~P^E 3E  2D _3 42Cx2PBC\2P;B 2B  L2A  @3A  03` p2`21 11"1+S0020" R002XR0 B+S002 C4 V0 0S1P" @*SS@p0Zm P000Sa00ZeJ 1pP0000 S D0 DtE(CE(xD( F(%~l&%s&LE(s&4 -'R%l'E(p'hE(E(%nE(E(%E(DE(E(N E()E(E(.%$%%%%%pE(%E(%E(|E(^6(s&٠`%nC, * E(E( %AHE(E('Wm7 0'E( 'E(E( G 0.S%gxE(0P  /xD(d0P/X00@- HP808)P:  吪FxD(E(tE(Cs&A-`  @?\, \PA *\.  Q R( [\SPQU !\@@]^.!Lo \0QS8 /0S0 R0SP/ S QR S0*S S 0PS 0 P0^ p-W pW]W UU @U E(p@-@@0/SN00N P`pPQP`Q*C0CT3A"0L0AS*pSGp@-1MPMhP/(P |'0P0SۍЍp.S@T|`l @ @VtE(a   0@gO-cM M 33 "@p53]PW1`0 00S  g  0 ⇠Pa` 0+QRV~ @  +  T* R`DV;  acݍ Ѝ&R* \R%1@\ 0@R R P BR00CR 分 0@&P\P   (  BP+T- R* ` V$p0!#MS@ 0 8TS 8TS p  0i 0 x@T *0S0T00  R S 0 }0E( s&C-`PMM RP  \SP R P0S ۍЍD@P p P ;[0 Dင  0St\S R PPdP `gS PS" SS GS R0 x0pS sS0S080 R @@@&W0E(A-PP 0SpD`ṕ@PL P%40  R p`@@ @0E(L0@-@0T  S   0@0E(s&T1 RP p@-ZDT 4\p \Q Q 0T*  ȃ04P  0S/  00p0S/  0`0i% @0/S000 0D0 R /0E(E(E(.0A-j40@TPp 00S0o`0 00/S @Tt0T0o&P0 SD jp040E(E(E(2A-0@SP' 0`.S0.S0S/S Xw`P 0 Q CR S.R  S.R0S/S C 10S510S ;P:4 CSR ! Q0S 0/S0S.00 `$ 00C00S080 `V">_ Y P:4Co S Q  S  FP  ! C 0C0 0A0 B!"00@z&R A-Q@pW :@ ; 00$0$0<0 0 0ݍЍp$u  F(p@-@  PP hp@>@-0P-S0S' g@P#E^x 0N0p S0 `CP`P40T Ѝ@p(s&-@-0@P   Ѝ@Ѝ/0F(p@-@ATp@0 R PXP ` ` P`p0F(-P@- 00|0 x0x 0 0 h@0S XY00L0L <ܙ ,差$ Y Ѝ@ Ѝ/dE(E(DE(@E(s&tE(p@-x忢@Pl=hPP X6P p-000S  p0F(E(  -P7@- 000@ 0 0 0 P0S xX00l0l h兙 X`TwD 8y0 X Ѝ0@Ѝ/dE(E(DE(@E(s&tE(s&@-= c9's&0@-MM@P@Mߍ00/SsRPtnRP ᝣp T☣p  0RP 0RP 8Hr] 000/8F(@- <s&A-q`@ MT pphAPD00CS0>@ Pp< @Y@DOoB0S@ Ѝ0P: S ͢P 0S Hw X uW 0 R@@p N0App Tʘ0 @00CS040 8F(cs&q_? (s&O-PQAMS 00@<S =S 00@|S0 0@&S0 0@=S0   +R'0  -R(0 )%#$0 z&$G( G(x G( G( 0@- G(0s@-0P`0W0`0@S P 0R@P@   P@0S00S 0ST P000 R  ЍpG(4S(% 9K  @-AL ^`X sr^0 \? :1#P? L 0l0̠?0 c0àΌ SQŒQQP0R0R0P0QPQP !꽄 BN_O-p`p됰P0@%Sq0V0&S T4e! a0 00 @ P@P@G(l@-0@!4Mp HT` 0 P@4Ѝ0@P S5WP@V P @0 F?P@$ P@  ZUG(5tp@-@P0)SpG(O-@p`,MTP TS T( T) #T! @$TO "T 0@#SP  +,Ѝ'0DSYA `@V@@P'0ISV'Y00`0` H ⣒ T! z! 0  @@P! 0  @PV`'T@@`@P, @ o  G(z5tO-p`M8P젟찟l!@ h0 X@ 0DS'00S^^* PU @ 0 c 0DS00SY Ѝ` pUU G(̈́ C-锐p`  0BS0p0@SP! 0 00P@@@P@ ЍG(G-`dP0@S! p0 00PP@G(@-@MPC1`PL0P  IR NRpp PpEp@@0PS@ $P1ЍG(PG-P-PP* `0@䀟00 0R0Cp0W S `S0p 00 P11Sp0@0PH0@P 0,P@1_%% N(4S(=@P/- 0/SSS00(G(0@-@PMMMߍ00/S \妜p ⡜p  0RP 0RPr] p@-`\F0@P 50D0p@r0q00"SP Vp-pz(G(p@-T` RpH0@Q 8 PP  0pp@(G(8%G-pWR 0S)P mB000000000CS020S @T  |S p S\Tk/o424b0000@/Sp=FpPJ0S0/p0CS0pppW000000pA0P00 m00/ lR `R00CS0<10S 00CS00W00 pR0S/S0@D00|0@P  R*0000t/S0S xP 0/0CS0 pG0S 00CS000P0@M0@J0@(G(HG(DG(% N(% r] A-`p0@00P 00CS000S W0P0CS0d00S H%@ HW 406 R0S 0OHG(DG(%(G(G-2M6r0@TPS@P 0.S00.S000/SS?X20PpTePZ( ,`V IPP U` R.` E0EnCn@0-S0Sp1@T@dRP.ٚPw t0S p.pP  `P |n 0: S W p.pPXuP pW ?0S ; S.pPЍ%0S @T H1( aB@WG8UG1F0S  1$ Iߍ0A 0 000 0@P00CS0 0@ 0 00x0 =00CS0 0S !GlGD0FX00S d@00S ^60S >0S$0S 00D0$ 01C 0>0S$0S h@T @ xPP H0E7S 'x0R8 @>0S900SE $.000a0,0(00 0p(0 p  =&0S(7S%00S 0 0S= 8  h=, p@ P 0 d= K8 P= ,=, R , ,( $P000<=0S :U0 0P)@I.P  @J$ 0 $ R 0T@ =\<\|0<0EhPU p`P,lUI0l PUY00CS00 JE 0 ;+EBT 00CS00 4E 0@n`P 00yF00CS00 E 0@fF @PT 00CS00 E 0pPF @P Z@P @P07:0P lmPP@HPL: RP00P0$ 0P0S `-V`-V P0E R9pPP$0\0C$0 01 0 H$0SP   7S 0C8#8S0PP)SS @708#8SAP0 Q A!Q8 R 0 00 Q0 -PP -P R 0S0(0(00(00S  d8 @  (00(00@0700407<000LpP7 7H 00R{0( =$0SP007dGQhH 0'000 000 x7 0p'0l'00$(0\7  10103/$0 6 gE(7(' 6 ' CL0S I8 6 6 @ R[ 4 0  V $CX p&@00CS0 jdP60S P l60S%,0ɐS5H6$58 h0 J5,,0( 0000*,0( r"0\E$0(0S,$ L5 T50S O5,0S pt:%0 50S =0 @0 @P$ET'=0 0<0$0 0C0 000lD000d4 8\XkO00CS0440S |P( T40SK)T0SXVO"I8 3 3 3 \ 4 03`2)ß00W:d3 0 0S '|0R#C#0 0 x3 BphI00S0T0N0"0C0000 OH8 2  t2  p2 \ 2 (Ÿ00 0X2 T0S8"00CS0 2 R   01D0S#mߍ910S r0(!SS}1 08 L0H@Is10@0@0S L1 @0S1 01$ @0S  1@0sD1 R#0S,1   B  @0S @0S7S@< 0 00S !9T@,0S0  <,0Sh@3 BD 0,0 0H 0T(8S(XG(4T(4S(%P(HG(T(0DSG("A- 1@PM`Rk01000  ;p !XZU p@@ Q X@T@Q@@ 08AS 00CS00 /@ 0* 00CS00 @ 0 ЍQ m@@U P000,K 00CS0T00S DS@Q@80 T(`x=%HG(DG(p@-P@@Pp 0S%SpfP @ꌑ p@-P8@Pp 0RUPp@ - @0@ R0S P P\ 0h%G(G-`P@唀0吐00|Up00CS0h00SG;0S0 S 0S00]PPpHG(G(h%DG(A-p`P0@00 Q' Q:R @":QR!@P 0`EJ0@S`@?%R00S @$P`0W:SP0R@T('h%A-`P倀000|Vp00CS0T00SA0Sp00/Kp]@T`HG(G(DG(0A-pPS R+q`a@T"W p000 ^0 @0 0 ;_00CS0H00S `iP `@G(HG(DG(p@-P$@Pp0P0@ @-L@000@00 ]00CS000S@XHG(G(DG(O-PM/`@ 0P @@@k (]P00š0 0S 0S 000V#   P@  :P @cPM R RA R 0S   0  003 0 03 Z0 R"00Ȳ0  *pP7Z { 2 @m 0|>00Ѝ H" R," R8pP B0000S R  pbQ  0X/R0XZp "P pP t"PO R K R G(⢊P0 * R; R 60@@DL P R  UP@0000S R    BR 9D R5 H3 PT(h%G(%eHG(%DG(O-`Pp$M `x%@Pp2, 0S*[ 0 00P@0  p0Rp`#0`2|P& ZQD=01 =@$Ѝb@DT@ P  p R  U 01W VYXU' [1 00al 0aS v00@0S v P Y>W 00SY0 0 S0 P 0< S0X 00yH 00CS0$00S Ѝ0@@Ѝ0HG(%DG(@-yP 0SHO-`pP@Md$P0cS @@ <>pP vPP VP@ 1 R8cS" %U<rP3KpPA U=< P4 <@<T 00S pB00CS00 (< 0 0@ T  Ѝ 0RPU De<b<@X pP`100 0p  `F`l1VD0/(PX81 0 000SZU0WE<PU9<U~6\/<UU Ut Ud;}8<N 0[1 GR00#S00 B00S0p0 G0 B0(T,Ѝp U   p  R00SPhTs T(H(%% N($P(h  w 4S(6QtO-0M P0 4帔0@0~Q 0 `p0 @Q Q#:Q =Q Q  Q@   4  BR  P AA `3A PW 0S@ЍQ Q@Q =Rp `p(`` L  BR  wp w     BR u   u   BR   x ( R 0BQRQ B  W `   BR  vR v 0AS Q AQ~@P /  Q @S&~  ;@@ X  7@P  #  ~R =Q0S 00    @T(%H(%4S( N(| G-Pp`d1dAf0`S 0X00P0H1 0081 (pppV0 S000`0`0CS0!0 p0开@p   0    0  R 000p 0p %H(% N(%4S(0H( @-0n@l%O-TAT`0$M`FA8q00CS0@0 PP 0@I0E P0 0C0S0AP 70P0 R"Y 0CM0PEPE0000C0$Ѝ0000H(% N(4S(5tO-R`p@P[ 0 0000PPX P X 3 0 E0CP00S H D/'(04  @D,0,0D c&H( N(%%\ O-Pr0BS,`R&@( ؂  R [ 0 0002``TP `? Tj T Y@0T: 0P[Z  R@0@Y0@FT: 0hPD BU# 2Q0 TQPR D2@Y@FT: HP7 DU0#0 2S 0TS0Q00R D2@ /PY 0S@@T:@PF0D0 0 C00PE0C0`FT00 0 D0C0CS@0 000000C00000000H( N(%C-PpM@`᠐B 0嘀00000p000CS00 p0@ @XЍ00pH(% N(%A-Pp@.A00CS00 :. 0 ` V.00CS00 #. 0 ` V(`j.00CS00 . 0` ^%f @-@-00S/ Rl%T0QH0 0Scq o/P0//@H(l%0    B /@H(A-P夀0@000p `R$ #0 `0T @   0 0C  S000SAIHG(l%@H(DG(0A-P` @0p0W0 P 0X S S0 000 00 0h0 $P   00T K00CS0 00SAl%HG(%@H(DG(A-bB0 pWcr 0S 9-7-0S@0PP0/xP2b000r0S\00CS00  0S 0X0#S x P  xPl- 0 0p0P0 R R A   BR 0E0CS0000`0\00S B-H0,`8 Ql%@H(%%%%@-L@00CS00  bp00CS0@Y@H(@-T T@08      00000 0$00@H(l%A-P`@000g$ xV |`0Ph$p0PS  D0  0000CS0 00SAHG(8&l%@H(DG(@-4aM0p0P0w@P >yP(0: S$ 0s  wP  Pw 0 00Z wd#TwL00CS0,00S ЍHG( %B\DG(A-h@Q0P0`0 PHpP<0`00CS000SAHG(@H(l%DG(p@-`P@00P0#P 8J 0S001J0X 0000CS0p$00Spp@r+l%HG(@H(DG(0/l%p@-@(`(P0SSSpl%LH(tp@-P@0Spl%LH(p@-@Pp P0Ppx#0@pl% 0 R/t% @-@0@1^ `   VpPW  Q Q 00 r B"Q q A,PU 0  0 L(5rOt%A-R0S20SP`AT p !#vpp "#JP + 1N PpWvp v 0P 㸙'''v qP wpfK  Ip,ZsK v P vpKdK  Ip@YK "00a'^'['`L(N(t%/%N(0S/p@-@PP1PL1D|P0a 0(00R 0S"00Df05#0s  0C?o2^0SP*pP JLP p0S *00CS0p\00Spp@ Ao PQPL(5rOHG(E,DG(p@-@\P0P00 H@00CS0p00Spp@HG(DG(O-@pTM R0 TЍO*ؠZ* P`PZ   0SPs  0 S S S P R00S0S@TЍ0S|22 G! 0R+  p  !R-    x"f*   0P"[* 0sT ,J  * 00CS0)0 X )؀` 0S 00CS0)0 00CS0)0 | 00CS0)0` 0Z 0Zi)000u * #40  ) )P S#4I  0 k l@ h  X)Ѐ 00Cs 00`Fj&L(t%5rOgpu}@- 0 S  .^\Q   @ S0C $00P0R0S O-PP10 0%SW P 0@S!!Q@ C$0S 0S  R-S %S +S @@1@YZT X@1 r9 002#00S 0S 0p?Sp  @$P T"@` ] P P ` \0@00SJ R Q !" R @t%L(G- a 0S Qq0m0@S; @ (А0Sʬ00CS00 P( 0 )0 R  0 S0!(L(_00V00CS000S 0S @pWZ00萠}@ w0 Z^EꙂ! P00 R @L(HG(DG(%A-`!@S1p@!P IS%Tp1@WV2 `1N0SN U 0S0PsPrV 1Ep/HG S#P#060S$ I#F#C#VF%C%U 0S nPPr\rP LLgWT 0 VN(0 P +p O-D450  B   B /@-@0S@p@-P@0S0ڈ70@0 2B ! ! !!  !!p@-@8    @% 0S/xQS  00 S/00 0/0S/0/ 08 0/=P/P/0/ 0 0@-0<%?p@-`R`@PHP "t0 0Ppd0 Pp0-S0S0 0pV ($00080@pM( M(T%O-RM0p0ep R XT"T2Tb @L 0SRy RR00CS0`1``@t10`0@Ѝ\Y.R %1 P&  BR 000$p 0 S B R  Y000pZ@W@  BQ@ Y Y  YR  Q P Pp P  Q  R P000<00  Kp%$ %% N(%0@-0@M P R` @p0 Ph h "V0L U<0< 1 001 0 %bz$ @-P@M&0 0P0S`p`@T*vpPT @T2PLP @0 P2Ѝ@%%PP(l000S p@-XP@T T D0T@p8040@p 0/%H(_T(p%tT(@-0@ZH(p@-d@dP(\Pp% P 00008  P8  p@p%%A-$R0@T @ : R 0 @ q8 0 00CS0!0`)V#V V v vZ A L`p! 0F S0 V@0000 @\V. |V ;V&P @0 ;P @0 @0 Pp&P@0 @0w|P@0 @0@0@0p P  00P000S 0 ~%p%@H(DH( | G-pj0@0 T T+P,0S)㰀" 1PP @> ]qG@`P  0RP `FFa@@T 0 % p@-`0$P P m 0R$, (@R   RPEPx    Q d 00000S@p 0 BRp@ c080@ p%@-y0 000%@-@oP#p@- @fP P @0 000p` P #0`@`% O-鸑`P0 b P@BPp0 CR00 S 0@@0XX U @P@W W. V. 0@PpGW PV oVP 000 0V wT000Sc 000h000S@ %$ G-PJM05@0 0 05 P00U400D$02]`P M 0S [1 $ 40  4 ]$0000 `SYT4 ` R84$ 4$00CS0! 0S$@PUY3 0RPPS p.0SP Px ,30S ex3|@|3|0pT00 0S  0 `PPB P6 \P p(300p# PP0000 0 0 20 B#200#"U0S"P R \00\0@0 $P00CS0 P@0000 @("00CS0 0010DPt ;o@@k1000S M 10 A0 SFp!倁V@0  0 0C08000x00 000CS010S)0@0 0 0 0 02 P B1 0R zz0u`@0PEPUZJߍ200CS0`bR \{00%00@S0p@4p W00C0t00j,`0@?o? @2;R0Sp |\P\Ppt ?Pp YW6;G S8 5:0 S`@0 W0C *0?0'3?pp000 S0 0C0~00@00C0p%W!*00'60'3?00 Q~  B  ?pAp000 S0@0C0~0@0•3W5*00'90'6?00 Q~  B  A0'3?00 Q~A• ?p Bp 000 S0@0C0~0@000C0w300'<0'9?00 Q~  B  A0'6?00 Q~A•  B 0'3?00  R~   B  W?p00'?0'0!Qp R00C0@R 1 00C0v001`@G0"0 !0`0C0w001 0`0C0v0(PB(P0@0C0y00 0"!0C"  0 0L$2  `!!J00pS 21 냐`00C0@50 0C0  00S 00C002  B )Pp( "1@0C8#8S10`0C0x0000C0p0 e00S210"QQ 21Sx0pW 0 l0 m00CS0<2pP0@D21S;0 0#<R00S2 0S+0@SP P1P0U1 UP>Y/UP2>P0 |P!000P$@C 0Ѝ@PB0 ,  s0P+ 0&P00 0<P_ >P &P 00p0pr0((0 @ -P 0(0  p 00@0F%p% % N(% @H(DH( wTM( M(z& PP( %  0{P B@ 80 } pL0 {Y0D 00 B #PD}P@ 0 0005 }P' @ 0  BR '~  =0 BR@ =0@[0%Yy :Y4 #Y5pt0@ 0 p0I Q  BR J[ 0 @ Rp 0 B p63Pr lPp@< [ B + R:p%pp02!R1S 0GS2@0 Wv /0W2 ` !j !v@R n@pYp K/o}Y" R 0#p0CS0p pP@'P023Qw0  00"0 `!1$0  0G-`̀0@T@@0PU @ 0S 0 0   B/o"W`0p 0S 0 s 0 0 0% @-,P0@-2aM0$ 0 10< 010@0}1|0000{VPI@1| 1Q @@005x dr 0S $Q. 4QG Q ,4  8000<  ,000 0 0 _0 0 0 S00aߍ0  p0 `0 FH0 D0 H00SVS,0タ 0 V U0S00! 0 "1P @' 0R00CS000S Ѝ@rZT  0P' 8XHG( G(%%  DG(Rp@-@`PP Vp ' x޺~RpPV jsRpV `y' 0P0 p(pG-` PppW@p  O0ȐP0S TX  >G:  |40@ l.V  T(T 0S @V@ P%|_A( G8 Dֆp@-P  @ Rp R  Rp d0 Rp  Qp Qp QpEP(%Mp@-@PpD0 0RPPp03/QPpP(O-@$M0@000`p@A p2@ 尲娒V 0S"2 0S2" $Ѝ@0Sp2 R@00CS 0SP P & QPswPP jT Q0SX hPSkQP0000 Sk\1 0R  VQpPD0C S =V&  O ?QPP .0S( 5QPP0 RPU )Q0 400CS0p00S ST0 00`Y0SP(M(%%% M(HG(%DG(O-P0@ph#hcMdP P00L#B.p-0U40@D[T$Sg 0Tq00 0`V_ %@`00S0SiP0SU0SR0sS vS UP0+S -S P ` E 8Q (` R:  P     %PT 0 @0SA0MЍUF ` p0      "TR G00D]% 婸r   %5S ?Pp.G% 01Pp0X0 N J 0D ꀊ-l&-D M(M(u( %<A-PQT 00CSPDq10SK R@ 0`0CS00 `01L00<S R 0qL0S 0CS>S RSxh R 00CS0N0 - ( ^ Pp@-@0TP R R R& 1S# 0 PpR!Q QT " "D0600S0T0S 00S0P(HG(DG(%@-@P @#POPkX @-@P FPP0  ;E  ^R(Qp@-@ 00CS00 P `d 5?U UH?Up!P0P0CS00 `=A-@|P|p0`00 T 0000CS0H00SA>0S 00S !@HG(P(DG(L P0  /Q Q0 S//P(@-b@0pSM10S 0SPP10SR WUOT T TP160SPPP0SP;x1N0l16 R6`! R20SPP0Q: xp3 0S$ UEop' W`RUO0@D>T000 0 r00 SNTPx0N R T  DR 60SЍQ Q2 1 @$ P(N(%8P(PO-@`PgP paP \P0@DpSppTPA TOP@DP:P5@<EP, (4  7@P@sSa0S 000 T $00CS030S 4@@T00PpӪTW00 T\W! @P@s 0E0`P 10STw@ T@@VPT @Pb1 R 00STV@ Tx@P@UT X@Q0S 00S 467@@TppYW `СȱPEPe ?P@1 z10S VP`0-S0S`TPhOCW W0S8 _90S4 0@ V0 S R0V00 ;`1 R  T` F00CS0400S V? %jS%P(HG(DG(7 wm %BG-PPE o@0p` TUG0S 00S 0@0@000CS0 00S @P(P(HG(DG(p@-H@P02`S@20CSpLV02pP(40T0P?o20S 0S//P(C-p@`1010r!Q0@S10C1 ЍqXPU X2 PḷmP 0S P(|G(?0!!R/P/P(p@-8P\2Sp@\BpP(0-MM01`"R !R X"R   1 1d"1!d2S ,JPl1, ,JP L!0,00J@P$1, c@T0dM`0P, U @T 0S P<00CS0 ! L00 0$0(00D>S 00 KlMK"!031P(|G(0@-MMP EP Mߍ0zEP@D 0RQH0PP00@-MMP aEP Mߍ0YEP@D0 SPH0PP00@-MMP @EP Mߍ08EP 0RP 0RPA-@`MEPI0 0SC PDUA DPPPpDPJ! 0RA@- 0-RS# 0S0 00t7 Ѝ0SX0 0P0S00 040,墹P$  O 0@-0P!S@M0SPЍ0Pi 0SfPUo U U U DP7 Po0DPL1PEU@P b  P  P  P  P  P  P P   p0St00@~DT @D0(S0)S0 0Ċ p@-@`P9Pn 0Sk0 "0CSe0o pPPQ`@MTVF@`BVT;`@7V@0`@,P%`@!P`@V@He0S p0!Sp(S0)S0Sopي p@-@PqPPEkP*0U%P0opMpp0\0!S@p  p(S0)S0S {pR \@-Ǫ0}%@-$0$0 00 oG(%@- @ R1P\ * wЍ2O-`@<MVPpF0-S0lSA 3S -Sw `0B@Pw2 000F @PlpGW շPh TTH`0%Sb{PPXWpW 3sS0S`3pV`/F0SpFPPW1 000 @P@@TaHBp ^BP t٩x1d@P A@PPU0Su@ BpWpGi80 0 < 0PV 0S  P1r0*Q"0S 0Q\ xةApuX P嶩Zr  An_z&? HgM%9K X i 0@-DM⼶0   0@@DPU#@@0 6  #  _B0P x, pp Ld DЍ0=ឫP LH(H(. ^%8;p@-#00S 0| 0x 0p0p p@0   PU P@P0P H0H P pz PpI@G(@H(HH(\P(%P(%%%%%p@-@!0@ӵ` 0 0@0PU@6D000dA d0 R 00CS0H00S p@@C0PC|G(%L(%HG(R(DG(P/p@-@PTp000@A-@P`pT0   S*0 @A 0000   尴0000@ Ԓ 00C \ /p@-@P P0`@  0!S00 0 000@0pO0 0  0 000 00 3  0 000 Ԓ 0@-@PM  0  U  0P 000 0@Ѝ0@-@`PT@ Ѝ0000px@PP000/0P/  R /BP/? 000/T( 0P00/T(A-@pP 0` V  V @00CS00  0@ 000CS00  0`T(%A-`@pxT [TP'T TG "T R廧 x1 p\0DS0@@7T/T@ 0`00CQPRA`ET@@0P0  aCQBW0CACQ70C00CP@V `R|v ``0 \@RTk 80 @ @ @ @ @ @T( z&Mh@-P`p@P \P 6/*0 cS 0<0 Ѝ0S0P@00 #100#7Q0S0AU@MS0-S@6/P^S   C@^S@0?S0T(z&0 0JG(%p@-0S @0AA00p0@S tPP0 0CC``ߦ00p"Pp0`0PPE,EQ0 ͦ00pT(>@-P0`V) 00  *0 0@00p 0 AdAᨦ0@0T0 A$Aᗦ00 ЍT(z&M@- P@pYp `R0P h@ 0\AA_00 ЍV@@T @ 0AAbT(@-`0@T/ 0'R"R0PP Ѝ@ꈸ P፯ p+0BP d0000 0 A@A200 Ѝ,pPT(z&G- `@V@TP L0@`0pF ,0p@P0T(T(0O-ph,M0X0d8P P1@01% Pp PE@ LP Xp (p80PEAU,Ѝ0  000P@`V7 0S 0S\V $h7P00CS00 87 0$ %V0%S@700CS00 o6 0P`O0p*S`p0.S0@*S@pZdtX4`p@.p@0xZ0WZ%Zq A0J R %X0J S00%S00;됅\P o * P \S \0t\ s00vG t 0 zD\ \LQ b '\ \\ "\  \M \^0? \^0@-000fnrtvaet 4P0030  C 1 01Ꭴ렓`P d` P  db  Pd  x㤵s0 v0 t 0 8Gp B$`0 0@  0 5t0  ,#l cZv t0 O D"0P 00t W 1|j  1v t  j 0et 0^p0P $0'S"S]X0S' L v t  q;X0$\0 $  0]'t 0V v t   0t 0NVBT0 HˣT(%ml& d)* l z z&dU(=?50C- 0`qMP` Pp +/@P 0 0p#/@PC 0p W ) PuY <Y P0P( 0ES P n 00S00H l^^YPH0?S0 -S00H0,Ѝl t Lnt|7@-0@0 0 X0TPQ P , Ѝ0@000 0 P! SLA-p:WP008X@P3 0S0 =EPP tX00 if`cVt偰P 00 `8iVPvP 00 8oP( Kf 0$00SЍlV]P 0 0oVSP 00 LP (f 0(0 Q 0S:P00CSD f0 0 0Sh } e"0K00M00P0D0 0C0D080;800,0/(<0Q00<008 ,0,,8 /@0D 9K<@0(080$00= 0D00<00,0/+$@0@-0$ 0d8 Ѝ@-@4000@-@4000@-@(0(S00 0;0,0Ѝ`t p@-@9PPB 88<@GPD[`U \ `, 8m9`9V0,0pC@-@48l 0,0@-@4w8O 0,0&/I- @-8 @/( R o8 ", 8 <  < D ,-D  , /(0S ]@-@8K @0<<@00,0@-$ :P 5W Ѝt@-:P(Wnt @-:PWot p@-0MP`0@-S00(00P0 0  P-P 0( RT  0 0 S40(w03/Ѝp$ LA-@`PpQP-U@QP00  P׮P0 -U  `0p@- P@@0P ,pT 80$P< D0TP$ <0<Pp강 H L p@-$@P0S .00PpU(Q+  0 BR@- U. M| 0- BS^0@Q ^ 40 ? 0 C  / / ^ U(U(tp@-hP@`V P.p٬`HV4}.,z.u.0U("^W=7 O-M`pA\ PG U \ \.TP D U.XP 0 O.PW  I.PU . P pT,0p zR S [ Z YXW0S@0S 0S<ST00?{[ZYXWP4T <@†{ RS [ZY XW :S 0S0S 0SlPT`7pPP X WUP$6TU P -^R@ 0&T 0~S Tv[TqZ TlY TgX TbWp lT]0SX TTX@0S@ <TS 0S( $TN<S JTO[ TJZ TEY T@X T;W 7R@ 0T 0?S pddT7[T PT2Z@ <T-Y,(T(X T#W}T:SuT0S mT0SeT0S ]T  VT| xOxLT X\XETWH D>TU P,U$3TUPT;S < S@ SU@S@ S 3  T:v`XS&[& Z+Y0X5W:U?P(s0SSUA ⚷t☷<S@T[ TZ TY TX TW TUp lT`jBPUdЍ0k0d$"+ @T   Q ! +0R녡t0 ! P+ U/ -P p"8EQX_ $%.65<=CDKJPQXW_^ghpowx~fyu }mt}@-& L,")s&@-,0, Q 0 0 <,)(U(s&s@-@`(000 #S@TP0S  00S00S 0  SЍp=0S/#Sp@-@,P$pE0P 00p(U(@-PRP@ p`p 0R" Ѝܯ0"S0SO 00SS  00@Oz&@-TePL0 p@0"SRЍ8U(@-TJPL0 p@0"SRЍ 8U(p@-h@P0S 0S 0SS <<U84  S (000P 0p8U( Q(9p@-Px@Q duRጪP L0   P    pp@ @H U8U(0@-@PPM 0SLD00Ѝ000 0>P0 0 nTU(O-Pp`HM 0S4;$ ,* P 0S ߍP? 0Q 0S @q  R R@  R@[T WpU: 0S  @u9/PV?`08U(U@-0S S S8 4 ЍbS$ ЍM=]7@-lP$ R\Q;@ H$0S p (Q Q Ѝ08U(0[(Epp@-@P 0Sp@R0PS 0P000Sp@-CP<@< <`0S<'00]* H  -s&C-P`PM 0S00(p/p0 EP" /Q0`@ p0@5P T0p +PH$0@@ 00Ѝ nTU(8U(A-@0P L * @R<2<1H#4*( ,), )0 )8 )4 )#4R! )!4S )!4S |)!4S `)!4S D)h!P0S l()L!T0S T )pHP8W ЍA;0S. a``\ 0) 0 )0US !S|  !3 \)0US83  0U $) 0t})pPs&H HGz  '_09BKT]BBfn^? vm? (G-Q| ,@QhP0QP 4QP<PQ(80S,00 80<0S804 <0P;PP;P1 QB"8`8X0apSp R p <0RXP 00< S4P0S9`(Q (Q @P0S0 BS `a 0oh0S  0 S* 0Q*da \8Z38U(uCGtO-;$M p*bP 0$S ? ߍS &P@0T[D@P 00뉔 40ਛR YSA ("$0f0Qjf/ a,2!S1Q% RR  0ܡ!,21S 1b"!b$!R! R,"b"!4b4# 0C?o2S  0 |pp`1R8 R,2 @P0 000(4"48#8 R* 0S 0p P 0S 0 p1So   @N'1S  f/ 01T T%H 0[(8U(VEW}}WEV_# R } W(s&A-P@`#Pp %R 0R000005S P vL $0f0Q ,N( 8U(0[( `U(p@-0@mP  P$p@I0@-0S ,8U(@-P G `U(O-@:PMzM 00@ l P5 ` ᵖP0P0 ݰ0SP :,P`( @00ư0S``(`dP+V0` ܕ(`嬩 Y 9 0 ,00P,0S d ,02P jP HHἂ$3P,1 -PFV 0SZ 0 0,0P2 @h`(b(9P,00 x2P ,00,0`V 0S,00b8!P,00  _@8, 1\ , [P0 ,0S  S;ǑBG0;\V0`(ʥP (/P (tl工 P0(`0,0P,0S ++RP0 0 *囥 P 0(`0,0uP,0T0 劥 P 0(`0,0dP,0`0 y P 0(`0,0SP,0X0 Dh P 0(`0,0BP,0\0 WP RP 0 (`0,0+P,0d0 @P  (`850,0P,07 l. P (`40,0P,07 {, P (`40,0P,07| j  P (`l40,0P,07k Y P 0(`0,0P,0x0Z Hl P 0(`0,0P,0|0I 7 `aF0 S0S  D[0Y: Y0  0J 0B뼃(0bSTB  9(`H 2[9 0S(I # \3  0 R M 0( 03000"0,0 0 0 ,0kP L@, 2![ 0ȰÕN 0 0, 0  (0 bS P  (0,S ̣D@pݍЍ R $0ɢ  QP$0 ,P$00!CK " Ȱ峢 0R ( [ K0 S|1[ 0u0 R  (0 bS Px  (0,S s (0Sg b8U(  @   +0 `U(2 A AhU(xU(^ k    3         ) I TU( z&j  n s@-`0PU V  P&A@P h'Ѝp`PD!ၧ 00哖0@Va 7$00S .@-d00,%p@-@5S4 0PSP p@'Pp0S 5S 1S PK|Pp5S T \Pp< HPp!(( Pp7K8U(`U(I edArdA 7@-1AP(000(;_5 S* 5S( P0S 0S005S | Plh0hP]"L5S Ѝ0< <mP0WEV8U(fd! md2 ,%X`U(gdC @-@P f/Ŧ@`U( 0 L,%,[(md0S/!  -3@-P T JP 0S S@@ ᮔP@Ѝ0@ Ѝ/(s&@-0@Q3@`" " @4%@-t@t0MQh  `P0cS CS SS 4ܭsS00ۍ00{($30@-MM@` PP 00YSP ,庭ۍЍ0oP); 0 T[(s&@-@M0 wP |ۍI@-@ 0@ 4W(s&[(`@-YMM@p p\YލЍ<0< S <fEP10YS<0<0<"rdA]v@-PM`pS@(STTNT`8SUFT !Ѝ@-P0@ 0$S0S2 0`Sp( TQBQC0AQ~N410S 8@0  000! S0c0A R!! Ѝ8S 0RV 0LV`(pS 0V \0=V P0 <05V 00 $0-V 00{(̞ @@-X@X0MQL  DP 0nS00 yS 岬ۍ0{(!] GP `00CS`0p S00 P0S X0X /X"(s&C-` 0pP0>@P #I]!pG実T@ U @ 0@HiPFp 0l Q៽ V ዟPU PP pX ЍVfx[s&G-PMM`p<$0@S0#!p- P ؠP P%0 xp P  ``D(8p P  VP   XᐲP08`D( p P  jVP  0(0`D, tp P  @UVP D 0,0`D0 (p P  @VP  000`D8 zp P  +VP o 080`D4 ep P  DVP @Z 040`D< @Ppu P  VP E 0<0`D$;p` P  UP 0 04`D$&pK P  HUP t 04@`D$Tp5 P  UP $ 04`DP p P  UP 0P0`DT P  PUP 0T0ۍЍaW(s& s6 6Yy(Gj *IfO-M@ Mժp PS `V20S0`Sw0P`P8aEX``0E` 8ġ;x 00A"S0#1` \p P& A@PP0s" $$ǝ 5P0S  3/ PA_P+ ࠰Rx%.A Jp P" 4S@4`S=04`P82a0C" 20< S :A /"[A'x5|%.A pe P0 x5< A B0qpAA 0Q<0PADxZ0x5< 0RA| P 0 000S" P0`㰀(V R s S 0 0t0 0`PXލ Ѝ4% @ /Z@[(s&0{( - BR0 R p@-P@9 R1!1 0,0 'ٺX0 ӺX0 lͺX0 XǺ ?( D , 80 ,8 4 < $$$$P T 呺0p 2Q0S*X`?\PQ |Vl}p@Qܟ  */8J]r,)+ O-pᔀ 2MSR R@`aK 8QH ,[E 0忝0 ṝ  0@\" q 8 媝,  ᣝ `@0" Z  0h !R11` _ 0S 0C R]!SZ0  1 0 0tD8QI ҜX ;<0P+8]Q* 8 0A0ຜ @#2<0P+8CQ *ЍOĹ0 0 0 0t h< X ЍO"Ѝ8Aܟ ]e̟ O_ja}A-@Pp(D<勹`8SA[ 0` 0`( "4`#/A-P@ 4"40 4"40 ⩠ ⥠((,,004488<$<4"44$D4"44$D4"44$P4"44$`4"44$p4"44PTTXlXQl`pW(4"48(4"48P`0@`V@  |0TP0A0T0A T4"40APU(@-@l40Pm08tf/ WEV@-@LP TP8#!00Q@MWEVPU(80@-0@S B08f/V( 0\ P0//@-鿠D0 <44喸0@ R 0s&O%G P7@-@ PTP0 08P8 07'p0 C Ѝ0B~8{(vd"0@?o2P0S@- p`Pě@P 忛P 庛P 嵛P@V@l嬛PH@T@T &p0 4C@@ Ѝg8{(ud"0@-PM zdP@` &p DkC 0 400+ +Ѝ08{(zd@j{s@-@ &p JC0  0 y0`P   p0   i0  hb0  P[0  8TЍp8{(td@_ 2Z~( p@-@PM`P㞞 d&p  ( V V d'PЍp (wH( I&p ,B 08{(}d(@e~d(0@-PM @ VP 8B4P 0!&p0 BЍ0 8{({dЀ"A-`0@Pp!倁(M00l!p0SP@LAH %p  ,BeP qP p` $0Q 00S*l@P gBQVW *V 0^ R|0|0 0S(Ѝ00* *D  `@ꀊ-l&88{(|d;Js_@-P$M 4@P %p p%B0P  ?0P 0Pg0P  p@p@ 0x@dp@R]U@@֢Pptcidyara"rbmngntsh =="0D S/ 3C5C$1 4! 8<0/@(0@-0A„QU0%Q ? /@.0@1 ^ L043c 0P0Q ? /@.3P0@1@ 2@D4P5H@@( 213/P/h(A-PT0p(,`@,0T@@DA?@?@@@(?0@-0@0 (20,2030P!P30@(> 0R//G-`0(,Bp P EƖ@PPW ,20CS(20CS G0@(a$\$p@-@`42SM%^  E 82<"@ 0(2,"Ѝp@ӡ<"82E@d`ơ,"(20@X"\4Ѝp@@(%e$n$$$$$$a%u%%s@-P`+  0SЍp00S@0"S1Ds@-$M@Ẕ00  0 0 _&s&A-`P 0p @Tʬ= /,s 0d  ? ࡐqp  RЍAL`0S`@D@,͙ Ѝ%((@(A-0ppP@`phb!14P S H d" R S R 0 >;=(U@((p@-4@P0S~( B0B1p@(O-PTM0$ (00#,0x0@00030匠s4<000S: (2,3`^(0,8 0ړ80D$08 @?ϓ$0 0ȓ$0  00 忓@ D04䂟d"P D=$0( 04,0 ~婟 ` RL` $R0 S p200#1-R0" 4LL`P@0y00P00S szP  mzP  gzP$ p0L00 S? 呓0g2< t3kE%KUP1r]?C$5\"0HP@\2S@0x0@XRx0 X20P@x0 X20UP@x0 X20UP@`L`(0U,0000[ 00S (0 0,00 0h @$PTЍ P @0)@(%%)((s&MW)z&w)Sz)~))-7@-@00CS0 4PP Pp ppm<0 P00CS08P0 Y@o Ѝ0@Ѝ/(s&)MO-a0 pG<Pp/B$0e@O 0qp Ѝ  R ЍOt`0S 0 ̎qp `BE, 0S %)@(p@-@P2S 0p`n/(21!41#41U &"U 80U p@@PC @⏗@Tp@((f(G-r@,a1`P ;` VPpYTLE J$]~,cU 0V!U ! [E@s_Ps ❗X2  I $! (! "4! 1"8",1!#$s_(P, "!"",!000@0 0 D 0H 0L0 04 8 < 0@v000@(VA-\P@PAds 2F@ t B B$}00C0@(O-Q40 ЍQ^H DaXR XD 00!R 0:80Ԣ #ZppWPPUJ U @DQ ČUȌ̌X L X0P0Z 80S yq )@( *.*O-P0p0Q`@07 0 $4 Q %C?C0V% 021S 02/ .0 1  Q 32 $450 (, T02Sx Y< ЍP P倰[R21 RS$ [0 0 2S Y &P:Y200p@`p0[ Y 0S S01S 2SLPD `b/ .040 81 < [S  R#ZY  0S^   BN R@1SO148<$|00C0@@PAy`d1S  P0 148<   00P2S. Y  a14a8a<0#d1a#h# 0 S 0(00 ,00(  ,  0 0x' 0PPU0@`  0W0S 8pP00W(0pS,0P0n 000 W 0S7X\"0SR ㈀ 00RX0pP0 0Pp4` 0S 00 0 00p+ GP2 S2S0 `5 P 0` S ʼ6! R0T0P``!R (0 \ !Q(0T!X!\P!$(,Pl21S  "/0.0010U0 3`2044`5 8<0 U P`P H2(0L2,00800 S- 1S* ( T000P,  00ST0!14!8!<!14!8!<T(@,`)(,00\000T(p0 S( 21S$ / .0,40 81 <T ( S  PT 32 $45(, T\(00,0pP `0 0 000pS0 S00 000p 4P  HV[7 0pp  0S (0S 0s X2 0 RS   0^04o$$00E#$0 #(#< 0'4 0'80'< 0 0` p90 @32Sc RU0cP[ 0 1<Ap 0PPl,2`0C 00PPa(2 00p `? 0PPUpp0`Fa ??`1`<A` 0PP?,2`0C 00PP4(2 00 0PP? (`Fa?`?``0SY 2SPU PUSJ041SL@(1/q/_(/4 /1=R////// 00C-8Bp42McS P42S  0PFU42S 0S ݖP 42RSftP:Ж42S]1!$1(1,ЍC 0S\ SH ` d0 4r兄W2S  `p` ؀0ZPp "PR Sf 0SЍC脖@ D0ЍCSPO  0Ѝ@(%0|h(6000Z0t0z00000A-@T2 @PP P P@ `p@T 00S p`V@PD00S @@ڊ@P\gD(%A-Pp`@]Z000 0@@@A-@pT` 63PP0@ o @7@C-MM0X4 P@ T@D 及P$@ 削P4 00(03P (T(0 ,0-@` PF 0#9 0LP4S@@(4@p4T@0Fp0l`P5PP0 l!41P30 < 00S#  i U8 # p@8 PA , R ,< 00\S< 0 0@܍Ѝ0GSʇpP0S -S@`a=~P00@@4* P~, R ,A0 QP 8800   0 R00S% 8<10\A400C0L!L C$1떎0S0S0S0S C 30S C )C$C $4ZP4#j h PSe  P긨(_ʗ5 u) DD!D7 DD%@ DSN "0/ᬩ(0/ᬩ(0/ᬩ(-@-   f s&G-P`p%@0S r  0S X|i  JU %T^ Y0S  0Sۍ@ N 묩(F!F-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  @-@M Mq` @PxPݍ Ѝ\!rp@P=0D@rOP0: S0RP00 0PP P81: S P% S  R  rPPl+PPPU roPP$0@Pꬩ(X QF`F(pFFF=@-Z<0P  0 00:$Ѝ  1F(F0@-4S 3/ 묩(@-,0 @( 0$嵌 @h (@-@^㨌㥌@@-p PL`@@0 7/P0 S Ѝ ]00D(O- MM0x6@  @  @ 0p$000 (0*P=((y@ ܍Ѝ 03/0P00   Pu @$0PS (0S W0SU SU pp000,0;p` ,0 p ;50@0Y0C @4 `V+X` 50  0 000h4   ` `  Y!@  00 0 ,0gP,0 0S `hP pW A`V||p@P ZC Wp` Y40S5 #  @ 0 0 U%00Q00R00S  000 x 0 S   Z0% 000 0@@0 00R0C0q V B G SE SB `V` 0S 0S^)@U 000 |PP 1|!R `LPP 1b |10|1#40L0s_?00010I@P30 0Q 00RA U$0`(00`P91 S}Rh|P0S 0S \elKR P0S 02S 0S0S} 0\2SK\F|!+xQP qPP00@ s 3 |1P )DXP PPPPPPL0Is0PP@1>@<h{P0PU+ `|1VS /P@ |a``L0Is``@ !RP XPP0 1A@`PP\< K/\=PP05P(. 5P0h00h04U U0@IP0U* 0RPd01S\0!@P %4QP0%8%\0 P0PEd0U03:\@u8P P|!d1 Zb" :0 0|12P0P0(00`P#P,18 ,80PI 02S0P0 S0 ( U$00 `$0K000 000$000 ,@ D00S< 0,40Tu<04 QP80,R$0 fPI p(0QIQQRR (RLp(GR_RRR[SMr] wS RRRQS9SSSST-TUTyTG- p@r W pP\aPP Pp7 $P,*K/}D08QP0Q:" 0PS00  Q puxPh`P 80"8 R 00 05 !$up(TTTTUU,UUUp@-@5%SQ%5 %SPQ %UUQQp  0 0Q0 Q 0p(A-lP`5p@ @ 0% Ņq@ŕ\p(O-POMphP) b5S5@ ET# |T 5d 50 ! S!$5"R$%P0S88 yP @TEOߍdP  RR @`0d B2" 0t JQP d Bd0P Eh0K/0h0 |0 @!*,q(r0d  01,}  j |  |,10,1#40L0sK?000/1001001#40>000310 00 000L0 Cs(%,5QP Hd d0PUp((VUUUU6 V@-@ P 0 5p(0/ᠳ(0/ᠳ(0/ᠳ(-@-   s&G-P`p}@0S   0S X| U TY0S 0Sr}@ m렳(F!F-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  >@-@M Mq` @PxPݍ Ѝ\!r?p@P=0D@rOP0: S0RP00 0XPP P81: S P% S  R  riPPlPPPU rPP$0@P꠳(X QF`F(pFFF=@-+0P  0 00$Ѝ  F(F0@-4S 3/ V렳(@-|0 @( 0$L||@跨 (@-|@M?|<||@O-`M$MpP`P"NX1 b: S/i0P  rR |00pPP rW UP 0C P"VfR V  VwPN P P W\1` 0`PIX1: S<V2":KrPpUPV9 LPW002`` 0!$ $&PPx P5|0S.3]`P S R S pP`-pP ``!\1 S R U>Pk`x!|0#1PaY $Pt`pUd( FZPP X ND% ܍$ЍI$V,V:VF F F@ 0`( "4`#/ p@-4"4 04"4 04"4 04"4@0PY\ $(0 $(z XXzddhhllppttp p@-4"4 04"4P0 @ \\\DD \@@\HH\LLPPTTXX\|`\ `9zp` p5z p@0zp@-`@"QUpf@p@-@P[[[[pA-P@M4Q->C[->CBX?X\<\99>[9>:>C[?n:>CF[ 0? AC>[}C>G[mF[EnF[E~G[ 0X J~XpV  $$((,S>,c[}S>G^[mFZ[HHLLPPTTXX\\O-@ ! 4"4!14"41 $$((,P,0`Pp0WС\5 S L5sT`0$ $ 0Q`V,_zTvT`XrX\n\`k`dhdhehplalp^pt[txXxZ0[ O`LIpp$5S\5 Sp`0SP%@ Sز ,*%TU 0`( "4`#/0+P0 C@ /p@-0@R M4 @8 P"9<Q008u@5pp0L0p $(0Ss| s0  0S s < 000 S{:0 02P0 @S,00; ` 9: \08%@5  L0 $(0Sf IZt D$l20SV ` {0 0 0 00@00$? 0| 60 P 0 XU`  01S0 ,(00(!($ x(o?khnl$ h(h$ C  Y 0 t10P000 R0T A'' 0'? P<9P68  W2 t0 l1( @( & P#h&@$h갸((Ⱥ((%V(VV(O-M`@ ) P0H: 0 0@40P$? 0 -62쒟2Q{ p q B("(sQ0< ,42嘢# 0JR xXpQ 04  0R  @PЍ( 0AY1  0 4 Y: 10S<000D0` 2 `0 (0Y 1 010S 10S 0[` `$110010S Kp1p1000 : 68C80bꌸ((%Ⱥ((%(O-P`FM M X q@: 0 p5 Rllh"0pSE H50S00  000S Fލ Ѝ ay00 v1000D0zؤH0 T00X0400 4QpQ\t` % 0VPT"H.P 84 0T"0S" L0 00 0 HP #0000S y0  0v.P0K 0 : @ ~8C80  0 0S s"k  P0 !J.P РḒ L000Q0 H [ ~ 0<0X02  0G0  000 B00S,k(2jp0 0G 0Gh [ Y0# 00C 4 S 0040CpP!xxx1p 0p V 0V0  k000C0 0 S Dq   0xs00 p   8C80X0000 0 c!0xs  0 00S ꥙VV((V8(%J.WV(W(#WWZWxW`W(W WWC-@PN`HXpaY 10S t10S 00 0S P< ЍC)`@DT> 1 RP1H e0  P PN H0S$00S T P 0S w0S G >@ ЍChX-P H0 ЍTꈸ(((W8(%VW X!X7XCX( 0`( "4`#/p@-LP@08200@ 00 /0@0 op茸(00S4  /( 00S/( 00S/Q(P000R0SO-p42@ RPMhD R0R0aď080S  C/ S ! R 0C00 0@ἰ? 0j\5p!`S 0 000 ?@U (  R8 R  00\ P `0/0/0 0 Ѝ  [ T R  P00 0<00/Ḹ(((UXT}XXXXP0O-@P:1 R0* 0됑吱0 `SxP p* 0 T C:\500 )T00,"1p R 0 0 !Ž p 0 T`0 C c00p0S   0 -0xp 0S T0  0S400,00S Ѝ谸(X@((T,((O-0p#M PQ P* PPW0k:8 `\5 00 S 00O,"2@ R 0 0 !Ž @x 0 S`0 C c00 d0@T CC cA30B$ 0j Q,040(0PÏP0 8%,10S 1 PpBU809 ԱPWE0 8|,80<01|!0<S0<0<0Ѝ U9  P\EOEEO`fOU O R T` R< 䰟(/? 0WTFEV  P Q RF 0X:P`0FQ   R@(Y(T(غ((ܺ(((G-1P 0p` R   00@ 0S 0 0 80PS `P` 8UH0ZP000PS　9i`4iQ$,$ (,`(P,P8댸(6Y@(([Y@-@8P m080@(G-衟0PSN 1p00 B?g PCP` 0@`8@Px1 ?jR`10A0I00 00 0 V0 (pp1 p#",`(p ( W Vp`0PQ(d80S|P 1@0  XPP00Ϡ^P0d000 A((( (( ((YP0p@- P?@R800P 0 >!SRp( (Yp@-X`0SpL0LP0@1CA0S000p ( (( 00 /,(O-H0MSP` M 003/ ލ Ѝ40 pPࣟ00 +0H00@0 t0 ¿ S 0V  0Q0X0t3!0S& d3Q2Qc +"0  10 N 0Z0 02/+ 2R20t0S>W>000 Qo ! ZH"$0$w+P$"0 " R ! 0! t R1*01 Q5 1000S1H  B/oQ" RK X!B0P  +B<4(P: P R, P Os 10S0Q 10S 03/     0P  0p`V W(Ժ((ܺ(XeY(YY Z(0O-S0RMM 00#4@PU ( , : SRލЍt \`(5R<R XP  RSU 0 0 ,Xkp0 PB?bP @`@ 00S 03 00 XT8ő @5D0LT 0 a31 Q>P R. Pt!P!0  S D  XP   . 80< 0 @80< `㺹P0 P 0 #0 S00@ ` R Q\Q\hػ(_(_̺(ĸ(f_((__(00S4  /(00S0`( "4`#/( 00S/D(O-M,M@U"\:[$0 : S`D[ ` p?P$ ?P 0 00 0؍,Ѝ0 `(?P  LX?P h0S  0  qP ;0S, rb : : z  [ 054%00! ?0S S :00/0S 0 S :V00#03*  R00S H:0S7  04 2,:* 0S R 'P0@4`PƟ S9U)Q900Y0 B?(GpQP"|90S  0| \ 0p 0 ( 0P080S, a-T  Z9Pp⬸ U0 00(p UxPP0X ZP (000@0PZP 8LXHP"$0 S7Q:80S6  V0;R01*h0S. 7('d0 ( #0 _P h70S  0` @@ (#H60Sh0 0!60(%R/V+: <V3#\Q RmP   gPpQ^q U  #p# PE"\:U PpWh RTPp%Q_'qP tPE! p 10S0AR 0 s Z: 0S 1000S x50S 0S 0)  Ut ?w[ 0S 1000S 40S 0S   7 10S0ꊡ  0000 04 $0 S0 0  00 0 0B$000$0 #600S440S L4 PP e@pt|3S000Q 0pQLtQPXd00H00S1 0S \30S? \P  0MP 2 0 \00&&p2 0@S0:00~0S0840/<0a0#PQ8`

hO=\KP 0H0EP0`0A[Pp`1PU 0\485  @5D0L 0T b32 R (@ `0 O%Ϡ<#\ ğ Q  0  D ?0 _#3 0R< S< `3ē0S0x0@S =d0, Z 0 ll`d30S9 X30S5 L0 S 3 S?X ਁႎ0 % s\@T`S  &T0 S\000 T @T`VT0? @`1 0p20兑A0Y 1XS  0<+ $0P0 "_ 4^000Y 0;* 0 0VT0Q@` @ T\@@`R0@3T5Q`1:@Q`$ 0@0. 00  P h00VT 1PS 3P   0R`* A ]$((T̺(Xe((Ժ(`(غ((((as&((U a(bbػ(>bO-` @ 0Mp̰̐ 0 0  BRЍ PPU  RQ l @ p R RP Q @p(ĸ(f 0`( "4`#/O-lMX b]0PpX0L1L0H1H D1 0,0SlЍ0S @d0,`(Y0 `00@ܰ 0D RpT0#::`P 00ASpQ 0 0S\tQ `0S @P{((((kbs&(( 0000@/00S4  /(00S0`( "4`#/( 00S/>(O-@:M`PV`@@ M :0S 0P *S *`0080< 0/[ y +YP X P ) P9`0S 0S P)@ P00 (9 #R0p00S0100,0nH(0 0 4"400< 000800$l 0P @ a ]`.0 @0C0O F\000S0{ XP0uF0 S$ 0S '00gP|7`} /00S0100,40H4'0 0 4"40'pc 0pp00ppP*0S  1P_ 0 0B`W%PS @  ` B B80< 0 80< 0@0C0Ɵ 0 00 0Q.*0S  P  0"pWWލ Ѝ0S 80< 080l5 0< S XRc0 00$000 zB^P 0S 80< 0804 0< S 4c`0 00$`S  B("( p UB ᴠPBP@080< 0 80< ,00C0 80R<.PSR$ .R $PPpP3P`080<4`3 R0 *3 009WP. 0 0qZ P0SLp0AS0S3 0020S40000(P x2 A#R0؀2 00 #R0uQ& t20Sh20S\ 0 P    P000 0 0 #R0 R  0|R>l!ly H10 S' TBb#R0 !0S  0R ؀}P 1 000p0P``0P00C0ZBP;_ ((((r] bSe( c (Uc"cb.cbmcbzcb(ccccc cmd((bbc"d,d7dFdO-WM M'0ASz0l hSP X7 <4D @FP (7 00L@  61P 60S 60vV6 CIX Y0`06`00圦100V0:6 R0S0@`aVlPVrWލ Ѝ, PP   *A 0S 5 @ F Lw0 00@(0S Sph%U<H(P* 4 2  B. ! ]d 5( 0S W 00]/C 0S a(0AU0HS(G U4(ZY,p:Yh$`4 R@ )xX( I1D 0,  R1 #( Q! R000000X!"!" Xdxhp40]/ ,0 S1 #0(Q 0 S  x@ 0D00Y *( R ,X2"X(,` Q@D aV!X"Xdxh[Q@D `aV @0 (0S $ Q P00r|0Sb! $`|\ ld10!00C0DP0 ?00000C0!" p/0S@0 0 0C0 00@| bdzW(dxWyd_( ((~~((к(dSedds&Ⱥ(e(xe7X((CX(=e We00S0`( "4`#/(O-̢̒0`1CMa@Tߍ0S Pdp@FDAG@D0 ddp<00@00C0 00 R2PU 20S 200S0R0S P0:000RP p 1Q RP@h1 R 00"P <1{00C$ P X PW0P0!!0p 0`0L00QpcQTt^X$X`00!Pa l0 0p :000 (((qes&(((ĺ(8(eV|J(eTKO-p3张P M`@?Q \P  ? 匣 ? K0 jWd#d3 0RT ST 0H#S 3S 0@ 00000CSFTYr P 80R000303L32   ?Q` a2! Q,S Q0tB*=d2D20S P P 2 PЍS  u $Pj?00 1>!  R1\ 10SK0T!  0d!S@1`0 ? VQ00 20 !찟00S0H0S 0 04040c/0 P0L 0 8 QT $  $ $ $  L32   ^[0 ؠ<0 僯Pp?ꌸ($(T`(غ((U eи((̺(((00S0`( "4`#/(O-`lMX *Vl2ll00,0SlЍ0S @d0,PQ0 P^000Pp1@ 01  0D R`T04:1AXpX\tX`Xd  X P @RE X %P 10S  0c@P;P 00S  0kQ SR  00ۮ |EX!   T  L 0</`((fs&(( (-fWf(WfffO-dM`M@PQ0!n0 lU0t0$?0SX0S $5S0SVPWX0S $Yk S Y R㸮d>pW\ 0P%T਀X僀 H\7U00!` 1B`01$dQd0,P0C00h01`l0R!B1d0-0CW P0=SLq QT00H   0S 0 $5> *;==0S  0 08S0 $5B111`R B- 10 0S  $~ꤜ0S%  0帐- 00$%BR0ө`S<B11@%L0 PP 0 A, PP 0S  x<P` *堐;L<@<0S 0 02d0pA?P0x;3A?`0 =<0T0.L0mT \;0WHQ RX0>F@ @0WT8 84<ϠQ bz S R㴪,0 S[?^ @1P= :0S @0 # "@0A!" !@0 ! @ @0X ! AP: @ @bT0009\J*;P:D:0S 810 0؍ߍ0<00

! A"$5S8N(0W8,(2W42,2<0002SV0@ x S0!!~ 4x0R0#ST0< TR#2!S\0P yRV=SL5s\35 `!~?X00S-[" !>R\ /   B  R\ ?0  020C02`H0T SD0\ 0 2!΍0h0H0DlE "0AS0000 04"0C 00S\0X00!!!`V0: 0LphppPp P`lXX ুX姁0 8PP~,2!~00<0S. dM0 ST0Tpp101"P Rh"!>2 ԐXdCNp?N0 0 9NM000$5S `0|63! 03080H ` H D /D Vꌸ($((((fV((U Cgfffg(gg(̺(h(fgs&Tغ(g ($(ܺ((gg((8 (% g(hThи(((((xh((h`(hhQ 42!.0$00` S`0?00S00\04 @$5S|2! `0h ppWS $%S0! !42 D0D ,x  x |0  ("|H Hp L3t !n r! T0x.P3 !T0 R H  2 00000 D0FP1  7r2*7,2820S 0 0`20S QL 7.P 0< ST0T STT).P FYP2 L 70< ST0T STT7p0 # 0030S}0 S\0P S\-P tBF+P 0P S\0 S\0{7H0# 07 ppS $S00S0`" S\0?0 0 S 0\00001D0p` 0Rp/d0W S`0?00 S`0?0001D0pR8 0 S 0\000S8D0;#H H Xp㵟Y8 0 S0\000S8D0l;#H H XG-P`@T(,p W @T5i:iA-A0 5 P0#R%(r`! 10" q0SR 1y0ad0  a*6t1h10S 0 00SP03Q0S4 uW@ 5*< 56000S 0 0@TP:UA5t0Up Pd0 0S L P<0 0S ꌸ((%niи(((iVi?i(i0/(0/(0/(-@-   Ӌys&G-P`pP@0S  0S X| ᷴU ᒪTY0S 0SHP@ C(F!F-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  @-@M Mq` @PxPݍ Ѝ\!rp@P=0D@rOqP0: S0RP00 0.PP UP81: S P% S  R  r?PPlPPPU rPP$0@P(X QF`F(pFFF=@-0P  0 00$Ѝ  F(F0@-4S 3/ ,(@-O0 @(r 0$"OO@+ (@-O@o OO}O@P/00@-0@S @ ꀸ(i1Q0@?o2P  R7 P0 P0S 0 0SS00 0000/ PP  P R ` -X XQ PPP0  000  /TTT8 ((к(Ժ(غ(T 8t0t 0 0 \5` S\0 X SP0\5L00S/\5, S 0 $ S/0\5/( (T8 T 8$(p@-@P0000 0 0022=p 000=000X0X0<0<0@0@0\0\0{4H3H3L3u/L3P3P3T3T3o4 k4h p@*p@-@P0000 0 0022=p 000=000X0X0<0<000@0@0\0\0A4H3H3L3u/L3P3P3T3T354 14EEP  +44K44K44h 44 5 5d0d00000P5P5H5H5 @ A S>S>h p@q*0 \\L5SXPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//(O-|4MX hDhhdhP@quP:G0p  P\HP0S 30S30S tl3l#0Sd `#SX P L0S @90RS s c*.30S h@"\5S 2\ 00C?o" 20Qh [ŚX2 0s#p0pd 4 02 ? F:010S=,A!Ϡ\<#P  0A ? 0Sd0S 0qh 20S t!\5S\P h10S(\TA4 H!0 00 0p 0<&0&0P\7p0p 60pw>0 P0p$2S# *GP *FP *.nVXZ hY 4[ 0SW?관X V. 0J  DF <0\:P$ V( Q3C ? EPPe 2S|3%8 S20#"20$#20PA 2S@4$040404`02P$V20A\2@02 E2C`zF `FbE 0| DH  ?`0P TT#0`P\`Q=S/0P 5` ( 2RV0 S4S 9c 5*< 503 30S 0 0`20S 0?P3 0 S` V 10S0d"S`` 0Hz2= C ,0"000 0t00C`r'? `0(" q(n ooovo_Bpo(q(((и((("qgq((qغ((̺(q(q((( ((( (r((ܺ(=S$0S)  0`<<00P%X30*/0 00S 0 00S5 0 >0S sP@a 5*N> 0:#: 5p/d1} p10S 0 000S$OP0a0*P/1] 10S ~0 00<cQ/dP 0Tb<0*0/d2= p20S e^0 0r0S0L%r0L%r0H00q" P 000cH00STNPc*.,3 830S 3,0T# 0 00L40q"  400cL00S&Pc*.330S  0# 0 0t4 R.0E q\ `PVR d0SPl4d*.440S 0$ 0 0$d0Q,%R0%45 S R! p0040SPHu*s.X5d50S 0% 0 00u(0S xQ$ W0S< x 0(%0Sv4Pu*F. 6S60S {t04& 0 08%<5HSR$ ) H00850<SNhPv*.6%60S MF0& 0 0v@%D5LSR$  L00@50DS%9Ppw*-770S 0' 0 0 7 70Sx(w0S0Sp0L5sl0Sd `d(000 80L50P5?T5V> X5-0$0B0^ Ӏ1`@R$@@B!!@H0 000L 00*-880S 0) 0 0d PWt P1RQڨ0QUڜ l 0 0S Pi*^-9k90S 0) 0 00S0 3 N0S0QQ'` :0 0S| |Pdj*,-t:9:0S aZ0* 0 0 M0S M0S  M0S-(Q\KQK H R0P;0T  E~0 ppV aF!` . R  ` M0S72 M0Sb]<Q| M0S M0S M0SH  8%L < @%DL<0,5S0SO p t,l000h<0,5<0(5H000/85L0<%0/@5D%4*,<<0S 0, 0 0=0S (=0S(4M*x,D=P=0S 0dmh g,,= P: P5= 0S= @@PL Z p PE@TW.  @?00@1>0A@O@@P.P\7  .E,@+|>P* ^ P;0.00 0 S 1 >5> > >pWP?ppX ? !00@DT@8 H4L0d Lc B b"30x@`P Y( 0S  8 H4L0d @ B b"30C60S  6p00_|Pp6˾@ ᆠT6PH ,Y08& 5000(60S 1S @P 6 5 @Q ] U @ 0`P@@  04 8 <%c#!$c4"t%S T50S \=XP 0 0 I ``0  0 04 8 # $ $0 \# 0$$ 48$( <@$ DL H$C0 5L5s0P500ߍT^u(uغ((0 \P/Q/ 0   Lq,PŒPŃ ,%TPD40S/8$0G-0DP(4 40S1 40S- T0SC 3`3 30SA=S> S*%3`30S 0P 0S`dSTS店Ps崗PUU00Q AP 0S ??@)9啗ᓗP`"hR0"00S8 lr003Pb0S* x90S* 0R0E>0*X4*% 2p610S ^W0 00SEXP10S E 1TQ `1*$X1` H10S 1*0 0H10S <E (1P 0*$0`00S 0t 000S d0P` 0ai 0G((ܺ((и((((u(((((8(`((uu0(,(IvI (5v($(Nv((hvO-PPMLp8 R8B@0S 0(3 ?P00@TaVa` 0 SQɑY\ J \P  ?` T ? v0 =,",2 0Ri Si r0S 3S !0? 00S  00S`0 S  0`Up!Ϡ0008 L3R 25  B # R#  B ` 0Q" P*#0`00S ` ` `Ѝ 0_S  $  B$ $ R$  B  ꌸ((̺(T$(`(غ((U e(и((A-Pph0``ATR ㎓@P<G0S @ <1p0A(v<0 0 1S01/ 0S00/(`0 5 /H0P 3S P 3S P///ጸ(^FPO-0(P,p0@4`8 P P0P \ 0 S   0 0 0  0P  0S L0 w0 0 00 0 0 蘸(((Q 0`( "4`#/O-`@8 0P1 008Q ЍS@pd8Q Q 00$ 0pሀቐpԩ  0` RP/! 0 P  C1  1 @-댩 v0` xRo/ 10#/C!000P/@-됩 v0` |R  /  /C! C!/! !/@-y딩 v0` |R  /  /C! C!/! !/@-S똩 ũ vO-$5SX@  lPphU00 `1X 0000$ p  @R ![ 10 <T+EP 1C0 2 @ @Dό R&p@PP U P W@T @ Ѝ \00@0 0S0 B0G-`RM@Xr yPP dP`T `fhP P9  ,{p ;0S  垔ߍ<0H(00,0 00004008004004 04$0D0(0P W[  QpU lKp* `\` 8 s: 8h ,h  h h h 0,0h0 h `O: p 0`?`a8SPb 0  0**0P0U #& 0* vd@edAvzd@]w!vBwww&w9wNwA-@Mp`;@@ p@ݍ P@00@]T00 ## O-`M$MpP`P"NX1 b: S/A(0P  rR ;00pPP W qUP 0C P"VR V  V)6PN WP P W\1` 0H`PIX1: S<V2"ѵ rPpURPV9 PW002`` 0!$ⴵ $⽿PPx 9P5:0Sſ3]`P S R S墿pP`-嚿pP ``!\1 S R U_Pk`x!|0#jPaY $fPtpUd( FPP YX ND% ܍$ЍtI$V,V:VF F F@00S0`( "4`#/(G-pT1P0@0ʟ 0 T X 3#15`05à121 R0` CPpp0a0!R00S! @% 0%# 0!ZXl000Z T00!ǁ8P,0茸(((w(o(wSe( 00S/(O-,Mp0`P@အ0V000,Ѝ00 ?U0$p$0 0000 P$0S a?,300 0 PV 1^0!4 t`dL0S4!! Q 1  (0 0000 P( Q- a'0! 10  |40SI K>0Q(00 0p00`P(0 R7 ,Y P \Q \ ("(P"$("(Q ! C( 000lPn 3 4Ѝ||Ph30S. ?  `43P,3Q ,`Q0C,0(@,0h PX,,?00̲ ,0R0( 000V0A+ \2 Q,`` (@,0!FP,`S@! 向0  B !#  V8 !!R!' 0S& =, R*0( $ 00,0 00( 0Q `@`P0,00|d000$00?@000P$ 0S b(ii(@ x(YZxx(yKy#W]y^FF^-ydZ(W((p|yoSeyG-QP A3aS0Aa M` 1P11r00`J00 0000P0PU <Rpy@p@YU 0001 0yP@  Ѝ0ATP  0S <  aP@L*P@0ꌸ(ii(((]y(yyy(p@-P0 % .  @Q 0S p# #3 0# #:>0 T0SpP8P̮p茸(^F(yz(z_R/G-P `$ 0p@V` 0@`` V`@&!D( `G-@0 4Ppe4 X00000`0 8#8$#48#8X00P a 00 "% ?Ѝ :^FF^: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- P 0U$PP(,`0p4@*^ :^0 *^*X@40P/ Q\/O-@Pp02#U 1!2 `R ` J U c9# S!V Q V3  P! I` P0 c9# S V!Q V3  P 0  P$ ` U 0 Ѝ>zF J z0A-1àQ`P x0x xx20Sp@@ P$` pFQL @ @PQ0࠱@>zV } zp@-@P40S:a80Sd0d dde20C800S   0~00PP80Sp0 zi , zz2 ,0S/`0@-0@  L:,^0,0080S 0  /20@N(zz} z,0@-S ,0, ,,2@TP :@7z  zO-dMPpU`@@ U0!@3 @#81S41@D2s2@Ds1@DS@D50  0 00Ps U0#03?^[[UZ㯉@D `0P00@5Q 8WO000 D 0XR @"!$"!L0<p(08p$0 0H(0 0 `,0`4  0 4$1HP 00 K-PT40  (00X"P  0,05S00SUSP3S` 4$`UQI 0`2 008D040  T 0S ,( PQ S RPQH ~l&~zd@%6@ HvHiO-P@p`,M$P"^p)$0S0$020S($p P V 00 0P0P 0 0 fP AP PP XOpP$dp,Ѝ`P 0`P ,b, ?o  00 00  0 ` p| 0P&qp p Up`dl&j\ UG-@pPT!Əp`:D10S:  p o09 6X $$ +ip+ P%W00S $$ +Yp YPPU `fV rV GTP$$ + =p$Ygl&π%p A @-  o贼 A-@P`pP 4,\ XT  @@ 0ϽU  A Ahs&U@- R0Ѝp` P@RgP 0 R SR  R $Â!#0BR R yP ꈊ- (P/00#01"$#ꈭ O-P@U \  p耟蠟 U@00P`6 [ `` `7 V `V*!ƌʠ?,͇Q`V*  Q*`V*?!Ì?G- 0 @,a,q@P^ \ ^0᳀ 0S@ 0S@ 0S0@@0\# ?\CTムა :^ *$5@0C6;007;00@R0@U^(PO-0P$`Ꮑ@P 0㘹z'0 0!Q P Ӄ@ Ѝ ְPC-`$4 p咓P`品(@ 0!Q P Ѝ 困P404-@-0  Ѝ Ѝ/-@-00@+待 0 Ѝ@ Ѝ/-@-P 4( ɏ 㠦Ѝ Ѝ/O-MP`@PЍ Pp P 4S  0HQT0Pp$&Q$VP 0S 4S $X 4P S $ 'SpH0!!`000 0 0  @ 0P 000 00 0 0 P p1 T`嘖&P$(0,p 0p$S4pS 0 x p" | L0 `0p"WPb 00P0Sj+vbf=O-$M@ХpPP? 2R 4S  0ᚂ$Ѝ0 mQ Q0   RSRQ"  "S 0$000 00 P 0Ph4S 0S,  00 000 P0 0P0 <00SS PẐX   0 0`S4S 0$R V P0 RS 0  000P\ H0H 0000 0   H;pFjU">I\yG-P`8Mp᪀@P嘂@Cdt# A@0$4$ 0840 ;<p+zp ݮᲁ>pp H4$t: S! W B.L 2p< $4S0 (d,T0.B. "p (d,T0"W|(d,T04$t0dT 0# (d,T  z)00$0 "P0p 044S   0  08p 0P Pp|  0Ppu P P 0" RpP5:Ѝ Y0p["łڂd@ d@ 6L{@-@P 4B BRP ⋯p 8W4  aЍ@Ѝd@̓@-@Pp P P+4PS 4 2_A- @P0TP p` X`p0 p螄$$ QEAS$0Ŷ 8#8"(Ѹ0 / 0T 00 /$4 0T0 / $4 0T0 /G-`P@Pp 0M(P"#P㬐`0`00 00bPU:Ѝ 1 00X0L@0`QP1 00, HPU(J ̄_քs&C$$0A@-!P@- x`R@dtЍpP P 4g R 0 ꈊ--O-Pp_o!R0`@tMR(0S00S "R0 U tЍP PU 0SGQD (0QS@!RS R7"R S R.A 40[ P#  7/p ' 7/p 40 P m0 $8  "P P  P =A-@pP`P 5/p 4 5/p 4 MC-(00pS4P Ѝ$d@ 0    0d` 0 0  0 `WP WkO- 0 0pP匁@ᄐT  B"P Z @V` 0 k@ꈊ-D ؅p@-P@`0 J@Tp舱 O-Pp؀ $M`@0吰     Q M It0 p ` X0 T p`ⷡ04S0 3 /$Ѝ舱 _O-PQ@04p 00` ЍP P0S* E `P0       04 p p#p p04pp   7S0s@-SX`@ P_0 ?o2R0S  Ѝp舊-@- iR sR aR p` Ozsp@-P@P (`Pp [p舊-p@-@T 40`PPSpp舊-iR@-- 0 aR bR LR( ?sR% tR@P 0P0S`)00p`(j0 ۆ-Ɇ p@-M`@P`ᬱP0 0͵0,0S  㴠Ѝp_G-Q@PM Q  ЍA~␀ p$>|`P phB~00 0 `PP V}`+6O-$M@`HP ,`$ЍPP 0 0 0 $ Y># P0*d Q P0 0?Y S0STP pY0 P pE00 PU 0pop $ {P 000 00 ppP |4  #\$  0V,S( 0 `$4 80`p| Ĕ$%!#,[PP T P R*L0Sh 0p_ L004 0 000 0PM 4$$  # 4  !4 "4 $@p7 Qԇ+00S 0@-@C^M E$ƟE$$0 0*P*Ѝ0 @x("(!᫟"`#XT 80 @坟P8嚟l& @K\n̉ ^߉0$ 8O-`DMPp4 "1币<0!ဆp 0S& ! R"! DЍLRR a0BSS0H10S  4(P $@P  E w{@ yP䰟 4{ T \0 Q0@ ! T J@0  @P@p, 2l&f-vH@ (s&A-p`(P@YzP0 p!`P @00 0$0@-@P$0S z{@w{O-20SK@0SD00h@ DP 0SD0SA \^<40$ 400#9qpp, 804<0P$ 0I,0 ( P bU@OqU PH04 83pPTЍ0$$ $(`Vp0Y`0X0 0000 WX0 0 0S$ (0 [ Pz$0 0(000qpp 0 QP Р 0Zkp , ep p  $ f꺐l& 7l ĐO-CLM` I@$P0$0\%LpP50S @jLЍqP sP @0p0$  0dqpp PP`0$0I$$40P00P 0 0 0 00`0N0P(0  0 0(0 040>P 7P 4  0,0$000* & 4PS,00 VU$0StP0T ᒃ!088 X : U S  0  <0eP<0 (, S0 R S ,0, S00,0pU000U0   00R 0 00S[W0[ 4SX 4SU $0S s 4pW4 P4\ ` 4 "$P0 0S 004 Q 4  !4 "$0 S40H0L ;p 401ST>0 S 0P 0T 00S!Q` $NP$ a@ P PTpT T  0!$ЍP`ꔹ 4l& _Wp@-M(@,`P6# ,X0P0 0͵0,N0S H Ѝp_@-WM M`p@T 0&Wލ Ѝ0S@ P( 0$$ 0$$0 xI0 DxP x_ x 02tm0 $8 XT#D!^ꈓF= ^ _̓@-0@ n00 0 0 Ѝ ^@-1MP@a qPf0Ѝ@蹕0 嵕峕` p婕Ѝ奕 t!80pp`\X0 0 $吕<厕P  @08 0@TS- Qz $m0 8 00  ppa1S1SxЍ@T2\Q\ TЍ@I괹 ۓ| ^,P6@ѓD_3 P `00CS`0p S00 P0S X0X /XY(s&A-PMM`" " 4 j2r@pTݍЍ    `Vk 8  ! `0"0!BBP +Ҕ0S91!BBǔBĔ”$! @|<#[P%$ !L<#૔ sm0 $8$塔 埔# bR@B咔 0B剔冔   H0S 0CS 0L 80Lo 4 g1m= ^,(_>j̓A-0p @P`M!L @@"P{p420SP]+ lP`P a@ PuP xP RЍ@@ dp@@@0S00` P 0S0S \^ 0 Q   <0p`pV ԓ Г Q pǓ   `4巓꽹 l&̹ 4 g1m̕p@-HM@P`4  I 1D0!zp T  QP 00S  0 %iR TR LR a0BST plRs0BL~HЍpT p괼 l& _W 0@-$M` 0 0@P!!؀C$dqP W  ЍdP_P W00 9PK\0P 0 ZP0$$OP dt ZPP dZP (0OP@d,0 |@P $0   pQ4 p BP 4PZ0P 4 PIk   P000 00[00|000 0S$000,0aZP L]Z0P(0 6cPP e`P e$iPP0|4 AP 4`P `4P @ @Pt H @Pn @0 SD00H0$ RL0, 0`D` 0qp< R$4,, 0qp$0`0 ᶗ$4P `$$嫗$4P` V Y`P% YP! W]x&hYP bP 'e`P 'e8&? ` 0cqpt p ?P8po  ?P   ?P  ?P   ?P  $ ?P  T ?P q< ~?P  $ w?P q/  u?P r n?P 01S 0r/S㲰s?+(Ѳ Ѱ  X?P s/ Q?Pz$$$4P( bP d`P d$$`0 qpS/ p0|< @Pk <pP < <C(< @P[ <P ?PP  ?PJ L ?PD 8< }@P $ <8 >P4 8 Y* 0i$ Bp $ Pp$4`  0kqpt$ W$4 (0R 88\008$0 0(0$0 00,0 40P0,` 0$00P00T0(0 X`0$$+qp|$$@$4P0 00H00L0`$4+` 0 qpf$$$4P`[l& -_PuA͚~ӛ;1  4 9_Q|C,ݚUqpMXet}Tʜ+0@-@M P   ኝ Qp< < 4mp$0Ѝ0( 9'iE@-SM@P, 0 T  \ $ d l 4 @pt H0P0X0`0h0p0x0x00p0`0h00`0 0X0D0P0L`0|`p_ [D Sߍi@Uia!im@-@  I  0`( "4`#Ѝ10S/p@-!MPM@P% PA. (01P A!Ax弋P 0`0?oS c` 06P ``(始0 0A. 00P0P A A⏋v刋0 0A. 00Pl0gP AX XA\p0P 0004eލЍp((_y4$ѝs@-6PP P   "`@T8Ѝp P  00SUV  @6 ۝~0 R !O-M@ Pxpp"Ӳ`P"  [  WVP- >ZVP:VpP 2ZpxVP +Z \'<P 0"h 0R00  p!  <Pr 0SohQl @ pal Y! R R RZ  0PW l Z XZX (s<QW 0j0S, @ h嵕P@ `寕pd HQ L 40R !$01Sp0S 3/p\ U 8 X吕p \ [ 5@ `僕p Ѝ@ 9۝p =F *\A-pU@P@UPPUUa`P .W$V P QVP`@FaT @- h=P ЍA-MP p;@P00p`ЍpP \  00 p !0  $=i@-@p @A-P`UpP~00YP@u?0 Y q  F" A-P`UpP`00XP@:W?0X S  F @-( 8;PA00 Ѝp@-8M@ P';P 1 !  KUP X0 Q0s0S00JXPP  U@T_Dp Y  2X< PuU`=_V8Ѝpc5 P li@-@BMM   1p 0S 7  /  0(⎜(@0S700$0/ 0d (“(@0S BލЍ< a@ Y@ip@-xM`TPP +XP@ VP0P Pc ,X   ,p埰Ѝp譞] li4@-@M  /  pЍi@-M @Z:PC0 / | p  1Q0r R08C84 1p`Ѝc5 H jiis@-`Pp@ @@#:P0  C@Ph;VW P@ L2@TP 4 eЍp讟5 S jʟ7@- P@?pT TLT P@00 << 0400gT@ Ѝ0b jp7@- P@p\ \0Hޯ@S P40 00 >T@ Ѝ0q jp@-M`SP 0P0Ѝp4WP@Ux=b@Pd㴯0 D-p<壯8 P@ PP vd<%>iU@-$MpSPv 00$ЍV` b@Pp 0 XpLsP@ P`@ p$mBdꜥbwi@-B喇 Ѝ_@-000 0  PᲒp `a@P>| ` @塒pl P0 R00bS %cU \Pxi  =s@-@`2PP  5p n0Ȅp@-` MP@SP vV Ѝp P%    U  PAS@ ]D겤vi 0@-,M@ P8P0 {  p,Ѝ0 0R0s0S 0 $0UPP  ( S@\D5 fjp@-P1p@`@@RPH0H HH< VQ P |Rcp j@-T @G8PQ 00Ѝ  p  c =@- @-M T@%8PD0D DD08 0{ p$cЍji 5 jiW@-M T@8PD0D DD08 0Z p$cЍ(l 5 jie0-M $00D P  ЍiU@-@0R P$0$ $$WR@ j00@ P/a CRWC/A CR=C/@- 00@- M@ m 0( 0 pí Ѝi@-PM  X@@╖m 80-P0 0 Ѝ<_?p|@-] @PPP 吭mQpPL``JP00 00lt0@`Vm`:` PT0d0X @ @@@@X[,03/`ľ %_s&P////0 L0L0/%0 T0T0/%0 \0\0/%0 D0D0/%0 d00d0/%p@-@pP 00p00D S 0A0CS 0$P>P  0@p%@-p0p( 0`P/ R/%0 O-4M@@!2T0(  Dpď׬ P(0$`!pSp D@T PoS@ڐAP`@ uptpP`[T000 [  l R  P Q R. 0S $P\(P  1/P j@0S  ☏p "SR(0 SLf\ 2/P W0p(ȣɚ;6e~֣O-MMPp  U p`%C  IpP$ 0Y00$0 -k ⡕ ⏏pa ┕p ₏p Q TO @  K p$(Q >$_X@T lX00@0 0VP%L @0I 0T ,0@4@?p 0V^0Pd0o 0P 40,@0p<e 44`(H0S !P31H0S;I0S8Z`@T 0 3/@: " =M0S:00!  l"1M0S T@8布 @03/@t JI0J/ώpNI0!S\a`"%J` 1 0 d1 T|p 1 d\!1 Hs`@#%Jp!1 @ t1 x!|1  P@Th 03/@ 03/ݍЍʾ 9zi~i%i^irp(H )Q?i`Sp ¥˥եO-@PpP  p ѪT  N@NPT!彪FNx`P \庪PPU D1O0S 㪂XXnW P.Z  P' 16P! K0S 0 L0S 0M0S 0 N0SO0`S PPV e   ~p(s&@-,MP@xpP [NP`(  p-0S hA H3P00< <50 $',Ѝߝ*(8i(4@ A^@-P@0 PpG-@NPP0 `@ Y㔀QpuQᤠPP  ypp H H@@@^@舩~k S 2(s@-@{M@P00ЍpOQPAQp@P <` yP^u ө(vs@-@QM@P|0| |\&QPQG@P T` PPl^u( iЍp~k ` (vA-@"MPP0 -`@PPPPp p< >FJN@~k l (ީ@-@ \%3PP0P PPL 0 S@@00 >00Ѝ5 u (s&0@-M@*MP%MP  MPpMP d0P P P P 4P>p Ѝ0ө(7i97@-@d* P H"DP$ P! ( Ѝ0@=FDO8 A-M`@PK bppP"㼨(  W  + p% (I( pl"x <@T h8Pـ`2PPҀ RU T Ѝ0 P@\@Pz $@ދp U媀u 0R 塀l)Z X` Tp唀hQp R%PP劀 FmIP;ЍA]Q\ 0Q    1 0PkP0 RS[Y$ 0` R P U 0pD` PߝX 98i(i\l v}m 4? Ch _8 Pp@-P`@X5T (B]( R R[_"00K[P 000 _Ps0"CQn BQj Qf^ 4!<5XppXPPX Ჰ  3$P c_Mp[WF 0  Ep? 0STt 1PPX0!&8!100#R0S 0m8\@  0YPpG@T 0CS0 0 xC0X0^ :T 0CS00wRxC 0 aD\W@DAD\ 7@D@S 0@0@D@ T030ZL@ZTh lǥ )JPSU8 @ 0 0 0`0D9K  (ʟA-X Pp@`5P0080P{ 0 p 0 `P0O-P`$M@ HpX) P W0  {Pp` 0p0  0 `ЍpG-SMMPPx!x㍡pX!\ `F<p 9D9i@- np 0QSЍS   ax&-/ 04 8 <` S $S HHH S/< S 4$0 ,/(/$/PPYPP_fTk 04 8 p@t-t=p@-P M@` MQP0 aPp@@5R Ѝpi#@-< @&P$0$ $D Ѝ.5 + @-< @&P$0$ $. Ѝ蚯5 7 0@-MP "M@PۍЍ0@Q P P+7~P@QۍЍ0@I~0S0S1iS7Q@-T @&P@0@ @@I xp +Ѝǯ5 C A`@-T @%PM<0< <  Zp Ѝ'f 5 M |O-`MM@ 40P4 lPgE7E/P7U'S$0`0@ 0 0 @`F( 0RtP~ 0S0'V 0l9 0d90\9\ 0X90T90P90L9t(@!!0 P j0 /C BRZ  0  00=C$0Cȟ"!0``F ^v `E0800IcCP S@BAp48 0`P0p s!0h@"0(0(0SD as0$ P0B'S$0؍Ѝ 0 0'S   BS>C0C'S Q:dǟ"!! CR   ##9C0C"!% <'Sǟ"!2.Bǟ>C"" Ɵ"!/B Q 0*Sy S &S  2S% Sq 0S R )Sj&0C'S000S 0 t6H t0@3s0( 0 B( @ R p&S !sX>r R 0 0sp0S s0S p0 r00C!੐YP0  @Prp <r0S $ZA 04 8 <$S5r0S 0rfr 0p W&q0,00pJx [p4#,003c10S1ׇ!Dr~Z,0Sb   ~] ,0, r3pG    #P# P# ß P# prKt#S0S  cr0S,  h\r'SPVr0S <Pr84 p W0W"    0p9r WL3r0S 0l+rX&rp 0 t <X0 0J,0[P20, p'"R 1 !f ,, r1H    !P! P! P! pqhK  IS !Sxtplhd`\XTPLH <i\Q wڱL(( $ ٱ߱=zn_D P+05°P<8 APTHMfX ǰt̰HMհڰ߰!&/8?S0@-M TP`p@@NЍ01  @i 0 /%/-@-@ M,00(000 P  Ѝ@Ѝ/0@?o21  @@@@0-@-  OO ЍЍ/@-@OH|B 0S/@-(-@-  OO ЍЍ/-@-  OO ЍЍ/@-\00S 0  0000 0 NpЍ(S@-@zHwzqzp0{K~pX xp@-pMPP2 P0S 0@P 0 0 00 0XNp DlP@@ ((@,P0P4P8PS00!031 0@-Mt 0M@P \㊗ JLPP @ (@@ 0MP 020Ѝ0% (m @-4@ ((Yp    Rp(m렵s&ܵmP@-d0 !X !T@0 60\ (0000/w Ph0h@-`  !TD0 60\ ,00 00/w P-P040#^4<\$0000/w PD0 40#\00Q 00/00w P-H 0:# ^4 0Q$0000/w P-H 09# ^4 0Q$0000/w P 4 <# \,4Q00/00w P@- 0:# ^ 0Q0P@d0 :0# TDD#^<0\ ,00$00w  @- 0 00glP Ѝ&%A-P⿍p`@WЍ KP E3MP@ p7@-P@U0  (\J Ѝ0A-0@nS0oSp@ pP`\XMPJ0nS0oS:LPP5LPP'D@-0 nks&O-M M0 0D@00 l0tpF0S SH ?XH 00,00 Dg* _pp@-@PP (:0/Sp(p@( &@- jf:s&O-`@ Pp(,000 唐唰00 TPp0@DTq oP0 PtxP<ex9 O4ꀊ-l&-  X@-M@A>0 0D@00 l0wsp0S SH G 00,00 幐f5 _pp@-@PsP (寐0/Sp/(p@+( &@-  Bcfs&ѽG-`0@P $p堐0 Op00@DT oP0 dwPPyw  9fA+Gꈊ- l&` X@-MM0An H 0P0 $@rp Mf9p@-@PP (?0/Sp'p@' &@- ies&O-P@M P0`TrP"[Op)@20 R. +x   &  x `!p0 *00)0 &0_ 3spM uPfPMP- 9P GP p1g@PUP|0 0|00|0|00|00|00pt`x0  wP夏wPZ,0p0Y00t0V 0;;0x0U,Emb$00|00|000Ѝ舊-xl&jlp X-MMJNP0 @PG00 |0rp0 `b0 0N/0 4 }0@000ger 7@-@P F0Lo SϜ 0 , Ѝ0м@-@^90P@@-@:0P@@-@ E0S 00S0?  Ѝp@-@PᾤP (0/Spz&p@v& &@-ƾ@-40 0,0,0(0(0$00 0gd2C`s&7@-P @EP00S\ 0 嵎 Ѝ0ǿp@-@ PX0 N0(p|PP(奎Pfdp@sC(O-@H p0-H (t$$e %Mp50pGWQ. 42@FP40S  4 40S 4 0<007a08:l$0000000Dv0@90;glP\04P 0Ic0(80@008 0uPP 0       +  @   ' B 0# R #  # R" , @ ( "  )            t20  |t0$000 Xt0 000 4t0$800 t0<:00 t08:00 t0@900 t0,000 t000000t0909R41r0$000 0 0t0,0w0 0x00007000+ 4  Ѝ4%%-%l&( ((( XB@(.N  %C-RMMIN@XPpD`p`00EL H㈑p$|L0op0KS 04  R< pL04I0 p@ 04n/`  0zHP 00 0,PE0P.0D P! D4e 4$04 0404040 40$4 0(40,4`044<$@dRݍЍ$@$b(.rX M|lp@-@PjP (妌0/Sp&$p@"$ & R R @-剌/f0@-@MP`p 0n000 oPPЍ0P0 0 0o0 _n0P cs@-`/P0@00 6nP0 PЍp 0`( "4`#/s@-@P`"0 0Pd00SPPP @@ 0UdЍp( (002P0/0@-@CMP( P41010 0000000 0P B< 8#dH00Cߍ0Cߍ0@o꠆& "G-0@`p8Pp6 8Ġ#̌ Ƞ,Ƞ D_4$03 00n4<40 8h0e,b<0(000pE040p<0< Dp P~H00ЍpHPD PG c(QS2 O-$M@0 A`Pp0 @T .V0O<00$Ѝ 03/ Z0p @P P @0 ` T0P":@ 0 `  p00P LH0@3/pP@ 0P 0T@Pp 0 0  Zc꠆; C-MM`p/  P@1L#Pd8$#4d4# N41D0@@ 0@00 0|@pߍPHڀ@Td8$#Td%4(C-P[ 4M@_@0P` :0P`PC"Y U 00h 0 P  H."0< 0``00S0 V0S`0000 }pp  iPPQ8#0!D0D00V 0 000  P0b"!4b4#P0P4Ѝ 000<0X(.(0@-M 00@08 P  Bۍ7Ѝ -@- "c_Fs&O-`@M$  00p 0@"@0"@0 "[Ip20Q0CS |2g@xP0p00@0⦌p ! 0 [qP߉LqP PPӾ0S R   .P  x㷉 ܔg!! HPP⭾0S R  P   P Dp n+lp t 0[4S08pS @p @Ѝ耊-l&D -T X).\B0@-M MC^P80@0 0DP(00 0kp A 0 xa ua ra(50P( lka,30P , Tda0Laaލ Ѝ04Za(VaR=/7@-@P ?0Lo SϜ 0  Ѝ0м@-@%30P@@-@40P@@-@ ?0S 00S0?  LjЍp@-@PᅞP (0/SpA p@=  & 0`( "4`#/ p@-4"4 04"4 04"4 04"4@0P5 $(0 $(k XXgddhhllppttp p@-4"4 04"4P0 @ DD@@HHLLPPTTXX\|`\ `p` p p@ p@-`@"QUpf@p@-@PpA-P@M4Q->C->CBX?X\<\99>9>:>C?n:>CF| 0? AC>s}C>GnmFjEnFfE~Gb 0X J~XpV  $$((,S>,?}S>G:mF6HHLLPPTTXX\\O-@ ! 4"4!14"41 $$((,P,0`Pp0WС\5 S L5sT`0$ $ 0Q`V,zTvT`XrX\n\`k`dhdhehplalp^pt[txXx0[ O`LIpp$5S\5 Sp`0SP%@ Sز ,*%TU 0`( "4`#/0+P0 C@ /p@-0@R M4 @8 P#` 1R  0  ?<#΋ 0`x 0`0 C c00 d0`c C ca0b0 0 0 x v\41P0p$Ss $$TGQT`P@Ul  00 ЍO 8St hhȀ XȐPUгP,,((U %TTt0p@-0`S[\@ L00S000000B0E0p(%|0P000/000/B10B1/101/ [D Os&O-TUM p dϠ 0@ `Ì0 150S  C0 R0S@`Ѝ 0 R` ` b42 R ( ,((U mH %s&O-MMO⾟D`, %5_Q0uPSi`50dodt%?D0Shh,/nD? 0?D4hPp؍ߍ 2@ŒD 0L 04;20d04 0{0  00@4T@:T @:T @9T @ 9T @8T @8T@@048#80yd0`p 0 40S7{ 3 0 000p0  8`  Z X &Z0 ``ao,Ff Ϡ ß\ ^/F222902?"""0Pa 2@őD L 00 /4;2dc 0d0"0 0 o 0p,2 0r 0` 0W8 cp`xSi`10cc `&!""#0ODD@HL05? 0 04s0hl 0@DE0 L04;d00 0@ `4 0<22229$,4( 0 02?  0@ 0@Dő L0 0/4;$0 cc 0ldh 0@ `Ì0 1m%(,(A%%o ((TO-)MM00=0?0,8(0c x<pW:l< 0 ; U 0P@P`P  <W P@ 0  ;Kpb 0  ;E<p@ ;T@  '7[P@ *8 7P (/`0S0,5 Sx0<0(500; 0,%S00T:P:Q04< WU 0Q WMz* 0 04 0A W? 040A W6 0 4Q W- 00 Q* }W$ 00Q(t tW 004 QT kWH9 @00T 0D\3SB<9\Cp垟WXp9X0SLW X0SS0$50 40bH00aL00BϠ850A<ŀϠ@5Dŀ0\P00\T0R380^S`R0001W @4p^ 0RD8 a 2! Q S,QdS18$Q<4R:V  @(8\5?>C0P4p3x00084%$0<0D0t@+0|00匐XL5P5G   ?8`F  ?  ?  pqu 8pG!PE0/0!"0 p p4%p8$``05<4RpD`VH466 84<00x$0$ 08pS_PS @`@0 ?@`0?PP* ?@P`(6#R0:`@0- 00 0$5SPQ0&" 0P0 ?00 1>00S`0 c2# S,Z Q Z3?00 1>!00 ^  BB0Pp0/2"0$ 0$ ?оWp1Wp#T0p10G 0)K  ?#PPB@TP` 0P尾똀 00B1  B1 R ` U"B !!0 R0CQE0E ?P0 pቾ똀 0 1 B0S0`0US0  B110S UVb @P`x1 G084<ĔCPp0S84<Ą-0$5BPS,pQɑRB@L0 0 000020S|0p ?HL404P@0 @x1᳿pp'Fd`q@00" Q4}L1\5?>C0P奁%4tx0]0(0#T a2!, A3 31 0 O@`0$(%%((4] (H`((%((( (^F<>w(((( ((s&ht@s&(_%,((TT(U 04 p G 0H$4  E$ ( B, @%LV.  R*h r <  X ! \ ! ?.@Xt@+@B@A.@B,-8 Hu p @40K p0 ,p B8d i A YZQ 0 ؜0 XZ R A  pW?΄$t<4Qï80P@D04 0H4(0Āp 2 R 5#< 523pr0S8$ ᾅ j 3ˆ 00 d AQ\ a6Pa`,PX0T `4壅뼐@ ៅᡆK 3壈0@0P 8b 0,T 00 SP0\#P !0@P` @4`Np0 Q0D&PM0S:dD RtS TP0 똤@t j0JF 0yrK0`0S 40S< 0 #(; (0+V. V$50S  ] 0=S,0S10$05H@ p ^PP04SP0 0R0 S00C0> S< 0,00P0 F 0,0S8< p开8嘥ȿ+" < Q \%T`R 0  ᐡ, 400@(0 0 @DU, @4A6, @R40 `0```0T0U(g 0 p7 I `0 P$5P'S`0 9pR8<00 t x00Sx0x 0\0  1`0  B1$%R' R0C00h0$l`0 R#00B1d0 R*0%0U` p 0 0 0 (0 0C 0(0(0 S l8`R`  $%R0 l ! `8 p  R2d 8RT T   9P%QXԐ R, d0 0q n  h,   8 @ +q`Q 㽚+H0DH ,pP+H 孚H0H 0S ,00C."d\ ^  00 0?d B2 b<10 *Q$01=S,00CU p010T0010X0 004+8S\0?0  0  B  R\ ?0  ` 00C 0  80 C  0C1448000C ST00C@ p`48 QT* B!44 T: $5Sl0 @0h pp^:S $%S0! !L`$p$p(0W|0S ,4 S d,04  0,4 $ 00`  VjG0S   0帀0 X#` x0} X\># P 0?d @ `0 <u (>\%R 4n0SPL Q``ƌ` $$S >`R`  $%R0l ! ` p   R2dp ?RT T  (?P%QXԐ R( d0 0   ( E  8 @  x5R` /  `@$  $ ppS $S00S0@P.l倐HF(P00@ 8p`0x1ᐤpYU0IX!@@l00@0T: 5@$\4Q 0@08(0  (0d0O@ 0NN nC 01p0Sڜ30S0 000S..P08CTC X3 RP0ł."\5(S 00 0 d 0/ @ `.3,00 $ HP0000P0S 0,00C0S0 20S 2P0S O\20S 0j O00@Pl:h*0EXP20S EA C 10S303040404 0#pCVW*wV.PaV.GVN0S  h10 PSX1\5=S,:81?^ E?0 0S 04 g dLĒH 0@ `Ì014 ,$0S0S 04 O d ,04 0Z 04Z)ݍЍSngU ,(T(? _} (%((8 (G-`RM@Xr wPP d3wP`T `~P P9  ,Zp  0S  ,ߍ<0H(00,0 00004008004004 04$0D0(0P 7%W[  iZpU lcZp* `v\` 8  8 ,     0,00  `g Zp 0`?`a8S*fPb 0  0**0P0ma ; 0* vd@edAvzd@]w!vBwww&w9wNwA-@Mp`;@@ dp@ݍ P@00@uXT00 ## p@-@P(P (dv0/Sp p@  &R/G-P `$ 0pE@V` 0>@`` V`@&!D( `G-@0 4Pp X00000`0 8#8$#48#8X00P a 00 "% ?Ѝ :^FF^: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- P 0U$PP(,`0p4@*^ :^0 *^*X@O-4MX0p0\00``P0 0, , 0S P 0 umS2aSMS ASB0C0`b0CX S0SSU0@0 0DT dS$ 09R M"P T 0U8$UQUDT P 0 sS@ @ @U00 @@@ X 00 p P2u0S00 0 004 00P4ЍKj @-( $ NJs&| 0@- @    G-@0Pv t``PE0 00000BoH0UB?E ᴀ((P0  /PPP\!1cQ\\/p@-TPL`(FV@ d0 P 6V0@ \0<@p(0P  C @- t co`/ Ls@-@PH` 008(V @ ~tЍph(( gs@-PX00S@H0`ă5#040<e(V @ _tЍpd(h(( h10 PS/C-TQ@@MPM`6`@f$a 1p P09 0 T:@6S0O@ D DD6ۍЍC+ 0P \ 010 S a8!#4a4# 0^ P;0T 0+ۍЍd((h((l( G-DB` pq&PP " s 0F040( ܴ06# R 0 !s0 60 0 !s0006&0>06 0  B 00C0( 6V0:`! `Vp 0ᛴ$&0? 0(0 6 C c0 0 &$&?|0`L0V&S %_0: S  0d  &ЍG=(< ((L(( %A-Xa00S FT:p%PP  0 0A1S0S( P @D A01 S  s0S @2106&0'0& 00C00&101 00C 00(- 5O-P`CM(H'V?O8fK  tP>U㰐Y   0@p00K @6 0k 6vppG  v&;K?od2 Ǡ R`$0000$r g2 WQ Q  B@ခ@ 00 =p0 Q 3cQ010!$0 ᒩ , 0UC, 00 40 ,0P,00 4 L Q 0  0 p$ F 0圜,00 0  6 v< 0(0,(200UH,0000@\ P,   D`04 0H\ d0 $4LPtUU 0T0;0<X5%<0Si X$;PU P]  w0L VR0400& \p#  @ \ 110B0Ųf0FE0&aPeeC0CP!Pp\p :3$P0  ` E0HZ0C `$00SG 0j 00S ,!*&A 7 (8 I) 0 ( "*I 6 !"0H& 0 09PpD YH&0S^d9 R0J0OqL  X&' d  rP &X p \ ,p0&s0&$0#0  0vSsp0C 0 0 V0( " B("( 0& 0 `rT BR'0 Xx0Sw 0Sv00(8(@ p ]TPPYP 0R SIq So d`P0S U7L R d0 P# 0pDu'oru+U&0# 0H&哥*6 B6  20 2`D D64w0CU 00C0CS : B/6! S/~`0S0  C02#8&0RHx`0 0Z 0:Z0G:,u3006   0(01 0 0 KU2  060 5&t(6ZC:ؤ0USL0S d0 JP V8ڨ40S X-P6! !!0!!!0 S#$0 ᓲ" 噠 $0d0$&S: 060& 0u0.GH 0X5#0003 HY0SMf`F`VI d30SA HX G<3PUBL0S \08`0` 4 PP1 P# jH36S6l0H0p0t0x0R086309Pp`Go  ` }Gg jX26RH0p0t0x0Rf&1 #?1#  0RP*d "y P0 l0PPP!g 0v!`P!] !P  6p!dT!PU:< U+:0U: $0 #0 h℀%L0S^`UB: 6l((Mp(uh(!%%\(x(%QNS(((`(Ud(4 (s&ht@s&_? } A%+PD N%A%S x%((h(p0S :W": 0 H 6Pd 0P0 W %%* 哠 p001p1Po 1 !:P, `U&`81 6P!0U/0 h hL0S `0  1#'$/%16QfH0lp0t0x0nQ080&2l0P (089 L2`ph2& 0h>0Df?o2U+u&0# 6` c2H H0 HD[QCߍXFG-`RM@Xr TnPP dmP`T `AP P9  ,VQp 0S  y#ߍ<0H(00,0 00004008004004 04$0D0(0P W[  ,QpU l&Qp* `m\` 8 N 8 ,     0,00  `* Pp 0`?`a8S\Pb 0  0**0P00X  0* vd@edAvzd@]w!vBwww&w9wNwA-@Mp`;@@ [p@ݍ P@00@8OT00 ## @-`p  @P 00S0?0\ 0S 0  mS\F\GL0 \ gL0 SDKT ЍE%KUJ%FZO%A_0 \ @-H DE<<P4@0 ,PEU@Bs& A-p`P@P V0 lG-`RM@Xr lPP dlP`T `P P9  ,Pp {0S  $"ߍ<0H(00,0 00004008004004 04$0D0(0P W[  OpU lOp* `bl\f` 8  8/ ,a  ] Y U 0,0O0 K ` yOp 0`?`a8Sژ[Pb 0  0**0P0V ⩳ 0* vd@edAvzd@]w!vBwww&w9wNwA-@Mp`;@@ DZp@ݍ P@00@MT00 ## 0-<\   RS  0 Sz& 0 /)Q@-$ Q:?OaO-@M Mh 0Pd00h00X00|00p000 0\0$0l0(0t02000040<080H030<00404040F00G00H0040P0050%+<0p 0S00|0000000S00\?00H R00S <t0S Pt|0p 0l0- Sd0h 0>i/0)MpD @|0@ Sp00۽ DLP  p 0D@ͽqb@P\#MpD r|NP ( Tl0S 1 : S  R 5   `P`0z W`r`Foobr PV   P  P@DH [3}pTrd0h 0 0d 0Dh0jd0h QP  h0A@ T0S@040x0 0P0T0@0`0,000$0 T0R0 T0R@00@00S@0S100 S0P00RS00 R0 R0S0P0z /z0P00a+a` pR  W 000uSW 0`S`SV Z T @0S T0S2|0p 0?0 D0p| pcT *ppv @@0S ?X01?0#*@0bph T0S|*Yp_ TpZ 0dhw[J U  U* >05[R[:\0Sd `!0SV 延PX` VU \0 0` V `DhIP0 @$  0  , ` $ ( @ , T 0 P < x @ D04 0p`D&$Mpe 2"okk`0dp?krp0ok|0k`p0 ደ0V0Q0S\xDU" U U T: U0S <(0S P0S0 0PPRD0(0 0S0S  T*,0 U00S,00,0<0S$ < 0Cx<0S* `t<0#SLn< $0R0$00S S \H0S H 0CH000 ,0R0,00 0S0`0 0R0 0R400 40R000X0S /ƵX0PL04&@_0PL0 LJpLroPL0P!* R8r,00pS<Rg'E4H[ p+p W,0S 0pPPd[  ?P U40S 58 R 0 S%PX0L000080 U $0S8`|80$04 8 R Q R8` 40`0S|4V8040 4 R Q R  R V R ```$0S PI 㼿P3P0!01 P$0,0Aి[0U  ৿`%1 0$00ԂԒpA0[ U U 0s#Ꮏ0 0 U0#2" U Z* U 0S:<$0V $ U ,0S<,0ꋰ $00p 0S !0 3 Z5s:0%q!   pJ0  .Ứ Uha U\abV10A0 3 0S0 0@r"0p 0 0  ,0 ᙨ @J 0Y 1!XV;p != 4E,0z&^  S|C_-S&Vu~?/+Mp_ DRnv~6 p?s&)gfffl URRaArrAa U0 U00Q*H [00R 0H  U0 U00 `Q!A1Q  "4R0D C?`0SP0S00`0 Ux00x0P0 0S !3# U U00 Y00 0 00 0?00 0$0?,0S  ?Z  ?`$? 0S 8?P0T @H>Y X> 0Sx p>t>>Q> >l0S ݍ Ѝ0o ? C0 l0&39p `P flI?C&_9 0 S0|0| 0$02#ll0 U0000 0l 0H0 t30R08 0R000\0\0S0 U0@0$0Q #   t  004Q0tp0H0( S 040S d(0H᳽H0 0p(0t?0|$0X0S& U!0( R030"S 0R<00d h0巸80< S Gp P < L((0<0 (0S U0( R00S~ $4 0$0 U000 @0,0 0#40*40`00 0 1@01T01P00 0$00(0x0,040303)00000 0(3 ?@1c4 04 v. 08#$0 #(#< 00&w= ?Q p0QX0S000t0o0 00 R  PT pe'?  D8Gp] P^ ( LP74 R ( 4R  R 0( S7071011l0( $R030#R03S 0$ |C_Q`000S  0! UQ0R0( lR00S \G(0 00 25 010 0P B24 01(00(0S  PP 0`( "4`#/A-0 0P@n @0gr0 `TpBi 0qeA@00@- 44@4P\P 0B"" )-@=B')@- =:Os&G-@P ` V!>0}P V0 0  vPP G2pP`0.( 0Pd0S 4d0 qV )- s@-pP@ 0  5X 0TTL<LЍp ;P `50 ;<)=)'@- 04$#$04GQ   < Ѝ/=@-$MP p # @1 00@ 0! 0h<))b<1 l]<5\X<5LS<`APTV@D:$ЍF<7up@-8A0MP`   0 0 010R  4    "!0Ѝp@<R  $    "!R ⳿0S1$#$ 0("( 18#! 0Ѝp@;0Ѝp)  @-sEpc)P@- 0 R * 0 #  @0)P `00CS`0p S00 P0S X0X /X<(s&p@-`T@P8!R#<10 <10 .810CS81V <1S 0 <1l0 hɱdDZ`0-Pp <10C <1$0 810S81)8%s&s& )O-@  0Q7t1 t t*   <(8(P*@0C (6K+ C | 0#-S88<8xS`S?S DSg .@ Y 4 , 0BK+ ⶥ00CS00QP)a0CS00 ⣴  PK 0@P: 0@0 |9 x90Sl9 00K )K @ } , PK 0 $ PK. 6 K  `  ͵PK P 0K. 80  F d ⳵@Puww D80S 7  .   ⛵P]7'<07807407007,07(07$07 0707070707 07070707]6   k`P-K PP 70Sh'0 0C!0R3 H70S0S K  @PPPh `ѳpγt0@Pp&  pijt@@hP0X"T  0T\  |pW plS  0QSL0Q㎴0P@}0 X\ D`X0D S@0S2 @DU1 PP mPPK 0P@0 K. 5K>l%l 0 4@ट8@pP @ XHl 0S$0 0C!0R3 0S0S 0`0嶴P `0ᰴP c=0,C0 0 S;.0l0 {5+ 0  d0d0@  4wHS p 1 01 Q 1 \R \@?p@1cF0DH`X(p3 R  @5  Z   tY   \0T0S 0RD00D0. L0 SH00H0H P0S  ⰲ  P0S* | 5 ➲ d PcݍЍ ⑲8  ⋲  PPA0S, P w  P j  ׳P ^ | ˳PP@d0S\X_000+ Er6X ,7**0**s&@ x  O *\% ~{*…u7P Fo'GA,**gfffcf: vr]  ?@7f@-<00iS03S !<KP1**8@-l@h0\ 0 Lw @4r 0 m  hV*[ckt*@-`0@Px0 B0PU1 S2P T0p0S 0@ S<< 0,$p3 ЍX%,**}s&C-PD1`0B8! Y!R!tM@p  10S 3 tЍ000iS00S 00S d `P 2W @ 0 i P ϲP000 p 0p3 W@000X%,**s&**\%`0@-@X0 B0@T1 S2@ 0P   0S X%,*G-lQ0S ``! @P 0S 484a4qP0 0@0C!R! 1S1 8Y TP`pȀА U0(@P 0E!0R30S u | X+30S2 @TP`200 @$ *s&(*,* ***O-0B$p 0Q0US `PP PP"2 @P0 D  0S= 0S: 0P5"  UE  (; V S 0S000C?oV20SP@Yw P`P30S  2x#0ES0000D30S ЍYN 0 X@00020S >P/0 t2X0000  000S 0@@T2 0 0@0010S P0 YQA 00 0X@^0000S X0000000S~ @0 0 n RT 0@s0S @ 0 @$ 0 r@WH00S 0 T,} D(14,**s& +s&Qc*`1A-0S PPj@`DqD T0 :41,a PU @T)$PWP@`0S 0D !0R3 P U 0S 0S  |1<P0S0S \0S < i1$s@*s& ***,*20A-0S |P `p @T V @TL$@ 0S$p$00E`@*s&J*kO-!1 RR0夑S @P|q| 0P0: ЍS DP`P 0 <C 0000w PP@:SR  00 Q ]`P0pr0 000 w000**0*s&8* *s&2O-0S ^0b0 N_#1P7pġP@*0pP00Y: P0 *@@ '8 W0: R0':,0 R S U :SR00W 030"S P 0000 S 0 SPhz \ X70000P@ Ѝ*s&28* *0*s&C-MM@P Q0S @p T0:ۍЍ0S 0 BX000@T`PP@p0 , Y $  6000PU *s&Z *K0A-0S wP`tp U0(o@TP` 0Q0F00S J@*s&e *~A-p`P@P /pEpDorP 0L0 0C?oR20S  P s&p@-/0@Px 0Pp SRp*@-8 Q0S$0$ 0 0O/%,=*s&A-`0p0O0000 SPڤ/0>+b P0 P<1P@O 0 ɘ0O0?*+f%0@-@0 0˨0@0Ѝs@-@P`P @TZ TT/?0 00?ᰨ+"+R  + 7Ѝpls&$0L<S/ @-P+f%O-2@`VCM{ `qP@0DUCߍ貀TX B/v0 S4(( ^j@0PS  b8"#4 b4#04!40010S 0S 0S0000崐{'{{g W:0000Y&*Ȑ0S 60 0S -0 000R*Q p`k.0S H`X0S  ` * +8+*s&@-<C7p @,PO70@0f% O-X3p0]MS DD@c@C 800#0-00RS #0-Ӏp"& gRPP "U.W 0",00RS[ 0",x嬀ph"lLegPP"L  Pp DDB@r<2P00SY : SVH`P ؀/0 Օ10L<aS$ آ< H @ 8( D `  P  \  `T  X  8夡P ,> -8!88hL/0>+b  P<匡P P c0?0H @P gP)PD k  n-L P gPRP|]ߍ*s&***f%+Gef%s&X 8**L,H,t+s&f%@-$@0 00: S8*G-@ q `0S+ 6P 00S P0 S00P R HRڄ00S t-  Y`"P 0 Y00:$00S $, **s&X 4G-AM`P@mpP00 040AލG/0 008/P1 00C 0  R+h X ,0  0 D j: +r]  Vs&~A-MMpK 00 0/R @`㜀GPP 0S P@ۍЍ D :`D @P 0S RP`+X p@-0@ @P P @p@-@/5@O-3tM0 S ppl00RS\3 P3P#0L*HC4#S<=88tЍO, ,$PL     +++p0@`00X5آزL<` M+L\0@ yWI< h`VV#WU@Pp (L<0@'pi0PxSiScP 0'0@$ 000 +L<0@ <HEv`0`<T|9L etЍ0 0C0\10S 0`S%0` S\4X4h0SS   q38n30dS X00`0\ d0P!c0 8>+4*s&***ef%f%s&++6**Pj*+ A-MpM`@PP 0ppJd!d4@P TT+L占 < 0*ۍЍ aD D< F4pPU33 U`k 3p0P *ɮ x*'0S 3p T0TP 8 *밮8 [E-s&9 +*8*W@-3P@-L@4#S 0  40#S 0 @4f%0A-@P` 0 P0: 0lhp ?႒0@$a@00S$`V SR *+* 0S 0 0/ R  /0S0 `0p@- P0@P*D` ?H0Pp UTp$/p *+0p@-P@ 0 P0: 0|Yx` ?$01S 0p@DI $ P\@P@ p$0 *+@-MPM@T 0``p/VVP   P @T@ۍЍVP @p@-/P@P@p00/00@P 0S  A-P/p\0@oC 0T@@DKZU pDP@D +$G-pP9`04PSp@P`0PP0C0 T`4 $YD@;+*EG-頡FPTp A`Pt&0@(0C0V$Q@$0( 600v`PPEPP yܦ @$@@(`/:ɦ 0`0 @ `P`S0P p0@0 P $C +*`@-@ឦ00$D +0@-S@ 0S 0S  0S 0 Pvs T` R 8dD0&F$ ЀP 0S00$+p@-@`PP|D0S ? 0P0 @/ᦙP1~媧0P 0 00p3O-2p0SlM ||*x20SGh(PP b{P Le(D0`000@(Q /*` R 0?*@aQf %1@ $10 %1 08`008<:0@ +D p.(hblЍ 0`0V@ 0 0/ 0` @T`$ ⨑000 0 0($00S0,00S0(0 0S000$0S0400@0 1S0 00ܛ@*s&D*+s&_ *+***C-20MS tYr 0ŏeP0 00;000Ѝ 0PP d `' X82P 4 $' $@0@D1`P k0P l o' x01RQ rQS $0!SP P0h -$0 D0P \1L ! "H D10S0"(P 0 AD@(C@D\ ((00( CT( (0 P < "< 8 R"8 4 R"4 0 R"0 , R", tK R" *s& *+r] ,s&'Iq**8*** 0`( "4`#//5&#./'r%O%0@-0@MT[0Q@X0T L0LP H  &Ѝ0@Q@ +I8*s&0@-P &#8*s&0@-Q 0@T0 R ||Rs#0AS@ ЍH0 D1P( &`%0* +s&:h%mdA-D@p 0 0SP( ` `  ` +uL0@-  Q0 0P ,0V&,# Ѝ +8*s&@-0xP 00S@%*S` &P@` 40P , $  0,&Ѝp +8*s&0@-0@S 0$P B5/x00SP`P ğqpH0P@` 0((@%" Ѝ* +*8*s&p@-hPh@4S 0SP LL4%H0P00080 4Sp- +8*9cs *+0s@-0@SP  40B3/p00S\0 .pH0P`@ᩩ 0((`%"Ѝp* +*8*s&p@-P,@P@pP @ p@-X0XP0SpH`@P jP  /P"@p*h% +s&A-P 1 a051q0S :p4@P 00PUP',"tPb%P?X 0A%ltT%P1JT 0H3%000@A( * +**(s&]! $+C-paM! X\ X% 0 00@! X 0A0 %08 !Q 讟 0"Q$/$X. , W $ 0 00`  W $8#`Rp000F"$t F$d~00@ LKЍ*s&8**s&*_p*)HTqO-d@0EMSP8a  <<$0 @000T*0 ?o2Q03S 20S 2 T" $0S Eߍ0S{ 00p0"]#0S 0"p! 0tPe$V- V V:   B B B 0 0."p0H0S  0gP 0- aPO 0S; 7  B B B 0 0-!  B B B 0 0-@! V     VU !p 00S #0@^  0S  V     V .p p \ L *s&*_h%;Nb+ 0P/00S Y,h% +P O-5M M)$ `R P  50S@ލ Ѝ90dUY00@T e L500RSM <50SI,9S' 5 05%05u# 'E#B  00 (4 S Bq@P$ʠ  B3@9S4 B.|0T E#Bh$@ T, kV@30T 949m (#ھ !#ij媘B 0弰 B4Pq(4 S B婠 R  X3p H "2\+R(@93B0 050Ȑ30s33P03Ȑs0 20S )"\|00-40 S 0"|#R Q`SÝ\U J $ U4 "U  " 1 )a#0)90S 0)"(PU <10S1$10S 0 X `y 0W0) B?W00pBS @!W<1<0Ѽ _"pWJBIBE`FVU //4S 04*0 YB,I +s0**8*j s&-*lV7 j -h%**$s&E\** _8*+O-dCd5)SW0pW_`R00yu0SW  0PS9 S00P0S 0S 喽09 R ?oV20SJUMU5D R4 pGW`pVp``y\2 RD R: R; 4<n820S>,P: %+ N909909 Ѝ0 *+"+R ! R  x!EUY0+5p`PlP d<|!X (w!`e  0S [ P^w a!00 ?qp V00S |0S 906;#;S T%wE+Xي +*h%*s& s&` 8*w *M*;      0*8+0O-'BM @R MxWtPP P P Bލ ЍDW0S870S ,,导00P 70Si  "4h"42h|004488<<HHLLgdaxx|]|H9^EDEA:^E=E"4"42"4"42T%0A %%Z 0 0 8^$[$P30S` P [L 0  0#`0 0 0{20S  !20S620S k&I%P! 0 f%f%Z 0 0 8$$20S 0 $m "`b0 0 01A%10S 403/ %% ~!P@Z00 0 X10S00S 0 0 8$$00S 0 $4\  03/Z 4   00$8*D s&* s&** +5 _ \%r LM0N  +*  h_ L  0 *+0OP Q @-1M( 0  S != 1 1R 4S5 !4pq04@0TaP/ P0S  R+* SR- P- !0 010000 QP 0PT 0$M "P ЍPB0P;C0P|80S050 000 @ 0@0 08*8*T  + *  _ q @-|cM0S ll凶hChS0S YWP0#0,, R0# 2r 0500K Pr5"0C590C990C9000pPh|n x>0S \2d"`2Q090 9`V 105 S:; S0*PP 00P  0 0 P 0 Ѝp_S-S t%d`0X 0H0P0;CH"+T4Oz&rP"+*\0@-CM@P0, R 0  CCߍ0{H"+@- @ R700H"+!@-$M0h ` 1 P%@PPDp$ЍPU D&0P 8<@H"+p@- M0P@H   Ē4`   ЍpH"+O -\M0 P  \ЍQ -CM0(  Cߍ/ 0`( "4`#/A-pP0`V  @  0!S l d; z 0T`0  0 d0 Do`"+rLp@-P@U U x 0<8  $p@*  s&P 7P P / //-M M? W).ۍ Ѝs&4`00CS`0 XX0 X /(s&C-pQDMDЍC@p`dP !W200 u00@020PS00C00@ Rp@T3 W+X( U U    ֖   0.    Ɩ  .0T :HHXp8(Pp Ws& `"+=h"+7 0@-P03TM<0S @Q TЍ0@6 31Q-*0"0CS0"GTЍ0@b !0S SL 4  h`"d0AS!0H 0S0TЍ0@$    00P1P2P3P4P5P|0hP1 20345PfP# TЍ0@~j@P=P(<P$; :9876 41jS$  $PPQ Q (} x]TЍ0`"+ < _" 6 : UT gdq~ j(GOl q zO-@`pR@--+0@-6S o (+^@-h㜑㙑㖑x㓑m/l`@P" XTA  <4嘋, @^8k)+)+@-鹑  ss&0@-h@  0@ 0\Q0CS @Cz&p@-@Pp00Sp8PU``p840#U :PX0Pp4P8P P XPp`P -7@- 0@P0l  0P0S0! B Ѝ0@Ѝ/O-`dM@P )P谟 U0E 0 S  dЍp | J ]  ^J !0 p @ @   I0  .0`  Y0BᴗP z&@-@`Pp@"!0# U 0 x⇗ph h14 \}P@TP,*P  ЍH f _-,M֐ H0 $0@0080000 0(0( $$0  O c l v   s&-7@-鶐`P @XT@  R 0@   !000 Ѝ0@Ѝ/P%t/+ p@-PP@ 0S 0CS 23 0 0pp@ TT 0 0 , ,Up0Spm t/+/+ eA- `(p 0pЍ P 3 @P  PP 0pЍANp01Sd0 \  0T2Pp 0` 0S ^ ` F( P ` t/+P%8 _ C-q@1MS0`q1SP1SgV1 z 묁XV 1 ЍCVU 1S  L1ЍCV8^ p0S* S S  X HDH H V)ЍCB   >  X   ׎ X A`"  TT  ЍC VЍt/+P%8 s& ٳ6 ^!A4 0Q 000/ t/+P% !G-AJM1MSpt=m`0 PA c4F0 0 Fypp 0 S JލЍ;X P0"A7J.H0 0G1$HL  $`000P PpQj Lp0S8i1!0  t/+1!V!s!eA-XQp1`S1S@1SFV1 w 1SV . AV1S A 0V] S D@d0S VAP 0  pI 1S XB Q 1S<:  A Vt/+P%8 s&ٳ!A-a0 MSP@p@i H4+.=.@-M @ P  $ POۍ=p@-IMM @`m P IލЍp P0 0 lhP 0S 0S0 0S  P=\..H4+@-M @ / PDۍ00 R   P=H4+H- p3MM@OPPYW`8$|P $|P P 04|P00 S 6P P00 S * P2  t `P` \2P T{P ,pPP0 0U,00P` #0SBX J1!P J P .J1!@ {Pp10S d 0{ 0p{PPPUX$ PJU 0 $V, Q)PnP`ZZE_oR 0WPP&U  4S J P |ֺp- 0dT7P.+ =.H4+.{..km ..i .///s&T//t/O-@MM`;@.prp P @ p @0T @0Z:: 0S ލЍ0 0TPL _@P@(0HT*20Sa001!pZ0V90 ZVP Z.@zP0 @ZV㟹 0Z ;P lZ.@ZoP wZ.DZfP nZ. |dedAH4+4E//@8 T/@-0`0 0XPP 0@PL XP Ѝp@W(P I Ѝpt ? O-tM< 8@40PPpƅtЍB0PP(0  (0P$0,P"$0U  ϹT T T;P07W 0xT6P07W 01P07W 00S\PTO7TP 004 0S0R0S00 00 (0$@` 00@TH*H7H'0D7 0<7<087P0T0@@(0@P,@$00Cs$0640S 0TS0[dDt   0` p~  ;X pv xX `(j0P0L6PV 0Zx0BnS010<0S 08 SJ ?@0?D000S5 0S>P ? x T0 HPpo 0w? 0Hw0L 0z+`pv+ 0. 05=.H L ,0 0,0 0@000D0@ B^op `4 0p0`XD p $?4 $;`6 p H\$?4 ;$h) p X0 08T0z0 0(+`p$+ 0. 3-h `Pɏ 0w` 0w  0SB0SP0剤T400[S%  p8c0p`$X p $;` p 0@[ 04$;h p h0` XP 0@w `0:w 0@[00P  0.w 000 X,0S0T4 00[S>  paX0 p`$ pH 4`P$; p> 0[ 04$;hw p2  $`p $ 0- <1@-h00H!T0@P $`p $ 0- 0%-0[P ȯ 0v 0v 0 vT0| |0m 1%1000t1S1}1ëZ1_1F1Y@11111!2Y2_2y2@-| 2s&A-@p4S`  PT0DPEE$UX  xPV00xP V0-04 P $3MDPE@Dp4+! =p@-P@Q0  0 pwP@ R 0S Lq#Pp 8Lg00 0, 0p$c#%c+2(,2,,,3@-2800S ,0 0$p [ <c+c+8+G-XM0MS0 DpW,Q`@`$$Q0 hm+0A<P 0 0 WۍЍ0 000nS ?S aS ppS qS x0  :0 d030L00 8'd+d+3c+3(s&+.3z&Z>3a3y3A-X`0S L00S 08P8@p0Pp00+c+d+d+@-@L0@[2@00Sq&,0, 0S00i&d+c+c+@,9+C-RP`tM  4ş4@ !Q RP ğE R`S `u0t`FQ ğ;   T-P ׇ Ä CR ` 0S $ LEz 84\ P0@04ßQk [Q \Q< $Q  DR?` R @T$P \P" P!0 0^\0 1Np$@@$@ l  P\p\H 0P 0 P p00$0 R  "DQ"00" t 0Q "F0S 0QX ]Q \QQ0 00DS000S+e`tЍp1A$^? l0HQ pppDW\Q> $Q" 傀ಀ 0R㜁F p1 B!$Q, ltH R' DY  DR R DRڵQ 1 |00,Q ]Q 0 $R p0 Q,Q ]Q B + 0R0F p1 B!$Qd lXH R_ pppDW{  DRw RQ =z&z&,, ,,c+=4Pp@-@@P@T -|@| |P|`0Sh  `0 pXe@ P ,0< 8[$0@pp@%? c+Q(,8 ,Y4A-@P@p0S0P0`x0 R `A R0T @ 0S 4 P@` ,h+0d+%{4P,23P@-, 0 E(,4P@-, 0 9(,i P@-, 0 -(,4P@- , 0 0 (,c+t,4P@- , 0 0 (,c+,4P@- t, 0 0 (,c+,4p@-PAM C0@ 000 0S0! [:P7 0S40=PP0 0T00aS` 0` 0R`T0 0 0@0S0@T@ @0 Q000S0&aAލpP, L0 P @4  :P(55<,550,,,(,5O-1M MP+ 84 1ݍ ЍP $9P @4@/ PZ30S cs؃ 5PPQ / 3P㜃堓0S0S `V~`30S5 0@P/ T30 083 0% (3($3Q0Q3@OoB0B&Q20S  2` 0gP0002`P0 0R R00 R K@P 42H"000 H 2 2QU2@OoB0% Qy10Su 1@#P0001@h, Hw 0 PA0S0X ,`V pQ 0S 0S0 0@P+ 0! 0 00 00QQ0@OoB0u%Q|00S  d0@ 0P000<0@`(,45+h 8+c+c+0,d+,,<,55d+c+4,@5G-JMMPp 70@ 000 0S" 8P+ 0S(0P<PP# T0  1 1 R0 0S0QW`3 t1 0Sh1h姏P* L1 @JލЍP @$! 8PJ/W$Pw0S r@'00 R000S00 #'|0p0P04qp P0ST00@54,,,0,,,c+\5(,(5`FP,5 0 0 0 0XP,5~  0 0 0 0MP,5G-KMMP* t2 KލЍP\"8P @<2@82000(}rP 2 0S@2- P0 (qaЁ0S 0S 00 3@P -`1@0S p 5PH1 \0PP 818!00,1 0,0S ^P+ 0 0 000 T P _oR \&l0Q00S 0@0`P0 00`0@ \|(,5+P,5,,c+\5h 8+c+c+ ,5,,4,0,5d+5c+`F@-PAMM ]) 0 !@PP0 ` pF Fa p0 0pppp0+6P -AލЍ0S 0 `S(,c+55P,50P  /ҫP@-)0$ 00 g0(,c+555Pp@-o@P P `hP TP (pU ( P$0 0 ;pҫc+ 60@- 06d+(,P@-( $0 00S/0Ѝ(,0d+c+60@- 0R6h+(,Pp@-0o0@PP  0S 0 妍0S P (0 0pP@`0P<)P 4P000 0D,c+ҫ6Pd+6=4d+(,a60@- Z 060d+(,0@- P 06h+(,@-(@(0 E 00S 0 4d+6(,D,0@- 5 06d+(,P00P0SA- ,(0 !0ЍPAaq0S000+0S 0S1"000PPP00P ,_7`0H L0<\04? (,8d+h+c+6ҫ:+d+6-70@- 0P7d+(,0@- 0Y7,d+(,P00P0Sp@- '0 0pP`P@YP# T0P 30P xl00?o2`SP@8 8 <00S000(,c+ҫu7h+h+7P00P0@-S r' 0 ЍP  n5P 0Pd00}S`00S T0Tc0HmP 40 0, 0( 0(,770d+c+77H, ++0p@-PP00008@Ppdp d(p@gP p@ '2@0@ 0S 0r00!(,h+7c+ ,78P00P0@-S & L0 ЍP 4 4P 0  P 0(,(5;8H,@- P& @1 ЍpP,! 4P @1@*P0 P` /@P*0@0 S0 0S P xP l0 Q0S  L0@ 0mP000$0@(,5+h 8+c+;8H,d+@-P|& 0 ЍP 0S t u4P 0S0TP0@}P ,0 $ ]4P(,M8U8]8H,C8C-`@ppPH_oR`nP=10S|1| ЍCETPda80& X1 ЍH5U@ 0 00 1"T:pX=(PPQ 0RP mpM5|0@0 ^T zn0P``TT TU@T 7@P XP $0  ЍC?,,c+o8e8(,88j8y8@-$MP% 2 $ЍPN0S!3P 0 1C*nP 00|S ;7P yP 0tn@h1d@`) PP @4Q0d+5>@- PP   R Ѝ@P   HR  @0S00 Ѝ@`p(,L>P%c+_0A-p`P0 AdP@PLp @AP 00 00(,c+>U>Pp@-D H0 p@00Sp@000G0$@$P0OPp(,,,c+f>0d+>0@Sp@-$ `0 pX00Sp@H0H'0<@PP0,-Pp((,,,c+>0d+>> @Rp@- h0 p` Rp@P0P D@P0P ,Pp (,,,c+>0d+>?O-MMPPQ  3 ٍЍPʴ#EE*P c@3pY 3   eP`@)LT0p㓄( @0S (30@ @c0S000p`J2呁2`0S@$S \S0@0# 0!|"  0  @#"00B   BR 0 F )bST0 Qc`0S@iR0@S 0 F)b?T0=c`P1D d1 0S x10SL1h`10S ,0-00CS0.  E T0 03/00S 0S 000CS0 S0  )tSq00000h0 Y 0pS7 (,<}+i+c+c@+z&c+::c+:0d+c+d+@-@P 00P 00P00 -h0lM lX00S hH 0d P000p d+c+z@c+;+-lMLT00S hD 0d P,00p  c+@c+;+A-@P p0 0C0S13_b `$IP@ 0 B RQ@  0 0C0S13p@-`@P:gXP , 0S!PR x,p@l,*`(P %KXP00 0,US!0R@E @p@-@P C00PU a gPp400p@-`Pp@0P< 0j.0Sp h0 S¢ Ѝ00S 0C @P2h+@P/0S/0@-@Q0%Q#0S P   R   07W0C2007W  Bz&G-pP(P SR@  =HPP0   4HPN0 0010S / WPe *`@WP 0PS $2` P*:`uWP P)P :gWPP000S`UK Ⲡ0S 00S1 @RđR0 d  TGP0 0 U ))) 0 011 .Ѝ @P) `Q 0S000) 0S S St0 0S 0`S@)H0PU ),P@A Ah+)AAAd+X d+_ - BR0 R  P R O-@M M pPE$@cGP0DHLP0(,$00D (0p0,0DHL` 0 0S 0S X 0Se@DDHL`0$(0 0,0`ލ ЍP0V0 0S ;S@P `P PP @P49 $4000S V PU@ /SV@0S  'QP @0U0C?o20S b4pWp 00C00p0Tp pW DQpPpUP 0S Q0P00$ 0R 0.00fE+ PZ0<03 0 048)3 t30S6Zl# d(@U0P0 $3@@y(:U0P@ 0 @m(0`0 @i0 `0PPy P00@tPS _(P Y0@ 0'T00STeU 0S} W +XyP+XAP+X=PXP+ lP0!0 4Pp80L YA+ P0ZPE>00002P1@@DcT@@/wU0P  00+P 0:P 08 04@ 0R 0S10}S5}0S @0S 0S@0P/}RP0Y8<00 @ AcDFAWA_AgAoAAX d+Ac+h+ d+AH,5Dd+d+5?(, s&A@d+O-jMMp@lTtQx|Vύ<84PLH0 !0PP0A6M0 0)p7 4Af'H8c',N0 0 =)00 ZQ /l=0S-@=P R*  @+0 R`f_P;0Y 00|SU pB0Sl;0G` ϼYM L#= < Jk,N;`0S00  U :* 0S 00S 0Pz 0Sw T&p]=`P` 0S :PPS]X :HDD`PW ᷻`0SU 0S[ +0 0 P!$P %SP  0h![/0d1`1\10A?W/p h10\1S 0S dAT! 0S 4^P $ $Wg0 0JⰜ0S 00S P `^%dMMMύW0004!$ 8!e0 @!0R PP000 bT800$10e/10]`P VBc[00 $۝P|P|0S0 $ҝk]]U`P@Tt  p 0m_0pP7/_RP80S gPP`m/⻻@D'HM 4M00S m?/80S00?o 2#PP0 P60S P 0S?%P 1S7%\6\FpVL]P@3<)8hM060(6P 00@T W\ ^aP 00@T H\ OaP 00PR \P`tlEtP<X|'(P<50S'`@T) V  7%PDT_0 0 ' 2 @Rx G_0"0C?o2? @_"0 "0Ar0 S ;S0 YZP 0 R RT 0SD0S(0? '"( ,0 R /  T @/!tP 0r@"RD 0  $PP#PP0S0S80S#@P ,凷 (P000/R0HL0$/ 0 pwx'x\ XpX\ d `^`Pd #P U  R90S 80S9xP $%P0S @DT`90S lY~0 0S( PZ0S= S E#^9 9`00S0T0S> sPrJ  3$P0 4 zYP@ Uc eP:0SeH: Q `p* Q0: (U:##O :R.sr k. 0A3/@p;@ ( 0; R0 H;Q`;Cx+x0 0 S (lg&p c%t_$x[#"0S,; 0R.MRtAr0S 巵000S 尵000S 婵000S 墵00jލЍ0S 03/0S 吵00s@- P@>P  >P0P PЍp寒`P  =P 0 FUpGP Ѝp@v 0S S0S  =0PPAAA ANI"?0@-Mh 00 P P10S 0S00 0 Ѝ' qQa @T0 S 00S 0s  0 :LP 0 S000Bp@ T d2XP 0|S 00 0S00 0000h+c+| ;+h+@d+A-` M@p G000@00FPV0P/S:S X|V@ἴP qG <9Gp$ (gG/@I@P/:IpP L@ᚴP  Ѝ@ /000p0 @@PW@p00l0@@DcT@@0(0@0CcS1S@?X ?FA(,PP00/@-c\ (0@  000X\@d+=+@-R\ t0@ d00S X0 0Pp <0000S 4\@d+c+c+=+@-+\@`00S T0 0Lp 8 10 10S \@c+c+=+ h0@- rX00S L0 0Dp 00 101000d+c+c+=++ -X0lM@ Md @F80 0p b d+lIc+>+@-0lM@00 0 00 0rS sS ld d\Fd X$FP0 0p ,ad $d++=+H,IIIc+>+I@-`PP@ @0@s8#80U 0s8#8000@(B(2b! !YP VU 0A0T0Ѝp00CS0 S0 S 0 /O-TMxp|W00ʿ? p00p 0<[0P`0V0W B@y0 @040SD H 8PZ0S= S DA0 S00  @P([0S [0#S [|0pS `1 R R 0Ha# LZtp uTЍ ? 000 $@0 PPZ0S Z0#S@DT|0S ld@"\NL$0V 0 `{#M"00 "@BHd+c+O-PBM M`E`P$P QH?0a>0 PPP0p`5(p5P<$g P@+40S5V $ 0D  L0XD S00H00S+( E 0S 0 S     R  T!$3PP$,p 0 DK@P$p 0㼳tp8|# ap0pSS 00   00Bލ Ѝ@D3@30S VW@@c3!K2 0r oW T 20S 5V  R x" R " R W WSl2l <202fW D2000 !00D1#0U10S CdPRPU [ 1000P T)T0 0P0 0 PS@405U dU(T  P W-T 0S1  00 0B>V0`X@40S10S (3/1V 0    0QR\@\0 RZ P :/ 10 YS P 9/0F4=+L (,h+i+0d+h+c+i+i+h+ I@,(,HGz&td+-A-` @T ʓ 0 ЍAЍ/0p0$ P xpJ h0h 7Toa0@S P 5/xi+J(,=+L h+:O-@FMs M` ( @W W W0$0`30(0$ 0H,@'S0P SX0 f 3 Fލ ЍR0 @,Q(aC2@@Ȳ@aGT  H 2 R 0 PD0P|2d GP `"`d>C L:C0S 00S , 0(d  PP d%@0S00?o2 ^P} eW0@6R6 D01@p  d 01 `D0(66S0d00 0d0m A 0`PS ʒP P 00S t0 |0 nP@0H @0>0,`@80?C+xd+:J(,(,0d+Dc+DDC+SJi+i+JJ0O-GJMMsn0p얟VXv600S00p  9#PxX |6  t60 9PLfJލЍ860 0 0 097S 60SZ6\o50S# 䵟0S5 Q U 5R "P 0S 500CS\5|3o00l=0S P97S( 5D 58%8i0SX0$000(00000 [PL 4\0000Z40܀C XSX P4`0(  $   dT C3P 4L!>\ 0h0d<` ((0#$0$c# $c4"($ <7 $ &R 3^0 R0S R3)0( 4008'P30S@97S00000 0S   0pt008'PP2 0 00 40I 0 `U pd 087zPDF 97R^ Ś 0S [R0sO0010S ;70:70?70>7='<@P0S,0 00 0<0 x1, EP!1 R  @ 0 0ZP 0S 0097S|0 E0S [[}X  S[00000IQ=+$d++ c+h+i+NA-M l  PP0 8 4 8(,((( $ ( RS 8Q  Ѝ 00-S0S 7 7 770SJ0<00@0D07 0K@PxGAt l d@ MPXP7,07P12PP$7`@0 MP MP6Qu AQ ,0 p,0000HQn  0S |6 @0sqD0sr`FPM00<0Sl40Sp5$  0  r 00|S  0DP/,,0S忪`5@5<0 &,,0S  5P<0,0p,0xPX0: S 4 L4 n0 0,0ᄚ4  P4 00S,  P 4 440S!@@?T4@@0Sh4@y `TP@40S 42040 4 <q44 R(4($((jO$4R P 3DD0s D30SP 30S 30S2P30S&Br,0Tp` VvU㨂c 48 rpcU|,00@ WQ00 0400@ MQ80030CS,0"p,040q402P001!P ߩ<0S <0,3/0,0@44@y1 R0PQ0 SB\1#B0 ? 0!$$P400@0 0 0 48 p 400@0 0 0 o$P0 qw0#l|@FD B,0S <0,3/4=Pd+H,Hd+X,4d+0d+c+c+M!N,,>+h+ x (s&P,55C(,x;0SV 080< @ X+ RD00S0< H0 P0KN, 41<S$iKP $00|S $P/$J=@-P0SR )P0 SN $ Ҩ): 01RS 41S $00-S0S `: \H:$ HD0S $ GߍT0S : <0sV@0sWIP0080SQ00SUl9 d9 H9T00$0St  T$h T/00PL90S O0 S$P$O0 S$P$80SD8Q0SPt[PP=D0S!0S' ]+t80S Ed(P  7H(80sS2 8  ;Pw00S  0Pl]000ShP |7 07 R0YHV41SC$,rJP!l74!(06 6 (0p(0p 0: S 0&0&0 7 R,7'L$00|S @$.((0S$⽧ 64! 6 680$ !((0S|6$tp6R P (6LF=x460SP 50S h50SH5P50S~ 0CS0D0S 5  (p(DQ$o00%p00(0q(0d5P001!ZPLN0 SEt4/80S 80(3/0(000L0S$4 SDQ  40S 8 4Re qp `%'0$`x0pw3X@$Pe  0,kk P$ D0S s0 0 @ 0(@P` T0(0 00ߖPwsZ,pq P @`@#?0 ? 0!%%P0 0 040  P@H0S@ (, pU@000@ N400M0 SE1(00@N M,00(00@T!000t 04p@ TL08a0L0 TUA @(, p%P1 V0#Qla@L `Tge<00S 0C<@ (0S 80(3/0 Pd+H,ZHd+X,54d+,d+c+h+>+h+ x M0d+c+M!N(,8 $R!R(R3 R 8( 0 Q Q QG (-R ( R 8( "^'  ^ ,QQ(88S08 S08 ( ( !R0/\^^00^ "^0 00Q8/8S08 S08/[+D&p@-H0H@8D0 (8080$8P  Up$80+[++@-A(8S lc0 S 9=0) P p p $8S 80pP\ UP 0S ,8S0;c (8S 00CS0 0 0` 086 8$ 0`3/48S 0S 00CS0 S0  P0R H@ Ѝp[++(s&IR::: | P/@-@P$7P  0TT@-@@0sc,00p 0CoH&c+O-4$0 MM00* t A0 `$`V (0PZ`V=  4q@PN 00 !P4`X0 0PP@ 6!RP@0H03 3#0  0#` `ij P G #Z300 0f|#`4Z 0f 0<#~`< #< 0f0 "m0` U  S  RS0"1 0;f#;Z0S;#;0d("?;#;0 #5;0?;#;0@#5;DE@"<0@S0Pa 1@V0\ 0WPV 1QR!0 P JP ! 0 !Q` p!dY` f 0,!`< <@f 0!  0$ @0S (P0S S d @ d0 S00p MߍP@ %U[0DEN0d+4d+h,.AHd+_H,TQ UUU@ %UX,P,9UAUKUc+@-IX0@ R0D00S 80 00p xI@Hd+c+c+-$M?0 0 +$Ѝ0-4M 00 000]IP4ЍO-pQMFV( "0`H&0 0P00000 PU008 0R0PU005"R u0*P\0P 00$00S& (0s0S pP h@ `50S` L%A `@5[06 5 r 0 5dXd@0f$4`4Z-JP BJZښ$$壢J $f x$2`0 `ğ R#3SPS04 1@($0f00` `V480PZ`V=  38  0 _0 "H3PT0@` 0P |"D@`$5 T;&` # 3W  R@pd#K!$K @"% 0"j a2 @@V0Kh2p R0, d  0vP0V00.*l"1\ ?\0'H0@"P@742 0@p (0S"%+0!O0U0!@(0@PSd!@p1 0p Qߍ 0 Vo ,k" 0"+1PP 0P  `P<} <p@f0 @ h,P,Hd+h+4d+x, L,=X,Y@U`,Q_\ U@ U.AUUWUc+h+U@~UU? @-G@4G@p@-Bd00` pd00CS00dp ,P P00 @R0S"P7d`Qd00CS0*Np "P \Pd00CS0Ap000S8A PA p0 0 `Vp0 c`Pd00CS0p 0@S P,P \Pd00CS0p `V0 0 NBPp@,L&V,A-pp@`lP@ .6PP b@P PE y'P@OoB@,O-(U0mMS p EPd F0S 叟mߍ0P.0͵164PPd(0P/S SUpF Pd4P PP P4$0CS0p- P P  P0 PsdLAP P AP d0p P 0? lhdp P 0S d0p P0? p P 0S0S dg0 P P d00CS0 p`2`] P Q82<0 0 dAQ 0p0 1@S P0S!   Cb"c!   c# 0`S<1Td00CS0p0 dL\0p 0 P`, ^0!S^0C0 hPP\\ yd+,V_}+(,D ET)VRVVc+V<Vz&m+}+ WWc+i+@-0 @0SP  %P  0 00@ x0 l˞P T0 LžP 00 ,幞P 0 z&FW>,,KWWW00CS0 S0 S0 /1A-0aS0P0P3U  %P 00.S Pl`1h+ \H%T1P@  D(%P00T,!,!,0 $1$ /U 0! 0@p000 00000P0 0p0S000P0T h0h0 @U t0?P$0`\h+0d+<\Wi+i+c+aW~Wc+ ,$,4,,Y4,,td+P >WWp@-@P 50x 00p @0h hP0d Q0 P0P H0@D0@ 80@0S, 0pi+c+$, ,+h+P$,!020$A$000 0۾@, Ay<P 0 ;@ 2P 0$0qp00P0}S0s00U 0S(@<[Z Fh+0d+,,(,c+zXXi+XXi+XXY02@- P#Y,=YA-`P㹛`p㵛 L@P  8@P $@㡛kYYY@-@ P , 0A- 0p0@S0`P0 P㬀" 2P 0S 0"S x0S R00`P"S0"S0 00+h+0d+(, +i+0@-M M P , |@-=Pۍ Ѝ0Ph塚4/S; @ =P;0@TP/Pr] YO-@pP`V1@@P`3:c<`E^<0P԰ Y/  0b;T@1PSZ 0 10S 0^Y0 R EC;0S*00 080 Ѝ`,c+@-AP0@0 @p pP0 0SP0 0qA@Ѝc+ht@`,P  R @-z Rx000 0R/`0000/0S < S0C00S/ S/0C\d+Td+YXd+`d+@-0 000  0S R 0Sh0000S b0C("( R@ S0 Ѝ z&z&H @-(A`0S0 0 0 0!02p 0S:S50P0S0 0 000 p0S:S5000h `0PpTz00, 0 p(nЍph+Zh+%ZEZbZC-@\ᄐpA`\P ^T1:00"\ \ L 9̠^@2\\WO-`p@A R %R Z0  0 @PcUF 0/U-UA%U  GR%0R0PMU30S2 2"0S0mPE_o C0RGQ .Q\P0mU nU|2G0Sx2l" 0 BQ P082 R 8cU.U00  0" R10S /S0S  0R 01B^ 0 BA R : ^^/XR \/ B/o" RQ00S 0GSE.U GT]*0SPY*0SPU*@P0LG RS QK 0TE*/0S@*<0 QS8*90S2*+0S-*> @ S'*000GS0P#0!c+(,+_+ +/A-p`P @2zP0  T  `00T  "90@ R   `FVp`00CS0 X2 PpTD000`000 T00ZZ(s&ZC-pP`8@0尐TV > 00@)ax0@P`0 \-SL00D P 0 Ѝ+?c+ZZ(s&ZZc+c+O-M M@ P 0<`0  83P`\ ;.P #\) )30S) P Q PUP  p>0@00002F..P x"xFv)>F@hsލ Ѝ pp04\ 0c p \X020(PS @ (0, 0/(0, pQ>0$S,F␡0I00S 0h$Q000SZ=9Q =*/?@#b!"/E ip4g>0S c>0#S [\>0AS  \0 0 PE0 P0p 0S C>0@> 0 Hps0L\ |P0><00h+Z[3[h+MbDip@-@Pp@Bp@-@`00CS0pP0 @ >0S0`00=0#S V =00p0 PA-p@`pP0 @ =0S0`00=0#S V =00p@-@PP`8P 88Pp0Spdp;9K h[@-@JP [@-tP[@-@tp [P@-xP[#\0@-PlMQ@00 00 T  40S P \00 P S0 03 0 ^PrCcpWX 30S 6@6@@` ' H' 'P $p`P@ 0S @P@ 6 ;  P@6 ;T0S w@P@q6 ;0SHLw0 S8 00P 0 0XP0 2  1 PP ˔00 @T 6 ; P 0 0@T r6 y;P lЍ`]D{P@Y6 `;T1 1@T 0P V0`V7PP)7'000W*0 0 0P@T|Q P>Ph+ET?h+c+8d+q9 99 9h\M\(s&eZ(,\\*9+c+c+}+i+:D+c+c+ ++7@-P 1 Ѝ0Q0S 1 1EP !0 CRtA R Sd10R L1P 0S0.S(1 0!P 0S 10S 0 0@ @&0 @0@&0 @&0 @&0 @& 0 00S 0S(,c+(,u\c+?8d+d+h+\ d+0d+\i ,,,\,,\t,p, ,,rP,L, d+00S!@-@0M, g: 0P0S8Av@0Ѝ0@d+@5-A-;0#S @)P4;<00/;0S +;0#S 0@P0C 0000h+Mb/(/@-$0S 0 0 0 >Ѝ@-@P0㺑P0@$0@-`P0 `婑@P  P$`0+0 0Ѝp@-@P ŒÒO-锒P0pS`@4M  0 0/0  @T T@! 9 0`F0C 0000V*  坿p:0S1 :0#S- :0(0:0S0T 90 @0p`F@P0,0w:0#S 4Ѝ們P @0p00000S   0( Q00SZ=9Q =*/?@#b##/ G: )p ?:0S ;:0#S 7:0 P40@:0 $4*:<00(0h+Mbc+WU0@-S`p@  㷏P;0: 000(0(0S,0SP U. 0 00 0,P (0S,0S PU` Ѝj0 0PUPPP !0 S 0PEUPG 800 00 0@-p`P @P,0S T000(0 ЍT00W30@ R   `FV 0P 0 ST(000(0T00ZZ\/@-9`4,<0!R/P(0<18C8S/ȴ10/4,x&!]p@-3BM000030S3@TBߍpx8l8dP 88@?4#1S,! R< 03/3CPQ@RTA 00@S@b+R?@PbqB4P @00S 00,S 00S0 @10 3/P00000S0S 11 03/0S+000P0 P0 0 SYy000 3PB0p P00 S>H^0000S 00,S 00 S00S 0 P 103/P 4000=20 ` ,000P ,sP ,!,77 p( P@ P k>7}7Ѝx7u7X0/LA$P A00O,O]]x&s& ]]0s@-@ 囼1`8C8S P0S _1 勼 H凼@0 ⠼0nS Ѝp ,x&!Y , ,]@-PMP Te P H00S@0\A PЍ @hPԲ=],x&]]@-@80wT 忲=6 D ,]]D0@-|AT 0S 1 0 /:x&,@07@-LAP/_$0P00  Ѝ0x& @-@0S S S 0 \R0 R \ @ RC-P@ M?0  ?0 p ?}0p` @PQT@D0 @ЍCi=s0 ,@@T*Qs00!&=]^G-AMMP`P0B  l2l h2 妻\2 X忻 0 0 dp,dds&={ x& ,es&kaT -cdOd2dF Odde@-a|,@-@M h0 \0P0 0D0@10S / 10S0S@Ѝ'P  00SU0@P 0 00S]0S P00I$P0P@0 S090> ,娶/5 |, ,,,= t A-U`V7P@@Ptp0Ph% /Q4 y LzpP@uDN8e0S+ (5  5@5 5 5 R- +4 400000@T ,P004@Ѝ0400/S@嬵P w w w 㚨PVjHSj@ 0Se{Qt0S  |p=0#|p;#s00S: x`P`|` R  V \3Q 30S t: hxPX3c0S 2Q P *o2: @xP 2 : xP 2l!: xP 2 : xP 2 : xP t2!: {xP T2h,!: sxP 42L =(s&0Aq P/P//0@-^@\P0 R NQ | 0\ P0\R@ @ 0$R ^ ?,`fPP 80 dÅe"Å^ P?d" @ef"/,,p@-tڨp@pP 0TSp 0T X0h2Sl@ɨ T 0T * 0忨 @mf&x&,rfvf0@-P@4Mln!N^ 0<, p"lR < 0 2  8-   C8S" 0!8( 0B(0R><r> 0B4Ѝ0,x&@-`0S@ P-0S 0000q20\ @轅,fO s@-0Pl00@0`h R R  l R  R8C03/@ЍpQ Px&&,=A-$q`AQT 0SP @'P0000'0P 'P0 'P0 t'P  dd嫨\50H@H  "  \ x&,Z% ={ fs&L&,00@-18C8S 0P Yx&",(0@- N@0 f ,H!, ,p@-`BM P[@0 S0`018C8ST01y0 j0Pn00x0 BߍpB/ BR 0100P y0001 ,x&~ ", , 0?o2 0/x&H-AM M++0r0+ +00000P0000@0 Pڶ0 ȑ P0SS WS BS 0 +ްP  Tcp+0S x 10 S0Y` 㛰18C8S ؠ0S Q     |P Y 0@^S00CS00 S00 P0S ,E ,H!,,x&",p@-PH@P@p&P P &P @x& 0/@-߰o/A-@PP p 00CS0 `V o&PP.'P0 P00XA1 0S P0000 !0S0R 00 `g| ogA-A`P0E!S qp$0!0P0CPSJ0`00CS`0p S X0 X 0P"SP, で0SP`0P0CS`0p SX0 X ! 0X!f(0 0P0 Pv$000P lP0"S0T0A118 0 0P0 ",(s& s&=J|g@-0S S S \S ^S R@ B0 000 C@T0 0 B@T1 0 B\10 P P0 gA-x@%P0 =`P`7PP2 00pPF 0P h7V @P  @0S@0Sؼ000@W%PP?P PPP P 0!SP^/ ",x& gp@-@MPP\1  @P`u00u0ۍp0 P 0@ 0000S T-  P00 f (udPHx&g,gp@-`@;PP 0 6Up$$PY@p 7@-@P y  R   @T|ݤ Ѝ0(R( dz0PXP O<SP K(NP ,hf@xt yt h",0@-@M@(0(@,0 0 @P (Ѝ00,x0 BPPP"P0S (00@SPR ",x&,@-~ (,h",@-@ 坯 嗯币mP 封 0P3P xUtSh y XЭ唁 lЍ,xt yt hhhhf@4ip@-0M`5PPT 1<18C8S |%xAx` 0 9 0e <嘭4R,P( 吭,0F RY" 六 偭;P 71P` >0(0S q=R 00FS0xڣhأP0Ѝp\XTP Dȣx&:i,s&FiLiQi",h X (Wibiqi~i@-0 7@6,-@-{0 R   ЍЍ/4#,-@-k-@-Uc0 R   ЍЍ/4#,A-ARp`P@1T pPX`@DO-dM @P$}0P 0}0P0 0 &880 0(P400Pp`,@@0,@ T R3 U&T  ( 0 (d(0լp ` Z0 000_o 0,@ @,@0RT ZPPU <v 04 JR (0 R 0S0b  0S dЍT 3 ` 0@D(0,@dH00(0 RR `:0@D(0,@(0 R40@D(0,@x(0@Dp(0,@pWm( pG  (0@Dp(0,@`(0@D t(0,@XWT Q ( Q @D( ,@I F ( Q  p >W :80"(-PP (|- R 8 %Q  R P`(4c8@Ht  G  $P T0`000S(3( 08 40TU (0 $(,Q@D0T,@(0UT(0 $(,Qt0(00@DS,@Tiii ii4#,j,jGjMj cjujjjjjjj!kGkO-lM($(|`%|PVPP:8@ 03% xz% 0<0d2d@0`2 @0P 00(E@P 8%@P ;GpP@0S($"P @ 9~7~ [lЍH<`@40S( (1 Px  , Gp, 0P¯4 0?P00?P<  B,$( p( ,0RQ @(S<`@ 0DP%<0%800%4000 0'<0'800'40\ 00٠ $P$@i &Gj[kO @ok~kkC-锑p0MS@0P t?,`0` 00{qp@  ௪?sp W@`0 P009 pppppW0@ @ Q@Op`6t0` }> ?@d o00 S @. @ C< w0ЍC0&kkkkls&wm 0@-M٫P 0: S0 0 S@ P 000vЍ0 <p P @TPT0dHS 8$   24#, ll#lO-0]M-SP M0S 4P ]ލ ЍOv/y]ލ Ѝ@p㰄aP* 00S0W0S $0Sd` zpPH # #@pW ]ލ ЍO|0: S  SQ ũPPhu ѩ`6P ɩxY0v: S+pRQ(3 P@`P2~  K〈P p  0 0C0 00: 0S0S`-qP`ͩ`vH 0S 0` =gP V _P z{ Rᙪ\RZ5pPQ ⬪Pw!1Z[ d 03w=tYp`2 0S!Pv000  P: b " 0S -pPmP-S 0Sp<4#,&m ClRlm dllirl llllm)m8 cm(s&0 R R /0@-0S0R @ PaPLU APLU @P AC\ 0T00 0@-@P@@  wP JGP00S D00S  40 - G!hOX]H#,_,0,&@-H@-)zPp@-P@O}p 000/#,p@-@P0-S@@p GP0Tpp0p@-0@S`@MP0@ , ]P@ЍpPU P o}0P0&#,nSB @-@P @'000S@u #,p@-@PPp00Spp@ #,A- `pP@P000 PP0 0 _@-@P P0P00S@ #,p@-``MPU> 0S; WP2 @@?T/  ! `00@ C 5 @ F00 *S 0 000?0`?[XP10 FE>_P `Ѝpn< 0@-p098p QP@Aqp00P00S 0&)ņ(\^# ;#;0bQT |` 0X R p 009 00R0II( ,0@0, n,@-P X00S S 9(,0 @ T 0,p0@-@TI0 qp0@ @}01p0, n,p0@-^ 9 @ 0@&)60 P@ ^@T0,0 R& 0@-00S0C(0,S0@ 0S!‚"\0PQU00000@/0,P0001S0 0/&7@-P R I00 0# Ѝ00R 0@!"0@@qp Ѝ0@i?0,-p0@- 00qp Ѝ80098<@ q|/ 00\ /0,G-pP` @P"9  `0  P09   e 09 rPG#,0,@@A-p`VY@  @ @ 0 qP0 0z0 ̞T 0 0q0@A/ 0,#,0P /0,\ -P0S0@  / P2:1S0BS /C-@4QM@`@|0S1UA:ЍbS9 .S8 00C S 0  ?+OP >cS@U:>0@0CS000 000C/  0?NP @@@0,1,=pMpp@-@P 0S`PpPQ CP@dPQVLK>i2P0S  p P&<&epA-PP`p@ 01S E*0S  R@ *Sn#0S 0Sn0*S0S sS0 dS0 k0C?o210@@ 0C^S0SP@u0C?o20,@-XMqL&@DN@N<N8 NTr,3,!4!!!8!!0SeVYP0SeVi0SM /Sr *S1 S S(P%UU!-0ES00E6;P 0Y 0S :G0 !W07S iS U U0`E.U V``dP eP PJ 0S`80S P0 BP tP :P 00`P iV0iS 0 T$$ 0STP0@_U0 ,0Sh U U L =UJ X P+U@  U !UQ0-UQ00  @0#0P2 P 0 a0CS00 0.P  00P 0Sa0@S @P000Sp NnXPh *1e`0,00@0S 0|* ,9P@ 0S=-P R+, a0ES000 P+P S+0 /2: !0*U @U !U<90S 97R0 <|90S07S ;07S 00#@) V /10@S0 @007S9 GP 0S S80S 7P X`30S780Sb`o#0CSUPڹL  ;P ((0FcS.000 e`c0 S '0!R0@*?070S p n/0 S |'0!R0&*?0 !R0 0! 70S!R0E !R0 0! 6 6!R0 0!x60S!R0!R0 0! !R0)?050S 50S z`|0 S 0k50S u0 S 0[  / 6P!teR00 !00B 0R eSd0C0<0S d 0!0<0*<(l%P0eP0^u\Q 0!t4 OL3EC@40S0S9} @ @4 D 3 H 3 P) q|3000!R0 0!L300@30| 00!R0 0!Q 0< `0000!R0 0!; ` `<0P0P0 0! P @+P P !R0100zs>Pu0P0 0!Pj !R00@00`:,#,#, n,L#,D`,;,vr :,? v_wX#,w_,\&&> `,_,_,=P`,_,_, n`&*w4wJwewd#,wvwwww`,ww#,AwxxT#,xl&0 %x;,_,$,<,@`,0P0 0!=`P SPj=qp 0 i0P0 0!=`P0P0 0!P$ ,81`P#P 0`0,`BPX(P 00,00  10SV! 0 fPP U U ?Vp!0> LS PP U U !0 CPP U U ;!~20S %/PPq U U.P7!0Pj#% (P0 0S ,#00S<30գ?00T ϠR0  B  3 B0 S #00S30գ?0/0  00 3 330S080>00S/1,@-@0 S!0O-S`PpM``@ pP Z:T008 "1 0T S@D0X0@D@Ѝ0  0480  @/o0"S R 0CS0 Q  S P R 0T@180 0P R* 0P0 ~  80 _P ` [0J0C1,O-pZX& RP @`P|` P [ ``F 0R@ 0R U *0@S0S  Pp0xp@-`R P@ ]0P @@@ 0ppG-@P `pM@00C  RT0Ѝ ` ?<P ?0 ?<P@7@-@PPe Ѝ00;SP0;S@@O@U AU \00SCBD00SBC0mS$00P# 0 _,#,;,p@-P\dpHPV@^8^LP gP @P%9 @@76@T AT T ep00SCBp00SBCp0!@00CQ#u 0 DPp@{T ^gP 0S0^  PA0dP fP pip_,#,;,@- @ @ ;, @-p@+ ;,2x @-p@+;,Rx2G-pW8PP{ P0`CpЍ\@P 0pqp ^ )?SZ ]0F0P 0S0MS0+S0GS 0US 0US0UES0UnS0UdS@0vS cS eS0@UxS 0@Ur0 #@U00Yrp*pT#,;,wxp@-p@`PP.;O,*;0XV@` `#;D Op *p ;,wx 0  ;, 0  ;,7@-dP@ PP 0S  P Ѝ0 ;,Po/@- * Ѝ=A-`QpP P P@P%U0P 0 P l @#]T @P 6/P]xux@-~|0p p0h hhP 0X X@0L L8P0@4 4 &|&x xx x yy$y.y4yC-P1M0SL @10SH 410SF Pp` Fi0@?oPU20S@ QPMe@KJЍPЍC 0@Sd@ 0DSd@ Td@ 0DSd@dT`P \PEU@@#,#,#,G-@`M0PSS00/ @ R S"\R" :R R DZ Pp P 0H3/0S@00Ѝ` P/@-鑏p [' )4\Ѝ00S @  dt)\0PT T W' 88qp  (Fa1Pt`q`n``PH0p000 0`00yVP@VpW XpVW Pى0SVЍ 4XxV@T#,L{C{i&h&U{l{0A-0S@`"@P0L `y@p`PQV@NVLVT#,t{@-@@P ,zP uonKz@-M@P Pۍ@ ۍ1O-0S# 10SPpP 0 `|R@0 -R` d;P PP @E#@ ЍP PP  0x U ` UV @T P uX%X؂P @T@P@T 000d0_@`<P(@0SU_,T#,wx{Kz0A-`V8@Pt!pP0 PЍA"rPo`D@A>@@@0 `yxsUqU@lUT ЍA蹈ЍT#,{{-M ̃P  @oЍ0@-@P0MSP @=WW ᪃PX @Ѝ0@T@0: S *@W`,h&x&@-M@ᨃP͡0 00Ѝ0@-M0P@ sPh0 R\P0 R\ tu p0St00Ѝ0#,h;,`;,/@-@P P0@/R@-@ (0@0Th#@_,@-40 R\00S@@ x;,d`,h00S /pp@-qp @#qpP@ QPpp0,@-P,#P3#0 R/  x;,O-q$M0S@nP`0S\0SO@bP`@@100CS cDP`@ 0S"P`vu00 @0 00R  0嘠嘐00 000k 0 0000000P0 000`0HP$Ѝ_,_,$,#,4,,<,O-M<`p@P8@V t30Sh30`So`V D3``F`V`utV-$0S 300CS QP ""Ly"QP ""0S6 >`&+20"`Pp0X 0SJY/Y @ Po"V<"0 40 ut  20S1"0 000 f0 0 10S*P10S v1*qp@PZ "P"P41A}"P  "qp ,10S R"P ЍO0G0 0 ЍO-V utS 00St001 ?Q*)@P9ut`d#,0`,X`,_,&X#,x;,_,p_,&{_,0,x_,<<,H00S <0P/000S $0@///x;,4`,X`,#,'G-(pP@,`qP"V 410S(1`V``ut 10S100T T0 00;*`+*00oᨂY J) qp00S@P W ЍG~!Vv V '#,_,x_,<<,_,O-M`nP P @,P! ЍO&!qp@PV00SЍO0A!P0 00@YЍ!pP@PT p 0Z qp0 @P0,#, n,A-p` qpP@VЍAw   0@2Ѝp@-@4P0SPpUqp @#,0P  P/&0P  P/&@-P@p@-@PptP0S 0 0HS @ 00C0QQp@Q  B 0#,&;,0/;,G-`@ qPU  P9 Y* Q_QU&8R@T|0 "0XPP00040000 (@0@000S < 0P00TP   0&;,P/P // / /00//000////0/0/p@-@4PPP ZQ4Pp4/O-M cD` {rPX 000 0  0(LP 0000 0(XQXQ> 00  0 'P*Ѝ=ЍO# <O-P@4M(0X0 ,0ut@A P4Ѝ40SU400 ?QW('@PPp8d00 0Zp P7af  ` 賟V0,@ Qp` P P@Pᨣv V}- `-V@P,0S1 h3Z1 @P(L30pW0# 0$ `P" R $0 S S` P P  `VʏZ:P `@T_@P[ |20S  P0 Y (0 S  %PO 20S 0 @ 1 R00 SA> P Pe p 4ЍO V  P0$ 0PB R \A0 Pp``@P41`!Z 0 0@P_ V V@P P P P Pv@Put 0l 0@P_|l00S V V0 0 0S X@Pe`0 x_,<<,0, n,<,_,`,_,<`,D`,7@-P@P ,0 R  000 Ѝ0<,O-`Z =R+ =R-b [ =R<Z +Z -Z0Q =Z0 QP0QQ0QCo0S) 0 S(#S 0BS 0R\S 000S@  RG = Z* P+R( PE0P-!$,P3% R R R000#=R00S 0=S P,0E0P0 S0PS   Y PdP P P 0S 0P y&;,y-&(s&|} }}}|}_F}r}}}$0 RP  /;,0 14/;,0 Q/P/&@-d04 ,    00X,,P,,`,,L,,G-P㌐剀H@HPT`ppP JT J " !  J J @`匀;,A-8p@0PS` 0P0aP ;,@-@$ 0 @z;,P 0 R   /_,p00S/p@-`@mPPPpP 0S8@pPp  `,;,;o@-,@FP00$?Pl0 01  -;D0'<'8&4&0&00蕀;,L<,X<,d<,p<,|<,P/0/;,0p@-@00P0 0R 0.PPPPPPPPPQQPQ&H&D&@&<&Pp P0 Q00;,L<,X<,d<,p<,|<,C-餁P0@SpM`"p`xx!0 0 0S[0@ 0 1 @P(a00CS9 `PU: 0 Ѝ 0P  Uqr   Q   R l@S `P 0R } yP,tP(`,_,_,_,;,&&_,,0P$0 00S000/_,_,(`,_,p@-H@P0S0000p01S 0F&P;,L<,Pp@-`0 p@PX10S P@@p(1@0PSP5P/`P0@@S  1CP0 1C"@P 0S000|  0p  0d  0@@Pq 1CP 1,;,\,,T,,d,,H,,O-`CM00dwvP1S0& 1S8 2 0C# RfY) Q 000 00P20S P wv  1PS  ps000ap1U 0S Q 0 S1C10510S)X4 1R.sr0nS`/ S`0F[/ 1R0Ѝ  ` 0rP  00KY1 0[0 `0S% U "% 0R 0Q0tP 0C001萄 S vI  0;,_,<,`,$,L<,_,A-p00PS` HP ` P 80@0@D@ 0@0TЍ`,;,$,p@-P@z 0p@2A-`p@@PGE$1S 0P $@@<,7@-8PPU Ѝ0@@ @ Ѝ0`,0 (! ,!/;,0(! ,! /;,P 0@-P/;,P @-@P$0P/;,P @-a0000/0@-S@ Q) 0S \Q@AOoB@0Sh Q S Q000S0000Pq4!p@-`@P 0Sp(P pG-lp0dES`P01SP001000PW PP- U p P Ѝ010S00# pP0?F0q# 0d` F$ F#E 1R P@#1 PR0(d0 d0 0  0U*P0C0#0 F001VX3 R 3PR 0 ЍG0SS QQ C0  0ЍGRP*pRS 0 0AP 0S0C 07` 100P0C000jPPUF` 0Q 00t0 PQ_VP P0SPPA0SV_0Sh HPd m 0 ЍG*_V` P V10S t! RS 0  m_PP P P0 -PPP0  B01S0R4ABZ@D pP@DT0CR0S*A8A@DwP  0 )0S pA`,;,X<,d<,L<,P<,;,_,P`,1,_,&? <, EA-A`pP V P = CP  V10S ! 00|QS 00 0S$ 8QQ 0XP< R0$1a 0S0S >00S$1R0$aʈGPt` Fy F)00z$<0u0$10P0 0S $;,|_,P`,>,1,<,@-(@0S =\00;,G-APpP 0P0U0S = CW`dq, `0S( 0 0S0@000Պ0 0C0S [10S0 0S N G7 GjY 0 0R  7x00S U d00SX00S D00SX    ;,$,_,_,_,4,,8,,`,<-0 R!  ^ !0;,04/;,0 R 00S P@0~0/0P 0/\!4 0 / B  0/;,_, 0 /;,qp/G-p`@P6pP 儐u U 0  0W 00V@00CScP P 0P@P;, n,PG-P0P`JPpЀ@ 0@D P V 000U00C0C0y Tʌ'P 0 BJ 0 Q@ @D 0@DSB;, n,G-p`P@0@@0W  S #R0C00C0Ѝ RP   C 0 rpGA-0PP@q1`EP q 0P 10;,G-1@l`Pp0XXqp00 R00STDP 0pT@$,#,;,p@-@ppP P0S0Dp 0P&@-p 0&80P/ R/0 0S 0 />,00 0S/$0$ R >,(`,Ѐ;,A-X@ 0S0dS 0p(0,`P` p U` 0>,X0QH0H 0.4 00/ 0 08?,>,8O,A-P@T  ^#0pP4 044 R@0pW T 4` 0P ^@Q 0࠱`@ 0>,qpO-PP10SPU @PP0⼡p`@` V  RXWA  0 V 0 0PW @SU)PA `Y0 0 w W`@TP0 00  0` qp )@P|PAp ` W0 0K0  0`qp @TP(`,>, n,P0G-`p|PU0  SXW@ U W0S P)9P @P P`@V0 0 0 0@00qp0SP`Ph`@W 00 0@00qp0SP`V@>, n,G-`P@8pတtu00V00S 0SP@`P@tu TUP#,G-@Pq0p`Ptt80@ p 00 0`Pqp080|>, n,800S/,00/PP//_,_,00CS0 S0 SFe0 /O-0P-SP   ~ 3T! immpmPm@P0S,@ 0S 0S%@T Ce@mmmB:X C A  _ 0  ЍO*`P @@ @S 0A $ 5c/@0 ;,km G-@P $`P( >rpPa `[   @yz  0Z P~p@ ;p Tt sp@6s  40  p0 ;,C-`Hqp p_qp@@PPW.Y T0 0 Ѝqpp 0  0a0@S@-TA0@S<0'@ Ѝ'P( #P   8X,^,^,0.Pp@-9 $P" 'P= P !srp p^P 0 &- &P \?06 pPtd0`@P\0 L0Af&P,@me006pG#,8X,U|#,^,G-@`pdP4T#0 5T Ta0'0000aP0 ?@6T P'08X,@-o0@-MPh@P  ( srfЍ08!P >0 00&#,8X,@-HP!sr@H 0! 0&8X,@-> sr @@@60P&6 >0606Ѝ8X,#,G-6@PP`j>T6k.sq 00P6 >06PU p>P0PPЁ  G P 8X,#,`,@-P ,0 0R  #,Tl0@-0`  ^ @^TSa04S '005S ##,8X,0@- @P 0QA 6R 008X,G-pP@P Pi`P)>`&>p6W @8X,00S/A- M`p-b@qpp6W @ Ѝ 0 PU}P48P P0  b_,8X,m@-  0mS Ѝ 0 Q0 ?@P 0 S# @ PPP0`0 S  Q0 R pV`PPp =pX00#,17@-PU0P( P@ P<0 Ѝ000S@PP =P0}=3 Ѝ0@`H00S< Ѝ0@ 0 0$0 T#,|#,&́ف 0 #,<07@- R P(0(@?@0 Ѝ08-&#,@B`,@-P M# @0.S 00S Ѝ 0S 00 00S000b @ ` `P0@ 0R 00@0@$8-&`,5<<07@- R P(0(@?@.0 Ѝ04-&$,@B_,@-P M# @0.S {00S Ѝ 0S 00 00S000 @ ` _`P0@ 0R 00@0@$4-&bz_,5@-@PUP  @ ЍЂ@-@PP  @ Ѝ0Sp@- Sp00S p@t l0p`zP p@qpP@ 0p@ T#,_,`,P07@- S Sl0 Ѝ0zXP@T0PP '<U@ Ѝ0@<0 00g p-&t-&/P/L0@-0@S 00 $0$ @t_,#,p_,X P7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@P;u Ѝ04@P,0  0 10 `-&\-&m,d-&T`,=0/0f `,P/ZP @P//@-@Q|A plY@0TxSPLH~D|@z<x8v@y-&>CD[T@--0@dS!@S1 CR&0C  R 0Q0 . Ѝ@A C#R k C Q 0Ѝ        @\P @v4!_, 4!0O-P8M`00P@*0 S  0  ? 0p00C/  0?pT*000C SX E0!R1PT*0@ S 0,S U<04 P0EPE1!0C 0UЍ<, & &@-PMP M 0@~ݍ Ѝ@` @<0Spm0 = x@ݍ ЍU X<Z H<P0SP(< &J<, &`=D ^UP@-  0S 0 0ЍP  R lЍX 0L H 0<0408000000000i&h&p@-PM 0  0 x0 [ @l{d P 0S>000D ;0Ѝ,0P w_,_,P @P/i 0 /ᶅh#,P/00S_,0/@-@0SI_,0/@-,@0S0 0C00Ѝ_,Dž0/@-,@0S0 0100Ѝ_,0/400S/(00S/@-qp@_,#,P@- 00@ ^S00S00 Ѝ0 0-&#p@-P0M % @!`P@@0,S  i0S 0 ,R 0p 0Y0SX 0Ѝp40@0000$ ~\ @_,_,Q=ULo0@-PMO  AQA0S1Ѝ0RS'DSSS 0e C R E C R   C R S -S 1 CR 0CrSdSWS ^S wS     0  E000 0 FK N R WR Q S-00 0  4!4!4!_,800S ,00S 0P// `,_,_,$0P/0 0 0C/`,#,_,A-PU  @Ѝ`p@xUP|`V 00S0\V0S 0S`@W P `@$V00꺆_,@-0S0*00 0[( Ѝ *  [Ն _,چ@-Q00P 0R  Ѝ@- :ֆJ_,P/0S/P 0  //oP@-/ខ 0LP/ _, 0@-L   Ѝ _,A-`@Px0-S0p00Cp S  P T00W`O-P$M cLP 00S S03/0L0$ЍeL0 @Pp88 0 R @@-PJ &$PP 0@093@!+P0P0h0 P @0+S9P 7c79P/P0z@ pZ)EaD[@T>0S.nP0S -P00 0 +P0P0PXD   0 p0 @ =RP    B  Xp00aK[0(!00CpS0 0U?o 200@S 3/T_U 0 [ 0S00S000 RL@<0 0 R 0eP.00S  _,t_,#,}D4!@-@PM @PU`p0@ tUЍU  i  B U R{  0L"00CS0U0S U3/U@`y 0 MV00SYS_U 0  1 U# U U 0?o20 0 ?o2P0U U U W0 0S00P0S00 0P W 0  0S00S000ESU U U I 0S0mPS000 00SD000V S꬇ׇ4!;,Bp@-P`@ᗺ000C S0 ` 0 B ^ ST00p pS 00 000S/P/H`,t_,@-XP H0H@ 0S0S  0  03/$@]t_, & 80S/S/ 0CS/$ &O-@pM,Q0S [; 0S0 0 Ѝ`V$P  0P  AAQ-P $YQY0 s0@@Oop B0 0S `0 0S Wp0p &@-PP0莚<-&/@-0M@20S4P 2     ib2 0S@ 10@@0Ѝ0! R0< "$01 S 10S 10S|1 \11S(  Sb2 P!2 R@ ~$10P@ 000 0 R  R(b0 @000S T0 0S T \0!PL 1 10S 1m 0Ss 0#So @h`,l`,n, n,0?,_,<-&0,0-&_,@-ll`,@- 5 Ѝ@-P7`@@@kp0 `W Ѝ"@-@6P  7螚xa,G- @$p`P 0(S%0  P@@@0^3#@- d 0 Ѝ,7@-P@2"@? Ѝ0@B@-<0?B3c/ ( 0 0 aЍMb@B40@-0@@T MaP  0 @-&a,;,@-@0@@-&0$R/ $嗾a,p@-& ЍO軴U 0qp  L 0ZqpV Q P _@ Ѝ&0,&;,#,p@-P@T 40@@@ @p `y+w+@m,m,p@-PH@U p@\Qp@(0?o2(0m,m,p@-P@ỹ p0 0P !U@pm,O-M,0`70( @40pqD780<087 @ 70S 70/S 0Ï0@{t (0, Prs007S(00(00 0,00 `$0000|60(0, rs  T0000S (0S0 00000S0S$Ѝ00C000 L0H " 00 000zy+  0Sqpڵqp0S`+00 00S0 @ y40S PIUPe U 0< 2Pm40S 4L H@0|4Px4U 'VPR `400PP40S <400S0R0S P 4L0SP```P L0He3PPU7  T  qp R#T0'`L0 `    h  D0NPD0 T 0P@TX\P* * P ` @ PUaP 0 00`hP0p`PL0 $P  000 0`0 L0$00CS$0P20S r000 0`0 L0p408 CPPI h0S8 Z5 ` p J!` 0C Q00_0p 0S0' 0P a 00o0 0S0YPPYP(1Up1) )0S0$0`P0S 0S < @B X0C  BSp aoZ0Yp0pP0$,#,`,_,_, n,(`,_,m,_,P`,|_,`,m,x_,<,;,p@-P@ḷ  04 P !U0p P$@m,p@-P@ᠷ  0LP 0 Up PS @P@m,p@-`@V000P0S0 r| 00^0tu00 U 0S! 0P tu !R0(PpVp00@00S 0Sp(0(0Sp p_,&&m,x_,m,p@-P`uU 0S0P@T 0P@|0 pP(@S0 00000@pp@(0P00m,;,@-0PPm,O-P3@أ0 404M`p 0P 0 X0`Sp$$P4Ѝ0  $$X0X8< rq ut00T00S04\0`ut 200@_ut$0  sy00 $0Y0 @$Put00V 0S 0$0(00X0 0$000 P#srJ RD R 0E0P 00@PP; 0 <qp@PN ` p%ut \0@P$100@_V `p000/V0V`p ` p @ P0X0  8< Z000rq0S Z0 YP 0  %qp`p000 040*m,<<,0@-MP @tu 10 }Ѝ0@- 0( 00S@m,x_,h0p@-@UP HP0 pp000S(0Sppd&m,x_,@-$@$0S000r @m,m,,`,O-0 ,M"0Qp 0SGPy pC 00#  \PH Q ,Ѝ,S0S 30S 0S(0S 0(0v0(00P2 X`@PE(qp@P[A!@PutTXPJ1\R0 0#@p HBHb0 0 0(0m0S 0S >20SX` 1``FoZ@P 0 @PX SiX1)`R@Put0`V@PP@ 0S 00SL YJhG qp QP 0S 00S3 m,%x_,_,\`,#,`,D@-($ 00000S@[ n,h`,@-($ 00000S@JX n,h`,㞪@-閯8, 000O00S@3ꤾ n,h`,@-@P x0x0SdP@ꤾ T#,X  1A-@TPP0 0멮vᾫ|pTRv㰫߮ 0@ P`p 0RW 0` ?00_ 80 ,00SA n,X ;,$,#,#,_,G-pl0P` X @ P 0S 0S S~n,A-` pP@6n'0Up0P '_'p@-HP@T 80   p 0 R%P%N%h-&n,O-0bAM MoIp>%W 0A 0 PP ể0S0000Aލ Ѝ0!S  GPA>004S S S X0PS  0 QP04 E0S  HH P? 0 ^R0 P\ S$R 0C 0M0`0000 \P0C R 0 Ch-&n,O-pQpPpMW M ۍ Ѝ@`S`ETpL3LC  DsD4c TPU Y< 3T W/P2@DhPpp;@ 85 @@ 0 p&W i$x V@ c$T<"0S000P ;04P S@ 2 Pp 0S 1T WP 000000@ 000S @0\0 0@ 0S @00 0Q @ Q0 @0S 00@ 0 S 0 S 0 S  P ? U0`00002n,h-&(s& n,z&VT7!e0@-@PP |P lP \P PPPh-&pv}@-@PAP P@ꉛO-x1M0S" @`0 ЍO`Pp000 0 Ppxy@`Ѝ00S 000S  0P @`;@ ͧ0 00A0 "# # 0Sn, n,(`,`,0@- LLPR^0S @T 0 Bn,h-&0@- LLPR^0S @T 0L Bn,h-&0/n,0/n,00S ;/n,@-OP OPOP@-0n,//@-L@I 'p0 PS0PЍn,\ QR0* /QS QQ*/0000/@-@P |"000000/0S0C 0//0@-  0#3@PP @0@0@- 0@SPR? P צۦ`Q  K6"` PЍpA-`pP@T@  G-P`"F$@p(, 5QP 0$ GdFP@P7P/P?/80@SQ 0@/a0@SQW@Q7@A-@`pR  ?P P@PT*?P #SPs@-0 00Pa0C`@S0 PЍp  000@@0 0 0 0 0 0d7!A-^\^1!0 l ^Q1!0 [\=[^Z ^\00]QQ$ ]Q0\[Q`.FQ5 `@p 0]QV 0@Q0 0 @\\@0[T T nT  \TR  @0\00X,P,%p@-0Pt @R RP D D <@D@ p@贮 @z&X,P,GC-1`pMQp@P0x `0Y 0 ?,PH D1@<1`0 $k\Y R T R 0 0P@ 0  [R .0B0S83 0  00]RT[T@ 0QT 0QST[@[T0Q[S@(0 R Ѝ0,P,X,d,00@-M M00P/S $S+ +S00+ 0 0 9S#\S @P0 0 xk0IS@P \00ۍ Ѝ00@00 S00~@X,P,zO-@T Ѝ0tS bS rS aS @{S000pW` Gp 0S0QU 0V;P0 0 PUP @0@ p0 0kb`P n,,X,P,ŜO-peM?Mo0 P\W ?/0 j00 ϟ0S?/0 |0^0T/L? 0XjS ^@/?0 j Q0S 00@00000S 00@0p00pS 0S @P#S ;S 0@0 P00LP  Pn 0S @,S|P0S 00@P  0S  00@aW=-0 (Q@pQ< @;Q }Q 0,< 0XP @\P 0h,`< 0CPU P@00,(< 0L5H < <P  <<0 \\^ ^00\ APP00v0I S mP0S 00@TP;0S004+4Kp i:*0 0S 00@l0S 00@`00P0S 00@|Q0S P @0SP X 1@( u9)0 |RP0U 0 }Px9x)0 P\XX898)0 Z$ M0P8(0 TJ4%]P M0!0 < 8 SR$0 (   8%00H 0$0 PP R00C0 0C S000lX,X< P07'0 8\RH [IQ␸0S <<00S ,l< 7P00A i 080 [%] 0  0S 00@\0gSk a9SX0SvS S 0&6 0[08 9R/RR0C8 &R* P 808z\R \ 00BQ0 S 5%0 T S00( 0  \ R5%0 n ;Sf IS00pS wS, iSY 5%0 R00vY& EV0"S Y4$0 5K  0S 00@<<0 [  RR < S 4$0  ^04 0S $Ip 9  U@P M[ 0S @;S ABg0110P\SS434#0 %MD  P2"0 < @P 0S 00@0@ H&pgh2h"0 0H p Y (2("0 20S%000 S90S 0Sw @;Se }S 1!0 <v)  9099090H 0 p000 XH 0S  p U4g   pYP 9)0     囱!1 ! 0 0 $(9 09909 l0 p,z&%x,X,P,|7!-&1R ֝@8, =Jer n,y$p,v/A]Ӡtx&40eݍЍG-@`@tp嘀PU@T00S Gh0d0@T0 0S0 0,4 P n,X,P,,,,,jp@-P @"000P @p.&@-@ 0  @0.&0p@-PPUph?@P 00CS0(zp ᢌyp0 y(,A-p`dB R3 RQ R P$0SV0(  R R F?$0P ,9fP0 P0! >PQ$00P0PT0, PP (00S(0 #R nR0V ,0 0200#0$0,0$0my( T0R #R nR   RpG QT000(0V0(00P R R0   $QT0P $w (0V0(0 00  T0(0V0(0(,=}\,g@-|@X0  0S 0S00CS0]yp X׋0  (,O-$DMX0`SpM00S 0S ~e3#X0X0\030 `00d0弓XSXP 00CS0 %yp X埋X 'pP0 V0 X PލЍP2 xp0S H0tGP 0cGP p4S H;0p0p4S \PP xP 00\0DGP|p0`0d0S00d0000S 00Sj aHP0  e0 2 01d00S +劬+R P0 d+0|+0JxAgPHJg 0l!< P*H\PP 6x<=P\c ( p$ G\0p !F 0`PS(0x0=PX30>00,p0\`0P l000S SP@  0  l8(00(03(,m(s&i,,,=âۢ@-@P qdP@-@@`P bdp@-@PPp0 Vd@-T`@PP $ 0'p0 ' Ѝ蘈,@-`MQqM0S000@03 0@0S % 0d 0 0S S ` 0l=@P *0 f< Phw 000ڍЍ蜈,,,"@-@P  Ptc `p\0 P `P 30P S x c Ѝ蜈,mG-pA嘁0 0`PU , R:(,>0(0 &U# \U   0 R`Z &R\RP` , R:(,0(0P    "pr P qu PE ,  R:(,0(0    0 ꜈,z&A-@P p0R`*W00 ҥ 0P P 0O-p/MlO0 0`PЍ080D?PU 0PH0 \ 0y Py P\^ R2 0S >00C S0 0S4 0  P0 R h>0R*SL>0@o(P0 00H0P 0S40P 0 R =0R=0 0S= 0RR0S0S4 0 S8=0@oP 0-=0C>S00L0 R: L  0` p``c0800400S|<p<8 00 X\04 0U<0S } +H0SP80S4PU 0`  EP0800A E4 Ӥ0T P !0 x 004 0t 0 `` 0D; 40,{0 0;0R( <0p 嚡0P 0S P 0 jEP2S 0 @▽`0S0`V: $ 00@ \:@ž0S  00a  @0'P y0 @0c [0`V: ]$ `0 0C0 P 0`V:T C `  0劮[ p SP 0`V:*`8K8 m:0 aV : ` 0 0\:0 SX88 00 @h04 0O<0S wP708060 P+80S'g04 0)<0S  Q80S04p  Gͯ`P <0 00F pp40< ( 0 <0S 1V 0400<068 00 V04 0<0S L0 R: L } 0` pc00p[ R  Q 6 D60<`4000  P 04`Z Z Z000 G 0Z0 00 V~ Z0 0RP  0d @0   PQC p0V `XOd@0p0<@p<(0000S \t04 0V<0S ~p P[ 80SX0sFL$L:Bp@0 0J`Q0 0  0p V0`0  `?0P  0 RS0 0 p0V R`0 0 !PP04 0A4 0P AP"0 000S 00P80S0s"Ap 4 0A40P (AP P R0Lv(`pL<(p<80S4X ! 0`Rl0004 0V*0000pW p0 1 W0 d;0H ! R0刘P0 pW*0$ ("1 0X`xp@0`0h<@h`<x0h0G0 0G8@P,,̈, p,7!,@,,s&.&nht@K? ,"(8!+X/X,5, =_tx&,<0 0R0((Q 0{Q   p,_,p@-@P`Tp0wS {S sS 0p AP 0 D _0`@p AP `=G-`pUPvPU00^01@ R  PVAGWp0!p!Q <0A\S00 0  ^0 0 00 00 00:Q 0Sp0S X00 0p00 0V 0S`: TpP 000BS m ,`08!gp@-P0`@T P ᆶP, 0S)00 00C?o2S Ppx0 0S00\0 0S00@0 0S00$0 0S00@,58!- 0@-MMP!@@P  P3^ ?p4+^+  @ P@ۍЍ0=H0  BR R R7 /(s&s&@00CS0 S0 / l7(s&@-,A0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@i$,0-01S ^00oS^ P0\ S0S Q0S R P0S0S0 00Q R  І-$,0@-  `Ğ\ @ T\    %R    $,І-p@-TA0 5S <0S -00$!<婠Pa0U&!0! R8  (P  喠0  ,P  占0  4PP 偫p@Ԋ00\P %P @ q00, kP$$SpІ- ,|,s&p@-@0` 2T  5tJd l\P`PT p ᅩP000STZ @(s&s&$,@-@P 3P>@P @0?SP@ ⁩p Ѝ/㎦P@QQP 0S SD4]0SY00n\Q ֣@-- S5)2s&@-0@<TQ T00 ?50001S R0Slp@TX` T@0$ @H4#5T(8  @,5$,;=Bs&І-IU^q{@- 51*s&7@-@P  E0S 0@T 00 Ѝ00"S sr@-@"P  p [Ѝq<0A-@X`c# ^p "RG ^<0c#N R 2.& 0p02#L @ "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L "L / 0p02#L "L /0S00//00//H0H 0p@-P@!@R0 U0 ,ز0P01p,,`,01//00/00/00/00/00/ 0  /, 0  /,5 00/e00/إ00/00/w00/00/@-@,00/@-@ , 0  /,e 0  /,إ 0  /,/00/00/00/00/00/ 00/00/"00/,00/600/H00/U00/`00/_00/j00/00/I00/ތ00/(J 00/5 00/tsO/gb@-0  0Ѝ@-@ +@-  x,r0@-%R  +@-  x,k @- 0 , , @- ,(0@-% R  ,  @-} @- 0,, M@-, @-  , (0@-% R y, < @-  p,< @-  g, < C@-^,< @-  V,  @-  M,  q@-D, e@-<h, e@-46, e@-,, @-  $,  @-   ,  @-  , @- 0,, @-  , @-  ,  C@-, @-  , 0$S00 @-, @-@DIP d 0   _ 0@-0 |1-,, p@-@-@7@-@0@-@600@-,!>Q,, 00@-,!@3Q,,00@-,!)Q,,00@-,!Q,,@-2@-2@-2@-2x@-薦@-褦@-貦@-  0@- [d,@-2@-R@-E@-@-ap@-P AN @H4S8=4;p =d  9d"?,? @-PPL04S@"<   "d d&, ,"?,? @-PPL04S@<  d d,,"?,? @-PPL04S@<  c c,,"?,?@-<<P d(0   ,',_@-<<P d(m0   ,,_@-<<ڮP d(V0 j  ,,_@-$@*P 廅,,A-\`)qW H5@P |A姅0 aP,,N00/00/00//A-P@`000 #1pS02 1(S%0lpt10#1Ux  Ua wRbFW80S  3/1SAtL0Fp( S0E`O o4¦? ? 1O-0@QMJPPPP%Pp 2 0  0Ң`V  0 F  @pVp 0S01 pxv! 0S`@`F|R@!ġ0C!\5\6\00 Q0S3 10 \(0 `00L1 S1S  0o! I10 C๔ЍO5S B/(B(!  20S 2 00 Ǧp@-@` P  0p@IE0@-@Q10%R   @ M xP \03S l{ d` \ \ T0 `8!, , ,, ,,}0@-@Q50%R   @ 4P x03S 7 xt p pl lh00S  0 i8! ,  , , ',&,,,0@-@ Q80 S00 @L C   P `03S  xt p pl lh00S  q8!, , ,, ,, ,,,,0p@-PQ+0%R   p@  x/ @h⑬P 3S/ @< ,A. p{8! x,r  T0Q@ @8 8C0 , ,( (/8! , , ,, ,\0QH H@0 4 4000S  /8!,,,,H0Q4 4C( $ $ /8!6,,, ,`0QL LhD D@ @C8 4 40 0/8!h,,, ,, ,H0Q4 4BC( $ $ /8!, ,, ,Q Q Q/ &   , , x,iQ Q Q/   h,,x,r///00/////////////00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/ @-@0@,@-@0@,0S00/ C@-, C@-, C@-, @-  z,  @-  q,  @-  h,  @-  _, @-  V, @-  M, @-  D, @-  ;,@-.0,@-.0, @-  " ,  @-  ,  e@-h, q@-,+@-  x,rA-T`)qW @W1@P |Ag0 !,,NA-@PP 0S a`t/P  .`1S0rOP a/P 0p RB .`@-@PE P x i0 0v}i000A-@`\@*T<0p " RG\<0c#N R 2.& @-@Q@-@R@-@S@-  e's&p@-@0S*_CP) \'^@P o MLTj|P%r&rC@ 9P < 0@ S< 00ppp舊,\-.&O-,M@0P0 T; R0AT 011!0 S01  R 01 AP5^P },0S  R3/00S 3/[1P PP Q0P 0 0S^`|: p` 00 1`@S0` $0ܝP$0pᦧ$0P``Pp1U00$0PeUP0S$008C80ᨹ B@S SBڰDP@_@8C80$S@ Sw^ 1  pP$ )0 `p B BR V` Z `1Z0ZR^ 0 0000)t&0 "P P 7V`y 0CÐ   S CUPPEPE_P 0 vP  ^ 0 0@0 PAP Ji1  0 v | Q l7w3XXW`OXPP000;lӄ!?@  S0010 SRSQ 1S b !ġ1S 0C" !8C8R11$PU%eppp0 nvP uB|va `P 0PSY 2C p5i0 i ێY<W P ,500xP0 qP- >P( dP& <PV 400C`F V$P SuP4P 0CP  @@PPt4P P0S 400C`(]{k1SR !0C B/!?1`C]1NSAPN P 0^A88#8xP  R11@(zP`PxP@a@1S020,(PJ @$3@P, #0@S002P0CP?P <P>P P2P 0PWvP tpP1aB P unz1S'ʰ1 B P u_zP 00P1 RE40S 3/Pe PP e P,ЍPR0v l\ 0SpW 0j 3/pd P 0`B P [u e `ze00x00AJ!0 b02P s00P000&`ye ꈊ,FV1s&ǧ`-z&8!\- Sz&R8!8! 001/ሊ,P0 R0//ሊ,O-p`*@PP [ ! M0P @ Ѝ000 1\$<0P0 00U040080 0<0<1@0q00D0`80H0, 40L0$0 0P(P1  @ꈊ,6P/D0 R/0@-A1 P e@< 㟩ꈊ,O-hBp0 %W`D5g0p 000o Ѝ0P@P 0S 00@ ['0 0 BnP eW0S _W000 00 `[0S (nP KW000 [0S nP  F0Y0 0S 0g ˔fǣPmm m@` 0p@0@0000. 0ESET0D0T00Ө?0S0 CR C 0DS0  0  PN P P!VUA`E Dl@DP`4f f f@`"PD P AP;  KR !   ` D0D0@0!P`1 V0p00@  ``/Zx`F`FV0p00@  DPE@DU`E¨` Y @  @T`— R   BU00000S 000 0 0$ЍO'0Y S ꜊,7 Az&s&A-pP`Pp `l@l@0T `P@ P P0000蜊,@-P@p 0_/0T0* -p@Ѝp0 00㩞 0l` 0@ ㉎-@t 0P  E&,!h0p@-P@XP0Ps H` R :ԵP 0S@@Q@puE&,@-@?0000蜊,0*j꜊,0>j꜊,-@-@00*  Ѝ@ Ѝ/-@-00  Ѝ Ѝ/-@-  ЍЍ/@-@@=@-@=@-pP@`M,0 0( 0 00`Ѝ@- Ѝ_O- M P`@pk@kUjT0 0`P 0#D0PSY 0SV L00SRDáPPL00PT^y@DO@W ;p ߗPSWpV`KЦo`0 S`K0 p@PE@0 :PT0 0P}00L0D 0H0T >Z  q aNvaaЍ00D R00S 0S cL0X3#Pp w qP 0 ^q똰bEEcc >/0 EGjp`P`IED`cc꜊,)`-@-,, ($ *Ѝ_@-P@`$0 0  0 00`Ѝp@- Ѝ_@-pP@`M,0 0x( 0 00`Ѝ@- Ѝ_-@-00a  >Ѝ Ѝ/_p@-Pj@jp蜊,@-7@- @安,A0$WPU ,% #变z]00h@PU %T "j]00000S$$坾 Ѝ0,u , ,s& O-LCM@"PP`@ n&@ "A啖Pp  [P.]Cߍp@T R Ẃ0P0X Y X @=R@8@4a0 0-s& 8! 1@-n0C-MM 0p@n`P0 ᶅPP* P zP 0S0 0B   HPPrP 0 Q00M0P}ۍЍ0A0P 0 @0 0@  X ,00S/ 0P SN@-,,@-T專P +P <+@("Pq@uX C-@M @奤0S0{$P,  ☤+0S#{P  f0Sl Y0] H)PeA@PaDt'$Dc*A^&'ЍP@R<}P'P'20S @`P'.Ap 0$!Pk<c} X  $P 0)AT PsP AP pPP 0e+Q !Sp 07'SpT+pAW3Npp0W3:X# @PQ  R@4Q p0Q  R@@P` Vp003/P,00  h0S  R l 410!8pd,,,,=@-MM+@(✏+(dB+(ⓏB+Z(?PލЍB?P 0 T @@@@@ @@@@.&B(>J HA ^-MM+ _+L '+ W+0 ?P  >ۍЍJ HA 0@-@M L1@@"#P @  P A0$*!PRU)QX&Ѝ0RL00S 3/P 0$003/0$M*bi@P3P/[P+W@P'[@P# 0P{ c:;{  0S 0_ Z'P 0@P4o0m%()*00d,,,bQ \ `-\-@-@M ʢ0@@>"#P* <@2  OP 00*!R00$Q )@P  0S 0` a'P%()Ѝd,,,O-`M  0 0X#*0S ` 0 SS 0ip0 S00C `@Z0 S:ŞPP@ B pQ %S0S iSc %S, dS 0T PsS(200P 0 倠ಠ@ZR  @P %Q0@ 0S0 aRT @R$R0PPR@ ~ T 00S  0! SD 0 @S$SS0P @U: R R 00 R @ 0QR\P 0S  S t00@Qb0cR^ 0 3/PW Ѝ 0 矍z&7@-@ PU ! M vaY00 Ѝ0llP X; L 5 ^Ǣ( 0$[(, g w   8 p@-@Q`T8080P00S0S   0p@~5,,"7@-@ SPU  #Y00 Ѝ0PP |  d00S rL 0H[i0 ,lB, ~   ,Ё8  s&s@-8Q`@L9iV*z N_cy_cu C_c5c_5ze 0 Ak@Pxx޹4P ??E^H^ -yЍp\-=s& O-Mp@`  0$ p 5U  b(0S  $[(P R&  O(0S  p$F(lP S\P NnpPT Pe&&  &'\R &0B? $0P$y*P XPP X00|嫜Pl妜P ; @  H; :0S :&P : '0#0;y3$"0ߍ3b3 l3< 0~"!031<0`0<0&2  00 ,\<0(    \00&P+00  @~?"!!0# & PM  XT $ |T2P ||D0S$@0 %U0 ,"QS %$%1P l 1 +T0V$2qw@T Ġ @~?0XC %0@0S@ @  0R0SQ Q&0S  3P 0 _] xu0  PS $2,O&ptbt< f@,,]! ?  N ,Q  + c ,@ m t 00@-,M 0000P00 000 0 00\PPP@P DD@0Q ,,Ѝ0@-l O&s& , -O-iMs?!0Zt&P 00iߍOЍ/Px&`P<1P 0!00*`P z[p P@& [PpT00Z%^VU0P 00GSW 010#S 00PpP@ P*,4;! -O-p0MT@X   p$p `V  @P'U` sPP>P@P BH E0PU m0'SP0U*S / ᇌP0 0kyX/0 0P  0@ 0 0H0 ~PX1Z B vҤp`PUQR( %2S022SP0220C2  S |S`` Lv$00 00( 0`0VPMUSnR PPV   0%S @S B* Bⷝ 0.S 0 0P1Zp@P^ 0A0 0DI $R5WfSv00 (u@0 0 (mPLbMbq0S  [V0A 0E?oX20S dx[`$u[#`bvV @ x 60S. &b@⊀^[kv00CS0000RUQ0S X$0S  `p5 SeNvWU _9[_X P3[?vIoMG0ЍO Ѝ/ ! &! ? ht@\-(s&)! 0@-CMl8PP 0S .Q@P 4Cߍ0 P߈ Ċ,Ë,G-p@ 圀PB`AT:00Y W ,/Y 000 P EQ 0 @z&0! A-`Pp I$p@ ᦜ ,p啈 g$P"@Œ,A-Pᇗ@℗opl }0S DQ0Q.SP @$ $6 2Ċ,r] Ë,p@-M 48PLP C  P 8PLP 5 B #p@ ( C 3 $P"U |@ &  "dP 0``0 &@PЍp  ܇P!iŽ,%i,Œ,8i(,DO-NMX6Q HDD`ێ,Pz0尪S ߖ W:-8 4e0 w=C$ C/| M00|=0夽pQ>e0 งP400峖0  P40  U Ur0YR? ;/ 0>vp @*<: R0 :P'P P 0X60,09Pt<xI0.\̟   0/P `0< B 0 0u`````ZP00ۮtl= 2D00lq0,ݍ<Ѝ>0a X2 t塗pP  `囗P pP;{ 1sS1lS+2 0P%QP <_P;⎗pP`~,*0x*0wovP\8 0\8WV*0yU l*0z\*0}\8@*0|~(:( R0U:$ R *  Q9ɟP \ɟW弩^ D9   +X9 @H- A|)0p 0HALup p=SrL9)10@@ KP 0H0 H0A4up  AeYpP( 0W` VPSUppkvK l! JhpH p.0~p<((0~LɖP (ĖP 忖P 庖P 嵖P 尖P 嫖Pe0:4JP '0\6S '01||pP 4l \TLD'8[7S/ ' QP&P86&A&A~0\8P 5P 5&oP p:4S 5h_P 0T&APڴ  [L\80&8\8~Pp ✅  ȊP0%08P 劅  嶊P0040%S\880\8P r 0S 8%8P Xc  D及P000S\80\84P0S\80\8p?帧4S3P  0@?S @P l32 0{HR##hRp#xß$`RX#W%R<# 2  30S1 zP 2@T t HHrt#0p0S l"T0S `"<ËP3S3 UZ #s?00N?C0C l0  0pF0p}PxP8A?Sێ80EpE,0x ,YP"H pU[0S 垓,#VW5S 5!1},oobXflX60Sp0 <EV4!S< "0 0 U~ xĊ,I! ,g! s&! Hz&O&! ! , uŒ,;! 7! X .Ë,Ž,,,N,&?! ,,b! <;!8 -! % iK" " ? ! ,,~ " " +" /" ," J" U" a" |" " " " " }# "# l" " # # , $ $ % % % % d% % & & ;& F& ,$,U& u& & & & ' & & P 01/<;!_C-鿏`@(MPsP3S0 p 0p :00 0p@0p00~/00 P 0P/S/00 0 /S 0/0 P0%R  @ 0  p@ߍ /' 6' >' @-p`CM|@PlP#`0R\PP @ W<0080 `0(*PCߍ _K' ,,O'  ,@-@ @,@-0  0Q P @0@ 28 0/P $  Ѝ,` ,,@ 0@-0@XMPA0  0@) P x x0 t0Ep@1P0/Q   LL t1 0/R@, ,@jЍ0Ċ,p ,,,,@ ,@-M@D9[P⋓P   0 D00Sލ\0\ \P L0 (0< .0, ),.,,,, ,f' ,' @-bCMX6S 0P \8lP9XT20S H1\6S 81020"(#2PPr [10 b_:4S / WT\@aU B10 I:4!SO *00 0 B>x;||1@P) )1l 1\.T+D(0S 4!4!,!,0S    'N eP\6S U N"Cߍ 0 BĊ,N] ' N,% " Œ,' ,' ar' " Ԏ,' ~ ' ( ," /" Ë,( Ž,6( :( ,G( }( ( ' Z( f( @-@T^ S C @TR \00S0 @B_TQ "#0  @ ! 0  @  0  @ S00\RQ @  Q  G-P`phM 0S%hЍ0L0 3/@P 0 @P  Q 1/P @ @@0ᄠ80:/P 0 083/P@@ 0\ P0//!01000/ 00#0//O-ap$MPA@T ^ ˑP00 ` 0S 0S0S$ЍP P00 S ⷑS, R ,0S R : 8 80R:P3#///A-@M`Mmp" *0P p}v Xd5\\ SS=S 8 d3R 0 ,0 ڍЍTTM) a) A-`QM p@ ⟜P PP PЍPPTP0 phP@$U@@T @ @`?0 @wPo) 5 }) ^G-Pp 0@0M'"pPP "`0 R PЍ 0L03/P 0 L놁0 FD @$0S P @5 @1``,) p@-P`o0@0S 0p@("A-0Mq!P0`L0 3/P< 0t@T 4/@0@P0  0 0l$0S $0 T \  0S0C,D 2(Ѝ`,) ? 7  =0S/p@-P@I 0000p@8O-p@P|M Y0P,0+`,P|Ѝ` 0S0 !X V 0S0L0H 3/P X0p``P 1,0000U00 0P1 00 0<00000pP ,0<<0@Do@0S P 0@  !D00 0S0 !Z Q 0S0 L0H 43/P4 X0 0 0 d @-Y P 0P 0Pp PQ` QTPQH "P <080P/,/(//t;!(Rp@-8@Q0@P@DPp 4PpO&p@-P@P  ~ ~00pp~ @-  O&@- x O&G-@PMP N/ޒ ~0 0 0S1 0S XP a,P ލ0S 0S1S P P @l0 1h0$1d0(1`0,1% 1S nP >4%0`>@ppԐ* 2`0$  7$07X 4` 0S 3Si dt O K0`0? ,`p䀍0.P 0S0)#0C?o27 #3RR  0"R6p7 'Sn`F0'Sn`pF0'S``Vn`F0(P~ 0C QX > 00B,04!  `<#60"`RPLP P ,04! |~<#`ῌd2P  @000@A00"p I0N?P0S Jp ᣑ ⟑KR ⚑0p0K?(0811n$10 100 h<@qx1rP0p( {1S%4` ␠0!] 0AX 0S,0! <#@ 0@ ,0! @<#0h ` 5 ) #k#z###}D#$,QNEFX_) #) z&) 'Q`) '@-PM`p PP 0p @P  hPP 0pPB 4P 7/P4Ѝ~P+ X  C 01/@P00pЍpP@00003/003/$Am) O-`UM MM.x0Pe[.W QeH,AErh8Z.T@[@,0p%SppW 0,0,Uݍ ЍU  n? h4F>D 7 \4040@P#`ύ֯Nx 54, Q~W <S D7h4F>D0C2$7\41 [ V?h4F>D0C26A\40 40 000000000 00p@ 0 x0}<55ps 1yt0 00 00000 0p@ 0< 5 5s qଔT1 @t00, nE "z5@0\qW 42XL1຀`0pNόjppr຀qh p\  t00$? 000/0,0S00Ӥ?'N?,$"@`pT0 ,0S E 0S N?,$"@P4pWD4 0}10  A -z "(z $z,1p0!,1 101$14141(8H!L1 1$!0L1H!,[6$ 1(1\),0q, 1401$141(>8@ $$pP  ~ ^zWx !Hp#"0$100$4; Pp2P p> C  L $10=0$107P00: 0 l0G5  5Sp Ph $003/$` PK `qH!> ,! 5$F0@>S  GPjPA u;?S= $10>C418<10S2 @+` 0bVQ!!10@b/W0,1014181>C0(1}1S0}1$1S ` E@d,\-(s& Z=O&,,,,h,_,>* _PP$030/0@o//BO-@P MMAD0*!Rp0)Q`U0 $0 E   P a Pp ,P*l'0`$0 + L$PZ(pP 44\,: ܍Ѝp 4:|0Spp0 @0 4p0SW00l , Ri  000x;8,9/PV 0  x8;,;/ 0 x8;,9/T08SS "0CS0S "S S/ Pp  R <pWP00P0)l2YP0 U @6' 'pP 0s r&P }d0S !88 Qd0S !8|\0 PS !t8`0S !j8X0Sl! hSd! 80\ EГL0@ DQ\0S ` R  !8J8 ⻓ Q ⵓQ{⯓Pu⩓PoX0 SPecpQWpph  c,,* 5 f* X F * H X;!i d, + + * + &+ -+ ;u4+ * M+ S+ * 0 f+ * x+ * + + * + * x* * * O-eM0M*Q8U"pU|&hh'@J&\u XQ X A&0 80T mQ 咤ލЍ4 )qWd nP7 FP' P  @yP' @ pH0X l40чP40 Z P U Z@D`@ 9 p P~U   S0SA   0S # 0P000P FeP14s10H#5:h#h `%\%X%0S H%D%@ B}upp80P0 0 ,0ST0 S00 P0p800SS0 4 0  0x;8.:/P>0400ST0LL S>@ S?00$ <0+P<0PL!@  PP ,0$  40( P8 S-  S `0$z PL P00(5S0+4^[v14  y0 S r0 n%%Ȱ0,,+ F,+ , , ;, _, @, 6,P- i- - - - - - - . . . " + 1g;!X + + + + + + + + (- ְ0 5 + , , , !- + O-@BMTMh Pp ` T@PpT0$(PpppPP@BލЍ䓟#%C3ܣ0@ %3# $04@(8 %3P@@00<DT@0\ mP `e$430$3 04 X$2 $02(408@00S0 CP ;$댲夒  .p20$8@`2@DDAT L2L"LL哈#P 82 4%PI(2  *20)ATp !0 bP&!$0 U@0S   E#P 0Sp C0@ 4 000@0x; 89/P1  X%P !F-%@P 0  o @$$0 {@B``;W7@. P. V. h. |. m۶. $ o. 0@o/b0 !!/(,10/ap@-@4P0 `r1111p(,O-P@p`ԐԠ԰0/ C !  !0  Pņ00S  0 0S 0P1SR0B 0 0`p@P X 00,0` 00000 Ѝ(,  ` D 0@-P@M/.⒆1, 00 0d0@00 0T0@@@@1 0 000@qP,Oߍ0D (,O-Pp@`4M 0Sp`P `Ppp 0S00V0#S 4Ѝ0 L03/`P0 L03/P)   Q 0S  !r P00P0 $04@H008p0`S,000TT0 0X0$0\0(0`0,0d0pA- 0R 0  DQHa@1QRpB   !LAPAPq0 \A0Q     TTAU @@(,/ O-PBpXQMU<2PX\1S2\U \QUЍ0C`1`1S``夀001PS \1 X!X1! 0`1Vle.0X`0 T1tX " \P6 \ ! 000: S.X1 2 \1`0 0X1`eP 0 S 0.S Pqh p ` XXP.^ SX1, 2 $ eq(,Q& X p@-MM`iP] oۍЍpZ P@P+q P*+hp P*+p P*< P@ ⨾P7WX p@-&M@(bI`P5 Jh<0 0G P (c5(c 1hi] < @P   ލpa#/ b ,4>66zYAwY\- ,7@-@0P @́ 0 Ѝ0 1 s&0 0@-EMtP@ \l qP0000U ($$0x:@lEߍ0t,(,l@-hM`A :l9{@1^q P0x $!r w1 <'0 00`00 0H0 0 00 00 000``PPpR02W'Ux:` J<X (k((Jhߍ11 (,t,8  F1 $ Q&m1 ;0 @-@P !0`RxzO|P  PP  xZP`h 1  T  101K@0Pڭ@T 5X Ѝ(,)! Q&@-@<['0@- 0~ Ѝ0@- 0t Ѝ@-0@M 0 0 0000 0]Ѝp@-P<@0/SpQ {Pp@Q&@-0P  ,,G- M@p`P- 0 &P(0 PP0P00P p @0PP0PySa00ͅ0݅ 000͕0ͅ Ѝ1 4_,8 ,1 ,,1 O-4MP z$,p@apTPj $pp`V40S` yppG WU \1\!\\}0,  ` ($0(/, 0VRR  S  R$0 0y(0@C@J$o@,0!00 0 @  (( ,0 VSS00P0#02S `F ~ 0p Qy(Pp$o`4Ѝ1 0 H0L0 H0L0 H0L0 H0L0 H0L0 lH0L0  TH0L0@ <H0L0E $lЍCw!SH0000%0PpG0  d 9/ 000(00 ,X& + R XY _6 !L , A-Pp`@a!0P  p0Q p@Tp Fm`P !@ B"*T 1mT0 01`0(`10q0000d6 O-RUMP , X! 3 #1Q1 B2q Bq BQ B B  0l`㰰0@ X@@p0 0,(0 @@@@@ p@@0`Pế'Uߍpv'0(  p D`∀ f 00*8b0A-0<0@SH04 `pPhV09h?V090VP:0A! 0S/ LP0 05/0P0 8p<  @  L 0P4 P p $ Q:  BS:Aߍ L`0 (06/P(0f 8< b @_0`4 V  V  R U  U  RE ,A0  ( g( P0 fp $, ( ( ,0P 0 pP`\p0  f 0P@fp`LPP\ p `P@?0` O-0@AM`,,7 O-@`4M0P\03/0 X ĀX p ppP(W 0 Y2 2 Z "00 " 0  C" 1 " X "0  !" " 0 " 0 "  C" 0CCW 2"j0E0 0p20h2 0`2` 0J00000P,<1pp@12((4Ѝ嗋(0 8 r P  ,0gP,0YH D00 0P P`&0,00$0P9 `0[Z00SZ YP P00S`(\0,(0k0V,000 0i3/`6 ̭,q< @' / u 7 p>!lO7 ( , r,X @-@P0cgP/MYP0S0X O-pMCP TUtX4{ 00 rs> ,b0  * 0$ P  1@0 B )R RHPQ0R r Q0CFS0TR000US0a0Ѝ@0  llGPT00U00Ha@0 \%41R7 (R3 !R/ R-R H ` ` 0R 0R`[XoFT00U00V Oe @GP0 /S`Sp`` [XtT00U0,`0>! ,Hg,<8 #,_T8 T, 8T,,X O-0MS@pأЍ`  W0@ 0 P0S% cS2 %MS) CS, GS R 0dP PSS! +0C?oW20S 000 00SmS sS gSR 0R RO-OM M400 00 P00 <0 0PP0@@00P(0 P 0H03/00040 00!6 0R 0  0(3/ 0P`` S08 `&a0T&XU\a`0$08000,00$0& ph0J(`HpD0WX0h05R0lp0h X `pV Sh O`U Th GPUh AVU 00 0<PTp|zwu0P`000@ S40dP0O>0=C0H0<0000D0 004c$x\UT0 R  Pp0 000H0P0 F0PT0S =xueP 0S80Q00`Q0S 0L0 aA3/P 0P P  2/``dF X!ZpBP0?cUP 0 Z [ Q P<0 S@0 D  R8X# a`0"$0$0,0(0,0$0!$0倒 D9 0]c 0xl00  0Pc 08# 0GcȐ 0 x0h00l01 0Ht0p^+D+T+ 'TL L0` S*pV 0 TpU 00 0dTo0 <ToP0+,0$ Q00Q03S (0A"PLvp 0 & PE00`P3/ A0``PQ5VP04PTI(G Oލ Ѝ 0 Z C 0 [ ? Z 8`,E8 J8 O8 ,U8 h8 ? ¦e8 X8 @-@! 0$   0 P0S 0$  0"O-Mp@( P,`|1/0@T0P5@PZ@TP0 0rb p0kbpW U T 0_bY00 @$P $ W<000$08<8p 0` S04 $ia0$LL0d00h04O0l0d X pW Pd OpQܿd IWJ 0 Po p3$ 0 X0 0\p0p00@0800<0#0psWP0, R)  Tn0 0@0pT0 F0pTP0P TpcPPM $Ѝ LA0 PnT0 0S! 0S4 `Q00Q0S 0L0 aA3/Pb  0开0S S 0%PTBup; 0U%PJ003/%B0K0 p01( 0R, Q ( , W (p,  R\ 0Wp(0S,0 0>900p3/ 0pXc0%WQXcpE0 Z0 0噳+Dyp 6apW000 0Cpÿ D0+apWP噿0W000 000W 000$0=`,E8 J8 ,e8 h8 ? 0@-@M0@L0 3/P" ! !WQ 0 0 SS@Ѝp@-`MMMP;` @P f Q bMލЍp{dЀ@-@P HnbP 8ibP (dboX A o8 p@-0@ 8M! 0`P@@ 0 P8ЍpAbPUJ0 00  0 uP@oC-X1M MPN @a0P *1SE$A T )1S ݍ Ѝ Q 0 1/PPP@pG 0S0 L03/P ,0X0uP  0  x;H 8/P H{@,, ,@-0P  _,@-0 /PR ЍP/R0 R/R  t0@ 8 (,@-@@@-@@ x8 @-PKP@af@`P  bWp0S  WT b{ T @LEP  0?%1f@ Ѝ,8 ,8 s&@-@ @0n8 @-@P@@-M@  P  P <Q܍8 0@-MP@~  Px  P 0TsP <0ߍ08 @-@_@A-pP_`l@P P  d$0! 0PP ᭽Ѝ0$D 8 ,p@-@P4Sp@Tp$ @Pp咽Dp ,8 G-pt`DTP `PP@ 0 0PP$0R04l ,8 A-TP4SA p`4&@ 4 0P P D ,p@-@4S04pTU TU Tp`040 460 4. ,8 p@-@P0 p@ =p@-@P@ op8    @- @- @-  0P/ ,0@-PM  0xPPj 啺@  0PPP`@P,P0Ѝ0@μ>!*9 79 4,@-@A-aJ?pW;$AT"0 (PPЍ @> C  01/@P  0Q$AHL Q>0 R 0S }P P 0$003/$q,,#0pQ@-s #"T R0//s@-(@T@ЍpH塻0P坻0 w003/@P/@-tMO`P @P0 p@@(P  90@Tp@tЍT0 @T|0t dl0l p  `P L `@塻㟵,K9 X T9 c9 4,y9 ]9 9 ,9 9 /@- j@g9 Z( ///@-0@Q sv@o?0 \ 0P000@-@4M0  bP0PU[^0 00U00 0  04Ѝ04,//A-pP@`VT0S0S X^PH0P$1U-^0U00 0X0`p@]9 4,0SR00/p@-@P\<0P4`" 6D0# A@$!p`,,A-<`P@^Pp( N A8,@-圾褦@-0@-AM  a0 h0S YH@L0LP0ǴT 44 0{ wAߍ0c,9 9 : 1G-1MP`@1P!t1t1t0ppl(`PBL@cD0 [c ߍ ᜝@P rh\ ^@P 0=S\?A@0  @ST@  >P 0 lVTP P MT@ 9:S0 W8 #: ,8: 1: ?: =1A-1@P%`p1P!P0P0P`P`P0  @"T 00Yg,9:d: Z: |: : : p@-0M02000`00P0@P @T 1X 1TO/11 0hPO/11 ЍpF: ;R 0@- P ,@-CM` P@`P p0 0`0SO/11 Cߍ5Skx xl lcPX \\TZ0S  <S41, 1,: ,,; ; ; E; b; M;價Jp@-P@S1 1  pt,1p@-P`@P0 p@; p@-P@_P PN/1 1 p; Vp@-P@1G1(1 P1 1 p; V@-4@; C-@aM.pL`TV PS2PPG aߍP m}P D"P080E0("GlP  ",?2X , [ 0a, [ CXN?1L0 0!,P P|1|10 tAPplaU U UeP10$0PU@8!88`A,ppP0S S  @_ 0` 0P@'P0@8 &C8 0 0 & F 0  000 p ᠵ@,~cd,5; ; ; ,N< =< 9:Y&`,t,,,,`-\-p Ko A-P$pP@P a-@T E ?fP( 0 2 P  08R P [@ጸoЍW\\Px P< 0 _|< ,< ?= O= W< < = 5= h//O-0p4@T Ѝ@T@T( ^& @` PT[Z [СQ UZ@P@ @T@D @B@PB0"/,O-!h, 00S@- /h,,C-麋X@(p,P0`$ 0АYĐY T  T:\0WaU U VP P 0U Ѝ HV0  = = [/ `/ @-@P 0  [@[ a?!= 0@-0@S0d T0"S  @0<00R( T40 h,,,G-lP0`Sp@;S S 2@1+1:X p  QBp\T.@T&RQ0000(Q $;X Q 0S T v?H 0@1 00 0TRT0R"1,{p@-P@u@op1O-0@SpP`0 PRQQT RL0VȰСr0 $P 0 0"00=0(Q $W0, 1X#Q  F vQ 0G0   R pR `0` `Z R [ R# Ѝ  W1Q:`0h,= p?!= p@-P@P0S!U 0E p(0"PE0U055403 0(2#ph,,,40@-0@SeDP0@0ӕh,>!A-AP0`SS!U 0E p0耟@SV Ѝ 4 U(@0³`P `4p00 0@0[[Pp0P H pϳ `00 P0'p(0,0`h,,,6 sG> h1A-0PSp@` 0 PQQA S90 ![ 2r 0 !Rv?000 V ! (0$0X3,00S0001RPp0S0 00 0W1S` h,P@- @U00S T ]OЍ=O-X0MSM2"Y\0@S2"`0Sb2"d0S2p"h0Sx2T"tH F0SHɵ80S 80 SRN80S -, 70pHPASTPPEPI @@`P. @  \00`0d  00|h X lh;S \L!L@0ݻP@_oRݍЍ 0:S 000a 1 00 0 0 0C0 ;0CS||PpO> ?!= g> > > > > z&>> > > ? 2? C? >!" u? ? N? f? K? O-0TM$00 (00 40 0800p000@,0 0@<00$$ 0!$0 0(000 P 0ST`@`DPQ 0[ [ !1R  sT [`RP`XP` P40(S80 00 $ 48R0$0 (P 0XX0S$ $ `P;S S2P11: 0S D 00PA`^U:PU2QP0 Đ(Q $2U,0S ! 0S E ,v5E<0P1 0$ 0 0 0 S 0  0S 0$ TЍUQU0B"1,{p@-XP@0S!R+)r00 S @ 0N Dp,O-BM MPtT0@P 0P(` ; PpBލ ЍD0 P 8Q 0  0 \0 pP0 00!$0X4X00 0Fv0`F;S P |EPY +RQ 0P \Q SF0Rpʪ0S R0 S + S- S0S0000000`0 0 P 0S  bD 0 R$ ?!p 0$ S 0"P00S 0$ iedA? O-DMhPl`vPDЍ>@P >$6#Sp 0 RP` ;#S0Rp0 d00\ `0h0x00XD P$`P`t0 (04H⨲000 00 00p;?!> @-`X0Sg0 W\0@Sh0 `0Si0t d0Sjl0X h0SkT0< pP S 0&á ЍO> @!= g> > > > O-MpD001PUЍ` ؠذPE0S Y0@  0 0 p1/Q S@@@  Q  Q @ 0 @0R0 0p1/P @,?!A-Pp@`0S P8p0 S7/P 0403/P 0D03/P0403/A-e@P`p1S 3/`V@Td0@@T0P0S@000S4000S(0000AE@!,,?!@E! L!p@-@4`4P0Sp@510S 3/@,,0 0#0/0@0/p@-@8Pq, 00080sp `^/ 4R R0 0`40$ Rp `083/<0 0"0P000`0X0S 3/ P0001S01 0S0P000 꼭 00//00/00/00/10/Q@-@@@ 0A0003/P@  @=C-B`0SPEM;0ݮRQ0pSծJQ0 Stͮ BQ0S Ʈ;Q0S@忮4Q0S(帮-Q0Sk㱮&Q0S00$ R!000 % 0 F   0  0d 0q✥p`Ԩ@0,0p ` 㐤80$4@`!0 `40 000 f0,0 p&N0$100\$10ܧ\0d00h00`@ pl0SO00S< p0 PÁt ,l3 000000 000 0 080p#p` 3d,0hl0S> S@; SN`p%P H3/P 0p0072 |000L0p 3/P x0| 0 00S 00CS`p 0SV 0CP2Q gЍOP+00SZ 3/@@OoBS R@0&0010@!Rx!@!x@|@pPpt@刡t0S|0X*@0P PQ 0!Y@x 0T:x0S@ ̤巧t@OoB@|0xT:@,,p@ @!1@ d,,ܛ R_080 @ ,P u: $ ,@ >O-S[?UM8 ,0044@`D FpP APt Uߍ60P00 P Pe30 40S 0RB 80S8(1SI 1<00H ,HLAP4#0? 4 (#H@; $E}z 0@PⓩP'@T "2B 00!P0S 3/Pt20 SU@0%0cD0`t T2RI1@Y,N @=,H! L@H@<#`P`T@)P ` H@ H,H,00 0040} @Ȩ H   , 彨 }H, ⴨ᷦrH40P1:1!L @0 000000 0000 00]p` D9D0S#0 5Q7[T Y ᅦღၦ0v Ꭳx,,_@ ` no@ @!1@ G-/0@JMM`0qPP+9P& 0S" 0`"`M!p/o;P T` H 0@T* /R  )P@N@Sm+8 P:5N?0 `HP+0: S pW&N>00ꨠ t!PJ>0@0/Sr0@!+ 8 SP`+8 P*P 0/S`0oo`bS GpG0&000 SV+tU8 P*+O8 P*PM@M@`JލЍr] @ 8 X @-*@-M @PЍ(0  @P  P 0S:$c(#"c  8#8S G-`'PPp X`p,@P%Ѝ0S @ pHP0 \ SpL P Xp0 @姭 FA @ @ A-tM `PXP HP4+7@P@0 z@ ~@P+J7zJ.0]r+J7xkJ.0LNLcP GPP|<Z, >PPso+J7K0J..PPc_+J7; JB`3 PPLH+Jl7l$pd0\!0J>P 0.P UT ލP@[+J?7JPPp0J.լ@++7 ʬP h lJ>ìPT @ @ @ A A A @ AA nA MA `A + mA ~A }A [&@ +@ "A +A }8 5A /00/00/00/00/0@-0@4M#|0$P 0EP\ 'P0T0670 Pa @P 64Ѝ0`,,,O-AMAd2 ,000PB,0 0000/ 80s0`0P, p $  ?(0 $0K 0s$00 0$h5 S` @@`|@0S 80< 03/P0p80<P Ѝpv'80s @0D 0 0Q:8`0S0L0` $3/P$ & [P T0T2y@&T"@(J@@,0S:0兡(0$"P>P@0@00 +0@080s=0 0@( Y !W|Ѝ#_!@&(00\1 0C`!00 XTy@!0(P R P@ 60! 0 h0 @,0 400t0S00XTP00P0 P@ 0(l @h  w@8q 3/P`,-IB gSB _B 6 BB 'PB XB 0@-)M@G0p \*4 +ߠ@,ܠP0 &*ҠP -ˠ 0 F  .0 0xЍ0!0P80 S+P ,㥠P 4Q ,'A!nB h,A-@  "(0MH( 0PlQ2d2 5  L! D!@`  p0.  0@ ,PA!,,X,C!X 3 O-`M,p@0 40PVY ppPT Pp0Z:`PU`Jh?ERUA X?X/XXB00#h R 0  80s0`F`pHU p Ch0S 00  80spHY pPp Ch0l0 0L03/, 00Y:pPpfp0+0P80<>ЍOp0H03/,0$$ (08RPP0$P(<00WS:< R4*p,0, 0$` 0S `0S< $`Sp $ PR( P`$ (0=PU` P0 Sc@D S \0S 0 `p8P0VU:00S40000040,0(pWs08`<00< R:pp8`/p< p 00<<* `8q ,0,( 0L03/0 0000 0V `V0$0( 0S ` $ (0F=`V`P p0k  008,0,p(p<0yS 0| 1/0 0P SR 0 ሰ 08;/`0P}0H03/0@08P0D00Z|*p 0 `<080sb00_ <0 0SY04 @0SD0  0 H3/PB $ <0 %P 0 0X 80T,3/00T00X0 0\0$0`0(0d0,0003/p 0 L03/00 00008@`0[ `0  < V00 400P0 00 Q40 pp<0Pp80s00  h0S l Y* 0L03/Pt !0 儐X09/Pj 0$!000400$00(0 00 0S(0  0 H3/P- X$ 0 03/p<  0L03/0p Pp$0P( 0S pP$ (0< W00 40! 0$!000400$00(0 0$0 c(0## < 0  00 H3/P<00`0<0l0 S04$( $ 0S(0  0 H3/P+ $ %P 0 0X 0T80,3/00T00X0 0\0$0`0(0d0,0T0Sv ,0Ss P0 P  R0P0k 0$!000400$00(0 0$0 c(0## < 0  00 H3/PP80s0 00- Q ( 0 S% 0 Si$ , 80X T3/00T00X0 0\0 $0`0(0d0,00Sy 3/p]p0`0W:0p Sm:Pp`,0 0Ul:8孙P  0$ 0S0p0$ p  Spd`P 80 p0R:pYP Y:PpW00 U0#S {p`ЍL0 3/P@D0 RP RP 0 L03/040T0S ,0S P0 P  R0P0ꌀ 8/ #"08,00,L0 3/P 00p开8S  8y\ X W08P@DH0Pe00   8 rp0ip` p!8p 40U 00 0S 0P*p ` @`80s0 L0 3/P 08400H0, 00,0+$0T00X0pPGm۶B C!]B , 00 80sh p ?P8p@-@P(Mg(0Sx(`,`W0 00P0F0 P P`0(PZP,(咘(P(Ѝp000.,囕(冘0,`(P\-| R,O-X`M)1$qS W W(!0 "@PЍ0 p0> C 0 1/pP0$q Q 0 > 1/@P@p 0X: @1XS<1@1\1(HL1X\1Pp ,P!#00@ 0 '8) 0 ' #0 W %&, T0P80000, 0 0B0>80000  0'}\嘗0.0H*H0P00T00LP (X0>W0 000p8500 %  % %P,  (P 0 %<  5 000000 000 000cpp S<5P,0;ᨔXpW* 0GS(> $P A$ 00S H @3/4pGWp@ 0L0 3/P 00S 0Sp003/0pH03/ 0! P7/P%$%$)@0 QIYb @J@DpH L0 YZ03/ 0 0JQ  01/ 0S 2"<$Є  0<P 0h Hp0  @D@0 ᄀX60X< Ply,0S$:pP p@H0 0H008L0P 3/P p0`0 0`0080P 8/00@D@H,pP 0,QQTQ@Dp pT Q  Q0p p@08L0P 3/P `00`00p80P 7/00P  P 0000000 0P 000f,,d,_p408< X h ,x H u: A!B D!B X 0@-@P`4M#}p@0S $ 0dL03/P `80< 0 80 < 8PUV`4Ѝ R00S 0 //O-@0SpP 0< #80 s#   ` 002<  Ԡ`0SQ,  R) 0 0#Q! Q0 2<<{# 8 0 r  1# 000 S   d;$ 1 SR08C81/h,!0 /h,p@-@$P x1SP 003/p@蔕x1瑕P$ 0SO-@0`PKMM~p⻞G0DI;0S K2 @,0:< ,0崋 0 < o=(05#ਫ KP@T80U 00 0 00000@00萍 @@@@0IpK܍ЍIS+R*<o=(02#8 ;c&@@ u-O-`0@PMM,0h1h0p 0S (0 S> 9 H; 00 0 <0.%"@~40kP`0V,p0U 0000000 0 00000000p 0崑p`ލЍG⌎,0S*< !,00+C#X0S000C0C0000S0 0,0B$Ph, u@-@-;0  !<$10(10,1P001.@-@x;0 0! 0O-4M\T`Xhp(0P  啒"\ @,@;/,P R7P NPpK E;p WpF2 ;; 0" 00 0(0 0 0!`lW(04ЍO/Po4Ѝ[;0p@-@Q*P儓 0 P}40 Ppw <0dp@PTn80 P@h,0 Pb00 p$D!'C ) C *+p@-PBM `@P &2 V`PC 0P: Bߍp`/P00S)0`$40Pp`80PS<80  4X0S0!˶@$  0 P\0 `0S ⵶ @`d0Ph0S ⥶@l0S ⛶@p0SH ⑶@T`͒t0P^*D!9C :!C ;= >?-C 7C A ^BCEp@-`M<P@᱒  #& 1U%P0DPK0 @0S  %  %8PU@呒 0 #P剒 0+܍p(0S p 9@h,0S H /@D00S , %@$^7D!? /C ^127C 30p@-M01P@Q#L  % %0`N 0S (0S l z%  v%,`V D܍p4)  % c%0`N 0S (0S  W%  S%,`VP $0P 0 P0 Pt0 P`0 PL0 P 0  C"Y0S0 `F` x?0p⇞ 0S Y$ LU$`,p WV o$ $'` q0`0"  "ᰑߍ@ 0  0S   `PV 1 `S pא 0  0N 0S @0S @ ߍCb<0040!00p@0Fo$ 0DL03/00 M0S !0V{D` 0S # (#8`Y0,p x Q0X 8 < RFO    ' 0@ /5@_ 0  l R0^| 0  FD!\C mC C9E ? 6 xC &=~C C wC .? @-x @7+0 @0p0Cd @?C @-D @7000(0,0000.d @*ꐯC @-hQ`0@sKMP!   0o1!S=0EKߍ0 00@ @@0-P(@UTpp (`0 ሳ0  0`0`pEPED00H0P30L00@P00000T0D0 30S D00D0 p@ 23"b"`"0  3}/T2 0"S0C 1šWߍ 30 p2 0@00 0)1S080.0$X80p$P! 0 S L0X 3/P h W pW 00$%1/pt0S _PWC0A00M  000;3 0" $!  8 0L0X 3/P ht0S 0_Sʚ  03 0" 0 0p@080 0S,h,C x, -, 8@ d;T,D!D! -P,D!& 7 K60S/O-@pMU䅟 MPi 00x Rp#R0`ZadD80  @Q D0 \PU L PPC 8%8r % l`V800(0S$ۮ$B[00,0S$ή$BN0000S$t$BA0+ 0 `0B/P `ὠx 00 0; Q <0Sn0y0!#嚮#B00 0=,0#Sn0y0⊮#B 0 00;8 R3#0yT#B00 0=<0X#Sn0y0i#B( K 0 R #Z"B 0 R "L"Bx 06#0= 0S"<`"Bx 00 0=$0Sd"+"B0 00=(0S,"!Bx 06#0=00S! !Bx 00 0=40S!\!B{0 00=80Sx! !Blx 06#0;! D D D D D " E +E @E SE C0S@- 0@S !1R000 n0S/ -20S/O-@`Pr]MP2M T]ߍ0 L0@ 3/P P0; $ 0Y:X\vU [ xY $1 0V!7 q*0 0p!0 0᭫!1S$⛊1S8  0QG $ QXZ 0S (⃊(C*>I1P/S L(܊0(0 00e0SvU (,* )*0S `P 㽐00!15:%  ᱐P r Q 0, ($!d $ ➐P` 00 8a4Q101V|, -,@ _E X `A lE E 0S@0@-S@00 0S/ -0 O-P2EM 2@T P0 x2P l|1S$ $P| 003/P ,2P $  Eߍ$0 R P 01/0P 003/P A10SW PaPD  <0 040000,00800 pP@2@0S- $P* 0 x0D 0T,0$ -F |, -) P, -CF A-$0M^@ QP`p@0 L03/P 0 @p$ 0S0Ѝ 0Q@#*11P0\  R'l1@h1@T@0SP-D1@1^0P@@T  @T6 @pW3dpW0V82# @  R @ RD RV @  @H0 pW P^ TXV ,0"0P0 0R,0Ό R8<0T,$ -P, -x, -\0p@-T00P DPPp0AS@  1SAv,,,,0@-P$4M0@L0 3/P T  0P  0S4Ѝ00^@ ^T 0SR2",l0\ Q0/\P ^U Q0000@-,0O-`GMMzl7\2@(T H2V 00 0 0000000P@@@@ 0@E[p@a< (Y+(G܍Ѝ$1SpA0L08 3/P `7Z Z ZT7S p$ 0ST7S8 P P C  01/P ,00 H$L Q>,,80S @-0 &/ E!m lG G-`@Pጐ匠X0r2 S80S00 00 S80S0|1 P%S$1S00 0VUp@-8M`@8  f'T P $Q勿$00S U 0 |1 08ЍpsP BP P Q G P . w P h,A-M|P8 "'U`ЍFP $A003/0 R   01/`P 003/@P$a0H03/0 `p&XDD2 08 8/PD> 0!! 7#`  0 3/P"#"#00 03/p p0` L03/o Ⱥ` 0SWp`?`B414!44%0<0S P L3/0L00 3/P @0D t0Rxp`0L00 3/P @0D t0R 4 d00`RP  v00`p 0Sv 0 |1 0@D!E! lG h,G-`RM@Xr PP dP`T `SP P9  ,p ~'0S  'ߍ<0H(00,0 00004008004004 04$0D0(0P xW[  ڭpU lԭp* `e\in` 8 % 82T ,dT  `T \T XT 0,0RT0 NT `% |p 0`?`a8SڛPb 0  0**0P0޴  0* vd@edAvzd@]w!vBwww&w9wNwA-@Mp`;@@ Gp@ݍ P@00@T00 ##  /O-4MFpT(t$ ,`&X\pAT  0( YY 0 0<R. R 0Xpp @P R$ P#2Q4ЍS0< 0 Y+Q X( Q   0T pTp 0pWW 0 0Y084p<  ,(W \^ Z9 RR  Z$ 0 Y000 00TpTp 0|pWW  00 R R\p\ ؀0@-4MP!! 0  P PP@4Ѝ0 00P/S0D0SD/0- 0S^0$^ (H P@  @ \@0P00@0/A-` R0 >h!N000㛓#000X  "  ,Ʃ( [: .{T  `P ؀!\R 00  0Sx 0  0<0< H0S< < 0(E!H yd|dz&{dЀH H!G F C * 0$\ (00t S S  S00/Q 0P/0S 0S P//!R@-404 44 R )r0@/,H H!G 80R*@-0M@"P0 0! 0! P0Ѝ/00S/x,cp@-,P@0S0S< 04 px,@-@0Sx,A-pP@0ST 0S` @ P<0@P`V@x,s@-S@P ' `{P ~Ѝp8pP ~f`P (PP )P` SP MP(  EP` D t;PhhZPP 0SP` P +P @0`0@0AH HH NH TH \H bH iH DG!@-  ÁP ڈL| |P yЍX3Z0S 0 t 3|PyuH /H!O-@M M@P;B/$@pPz(` F0pt p㿦00@@Q$D0S8 R( { 0xPY0D04@T,4@0@T30@T0 00 ϽF z P P    0wP  p 00#㨁؀Fy@0V  00# T#ᖁ000G `#HP܍ Ѝ04 040RP8< 8<0RP {0( S 00#fPD D<P #`XP@h Y #Y4KP@m P #P0$" D0S(0 D 0{#\  `@0p0#[@#000@6 <`d@H H H H H I "I S8I @I hI 0@-M 0v 0@S|( G xPXwx0L @8⁛8  P 0  NЍs'BH!G @-w0SЍ@-@M "wT0  CR$00S ЍwA-pP@0ST 0S` @lPJ ? lH!|d@-a0P0Pp,,7@-@ P00l0 0f0 0`000 P  S  Ѝ0O-p`LM @P8J80 6(080C붳 6⼳=붣  B⾣@A30sS) 0lS`q 8>P08 6# p)G0$0F0 0E0 0D0 0C00B00(0pt0 8,0P,0 0L '"0 p LЍpW0`VpH!C-`PPT\0(Ѝ!SQ0P a`1/T 00갱J O-DM  0000 00 0 zp  00 4`Ro04`800,00  (0$ fp ,08<\@?! ( _5#ZP0$P00p/2#<*_.0 RP80 \X 8 PTuU G" ?P1 0@LH0 R p ? 0 /G$'@ T R`@`000 00  0 p 0S #"01# 0?04 SQYL0 V`00P0pYkXUDЍ,,/C-`@40M` }p\ X \^ PRPR VS  RQ \R  0    pЍO- ,80@-0@SjD 04  R@,8 -A-@p`P0  0 0 0`B 04 8 <00 00S00  SR000O-0@Poo`#0S Zp`0BT ЍZ  R  SR S0"P0S R00Y0 0 0 [YA-Pp`(@$@0" 0 $ 0( 0,2Q 2R0 002S R02S0(2: 00S= SSS- 0CS03Ѝ #"S S0&B0C0!S S0 SS S S0 S , R  0S S00PXR8L0@P  @-0 2HK!K!J p@-0@P@0S0l00S00ӵ0Ĵ00p,p@-@`PV V p0 n00`C0Q  07@-0PS@5 SNPP 00S T 8Il Ѝ0D 00# Ry,8 -S@- 0Ѝ$ - ( X QP ! " ! S  R  ( 08 Q S 0 0SR00//p@-@Pp_olUp@lQ!XR@-@0@ @rR;)r00@02€>K K!J @-P Q@0p@-tP@0S0S 0DHSTPSD  p# @0p,8 -08S^5/8-0#- p@-@ 0(  P0R0PS 00Sj QppG-P`NM@< ЀuKᠠ`0|  ` |000 ;PP <pNލ艘 H ydG-xM` @pᜐ堠SP! |!0@P 0S PU 0 R<D1D!DD00S 00" !P@&P0 0S0L0H 3/P HL 0RPPT $0RP0 0   x@ 04/@xЍY Y ZL   YZ( ( P)K M! J F C * O-p@PBM M`/0;P( H0P@0P0iP) Y  $;$  i P!14"S5 0Sїto@ lU01U01Bލ Ѝ Gh0P0  i?XY$0 0I0,j?X Y 0oS 1 SR 1S  RS1S1S p2?R0_Q  @0 0@QD 0H 0L0@!1F41Q 04 8 <" 0P(@@Q Q' Q0PUTi 0"0S0S0@0hP P `@@=02s 2 02@F @DURX A- 0MHL`Pp h1h!hhPh@P( T00٫ 0R`0 !?020!20W 02p 04 pi0Ѝ 0S" $0Q00 L03/P Q 0L Q 0 SD S003/J M!J >8 -P/@-\ @  0 2BS02D0C@AuOvO0w.#8\0 A- P\\0@@ \ 8\ @T h@ `Č `Ȍ `̌b` ` p SČpȌ`! 2/ ``~``a0q1P *ip`T8tBpP08} ^\ 0Sp`82S04@11111111108 l2~`S@P0 ߅ P0c0@SP0 0HL R   ? N ?K/Z[d0P `@10d ἐ 09/0P@\Ѝ ^,,G-p0@P8HL041` \ S ^ ?Y R  0\ X0?Pࠡ࠱000^ 0 G/,,>0@-@0M 410810!a0 P0u0 0Ha0 J0PU ! 5/-Ѝ0,,3 @- Hɐ@ E@- @ 0  ;_6M s&@-@@0sw,00p b0Cot\&TN--$M?0 0 ᲏$Ѝ0-4M 00 000 P4ЍO-pQMFf$9 "0P0%0 0`000 00 `V0(08 0R(0`V0(0"R 0*`Lş(`0 0 0$04U0S $0s 0SQߍ$0S {pP @c40SP $A␄P4[06 ~ 4f  0 뻸dXd@0eH$oD4P$4Z-JP JZښ $$壢J #e #2SP0 ß R#3SPS0 10@#0e800P PU480PZPU= < @3役 ᚰ 0 0 !2@T0@P 07P !៹ɰ@P$5 T;%P # 3W  R@pdh"K! $K @"% 0L"j 2 @ U0)1p R0, d  0P0U 00 *!"%+0!o(0V0!ᶃ@$0@PSdp!孃@h1 0p  0 U ,!. 0*!fҷ0PP20P  僃`ᑢP<$<pቢ@f0 o@t ihN-`N-HN-xN-PN-D@N-=8N-Y@UXN-Q_M!UU.AUUUTN-@~UU? @-T@XP@SRG-@  F700pP ąP:`X:00X0 !P\ @-P@`pP0S -S :S S  000`  0  0P0 ЍU0S T  aPz&p@-@Pp  `@U700@pp@-P 4`یp@  ᱌P@p@-M@ 'p $ ЍG-`p@T2 P  sP0IPE jPP& PE0P @ R R0 RR00#R0;R0S Q \Q  "Q0# #QS0 @-3M M Op 3ݍ ЍX p@-P R`@0 @ 㛍0 00S Y UP3PE ЍpA-@Pp p`" j 0W0 |0WxX Uh0X`0 P U <0H  0h08 Ѝ P 0q_BSN N r] N @-`0tM0F?oP2p @p^ -pT@]p h2Sp L0V#4 - tЍeh">pp@-P@@(pPppp@-@0  ы0 S " 0PUPUp@^0S   0 0S ^^0S   0 0S ^^A-p@PMU `0S@PE7  :0Px00ۍXn700S @ Q@BPE@C0 00 pLR0S N0#S @UX N!N N N @-M@ H 1p8lۍP  N!p@-d1`0SM LLЍp@@>  <P  0 !   ۊp0 S 09S .Ѝp0 S   000 00P0 PS @ d0 g pDLf  Ѝp@pN N!N!O  O p@-@$`PW[Pp0 @ `P0 002 0pp@-SP@`xM  :j0 0尊p@) 㞊p$  ᘊp ᒊp  ጊp  P  H0  p(0xЍpt zO!N  O 0 0 s@->@P`<p @ p0 p`` P0)p @ 40 pЍp4O! O $p@-@PqP  101CpP`qpI 0#1/pp@-pM0 p @ p@pЍO-QMM700ۍЍ   Z  @`V 姉@pP` @-`R00 ЍPp@0STg[@PT  Q*R@00 S   0 0S0 S *[P `z\x\  00000`0 @@P0   @-@@~ 8O!L1p@-S@T1S"d1S,RU6lRUppbV7l@\lbp1C;\L10CL1SP4\0P11C.\T10CT1SX'\0X11C!\d10Cd1Sh\0h1Z2,P0C2bV \bMp2,P0Cp27@-@0 PP$ H1 0D1<1@8 0@    (    )      C A Ѝ0@5 Ѝ0Q@-@  w  bшP p 00`_ Ѝ@ Q @ 00M pЍ@J ЍN OO! O Q@-@  G  ⡈P p 00/ Ѝ@ 1S70|[+YP| 01@ 40 pЍ@ ЍN `O! O @-t0M0@Q0$)p Ѝ  qO! O 081/@-@dr&P0S  P 0800L0S S@ Y&LO BO Zi@-p@\M Q t0  -p\ЍTO 0@-800@@? P@-@p t10cSt14 Ѝ@ @d 0 Ѝ\O PQ7@-@  ,, _ Bp w P Ѝ0@ P 11P,|1@ R  |%]AQP |`00CS`0 XJ@ T0Bp 0< Ѝ0@? X0 X Ѝ0N O!s&(s& O p@-PD囇p44p@ @sp p@蟇]! rO p@-P@ ` 08 l, S=U\% 0X 0 008 , 81pp@v O zO p@-`<1P:<1x1S0p0@Tp 0S   ʌ0@-@T 0S @C-p`,X0$:0P   1000  qH,`Q 0a(!"4a4# 0 F0 >Q & P X  h080dP040 Ѝ 0b"!4b4# 0S %/0p@-8P`J040 :04G@ PpP  Pp%pp@-8a? $0080S  p, A p p@3P!@-@@O-M`80pRP@T/Ѝ eP R+W& 080 C F"0   ]0800 >X  R @8 FX 0    8P C-`HaM0@  ЍPPe p0 P  , ⾃pnP1 P P2 P7 PlP@ P8!887@p$R! ,Q0S000 0P 00  ` xD!\10B0H1x@l l<xI HPʍLP!O gQ IQ WQ Q _Q P Q N-Q Q )Q q 1Q 8Q AQ @-@  ,[p oP<1 ,(,_0,1ЍP0@D<1 P$6N ]P!Q Q Q Q/@-@  0S@C-q`@ xf @P00@ 0S  a|0 Sx   0@ Ѝ 0 pPt~< @P 0@0PEU  x) PP 0S  )$0$0> R>  **X 5 0S 1@0 S   000x1  @  0SP P 0;0 S   0Q R lP!R 'R 0A-M P0 0E0@!0Eⴃp 00`+k`pQwb07S ^0 S X `0E 0\!`1  `Px1  ލ ' R PpP0 S   x0 pP 0PPUUxx x x1p  P  0S 0 0PP!;R JR R H\Q@-@  ll3*p07S@\0 S 0VS0S@lN P!A-`R@p@M PP U 700 @ЍASP"R 0S 0 'r>XU$  *P 0S <0 *R p \ <0H <V>P  *@ЍA@ЍP!"R R R O-P@$MpP  P 00A $ЍOPw P000 P`PP`VQ`P    0PEPE 00[PPIcTPPP P003#[p`r 8118100x1pW* Px1pF 81181kP NP00 6PP4PPUPpP xP 0: 0 nP P ` 0S 0 0p  P YY p 000 0S 0 0pW81181$Ѝ  P YY  op 00W0 0 0 :0C WUx1  05  R @ [ P W @(0Ƞ0 0 0  UB U  0HȠ0UB 66 0S W xx0P 0S "``W`ʁ*`0 xx S S S ,S @T( 4"4p P`0""@4"4 0W SL L0 b"!4b4# 0 @> *>0@D Ѝ耼p@-p1PSM"`! $@P T 0p1!V R 0S X\mvPP Df@tAtЍpp>0S O0x1@T l1S E  @>0S@ 8`l1S   {0 @ SNP 0  @  B.(0#p ,l1S Z Z =Q![ `[ 9[ [ 0 R/ 1/N-/A-@P 1 !  6SXpR0 qP 0`0SU000S \ \ 0 S   00S000@00P10 paU0OP[ Q!G[ [ 0P@-p0p ppq 00P R 0 U  [ )Q![ p@-@`TP\@@^0S\*\@\0 0SZ0 5Pk9 <R0p@-`M@P  p(0l``FSЍ R*p 0  B\ L *R B  ʚ;G-PP $L1L!LLoY@10!<`41Vp(@ 1!0 S0 R S,   @T0@T 0 S4  0(p `Q ,00@,@O@P0S 0S0 @@[ S00@( ( 03(00@000 0<0S80 Rp @ [ Q!Y[ @-XO@P ~pFP@0  0  (0,  0004 P0-s@-@T0P0Ѝp@Ѝ/ r P @/op" R 0Q000p 9}00C0PPU 0`0HP0HPLPU0 P(P0P0V00 S   0O0 S ,  0O0 S 4  0O@-@@OC-@PM pb堂T0SY 00C01@0S D3/\2\"\\(PU0S Pf0S R=0 S ,  003/00400P4P+!0 P0V0U0S/ L0 S* HP% HLH0 R |Q    00   CCU 0 HN0SP(p[0S} W`ЍT0u0S 0S   ,! Q 03/PEU[ YWN-[ Q![ @-8 0(@ [2p@ t@Ѝs&A-`M4PspM }0 qp@ {@ۍЍ4F P P  ӣ#P@@#C 0 ,$@4   Q|\&s&-@-   Ѝ Ѝ/@-MMP`@p0  qP 0pۍЍ"-@-   Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  l ЍЍ/-@-  ЍЍ/-@-  V ЍЍ/-@-  ЍЍ/-@-  @ ЍЍ/0/|\& 0p/P|\&@-M M t B{p P@;00 dSV :00@ۍ Ѝ$P0p 4Nd|\&=0/|\&@-$@@NP4 @HP|\&p@-dP@k; P04  PP   3PT V00pp|\&s&(P@-@Ps9>=@M@-@ p !2|p !+|p`@-q@ z01p z01@ =|p@-PM@` j  Z0 T+|p 1@ R! 0 p`Ѝpii$0 /L0s P/P  //@->P\MUyV0P0\ЍUp700@ p`R0 PU B0>000 <0  ,> F PP> *K%\ @-@T=@Q/@-@T>@0P/- R 0 R00^ PG-`P M0(0S @ P P P:`P 0!00 0   08S0 00 Ѝ080 00S # `pP `Pw0P 0iS.S  `Pg04S 040:Sz&0@-@PDM QP@T 00p@DЍ0U  P @0S@-`Pp@MTЍ 0S P 0S0pQ   <@P @-\000Q/Px1P/$0/@-@M    0 zpЍ~iO-YM `F/@H9X0IpPpYߍ0pL 0S 0S PP@ Y *P @T0SL0P 0@S0@S@@T1S X1 DPAT1S@\1S`1 6P5\1 S S R@L1SP1 %P&L1PC_oSRPU@(P04S 0s0P?AB@@$P00SLQU DJPPdh1 P Pd1UP H@ `  0[$0D  H  `0 S ]9X001H \0yp X0 RB000S0 15S4 S  CR.T X L@@RS! y R02 > 0*#81 000S p S 0 S `@@0?H0`p 0P0H0}>H0 @4000L0PPPQ!~K\ w\ i\ @\ A-p X`0P M0 @R  RT T 1 # 0@ @ QPUx!@T00 Ѝ R @x6x-Ȁ 5S @00 50A % 1@ A  + A+": A !9 R50,@-`pd@P@ Ѝ ڢ0PXVJTJp Q,*P CPPR!@-`RpP$M 0S0U00$Ѝ/@P 0 00 0  0S dU 6PP, T/00DU 7\ \ O-`@0p"S0W"SpG` Y PP u700 ЍTUYP T000졟0W YT X0#0%*T X3#: 0\S^0PxSmS0S< bS ST Tn C R T0 `T 00T 0T 0000 0    00 PP 0S& T  UK0 `P0A\0SP0S  >KT PT0PQ!z&P /0 S S /S/P0/S S S/0/O-M #PPЍO= `P ||ЍOI@Y@S   pWIPP  ~P 0QA00Ѝ=0@S. P( 0S ߊ@PH@`@G0P 0 @ 0 0 @ @R!] p@-@P H` 0SPH$` PP(0S $H0(0$0p,` P,` PO-@/4M10C`pXPSs00pHU- 9`Pp $<P@ P7 7  '$ !/P`0@T\0S @U0 @5 0H050U+ H0xt>0P HH0 E@PA t014ЍEP 0 1pA 0S aP"H01@U  CUH070 0  pX P! .R@  0R77@0U   0pP  H RU H0@1SՉ@H000zU P0H0p ,0 00 0 M,0S< _ czU ,0!00 0 g,0 S J Uw <1D80w40b儒000 0 PPP00 0 P  p@0  @P 4 UI <180w40b儒0p00 0 PP00 0 P  0@H0:0H P0<0UH# 0S /"`P /`P00 V /0P0 Q00<0000H060U ,0 00 0 "M,0HST  Ah 0A  ap$  P 4@AK0  U uU ,P 0SU0 pH0 50f h050,0 % 00 0 i,00,pY4$ UPPeUʧ700 50 $ 5'@p 0 *  0 |p P H0@40U 0S 4S 04S0:006S 06S090PU, ,0 00 0 jL,0HS <U H0P SPH0;00H090U `  l`, pP C`P 0%i C FH0Q7;0UlQ 9P0l1 x2P0l1 `+P0l1 P pE0PHp1tH000~U10H 2xP0H 2p P 0H 2h P PH Z H000TH020OU D 0pP(_ H0 S;70<H0207H0602H0;0-H080(UV <1#8b0w4儒00 0 P000 0 P0P0P@U2 <18∂04gr000 0 P00 0 PP00 0 wPp@0  @U =PH <p JPWH0p000 SP0<00 /P WH p P  PWHp   \P  H P  4P   PWH  BlxPP ~ ($upo 00vQ!] x\&]! J] W] t] (] ] ] ] ] ] ^ -4^ h^ 3b ^ c ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ "_ _ _ _ *_ D_ M_ W_ \_ k_ x_ _ _ _ ` ` :` W` j` {` ` F` j ` ` p` ` i i @7a Ra ma j |a i i i i i i i i i i i i 4` j j v a R!a a a a  a a a ,p 00pP $ ( H,8  ~P B OP*WH\ B $p pP (( ( H$8  MP  B \P  pPW ,0 00 0D I,0HSz  P /o"Bj ($}P/P0H (0.Pq 7$ ! (0'0L ($_Pc/P0H  (0PS 7$ ! (0 '0.U\ H0(X U X"H020H0 000P1H000H000 H0 00H0 00(07600R 2  *450S00T01=5 =50H0U <10(@0P@470'lP 50SxhU H$CP$U 81 800 (0 00 0 I(0`S, 6`( "4`4# ,,0H0800 PP0 0 P 0 0 H010{H010vH000qH050lH050gH000bH,';,\UZH090TAK3O0\ U0` 0z ZAAKοOAK OAKҿO"Ug \0@T$(@ <`P  ,00H,0 S$0PP4  pP0:0NP  ,00sH,XCP PpP`=(PCP`PpPh ,CPPpPP j \CPPpP f sCPPpP l eCP`, _CPi& YCPl   : {l?o2= ( tW8  @>CPb T8CP`Y p ^+CPc %CP  CP` CP` CP` CP ` CP@` CPh BPd 0BPe DBPe l \BPe pBPl BPg BPg BPlw BPlq BP f Wv ZP0$, ǙPP"( CAPP0P0BpPb .pP  R  R 0,PS0P , S%00 0$0(00XH`  p @  dZ`0P ʎJZ\0PZ ZUl HP70P7H0"800H080H07 00H070~U ,6P0h2vh2S H000kH070fU p`P 00w`lHpP؀G P PVGD P P:1Ȁ06H0401H030,H, 4,&H020!UO D0 spH` /H000H000 H0@00U2 ,0 00 0 pF,0HS U ,0 00 0 [F,0HS zU ,0 00 0 FF,0HS0 e Za b b O-pУ@`P8 P >P `nV<1T ЍOR$ RZ4 ,0840 ЍOM ЍR!] LO-S$M`04 @ 0QpP  8Ȑ̀ ⨠娰<1H0  00tGp0`   h    P` U (   $Ѝl&ZS YS R!-A-PQH 1pS`01S`5x1hS`8  ??$?0g47S90|?8g<7S:8v?@gD7S;@p?HgL7S<Hj?(h?Ae?d? 1`P]?[?1`PT?X  aP T0 ST47,`0C47<7,`0C<7yD7,`0CD7rL7,`0CL7O-MDM`P 0=P<exP E3&7 E000 0000 0P70P7F H0E00 0:00 30000% Op l +8 0 E 0D0 E+ 0 P#Z 1@@\0Y,=P0047`(vP3 @5:_ ؍DЍDP iPA0 D  D 0 0 DDP078247024,0<'哸 R28>@,0D'哸 R,@y>0H'87l"L'<7@7D7p"H7L708 p0  l@0S R R P\R @0@ R #P0 00 v?op200p0S0p@0p DD{P 0 0# 000dDP P0( % 4H P9P4 Z#d hpP"($$0@0S 0 S S0P\S 00@ :0p  TPphqdPd p < P 0S P  P 0S P Ppp0 0# Pu Xs0D00D00 0  0g0 S E:$ E000XY!Z!N-@ Y![!Rb "7}] nb 0Q//Q *///G-p000@0P `P Y 0 0 `R:S@C@3@D"X HGU( IGUA-TpW0 T`@V0 L0LS @sP X X| |00 S HH0P 0RS e Y!e Ie p@-P @Pp,<@-p@-@Pp PPpT0 p@1@-0@GT 0@0T0S@-0 p +f ]Z!e T0A-p `R0080810@: PP?1W U t0  t0 (p@o0S hpd0S @p? @U4 }C.P P @$T T0Rt0t 0SqPt0 t0 88fPT0$0x x0R T^@RP0S @Ef >f Vf ef Nf tf A-`P Pc_ @T T0pS@p@-Q Mz0 T0S0 PU|0h xPc_`@P 0 @ ]  Ѝp f jZ!e +f f f G-Pp0M $    =P 7@81A0 81P(P  0Ѝ |B @T|   T0 R0 0800, P T8p 0SS90SSPT0c | `P 7 R|0   P @T T0R88xPY0Sx x0R `& [T ,00XXWPR WP T T0R88FPq3p0VS tc_ @TG 0`SS-90SS)#PT00S8 00 H*: S R   p 0S 0S W@MT 00,F @PtZ!Z!Z!f f f f Z!Q00@-@1LS? @q@dR@l̠ BR00 1BS@P@-;000 0E0S r/00f Z!f P@-Q000 000S ]/00f Z!f P@-}H0H H0S SoB/00f Z!f P@-D0D D0S Sp&/00f Z!f P@-H0H H0S S,0@o /00f Z!f  ^p@-@Q0 RP_0 0`S0 SQ 0` [p@p0 p@W0 p@(g Z!{f %g f0P@-x0x xxQih0X  P R !P BR #@ļ@-g Z!f 9g p@-PP M0 h0S@T 0d($"4d4#@c@Ood@T $S 0@0 Ѝp|/0h`Q ,0000P 0 f [!f N-Eg 'A-0S00@Pd` pW G/0000Pp 0 N-]g [!nf P@-808 88Qv(0 !>000f [!f wg @-@Qj[([!g C-`TM@ P `hip) 0 i ````i1pWp0`V& i 0 0 ae@ KiT  @TЍ00C>S00`"P!@03@000C>S00p"P!@03@0 Q!P!Q!Q!-3@- P pp@Ѝ0@ Ѝ/@pp@-@RP`@p0Sp  ppg A-0Pp`@S:0SS 0  RS* R0 =`V1S* ЏP a 0@DpR: Q g X[!g g O-ATP` M zy5C@PA(@081 Z  xp 00QPȀ KP FP AP <P 7P x2P h-pPpZ P Ep @61@ R ,;p 0;1#3G0800 00%%)p L0S% S% p H p P p $  p q| pw P0S t0$0Q0 p 4 pe x0Sz 811L10x1[sZp M Pw p@ LP 00Dd hp0  Tp* %P %P0 x1`2@ p X00SXppW0h 1SP\p@$P# |p dp upp$Lx lp~ 0S P fQ [ T  Zp  r"ZpP| Pw Pr Pm  P P X00S 0Sa!Za!Wpb%P `V%R_ pZw0Sc   pl 0!lpTdpQ0SS   < upW 08!pCNpPH 1 R=Z  P; ЍZ p pr[!h h LO ZiBO P %h R zO -h ([!:h Fh h P ܦWh dh ph ~h h h tZ!h h h h Wg h h h =? h h IA r p@-P@pp p@yRRA-P`@@pL0s  S  U@ p@@@dW0S R H R U pBO %h ZiQ p@-P0U@S 00p @P@m@T:~p/h s&@-P`1pSMAT  p@lbЍ TPЍ@!R 0$ 0 0 p@ @@aV 0 !p@/`P ]p0S lt00#40  LLD SP 6 0 ([!i i [!"=i [!i 2i A-PP 0S @0p 0S @@U00 S U   ^ @ .S0.S=0_S-S```&00  @R)"0T0 0D0z& @- @0P P T00Q  1DP `00CS`0p S00 P0S X0X /XnX(s&p@-h1@SPvPPE @p w0.SSPP XP HP 4P 0  .PP6 Ci p@-@P'Uc 0 V0 tV0 dV0  TV0H/@,8)0& (#@        V0  V0  V0 V0 V Np@t IPi 3` oi i i i i i i i i i i i i j j j Fj s& 0(HLǒ -\ lp Q^ ,\ ,@-QMM@pP(_p000 UQލЍA. !. d0h Up`0SPE@E p 0S:0@0DS X 'j -j O-,MTPpP+ t`  @P20S  P@ P@,P$ X P$0X4200,Ѝ P,P, R P,PE0S X R0 6l2z0 0 0 8$ R, R P 0 0 j8$ R R ,PX!@P !!!\U0 T VPPT V\%0P00PP`F@pT V P`Fpz&[!G-RMMPLp`Hp< @>pE Up V=*p z>4 TpTG    0 pIp P; IiP 4I/   ,RލЍ   20V002 0@I p  @pP0P@T*p0S4 p` @T* T 0 Tp @ p    Hm0X$#$("( HiTpn @   HZ0Xd$#$(B(   HM04!c#!$c$" ITpN @@  H: 0b"!4b$#  H-L   .0I/SP+ \I/ Tp% 0S @00SP%@Tp00=$  ;6 ^A- @pTPM ЍR` R 00P0S 0 -0 0t0#0Q0 3$ 0V 0  0Raj Gj O-4MX@p 0S\`d` (0S:0 p20"4ЍO6 0  ,   xp0,0 ,0SPCD  ,<cp 0"00,h/4ЍP V0 000!0   0,pGp000P!d `F,P 0 S(0SVP$ (0S(00` 0$ ;/P $P(0 S0 0`F0$00 (000$ ;/(0SP, $0R00,  (0S ,  09,P[!|j j g j j j p@-P@`P 0S P$`(0Sp,` P,` P  0-]0@-MMP+ p P0@ۍЍ0;0 C@P S,P @- PΠ R00\L  ^@-Q00P`PV0 V=`V xЍp@@T   z0x@ `DPЍp`Vx1@P e0>0S *wP PU@P PPI`F/0P@-000 00 Q$0  @7j `e!k 0k A-` (M&00>0@SP  0'0x B0dpp 0t0 0 01 0 0S0S|0@0|0 0  X00Qx0 xPT (Ѝ0 8 0=0S 0xPTA) A-`|VPPFPP2X@p`Ex,P x倂|"x20 V0  V|20|2@-`@MpP! E (A (1X( 8p\PU@ Tw700@Ѝ qi///0@-M @ b*PPЍ0 3"Qp 000)00z[p0000@ 0l[plp 00 " 0`[p< ~p qk je!`GMV 0P0Gߍ@PF/ 9  0囿l0 p 1`0 DF?a[P> *0 F?T[ ii@-@MP4@ $P P@Ѝ|e!Q@-<0< <<~0SSP`///{k e!k $0 /Lp/@-Q @ ?t0@0Q00@-P@,M(  ;  + PZp 0 00S p,Ѝ08i(p@-@MP  `    (PZPЍp:iO-PQMM<3<#<<T0S(3#pW3#@H`"0J01801\0t0 P00K`T0`V3P `0P0T00T0 P T0X00T00T0PT0 0T0VP00P0YP0 < 0| P0 x ;P0R h0x 0h00|0P00`T0 0FT0T(@)@@F@  弱 T0R  B  @ Y@ T1F0FᶰF @T0  YI @T0 0F0FᶰF @T0  XP UPPEPP@ D$("(hXp`ݍЍ  ;  YI @ f e!k +f f  C-`p"0M` 0$`  0,pP @T@+Ѝ`Y*PPA   0,p;0 S '+@ ``T*x0V*+00+T00V:0 (P|P@ ( ᝸Y 0@Pe!@-`@DM pP@    ៽!> U 134  R2$ $@0 #DЍUi@i@-|@QM  00p |2 0"x2XЍ@-]MM`@FP#Wp PP VR 000S0S S SS wR0S H^pVPS CQRS 0  Vxp@P V$0 Bp 0S$H`    hXp 5 $ L %80Su S S00,0S  R000@0S  R00@ H @ 0 Hؼ!>50H \0Xp\ 0S 01S hhQc0 0 000 0 0p`URZ1S SN F F]ލЍRIx@P= @0 3P0 0- H)@`XTY$0S! HM PPN0 0~Qii@e!k @-40 000 0+Ѝe!2S/2S00/@-@@V002@-S0@0 @@V0002S 园/e!A-PM`p (P+P((@P. 0LL`0hVp0 ,!SL]VpPV0Sp Wp PU0S p VV.)@! (( Wp | PWp 7/PP Wp &P Ѝ@k k qB@k lBpBfB@O-@p`0M00PU  U0S2P    P崡 00S U 1!Z0P00 0 P0 PPP0PU:000000x Ѝ@-  BW ЍgBp@-0M2S`P@x (VP@0 \(W00ލp@ e!B@-P`2@Sp0$M  0*00q4%40 0 0p`;U$Ѝ@-@qU I(@F(@-@pp Vp`~B 0`( "4`#/R0@-00@ ^ 0 # R0 0P0p@-^@P T00p``0@D^"000œ\p@Tp0,QRO-M@@00`1Q V00ЍP0p Q :8Q@SI 딂\> \ plP p,lP U  Z4\[Wpp\X @ Q*S0C 0 &P 0 B0  0 S2X00cSc@-@ 000P 0S00 Ѝ@-@ 000nP 0S ^Ѝ@-@ 000YP  R J Ѝ@-@\0S \0\0@-@`q0`=T0`0@-@08$@0p@-800@P >Q &T 0x1 RpR 0S TT0Q  ꫢT0800 >0S  p@l A-p`KP%P@00<000S@ (0? @0K0cScO-@IMpḀȐup0< JIߍ0RS*R? ?0 000K C[%PP d0S  GRW ( Q  R (Qh 0 0000200> 0BS0 *z0 370 RS00 T' $0K0 `C7`0$0Q  DPW WdP h  Q x'$/ D X7 FQ @Hp$Q DQW R <0S @FT60 0 <# @W 0FS80 0 @0だ G 32:0 0d 5S 0 FS+00 %A C 50@W 00  0FSw20 0 @8 R  FRh3    0FSY 700 0 @2,0" R07,04'R SI S F P41(1"<1815%#8108ZW (1S 0 F0S"=00(  (100@0S W0 2S 0 FS <0 0 " z 20@W0081 0 Z00 FR P0@  } 2S P 0 FSQ0Y0 0 2 0000Y00 @  @W 00  ^00FSt0p0p@x 6S 0`FS^00 &A  60@yW,=(, "  P W: ART ,00,S P R:(, "   PW: ART^ ,000D0C0W00FSP90 00 0C4 <1@ 4S Y 0 FS8M00 $A  40@B?S7= B?S7q 00PD0 KS:KUKe 0 S0P0"1N 30F R 0   | @> 008  ^$Z Xl ,l cSc25Tl ol 7@-P\ R&@P\U0S x0x08  Ѝ0PP @ 40p H`&l f!"0 O A-PR1!@ `!P0 pC R0 00 R0 6 30 0 0P0 0:0 00P00;0 00P0060 00yP00ЍP 0000000 00]p0 00Qp0 00l f!l C-@PTM b"P@, 000`0001iH00 P00 븀x0`  (z#0(10< P !P( # @ B  ) 0ta !P( ``(1 ( d0(t!p^0+"70 (P 0 >``` P( `"(1* (> >Qߍ 0*  LO f!l l 0@-p M$M0i0PS`r 1 !p  Pp@ 0S i p ۍ$Ѝi@ U0 Pp 8QQ050 00bpPz P(j l (s&$"m f!'m @- 0080@P PU@ 0S@ X `P@Ѝp 00O-IM PpPHLL `PR H2 @P0!IߍO{"0,0u"600 0400` 0 p00,0 PS2 V30a2@0 0 ,0T>`0 xP >:d@PIߍO@>0 Px `VT` 0X`0T>0 4`M>P?m f!@Dm Tm gm G-@pPQP,b,`2S#PU`,@ ,x\EYP`UE, Q 0S ,9$GE DP,`0f!|m tm RC-00`p@PT:p T  X ⢑00U *"0 p Ѝ0R0   @L>0 DEp  ?> Ep@e 7 p@-RMM000PS`B S@ 00 0qpۍЍpp p p `F Di=, hEp V=@- 81S Q S0 00 0LPЍ R :0# DPD3O-04MS@ h@@ `0P 0_0 o0 00 0 P 3 00 y0 P3 0 0S0@0k00T0{ @P0t 00 0 `Pk 0 $ ( eXcpP  ,$(,8#P`@ X0⣡  Q*"00pP 0$00S $0 hj   ,(xt$j(g,8dP@ 0 Sh0` 0h0  0304Ѝ 00 !0 pPz @ uZt $k ,g,0pS :P@,0$S  S St 0P !R "Rp( $(,8~P@ m _m O-P0M040@`0 `2##`pp#`W9 pW6l0S,0S`,0r0v 2S`,080w0v 847S`,0lr0v p"Rr0,p802 Sp0,0g47S j< 0t pߍ0$000 `2$Pp$`  `$O< 0  p $`w 0 p 00 `2(0p 2< 0 p(&< 0t p#0z0,L04l0 440pl#0k@0"04,0 40p]g`]d`da`k,0 !P !904ǜ R6, `"N`P, 00`1,0,0G0 ` 0 lX00, }R0S 0*00P 0H ` `  0,M,p1S  ,0 !P !`" P ,0 0H0`0  0*p,`m m m m m n @n p@-PUp@0L0pp@- P# M*p 0` 0 ` 0@LpK@ Ѝp ` 0Lp )X` 0Lp  c00; U100Lp@-p@`PV8!(0-080000&0S  0R  Kdp`H Ѝ@ @ ,0p Ѝ@ Ѝf! O O-`@p 0帀SP$H` B000 0 0 `00`0 0 Р0 `  $: 00003H081x HA ЍO8<0 $: 000t3@00Sd3H0p84$: @vP0 080S##s 3u840S'0s 2u40S,d0S) $0P%h0"v: 001S:r p2u 8dP8 S0r 82u 4,A$R: 00#H0S0SU h R 0R<0S 0S11H000s8040 P14 \P18 VPl10 P804 T00@0S0i $0.0 0p ̀h`0 9 P0 /0S00Hh S P 0dh0 ЍO Ѝ/n Nn h Un rn yn n n ?? 0S; 0 S<$t5  F0 <`0  @ R 0P ЍG 0PS 0 PD0A 0 00 0SЍGЍTg! O q cSc r (P 'r Cr \0p@-800@P  D h00h00L0p@ Ti]r r !P \/0S/0> d0S  0R/9. /!P O-0M0000PS`@pTQ 0 ЍOu> R*RP 0S 07S ǚ ǚY  S4  X!  Q 0 S:500 0p00 0  ЍOY Y 0 0Cs0'0S0 S0L0 x p    0P 0 0 (F0SY0A060@ 600 0Ip0 0  `P  %0 S 081\ni@D6P UP0S0 0<S<0P0Ѝ 0    0|P 0Y6S700S00 l00 0P Rl532Y@0KSK?3@%05::0 Y0S0  d P   [ iL0 x4 @0S Y0 % 2)  Br  Br0 0 $ 0P 0   0 :Y 5 0  |3@S R@00 $0DϽY<0<0818 ?  ; 0 P0P4 000Р 00 0 0P00S* >P *   p国 @ 0|ЍO6600 0<P0 ,0S * hP  pl`81 R000H 0 000 `0`o0g\0S   0\!0YP 0 8 R @1ЍOOY 0 ^Y 0 .0Sh00 00 P0PY0 "2 x ЍOt r r r r s s 's ?m 2s .s Bs ls !P s s s ws `g!h s s s s p@-@l PT|2 0 Lp@x`D N\P d  p@s`$=t O-`Pp 0x1@TT 0S R T0S> R *™P  0 D@lt O-,M@`P Q0 ,ЍO%`F 0VWP0@SS 0SP0t#tx'xVI:PQUE0VB:  i"4"48#8S50V2:1 S/ 0 0P!' N0S 0`00a0<10  &  !P 1  0,Ѝ G 0  B6pg!t t p@-` MQP\@M  0000x p 0S TH  ۍЍp 0X`V \@TN |g!$"A- p`@PpApPUt1 0 HAp0S 0A\0S 0Ag!t G-0 ;M0MNp`p Dd`8i0 P480EL80H8$0ED80@X@8<8  XX:W0` 0E 0Ap "ݍ0Ѝ`g!N   p@-@PT ge c(a_@x1S0pSq @wA02p qA02G022p R Rp07@-PX0B @P 0S40>8 Q0'Q'+  A R "'     0  Ѝ0@8}EPh@Iji 00 d@ 0 Ѝ0zDt 0p@-@P0( Uph0Spp@.0O-P`@T Q Pd0S  0 H0pd0 ЍP0AQ 0S 0P W0  08p|0#  帐81- 8 0 $ 0R0hd`h08 R0, 00C0 },0800<0  P`00 g0 00S $0 pWp:#<0 2 0 0 R0H0@SQ 00ppW\0H0H_t   p<00u !P 3u Nn ,0`( "4`4#S /0 @Rp@-00p0`PQPE@ `ȹ @d@$,b pP/<0`( "4`43Z!R 2S///P/P/Q 0\R/ 0\/P/-000P b8"#4b4# 0Sx1@-@T P@x10S/ R0 " /Px10S/ R0 " /PP/h0SdP//0 SRQ oRQ /Q P/Ph0h   RQ P/@0 RP/R/@o//cScC-`x1TM@T. 0S pW$ P n 9PP@0Sh0S d0S4$|Td0 0S PPTЍ|0d 0|00 00d0 00090R P]  PU9$0 00 PP 00d8dX#v ͟PP |0d 0|0XxIU" 8ZPPP ᪸k| ⟟Pep{0S 5P 80 P  IU` P < 0$Q S "  Q  mPp h  5< 0V  h/pP: t0<0t00 00 80dxQY X 9P WU{ (pP FȐY $0% h  5< 0  $0<0|tZ!u g!*u v u p@-PP1!忶 Gp`01S 0S ܸ0S ظ0S  c0 @T 0Q0 PSP 0U d0S0h0d0p@wg g!u /v "p@-@T P>P@0+pg!G-Pp`P@Ѝ0E @P00 4@P 0P000000 000-20  S3$00 pPP,0 LpJ0S p0 0CP  0@R 0 0000@@g!e ?Jv iv @-@T PQ0 8 00*:SR h0S dP KH` ЍA$`  Pdp (0Q,0Q  D `P }800000( ,0?Pҷ0S  0h dW $0Q 0h0d`0SH4{v v 0S/0S/   O-MPH0<`R8 0@xP00ЍpP P0 U@ UP R R R0 P 0S8Y0000000Cs p@UЍOC4 @PЍO p    @@0 0+0 &2 Sg!e 0S/G-P@M T 0p `x=00 0@0 0 @e@ЍP/@-@TP@0 S   0p@-@PPP 000p蒰 Pݶ 00p0000 S0 @00:S 0S @\S000@:S @N-z&0@-P:P@A0 P\:R \:\P@\\ @R0/`& 0@-@AP:\|\00\0S^ 0N:PP |P P O-CM M 0d4 !Sp$  SO0E`VK `0P0E@ PPN 00pCލ Ѝ@@/;04pW p40(0= P 0 `R0 :R `d4@0  0(880P4 PF0 {0S ); p PP ;000P p 0S#0 0 0㴫p8`@Z + 8:0P R 0:0SF ܵ@ ص@ :0P 0O008`0 SWC p@DW:SY @\Sp S Spp00T:C P@D  0SQ :Np0P0@ 0 Y@S 0#SS `P@@0x[ P:0p0e= p0 R0 :R0 0KI 00S B:S:0 00IS! PBP[0i P0@DJ`F @ 0S a:9 G 002  @ ` P D,0  ,0@PE P0S >:$ D0A00T*0 PP 0P:SVrN-`&+ @-0  0 Ѝ@-(@ P k0 0N-0C-BMM00pS 0S`! \0S)  R&    RA^0C R[ ~0Pv Ps @ Kk Q00P ލЍ ~0P P 0@P0k0 PP U L0P   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R  0 A0SPZ\R    B{:R|R  N-z& p@-@PDp@NG-`= @P@ d Pi9 00@^S0S:SQ @0 R0FAd7 P= \S@0S:S: 0C\ 00C Z @ 00CY0TS @ ASBC\ 00bC ^\ 00:0 0 0Pd 0:SS0AR0@A P Pd ph!g!A-p= `P@ d^ PPd0`F 00@0S @Ad P Pd0 :RRAS@A P @-@# P 00S 00XS @00A ^a0ASW0AA0AS70A\2" 0@-4@0P }/PN-v G-A0SRPp`ʏ PU00Ѝ P00CS0j Pp0 Y( KP x, tP FP00SW  R00S 047σ,P R   S@T PR   R N-R-$N-@0@-0S |P cPN-V-@-@ZP08GN-p@-P@PPp9iPpN-@-@EP Q 0@87ST N-V-p@-@ PS P@p p@-@P * 0@87ST N-V-O-pWP`@P @ ЍZ K P 儭PT  RT@ Z //////O-8r@00SRP`  4PU00 Ѝ  P00CS0h Pp0 0  hcZ ,PD Y8 UP 'P00SX00 S AP P00S  2P ,P x&P \ P DP ,P$ :厡PV-$0@-4@0P -PV-v X0@-0S ;@@0@00DIP0DЍPV-PV-@-@`0P0`Sp 0.P PP ЍV-@-@P08DV-p@-P@PPpgPpV-A- P@`pPЍ0 (0P84SUP @V-@-$ 000B;P ЍPV-A- P@`plPЍ0 (0P84SUP @V-@-$ 000B;P ЍPV-@    /0A-P<<`0@ J0p0D0& SQd 0@/0PA/A/O-@PD]pDpG``b0Y:0z  Z# 0@@DC 0DA\0:Z: [=0 S: p `$ Ѝ `pTZ-A-@`Pp. Z5( T5" N5A G50@-0A^ 0 n /o$P b2 0.0AT doP$ n  N$ A000R00@-`pTM00`< @Pٕp TT0 6p#@ X<0@404 4/,00S 0TЍ`&v TZ-A-`@ 0s P060p0pGWp0P5P @P @pT 0@@PP @TZ-p@-@P?@0 ?@0R:@@pP pTZ-p@-QM$0Sp A1` 6/`1!6/& %R1 0Q! P` 6/* |)Rt10p(Qh! d'P\X\`P6/ ,`0 ,6/ `0 6/ 0`0 6/ 4`|0| 6/ `yX0 6/ Pp40 5/ 0@ |4/ЍpTZ-`&_v @ w n&*v ~ t ,w :Yv O Cv v Ew Lw [w jw {w aw w O-Q<08@0(00IPS @tS`,@48pT:(㔉)<0( T:(㔉)p@0(pT!: Ѝ  5030I/@`(4'008p D!0 `@4<08p4  b "0 0 `0@80@媮000 4/0SD0 sTZ-Th!dh!`&_w p@-@0`,0DPSp1S~@TZ-0D0P/TZ-G-4DAMHPMU0`00000P0P, p0,0x0@00`o`ⴓSLXo Xw +o3pn A>004@ppG0SkXf$0`S D(4ß0 R 40<L>T @C 0 B3^00@  C310X  2` 3 d ! \C 2h00C0'0hS8 0 p0 00I3\\Z%4`D| <Q ,`9PPDpAލЍ宐pP b4P 00PpWA C9RQ 0000&000%0}0L 0 R0Cu0s0Sp00$0k00S0Ce0cL 0 BR^0 0S0CX 0VL 0 BRQ00'0L00(0G00)0B00*0=000 0僭d0d :/1, !TjP 0H0TZ-h!`&w 8m th!Z-Z-w I&w 0H0S/TZ-0P /TZ-@-DAP|0`SDM)0S&l30S S fd30P 0P@ DЍ t3pW*P 0 000ْ0p3p=@ r`0pX0 T7/0S 0SP 0 P0DЍ@贒TZ-Z-`&v G-\qPL @0P12C001b5R 0 0&0S  $3h0S*0s0PE`1``d0 R1 *! q ` `  !`` 0R00j0S0PS &0S,P O,@GITZ--!\  0L0#0TZ-@-p0M  L0@31 ^AP 0C! 0Ѝl̑TZ- @-L 0 0@11D ^Q       TZ-A-Db@0Mu L0 @2# p PW%cP_  Bc p\  Z$0 HD@,X#10000 2R01   000 S" V00 S M ЍA X 1(4/00~X1威0 ᨦSV Q`ЍQ0S ⍑ЍA臑`\c  Z㦪 l#@l %0S Z 唪 b0@0TZ-Th!A-Q`0MS 00S` @P9 0s$@Ѝ ἑpW   @崑ӑ0p0|0S0S a@Pp1p00FV@@1P 00T l@ؐp`W 0S:S* 0| 囑0p0ppTZ-Z-O-`LqL1P0SU$,@T,P@P6 h0d 0B1 `P 1֐h L0C R P!050%Pd @T: W 彐0 p[L0CY1T*Q@@TZ-G-qT0So:\0`S& 2 c@Oo @d(0d$0P0@U1 0S. 0 P B N %Q * RG  ᛩ0B408@S 1:X 0@D8C 003 c0?o< @@D@  ȐPP  PNPP 0 @ S :    b01"!00000P00,0PTZ-`&A-p0@@ `P PP0`0P P@l %Q *0S  (TZ-$00S:@-@@RTZ-@-PP` U(0SP@P )@T \0@*T0T 4/E 00'0S 0 (( @\/ЍpTZ-`&_'x m O-$MPpPdE00U0SPc )Z@ <3@434 4/W(0Sp0eWD@XU0XU5 0PPW00 # 30+*[@C@dQR: =LzP5 KL ` $ J2 10X0D30 2%Q a*0S ^Z^1)Z @\ 1@囩1 ꆁ`K K:1X0<0< J 0 @D@ T1 L0 43   @[ [@K@@d PP P0P0 K D K0@D   %Q   0@P0'0S 0 P0py.$Ѝ*0S  TZ-`&_Tx x Z-m @-M@pP,aD(0SWTP )@T: 0@ 0 4/0#880 ὣP0Up@P  ͧ'0S 0 |( @-.Ѝr@P %Q|0S0S P 00TZ-`&_x m O-@QpP$M(0S@ P wP'0S  p@P-$ЍW !0`TM\0T*P* 0`0  `?oo 0c `S PP T 1b*ᯧ@4 T!P030#P0S X $200301S%T#2QZ FD*0T00S<PP 00PPP0 0#  0|0S0S @ Pp塍<剎`0<0 0 t-pP PP% 0   D  ҍ%T#2QZ J*0T00S  DUKP )PU @0@<0< 4/PP 004TZ-m `&Z-_x @-L0@'0S 0 00 0#-T Ѝ@ЍTZ-m H////`&/`&000/z&000/z&000 /z&000/z&000/z&000/z&000/z&000 /z&000 /z&000@/z&000/z&000 /z&Q P00Q////////0P/ R//A-`Pp@0 P @U*0Q R* /0/tx&{ {0 0CS0 S P#0 /p@-P@,`TPp@ Tpi!0A S010//i!0P/!R/P/P/Qa/P/0000 /z&P/ 0S S//0R/0000/z&000/z&7@-@PD@P 40R0PPɦ0 " Ѝ0_7 By s&PQ 0S///`&03P  /_Kq0 ACP 0AB0P CoSPS//O-MX@ @ЍO,SQ`pu rTp 04S`\kP0@`S@T~WlЍ_U` 㚔!^`PE`0r>T 04SJ:`\H㌱  T  QX ( Q     Z P   -T0`[?oT20S@ @ @0R @T`0-@0S S @0V @ X 1@@V X* 00`00P 0w!~!00S00/pQ"z&y 00S00/&"m&y ///@-@H6@P ( ! @Is&-@-   Ѝ Ѝ/ -@-  ЍЍ/ -@-  ЍЍ/ ///@-  Ѝ@-  Ѝ0-@-   ЍЍ/ //////P/ @-P 0A W00ЍQ@P I@p@-0P `| @P  \*. Q  Rp R  (  p 0 B z&Z-qA-P @`p>3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p0@- 00 } Ѝ0S/1>3 !/0S 000/Z-0S*p@- @PU P p Pp/0S/p@-0P @R`*0 PQp0Pp0S/@-@0 0C0 0  (  ( 0 S/! ^R/@-@0 0 0  $  $ A-P0S@`$0aH U ( U ( S 01 BpC B!0`A-PRp `@{P 0!/000A-@P`p쁟0 SV1 V00W W0Sc0P 0 B 0  BV  B* "M A! AC`0 F  B8  B "/ A & `PpG  B0Z  Bv`FPpGo`FPA~!A-a@0PS0<R&*1 21<0S 0R ,0PP0S*!!! 0R ,00S(!!!,p (S0PA , (0 ,Ptx&z&z&A-`P P0PS\ ]\ xp@BX T 0| VPPp`&0@-S@* Q 0S0000 [Q.Q000 S:0S008000R .R ]R00Z-< 08 C800/`Q'Q!//z&0sA-0p0@P`M⤂ p00p00pS 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0SN u P0( S,* R)\\&|\#00 |R 0S |0 3/000Q R R0SS*|\0 Q QQ S: 0S   B 0  BЍ 0S 0 c 0000  B 0B B0m0 "0 00 0WZ-p@-P@0`PP@@p Tp!Q 010//!,1p@-0@S0<QP: 1,0R04S"`$0V):8p1P8 S50#p(00<^ 00^ 0S8opU 0! R R0 0P`tx&z&z&O-P 0R@pM XӜ P&  <̜ P 000Ѝ 0@   RPP ЍO 0 PS@ D 0 00<00S*^Q0R08 ]R00-R @@g Q* ]R -RS\V0]Sj-R0 Sc:0S006000S80S 00000 |0 hS ,FhVKX ,0Sq40Sn$0Sk<0Sh(0pwd  0(` pc 0@`F p@ ȟUh 00C0c-R [RS :R =R} 0S: N .S0,S0`0`0-S]S0S0`0`40\ 0 IY0 S:0`S0`00S00``E0 Ⱏ0I{P  0 (S0<B(R$ QP    tP  $0  0$ 峠S0tS0`0`0-S]S0`S0`0=  0 S:0`S0`00S0 -RZ QW]QT -Z00  YI 0S. Y0`S 0`00S0<Y00 Z0S  Z4 0PP  .  uI400!0ⱐᲠ40  7P0S 00100  *P  %P (B(N [ 0]SS0<V*0P80 P <0S P pH00勰P00 0  EB#ЍORW =RT ]RQR :R ]R001y y tx&Z-z&z&z&p@- 0@0 (M! 00 x l0R 0`0]00000P0 `P(Ѝp(Ѝp@z&z&z&A-0@``Pp\U [U_0V:0dS0`000 4\U=*Ux .U; 0Sf0 `S xAPu 844U\ 0CUUt0SU 0`B }t  t 0D OU &83U F 0  , 0000h308@0S* *Q2  0  B  BA   B0|  B5Ѝ 0  0S 0S 00t200}PT\QR {RO00j0PS;* ,R8 Q 6 2000/ UU0 R  !   h0 S*R\Q}Q00 S*0R S\Q }Q 0<00S 00$Eo/JU @0` V1@`(p 0 S *R \R0)S ) \a V 1L  0 S *R \R )R003 0S00000+Z-)>{^ ]z&@-0@``P?Q $0A  R % S 0^Q [Q \Q 0S Ѝ{Q |Q720V:0S00500 @0` V1@`(P ?0 S*0)S  ) V 1L  ,0 Sf:0S00l4000 S**@?PQ{PR ($  "!,Q 0S 00300\0 0S 00300?P  *P 0 B-  B   B0!  B0Sw* *B?RP {Rp Qm 3000f b 0)Sa  0  $  $  0  (  (   0   000p0<20to kmi0V:0aS0`000<Q >Q x`$P |O &   B 0  B  BZ  B. "Q A% l0 `S0* ,R-  0000< V0 R   0 S*}Q00A R 0}Q 6000S 00!Z-z&^ ]0S G- `M pQpG BpL/@P 6W:| ЍP;PP P $PPxP @*P 0uPP6|    $ ( , 0P4 8 < @ D 0 t000L R:0S005000 S8:   0A0LP0S 00,50000Y`  p0 P>3S! 1Ss Sp S <0RpQ00< 0 g  SV S<0RpQp< 000p000Q S S SS7 S S3 *S >SQP>3S S& "S 00 0\ S:0_0PS, 0E10S*P8H@00CU00C0 RB  \ U B!U  1 EU, X 0C^ဗ!1LX0RU!U!  R0>P P PS 00 00H0@0 @000 0 R00d000`M 80S@ 0Q10CRZ/TUUze$|eZ-Ee,1p@-0@S0<QP: 1,0R04S"`$0V):8p1P8 S50#p(00<^ 00^ 0S8opU 0! R R0 0wP`tx&z&z&0p@-0PSQ@ʡ@80P p<0S P pH0@0@P(00Ppp@tx&z&z&O-P@pMDT0@ #W # 2RS T| z>#R  Ry R R Rg 0pR0R T` 0PfY Rl & R *R` &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Ra R 0R  _ R Q R) TQo_RQ_ B00/o00"P _Q0R TЍ0@P T @00S00 0S000S00u 0S*0S0T S00S 00SP4 000_\0S 0S00M 0S *0T _0S 0R0S \0 o_\P0S00S* T00000_R0X0 S  _0S 0R0S0p>3p1># R{0G0 a>#RO R[ R] R" `R Rj R 0 >c0D2H0‚0@0 00PC0A@?>c pr6 pRHHd\.H A T0(   uP!0a !R@ pH0 0@000}P >cp0 A|0 !RJvH A @ >3  0GbP 0G>#`H0 00@TP01!># R 0 p`>c`1>3"S`F >3b2 ؀ D H0 0@000,P00 \ z&g| O-Pp`0,@Q V >\# (\ \Y \F \Q `P \Y \[ P >\^ \ \J \04\ \ \9 "\\ \I \ 0K \ &\{.\' *\ \08#8S \ {N ^0s 0@0s08#8S{0[00>@4N5>5. P`F`FV00@>N>0> \0C~>!0>#0 R@u @O-4M0\0, 0(0 000@$002   0 X = Q  0 R  R  PZ$P  (    R    ``S  R  Uj k V pw p (B( _U RQ v   _V R up  (B(   _U R w v  _V RQ ppX u0^ v  (B(    _U_V QO  X 0FPyu  p $ V    upv  w( ppu  v X pX qX0wo u`  _VX 3"  Q$,ZS (  `X M 0P#v  _PU PRPU00000S 0R0 4Ѝw_Uw^RwOu2z&O-pP`M80U:Ѝ0!>3S S8 S6>S1 0 800@ 0 YS  D>31># R 0800@ 0 ~Y_  DS S- S* S( @` PS 0 b800@ 0 YY  DSU S S 0>#0FϠ2@P0  =P0  0P P 0,VP 0P   W` 0 PE >#P   0T 0  0Q>SP!>#"RPEP0>#2  F O-P@pMDT0@ #W # 2RS T| z>#R  Ry R R Rg 0pR0R T` 0 PfY Rl & R *R` &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Ra R 0R  _ R Q R) TQo_RQ_ B00/o00"P _Q0R TЍ0@P T @00S00 0S000S00u 0S*0S0T S00S 00SP4 000_\0S 0S00M 0S *0T _0S 0R0S \0 o_\P0S00S* T00000_R0X0 S  _0S 0R0S0p>3p1># R{0G0 a>#RO R[ R] R" `R Rj R 0 >c0D2H0‚0@0 00PC0A@?>c pr6 pRHHd\.H A T0(  vpP!0a !R@ pH0 0@000}P >cp0 A|0 !RJvH A @ >3  0GbP 0G>#`H0 00@TP01!># R 0 p`>c`1>3"S`F >3b2 ؀ D H0 0@000,P00 \ z&g| O-pP,@ W`> ^* +^` ^i ^O ^a pP ^o ^Y  3P A^x ^ ^` ^07^ ^0* ^G "^ ^l ^ R m ^0 &^y$.^03 *^ ^ ("(R0 ^ y  ȠLȠ \0 00 r0     0s08#8Sy0 ("(RY 0>00 E0  ?oR20SpG pGP t0 00> 0 0 0i 000>301> \00 0>000 1>3 SLO-u!z&O-pP`M80U:Ѝ0!>3S S8 S6>S1 0 800@ 0 ~YS  D>31># R 0k800@ 0 bY_  DS S- S* S( @` PS 0 F800@ 0 =Y  DSU S S 0>#0FϠ2@P0  !P0  0P P 0VP 0P   W` 0 PE >#P   0T 0  0Q>SP!>#"RPEP0>#2  F O-u!z&O-pP`M80U:Ѝ0!>3S S8 S6>S1 0 800@ 0 ~YS  D>31># R 0k800@ 0 bY_  DS S- S* S( @` PS 0 F800@ 0 =Y  DSU S S 0>#0FϠ2@P0  !P0  0P P 0VP 0P   W` 0 PE >#P   0T 0  0Q>SP!>#"RPEP0>#2  F O-P@pMDT0@ #W # 2RS T| z>#R  Ry R R Rg 0pR0R T` 0 PfY Rl & R *R` &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Ra R 0R  _ R Q R) TQo_RQ_ B00/o00"P _Q0R TЍ0@P T @00S00 0S000S00u 0S*0S0T S00S 00SP4 000_\0S 0S00M 0S *0T _0S 0R0S \0 o_\P0S00S* T00000_R0X0 S  _0S 0R0S0p>3p1># R{0G0 a>#RO R[ R] R" `R Rj R 0 >c0D2H0‚0@0 00PC0A@?>c pr6 pRHHd\.H A T0(  xiP!0a !R@ pH0 0@000}P >cp0 A|0 !RJvH A @ >3  0GbP 0G>#`H0 00@TP01!># R 0 p`>c`1>3"S`F >3b2 ؀ D H0 0@000,P00 \ z&g| O-lM`-PQ0n @-Qi   e        Q 0#R`S- 0pp WG,[ 4\ 8^| <HZ01S 0s x[BoPR 0C1!S 0C0p [Z 0000 ,@4H80: 0; $ $ 20f: D9 Q0@-M@(,4`0  P#U `0`/"`o R?#0.o^,AU-00ĵЍpFW`&0@-(M B (@{Ѝ0Q0@-M@(,0  P#U` `0`/"`o R?#0.o^,AVU-00ĵЍpFW`&꼉0G-M@0p`W PV P%Y P.X PmZ PNx P4 qW Pf  {q vqV+  oq jqY  cqt ^qX5Z! L Sq< Nq ЍYXZ-  =q 8q  /q *q Ѝ !q qZVY  PЍG}  7 6 6 6 6 6 6 T6 l6 5 6 5 5 5 5 O-PQ0 M0R0p`TT00 0 ̾@P @0S nSc a0CS0PL PF  ЍxPzZ V000U000gPLZ V070U070@VPZ| V000U000EPZ V000U000ZW V080U0800oS 'PU000V000~0@DP 0P PiZL V080U080]P~ P PSZ8 V000U000@U080V0807U000V000.U070V070%U000V000 ЍU080V080U000V000ࡀPZw ZpP XP @5 |4 |4 4 3 3 3 2 2 2 2 2 2 \2 0 0 0 0A-`M 0 P!!0@H@>SHPPP PPP8`"`!P03 pP0   p, 0 p@ p@   p@@@d0 PP 0 P P`Ѝ00@O-1MM @PDP  8 "( p C. `d pX @D;@8 (70Sl pp  ` ᰑ 00㨱$ !`%0 p@ t0!07   P P  0S R001ݍЍ蝄0S 0K0S R  P p 0 8D<4! @ P0 0d0Z  030h,R < 1ݍЍ p/ p/ FtH0/ . . . gt0@-P@M 0  PNp gp@ PY  $ Ѝ00 0P Ѝ0@A-@@0s/ PP0P 0 :p` `z `1 0`0pp& X`p `` 0`0 00P}TupC-@PCM1 /sP3  pPB ` @000t2 @ @P0F0 @F|x0S VS00 SCލpt@@0S@\0\ 0P@0  P@1:?00@꧃00@s* * p@-QMP4@SMZ TE /osPB QP0s+ ~P  QaP 0`a9pO @ 0@0yqpF @ p? ۍЍp,0si/\0p0! +m,@0 P@0 8 P@1:??00@p 0420#S5p@ )00%@"@szrzr %@yq( ( @-rP`O-$(X,p.S`P@+Wu00Sb [0 0 gP: $" 2Q > !4"0x"3S20*rW00Sa [0 0f P : )" 2Q >@AQ!Ou0 {0Qq w{` f P : 4#0"Q . ![0 0fP:t' 00{S' w{Q e 0fP:  4#0"Q .@AQ!O[0 0|f P :[y'@w{ 0lfPy:0 )Z@0S20n2" U%> "Ww{T Of P \:4# IT0S20R2">" R01Q"Oi 0S20XC"""""""""""p@-@M@ ?P, `~0P 0PQS[01S 0S 1=S 0S1,! R 0S[z 8<01S 0S A!,! R04 S:t000Dpx |0`lx0p40|0pt 00 0V\0P0%` 0LQ0 =!01?, S(00c!1$0 %X=A03Q F< @@IP ( 01CAF,  /PT$ 0P  [ `0% [ Po$0SP %0#Ѝ00Z`F* 0C!R Q!,! R4 @Rt000Dp|0x `x0p40|0pt00F ;`0V1000QP0% * {˟ ,!\x ^4 S*P00T;$ 01P `% \ ,\Vt000Dpx |0@x p4 | pt0@0 P0@ $000L;0,^0w <P0r  0=R@m%0@Dh0H(00(0000,00,0> F 38<PKR Q F"x&000 P 0S; F%0S 2  Q\(8s< F`%d  0 Q0*0^*r@s!FP&T8@<0 @0D 0 0h$% 0S 000000(00(0,00,0(00(0$Q0PS (R" :"  R#Ό01"?!x"0$00$0 00 00000S <\ H@NTLX \ h@0Dh 0RLQh$hs` &0Ph 0v> 0`0?d000P0?T0080?<00@0?D00H0?L00/X00\ 0 00#JP0L dS<0 `0d $F%#F#"F$!F$ %/(0S  R $ R$ %R  :6$4&60%E!$0/!!> |5 Ã111N`ş P ?$LUE ?H /$ R  " RL@\P E%/L@< 0H 08#1 _LA%:6$4&60$$$0$΃4HP#111L4 U >.0tT0.ό#! 0 0PL0LHP 00UP00 0T 0#0v #$0S"x$0S"x0$0 Pl3@h0P :($^0<P0 0=RH H %0h00c @D00=v"%:600$$0Ϡ! $>0H!!!0C" RH 0H  Ό l" U`? PŸ 0/  "1? A  L L H0U 0\ 004 $ P1@0P 8:P03 0<R.$0h00c 00uL!%:600$$0Ϡ! ($>0H!!!0C" RH 0H  Ό " U?  0/  "1? A  L L H U0 \0#꬇qt$XЃ""""l'.%Q(\)\²0  0C0  BQ $0 h00$% 0dR@  T \PPQ&P@T8<x  \0 Q00000SPT8< b F ] 0 F!W 0 !Q0S(0Si P1@0P _:c 0u00%:6  00$ 0Ϡ! "$>0!!!0C 0 \ H @"UL? ,d 0/  "1? A  L L 0UH  R0# F# #$02p rp t t   0 RN  0 & F%F000 P 0S %F000 P 0S!F% &( $@R00<\=QHPNUL0X\m@ D@h0 000$00$0 P#R R  \Q% 8&<q0dP(00 00@ % :60 0!$Ϡ0! !>H%0!!!0C h% Pp5!" ?.Q!QT$ @00 #0BL00 h00%H100 B00 00SD ^0  $0h0 C0000S3 ^ 0@D h0 B(\0 $0h0 ps; 0B &R" 5 O-Mp@$;z04l07z0W`0 T& 0 2c1  嘀?0<UPP/ 0v> 0`0?d000P0?T0 04 80?<0 00$$%"P˟$@ 0000  000T ;0h0PL 0TP dP= P> $`Pj0Sg Rdʰ R `ʸ R \ 0 0` 0`@Sd ?O$@T+ET0}N0`@d0y0@pD 000000 0G0v^D\Pp \ PE pϠ \PH0P0l0X00 I0h0 pptx|PWxSR0S S00h+@|0Ux0Yt0Zp0Wl0 Rh0 R{t ZZ8P0>C 0C0p00@t0` VPw x0S Hy0ptp000@48 h000jP ' 8 PXv> 00!0#/!! !.w/ B 0Sǟ, ǟ|?'P PȎ00#1?\v.C BAQS| \xt Ptx 0 qpp I 0qp ` V@P 0 ?oR20Sx0 0ߍ 0x0h0qp@ 0V Q" 10!R@-NS* h0 P0,Pb000 `0  ZR 0`S 00@ x0h@ Qvx0S0 !0V0ZS 0#dh `70hP0? T0.0h80? <0%0h@0? D00hH0? L0X$`\TZP M`+xT00(x0S@T0ßs"bW2):##c2S#x0S, \TP)g<6PP  hß嘀dT0CL30@>w0h00p `0@4P8P ? /' Rß&0Q 0Y/0 #10">/ 0C!a 0C0 0"#0R"P#. W#0,npW10' #ΌQà3\!=30S C! B^ D 0  Euqp> @ (p=Ow#00~w0S @㼠0h0#@ow00@ ߍ輠Z) ZZʒ 0 [w Q 0  s!P MwT00Jw0S10'` #ΌQ0"c01 2c1@Tÿc.wT00DTl)\P(\ ףvɻ %I$@-@ LpTat X00 R 0 R 0Q/  /  HT D  DQ 0@-0P S@@H  ^0 S  Q 0#0S0 0/,H H  Q j.0 0#  Q/xG00Ɠ\ 0@-pPo> 0@" \ 0 / GA-@P `p@P0% P @PPA-\@`@P pjNP0& P @PP FA-\@`@DP pH@P0& P @PPEO-P M pP9 谟P n`P P @ % hP @P0S  Ѝz T W o  [0p0S$E\ A-pPQ `@Q 1P 0@DDB(000S  ?p@- M`pPPp) u 0 0@0S u0"S" 0p000S0 7/ Ѝu0"S1Ds\0pT000S @ Ѝ1Ds$ L? 4> @-@d b@_O-PMU@p  PP2SPR FPV  P` A T @ P) 0nS: P= eP0 p0Q Q P P 0 IB"Sq0 000P Ѝt0 00 S Ѝ0oSP    <mO-BMM@pt,0  0^UP:dPP  RUPm00npP PC @@`K*0 PP2p [0P0 0 PP$p H@P! 4 0dSPkPU0 Pp` py  0oP @PP0 PpO ৩P bPd bpt 00BލЍP/U ` P _p=Zt0SM  _P ^0H0PP0 p<  ^:t00  0^P`! 0 0 0&t080  0^3t !0 &6!a00,t00  0^Ps00  0 P^us0\0  0^Pj ldQ PQ zd@ jl   T L  0@-@PM 0 A 1PЍ00@-@>PM 0 A PЍ00@-@?PM 0 A PЍ00-,M 0 LPЍ --^0$ S   0/ 00dBXBp@-P^U@pes? $0$`0 6/pBl p@-P]U@pMs? $0$`0 6/pA@ @-( @P 0003/TA4 @- @P 0003/A p@-P?oU20S@p00 03/@ p@-P`UV00P00S@p  P05/P@X p@-P?oU20S@p00 03/?$ p@-P`k @Ppr$0$ @0p@/? p@-P@P p 0 0 03/pT? -@- M  xp@(0(003/ Ѝ@ Ѝ/> @-xp@0003/>@ O-`,M$ ХP @&g$0Sp,ЍlrХH0$00<00 P@ O-`,M$ ХP @X$0Sp,Ѝ $0( 0C\ 0 CR$ *#0$00S3 5$07$050$0(0,0!PpO-@Y PDM@p, fo@ [a P @O [ [8$0P$ 0@Y Q< `@@ QQ3 Q0 S0A1@ 8 ,0R h S,3 5407,050,00 00 Q, P0Ç0,  0, 0 Qa@Q8,0P p S>3 57,05  50Q,0g 0 CQ * 0CQ,*# 0 ,0 0,0S3 57,05 50S 5,07,05 50S,0YR#00C RL00C F5$0qS<3 57,058`0,0= A/of[" R  :AoF[P  f[ AA0@ \Qmp,0 S#3 57,05 50,0 QS 57,05 50S,0 R#00C R00CP,@DЍQj p`0t FQ)Q* AR bQY fQ ?R0@SP p b7rp@S B:p: C cs3<2080 S ,0 S,3 5407,05 50,0FQ0 00,S Q 507,50 , 0 5SQ= 305 7,5 0 ,Mb@0f`N2$0?Qa R^  2! a, A0! @ `3 8 Q,Q<3 57,5 5,8Q,  P,  , Q0@ `0 _P$ P! QP3 ``` VRQI[  R `S` 0P0`\ P\=Q,0 S 57,05 50,000 R,0 Q ,0 0,0 R0`S<3 57,05 50,00804Q,3 547,5 5,y ?R0@S@`0%#jo%#jxZ%ju00@-MB0@Ѝ0p@-`PM0@ 0 4/ЍpG-PRM\  `UpP*/a@^P D1000< pp Ѝ80S  1 000< ppn0S Ѝ贠 n0S 0 < @x0000< @ ppn0Sn00n00< h9   @-$$@M ЍtO-EM MaX@P+p `E%Y [0P@)T 0 [0P@T 0 R0EAP X XUEލ ЍKn00Eލ ЍDn00 L @-@` pMPTiP* /J[ 0R rR  P   P @0CЍP  rR 0rST 0 @0 Ѝ@wm 0 l A-`@ p 0P/S /[P @0 Sp 0 S S lp@-IMM@`PP  p 0: S X0 0tp IލЍpmO00@IލЍpm00 p@-IMM@`PP p 0: S X0 0Ip IލЍpmO00@IލЍpzm004 0@-@PM 0 A PЍ0P 80Q 0 08080//p@-@P PP`  1PP u ^P  p@*/PPp--00 M (0  ЍЍ/܆DP --M  Ѝ Ѝ// -@-MO<@P@ 00  0Ѝ@Ѝ/XD0-@- M@OP  Ѝ@Ѝ/O-q`Pp,M;  PR $ Ppp @P$h0 PY P@ 0 @YP N ,Ѝ000:Q!0P00,ЍT0p@-@P(M & (Ѝp0 00 hDp@-`@PNpp p@p@-P000 0 (M` l& (Ѝp Dp@-@@ @  `  @P~Npp p@k꼃Dp@-(M@PpNp B& 8 [(Ѝp@-@PP P  ,M` @VNp (& A,ЍDC-PP,M/  @` p`FV`R V @`0 @T "N ,Ѝ00 0:2 0,Ѝ踂T0p@-@P(M % (Ѝp0 00 ꐁDp@-`@PMpp p@p@-P000 0 (M` % (Ѝp4Dp@-@@ @  `  @PMpp p@wDp@-(M@PMp % 8 g(Ѝp@-@PP P  ,M` @Mp r% M,ЍDD P $ Q80 @-8M80@08 Ѝ880/LL0000 0<Q 80880Ѝ/lP/0@-@0@0 M0S 0000 X0 x0PP 4 d00B/P00 Ѝ0@MP,<,((D\ L O-3M0PP 0 @0 `0Dp@ P P00U pp0 0C% Z 2ATT00  RF LD@D T]:[ 2 0000~`K L0 V0 W8 \2ATT 0`Fs 0Ry L 0 J 0 BD0SH L0Ѝ0 V  0 / L ` 0 $0pHX;0S2 0 Lv 0 B @ 0 B  B{L`FtY  0 B  BkL 0 z `L 0 0S 0 B00Ѝ 0 ]4~ 00 zDp@-@P1Lppp@ 0RS00 /p@-@<0<00P  @Lppp@ zD808 00 Q0R00 /yDp@-@`PKpT T   p@pp@-@P\ \  ` @KpTT  p@pyDO-!PP Mn 10, 0D`S1H0?a0P^1!p !q1 W0C@(t  ,0@@KDAA|` Bp2  W R ? P QQ Wt ,0 000IC11{00Q0 0, Ѝ000=x0 00wvD@-@0@ 000 @T .AP80@080v@-@P AP80@0800-M  Ѝ0-M  ЍO-ϟiM PȡЁqal QP@ P? `K͌U PD? K͌T P? F͌(Z P> F͌(1S Pl> C͌ X sP$> JB͌8W aP= ̌V OP= ^B͌`d=@ 0S078H H0P `P P  P P Pt P T P0 Pp( qP P`P (aP Px PP'( tQ780D0x100C40S000C,0h0Hp0L`P$$0PQ ,0 p0`@ , V @  f`W/0!1AQ 0 0 @T @vT, V   @@dqXhP 0Z  Piߍ P 1 S  ,00 0! 1S 0D 0| 0?p00AP,,0`L0!!\V, @  B  (8<`@ [$ 00A00@S9 00a1 P Ua PU, [000 P,0匠0Zp(0p1P0@`@P㏼P`  V 0@0@S P8<`@P$04 0R$0'HpL`P1L0Ϳ0P@@X1(@P0ſ0P0$001T0徿0PPP1 PX0嶿0P0000寿0P0, 0pBPBHPP@ 0T8`<@OH U,` p@PW 0g1pV@10P00 00Z00 mZ,0W0 P ܰa[@@PP  Z @pV @@ PT 0P@ UT0@0p8`<T4 ! , <B B P $@0p8`0[T0, q 0q00` p @@HP\V 0f1`W10 @ 0 0 P00U00 PU,0 V0 @ PqY0P@ 㐻PP  U `W @@HP\@4P,00 0 ,0H0 V 1封0D|Ad>p`FR ( `d( d( d ( d(  d(( Jd5( dB( ^dO,0$ 1@*,  BU00p@8`< ?,   , 0 H T0封.1D|Q >p@T[1 0p8`< T P 10 0R_ (0Sk ,0P0 PXC h!(0SY L0!11 @ T p @ T,00 0 @,0 PCT0p8`<,04 10 ,0 H0T0 就!D|=p@!(0R1P@PB㓺0P@ T  0PuT0P0,0ST,0 00C, P P0 X" 0 0 B00 S: 0T 0 q!1 @Tq` @奼T,000 @,0,0Q@ 0@1>PpP`7 Pp- W  `P P$0SC ,04 1@X h!$0S5 P0!11 ` V  `YV,0 0@ 0 `Tq$0W1`V W  0 0P`0p08`< 0,0 SV,0 00C @,p0 [# 0 0 B0!0@SA 0X 0a!D 1 P U a PU,000 P,0|!0RP0P1`@㜹0P` V  0 @ 30 0R80000S y 0p8`<^p!* p!:! f0p Q R 81 R 0SЍQ @0 0 0REl0T0ЍLO`<0l 0̃ S/O-D@p`ጤM[ +v(p( $W*0CS0S< 3,(1P 40/ $ % 0:ԓxs̃H pß8|.l``(XrPhÃPH弁@x840,( @2101: R 0S 18p10S pWЍQ h2 0 0lDPr'>ppGl`( '](@ T (0Ѝ>㠶rp<㛶^㘶v㕶8#㒶:㏶0'㌶#㉶0z# 0儶H#ぶp-~-{`_x|uorporlyizf{c@|`h}]`aM` l !+!,%!-!.%#0#%of&i`"%{j%k %l%m<%nq%t$%u4%v,%w%x~#p#rd"ye"z|<d00p@-0['N( \(0S(@pO-8g887M`  `P `0ǟJҭp 7 000 S00U0S}Yp  @00  4` S 0 `0 40 s 00bR$ 4S4 0((&00 Ѝ$0 s 00bRS4 0㋰ ?<21 R R3 $ ` r  aR$ $ Q ph0  T5 U0pS p ! @00 4 ` $R{  40 0 ;0P $Q B q/ 0 ;0 Ap4 S S040ST 004 0r0  cR$GU  p p P p0np P 440 s 00bR4 44300fS t30l3#`e pS 83003#`V p 30 B  `40q0cR 4S02$00$0C?o r  aR$2#\ p SW p  0 s 00bR40 ; 0⠴p P `R pa 40 s 00bR4 4$R40 s 00bR40  ;0 ~p E  `Q q 4 00 0q0cR  0 ` Ѝ 100 ?c p; 000 ?c pv/` 0 `00! 0K 4 00 40 s 00bR 44 `(HATQl(4 p@-P@,0 0 PQZ TT Tp4O-T4P@P0DM 8 `$Qq  :Q#R3Z 300S 80JP0@P@P@x@-@ZUP `TUP SP10S. ,P: 0@S0S0[S0mS S@ 0S 1 CR'0@S ;S 00C S00 0@S0@S mS 0C;S P   0@S;Co  O-0`fS`PpMHvpJP T0 pr(ʍ"(0 I"Rp (0$00 03SJ<PK yT@<P p 0XSڄ%$ xT 0l50 d5"004S03P00S5 p0S2 4S, 4S 0d%V、匑Tp"2 2Pm 4p2Z& LQU# P P ~P @=oH5S4S 4S0?o2 *04Ytx2 PtX  VTP3Zx2  MTPx2?;~0x2V  CTPx278x23X|2 PV t3|2gЍ0 D p$l h $ <%$(LXi TP Y TP Z# TPp2?;~0p2|20P?0 r("(0#H"Rpp2Z0 e :3,p 4 IP`$Ѝ0`00|P @ M 0R` 00 `L00T @8 300 Lx$ l0pC- M P  S L`<0`00:3S V  Ѝp  0 000:3S/CTX0X 00:3S 03@-p @P`/$@-@0@ 00 03, p P`@-<0< 00034p @P`d0@-PPP M* 0Q0@00xP 00 02000*C= Ѝ0|P H00 020000*= Ѝ0l/0@- 0 @P0:R M# P P&tP 000 20= Ѝ0`P D000,PP Ѝ0,l0 000:4!-Q0 S0 0 Qp@-@Pp80pPU,LQ (0 P0C0S0 U@Tpd#80pP 0S,01///A-PPM Q@`Q00?`FV`V` ,p(L 0@VЍA-PPM Q@`Q00?`FV`V` ,p(L 0@oVЍP/\ 0,  B0/\//A-`MVP@,p(L 0@CTЍA-`MVP@,p(L 0@)TЍ@-PP M+ Q@7`pV00Ӣ?0`FV`V` W ,1( @Q Q( Q Q V Ѝ,@ 0(@T0 p@-PU,NQ Q@(`@0@@`` \0C 0 S0Up(,  0 R S0/0@-P0PU,LQ (@0 P0C0S0 U^00@-P0\0P#, 0 BP 0 PU0,LQ (@0 P0C0S0 U0\0O-#4R lMVCT_ ,PA^@8 =$^8R@ 0000@0pP 0-,Pp4S-`@PP3@ 0 00p) ,4, [ 0  C 0 R lЍB0  (9lЍOT0O-:$M$pdZ0  r$ CPUw P0p 0 p Ƣ Vp(:0PSH8 0  ,@P$Ѝ0SI S5 SpV  `Hp0004S$ЍOAp @0S S SpU 0 Hp`Fp@0SF0Vᨀ *HVp P @FXp  $Hp`FVᦀ* P@Xp P @0S SVp @Vᦀ:Xp PQO-PM 4 3`S,[*Y= @00! 0@ @00@ BTP/ { @p ` fPPE @0S 0  Ⴁ`PЍ` D  P 4A " 2Ѝ @0 < P0  0 /(404 000S :P /<0<0 0 0S :P /\404 000S :P /<0<0 0 0S :P /404 000S :P /-DD 0\ ʌP 0 ~8@-|0| 00@T 0J#4R B0pQ 7@.P t @808 000S :P [/TD0D 000SP:P4@// 000 000S :P /L0L 000S :P @-p @k/xA-0 00pW* Z3$SP! #R`@4Sp`3@Tv AyB0tQ 7A4.-0    p0000 000S :P Z/O-00 0 MX% p `P 0 <p @-P  0 P0p@ 0 5@ n Ѝ@P  P /p@-JP }3S P`4`O30PVI  0s3 S 0P 2 $R 0X0S 0D3 20X #$04p03ppHp@-jP 93S @P4P 30@Sp@A-`Pf JSU?sW<  @P3$S3 SW*0N, SsH0S0 WP3PSSpP4Szpp3PUp,0\4000?a000401C0010L10|1spp@-@P PX0:"C0T0XppG- ؀\/P@p  `፟P LTL VW PT VW  P000S;0 x0 0 `|O-($Z Ap`P5P@8P ( DT29P* T /P 0 D @00 D0WXT P  RX8 @(  !E@0p|d @-?C0 @   @ (( D  ,TA- Q@PP% pW# 0 0S0ȝ,Ɲ000 R   R   R  P D屝ᯝ4嫝`T `TX *P Q Sp  QW02p@-`P X0@:R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S [P00SpX@ '(@ 8Q0@0ppp@-Xa@P`Q X0P:20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  \00S P000080S@078@0p ap`H0H 000S P@ ?# Q@ 080//D(0( 00Q0/D(0( 00Q0t/`Dp@-P0P0 0@R` U,  pW$  0$ 0 00 0(p PEU` 0 兘P@@p  p> Ѝ-,0 (0 M0 ЍD- M0 ЍC-@P M(p, P00S 2`0 GR 0 O@0L"Lb ``8 Ø 0( 0Q 0P00D 0G?o P20Sp0q1QH``00CQ000 Ѝ0`00SZ00&0   0T S00% , W10X0PXpo T0pGR Wڠ`P`W 0  pP Ѝ80  080 000 S0CpCVrp@-`@PS!pp 0p@- M Ѝp@-@T T  M` @P2!p 0 ЍpDl l0 00S X  8Q Q @ ,@ /&R//,DH H0 00S 4  !R@ ,@ //D`0P0 T 0008!R !R @0<@0/6S//P<0P0 0 0001S@0<@0//l0l 000S X *" (Q Q @ ,@ /&R//D$0$ 000S @ /DP X0:20(!R !R @0<@0/6S//0P @ /A-p@Pp" 80  P` Pd  ] D000T $000S0hH0H 0 ?o20QQP T//D000 00 0RPT00/`DA-`@P`$ 80 ! QP}p~ P eS  800PU  000S00 00dD?o20SRPT //0PPT00/,0, 0000P/P/,0, 0000P/P/O-h3@P0Y Q T# PU D#00SPH00SPQpP0GP0HS``HpHW, 0 ^  1  !!^<pGPI@Yep0S a[0q SV,0 0D |000 P0pP`a`0IS`IX`a,1 \  0  !!<pW`YHp0Sa>0 S;,0 0D | 0 00P0qpI PX 00C '0HSP 1TX[00CS``[TY0IS`YPY0 0CPYh|0 00Dp@-@PpP`0P0C(, ,1C B00R00@UpP 0S 0@//P 0S 0@//P/P/P/P /P/P/(!O-PP , 10, 0DS 1H`?c``  AAp0@!qW#갑@W0 8 0| 0p@ P@ 0@0 0CX*0 00XD\000S  Q R P (!00//Xo o( \/Q,0,  R/1S \/\/1S \@/O-A1@ 0QM5 P`p, @p 0S# Ï#SÏH000C  ```P 00(00(00S0000C00T0 03/p 0PS@  Ѝdn@(n0`m(0A-S$'p`P4@(0PS@Q Qa ppQ p 0P(0@Spp(0S/p@-`@0P (0@SpP0@-0^ @ 0 Q@R00lO-`@ MP VT``D0S  00C(00@00 T0@ 0 S `&, 0 S@p @ RᴀD`Dpw `| p Ѝ@0 S RR Ѝ,P d,0ݑ0P 00X p  ``F , B,(`aaA0  T p0D`4ᲑP  Fp`,004@ 0T` p0Dt@U   PB  0SQ 0 0PC 0$ 0\R <@U 0 BQ 0C R G-l@P 0Sp: P PR E PPQPEPUP ` `R F `0`S W0` XP0`F`V` pW 1 $p00SC 807`PL! R@! P( 4! R# $! R  R 000S1Q0/P00` 0S0  0V(W ѳ`F`V`XP0U0P`W`V``0 @p 0 $p0PEPUP dD0PQ8 0 /$ $\/ P/иPQA-a@`؜1Pp0$ TY 10 0 QT$ D 0R U ESpL @10 0 QT$ D 0R U EAp: w0 0D  Q SC$ 0R U E+p$ 0$@ P0*@0B0TP @T 80@Tp` 0Q|D0PQp@-P0P`0*Â$ @P uT00PU pp 0Q꘶P- 0S* 0@- \&@T!\8x ƌ8 t @,0A0@PU 0P0U00 S0/0?o2?=XA-$@0S00â?P4 0\/@0 T`A pB 0S%0^! 0S0X K"@0 0 0 9@U/P 80Q@0@08080//A-P  0 BS0@( p`0,,0A0C1!0 0m0`S@( 8XE?*00@-B  80 P R00 8 $ P R  R0 00S00!R0$R0 R d1S0800800080$RQO- M4|ڌ`ᨍ@Pu 0㈰(᠍Pp,q ᵎPP0` Y4& 80!S0` ``pX08 0 T``0a$ <@0H0|0L P08 4!\08 `0d0h0l0p0 ЍP4- bP' 0*Q- Q80 SpG V P  PʪP Ѝ ቏ᇏᅏ჏@ Ѝ{ A-0QM@PP(C p`QAR   B P1 \.X) P$,P@PP H0 DH00R00D p0$`P!b@0SЍPЍ4@-M @ 0Ѝ@-M @ 0Ѝ- M ЍO-M@ā` HP`JU@p_WNVPED  0  PI xL1D00S*Y p$`(D0p0S0`@0,0U00 D0U@pC@`C0Y Ѝ00H00H0t  P PEP` V IIP ЍP @\|$00@-0@P0M t  l 0 B/o 0"00  lPP :Ѝ0PЍ0|D@-44@M00 MЍثQP-D00M  ( @05Ѝ䈫P8 /00@-MN 0N00 P@ 0 0E DЍ0QPO-4ŸDM PPhlpt@x` RK SL0[ B\ 0CQ@A PDPU A@A\UQA PNPU[[H p @D11A0100!0lp,00@0@0-*@0l @ V 0 000@ [@:  P Q [@* p0pW  DЍ 0Q0 AAO-DM(0X0lP,004 S80 S 0( S@@S@00CS@@h T4 L,  p04@^00^0\00S@80<80808080PX8EXC8U\PEA8pp00 8 P(@T ^F00AQ< ,0 (0h&h08C8S1 ,, P (@^ @@P8Ph4P XEXJ^ Nh4P.P XEXJDN^( n@@D ^, 1 00UC@0<0ppp8`! 0!1` A S `1 0C8#820C8#8S弱 80tD 0S 1P 0xX0EX UJGx08`, 0(0\,0!0 8C8  S^LPIL00B  @HDHT,0Q0 (00S+L00S? ( R, LP S800,0 1/$00Q$0 0\ 0(0AQ 0 , S(0 0 00,1$00 04 S 80p0L|@0H00D00hp 0SL01H@804 0,0000\,04 0Y0Y 00S0`S0F0Q804 0,00 1 1 01IY0Cڸ@LHPQP YqH @ R T0 00P P 00 SPS P*0 R00S 00P ɟ`V0 0CSp SqUp7 0 AS0 S P0P ` P R  0R  `:,00SM@ Q0C0E 0 S00( 0S(00000 0 S(00 R0 000:3s P  RP   L000Sl9, 0@000h0S(00S8000S3 80 :8, 0`V 00Pm0 0CS<0 HD](D<0NN Œ Č Ȍ N LL\mɟ`VWY8 T0T T@00D R 0 R PP! YR  uY $Rj  0E0 p0b   0E  @000$R , 7@  b@000!R 9x; 8000Vy00C000C0)d6, 00SA0X *1h"0 @, T60H 0  8 0P4, e `p$t00S000 @0p 1P11qWl5l%ll0 +@00 00S  05# X0:h280V @ 50S 0S4, 0pQ0A0 0C0 ꔄ 10%0 SPP 1 11RY@ڒ RRQu 0    m,Q Q !PB#`F p0p`P@ !?3 pGWaFP `/p @ 0  L H P 0P0P00 XX0@P0P0S^O L00S6(080 | 800  L,820 p`dЍ80GL008 0080@080* R d1SdЍ( 0 0< x \X1, `p0, Q0A0Պ8! ,\PY @@YP 5P0@, QeJ   8@,@ APX@T `P `pꀔ?>0 |7 V r86H5|-,p,8+*lPT` P @ p0 `, APYD PDI  P! Y   @@T`Q00 BCP`P P8p0 CQN @0p  0@4$<0S P 0,0[1,01`w @@[`o P  XPn0$00S00 $X00@ p4<PLPA\L0(0 0R( , p0 `, Jz @Z0,  \F `0z8 0)00@ 0Cz(@ 0 0800  x 0XPx    0Q0000 CP4`0X0H080 0DP# @P 80@0PL Z J D| p~Pc d1S` , 4@  TP:X X@ P T@DT H　HH E@F0 0: 80R0,`0C 0B0X00@P `0 40 0E00 PU U R0 R  X R RR)0SC 0 R  9, @` 0  `l@0 0p0 `_00P g 0@` 00 B0[ P0 PB00 p 0 P6+ 40U( R X R$R`V] 0` 0 0 |:, @p@0 0`qUH%RPP p RM $R $R X  ôQ R9 L5S<  (;, @` J0  `@0 0p=0 `00P  -0@` 00 B0 !P0v  Q0@00` 0  @000P  T P$ , x<@ 000 @000P" , <0 0 0 C R! U p=, @@0 0p1S U `=, @`@0 0PL5S 0 0RU p=, @@0 0Lp0 0 0 7@000@, ,>@ 0`C000` !@000tW ' u 0 U@`= 0 0LeP4Pj @00 pVU zʕH%Rn0 @@TI 0$ppP@<@U; <PP$p`@0 0H`)UpH50S0X0S* 0 0 0 0, @p@0 0H` U~0 0 0 @000jP$pPdYl!p@-P@PPM0 0`0 R    80x t00 0 000P 0 Ѝp80 D000 0 B/ 0C?0Ѝps0 00rDC-鬐M@P 048! \` d0hlp`PpPe80  D000 0 B0C 0/? 0ЍЍxr@-@P @T(!G-PP 7 1D00SHp0?sppS/, ` !a@aT:#80|0`p @V0 S00? Q R!R0 S  q0 00dpD 0R" 0R0 0#0  -QR ^ Q QR 0P //op@-PP0 @ @T $U0` VP `6Vp`|0P 0@PUpT` @T @pp  ! !@-@P@T R/A-p0,SP` @T @~T0`SP R0Q/ C0A "" Q/p@-`Q'P@0N "" ^ "" T \ 0L "" Q\PV@pp@-@@@0S DP$00C$0K$O-:z0M*p$P( ,pP \*00\c S@@s  nRXan HR @@j`40IS0c0@T ^OoB@TP AA  RT0)\ 0  |  bR\ \)` R&L) R! CP'$I@, 4R S[80S 0P0$ 0B$0X @C, 4R CPg S ^\ l( 00Q L80, 0@4(0RK0$$H 0@0( $P)0S700S00l0S$ 0 S! , 40R$0l P, 0S ]0P0$@P$T70 R(,Ѝ 470( V$(00 SBGg@`9 & (00 S4$&P0C (00xP0S  !P$00C$0(@p&  d60,@(@0 R 50,60, 40RofF`@ 0 0, $P,04 CS (@Rf 0 KRbڰ5%0  p p @p% 0(`Z 6q`nR `F(%` V ,00P0S 0P0$ 0B$0X@@aV  @ Q[Q $ 0(@0C,00 K[Z pH40,0@$!,1010zd4`000 P ^$ $@$#@ P(@h0 Rv ,,Zq  P+ x# E l# (@$@ ?#R W( , #\ $6 (@  P 00(@$ R  P $@@ lP " 20,  , l40 S \ ( H20$ ,B@0S 0P0$ 0B$0 $ 00P0 ! 뼱 00(`V7ڨA@ 10(`0 V0|!0`Fx P(`0S  0P0$ 0B$0@,0%A@0S 0P0$ 0B$0 @,0X$l#<#h"X"H!!!!@1(`0 R*T$ !P0 0 @T 0 R 0 P$ 0 0 00 lP @T00,P 00( p0  04@SSCPE@D4@P,L 00SL004P 'tƒ A\ B\ ^tƒ    //T,  1P0= 00` P7ʀ :l“3\0 /@ P0000CS000000000000000000/XS@-@P@M&\\ Y #3t P P 00 %000 0pЍ4Rl`P -P\P Y͌# /lQ@-00  |00S d d0 8=0!D00 R PL,t@-$!$1 00ʃlœ\   R  ,Ǡ 0:'.t00 R@\ A\   P0 0@0 0}00 P  0G8#8 S R0 0?P4/ZXЍ0G\  8#8 S R@0p0ipP4/pW ;<Q# @-@ RM !R "R pPĜ\  00@`Ѝ/0Q # @-  MS S PpP$R ,@6Ѝ/|8@-0@,M @Ѝ@-@044M0 @ ЍT`70@- RP\\0N ^\1   %@@ _ ,\'\ { X"LB!!N0 ("!! L}0 0% !  <{  \@@ RA 0BP8dP P @@  T0 B! { c\ "0  '  0  o %X  +p {o\\:\   7QO-$M n/ 0 w0`f S` 0S0\S 0 Sa0 0004h4p@-P0P`@0MS SP!  00 0Pl 0 Q00Q H  8 x0 Ѝp0.p<A-@0MS0D0@!0@P0S?  0 "!~r!!`"bNL LL 0 0210B qP `0 pW$P@WP 0fSPЍЍ 0Ѝ-NgA-@0MS0D0@!0@p0SE ) 0 "!^RRN  L !0 120B QP `0 pW$P@TP 0nSpPЍ"0ЍЍ8,kL>G-`0MS00! 0@0S[  0 4"`1` I $L0!b!bI4ቐ გ1c1cL0 0Ã#3cl 10B qP P)0< X" pW $@r0sSP @WXV @T oPvPPЍЍ*-?L*S0 O-TM_lKkPPPQ ,$  ^0 : 0 @P= 5e000` 0: @P 0S  R 0Z I #Z =Z =ZP  00pP0 p WZp  0 0X*Sjl0P0 0S0, 0  MZP  /oY P /m0q,0@  0N! l3$ 112cAP3112c B L0L(s0'pr!qpC 0>P q 0 p@B `@, Hp@W 0S  n = 0PP  n @WP00TЍ   0  "$p΀‚ €䡟‚ N G !1 qrpB PqJ  @:pZ  0 `1$  0K $$N04!b1c $!b1c 0N Kϊ 00  0ɉ)1i1c1⃐BP㉑ 0tS0cS0Spp@ < pPVY Il00vNgݐkL>-?L*Sq A-P`p0\ %\0@pS sS lS P0\UUW &000@1CP0PCV` 1E!00O-̟qM PQ P` 00S040 p$  l@H Z 1  RS GZ P P 4 Z %Z%Z400 R,:@jP 400@,%,d+P p` L˟,@ 0:ZAZ JQ 0JPPp0-00 >Z A0J =R* =S00C?QRp  Wp1PW -.R0 XZD cJQ  Rp PA0JlRpY PA0Ja0J Rr11OSu@00qߍI@[/hP 00040hP, 000#pRp  Pp1l X   QU PEQQQ W! 3400`P, U*R 0 p 40P040 P PPp1  \1SF 0C111SC Z0! J 2 ( R'Z OP0S'Sl 0S'S'SPPAT 0DS11a h7@D!&J0AqVZ ຠ `OT` a 1l!01ATf @DAAAa0J RA0JS3J Aؕ 0000 0 B10 OQ4 }RRT0  R}R}RP!RV 1h BY!r  P`!`1,` Q*P  0;p^ 40040i10J Rd1lp1OS!!0l1PUAT @D`1AP OT0a11@A?0Sl00l0 0St00t030S&   ?R ;R P0S %S0 01S3 0C11AT0 400 Q,,*P  4 @ , 40,0PPp1AA0JS30J1OS!l!011@00@`hPu 400`,Vp p2h Pi 400p, 000S   ?R ;RH eRQ` P0S %S0 0AT @D1A !OT= `V }```&``VP``P``ü`@oobP``V ``@Q ANQ AAT @D1!ZAo!᪢Vp p2JhP 400p,PY.00!J)o0 0媢"0`0001&J0GZ @pn0`0 0000,0 0|@V``pS@`V`pN@`fpJ@opF`@pBoo@bp=d"'8   V8@-- M0 0 ЍЍ/--M0 0Ѝ Ѝ/-- M0 0 ЍЍ/00/PA-PQp@M 0S XA TgP `V 0v0) V T~ 00 %PP0T0h 00ЍT & 0 0 R T tTpnRP0S T`8 ^ ʖp 0S R 8(C8B((0 000ST00P i 8 C8(0P i 8 C80T!T@4p q q Dq q ht@tq p o o

fU' L00L0 Ѝ @EP Ѝ@P ` 0S0080W <08 H0@ HL00L008 z400H0@ 40 0, H0@04 H00$ H04 0H0L00L0 @H0R ,0 0 H00H040, R0 0 H00H0N 8^ ^ O-0@M0`[  Z p p(080H0s`P; P  ` 0 0 0 ἀ [0   0 p Z0 0   0 0 0 @ 0@Ѝ0@-1!000 @S0 0S0:PA_oRQ@ \T  0S0Q@000@T0\SET00 0S00S00lA-`p PPU@M"R& OaP !0P ᴀ7 00V0  p,    0 0 0ЍPЍ_ p   O-`0@ 4M 0 #P papZ6 P P`0P  0apP|@P P@@`Pa 4Ѝ a a0, Y 0(0$0,0& PP@,p , PAR   0S00UPu Y  T㼂 P" a L@PX@ H D L F ,p P$fU6  0 P- X;  lBHDXDnUDH sU  ]"0 S  Q ,@F   P-a 4Ѝ : B P$a$aa@RV U A-Pp ``V@M(R,  `P$ A0` ඀ 000P00 0 0 0 0ЍPЍ^@-0P pW@` MR _P 0 `0  00P 00 0 ЍP ЍS^0O-LM<  <T*, , 0@P |P0`|0zPP  p00CYP]V <PD89P\P>_PP @ @P  W 0V 0,P ) p 0100#$0490400 0Iye 0s 0P^ ,P  0S $ .S  ROSF = P# @P[ shFhv 0n  P DaD0 0SP P) 0 % 0S v0 & 000  00 n0TP_WPLЍ0TS 0  0 000S (0(W8 (^8 0S! @0@S' Hx00 0 0f0 Pm[J (p`@V 0 Vp 0P: '\VQ,W%U^VP< P@U P0%0HS y  0iP (p20 FQ4E F/R)  p`V@ V,h%`  @ ` @ ,%,  / P P``P p`(\8 e@T@@B`  <4X Y10 0IP%P0 80g80P p `P P P P P P P 0 80A80P P?U P#v 0 S00Pp@` 0AP, 0  80W80V0@A T@@p`I 0 0 0000000s0P (p[@ Hx` hFhv8 @0n FPF 0S00 AP<8qPRVp 0P8p 00 (p$_P00kP hFhv0 0@s 0 P0PM 0  0 B /^LЍ 0 z t00|0 i%d < c p %fN M TM L K J K hJ PJ I P/^$P00//0@-MP0 0^S!1l!1"b2cNL 0@@0$@B!A@C0PЍ0赁Ng P0`0K?//(p@-MPi0 0nPcl b N00PEK 28@0$AB@C1dPЍpkL>$0P00?//<p@-M`-0 P0ec`E $`L0b!b4!b E|@R1c1c@L?MD@D 0P0@$$C!d!b8A@C1{PЍp-?L *S`p@-0P0M`2R@P 0Ѝps^, 0 0S Q20ЍpHG- 1 !0 qP P@3 04 S0`0`2,0PP00|Q``  VPeȄ`EQ  V|0`0ȇ`H00x@-@P \\\ \$\,\\,00!R  !X 001/ 001P// @- M`p P0P0@0Ps ᠈P 0ᱫP Ѝ 0@P ЍpC-@P,MA!LnL`HDp@\ X" >>"d!00,ЍP] P =0 00X0BP P> ~P - 0X 0 0"P 0cP0T=0 00ẴX  P 0cP0=0X 0 04"P<<"Pz 0cP0jʨ<0X 0 0X"pPo 0cP0[d 0X"  ^PQ cPs   `=峳X`pV";" 0Px>P; e0cP0ʤ 0X"  V0cP0p;0X 0"(;"P D0cP0,;0X 0":" P 20cP00:0X 0":"P  cPʤX  0"P6 0cP0(`:0 00Ⴊ Pp;9X"x P 0cP0:0 00سXP P& 0cP0Cʰ90 00óXg P 0cP0@`90X 01"8"P? 0cP090X 0"8"P 0cP080X 0"l8"nP 0cP0ʔ80X 0z"<8"\Pm 0cP0P80 00X" JP q0cP0 80 00X" 8P _0cP0c70X 0Q"L7"&P M0cP0Tʄ70xXB 0 P( <0cP0D70X 0"6"P *0cP070X 0v"x6"P8 0cP0ʼ60X 0q"H6"P 0cP0x60X 0"6"P 0cP04460 00X"o P  0cP050 00X"X Pn 0cP0`ʬ50U 0 01X"M P 0cP0\50X 0"4"P' 0cP050X 0"t4"pPU 0cP040X 0",4"^P 0cP0ʐ40X 0"3"LPq s0cP0L40 00X" :P a0cP0b40 00X" (P O0cP0p30 0 02X P :0cP0Ut30X 0F"2"P0 (cP!AM(X d P 0cP0"20X 0" 2"P 0cP0&ʠ 0X" ; P 0cP0\20 00X" P 0cP020X 0"H1"PB 0cP010 00X"8 P  0X")!00x10p10 0X"!00@10x 1X""0010} 80X""0000pD dD 4D C G0C B B B ?A A 8A A HA @ p@ ? D? > p> > = > = (> < < D< < < P< D; : : L; : 9 <: H9 8 9 D8 8 7 7 7 7 6 6 6 P4 <5 p4 @4 4 4 3 L3 `4 \3 (4 $3 3 3 3 h3 2 $2 <3 1 2 @2 1 1 2 1 |1 0 x0 L0 1 / / 0 / t/ / ! @-DT`/ D/ ?) ) T) * * \* * T) ) t( ) ' ( P0X"m"0010t 0X]!00T10\10p P00X"9J"0010$1010 (1X"(7"001010M10 d1X"%$!0020 20 1X"!00P20X20: 1X")"0020}20 02X"!002020 2X"O!00{30A 2X"x"00n030j830@ 0OX!00X|30 03X""00K30 30s1X!00:30 0X:!00'XC!00 $4" 0㔦PXs"00  0Xc!004040 4X"S"0050 4X"F!00850@50H50PX @5X"-!0050%"00 !00"00Pܕ܅1!% !00"00 60"00!00|!00"00"00}"00x"00s"00n"00i!00dP!00[@0W BḂP  T7冮@P 0BP t7"0S)!0090SZ !0010S| !00)0S} !00!0S~ !000S w!000SF o!00 0S g!000S? _"000S W!000S O"000S G!000SP ?!000S 7!00PU 0S )!000S !"000S !000Sd !000Sn !000S "000S !000S% !000S !000S !00{0SY !00s0S !00k0S !00c0S "00[0SY "00S0S  !00K0S !00C0Sm !00;+ R;0="000"00+"00&"00!"00}"00x"00s"00 n"00i"00d"00l 0P <"` 0P~"<"z< 0 0K< @@ 0 >/=4 0 054=T 0 0,X= @@ 0 = 0 0y= 0 0 x= 0 0w=0 0v>$0 0@> @@\0 D3D00 !00j30 02 @@{0 e20 020 0p20 0L2d0 0(2D0 002$0 0e10 0v!0010 0u010 0le`1 @@|0 _,1 @@ L0 R#000 0IZ00 0@00 0700 0.h00 0%ND00 0% 0p0 0\) (( ' ( ( ' ' 8& & ' \& & % ' & L% & $ $ & $ 4$ A-t ANL\0@Po\.DQ 00P \QHTL a`0 ራ 0ᒫ3\ \/ ANN1 0QU^46 0b0#6(7(0Ta` Z 0d A0O/2G-0@P Q0BA N `@ƌό@0pG/p0PϠ B`@T 0 P\Q \2 0C@PU 0. R\B\A ! QI%RL:  H  b3Ό2@XX 0ߪ 0HP t` 0Ū 0"P tP`P@P056 0ʪ 0᭪ 0ᶪ 0uYn?P 0S $0S 0S P? @4@P//A-P08pP`' , R0( 4", 0R40G@BT@! V @D 8,0400G ,04 00 @(0( 4/P840,0S00 40Q 0 @-P0 R 0 I H SpTP @$ < @ ˁ4?0P R $ R  R S /0?00T?0$ R&4000  0`@<>0U 0PEd@T$0S`0  0@`=0U 0PEd@T$0S  &$   0   0c 0t @$ `Rx`L=0Us 0PEd@Tf8?N?P?5? J?LM?p H?A?L?    d :?;?0p0P0?0X00 p0tP 40040 @v 450050f8 0X⽿p0P0tp0 (0$P$(01 80080D80080 0cSR: @3 0@l0'L9@0C(@ ` \ p T d \ h zP 900900S909Bp@-@ PP80S ($03/$0(3/00pPA-@`PP@p0 QR 408 B4 08@V000PA-@`PpP 0R| S  P00S  6 30S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /C-T#T3 0 M000P@P`^-@\3 R < 00 2#  00S "$< @0 P0cA Q # 2RN  S=P0Sd2 R @< 00 \2#p0@< l0^ppW} H Q0c& R#2Q3 S"Q0S Q*0 P  Q*0P  Q:0pSp R0*Q  R*0Q  R:0l00p0C0l0pSp)x0 00 0P,04K0p0 p0 0 0 30 Ѝl0Spp l0@@@ `(S???DP 0S $0S 0S P?,A4 BR/ Q /@o/A?A-pW_P 0!(`3/@P\ 8X9  ( 0(3/PM 8 k8!gP S>0Rp*p  BS>00p0 (08#U8@oRS B P T X B T p 0Bp8 9p 5P S>0Rp*pS. 0A p oR$0(3/P 0S $0S 0S P ?,B4 BR/ :+/P 0S $0S  R 0P0?0@@/O-M@ @PᬰCX 0C00$P $p`0 sRpW-0p  p0 Ѝ0` Q`V00p<J\S20b608#8P0X 0 C∀0S 0X\!\ ! 10T2 0# T 0SЍ0W0T0S Ѝ0D?o 240%R00S0000020(0@0,000@(,04@080 00 0 00C$0 B T@[ q W3> BI  p Wۄ2  B37RL q`36 B Jq`36 BA@g @PKU 2@EAa P%A0@  2 `"<0@ 4ЍP [P1:  XT@p`0 pW`6@^ B37[`pNV*jkV`HV$+ `\``\pWLNW\NW`Np\ \2Wۅ  >`V7*pG(p\ p`$p`p`(p$p$p@ V(`$` PI:`@`````^Lp\`@\k \c$`\``$(@$$, V,(`@  %$(@$$, VpLF$(0$00W\(0`@]m Q???( -LD, qR0N80#8\0@qR0@80#8\0O-,Pl0AOE@DS8@$M@AO<00x00@@D@^00S| Pt0`"!!^!@p4 0TT* RR 0 P^ ^ ^YY  0PU<PU=PU>PU?PU@PUAP0UAPR@oPP 0CX20;(8ӗ1Ӆ1&=ftPxl0PAPEN NxtP0NPWNl0:8HPXT!D`4PᵀH@ᰀ00SxAPP`l h\0S8 B05l0\000S l`IP0` R P lp#p  G R ` h0S:l R1#P0 6SH \0P8 Bl0\00PЍl08  : RƃPƃPƃ !hP\0P8 Bl0\000SЍTO-xj P,M`t \l 80H00XT0#D04@@QH0  ,0BA?C0CP`PƙYp00B8#( ƙ#<0ƙ@30 B0(1I>RX30;"8ӗ1Ӆ1&=  `tQL \ R㠆l@80X`TptR` l H 06#0H0Xl \0P8 B El0\000S,Ѝ806&6 &!9096tl L Qtl \e 1t0 S` R S; SY`l r *l `m 0D 0 4 @0 0A$H0   @`@ Pl @!0P PH0P `   @P$ll R1#\ Q \P80 B0 l0\0n0P,Ѝ\P80 B0 l0\0[00S,Ѝ|O- ,0IY!Q@o00`MPp ؄0 `C S 0U000u p 0 0 0B 00%C00 A #4 0BV U`1\08  <\0 0  PE B    \0UWp$6 *0R1 B3:\0l``F0SP!P1UP! U:Spp  W  B0p  0 `VP ,8 ^K ƋA, l&\ `VPl& RƋ5X(0p'<` `FV*\,^zWp!Wf\, 6 Q* 0Ƌ51C(LS0!S 1 R4\  U  RqЍWD\\l <A Q  Bl &R &l Q8&pG &l, A Q l S`1 `!U00  SR#000僀8 0\00\08Ѝ<` `FV:8 i, lBP l\8 LNl \S&lR && R, p`Ƌp  SR# S`1 `!P 0S $0S 0S P0*S9S/qSZSE0C0// [0C0 / S/@O-MPpQs@`Vo V\ t0Si0,0SC0p0t0S(Pl8P pLpXTD@4H0P  ;. 0`RH0`0t0l t0SPl  l \ 6tx`hp`ЍVL0D 0C`B `,0l`\`fpG0*S tX  0 ,00W:A-@P 0S $0S PfpP `l0t,@0S@1VTU@80C opp@-@P$ 0S! $0S A`PP`0 S0c``,0S `  *00 00(0Yp`p900p@-P@P pP,0L D0<00 B@C 0X 0 00 00l@00\@|0:t@ Fx`h@H@p[@-@P 0S $0S P0 Rp@-@P 0S $0S PP Q000U0:60ppG-@P( 0S% $0S" PQP`0&0R:pk6 @cT@ĠL #0 6KPUXPPp@-@P P 0S $0S `P0`P|0pp01A-!4`TTpBCPE0 R R R0 PR\ \:0S@U!1!v!w|l R ^  RX  `\h$X  `\h, RO- M`,0P 0Qp 0@S QW0ϟ S  R| Ro  R( (pQyWd R B‡RP^.SnQXt0S 0Sr RV R <.0 103/0@SPn Pf Wo0S S00_0 00#400 03 0  0#400  0 ~0S0c0?o20 Ѝ0Sy<00000! S *SK0Sq00Q 0S0@SP Wm WxL0S0(0 Ѝ0 0&S+Bql0S<  B0#2 2c0# 0l0Sc q000 R09S ES IS [SH gS0, Z 0S0,W @; R.D0Sa ! P B X:H  PE[ 0 X0 9* PH 0 ,0 SR0 B00SS@ ӇS   00#  #800#"0    ,0 S R 0 0I000S&  0 0S0  0S,0SQ:z R-,0S  R0 0[00$0S,   0$ 0S0  0S,0SQ:M R X0t0 0 0  R ,0P0S0PUP$ ^01 R \01200 00 0#400 00 00 S0 S00ӈ R01 00 00S 0 0 0#40,0S0 0E00L6P0t,0S*  R0 B000, g00R  0Q00SZ 000#400q000SB*0 B000 B00,R 50 00+Zt 6l8&`6&6 &!909&tl0I0Qtl0" Yt0SW :W㴖y 6S \0l S 8 B0 l0\0000S\ R8 C0o l0\000SꄣZt0(l 8`R B  ^H 6ƅ6ƅ6ƅ!909&6Rt0l 0C t0l SJt0 SW S Sl 8`g00&0 N W 0S~[0 B00O ^ ^  [ [  [ [ [ [ [ KoP᫲[@ `S`1`05:P0@&ƅ&0 !ƅ0 01I>  0001&=  &6`Rt0l 0C `t0l u\0S8 B0 l0\0R00S8#  #800#"0 kWB 0 0 0 0 0 S0 S00ӈ R01q 00  R000 0 0%*W6: &R \ R80l0 C 0 B 0<L0DC0C t0S*l0\06x\0l S 8 B0 l0\000S10e\ R80l0 C  A-`pPTq@PB Q00V0SI0S: (0sT Q 1@0@!A00000 |0 `bp( 0S*t l00\ R$6S S L D0 BC @060@D0 0!1 0RppEEp@-@2PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0($03/0qVP0pPO- M8\04< `08^1S00PP 0 0pS{ $0Ss wpVjV`F0HSs0FSRo WmZkFoY㫲[dV @!( `4/@Pi * @ !2) X  P "L  BT  A0`, `4 ( P6/ `,8(6/ `L@(6/jD 0(3/68 R! ( @ R% D PR! 00C60p删$0 ЍO{v `fp00$0`(0 } Ѝ8 80  000& W -M 0 0 AЍA-PBU_8 `vl! 0(3/@PR P!@k 0 ,(P3/ 0 ,8(3/ 0 L@(3/z 0D (3/080P. @ R+ D SR% , 8 @, @@ ;L DD 6&!10 0C006& 0&;> 0$0;/@{O-Q M Rp 0 R 0#01,#0Pp0` 0  0 + P%*0 @)0 @$0 q0B0PQ1;`,:(9p'463041 R P%BQ` 01 0 0# Q#4,!!01\!#00#0#\#4!  01Q #0P%0%x 0S,!R4@0HSPS aS,d&P%PN&, QS,T% S%, QS,T% S%, QS,T% ^%,00B0 R | 0 0#01 R,# ЍL0#20S!B2Ppv{HyyXy,yyxwA-PR` p㴀@Pp  !1   0" C  .P p18   0" C !&Pw A-PR` p㴀@Pp  !1   0" C  .P p18   0" C !&tv p@-@P Pt`t`@P  !1Ē   0" C  @pPpu p@-@P Pt`t`@P  !1Ē   0" C  @pPpu 0@-1@4P 0,C @$!0 G-Rx 'xh Q ROSRCW-o`V @0@0\\\0 p\ \  0p0\0p\ 0\p0\0p\ 0\p0\0\ p\ 0 0p0\\0p00 R7Ǡ7 lŒcVV-2P0 pGN0 P"R 0pQ1W1|G#7&c2pG0N 1pW|GpG|1^NNPV=F10C=@  L 0R`RPR0`P0 `R0` PR0P `R0` PR0P `R0`PR0P`R0`PR0P`R0`PR0P`R0`PRpRP00p 0Q0@  0C 00 pQ80'7b"c2pGNq'R'@-7Fc20B c!'b "0C0,  LA P A@<R,C,0 BR,B B/qR'@-7Fc20B c!'b "0C0,  LA P A@<R,C,0 BR,B B/q/< U/0S0`0//3 246@-S k>@@0 #400k.06S0k. ς 1O- p:PTU$0!`Q U @0ς!\KU` ẠZ 1 @1:  V:0Q=0^  pQ Q Z @ O-pj P`50 0  0p0S01YQ ⵏ 0100W0Y0[ B   װ 0Z.061#60S\+ ೎LY LQ LG⋰@ 0p@Q0C Y> 00A@N0 \0000C01 LQ @00^ 0P 00U00S@ T R 802^02N00 R0@ T<ЍW@  |xP 01LY 1R 6 G2#6pP^p N00=C-@TppR!ಐ0N+m^\dT( Y!. Q =^0p R. \HANpR 5 ^0@ Tp5  \ ʰ Q ^0 Q ^0 Rp^0@Q^0p ^0@ Tp@@  @O-鲠MZPPRt0+!  k ^pZ ἖` S 1>@i0nh S&hU0N P` `P`,ĠƘ lTLh&h἖0@0lih S&h 0P``0P`#406L0cTCh&hN\.ƈ0̆@ Ƞ,ȠPP0@#4PP 0Ƙ0l^h&hLW`ƈ7 W0@Q `W Q^kp`徐v0`i7W8`I#8 pp00p0#40v0gQ8#8p\0v`pV0@S `Vp0@T PpW Y0*`p ^F @0@Pc UYX%X@ 0P`P0CP`P%TPV0PeTEH$H S6L3@P8#8k`0`0@0P#4``06W@c\Ġ 0C6D0@Qi `V pm 0@P9`d8 V#8 @`0@D0`0#406@0cUS8#8 TFS LDPH$Hk>`@`@@P.``W@n\Ġ N 0@Q$ `W*0@S P palh&h`@ p0T0 V4 p@` 0@SЍ༖ N.CkΈ0W@6 N.4kΈ@W0Fv P p'0@S P p0@S  Pp0T 0W `@ 0 OO-ʀ6MS 4004`003k^0 0300300 A @b98 T#8@p000@p#406 B 0c^&6S0@ 编0$` pḀn98 Z#8 0N 00#4 060cX8#8qX tq@DH$Hph>W8#8挥pH000p#4060cTC8#8 BR@@@CqԕrԅAqಀph>8Y#8H000#4060cWs8#8 p0@sWz `D B("(>@g8T#8?@000@#406pGp0cR#6 Sv\kN&0Pn28R#8  P`0`00 @#4PP0&N0bQ8#8 k0&Ѝ 0&0p0v, 8s(ss ss00@-(  ;0,8+J &̀+k. $ˀ0G. 0S0 0xS0 0LS0I0&&&&HA-Pk΁@`&8#8 R   pp "$ &bS0  Bk>& 0  8#̠  4##<V0 0 p000*60@-S S00k@@6 0C60k>@PP@@!PPƂ00@-k6 S#("(00@P P 0 #4@@06 c\  ("( 0Ck΁ S 600@PP  0@@@#406 0CS6 S00k.@@6 0C60 k>@PP@ @"$PP Ɓ0O-0 QR@ M[, R 0,p&]&P+(+0N  q/ ! RH@P jƖ  \& R Q3 "[&kΆ 0("(1 Q8#8000#400aR#8#8 A+ QB Ƞ(,Ƞ!k>0#400a\38#8 A Ƞ,Ƞ18 Q#8k000#40缦0j\38#8 J Z㼦@ Ƞ,Ƞ!k>0#40缦0j\3! JDM⼦k> / ! Z! ! 缦jR!! J^ἦ 2 / Ml  \ P+R +R ,RE R  Q ,\3 "[R&k R0f 2 8#8000 #40&0bP8#8 Bdk0&N.V 0G. 0R0 0xS0   0LSI>X&&&& Ѝ R3 "&][Pj 0 ЍOj @!:!<18#8!28#8 tjhf:Ɠ0@-PV Ɠ!DPV @Ɠ@QF !6@o0ƓAƃDQ  !I.Ì!ܕ"܅&  $d0S A-P p@0 C`0@j[TUT @&P D&/@- MP`p\*@P @   h[p P , @P  Ѝ 0@0 Ѝ0@00@,T  Ѝp@-P+*@P @h@p 00p@-@*0P 0W000 00p@-MP`*@P @ @B0 0[p {,@Ѝp0@r,T ~@Ѝp0p@-S P@0 C`^0@ZTf 0 p`&0P@p%yara0p@-S P@0 C`90@ZTA 0 p;&0P@p}%tcid0S p@-`@0 CP0@ZT @pp/0S p@-P@0 C`0@gZT &,0P@pB%p/yara0S p@-P@0 C`0@DZT %,0P@p%p/tcid0@- M@ MZp  P Ѝ0 Ѝ00 0 Ѝ00@- M@ 3Zp  < P Ѝ0 Ѝ00 0 Ѝ0yara0@- M@ Zp  < uP Ѝ0 Ѝ00 0 Ѝ0tcid- M Ѝ- M} Ѝtcidp@-@Pl%0PPptcidp@-@P`%$0P p|00ploobp@-P`A@P  0@$p@-@`@ @-@Z@ @-@T@ @-@N@ @-@H@6 @-@B@E @-@<@b @-@6@{ @-@0@ @-@*@ @-@$@ @-@@ @-@@ @-@@@-@ @ @-@@3@-@@L@-@@c@-@@z@-@@p@-P` @P  >0@$pp@-P` @P  ,0@#pp@-P`t @P  0@#pp@-P`b @P  0@#pp@-P0`PN @P  0@#pp@-P`< @P  0@#pp@-P`* @P  0@#pp@-P` @P  0@#pp@-P` @P  0@s#pp@-P0`P @P  0@_#pp@-P` @P  0@M#pp@-P` @P  t0@;#pp@-P` @P  b0@)#pp@-P` @P  P0@#pp@-P0`P @P  <0@#pp@-P` @P  *0@"pp@-P` @P  0@"pp@-P`x @P  0@"pp@-P`f @P  0@"pp@-P0`PR @P  0@"pp@-Px@V#(0P p:0P 0pgntsp@-P`@P  0@"pp@-P`@P  0@s"pp@-`PC@!#<P pP U patadp@-P`@@P  0@I"pp@-P`O@P  p0@7"pA-P@"X0P py&`P  P `(gntsp@-P@"(0P p0P 0pgntsp@-P`7@P  /0@!pp@-P`+@P  0@!p@-@R 0@!p@-@ P"$0P p00ploobp@-P`k@P   0@!pp@-P[@P  0@!p@-@| @ @-@v @ @-@p @ @-@j @4 @-@d @Q @-@^ @` @-@X @} @-@R @ @-@L @ @-@F @ @-@@ @ @-@: @ @-@4 @ @-@. @" @-@( @; @-@" @N @-@ @g @-@ @~ @-@ @ @-@ @ p@-P`@P  % 0@ !pp@-P@P ` 0@!pp@-P`@P   0@ pp@-P@P > 0@ pp@-P`o@P  0@ pp@-P^@P  0@ pp@-P`M@P  0@ pp@-P<@P 0@ pp@-P0`P)@P  0@ pp@-P0P@P 0@ pp@-P`@P  w0@r pp@-P@P 0@b pp@-P`@P  U0@P pp@-P@P 0@@ pp@-P`@P  30@. pp@-P@P n0@ pp@-P`@P  0@ pp@-P@P L0@pp@-P0`P{@P  0@pp@-P0Ph@P &0@pp@-P`o@P  0@p p@-P]@P 0@pp@-P`L@P  0@p p@-P:@P 0@pp@-P`)@P  0@~p p@-P@P 0@mpp@-P`@P  `0@[p p@-P@P 0@Jpp@-P0`P@P  ;0@6pp@-P0P@P t0@$pp@-P`@P  0@p p@-P@P Q0@pp@-P`@P  0@p p@-P@P .0@pp@-P`w@P  0@p p@-Pe@P  0@pp@-P`T@P  0@p p@-PB@P 0@pp@-P0`P/@P  0@pp@-P0P@P 0@rpp@-PD@!(0P p0P 0pgntsp@-P`@P  T0@Opp@-P@P 0@@pp@-P`u@P  40@/pp@-Pe@P p0@ pp@-`P@<P p`P U Npatadp@-P`@P  0@pp@-P`@P  0@pp@-P@P $0@pp@-P@P 0@pA-P@sX0P Lp"`P  cP `M$gntsp@-Px@U(0P p90P 0pgntsp@-P`@P  0@pp@-P@P 0@tpp@-P`@P  h0@cpp@-P@P 0@Tp@-@Q 0@J@-@R E0@@p@-@0 P ##p@PP#0S #p#0꼾@-$@@"hP 0R @-P Q o//Ꜭ P 0 t@-0 gf Hf @-P Q @@ @0@ f0 R( (0( g0 IGf f Gf f 0S p@-\@`@@ PsPpP p@ XA-P`pi# @P  {`P ppw"ʰP` nn"U @#e"## $p@-P @` PpcP p@]@- @P $ 60 0 0 A-pP @P"  #0 0 0 P `P  ` P0 000 ,0< @DXd c /@-@P p@ g 0 0X Dc lc }-A-M `V $P0 PE@P< pP  0P{E =ЍAЍ/ЍAЍ/ 0 0t PC4c b Ul[ @-@P "@  0 0X 5XCb 4b }p@-@P x0 0 0R0 P0P Q 8$ p@ppd p@-@P `0 0 0R P0P Q $ p@pp P/0 0 0R /XP/<0 0 0R0/P///, 0P @-od  QP  QQ #/p P/ 0 0 0R/P@-@P \0 0 0R  a0P Q #00 P/00 0 0RP///| A-PPM /o00 0"P R Ѝ R0 p 0 p`P 0 S  R H  gD pP` ]!  00P0z A-@PM 0 0 0R ЍQP 0  0p`P 0S d P 0D pP` &!000( (0( $0 XTy \>] 8] ; P -/o<0"0 0^ R  R/TP/D0 0 0R /@-P &o P/D0 0 0R /@-P od P /ol00 0"\ R RP Q  Q /H fP 40 0 0RP / fA-(0`SM.P@U Ѝ P0P )pP 00  0P* S'P0S0"Q00 @P X 0 0 0 @Ѝ( P D L P 00#0 0 P 0S S R/P/ R0/@-F @ bhp\@-0,MS-a @ S  P `C` `P FP P,ЍX  ,ЍD P ` B(0( (0 Y T(Y Y X 98Y $@-@@-(@@萮P 00 S 0 P :\03#/S 0 P \0///A-Pa`ʬ@P ( pP  ᱬ@P ^W@, ,0, (0 ',7HW W M 00 S 0 P :\03#/S 0 P \0///0@- @PM @ Ѝ00@- @PM @ xЍ00@- @PM  @ jЍ00@- @PM  @ \Ѝ0@-@P ,0 0 0R( /P/0 0 0R / 00 !S R!* R0*/-  ^0 : 0P0*  R*/@@/ / P $0 0 0R //P $0 0 0R //P $0 0 0R //TP $0 0 0R //P/h0 0 0R / 00 !R0* /  P 5*/P/h0 0 0R / 00 ! R0* /  P 1*/hP/x0 0 0R / 00 !R0* /-  ^ :P/x0 0 0R / 00 !R0* /-  ^ :`P/@0 0 0R / 0 0 S /P/x0 0 0R / 00 !R0* /-  ^ :P/h0 0 0R / 00 !R0* /  P 5*/P/h0 0 0R / 00 ! R0* /  P 1*/xP/x0 0 0R / 00 !R0* /-  ^ :P/@0 0 0R / 0 0 S /pP/`0 0 0R / 00 ! R0* /  \ 5*/P/`0 0 0R / 00 !R0* / \ 1*/P/h0 0 0R / 00 0S00/ P %:/4P/h0 0 0R / 00 0S00/ P %:/P/P0 0 0R / 00 R/! /<P/h0 0 0R / 00 0S00/ P %:/P/`0 0 0R / 00 ! R0* /  \ 5*/\P/`0 0 0R / 00 !R0* / \ 1*/P/h0 0 0R / 00 0S00/ P %:/tP/P0 0 0R / 00 R/! / P -/o<0"0 0^ R  R/P/L \ /  JQ\/8P/L \ /  JQ\/P/P \ / Q/S/Q\/xP/P \ / Q/S/Q\/0C-M`000 00Sp pP Ѝ(@YP+ A( 0Q xRJ  P p&*0 00 0S  P Ѝ^ P p:Q0"SL0"SH  qp  0 00 S 5 00"SG O-MM(@PD1 p000$0`0$ 0 0[ Q` $ 0`;/0 `P Mߍ P 03/P 00  $ 0:/P 000 PMߍtF p0@-@@PAL70L.0Pa`L8 0LWL Vp 8 W8T#80O-3KM `0 0@R @@@$@@@(@0 0C0S50fSQ ="SE [Sl2 0 @3/P 0p0  0̠<P p0S !S$0-S-P00S00PP -P 0-P P 0>P 000/SR `,`0 S S0p p S :S 0 S S0GU0 RzP0/S7 0(00>S: SA 0S p03  0B0SR 0 S S6 S4 /S 0 S S,/S >S S`FVx0Su `Vp0(00>Spj 0  $ 00 0 ؾ S =SB0"SP0SM   0"R "R R@C$ >R;0(> 4> G-MX@`pI P dV W$ P[ <PT &P@ aR lR gR' qR uR oR  tR ;R"@ tRT Ѝ mR8 pR oR sR ;R'@ tR ;R>@P P"Pp \P@ V   WP UP PS00S@Ѝ pR ;R@ uR [RD\ BR  ;R<@{  @!1 0 "R /R 0iP 0 +("( R:Y ~ Y +     SP40 Re \Rb  uR^ :P X +  PS6I0     0 # <  P,!*-"-  ƠP  * --  (  " "0  ~T; $; O-`Ÿ M @ 0D0S<_SS @S  0>S 0 T  @P (0SP  R @7 ЍT T$ @SPV` iP @P ` ^Pl0S  0S(9 ,9 89 7 pp <7 DO-PMȟ`@PM ,DpPD yEpF 0F fppSp>0 PᎤ0P0Cu%    `p -EЍ00 P0hp``E`ЍC`Ao/A-PP WP`p @5@P@@-@P p420,p0P4080<0蘺t@-@  nH@-(@@ ◣(ᅹ₹@-@@ O-4@T p`, oP @@D¤@`T P礀Qㅑ@0@ @@0 PZ PZ P3 3  @-R 0P< P 4Q ,  D D0D )0 ˻, ,0, (0 »и3 2 @3 2 p@-@M4 00R1SP,0SFR 1`V. P` 0 0DP 40, 0C40P& `ЍpS( RwЍpЍp 0 Z0D xp p0p l0D o\ \0\ c0D fD D0D @0D ]82 1 p2 p1 yL2 L1 (1 (1 iA-P`,p3@P W 0 !u,@0`^,@0`C-`0@SPpMF  PD00Ѝ!0 sP ,0SU !0 hP ,0S(0S00  0FP 0S>0S0"S:0:S 10}S "S000"S 8P  2P @` 0 @cP , ,0, (0\ ⮺/ \n lm  l/ l. 0p@-S `  Q P@0@p 0  0 ∺봳 . - 0S 40 00$ $0$ @-0 r0 . |- 4 @-R 0, B4 P @ @ @0@ <0 W, ,0, (0 N . -  4. , O-80M@ Ѝ@p`% PP @ ` @ЍĒ l ⇡PP0 004QY z 4 ,R\ 牱Q1v  ] P 0YIV  B B!С,0 P 04 `<0 04 <0 RP,UM<U7U+Y& 唡 @8 P 6 3PP( . .0,S<SS= cP+ @ <0P0`<04 y<r !|,0P [YP |,^x x0x t0F/ℹd d0d W0,{L L0L 0 r(fЀ ) ) 2 x+ ) | + |) p@-@PPK0S L  Q <0 0 p@< 0  0K/E딮( ( p@-@P 0`0V PP p p0 0  0@S0<  0pPp( (0( $0K/ $, @( ( O-0@SP MR z`40SM x `6P@ ЍP pP 00S 0q 2 00PX 0S. @0R* P# [` P 0P 0S P'c X D` ЍOkP 0  03/P  40R 1#PP 0 0U/₸- 00C 0P `@zh h0h d0U/iT T0T 0]/`, ^ x 4$ % X<' X% 40' 4% d@-@⢠0,S<SSa 0  0 4|y& $ PG-V Pp0`WSW@6 404 S @  S3 F000,0 100,0$ 100,0, P  ?o @ 2\0S0S P@P :  404 SS@  @D D0D @0c/ʷ0 000 ,0c/ $ " !$ " 7G-PS @- Y`' T 1p 0R   004 00R% NP 0S 0 GSd d0d `0i/|0,S0 000 ,0F/k$ ! 1`" `! G-PP' 0 0R"pB4`P 4 R @,0儡ᄑ1  ,04 儑@ 0T:804 80$`蜦0P 0  Q@-P80080/p@-@P80080p@p@-@P 80 0R@ pP4@plp@-@P \0 0R@ pP`00S@#:p@p@-@P@pA-PP 0 0R4p`40S @40S ,0 P@1 `xA-@P 0`0VpP0S {P @T @ @0@ 0]/⌶@@tԣ   A-PP /o0`0"Q@@T @0R pY H@P @T N@ 0  0]/R   0P \@- ^ 400\@/ 0  0F/3X $  0P o@-x@ T\ @\400\@/ 0  0F/ ԡ   @-PP M @1 0R Ѝ`@80  Ѝ@ P 4 0R S!*,\&0 B!p@崝400C40<00<0I G h h0h d0s/T T0T P0s/⸵@ @0@ <0s/⯵0 <  u   vp  p w P/?o0 2 R0S/0@ S/ꨟ0P -?o82 ^0S 0 S$ /XP/0 0@0R/ P/0 0@0R/ P -/o<0"0@0^ R  R /᨞f A-`P @PpP (0Sp 0P  pA` `F̝O-0S@9 0@S7  `P P. X8qPp@= P 7 P 1 P HXPU0UU !B< #1 0@?,B PO 0 s0 մX% XP0@#r 1 pP   0P6 0S3$ P, V8 % @P0 0p0 `@y `  p` 0$ 0R0"S 0 |0 -M ЍX0"SC @?  @Pp,z p   /P/?o8  2\0S /0SP/p@-4P4@P@Z0 0Up谑P`0S   0dT@-@<<" T (@@:@@ @l E__@-@P (0 0R'АP/0 0R/ᔐP/0 0R/l0P -?o82 ^0S 0 S4/80S /(0p@-S@ `P`0 P0 P ll `@@ @@pDDD@ @0000 S4 xC^@C] A-PP / P`p @ @P\ @@ @P p<``` 0,p0P4080<0؎@-@ @  @-R 0P< P 4Q ,  <0< <<0 ,0, ,,0 ` P Q 0 VPG-? Pp0`W<W@ 404 S P S /000P,0 10,0$ 10P :  404 SSP  P@ @0@ 0( ☰( (0( 0( ⏰ 0 d @ p@-@M400 S,RP, R8S 1CaV) P` 0 0P 400C40`ЍpR S K } ЍpЍpd d0d k0< LL L0L |0< C4 404 l0< : 4   d t  A-P`,p @P W 0 !W,@0`@ ,@0`p@-00P4Q8 @Q t4 <0,04Q<0pPp 0 0P 8 (  o@-P MU3 0`Sp@$  FPT00 Ѝ 0 +P ,0S @t 0 @eP  Ѝ 0]S$ $0$ 0` ⩯    Rp@-@P 0`0VPP p p0 0 0@S0<  0pPp( (0( $0 y댈D`   w0G-S@PK TpU 40SF   P@G ~P P 00S 0>]P7 0 03/P0  40R 1#`P' `P 00C 0@P  @ꀐ  pG \ \0\ 0 8 808 0 뜇$t \4 |   40S 0C40/ 0  @-0    0p@-S `  Q P@0@p 0  0 Ů눅   ip@-@P 0`0VP0S R <0 0 p@D D0D @0 ❮0 000 ,0 ┮ 0 x   T wG-S )X@ `V 0P 0R 00p ]U` WV 0S  Gq@ @0@ <0F/T0,S  x T A-PP 0 0R'4pP 40S @,0a, 40a@T:8 408 p@-P80080p@-@P 80 0R@ pP0@pTp@-@P 80 0R@ pP4@pp@-@P \0 0R@ pP`00S@#:p@괁p@-@P%@pp@-@P80080p@p@-@P8@@@pp@-@P 0 0RP`40S ,0AT p@p@ 0  0O/⇭밀  aA-@P 0P 0R@ p``8040S ,0X <0, 0Q<0@I@=@D D0D @0S/I0 000 ,0S/@ `(| Pp@-@P H0 0R@ pP`@p~A-PP1 0R@`4P%80,0!qW% P P ,0P < 0@ 40< AiAD D0D 0W/, ,0, (0W/ج|~  Hd0P -?o82 ^0S 0 Sd/8}p@-`P pP@cP (0S p@ | ! |0 //@-!WP0 p0  O-IMP  @T p `0 R 2/0W\ P Y  9/0  p?PV @T!1 0 Q003/Y@ 9/T VT T @T@" 000Q 1/0V' P70S+ 03/P. Y 9/V@T 0 0(  0 0 Iߍ 0 0(  0 0( Y 9/Z 0 03/X X0X 0( ߫0 (   \ x8h 8P0/O-@MM(p aT 000 0\0+`P$  T%0 `P4 0@ 4/@P`P@003/0 `iPMߍT00 0 P 0 $ \00 Mߍ0 000 ,0H a R00p H# 0/0/@-@@mA-pP`PM1 @T. 0@0W   WO 0 /R C 0CW /RW  W0 0 B/Q P!0C@T@! M0@ 0.0 0 0 S* ;{p@  2U ,0P?23@$Pۍ?00@ۍ S02p 2P2Hf2p =2p 0P@2 p@-R 0@S PR :   Pp0P  , 0`0` `90 ࣪L0L L:0 808 8;0 p  t Tp@-@Q PPpQpA-0MSz@`PA7 Q <Q& >Q &Q a`Q PЍP QЍ|a&`Q ~PPa&`Q rPPU q/UpU"0E'S0rP\\P WP PU /U\U fPnPtPbPUx 0  ,' QQ 3P0 000 0 x <  0S p@-P@ P@p 0Sp/p@-@QP Q PpQp@ 0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Qp@> 0 0@ }p #0p@-S+@PPU Q PpQp<Pp/P PQ P Qp@> 0 Q0` @| , 0p@-SG@`PU Q Q aP<\Pp PU Q PP QPU Q CP QpPQ 6P Q/.P p@>( 0 0|  cA-PP` Qpp0` XpWV@PR  PK <V`p p0 8/PP`<``Q P P 0S (P P 0SPP P P P 0 PH l|lp@-P@PP Q "Pᝪ0@똪@p zy011/A-\@`pP \1S 0 €  P 1P1 `p P 0808 8A0 -$0$ $B0 %dX |8 \@-@^ P ^%QRS  T00'NQRS"  TŒ 00 0 Z0 D `G-@R0(M0QP P 0 ` p Pt p `]0T?o20S00(Ѝp`0 Pp@- @PM`00ר0 0Ѩ0 0˨0   Q Ѝp 0@-@P M0ᵨ Ⱘ ⫨0     P  Ѝ0p@-@ P0Ml,`.4l4#0厨 4 40ᆨ 4 40~0   Q Ѝp 0@-P@ M0gxl,.l! ^ 4!40W0  ,  P Ѝ0p@-@PP`(M/ 0S, R00$P (Ѝp0-S0 0 0 0 0 0 0 0 0 0 0"Z P0V00(Ѝp@ R 0S V00@-@ 㯧T00@-@.p00T0Z.0[.0\.//@-@T @-@T000 000S/@-㟨hut000 000S/@-㏨(ut000 000S/@-tt000 000S/@-ott000 000S/@-_htt000 000S/@-O(tt000 000S/@-?st000 000S/@-/st000 000S/@-hst000 000S/@-(st @- @?^ʎ0 !00@S  \pt ? ? lR! 0^ < 0  0^ \#000/ 0 01//001//0 01 /l/0S@-@1/00/p@-P0P0 0@0PS` ,Ppħp㙧tqt/=-000 000S-/@-㇧-qt@- 000 000S/@-tptAo//0@-p@P M 4 P . Ѝ0 0 ;0 zvt @-p@M L -P pЍ(0( (;0 ]wt@t 0@-pP@ M T T T K 0 Ѝ04 @- Ѝ0 0 :0 4t $p@-@ @ $- 0 80 ^t x p@-@PP (P$Pp0 70 ` p@-@PP (Pp0 70 L p@-@PP $Pp0 70  x@-@P  Y.<+ < 00 ;0 Ť| (@-@P ( 0 70 ത(DD @-@P $ 0 70 ࢤ$ R/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@ؤ P//-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/8@-@PZ80 0 @  0""048# /UUUU3333  ג,)p@-PQ@v : Sl G Sd0 c Sp0  S?0c0 r-w-!- R00M >Rx  -   r-w-\  Q7 &Qx-,1r-@w- T$ T T-x0   p Ss0  Sw0 S?0l0Q s! R0s  t0T0SS   S?0b0A0a0-0$0$ $90 ( ȵ O-8AP@:  dpPA PA  ỈpP% 00f` 0@T' P0=S AP` AT BX ! hBD0D D>0 ࿢ 꼤00@ft G-XX"X2XBM 0 P@@D H0PLi X`P ㌠吠唠嘠圠刀{pm pp tpb  P g)p[ X0p 0S0R00000048<-0 . .0-8180 00@000)@-T  #P0S pp@ ) % !) Ѝ*oЍ @,0@ 0    tttdPO-PMp 0GW"S00`0v@ƜP-TPg +T@`0@ ǿ 0   0  P p  !ʎ @00D \a0DSW0DA0DS"70DUr X : QP   S  R  "000T7 W. 0 p0R00S 0pS 0F0 Ѝ0S R 0@0`ꋣ00 R0  Ѝ p p᠀堐 XR A B0A PR @ 0`X0X X?0 ^SW p pqW ꙙh p00 0M0Ѝ2T_/O-PMp 0GW"S00`0v@P-TPg +T@`0@ ǿ 0  4 0 - P p  !ʎ @00D \a0DSW0DA0DS"70DUr X : QP   S  R  "000T7 W. 0 p0R00S 0pS 0F0 Ѝ0S R 0@0`껢00 R0  Ѝ p p᠀堐 XR A B0A PR @ 0`X0X X?0 SW p pqW ꙙ( 000 0M0Ѝ2\/O-M8@<ЍP@0P@ 0Y( @P@ PU P 0 0  2  { @Pt@P@h0h h0 ༖P0 0ൖj26&6 p%X - M ЍA-xx1 0!M@P0<80P`I p4 81p4ȇPP ! 1 0 <8 30:!ݍ0 +  0 Pp归PP@T Cn` 0P8T圇PဓP @T@ᅒ傒404 440 =14(4h A-!1 0!M@P0<80`b QPP 14^P?p4 d1pR P30P0 $ ( ,  0 0 ppRPP!@T Cn` 0P8T1PP @T@0S  ) p0 0 <8 30!ݍ`00PH H0H D0 ຕo12|1h O-ğFM MPQdč@`ᐴt嘤 T V [ ZX ( 0H0;d 0AP0S  0HPW 0  P(00){P $NPxIPs$yWj ,@Pj(p,n {P $fW ,b c T#L3 0 d4 30Fލ Ѝ( 0P3YPTPs / >P @@W  G0Sv ST2" @0 9tt X0T P(( x"2  0ݔTC!1  0ҔV:!1  0ǔ[1!1 _ 0༔'!0  H90$0Sd / ÃP!P  0  39(1(! @0 '9 *A 1 *.0 "08/0llDHt 4L ̩ |~ y~ Ĩ\z~ 0{p~ Lpp} ȧx} \} <} @-``1 0M`P000@P:  T p T0U0P @y@P@ 0 0 0 30+Ѝ/000U00000ᫀP 4"48#80P P0P 0( 0@@/4+*L{  @-@P @  0  ~0< Гz XO-,,ǟ GM Mtčĝ ĝP $ 0 $0S 0Se 0Sn 0SU IP2C@P80X D,0( p= `ph6P000p Ip@!  Pg끕00S" }0@=S`T`V`W`V Zf`Ppj0#S: PU (D@000C00V0 @p0 00 <5卄P%G@( 0 Pp0 00 4yP 4 6 $ $ 0S000C00  0pP40 50pP$h`0 ᯎ ᨎ0X0H@45PP0H0 Pڶ5 ,0pC 0PU 0Pq0Se Sc P| Pu Pn  P4 R1("2 0 t4 30Gލ Ѝ0@堔"0  (y@t i 0400b40 S  yP 0pW 0 (U 0   4`姃P} Py P!1 H 0Kx!x1x 0H A0ST!T1T H 058!818 0H +$0St!1 H 0j0S .($00p-T)$)(d`$t Ȟ@t Tt `,t s H,C-Ÿ TMPPLЇ@`pE VN WW X` 8D# W' 0 ᲎   0FP @T@T 0 pPP 0Ѝ @Px x0x t 0ˍ` `0`  0V@ @0@ < 0ඍ̑b @^b `Xb |]- $M!Π00  0 (0 0 0 30$Ѝ<)l- $M!Π00  0 (0 0 0 30$Ѝ),G-p PP`  B 0000 C Ra CRE@0@Y)00 C Ra CRA CRS:Y 00C QaCQWCP00C PUaCQWCQACQ7CMS00 D0C?o2R0SX ? R0T*@D T T-@A CRSb @ A BR0G?oD2Z0S\  Z?0X*Y 00A Pa0ASW0AA0AS70AQ P,1,!,0 Ό00C P 0 T:aCQW0CACQ70CS 0  }0ୌ   DACQ7Cz|0| | C0 D@`S| P[@0@ @`0 ,4_ |^ ,܊t^ ̊$^  G-t1@0P?  @RP>T !6*P0 4T8 $ <0 (Ѝ( (0( B0 ⣋T Z p@-`P@P0M! T* U3 ,0 0(00$00 00P0 $>P+! 0" 00Ѝp 0 0 lTt t0t 0 aUT T0T 0 VV 0 pmNSvmz靠e `c{&D`l̠daˌni "mn `ak  `H8古n` md d8@,b3De (nIp M@gy荠k{n`[n@`dk&@ lK@$@dJbhKPP%X @m3k`@ j+NNNbP[lT0Pick ci!0c0k @$ Pl @DPH`K `ˌ*d @Pꭠh jˌkg+" dP,i+0 iˌf;# 0͠T0+>C3C7Ch; . 0cPP T2gˌ a " 0g;a HPpᄢf b;,0 b;#f `@P娢makl; 0 l;#a 4PТab`;&0 `;#bLP n P*e Phe C3C7Cn;`+AmAhkAh*jhL堅b*l+`$l`.Xzmv逈eehPd" zTd,mXv\ȠP`ˌ`[Xg;n@0lb . b ` d 4@n[,`(@P%Pl@e\b[b+D@0#el@ 0+NDCDGDaK$@lK @$@MnK`+% " b*l+Lbˌ(e$, ˠ`ˌ<f;+@@@n a, j ` d" )i8e[eP0+H╃H⫇Hj0#0c9g;.Pdc`cb,* \ꭠ+K╳K⫷KgHp +~G芠sGfwGfk.c;ndKal%! h`abahk(e+$ " 0$0# 0Hpb-=l+`;d !l{ ``&` e `a{"p'd pyb ddK+ ja\0j`$ ! bbˌ a+h+   \@@-<<1 M0 Mp080@pP8  p`  eP3 * 0 0 8 30*ލ Ѝ"Aop `Px eP* PEP0*<{404 4B0 y넿HtH / $?p@-0@+@PPpz0Pp`C-@PlMP `QP0SG P>8q8pPwu su` 0` (`ju0PPP#P^uZu` 0`(`QuP PP @ dDuAulЍlЍ'^[(0( (H0 x@BQ h=@- M`Ztqt1pP@P`@@T 0Q !P Ѝ$ ZP @ Ѝ@ ZP"0S- -S?@0 0000 P " U RP +R@@D!0DSX ZP0S +S!@?@!@T=4<4yX ?P L0P00 1 R/@P/!R/ᠺ(0 @>R0 00//4@-Mp @y`P`W P0D>S 0!3100 0yЍ>SD 0!3100y00y00/-p@-MyP@U@0 ` ` Px0x 08 R;0Ѝp@Ѝ/0 a0z( ( 89 A-@PP`p; =U( X0ES  S0+0E0VpP00Vp&2!0` 0`00+XPp -X =X00-0V0`0+00+0`0p@00000 0]0 :w00d D8 H8p@-PP@F 8a `0RuSpWS6X0CS0p à 0R Q PSPQPQ  0    X0 0+S -Sp0( (0( b0 vR I@ 66O-0 xSpTM 0@@ 0`004080<0QO 0(0x @(Rx@T%|7(P0p00000TG @ @D 0 a0GS00x00x0@x@PTЍ+W = W0 -S0000 0` X B R = G/oS"!"   ( P:0,P_x ,Wx R, ("@P0 @(偑  ( 0S# (p W:,P0 rT0P R@8$ @$O-P4M@P\pu WiX0S- `00 S 5/000 00!S5+0 0 00!WaW0] Y[ X00Ud5S`500 0 0 0@0` P(0`0p5`0$0X`m 0S30`hW ,A 0`mVW@P ,(05#[0P` X $ 2P0 8%*&  # #. BPU 3ß2#0!/#1##ʂ0#  0Q`V4Ѝ3+00 00!o3/0 00!hh30$0H\.d0La#0L0|2pST0, P `@!lP 0`V ^ @P,x ^}[`"$:600%$0D"%>!!!0C,"0T$P%"A0$AO#QX00 0 0$00?S%4P!( `1T101! T$?01>! R01"_0`A(0 x10X00`d(00@t`dP(0 _l  R1 AP5Q4 0A`X0 0A$0PE `0P 0  `4`4 0 9@ 0p 0 8@ 0yp` GzGMQ(\)\! KSQI̬ `4h  O-PP@` Mo Tw V p0 8T:R P- Ÿ P2 1L PPq@pQ @T*RP P 1L P R 0Q_ SQ Ѝl P @@0 L0\? 0 \ @ p R@p\ p W R:\#Yp 0 0 oT0 0 oV0 0 ovp,@ \?[*!]-` 8  p@-@PP U p@IX X0X 0 oU8 808 40 op@IX XK, EG-P@U T^ Pp ppq W00"1gP: Pc 0Sb 0 R 0C ` PP0 XA V  00S0 0 Q 0  ! 00S3*_oRe`V(P( U  !o 0 0 oTt t0t p0 o\ \0\ G 0 o q00Pp D  t A-1 M0M@P040`P$ QE U9  00S0 0@ $03/H!@1 0 4 30GۍЍ7Qq1p$p 0nV U$ 0 G0 n 0 0$ n 0 0$ n0 x0np p0p H0$ n<  pC (| PET DD  O-ƟMM tMPč pTDe0e XB 0SK VT 㰰QpUd0U@@ R R 50B?o2 000RU$00 S0E0@v0S0000SfV L0+0Z 0@ 03/[o 0@ 0000,00G(0 03/P    0S00* z 0.S  Z0S0 Wy:0S 0S  ,P80: S $ wP (0JQ/03 10J10 00@P~000$0 000S  0P*80: S&V 00S 0  000S0 P@T  00S0o04/P/ 0,0" $2 MލЍ  0.S0Sm 0.S|i0S  0@ 0L  2/0S0?  000.SP _ P 0 @JP? @ n  2/0@I(100+$0 00 `P0!1 4 0mp0o R 0F0D!D1D 0, m0S ! 1  , 0lV!1 , 0l 0 , 0l0~$ &QIn0/ 0 @0 03/0snFlF0n*DPp @/ 0 t H  O-ßKM MPčp`Pؔܤ; WD UM YV \] /\@ @ 0\/\0 V'"2 0 4 30KލЍRb/\;/00P/\V\- pp"p2p @ 0\lWP"P2P L@ 0QlU4"424 0@ 0FlY"2 @ 0;l@Pp P:P 0   R  T 0T/S 0: S+ S 0 0 0 0 PX# +00S0 0@ (03/0S0: ST/03 301 1:d RH0P娰0P H 0k0G 0 km/0 0ᲰD<d \ 8 @ m $ n d o` 8 SO-şM5$M 0`P000P 3 QE @0~S<   pH 0S/S;RR 0B0 4ZS 0H*0; 6P4S 0 0CPR3 IR*0S0;R) 0X @H p S    န値倴*S1 00@0S ?S! [S!^H QM00 S@000XS 0H , R @ 0< 0@Ⲑ 0R  R QR Რ@  P+W@PU P#<3 0 0 30ۍ$Ѝ@\0 D SP 0]S2!^0m 0]S  000-S]Q 0]S  0@< 0T20u  0BW 0R S0BW 0R S@d 0 Q{  001A0 ZY0 [0!^0  @E  p4x0O0P H *; cP =0$10QqAp@P0 cjU 0X \j 0 0P Rj 0 0X Ij0 0Bj0\X =j@1@/?**H[-]! <  O-`QM@pM R W T   DkI^ @P}\ @\ [\ {\PU PE0]\\ \8(/PPލЍ ]RRRF 0@Q`0,^* [^ ]RR6R` T: `{^0 }^S0CV  B0S00 8(N 0SV 0F0C  0j0 0 @ ]RR ]RR x| |0| xd 0xiX WdX X0X Fd 0kiX< <0< 8d 0aiL X $x Hp@-@P`PM( V1 0  0 S 30{S 0\ {\ P 0 Ѝp0}S0S Ѝp@rd d0d 0p iVD D0D 0p ik 0 h < A-MMp@PP` ; 000000,  0 +R0 0S0 0 ލЍ \R@ @R@ )\ L 0 R ލЍ$ $0$ | 0h\@ @p@-`P Pp@0T1@D 0CPP @T*000p 0  0 h 0S$ -*S ?0C\S0P0S Q 0S 0 0/ 0p@-0@ TpP"TC ^ (a`00 0DS'000@T7 "T- 0 P \T0"S0@T&0@00 CR S 00p@T "T P 0#00p P@.T \00p p@-$!$Q$1 P0 QMMR050 H 0 0 5 30.QލЍp , @ ` 0 Ap x @EO0 \PD04 P 0hz`My 8XL5C-0$eP`M 500S xE@ p#S"i0 岳P$ 0S %P @ 0Svi0SЍt `p  0@S0 0 40  0Sx t倄倔p 0fS0fS 00#3R0 4$ 0000@SV 0oS 0oS0nS 00#3R0 # 000 ;dP 00#3R0 p# 000 &dP 00#3R0 # 000 dP( 00#3R05 " 000 0#S 20@ R@@XP00Ѝ0 S S\ cP 00#3R0 " 0@00q  cP  cP2 00#3R0) ! 0 00T 00#3R0 ! 000ElP X)0@S0 @  cP =QAX 0P0 0 xcP=Q 0 @00 "X 0P0 0LxKK0KJJJI`I IHHLLHGG(t FF D|Fp@-PP x?cP e@PLPPP 00p( (0( I0 eE @-,@@Pj004EO-ȟ MȟpP P`@ UVYT{ 4 [pJ09, tfW da U{ 0p00 2c110 0p 00S> A0$00 0p P2g<000S[ ?fU] \'P7 0 0 30Ѝ `s?0l0` Ⰸ{pp  WPWpJ 0BQ #S P BQ #S Q BQ #S V BQ #S S BQ #S R BQ #S! I BQ #S# H BQ #S" G BQ #S: L BQ #SR M BQ #SH N BQ #S> O BQ #S7 D BQ #S  E BQ #S F BQ #R 0S:U 0p0S8 Rh BD{P `0000  00  T$   440000   $   30000S0 @  # 00   hpW p[ pf000@yf@W 0\ rf000S jf0 0ybfY 0  [ Yf000k@Rf@00fKp00,(@ ((@(@00,0sX [  ϻPk~0Sz[u+d1!_0 dHf00e  ppe pw0`00X0`0 0SCQ Tqp Y*0p0^0 e0SY00Q pp0S03  pE`00C0'  p9pQpNpKn[> 4pDkp.pkAqq,pT @;< D8L0ˠ- M0 Ѝp@-`@`MQ P0ˠ 0P ЍpF@ hp@-@P> 0S0 .T0@0T9  T04 0R/Q T:\% 0 \/RT0C"0C/QT :0 BPU0P!T0l0p`@@PX LY0<@@0/S (@@ @@dLЄA-M@PS(q0Pp: !0C `0 00    0 b0C S&0`Z0 0ᐔ0pS@ 0S 0SY0"S $7# Ѝ T1r0:Y00:T @-@P1 0S* S@T. 0T)  /Q0C T !@# *0P@/S |0 B@T@!l0 0X  T @@4@0@/SpP00@-@PDM  @000-p 800S DЍ0p@-`P/=p P@ p V U p@p`IUP ^p` :74Vdx00 Q?o?o 0C-@c^?c ^' ^ `pCc&Pc2680E270G2&1H01./ "(0C0 /0: Q?o?o 0@ c5RA-?c"6R2 7R Pcp0E7`G 0E1C f<68<70< 01>?0#ό Ό C+ C+0c̠0: /07 Ϡ? 0S! Q/o/o @bPG-?b P) P @pBb&`b4')3V4( X4G1Y 010.? "1?1>( B24 5 /00@ Ϡ P! 0Soo C-@@a5T?a"6T3 7T `a2V7pX F3Q g>>> 36 / "A11 A>+@A4+a21/4 6:  / 0Q!*?B0CS?S3S4 cC0 0c11/C.B0B#B# b0/// Q":::CA@- @@Q?Q$&3Q&40a0Aa223 C$LC>CC.#@C$#0c0## P ೠ;0 SJ?Q Qa01!/ B //-C C0c0,PP `@-W00p@-@PP  p@$ 0 10 U̦؆ p@-P@` 8Ppp@-P@ 8Ppp@-P@`D 8Ppbp@-@PP pP PppC-PMP`V @T |00XVЍp :  <p@`$ @ 8 00 R !,@-cW00 0S@lH0#/"b0!s!!@ 00lRR0c0A1R 0< 0 B``C/  "bQ0"Q$I)\P ףA-P0E \`dp0LPSa0@E: T@@ X@TS^!:O-p(PB`qP@ 67P PXY  P A-1 0M0201 0@`0pS 00S \P#P3.000R`0@ t d0 0 2 30ߍOPP @@ @0(@$0Y,,$,O-ϟ 0 0XP(<Ѝ 0 P(000U00S SD 0$`Ph08P p`C PO Pb6P p W R0 0$`0P 0p`C PO PF6P pW R0 (000@ 000@(X(PD(PzW0  GS( y +St -S 00 00$P P䅐ಐ P:U X$P( 2c2c2,S \0c$00P 0(0w 50 ,P(^U0W0,0i0pPO0  P5P1 pOP  5PP% 0(P 0  R9,0X0!0 B 1X/0 00|; 0  0P(10 ,0 c0,? 0PS,0(111v>C 0C,0    /"b!!A0,0 X0 0000 0 : ,0 :,,0 v>C 0CXP0( 000 50 ,P(0PX%S(P 0 ,, ,0 0CP0(000Xp 0  0P S(B 0 00X0 009 0  0[P(X}XD9\0   0JP( =0 P( X 0P( 8 ,, ,0 0CXP0(o000{ 0 P(a000m 0, },0P!/A!b!b0C P0( I 0 B0 SW0(0S0X0;7 0 0P(B c0 ,R 0PS(, 6 0t0?2c11!, 0 0 0000 X780   0P(X ;0 mP 0 0 S0 (0X(P3 0  P(((P000 c0 ,P(00000  R 0s @`0PPv0 P@ ` @a0Ka1c B  B0   0000 P /#b!!"A @@şK/"8bP 3:,bQ # 3 P b4$  Q000000%0 1?3c112B x$xK?##p$cR3:d$cR#300T$0010 !00C0 00@ZP7 R0PR00J0PX$`p(P*0000PX$`p(P000,P 4 /#b!!0"A ((K/" bQ:3bS0#03   1 01 B00DRd , 40 00N(00 S!0r @WPO"  IPH 0 40N Q @(P0Pv 0(P00(PP @ ACLC  \^JS S 0 0#3P0 z G/o"(PzW (PUSX ZSP  @ 0!P ( 0$0A010PE0,P ( $P( PT!/"b!C;R, a2ba12+L QQl'n$IXP)\(\ ף|w Tw v Pu  TQ(tP ⎀Ḁ@CP(fMP P(P @j @0C2c2c2P$00( (0  @c 0 @]XP( 000 SlXP( 0000@>0S; 00@70S 0@0 㸁,0 0P P(00, 0C$0(~,B2000c^\0M0c$P   0P  P(00 , 0C$00(0W    0P ,  "P ( (0 b$ @00 0M0Ѝ HA-1@0QPHP P MO Q&T10 P1%@4p\@@ . R ! vΌ @p `FU! Ѝ0 P0  @@a Lp ` $U,QT 0 ЍD %P Q00Do 0o *t$0gfff,Ԟ@-0M@ 0P 00Ѝ@-0M@+0P v00Ѝ@-P@j|p@-LL1 00Mp0,00`@P= U2    P00Q Q Q E 0 0 ,0 30#0Ѝp 6 |1P 0 \0\ \;0 ND0D D:0 NIt,(t,t,Tl P0l p@-@PP U 0DPp P @pD0D D70 nNU(0( (80 dNꀜk |k \G-pP`' X/ Y JV @P0PES  R  D50PEV R  RS0@0D@ D0D DH0 (NX(0( (I0 Nꤛj lj R@- 0BAs @Q 0CR N@O-阡PP p MU WC W3@PI }4PI  3p`M I4101S Ys4 Ѝ0x30P@_3P- 0 0P :30 0  N= 0  Nl0l lD0 M 3O00808 8C0 M34  h ܏dh RQ@-M #@PЍTT O@Ѝ㌦ЍwO 00O-]M 瘡Mpō @pG p1PR jpJ @PCP`0 80xQ|Qy8Oⵦ80`TQ>C=6 sA$`040P1@P@P x0 0 5 30]ލЍ\0\ \D0 MO00@ O008DLf 0   M Ѝ~--M  $Ѝ Ѝ/ -- M0 0 ЍЍ/O-锒@P p`M X X00?B%@00P @ P 00 00 P! !  E1XPG  @VP WU V[XPVppPpW` C 0`f`0 +pP `PFPPP1 0 0zLW`!00!1 00>B Ѝ[0XP C0PP00 )B Ѝ0 NL`pPP V pP `P@0@ @?0 4Lb \d b h@-@ MA(0S2 ~?0 `0( `1/qpPp0)  0 0 PUR <0PUA ЍPPTp 0S  0CPAM00PpA@-P MA(0S: 6?0 "p0( p1/qp@`0/  0 0 @ToR <0@ToA1`V ЍP@T` 0S  0C@oMT00jAM00cAp@-PPE 4A0S5 @Tp1 Rp00P0 o P 0S P0e 0c0(` 0P0 [0 SV,P R4P N8P Jp@GT0T T0M LK0Sp000 0K0 @KeEDL_ ܐ_ p@-@$PPpTp@iꔪ@- @@bT@\\p@-,PPU U@Np(l@-a@P`ME P 10p00S `  0 XR` ` 0@@S8  V8 CR 1!0A0 S0Q^*:ЍV   "Q @^ #R.S*@A a  00C0 F0 J "^ #RN^^ N0 0Q@P] 4  R  *4 8/ 0X\S 040:8 R РS /\ }xB@-@`PFLLpL0ppD尀 fT  ? ⍇3(@-P`@JL0 A-逆pP`@P( T0  0 SSS0 S00 S 0050000005%0 JT5%0 I|%0 0  00L50000  8 70L0 20-V00 ^V00;\ 40000 00B0!0000LS 0100C0 0?V`000 00000 \ \ 00y $40000  70L0 0 h", 3010P;\ cP3`b0001dP0j R SXc\Q t30100 M \; =\H \7 00C00 LR0h0100C09" 0 0  Y 00L0f" 0W0C0_2 F0nR! \0F?o2%500%0F?o2300&0F?o24 00=`Foob%d 00!0 0   00L0! 0W0C0 0 #\ 0 0 00Pk 00L0 0000 0 0 0 0 0 0\ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0dP@cP'dP<00L000L00<00uP00p,Z P`[ ||8[ T|Y TY X TPW O-`RM@p , [5 X PI 0 0X P@0 `D-PFV0F7 `  [ 0U, 00 0 }/0QH[ 0 /0FH 0@SS0T 0 0@D0 T0 E0 Ѝ1J00Ѝ S (J00U T Ѕ`T p0  00~   A-R@P0`Sn !"#b! DQqU> 0S$ RT 10 R RO 2/!1 00U00' 1/0P p $@40081003/0P !p0 $@ 0V0 00 R (QP000P3/0P! U  R  SV  0STIP000U l/>3p,t=A- R@P 0`Sm !#b!b DQqU> 0S$ RT 10 R RO 2/!1 0 0U00' 1/0P p $@300810 03/0P !p0 $@ #0V0 00 R (㿞P00 0P3/0P! U   R  SV  0S㷟P00 0U L(̚X,A-@P| PB`Px rpPh  00^c<!"#b!0CaqV8 X pCPXU $001p00S ]3\1003/P00> 000$0(100S100S 3/! 000``0S 000S 3/000(P` p  0000St'P0000H0003/P 0/>3(P(=dA-@P{ PA`Pw rp Pg  00^c<!#b!b0CaqV8 X pUCPXU $001p00S 2\1003/P00> 000$0(100S100S 3/! 000``0S 000S 3/000(ㄝP` p  000$0S㎞P0 $000D0003/P 0`4h8 SR: G-P0`00Sp 3/0Y @IOP T 00 00 Y @IOP | T P00 D0D 0 p`P/᜔dPSR; G-P0`00Sp 3/00 Y @IP G T 00 00  Y @IP 4 T P00 D0D 0 p` P$/ဓD0ĒO-PPM M Q \ /\E P@P:p/\ p P/ `K`\n @ /RR.\)  B R/0  D0E  I Vp c 0: S#  S/ L/o" R/\  @ DQ6 .PQ X0  [K/Ra0W0]0娐 !uP-W  [@   RY  E0/\0#p0 @/R0 X0/ ލ Ѝ @ qލ Ѝ.00vF X 0/ ?    PFbF00 \F>00WF00RF00MF?00HF00A-@P Q ?P`\PFp@P 0P`V *F0"S "F00@p@-La P`M=  ?00QP0嬛P ; 00\% 0@0 :\0@S \S 0@ S @ 0:S:\ \000ЍpL0P ĝ 800  E 0 @p@-@P`P3 V( 0Pp:P @R0R P:U P0@Sp P P@Rp:UR:Rp@0@ @0 C(0( (0 ~C8yD yjD x00/p@-@PP" U+ 0PER R:Q|Q00Q0S"P0@|R  :RRpT T0T P0 BCU8 808 0 7CpC iwC TfwO-ȟ M MDčpĝP$ 0v 0S 0S 0S t4!S Sdh`P @P5  㢚pP 00S RD@ 0 @:D@ ` @PT"0 S* Z :S `\S S S 0U:HPPE TpP+ P`0@ SZj0[P0#QQ 8P6@00PS0 006 p0040(0,@= P :S~ 0pS t40@0 0(<QP<4` GC pP> :00`00 [00S  `U@P  W 0 ` PYPu0SA00`YPE*0 S :S `b[ ` Pf `b :S& 0@S  0D`F00S:S:00` F0H[0 E0)  ) 0 PCy `#00p@ H PEIpGP P p ,@ pT  E0AX0$0p#3 0 D4 30ݍ Ѝ@ @PpśC 00&P kpP 嵝`3P00PS0,@`TB 媛`@0T<S= C0@圛C@00"2 0 A0S"2 0B A0Sv"2 0 A0Smt"t2t p 0wAc  0@^0S> 00S00S\S00 RAP| 0S7\S5 00S1 :S000 0 S4So A 00S :S|S@0@ A@0S'!1 0 8 30Y ލ Ѝ  @P 00 C \10 Y P 4@P @ @@$QP P 7 @ 10   0ǽP 5 0 04 ? 0 04 ?0 0qP\  @Y3H$LD$|a X8x_5 iTi4 i,ip@-PP@ T `` P 0 0 t00p@   T T0T P0@ B?T8 808 0@ 7?3 Yg3 hgA-`P@P T Ux = `P d㼖@P 0:SS   Pr`d p \S+  R0@ 0:SS ^S0S:S 0 R0@@AdPi 0`:SSd @0ARpA0,`0S:S 0C^BC2P 00@^1 0@P0 0 0 00:00@Ɨ`Pᡘ( 0 0 0L >| 0 0L >Tox x0x t0L >ep pwp@ 002 <1 I|e1 TWTe0 Pe(eA-PP@`I TR V; = PPf d@Ph 0:SSpppdQ0:SS   \0@@Ad[PJ pd@ A\@ATp)HPp@!4 0 0X $> 0 0X >T 0 0X > 0 F0X >pP @@@? 00D/ Gc$/ \U\c". Xc0c#. tc cp@-`PP@4 U= T& # P? 00S 00XS@<,00A  RaPAUA0AW0AS70A^p| |0| x0d =d d0d `0d =UH H0H D0d =p\- bas4- tStaq- paHarO- AM MPßP3 0@P0(0 0`p 0S3 "90/44 M/PP9 P0D 8T 쒟  0sa?00CS0 3 / *0:S 84SoE?0SA?00T"<2 0 (0 30 K(!P( 0B.K:SS00 B0$ 8T S#䡟 440<4 0 S BKJ ; /04$ (4I> <4 0'$CPtB>K0C 04 8 0S:SZD H R0 0  Q!000AM04@@0= 0:S > 00UiPe0 E0 <I0 :SS008$ 0:SS00g@ 0{, aa`&p_`@L<* ^%@-0 00 -H-M0 S0 00 0 0 0@  00^100M0 R@0    R L00 v@ 00 0 0 30KH Ѝ/ X@4@-I0 @ @0<]]O-@`,M$xxPKd20 R\ 00@`pR 0 IP Z p -P p J / J PP0 S#: =% U10 r 1$4S1$ !@00P ۸P0S "<100S (!0 0 $0 306 ,Ѝ U r :pP Р rP 5SX0(, VT00#    8PP O(P0SL|n<t[[(& ˠ@-(@M@@0?PЍ蜪@-Q@0M 0    ",  0$0(0T L=P0 0# 00Ѝ ?=0Ѝ0-$M  00 01P$Ѝ0-$M  00 0!P$Ѝ0 -M 00 0 Ѝ 8 ?07/O-@@ sMPPp`0 V8 @X0^00pAtA70Oq PP0P >TAC60 0$00 @6 t0 0 1 30sߍX0X XG0 :V<0< <H0 :D:" WW" XW0   M Ѝ,O-ϟ MPÍp0_ Wg 000!R !X P  ]5P4%X 00S)00 R .> 0 3 30 ߍ`. 0zS 000P0C0 pXgP o@0 0 5P 0C PSRP =- 0 >:W=- 0 4:a`0`F p0p0S8@0 4P, 0P0CS0 0000偼0S0p0@0 0 4P0 0C P0 SP 00 pg0p0SP 0Sb0 0_00S 0p000Sp000b  0 P\PY+PS  PO00SVp!p3`0 S` 0"P P` 00 000020p0S 00hʠ@0^T@pp,(0?:TIP 0', 0$ 0 0$`-Q\ ]QP0 ` Q: @$00!0SVp!p3@`0 0d:P000 P& 0  B00  `J:0 ⾓p PTPpG@0SW `P 0@0080偼0S %P -00SH0p00p0S00 P 08pG0Wep8pFWp!>᠈ m@(0H0p0 +0BMS00 [m0H0 00CS0c000pWH&\0XS 00 0 (1 0        0H0 0(0L0 P00-0F SJ*N0 `p(@園0V '  0 '(0 4 8@` p>(00S @P V ,$00SPV`@ T@0  R  R=  0 BV0 5 RP/0pH  Ry @0H  R'  `V B   H 00 0SP HX A 0p0 0000P00nLH!HHQD@$@(! 8! DUHU! UL     NM<   ؘ`C C$ `pG00P0W0S`J 0000P T0$@p@00Lp00 0P00( ; P6 0  B0 0  y7 0p P p/ p 0S $0 PS0pS`F V  P0 0@00WJP ($@X T 0@0 0[0S9P [($@  0(oK00>4m009V~*$  ]R R@Pp00@0 0oP00s$  ($ n4X  @YP0 0PP 00p,004@bP P P P P] P 3#0 5000C ,0O[ 0$@(j ` @vV @ ](0\0LH0\ ,P-@0 `@V`p ,X@0Vp@H0 B0PH0 B   H `V  0SmP H0 p H00CP hX0p05Lp0@P0 00 0?oV20SX 00 0 0p B0V 0[ R4PU0 /P N ׏ P 0  B0?0C  6. 0(  减p0 P s ͏PX P`Fp0S P [[ (0 {1(0 SA-@P`p*0 0@*@-@`P MDp*@0p0 000@* Ѝ4A-DR@QP`x v ,200S8 f*0P1S010t G000P`$ pW@0PD ᗍPP` 0 500P0 0 C `C000>*0  Q  Q*RQ3 <00@8 0 B`0*'P&00P0 ߋP 0 ?B 0#A #@ #T0T T`0 (4} B0 ))`< T P=p@-@P) L0@)p@-0P$L`T M 0S pW  07/@P Ѝ5@ Ѝ$0$ $08 30pd<@ <0 00M 0ЍꔩA-0P$L`TpM 0S $X 0 8/@P Ѝ5@ Ѝ( (0( 0p 30$d ;;00 0M0ЍꬨA-0P$L`TpM 0S (X 0 8/@P Ѝ}5@ Ѝ( (0( 0y, n30( ,;:00 0M0ЍȧA-0P$L`TpM 0S 4X 0 8/@P ЍD5@ Ѝ( (0( 0D 5304 :900 0M0ЍO-MD`PpZ@@` T6 0US``$ZG 0SD [A 0 `;/0S+ @$lV 0S H[ 0 ;/@PЍ4@Ѝ0$lV 0 0 20H 0 0[ 20h h0h 0Jh 20D D0D }\ 02 9T8 `99 97 88@-$$@M sЍ謤@-0P$L`T M 0S 8pW  07/@P Ѝ~4@ Ѝ( (0( 0 o208p \860 00M 0Ѝ̣@-@`pP94tt0l尀 YT  2@0 O$]$ F눣($B$o0O-ğ$M `H0 P 0P 0u pP3ʿ00000! B b09<Bp  UQPE @ 04BL3@0S0 MTT  MT  ^DQ #2!Q   "  R  R  \000!#300@ 00@00 @0`PU*$Ѝ@0 0M  0P-0 S^^?0@0 0`0  P 0J ZS0 { 0J ZSw R @ \1 0000 $Ѝ0\  v  `0\  f  `0\  r  `0\  s  `\00 00 00C0S ``0\  a  `0\  b  `0\  t  `y0\  n  `r0xP0U 0 D RQ0\  @`b qA- Q@Pp`! }P=0D?o! D2]R0S =h0$"0@ !1 0 V V 0+ P0 Ak Dk A-P@p`P.T T t0! D32 0 A_T %<0$"0@ !1 (0D,TSI6 k O-@@ȟ SMD(ȟPP x`pt  ?o2V0S Y W w@`0P0  X0P0 [00 p1# 0 S@ PC1T- U T 0 1 #P00? PPk@T`P @  "1TP 0@T0P00HC1S@1@! <,` pPJ 0 (010S V <0 G0CPap1  * 60 0  Rp1  ' 50 0  Rp1 00p1 00p1 00p1 "00p1@\00p100Sp1 \ OP@T`|P454%40 /@L5%0 / 㤈P* N4$z0 / 0TPP{4$0 /4$0 /Y4$0 / p T$ `p@T 0p 9/P100ᔉ咉吉厉$3 0 D1 30 Sߍ@@w0`S$O 0S,0  80VR U 0004p@p`00 0 (  @ `ɠ8ʌ `pPQ^_A (, ^]*  P2 0*A5)q @. 00 (0<Չp 'ax ~$0~s$@ 20 ,0/T 0 0S0"700 0P  {00, 0R 00$00S$0000P04p0S 0SV W1!0 .4p000Id1 @`,@(e(0 [PY4*( / $0`0S$0 DQ  JP T`I0 000p0lD$ p P/ ..| ..< H.. . . -. -,8+ *L@-@ M(0|0x000000@  @ 80P @0 0 30 Ѝ"T@-@ M,0 0(00x0 00000 @@ 80P @0 0 30 Ѝ뜓\p@-@QM`P0 )0 `aЍp0@-@RMP0 )0( PKЍ0@-@M 0 00 :Ѝ-M $+Ѝ-M $(Ѝ@-@ M00000h0 @ D 80P @0 0 30 Ѝs뤑@=T@-@ M(0  0 0   @D <0P @0 0 30 ЍD<ؐ0@-@QMP0 0)0 Ѝ0;0@-@RMP0 )0$ PЍ0;0p@-@QMP0`0 )0  `~Ѝp$;-M00  mЍ:-M( \Ѝ:-M $$LЍ\: 0-$M  0$Ѝp@cH H0H X0 Q, ,0, W0 G\ h4 ̻@p@-PP@" T+ Pp bP 0S S`P p@`p0p@/L L0L w0( T, ,0, x0( X d, 8p@-@PP U p@ bL L0L g0< U, ,0, h0<  X̺ 0@-PP@ M T# `P Ѝ0cbP 0Sl00 cP P0P 0L T0 000 0L Ԅ l p@-PP@! T* 0 Q p>`P #bP 4`P  /`P p@)`L L0L 0\ mT, ,0, 0\ b̃ dظ G-PP@J T  R# R `V$ V  0Lhhqh pl 0P< R R4 0 00 0 `V000 0`V 0| 0 F0R%  0 0 0 I0l  0l ` 00 00 0000 0L褸 $%X $ 0  @- / 0SAS/0-$(0@# A  A A A0/p@-PQ@`2 V' T ^ 0S^  S 0RR00p@@Tp@0@ @;0 (0( (:0 y  C- MpPÍ`@PL TA A< YP7  Y` 0S d!\1 0 3 30Nߍ(#@- R? R0 ! ( p0S /% 0p 0 0 0 0 0     RP  R0ꨫP x$ L$ (lO-|IMxğ,M IM$J͍$@@P p`WP W0  $4 I0$ 0 30Iݍ,Ѝ0 SJ=00SX302 20 ? J=00岰h} 4#+4J8#8  ᑌ H J- 0S >UV0  SV S RNJ=001:02 00嚏000H0 ,0TP @,VU  W3 0S_0S  0S0s S0S RJ= 0 J=00[WK O<  xXP_  0SJ hf1a! 4a4#Q #< <0J8 0J=00x 0 Po J- 0SJ=  0rS SwJ͍0 ~%j! 00S_LP P P J=00W0  XPJ͍TP zP} | ̓O-88ğ M@pQ `@$0 0CPS0#3 0 0 30Ѝ#3 0 0 300 HD@pЍOWXc 4"4 8 P# #8lpPT0S RK 4"4$!$("( "8#8 DSPT7VT00QWX00 R0SX 0Sd S2YP00SL"0 (T@@O 00QWX00VT;|! 0 X: pYp 1嘡嘱 P0 pY 0@D    T00? 4!0 ݊piT 1i #Y8p0萟蠟PP0 p   T00?pW 0@D D ொP^T[pB\  ࢊx` Dy |L8<|ЪO-p 0 IM8 P@`p/  P PW  PWD  0@S000h &h0aa00  0 P 0 0 1 30!Iߍ Z C0VX 0S NP 0 /0ۨhA-@P`p 0 { 0P @p@-MP`P@@P@T 0S  R0S P<@PЍpP4PЍpp@-@P PuX%Xp0 @0 r l0S/. AA0C.S .R Q P-S Q P_S /@-0 S@RO 0RM 0^G @PTO 0S`V DDp Wf U` \# DPD`VR S`/ @@@0T*R^00^00S 0 0 0R0C?o20SJR 0R 0^ 006 S0S0^ U. \2 D0D@T 0U& \ D`DPVS` D@D0T\U \ D`DPVS 0R`V\0S0p@-d M."@0' P  0R0 0S  R la  haR 0Sd .P 00 Ѝp  0S S0S,  R R R  R/@- / 0 S /0S S/ 00S S/0S/ //0@-@P M 0S PP 0 PF@ 0S0S 0S  Ѝ0$0$ $n0 o 갺l 8@-pQM @Q`P Q Ѝ0SSp P*(4"<8#8V R" R  `0S Ѝ Ѝ00S S<0 P 0  Ġ؃p@-PP`@ V T! 0pPpx x0x t0 V\ \0\ X0 T@ @0@ <0 k hj t<j zO-ŸM2pC P 0 0`D\P0 $03/P 0P&<00&,SS00 80R0S_ Y0S@p(p$&$(V"(I :0@D@ 04,Uq*0 C 0\`Pg0  $03/P_ P]]Z]`W]Vp `M80S?&<00S ![?G]` D]A]6Pz00 \0P4   P P, _0P( d&D04D0Q d $RpX $Rk 4 40 [ &<00 So 0K'[SP00S04,X0@N pW} 5p`000H00P0hP0$,`aZ: `p``p ,055U 0$  `  RP $8$#,(@0"(@0S S000 0SaZ[w 0LE0S3 \00\00H40$0&<00S1 @aPPW  (5$%0 5s{ ,0Sp #0S~au\00@ (0R q[? [[^[ @/PPWU,0S <0pC 0D\A [<0 C00P: 0P00,00,0-0@@T@.\@@^@0d2z0 0h[PP0 $03/P X00 S  P@ 0RC.P@$&<0P7 4!(0%P rc!1 0D (0Sh!h1h 0`D 0SH!H1H DD 0 0,aRC`P.@%@0.Acp W0@3 WD0%[PD0v4 4 R  Q QX Q 0ipX[ 0([ Z АPZ H Z O-@ğ SMDP0)^`P %^pP $0  088X0`00pS0  PO 000 CPK @@PX 0  2PC`A`@#|3 0 D1 30SߍY 00>[00 Q0 0 .Q0Q RS% d! St*+ 0 P` ` @S Rd! Sf*.[ 0 P< D lPdq 0 DDQ0000 0000 Px0=S Z0S# S S Q 0 Pc0s70SS0S Z000000  Q000S0000 P=ʊZ00 0 P3ʀZ0.[0 0 0sx uZ00t 0 *.0G0 oPaZ000 DDQVZ00U)c_OZ00R\HU oO-`@VpPM 43 0 S_ q`PL 00P0T0X0\0`0d0h00000 00000PSC S$ S0 0% 0#04pTp0  0Ppp0000 0000 d1S LЍ 04p#ጀ대=X9Y00YP P P 04p#ap P p08 P 0  `0 S< 0081 0T0 0 ?P  0 p7 P!004000  0P^0S 0 S00d1SlXI   00SR hpO-Ÿ @00@$0` pY i;92 I520Y0 0 S   S  R  R Q\}  ^ \/oQ" S R0S  0PQ -0 0S Q0S %0P 0 ΞP:  0 B   (EP(BY 0( P p0`4P8p`P,@<Y 0S@TF 0S[ 0S S 00SL P(0 0= RBP R? R<0S0S `;0S%PU@;35 \ ^  ;00U Q  P \ ^  R R  - p& Y ` P 0S   0?S C" 0c6#PY  ^i #\S㔐Q^'@ pTp0S 0`@ p$p T d;42 D52H 0SE0 S > S PR  PO 0@P0 0`P`&0e/0 8(0 @YPa(0@ S0`P@T $PP@P [[T$PY@T@ pTu W 0/0P` 0 PU`VX bZPS 䇟PpH0!L0 0PPHP$p]PPPB [0S: 0S y[ 0`@ X'X7X Ty/0wQRSP㔐  P   P \?oR20S b R㔐P NP\IR PLV `$p(,PP00 00SqP@T0 (6$p0(,PpP S 00 0 P@T 0S00S`;`9  0 yP pY 0NP-  0P R 00S R00W  {P5 0kPY 00S)$S㔐R0S x$x4x 0p}/ 00n,@ p0`4P ZRSQ \`@ T# P@P ZZTS㔐b ``{Z@ 0"P 0  0P ` @P eZcZY@0#030 ,,0c ` `S_] PEZ`00WP 0 PP[PP HpW0!@%`!!:PW@P  H HF6H`L WP @L@*`@ Z0"(` `$ P,W 0@VP` @>HM댠 p0W|0E 0 0B l0 0 0  Tp`hx !5P PS0E D $0DP00EH$H|$ 0U Sr S 6^ $P -(}0}lF E E 0\XzB dx`wc@ $wvuh\Ii Q D 0P03 P Q$P0Q W : ᚆh,pt0(` 0 0q"0S0 0\YH@P P0U 0PQYP0U IY0`$p(,P{$PEb.> f x忇P1x00x0 #Y`@`@HP0U00L0PYP`O-PLM` Zi  @㰱q p  PP0 0 T0PF ``0S S S T@DP `0S `(0 ( (`.P00 U `V Y 00  Y``VU$@LЍTT T0T P0".Z8 808 40".ZZ9 Tpoh 9 oni G-XMp@AwP `P@ :00  (0 KwP 40S0- XЍ PP TX 0 .wP CX8 8(Pğ  $,4P$ʃ @ ! " xDb(@@ #! P\D@@0,0#P0@Dc>@ @",$P$Dʃ@@ ! "0P Db(@@ #!@ @",PCʃ@@ ! " P Cb(@@ #!,PC@@0,0#0hCc>@`" `& `jDPDC@P! P%@P,#eX @# @$@#D  , $0l̈́ 0 ! ba` ` " X`"0  0#0 e0@ጒ@$ @|ŸdM   " b0T"0  0#0 X0 ,,  b(Ņ` ` "  bMD`!0  0#0ck0 ̑!  Q<P0 P0#0Q5 PP "@ b-@@@P4d , l˂ Da @`` " (p,P! P%  PpLЍxjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ@-@P 0D DD@  00,0, ,0 ꉫ#EgܺvT2A( _G-PPp`6 W* 0!ᣑ000? 0"@@i>V0: =0iS@I"p ` *40V@@p`F GH H0H 0 ~, ,0, 0 t' H^ ^h' p@]p@- ! 1 0MPP0 00@( T1 `  !? 7R8 bx b$   0 0 0 30X Ѝp@` `0` 0 /T@ @0@ 0 $ٔؿ& DT& l?\(& 0?\C-<"<2 0 M000$2$"00 @00$ p P`0R   0XS 00 Q .. 0N l!\1 0 0 30 ЍQ  Aa 000C 80BS.R ^U* 00mRP 0ES0 S S^*0W 0n(."4n4#00 00@^0 8< 4^*0 8<ꄾd- McP Ѝp@-D!D1 @0(MT0$00B  `RP?o2T0S8 0T0R0S A 0 0 $0 30((Ѝp (0!@$R0@0T$0B0S \@0S ( !0$ R0Dړ" " A- rM`PpP: UB @X0^00pAtA5Q0OqQ01 000TAΌ LOP5  0 {pP& 0@PP 0 0 1 30 rߍ0 <0 Uh0h h=0 P Q00 0P0m뜺B.,! WTK! `W0   M Ѝи -- M0 0x ЍЍ/--0 M0( 0 hЍ Ѝ/dp@- MP@,0x x` 0 l0  `@P@X@/0@1T  ЍpȈ(@-HH1 0M` !000p @P   p O~@ 0 0 0 30'ЍA~PpW @@T PU 0SAP@aT\ 00@꺒넷i 0p@-P0@ 0 p0P(0PP(P,PP 0t0PP 09P 00 0p88tP 00 0ppT@<S 0@-@ 0 0 0 0 0 9 0 00@- 0 MP @0P 00P 0 B?o20c Ѝ03 00 0p@-@P 0U0 0pp@-@PpP0PPlP(0PiP(P,PpO-p0Pj `Pc 0@00 S S0 S S tPR 00q(4P"<8#8U 05 (P@P 0P00S S S@ 0AS A@PQ% 0 PS0Q0000+OP  NPP 0@@PPd8R77G-@ 0PpM,0(Sy:  (T] 0 T0T 00SP 0 RJ@D@T0`E   RA 0@D@D0`0S* T0U 0 1  @D@T`H 00S#0A S0偠0  <0S000   +0S% 0p@tO0pppO(0pmO(p,py@ЍNP  (,@p(~  Ѝ00@- 0@P M   p P  Ѝ0 0 0$ $ 0P Ѝ08p 0$  $ 0 1 Ѝ0O-PTMe pE,P@ @0 ppPPd,L`P` 0 ppPPU,PPU0 @\ \G \Q \C pp 0U00S LP. p0 0 0@ ` R  R2 R[ R 0 @U 0 `N 0JX0L 0 TЍ @\L@ 0U  0⼰R  0 ` ` 0Gp@71@- P0 P  000<890 A><à 0 00 AЍ00 01 0 0 0@-S@ 3/@KO-M@Y Qs` 0  @ AA! B B&"@@" AA! B B""@@a AAu! B L B \ᧇ" 00\|3 L0 1 00p0`0`Ff& G B$"HHࢆ(0F0C(6# B B("HA!0C0C1# B B%"AA!0 Ѝ ZTr `  z  Pu 0 po 0 J0 E! G B$"0C0C6#AA#! B B("0C0C2#AAa! B Bu"0C0C Z㧇# 0Z" Z Z 0 0 0 0: 0 p5 0`\\ 1L0 10`ZZ- Z) Z+ 0  p 0`p0L0 1 0p0`fZd Z Z Z0d0`YHp`F8p`0|0x0t0l0hy7  p @-@P @ L0 /0  <p@-1!00 P@0 00D@1011.T 0@\0 S@ A P p0  00C1000L   00LDLT ʚ; A-`M PpM&laapGQQNHH0   @ N 07 Ѝ̤ Qt:@-2"00 P0p 0C0@@@m 0@@@f 0C0 @@@@E 0@@@> `0@C0a`.SM @000@000@ 0@E0C2Sp 2S 000 @ @  @0`00n l afAdaDn l lA`00@  0@A00  0@@0000@00 @ @@`ixt  O-``!TP@@R@@<ǟ MM|č ǟT ਄L<7%G0P40 0 0&6 0 P@ < 0D00U0006h0H0p0,0 0  [P00T00S <0`1  D0PU 0P 0U V HMmV0h0S 䵟 ,0U?p5P00P 0U7 W,0?p50= 0Q8 Wd0 m@V,0? )R 04p$UpP   DP*4 0,4 p0T4P p04 p08p4@p8 00SHP dF0P40[(0 $3 0 |4 30ݍЍ_3P `0^0S 00T00S <0`1   Jp l40S T#2 0 |4 304ݍЍOmHp$P,0!?0"( wlUX" 8 " \```PT@Xbl@F`DV?xT 04  S D$#$*D(H"($H3 Z 8Gl pJ  J?l T0 P:2L p 0J00 .JZ+ T@F0 `D"VT@X\``ꌱ0   Zl0  0 @10d` `ppG  pGkT0 d`0L p 0K00 .K+ TʴI k=댘hB؞|6H?t455@ 544433`3H43t3X3L3,3^111\11O-tM@@ `PVPPh0 0PPp 0  0`14S, ἴᾤ0  (6< 0 V 1P806< 0B>PU  0R40008 `k`1S   ;`1S0 Q0  0PJ0  0P7P  PP$0  0P0  0sP0  0gP0  0[P0 0PP`1SxYz < Pi0ppW  0R 0jXpW 0pW  0Rx 0jEpWf 0pWa  0R0 ,0j2pWGpWD 0 PS00 j`1S   0 ` 0 `@0 `0 `, 000 0I tЍ   Y _2P  04001p 0)001p 0001p 0xt1p 0 [.GHL 0jtЍ tЍ 0 %10 0  0 0   00 x0 ꐐD/Dp/\/$-h--,8**d*8******t*T*4**)@-@`00AMM0 400p00 ?PP0S oD 80 0 4 30AލЍ.*UL0,@-@ M pp P?`P9P 0S@  Ѝ00S.S 0S Ѝ`p@-|0|AMPt 0 ` $ 0 @P 8 00 0 4 30Aލp؇p@-P@Q`  @Q ePV 00pV00p@-@ M`pPU 0PU  0\W 00 Ѝ_00P0 `W00 Ѝ%p@-@MP`0S 0 @S 0S@V00ЍpO00@0 PV00Ѝp%0@- MPi0@0@0@T  0U Ѝ0p0 0PU:L@@ Ѝ0<00@,0 0P Ѝ0 {.l$% $p@-Q`M x00<@.P 0PU  0VЍp_40P 0`eЍp @@4z#yp@-MP 0@0@=@T  0UЍpt0 0P@U:P@@Ѝp <```@,00P.Ѝpy""$l"0@-@ M Te  T T 1 D0R  T8 2@TP |QTP Ѝ0TM  T/  TJ DQ TP 3^41P( 0@T T: QTP PTP PTP P TP PPPPPPPPPPPPPPPPPPxPPpPPhPP`PPXPP ###h#L#`#""#"l"p"l"p""("T"h""\""0@- MPF@O@ zP Ѝ0 0( 0P Ѝ00@- MP+h0h@0@B>@T  0U Ѝ0O,0@ 0P_ Ѝ0v\ lMp@-@ML 0 Q0P0<00P@ ` 0. 0@T @D D000T H0 0 <0 30 @Ѝp@Ѝ/.0 T2 !O-PM`@PP p0 ܣQ  ЍSq SRPP -R0  0+R0  0h30P0 00 B10 11 .R 000 @T@0✑)SQ 0R#300@0SQ #3 00R0#03!3 T$ +<0+80+40'<0'4 0)< 0)400 '( )( p 0R0p T000@0SP 0R#300@0SP #3 00R0#03!3 T   T000@0S\ 0Q#300@0S\ #3 00Q0#03 3 T   00 Q 0N0000J00 0 0 >~O-Q0 dM R Č  $Ȍ (̌ 0 00pp< pp_p  cPc$ЍHC-@P@ `p MPOP @U aP@W  Ѝ @XPt0 0000 0 P"@0S0Toᨂ#k vC-@P@ `p MPx@P @U WaP@W  Ѝ @Pt0 0000 0 P!@0S0Toᨂ#jup@-@P600CS0 S  P `0 P-pd`0 0CS0S P 0 /d@-M@0  0000 !R !h0@Ѝ@-0@S@#0@0Q R#  004S 0@R Q R 8 @0Q    rHp@-DPD0P`@0pp 00p@,X0+qH(p@-@ @ `@0Ppp0p@,XqHA-DD p@0P`p0 AqHC-P0 `0pMrp@ H 0D @ <8 X@Ѝc:pHC-tPp0 `0p MHp@ ( 0  @ ЍA:pH0 00/oH0 00/`oH 0 00M0Ѝ@oHA-TT p@P`M p 0 Ѝ oH0 00M0ЍAnHC-tPp0 `0p Mp@ ( 0  @ Ѝ9tnHC-|Px0 `0pMp@ 4 00  @Ѝ9mH0@-P@000 00M 0 0eЍ0PmHp@-D0D 0@0pP p@9p mH((  M  0 ЍlHs R) p@-P`@V 3P 0S.S  0@S \S 0SBp0S @Dp DU!B2p/@-P0pSp@ M` \0T  0C0 ЍH0H0 p<0<07/0< 0 k8,O-Mp`@PpM WC*00V>:Y ` <1 p0 p, `P 0 p- 0 p 0% Z ` p0 p F0?V0S0 0 Ѝl0 op 000000Ѝ 8O-MX@ @D 0 ~p_ $0S`p\ 0 qpR 0 0`pJ  ;00(0#8 0;00.0 .00R0  0 AIp* 0 Y0D:08H+@B0?R0Sh*h:h  d0T  @ 0ZD : TN 0 RP@*9 0 0 30_ ݍ Ѝ= 00H0<0@00 0 p@ 00 0'p,h) 7` H =< 0@ 0 p0000< 040 B~P0H8 @I0? R0S(8 0T &=<00Se 6@0D;8d 0 P`0 p < 040P` BFPH=<00S 5000Yd 00D7 00 pa =<00PC  7 `P V ʈwVp{ @P 0T00 E`pA 00d0V0@D^ l0 Rp2<0P`40p@C 0P`P"0 9p 0 P`PY=<00S |5@P50`@DK<6d 0 `PR0 p P*=<00C50BE0@d 0 07p0 p 000d D; 0$0 p 150d  0 p `VD S @TP0d 0 00  p 0SDK =0003S 0 p DPUD t dtddp`0X1 0E@HS 0P@0 PjK 0 D 0}p^ =-00< 0 SZ 0 PN=<00 C30=+L0X 10"3`# 00;L0==0;L020 200;L000300;L0<=0;L0L10 0;L 0 0p 0D 0 SSrp@`T P 0d U`  R @ X$ 0d  G0 p @T 0=+L0X 10"3! 00;L0==0;L020 200;L0L00 0h!;L>L C+A0X 10"3A C0;ue|elP(4 D`l0`5H P  E(`   % $ * 0 D(  @ *x == ==== (% 0 VUUUL\dd pH0  `=000+SI =<00SI@0@d 0 0z`P0 3p  0 d j0 %p 0@T0DKI*xQ `pPTDK> 0d 0 0L0  p  < 040 BP0DK 0T*P rp\^ `P倐P 0$VQ  R @0 Y$ [0d   0 p @T0-< 2!?C0 Sh0 p@ 0 p=<00SH 2p0D;3d 0 P`0 pl <040@C 0 P`%P^0 upV 0 P`PMH=<00S =<0X40 0 P9=<040$0d 040 0 Bpk"=<00S| =<040v=@  <<0 ~ 2@}2@000<`DL5( 0Y P@0 p -< 5B !?C0 S0 p(=<00Sb 0d 050 / 0 p `VPpD6 1RG@0`P $0@@@@;= 0Hp 0d& WP *( |60@@6 04/$0pG= 0p0VHD 0 S@P0 p @P<0P`40p@C 0 P`4Pm0 pe 0 P`#P\0 spT 0DK 00CSw 70=<00S0 H[= @ 00%kT` *0(<(` p0p8 T07/=@D @P 0`0H[08d 0 w 0 2p 0YD2*`@xp0p DPY V 0  p `0d  @I 0 p `F@P 0 Y 0 p@P< 040@P BP 0 p PDK-1 0@)1H&1D  8 = 00@P ( |:| 0P: 05/P`10@DK1p*0Y~ 0 p~p< 040p B9Pr( 0 pj HkDK`0PD[ d 0 0 spT 0PD[ 0d  0 apB 0P 00 @0<d 0 @P 0 Hp) Hq=<00S\,0 S00=<00S L0@d 0 0h `P0 !p 0p00d D; 0U 0 p  0 d G 0 p P= 0DR =<00SP D0@A0P>0PP0@D;=@2 0 `p0 p < 040`p BrPH 0  4 < 0 BdP0Dk 0PCUx@pQ@T 1 W2 (0d  0 px=<00S /@/p?@@2 0D P`0 xpY 0  PQ O@0 DdpE 0  P> 0 DSp4 0  0P@, 0D; 0@p! < 040@` BP_=<00S 0 C? 0j=<00S 0  4 < 0 BP0D 0 S</ C 100 S{0 p,0 H{= ` 00# VP *0(. @0> 04/0-p`F H{D`X0 p0 H{= ` 00d#VP *0(-  @0= 04/0-p`F H{D`-0 = R =<0=0=<0t=0 0 Cd=0 0 CT=0P$ 0 PU0D[:=<0}=<0=0P  `P&VV |p@P 0T00 EbpC 00d0V0@Dn0 Tp4P<  @PNTTo (|p`P 0V00 E6p 00f0T0`F]B0 (p;d 0 `^ 0 p U tk`PUDK  0d 0 0F  0 p=<00S=<0:05O.j0`pD{P 0 p :d P0  P 0 p  0 p \ 0 p .P` 0 Dp = 0H{` PPV *0()  09 l09/=p`F `H{ `p 00 `po l 0 pg -PD 0 D ypZ =H{ ` 0PPPV *0(( 08 p09/=p`F `H{ `p 00 `p0 0 Gp( -PX0 D :p =H{ ` 0^PPV *0(' 07 t09/=`F ``pPH{ 0 0PBp 0 p b-0l@DK @ 0p =Hk P 0@PU *0(& p06 t07/p=`PE PHkP` 0 0p 0 Pp 0 pS0 HK= ` 00P!V*( 5 0`6 06/0 HK= ` 003!V*( 50`5 06/0 }pU] 0 Ch50`0 opO ,0D(5d 0 0 [p;0 Rp3  PDK 0 Po0 Bp# 0@dDK<0`PC@p0 1p  040@pP 0DK 0S 0 pDt,` @DKNSd P0 Jp0 p ],@DK80d  60 p C,0D;L3d 0 $0 p < 040p B}PD  0PC 2gP`&P rp@P 0T0 0 Ep 00d0V0@D 0 pH2H"0 <0 p| rp@ 0@Y0Dg:P  $@PYTT qp`P 0V0 0 EvpW 00f0T0`F 0 fpFVH0 [p;(0 Rp3 qp10L\|TH@PH`8d<h@h@\P@hl@xx*TH@tl`,p؜ VL0 p l0d 0 )  0 p 0 p ppi 0C00T0 p0 p qpxV(0 pqTT0 pt0 p qp=<0!1 0+J X0X! ##1 0  +J X-- +J XX" !"  +J XX  #  +J X,- +J XX! "  +J X 00 ;J0Zp; PUD '@- R  MAL  ,@0@(@@; Ĝ0 ЍMM$000 1 2Ѝ/<A-PS`1p@@W0 V:0 $4"48#80@PU )Pi(0@0T0T0@DT0S,0, ,l0 QP@|Ԛ G-0pW9:P0 @4$#4T0/` 0 4$#40 @T"0 T4$#400S X0T0 $( ,0 P0@ (00A-QMp$0PS@` 0! $, (0v(`V|0Sx(0S0! , $P, (0V3100)Pi,0 \, d0U4#4 00,004#40,T(0P0T(0 S0P$00Q (0, Ѝ 0FP5, (` , Q/:04800XS: 0ST.C+SQ/+` 0000  0C Q7ࠃ0ࠓ0CQ 00000  0C Q700C20L0L L?0 404 4>0 " T t0 PA-Pp@LU`. T @0 x0W``W0 .pPEVp P7000 2000 S70Q00 V00 0  g 0 P(/|+o/|d+///-@-` @0 0DM0<000p2 020 RP=-00000C0< 00 0 <0 30DЍlHO-h2hrP0੒ 0 M 'r DrgqC8(00B刀B$ C@$AR i!dP @`3@CG*TNXWnY1Z$* @ 0 Sp: [ @B0?R0SJ  Ѝ @ 0 Hzp# W0Y[0S    00000000SW 0 Wp@@ 0 DLp XW  0 M?p Y L0L Le0  Ѝ @: %I$T A-`pP:0S-@ T 0D0@D0C .R T  S\RT  S0C\R@D @0.  0 @@Z( 0 p@-M P@ ȍp k`\ p Jo4 (0 0 8 30ލpkl0-@- M0@R0  MPP * Ѝ@Ѝ/ N, Ѝ@Ѝ/kPRp@- `@PPP0 ?p@7X00pPRp@- `@oPPP0 ?p@X00pp@-@Q `OPPP0 ?p@W00pp@-P@WP p@ p@ p@-@P 0PS <0S GP \00p00pQP@- 0R R  m00p@-PP Q@ @Q Q Q ARt032 U00p P !@pP Qp@-@P PP  U 40,E0S &00p UPpp@-@P] T 0 4. kl\ ʠ5 6 0p0O-MP0@ )p讟> 0S @P00 00. L0P-Q000Q0 0 00A SG ` @ a0`A L @00A S,TT Љ0A=01 0Q- pQ# P  ( EQG 0 0@@0SЍ0S0 EQI@(L0L00+S -Sp! 0 C R0SL'L00S 1 CR  R #^iSM *ISJ NSL@ xP L00(S t00XS PLP0Q Q0 0r@n} T0Tpp(0$0@<01$C Z}0 0S%$0S| $0S0$ %0cS0`S%0 $a@V@L 0f0$ pC 0pS R 0S00 0W0pMWW'r" 0 +  0pWS \刁5A\ :L*0Sh&BS5\l :%h PPP 0S \:%PYW US Q"00 RL000S 1Ѝ( T0K@Xpp$0| XRdLT 0Ru 00L0 0R 0l10BS ER0 0 ' L000L0Q P00p0L00@@ 0 0000 vP $0( S B  ?R    < (08m@P@07A0C3@0 U  0``R 0RK`FPES[\$0SVU UPV P娃PQ 0  0勃 0S P  v X7@PvPU&6A vP 0S \ 070jS k&0B0X&!~[ 0> \PXq ~Pxv t rpP   ! l0d PP P d lR0(0`C 0(`S 0 B  B PPR6ag0@0ms0S 1%(0^ L 0C10 L 0B QQL0 (L00C Q4Q0o (pP(h Ta@`T Љ T\@T ㉐0 CL00C [!L 00 B0C [@P\$W knS PW P坁 P, v Pր, P kpPpj(߁pPPY  u\` 1@P,`-uPu [X0S46S p3uP# d3}0 !1040, Pc2`VC <0jV00S "2tP P3{[1@D0Dk6PCX 0}%}@28 0S  R |z 0}X00 0@P!=1tP PRP NL J 1!e} 1k} 0[!H1040 0R ER  R 6p40 l@00 0lP0x LT q0@ S 0S}  0S 0% 00C?o20 0^ 1 0 !}W X!#N l0#!I d |A5?ht $ȴ|$q N?55?P9?m TL@tP L0p0CL0tPL00XL0` h0%N56BXE\0A#|%| 0Q56Ut 0% 0# 1!LP00B(0 0@a`] ER@(B`y 0@P\eP 00S0 Sy@PApg0GruW0j0 08 ||pq p0S% H0$^LR EQ@ `L` `@( 2sP"2sP 2%Sv,0Ss 0%P dPR 5&tP~0T X95F\@~!$m 0@( #1 0 |W ~ 0S \3!:k cR R4R 76K0cXp\0\ 0dP 0Sg0X0d0 `S80S 0SU V@TP~~ ~~ ~ 0SI 4 {40SA<J 0 %Q4! 5# 85!@l LoPrp0l 46%x5\ [0n S ^X0 X 0j{VX0@SUN\ 46SI60jS\9k&PBX 0g{X00\ 46S`60kS0S0S Pq P\ u 0S60T kSR7S P~~ ~ ~ ~n P P@(W 0S \ 870jSS7X0S ^5 E X" 0{ 0% 0cP6 X02X0 0XS 70jS# k`Q ^ ge6C#: :X \0^X0 qP8R 006\00X0 (0 00M 0Ѝ  Q":?C0CS S $4c&&0C0c2///A-P@U `y0pS @ P 0S U@Dp@-P@dP`P0 S :pSSp 0R:pp808 8e0 _$0$ $f0 WHi  (i ܪA-P`/@,T*(P/ $P4 pPW 0P P B $$P W 0 P l l0l C0 T T0T D0 < <0< E0 (h $ԩh g 0 0=@-@PDQO-^ `Pp  A@ 0S 00CS 0\V0 S  RYWppXpQpW\`\\U0 SP\pf Q@-P0-r-w0-0x000 00000S wS -S rS  0S /xS  / p@-^ PB2 pw 0 pP P//0S/ S S/0S/0S/@-@ 0@0T S R RT/ ?/PP/=?0PQ/?SQ $0$ $p@-0 /,c D ??SS $0$ $p@-0 /ܥc ?S S S`/Q/AQ/Q Q/?0 H0H Hp@-0 Q/?S0?/0?/Dc \QP0 ?0/@- 0  p@-pP 0P0(@` P_a0Sp0@ @`p@-@P`M P0ES  aЍp  P7a0S 0 0 Z0 `a p@-@PpP Q 0S Pf 0PS` p@] A-PPp X P@PEX `P@`( (0( 0 H`x` O-` MV " p@IV P^P @0SV F!Э0 `F`1 Ѝ Ѝ  ` - ^ x 010C. *  $    _ A-RP`p(M @x 0 @0@0 P0 P0sc P@ 0 (Ѝ^ L^  T00 5CS /0cS#:3 3Q31:0CS! 2#0p@-@PP U Pp S 0\\0 0pD0D DL0 |U(0( (M0 rxl] yD] O-PM`p 0FV"S00 0\ P @P-UN +UP0+ p{"@0 P00E Qa0ESW0EA0ES70EVt PSQ '@0U0 V)  `0q 0T00S0 S` 0J0 ЍS T 0P 00 0R0  Ѝr `00XS 0A0C0A PSVr `Pr ` 0 ?0 gꙙ$`Z ,`00 0M0ЍTH QO-PMp 0GW"S`@ vP-TPs +T [ ?0 00 00DP p P:Q PS \1 !ʎ\ @00D ^ a0D0SW0DA0D0S)70DS&| [YQ PS \!K"00D"00 0S \0F0 Ѝ[@`K ?0 0㥿  0㞿0b 000D00 R0  Ѝ[@`f0TK W@0 p 0 00Dl0T00XS>@ 00DA B QR cp >` R0T3 W  0p| px 0@`> p PPL1L!L?0 0p 0>00D+00XS W#0p 0 000XS W pp p 0A0C0B QSWpP pe0p 0> 0W 0@ p p0@ p 4333333\V @00 0M0Ѝ  | 0 Q?0S @-_-- Mv ЍЍ/G-PP`P VX 00 !PER !U6@  PG0 6PU pWW@+|Pp X4 00  @@pG  p00ڸ  0@0 0ϸT0T TB0 V808 8C0 ᷸htS 8[LS A-@PH`H0``@p @T  U A (fp@-@Pᅸ00CS0 S  P `0 P|p9A`@-@P c 0`00@b0 60 ZQ - M ? # Ѝ0@- 0 0 MPP000@ T#   q "0 0 0  f| t0 0 0 30 Ѝ0T0T TT0 MT<0< <<0 C]  mP MmP NA-pP@`' T0 V9 0S 0S 0P Q 00 00 R` FQ`00x x0x 60 TX X0X T0 V< <0< 80 O ؒO ahO TbO-ß OM4`tPP `p@dh V Vv Z.` 垳P 30 00 [ .Q Q\.Q a :0 {P 0X [ 00:[.[#4N[0Q.SH Yf0IS00_00 I Z  0V W P00 0 ` `0 0C SA: `0  `0  +00N/00P!@1 0 41 30GOߍ:[ 000$0( @,0 000 `0P  P00 ZX0000 0 ( 0 A<4 tPPG U.R{  :ܲP o\ x L Lz K ]BO-`PM@  0X0 X0^( 0xP> 5000 00 P @ p  P 0 "00P > R  R 0 @`V  pWI1:pG`W:\pG`R C0  ` Z`pG@ R v 0 0 00@ߍ R R0 S S  ƭ P| ` Q PD ጽP@ !T: pi P@D X0P@- #[0k0 Z  ?[` pG Ka  2 pG  Vb һXV P 0(P ` `p R R R RT T * ZP  RPD(P@D PV p@`V2  P' T <:`P P !T014@1:r 0 @ 0ÿ0 0@ 0 @ 0 @0`pP_, 0@ 0@ 0  PP P 0 `@b_F t^@-pp10LM`P0D00@G Lp0PS- @.0 P( U( qp0 0 0  58P 0 I  0 0 0 D0 30LЍ7Ptpp P@ +T@ @0@ <0L +ZD p lD YXA-PP@M8 q`p@T* X pp00庺 0 7P0   0 Ѝpp @T Ѝ7P @, ,0, (0\ ׾ rqC |X O-ʟ UMMLōlz|ŝ`PpxU別( 0 (0S 0 S00X :0$0(K0P,0  0 @[ S#p`P ,0)09 0 L5 30XUލЍ5 0 0P0 $03/P @[:0CoᨂS  Rm  P0 `PPP0,W4'4p8#8X 05400 0 T0R?HDL@08< `\ T^*`P0 C 0``PS0 $03/PK @ Y) p@ T`0@W4<0S 0 S  R08P0 0S!0S H0S0P容P0X`*\0L 0R *p  H0`0LpH0 00S 0 84H0S 0, d0L P0QH RXK p p XPH `BZO[P0 0 0PV ! R  ȠLȠoQ \ V SppQPW  WX0 B@GAq 0SPSPڰP^!P"@Qp`0S 0 ,0`@D @PC0@P0CS`@:Dp` @nYL0X C0 0CS`:`040$0S?0 @0r@Pe0 v VB@X00`VX @`0@``(PK S  C'SRE 0PF 0`B0%P `j2#3 0l (0SV#3 l 0L(0P04D0,0[?R0 0 @P0 8 VT D0,1Q:*,pP䒸P P`P勸0` CR00V 84,p@PPpv0`P@ CR00T@hP`@7$03/P `u/,0D(`C 0T00Pu  , D00D0D뛾 0(?7PG0 @P0 D VH0S0P T D0,1Q<*,0P,0 XLp@}( 0% xy   N^81TA 0 p pIP  ?00S 0  0pW0   0 0R 0 | 0 u 0 0 ^9 0 c2 00S SZ X(V  y@yx4 dIvG-M0`p@P0P0 V 0   0 pPЍ 0 PP 0   0໺2 `DuA-M`pPȼ@P , 0 (   P0@̼Ѝ0, 0ЍA-@P M`P@pQ UV'0S9 0S0S9 P`4418(!<P P0 0p P 00 ЍU U, `/ 0 0 Ѝ0S U 0 00S000s S 04 P` @8 808 4 030 ul_H 0 8AxsO-00ğ DM<h@P 0 (PP `p 0 p2`P ]P ,0 0P0Ü RR RR 0 R R$0 S S , 9@P p 30 00S S S@ 1U g*@ !@P 0S 0 0$0R 0@B PE @ Y8:I S@@3 宺 @ I@P Y#:  基 U@Iq E1P@GP `p   ᎺI  U>p.` V `pjhv 0  0`!L1 0 <0 30GDЍ(tPPE pP =PCk P0 0 0  0t 0 Mp `pP0 00,* 0 0 000&00pTp` F># >e c:P aO-ܥM@P `p" 500SL ([S W W W B 0 Ѝ0P R < ?,0[' + შP(p 0;/qp  00P @ P 00 0 00 ԪЍ p  y=P 0 Q+ L WZ p  0d=P 00 0 SM  00 0;/qp 00PPßQ <PU;0 {p0 ;/qpP0 r 00 0PUßR <0PUß`X0pZ Rg00bX0PZLS  00Q] <P800CPU0&Z   "  RPPL0i?  P;/qp> 0P000P @ P K00 0 PZ 00 VmP'0S$: I y AJ0C09PPT 0S  0CPß@1@!@G0 'APU0 Z 0CJ P'JPP @0P 0000 00ө0 0 0ũ 0 彩H0H H0 0ꌯ <  \\[ [x[ L[O-P,MPp@P` T 000S000Z00偩$0 0PP`W0 00 @P $ 0R00SQR+X` P  0P 0噴0  VP`PX [XhU,Ѝ CRoo$ b  B0 S $ `R``V8 PB0S0: `P`$ R``VR`%X00S P0D0P \[ TP|[  0P \ PPdP^[ CTs[H U $P` Pc z P 0S   00S S0S S ^ S@@T000S00垮i0\#00% ^@ [ @@ S@ U@0@ @h0 Ͳ0器 0B$P LWp@-@PP` U 00F Gp 00p0 60 ॲUd0d d70 0 0@p蔴0TS00 VV V -M0 3/Ѝ/0@-@PP M) U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0@0@ @0 L(0( (0 CUd U;@ |U0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H 0 , ,0, 0 t TTL :|Tp@-@PP" U 0S S S 0p@0/p0p@0/pH H0H 0 ֱ, ,0, 0 ̱ TSp 9Sp@-@PP" U 0S S S 0p@0/p0p@0/pH H0H 0$ , ,0, 0$  LSR 9R0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H D00 _0 000 ,00 U XRQ 8Q0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H D0@ 0 000 ,0@  `QP& 6P%0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H D0P ۰0 000 ,0P Ѱ 3OF 5OE0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H D0\ 0 000 Y0\ dONe| 4N0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H D0l X0 000 a0l N lNMx 3M0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H i0| , ,0, (0| xMLt 2L0@-PP@ M T 00~P00 Ѝ0L L0L H0 T0 000 q0 ߯ X2L #K0@-PP@ M T 00P00 Ѝ0L L0L H0 ༯T0 000 ,0 ౯0 1`K "4K0@-@PP M. U" 0S S S Ѝ00 0S0 02/ Ѝ0003/P 00S00 Ѝ0H H0H D0 u0 000 ,0 k ()DJ \0J0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H D0 30 000 0 )  G{T ?>p@-@PP U p@QX X0X 0K/jU8 808 40K/_p@9 X$> >=p@-@PP U p@zX X0X T0N/AU< <0< 80N/6p@bD #t= d>P=p@-@PP U p@X X0X 0R/U8 808 40R/ p@ #<p =<p@-@PP U p@'X X0X T0V/U< <0< 80V/p@ h"(< =<@-M@*P0.S00ЍM@-M@~p  B0?R0S Ѝ(0( (0 ஫0CЍX<X p<0S.G .S > -.\6 AAQ00C S;R .R0P S.S AAQ0B Q)S .S 0SQ0B ^-R 0S .00 R0/0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C//+&0 0 /ᤆ H0 00/ᄆ L0 4# /0 48Sc B P_^p0Q ^ QC y(00H0S 0Q* 0F S0S 0 `  0AS^01"0!0\Yp 00M(00@$ЍAT{0S"@@A@pZ <@0Ġ?  0^0A>Sp0pS 000^ 0AA^ AN[ ^( SQ0SP9 Zp? 0.$ @C /Q R 0 0R/ި00@G0?Q0S 0 0R/Ȧ~ Vs*p*Y P HP @ @0@ <-0೦cj p>cP0 ?0 U@Pp>c00DX00XS UPpb 0L00XS UpbPPp>c 0=U0@PP.@ p>cP433 D\ 00 0M0Ѝj A-00 rMPPp`, V4 @X0^00pAtA00Ol `p00TAΌ 00`L PP'0 @t0 0 1 30rߍX0X XF0 ֣V<0< <G0 ̣?j i p xH 0   M Ѝ i  -- M0 0 ЍЍ/--0 M0( 0 Ѝ Ѝ/h O-@SM \ YXb 0pS000!R !01 ;PP E`#3`7P*Q30A 0#1#2#4#8 sP 8   [ U 0C  pSR\P0 0@pQ 0S  Ѝ:T 0 @00808 8@0 )) 0 0 HA-@`Ppݘ0 {0@ݘ$0$ 0 M ЍPf Plp@-0 000St@@@pdddPP@P@P 0000 0f t,(p@-P@Ϥ p@A-@`Pᤤppp0php  T  5<0 ດ  A 4e (40LIA-pP@`  @ >000@P p@-@P婟Ppp@$O-DbDR`MP *$Bp@w r@0p RD 00nx 1P[ 0S` P U [@0Z P 30@[-P ( 0`V P:Z P8a`0pS PP @T P 0S  3/0S >0PU@:W 0@@00fZ Q|00t@@/ЍX*Ѝ0@0 0|c <T@-@!BM1M 0pPG040@@@ @@=aP`d ! R !`0@  P0pA@ P< T1 0༑aG` 12<"&.2db `3c@Ez:E.€Q_uk9"mnףp= ף Sc$IųQ\(\Ģ d Q(\)\˜ c 0o0 ):60 0($0(>! 0)Q` _P!!!0C0 YÏ(" ?00 #2>PVX c 0A ):60 0($0(>! 0!‚!!!0C00!)aYoÏ(" ?00 #2>[?@G'PE@Gp1#! +" 10Q,U#1 ?0 25:$20 #4"".<2Q  3 #L201d0T\`"2? B4sppp0/SX0 is c 0ב"):60 0($0"(>!!!0C"0Y)Q_("Z0%R^PVXPo`v c 0㯑0#&: 600+$0+.P3&1110Bh#`V :+"#2 >t3P0 PcRP@ U0#V B!a!b0CX0 c 0u$):60 0($0!(>@$ 0‚!!!0C0`$)YÏt4(" ?00 #2>0r/D B  1?A1c 1c0R@ 0B05@ @ 502c,%2c2A@" "b1C S/  0@ p0\\%\;#吅  00u!ό#1 W?0|:5&  +4Ϡ! 5+111A V 1# 00! C2 ! 02">"`V0`000&  0@00TPP@D0S0@@ @$ 0Ѝ& vc 0 Ố'):60 0($0'(>!!!0C4'0Y<)("0,".L<0@0P<0000' 0 P<0@0P T 0 O-`@PpM 0S*  U 0%-> ZPl>Ÿ !"⑳<0  0  S 0 P00]Ӗ00;0S0!  !P  U 0~? UP6౟ !"; 0U 0  S1h&0pP l6m&N0R'  Z0S  X*n a\Z R `S{ʟ  VP@@%.[y(  W.y5:IP % ^, Ό3# qdO0RS@@yWEVPP ` @E`E`ȟ(ȟ垫 ,`&AO᠘.hY11:hhH.B Nxh, ΌpT3# d S 0@W `P(H@1S\` VPE 0":60 0 0Ϡ!  >00C 0R d?#0Ϡ 0,ό~(C1   ၢᡍ   ǟ 0R0 pƟ ' ^, Όp3p#p q\ ` V PE   Uʬ6 00cPS;Q$0(080` Pp@`PL40#XTu YW W0d#Qp? 00?0S 8@<W 80<8p< 0 5/PS `0Z\ Q@X Q<T Q8P Q4L Q0 p0`S P Q% Q!S, Rfl0Sc pW 0 S J1F P,Pex`0S  BrI00Ѝ#XTxt[ @<8@8 <0RxSR SR W@ 0wYW? pW<8ph ` 0W#@ 0_ER$(0<;0Q$00(0;0050S<  80< $0(80 cQ< 00 4$ #3@`TFJ#M @A 0S2 0N080+ 0+P0P0姮`Eo Z*Z:Z$4Z4*Z\4$*Z#Z1 "*Z$!ZZ$ ! *ZZ *Z Z$Č*ZZ *ZJZ$Z`*Z *Z$ Z*Z D*Z$ JZ 1\RI}QG*1YE @ $"@ @$$  `,@T7^F 0FA0  9 0PS-`Y00æ0@T |)d9 F0 0 30FFۍߍ0/S ;0BQ 0R/S  7P 9I@J00b0@,TT PS PRQ  3 `4p@$OD(,00U; 0\ 4 Q"<$1^p) ⁑YN R`!X0@( $ \͌Tv Q0\ \0$0\4 \$!?8:Z Sc0I08*S R^ R^P 8ZCPQ L|p@W P 0NE+C;E?.h @a0X`@@X ࠋP0X0 @0PW a0兡`P  pxP0/SV0/SSP(0/Su JF̋h R Q R RRRpRRQ BN  h$0!N$0 ph    Q$( (P ` PJh@,00(0S- 0\ 4 Q"<$1pYPV QZ$`P @ P0\ \04 \$0\$!? JZ (P,00 $ P F̋S n"1 R 0oS0" !0S  0G0B 02' 0SHK01 R p 0Si !0Sp R_@2dz01S oPW@0W-0 S -<=0- @0 R s Q t̔<\07 0 A+- h@0PbTb``U0SZ0@?`c0SP⅑QPYP }SCPPA@QM0`0 RW@ 0# C !p@pP  /B 00Nh 0 0P0W @0|Y TB(<02$ '` @ 0  x hhNO-0|M<SP 0@S >S 0S >S`@0FS@|ЍS*S0S -S0 C R0`@0FSHpP Z 0S10ƒ 0 "hh0唍 [001 OX10\1 001[ <[!0S0S >S@p0H 0 b9N h&lpt hc*[[ -[00K S@JQ@Q,Q ;Q^HNL d ;Q,Qc QvH^(- P m6Ship@019mo\@ pKpPhiRp@L)kahptulg.N   @h@@  @ P 1 0 0U1  0EP00P ,R d0(0P R0HLu`hlpgtl& $` ,`䴟䄟 $ p"$bQ.:bQ # 3!d "b"ba/ ppcW Y0[Q 0`K @L rP  Q3K p`,#0 胟 p,`bP # 3!d "b"b#/ cP`cs \pP 0P 4L#+"@bP*<#8# !c  p R ,`0 ՙ 0p4`<@ p `@D,8@Z"28#!BcRf:"cR0#03D 1d "b"b#ZTV 0@S 0*dŸ Ytc, Q  \Gce Q!Q*S ?0101c0 p/ 00c@`(0X$ 1$ (, ! 00!Z Z Y,0p4`8<@@ f. g,0p4`8<@p HQ B°! 0p`, пt| )\(\ ף{z 3Py A-pQ@Z 0Sl00 01ɀN  hh6l6M`P-`P 0:S  ^P `VpFPU N hv0PPT`VNLg@_ `S T 0:S*S+0C013ZS@Sa0CS`P v @-88@@ P@ $u (0 00P/ t,0, 000S  / t P/ \ P/@-@@ @y@v< @-\F ! L3/L2S @00P2S T/0#03T0#S0 P0P@T@@P20CP2P2SU PU Ѝ\00P2S `@T 0400P2S(8h< A-`0P0Q0\\ MS@P1 V9 T@p`0 80xq|q8OT@D @@`@p8P1TA`NPP60@ 0 0 1 30ލp0p pP0 5VT0T TQ0 ++T 0  H Z $xZ -(0( 00M 00Ѝ  --8M$ 00  0 0 0wЍЍ/8 0--M0 iЍЍ/p@-0 0@PXx`00CS`0p S  P `X0 X PXxpXZ` (\0\ 0 `00CS`0pS P X0X /X;, (--00 M (0 X ЍЍ/ (--4 M0( 0 XЍ Ѝ/d (G-@SpP] 0S:X' (S" WH 3x0` V V,* e0p0J0`;PQ`UT 0 @00 `pp`N;P/0`Vp C000 x 80 0SJ 0 00w0 Q0 0 =0 I~PX0X X0 0 0Cw I~leV DXV șTV --M  Ѝ Ѝ/ -- M0 0 ЍЍ/@-aPP`@M8  :pP& k@P#  0P S 0p@ 0$  0, 0 (0 0 Ѝ뱃0000@Ѝ 0yЍ808 8>0 8HT @-@P Lw 0#C@Pw0 ;0 uUT Ri@-(p@-@QPJ 00!R ! 00! \ P 0B RQ`' Q0AP R 0 U00SpuP#tP `tP0 \0\ \0 W! 00B808 8<0  00긖R DTR \A- R` P$@ R0 0,°0` 0  a0R00SH PA@\`2 0[1!@  x0S< 0[1!r@  x0S p x0SB 0[1!T x0S, 0[1!EKPKNx0S 0[1!4 @?   x0S pT 0[1!@@@J@@#J!@ @@ 00B S01 00B 0B P$R x0S p% [1 0!0 *R# 0B Qp 00B S@ i  x0S  p q  x0S np  ;  x0SV 0[1!x0S Qp  0[1!xX0S 0[1!x0S 0[1!~xM0S 0[1!qx0S px/0S 0[1!Xx0S 0[1!K pu pn pgs R  0p 0Z  [p 1- pJ pC  x0S p6  0[1!  x0S 0[1! I x0S p J x0S 0[1! |pD uppW  ip$ bp [pI Tp)_ x0S 0[1!] x0S 0[1! , xt0S (p 0[1!oE x0S p$R_0p' p7 x10S py  0[1!@x0Sj 0[1!3x0S pXx[0S pL@ x>0S p?  0[1!  x 0S p*  0[1! pP ( pC p pD {pP  0B Q^p 0B 0B P$R8 x" R 0Yp0 [1pP P P P P P P P q0 S  p  0[1p!sP $Rp00P P P }Pz xPu sPp nPk {iPf vdPa q_P\ lZPW gUPR bPPM ]KPH XFPC SAP> N<P9 I7P4 D2P/ ?-TO O P( 8&P# 3!x0S p  0[1!P  P P P P O-@ϟoM M0Pƍ0PD L@ D0S 0P00!R !0s00d00 O 0SL   RR l D 0  , H /ܰ 0 G/@$匰` 00040h0\0 00@T `%T @T0PFU~ 0pJ0(0QPPu pT 0 @P `r01(0`0 0EZS00PjoPO   R00s D0S[ P`p=*X1RRXOX>TQ.`C4|ˠ0N@QPDD D,PTD0l(8 00E S0`0 P! 00E S P@r0PS 0r0P@PP00s0s0 PSR\  0SL0s0\0P00E S pp qp00B S$R0Y S,L0 1,  (0, ( L0(0S0c(0@0, SL 0L Sx01:`0r PZ 0SP00RQ0r0M0pd`@P,_XpTp8p@pQP)P @rl > ; ~x~^T: ',6 3 2 0 <. - Ld c 0b a ` h_ ^ ] H] \ Z cY TY L0`,0@p0S , ,p1S0qSt0P0 P0p@@@PJ@@/```2 @,: ^ 0!S0 r0Vs s0@<0\0L,@ R MRd d`00! , 0f 0dp,pG@PG0`0`a,`  : R: 1P0 S0r0<0V ] >D`S-0`r0 @0\M sdpX`pGWdWF 0 rWPP@X0T080@0/S[ H008 @0 10R+ S0bB- C S!!!/.(BcS0C0P0`00pBEQ0@*n0 B1x   B0 `bS00dp`Fdp`,pG,0BpGQ 0^r0P Q0` 0 0Y ( BZZ~ڌ0$  JZ   R Q  i P JZ$0(% 0  \0 S0@0$@ R| R4 Hp8 @GT@T ڐ 0 R`@0 ;8TJZ1\8 Y`    d 0RM@ 0 pGWpW ڐ 0 R`p0 0WHXXڠf$p``@HX   0R`0 S h0P000TC8$ ⌀@DT   0R0 S _h0P00@DT 0'0 P @ 0;S0 Bh0P000$-7h0P00=  R pMqdppP@qH00Q@`0 S  h0P000$ HLXmhP00- Rڌ  ` K[0Q0S g0P00`K[0$ 0^ 0rQjQS$0ld0VrR 0 X0WPP@T080@0?S] gP@@(08 ( $PBU0Uj$p`@PEU   0R`0 S rg0P00PEU0p+0 PP0 dS7<0 0cS$0 \ Ng0P00H0$ 0C`0 ;0@P0`02S| -gP@@0h 0> 00$ (  0 R ,0     d 0   0 R |@T H  4 p=S0 f0P00|r0Sv 0rQ00f0Pg$-0  P0 S f0P00& NS f0PD$~400NS `Ur Tn`0P@p0X@T@8@>@0S80Sp0pS@ @  X%ڼn$p``@HX 0\`0S uf0P00HX 0P0P0  \ 0  SL0, L0Ϡ 0S-0qr00@S࠳ D P@  Rk ,0P 0P0ITX  䯟/s@  XP@@P@T 8pUT`U@ PEI@D0Q 0T8 BXX ڐ0Q@0SXppAWW 0ጀp`P@JZ   R Q e P ]JZ$@0P` pT 0^p0_S0 e0P0090$S*0$Z^ڸ-$ @⌀JZS   0R@0 S e0P00 0ue0P$u-=   0%s$,<   0sl`S0$3R ,0P S ,!0\, 0 P  0_S0 +e0P000$Q@4`X0T0@0_+;  0 rx00CH00\vMyo\ P{8 @TX@ `""   . B Q/P;2#0/0 0 !.BϠ # *@ Qʯ  A0F,PPF# 8 `P QP Y <"N8" P8@N@8@ @ `N BP(Q B IQ/2#΂0/ 00, $!L Q. ! A0  @8PϠPB!.#uS0Y0$00 <,00s<<M,dp\ ,`PpG`, @0Ij ^f ,  r0R/ @PgS00$* (   S ,8+5 ^ 0, Sr  "@SL0 00,pL0+<;9 ^ ,0r 0S ϠP0@SL , 0101,0p0L ,0MF  % R ,0PϠ 000SQ`5, @0j ^ ,  r0R@ P\0S 8  B0S0S S0\8 TXp@4`_@@K`U0f`p0P@0rXT8if`S00$e` jS   L0 00 ,pL0S+ |0s H00S00$p1S{ 000QG0$O@ 00 ER0 nn"!  00Bh00?R0SK 0h Srpr@p4`_X@T@8@P:c0P$80SpH0pS0@H00$0 c0P00 c0P00 SL,01L , ^z 0S r`F @P; ^ ,0r 0S Ϡ^j 0S r`@R ,P ^> 0, Sr S* , ,p@0l P{R ,0P1 fb0P00 9b@0P00` 000 0a` P% p ,! EQ0#^0  M50 c`!39owb@0P00 S   L0 00 ,pL0`b0P00 010h0X@Tdp@,pGS  1(0P`p @ x0 bRppS 00C?0@S%$0uPX LX V  9^X X^3^T < ^]xWW  S G F x NNDM MLM $K JJ>L000L0t@d@|pp$p⌀@DT4   0Rp0 S  a0P00j 0080@4`X0T0_jL000L0PS a0P00 I!0  P@0 D|@? PPip P0p@ 0@00/L0P00L0L ,p0L UL000 0L *L0 00rRL0 m0PL0 00rRL0 ^L0PL0'PXP8p\V`!#3 0 ox00CH0L0LFv040p 0 0 SL0,L0 00, H 8 BR @›ac@`L0 Rr L08L0 Rr L0/a 0P $H<$<4< @D 0nSj , ,p1^( ,0r`0S@ X^t  ,R! r0g^Y  ,R! r0ZR4 ,P1^ ,0r`0S @)h > 00$ @@L0P L0jQL0,p@L00gL0 R rL0L0 Rr L0@X PL0 Rr L0@h&h6h 8 0*nSR$|@0dL0 R rL0WL0PL0jy&6  0 nx B0?V0H0D 0p 0SL0 ( L0L0 RrL0@ @ SL0,L0 0, 0 @` 0P $|@ L0 Rr ϠL0L0 Rr ϠL0L0PϠL0% @_4ML0 RrL0@\L0,p @ L00L0 RrL0@L0PL0xL0 RrL0@ 0@00F0X0T00S* P,pP`00E SJpqp00A S$Q0!S- 10P` ] SL0,L0 0, 0yKo 0 0 '0D 0p>S,L0`1 `0,, L00D 0p( 0SL0  L0 p,Pɟ@-@`P MDpb@0p0 000@b Ѝ` A-@P`pb0 0@bO- M4P@`p08<P  ЍO3 0:ɳa 0@a ! 0uP]0ST 0S0000 #P )JPT  46OD5@DX 6 L>H.H>D.D>r`p0.0> 0f`p 0P  02PKPE@E[ @0=1 P^ 0KD0&=010x=, 0  ` 0ЍOh@@C>0 SA. @0c 0c6"ё0@DX06A0D0 0S0e0$00$0 0[$0 0C$00H00k@00@COo0B SL@S0C0 < B0@R  0H 0 00@000C?o200YU 00eD 0H$$0 H0d080 0\00S400P(0Z  40S00R  x Q  RP ) S0S[a$0 SR&@0S @ P6 0@0p$`I PP. H0S@0 0R0L %  0`S'$0`0$00` 0|0d080S\0400d00d0 Pk0(0(Ѝ0P(0 @T[0 0\ P04 X0S@CN 0@6@dP$` PpP@ VU@0S\ @H pP PP *0$`@0$@ p ,00 ЍOh0d0[X9 0 1+b@!%V 9p 1`@P 0`pD0S 8bP K 08 40@S UA 40|`0Fl8`01CbP1 0'd\  &%(@0PP`p0Pm`Pd`Ѕh Zj 7 7`p 0 0 000 0PT 0$ 0P dPT\`pwSd@T[6x0P0408 S00Ӣ?1  40S2 6 0P(10(@0YW(0T" 0$  0| 06_@ UA 6e 0`pP 1P 310 0(@ 0 (, Q0@Ѝ 5@k01 I$B`p <5P <@`p @P 00$ ` $ 0 0$0S 0SD0S40S@0S VH0SV00 `@Pr 00S0 0 0S0@ T  R 000S(0V?t 40( S 0@0 PF W > pP> P8 000 00i `{P& 0S$]0$$0{ $0S  Rv 0070S;V 04 S` p0@ s0R \\48L20"7`CPPZ$PW PK @0S\ R\040`(@4 P` 00S0S[ V`0S S P P(T~  0t9S 00@00C040S _PP10(@0W PP @0 0R0L 03H001n `P ?aCoc?`(?yPD?'@?@48?@$@ 0P(e@`00PTP@# X0p`1P 0 0`pP e0PP 0%P`#%P00[0?0Sx0P0$ @R00P B0A`p$ 0$ @R00P B@D0A$ 0%0`$@@0a[<0`Z R0Z @0SJ |0 4018 P 2pPS@P   ! hPG @PZ(0@DT Pt9U P|PP0( 0$ V$ + 000SK0S 9Y @` pW VW  40S \0Sr K<3| `pF 0t3 \0@`0 UAx0P01 a (@4 ZC  3`p O  0 0`p%P `pI0PP 0PP B10(@0;d0S x0P0D|01Po @qP0 S  0S& S  0 `pP `P  |BgW1 c.P p0S046S01::S $00$0 00 00H0@hTd`[کd| V0E0SQP@Q0a Q^ Q TZ0P P09Y ` p 1@ P0S 0S? S040 S @P @VI 0Q 0Q@ T40S `@ p0S0SdP0@S00$`@0$@@(  0S0SN0` pWf 00S0S0@QPQ0Q0( 00S0H046S0H001::S $00$0 00 00H0100@e0 S`| p|( `0 pc0S0SS(0RP0S 0S S0Z  pP \ R\040k0@90`( p0@00C04 \040D1( n00C04 P\0S9 3 09Y @V `1 p$`@ p(0`@ p`(0 p 0d \08 40O$@- M@P`^g p ]fUT 0S*bP  Mf@Ggp Ѝ2 @@?f:gp Ѝ$S 2gT@p.g@D !460/\ /460/P@-@00 R@cP@Rp@-P`0@0R@*R0Pp@ R 0 R Vp@ 0@!O-0@ MSX@DPa`101 0daYq`":0 6  R0 R0 W *00S 00CX:X@D* R @  $P  00S 0S W0*!1R 0CX:X@D* R @` Ѝ@- `pP0M 0,@.0L10le `IT 0      9f)fk l@-$@-$@-p@-`P@ TP P0F R ͻ@P  .e00pP P(0( (?0 dPP#p@-@P _`᩻PP   ep0 :0 c8P#-M Ѝp@-@ P` !LN"a !@Ap- M ЍP/D -2")2b3c1@2`M1 ЍC@-@PPM ` p  0a P p`Ѝ0 ;0 c" p@-0@Q r P p0 S P1 pPP   ! vd@0O-`M p0D A QP *5Y @0S SnE @ 01P j P T@o   <0SY`Ѝ<0S Qn@ 0SC Y 0P  0 8 0` 0S00 000 e"00 0`V [00T00SL<00 21` b  0V0FTP 00Q-<0S 媠  @* TQ P@  @ ZqT  aPPl"! 0#  @ y`P 0~ 0Q/ R  B / 0RA-@P'`Bp1W@* R0C@C   *cV X@@pp0 `f360@p1W@:bPPO-p$M@ $0Z]0000. 0P-Q000Q 00A S00P0 ` @ a0`A @00A S TT Љ0A0SpЍ0S0 EQ 000 00S 0@@ 4 8 S ?o2T00 0R000Tpp 0 T" =01$C   0 5[T40 S 40S4 %0dS40 D pDpW'0Sp  "WD 0PH pBW 吰 0 A0SX0QD0pLW p W0pw0000P0D S  X00SD0X00(0p 0 000 40@ 8S B @ T 0 R ?\0 0dt p0d@0P 0  p ! Tb0P    !Hb@p0P D `0 V@0\00 D@`PC0D@`\P@Q0C @D@P@T00S0S@DPE`F@0S DQʒ40SUVS0P0 P 0S0S @ ` @tpPppW< T0 R"1 VX0D S00 0@ T0 @DT`Q (`Z``Vl0 x0<9#$(0p0 0#W00S0`0/0 @PX QZP  !KPG (0S (OM[`0 P0V00C?o20S 0(08jP@ ,8W1h@l0&`p P  0 P(0S5 ! 00XS" PP0Q Q3 Q000S000R + Ѝ@(p000+S -S 0  0C \0S 4 00S 1CP 8 )X=( R3iSy :ISv NS,x@ P% 0 00$0000(S 0 00Q QN P  @( EP00<0 p0'X%% HPX@P@u吥\ "#AA  0HX 0!z0 G,pGHPX@\ p  먀 T0y0S  00S l 1 CR' 0ES  8 p8 f pg0p X$1 0 W 'X),$ HPX@P@t죟\ "#AA  0GHX 0!z0 G,pGHPX@\ p Z -먀0000Q6 P00000000@ 8 00C PP0E @00C PP 0> @\ @7 Ta@`T ЉQQ@T ㉐U0C00C Z 00L0C Z@P!8 0 R8  b8 nS s1 8 @0 0C10 k 0T"0 0 $0bPh0D0046,q56,0!z0 G pG@jP T 1@PPl Vo 0 x00`#$P4  B\=(0Sb 00 0R0 (0pc V瞯<A??|N$40P0 pP  DQM PJ Q 0P 0G \0P 0>P X0 0C BX0 0(0 1@PVD@!@1" M`P d`3 0# 0T$\J T0S 0 x0 1KPAa?SP@PP B\nX0D S  B Rꨀ 0Pt  0L$ Pk 0x 000(0S 0$ 0 d}0 R# 00S[ SU SF n000 $0000 "AQ!*k^000  0c230(0 S0A PQ80Q00004 @00_"00-@BPP& 0P0C0 Kh0(00 00 z_"000$ 0000S0 EQ) ^< !00 0 x0|4`#$00000T0_ Z0$ 0000P0 S0pp0 @0 b0@T 4080;\X0 0 X0 [ 0@KT8 ZP 00C0.*P D@` 0# 0T$\ T0S 0x0 0008 0@0 BS0@4 @00cT00(0hT0 000000 0$0eP j0@T @DP0  X0吰0C01PUPO 000,D@mP 0`0C0dP0$ 0000000 00 !| | | |Q 0ESz0(0@.P0C0@0 0@a`B 0D  $  P e^"0 0x(\ 8 g0x0$# 0x0$#Q` @;`0 `  @ @(=[" 9R 4 0a,06D0`T"4 5\ 0T"0 0 $0P? ( 0#P 0 x0x0`00cx0  0@(@ 0 D0 CfPd" 400C1 0  0PTx0 0 x0%0D05`P$DR!0000V0j (0S 0   ~\0w (!D0 00C 0zV0a!0Z0(0D @X0S@TP  P(@`@ 0$ 00 0S0S AT00 (000D00P00x46|56,0!z< G pG0x07Z! 6 (0  # [  R  U VZ 00L 0g 3 S 000A P  @1[@d@P000!00+X0D 匠S 0  0C吰0D!000 R0SP00P0000  0C吰0bPj @ O-@ 0Q@P MPP,`PO  0p$Q@  "($(!(  X"8H XA3pIqW K "8 80W#8S 0Y 0  0 Ѝ@P   ! [/``O-3ß0 M00@Sp 21``C000 0S  0S  S0SB00XS 0Q P@  Q RWU\Q\WI:Q0 X \ 50QR j T0#03\0SWf*0 GV*0F@S3 F B S   3Z0WR 06S PW*@DPD@ Q0B Q0Q l  l>U00XS Q0X j00Q )Q  0Ѝ;^0  n2>000 )AoR㩒Y 0u Q=0>0l1 c, 0# Q:iD O-M<0p 剳HJH:@`00S 000S 0@0S DA R[ % PD  \  P 0PS8 ZPP@Ѝ P0Q[V R 0 BPS10W ^P0E0CSڣ0S| P [ TU 0  UE\ PN Q UP   U 0CC10B>P0DS0 SE@TS@DTDX`  `R ߰ BP[10P0+S -S0P: P80 0@B\ P~sPP0 PBU0L[0lZD^ PdP [ 0 S S80S 000 0 b@0Z"00IZP0D^0[ @0 QL 0S@00S P3 4^E *@C b`P `D21 2 Q\` 00 00S@0T@DUQV`Db  218 PE v @0T0 T1 T@00@0PS  Z @D@ R, 0 R Q 00PS00= 0P0@E TP 0 C0 RZ@Rh@DU 0S{ S SUUv EPq YP@"00ЍSn Sh S4 `Pb@00@0 0) 0V@ !XT 0 PeS5 0 0@0saF PeP\  0 S S T Y@"00Ѝ@?0PS- P l@0 Ѝ80S@V 0S S S@80S000L080S80S  0h800c8080S `T0D  RP!@0@0  B0 QP[ 0Q SP߰ P[A1P0[80S@[- Z0`, D^  000P0E80S }0  BR "@w0P03880S P `Z ^  0`p 1P50PSP P @ A-P@p` P  0 P  0 PA-P@p` P  0y P  0r P@-00h0 00/4 @A-@< RP`pn3 ^ P 0 W@0 p0U0`PEPV 0 B P @` pT  0 Bz Pp0U`98C- M W @PR 0  C 0C2SzP 0 Ѝ6c @-@0AC^ 0S R@-@A0B@SA *@QAAT D B @ V0"S1 1  !2R / 3RS/0 |0|0 c Ra X0X0 c RA 4040 c R/l .L-(-A-@T0000bQ1 !0U2. n" p(  U2.0D10C#0R!0 0U U0D1 0CC!S R 0 @-P@M: Q @ 0 R Q N @ЍO-1!0 M000000 !1 0 0 30WЍ`pD00@0P(@0 `as -W0< @( R  00     W| U@P0TD00D0 0D00D00D0 70  000 / -/ +\1A-0@`T@p Tp P. Tpp8#8S!Q*' q/ q90R0 SP aT@X@@@  000COPX@ TppPZCW@00?2  000aL+*A-P0 Qp0e S W`TUU WS\0 P@ WPUP  @P@?00@-tQ@AT# SQ ^& RT50d035DPP2 0 QAR0@LR0 ^ Q(0@&Q Q0/#0@T $%R 0@ U/02U0A Q "0Nt@D23  0R020N 0p@-ˠ Q @NT#S0^8 ^RR:10@op^0 \# QT=0d035DPP!PBU3@!A1#T2D1$!$L ! A"Np@\U /Bp@T  $%R# p@Rp^ !Lt@D2   QAU@DP PE 0@ pAR@D P ?'O-8`4! Q [P@p M7 ^ [ R&B *p  ЍT>WP 0 [ 0:^ [>  0 R&B*`PVP3 "[0   Ѝ$>' G- PXl X` PC Xa`  P)2Q>Ϡ8 qD ?qV   @)pYP X Y  0  $Šˌ '5  ?@pY 0 X``@pW]VVA? pAAG pa2GA n2.! N3!3 a$4#G-pDR凄!#ࠋ A Zb @Ġ)Q" Y A= b?ZN j? 2 B> Pb0502 0j 0J66j 0P 0 GH% Y# Q0I4 2 Q Q%0/Q  G2 0 0 10 I?z? J :> Pj<5<: 0b 0B88    2 0G-逓Š ˌ!Z #j pEAŠ"ˌW Š9 Uj U`P \0W: Z0:30Ao U^ VA(0UP Z@T6\ 0D:p `Sp241"#<  N2!@NE4!n<>"G V;4A?WN`F?` F62 f<26 0g<ǠÌ 0G>Ì Z>GT T`#0p!`3p3810 Z@ S0:\ 0* `p 8 4 G U( APF?w.?0 @2 `:1:%0 0e# 0E4#4E \1P@(` Z@0p0 \@ S0P(:0Pp 00P`\A@0p(o?Se? A! a< ! c<àŒ! E>Œ Z>C0pV@8P/P / /BR01S041 #<120A#a/X P/R30!#11SP41#<120A#a$00 0A#aȖP / /BR00QϠT1!020- C 0c2C>`0/hP P03 !0##1RD$1",!020 C cA.c00 //p@-K@T0TUo JP& 3V @DOoUB@dp~TTQ03@d5 L  000V`pp@  000pp@-@;0$SM% SR # 0 Ġ,̠ 0C,0cΠ!= ЍR h0h 0S 4#6>ЍȠ\03:045S x?S/ . ?S/  %1+ p@-R@;0 ? S5 RTJ JP 3H: 4Q P  BB bS^7 ;Q039:0!00C0cAT  p@0 QABAR^   pT C/o^" R p@20[p p 0Ȓ;!0ˠSA- P   \ \ RL0R 7QR^\RB AA!@L,lS^ 3Q031:0!00C0c @C0$qaVp }@~@5? 0\S00 AfQ3:000   0 P /45S @o/0  p0d 0S \0P 0S //Q @-P00 00 ?S/P 3# /R /45S @-45S /00 00 ?S/P 3# /R //45S @-W45S p@-$$!!:S$&O3S%C>c0&0T @c PC22 Q 2pQ,pa1^ Qp  000pPS \  000p0C?oP20Sd p0@-0!*P M!: %+ %U  C!A Ѝ0@` O Ѝ0P0P 0S % Ѝ04>70 -Ϡ M\Ϡ Ѝ Ѝ-Ϡ M\Ϡ { Ѝ ЍG-鸒!__%!J #  Z Tp`8 0O} @JOo\B@Tj GqP0 #* @@8S*p@@4q#<p100 @CĠ+C+0ct0Ì@dZ0V R0`! #* `8SQ:P#<1` ` F:+F1+`f2fj Š'ˌejህ0 auP6`Ǧ0!03\ 3 0 Q @DA 0DG^ ʯ X00 \ 0p#*0 ^0`#:4`dO-d!D㣏MfF㡏(!# Y YP00 T4 @ Ѝ` Y@ ЍO0 T0#: 4#<100 CI+CA+0cY2Ci\ e kuEJaU AQ 0L22*0 /30 W Q0P0Q\`0 R 3#0 \IP0 # 0!K* 03 0Q @*Ā ~  Wp`\p`Wp pp3p#^3#\` \`Vp R0P 3# `p ЍOm0H 0(P 0! #* 0(R#*0 $1Ѝ2p``R0 #* 8S6*0V 0#:$",!E0 0 C+Cba+c0a"e"kuJUa AQ 0c 0C*W0 #0!*W00#!-*%p! # QP   00 / @- \ llQ  QP/> 4>70@-! # Ϡ\Q^ ^0030# P  00  h @-! # Ϡ\QP P03# ^   00  : 2A-(a(1`pP0MS3 U10AT !0S 000ʤ '@T  0S00 0Ѝ  @00D1S@000墤0S 000噤 th 0p@-@P0p R pPQ`00App@2D `z80 0QApp@nt thL0  ,0#10/!Q#8Q#4  00/Q #2#01  //30A-`p@P p1,0@U00p 0Sp1P@P#pP   ! Kk`gP0301#S412ss /"r3J / R//@-@P0@0O-0Z  @ S MpP; PaU* F B  -K  ^ !*0I0C X00 ZP`V 060Y00ZP`T@T 06S @ ЍG-聟0PpS%Q@Y A@iV'10SQ`P] 00001010i0S p1U @P4 P1 p@T `P@T10SfP@$ 000S 0+0&@T 0C  pP@h0iV0S <0 ,0R0i  8tqhX~G-`0b@TP塢ڃ0TP$ Zp  ZJ p0   a!  \2)R0L`0C\0030 `-pG \ `#-0P!1^$23\ *G-0@`@DTP  !1QF*32\ I*@@P`P @P @pq0 0S 0S W 0G`WL3 ``PQ@! H 00P0S 3 # Q0 A B  02NS bP 0 00P` A-P@Q`pE9 ` P0 T @*R0 b3ΠŒ2 ET* 2> P08 T `6 # 502,130?C-` MpP@P А'V`0Y 0 CII5` Ѝ s P `!300SY 0C@@1` Ѝ0S0/0 R /@-dap`@PMB L1P5PP3 upP-0S  Q6 p 0: S/1P  8#800@ 0$  0,  0( 0 0Ѝ9J00Ѝ<0T0T TE0 &H&J00"JO00 8Hkxdlp@-@P =00CS00 P=pP0 =0 Gow@-@P 00CS00 @ 0  I0 G`wDoHp@-@PPD 0rS= wS+ aS3`0S  +S" e0C\S00S``p0S0S0S`0`SI 0 p` 0 >0 Gw,v p@-@P8 0S> 9= P00P! !' 0S 3/PP೼000P @ P L00 00`E00aa=d0`` 0p7:P404 480 7G7I 0P0lu@-@P 00!R !+P 0C 0 ;0 G<`?`  +dl+kh+&dlk&@kh+&dlk&D kh+&dlk&H$kh+&dlk&L(kh+&dlk&P,kh+&dlk&jh*T&li)j&+dXi*h(\g'+d)lh*gt&`dp0ex%j*(n.jd+)h`l'n&lx,p eT('lP`X d%xl( `+ẗ|x|FGEPKJ`DIpŐlĀH`ĐŀPt l [`0 `pA/`47pd APpM_ĀmXQ 0pmPSQ 0pmPHQ 0pmP> Q 0pmP4Q 0p}mP*Q 0psmP Q 0pimPPQ 0p^mP YQߍFOFp,qQߍ/TaQ@-P @41S  P aP0FA-4!@ pPP/1S 0L1r @P!k;PPPUQPMoP [PQp yQW [Fp_oRVFpSFpp@-@P 0@8@A-@`P] VapPPQ V 0E( Q Q Q Q Q Q'  Ǡ    Ǡ   V Ǡ Ǡ Ǡ  V E0@BE@SSO-P M1 Sz$aVp$q( qSSp A`TR X`D (1 Sʃ ರ[ `0(q^ 0 P@  Ѝ Co$B/\" (tr ₰^ Q `VH$8 S pVpGp@(VK (1 A$T$$(0 [ `(0 A^& S :0  B @PME@@,A \$Q(!r8 V(, T00100, 2C(1[$;((~ Q ذ0 0 C $A !`($aT夰0 C0(S 0 sP\ [ px`$aS$e|dwtwxdРO-,M0 0 S ! rp2/0, (Q0 Py @`P@P\&$P 0  CZC 0@PUpWW 0 `PQ 0@SPPU2J[Ipp,Ѝ 0 qPPu2  $`5rP$`  0 j`P% 0@SP㲀0C  P\ \1 \"  iP  0 lPp@`@@,Ѝ 0 lP@ @ †Ằ[ PಐU 0I   iP(A0DS V(Q  0qP 0 @-@ ! \ @$D,D00,1S@-@0@ C00,1R@-@1  @0C,C ,!O-`ᴙ0S ]M> pPwၚ@P Uq  @| CP 0  p4 < pɟ00 8p4  DSB@ OB PXP 4V P0pS40X W!3^ XL ^^@4 >P3 uD H 0$ jP 02 KA<,0(  QPV\^ P  0p pt 0} V( 0S% A/ 1"++< *0)4 p)<(0<( '4 '<.0<. ,4 ,<0 4< < 0 4< $0 #<$* <($0 4< (, 4< ,0 4< 04 4< 804#<8 <80< 4<< < <080  80    0   8|  4p p ̇$  x $ (p < ,Ġ( 0$8 ,  p0̇(,044 4x 8 8<0 @ 4<|8*8p | *̇ <0@)t )  p' pK0  | 嶀S(tpN ) ) x 岰+, t, SZ,CC r AZ2X pG^ز  9/@P OP"BP]ߍŸ 0( P p1DN90  !NVr QU0 aPP$4Q$qPd q!Qq@A0 ` 0 `]ߍA AQsA R2 < p 800p4  DL@@ H@A001 Z ڂA A@Pp{APmvAPsAPcg0akA@fA@\h Ta`  / /F[?O00000 0000.0$P00JPh0h h0d ;=w?q尀 <80b10TM*@-@`pQPM .00U' `P$ 0S r?(p0 $# 2 pЍ .Ѝp .Ѝ>00p 2/A-Q@M .$4,.,80!<004.T"48<08#80CSP!4< Ġ!l 4 ̌8 0<04 80<"04"80< 0*0(S"( SR~  B("(p`p0#$ 0F0VP   = 0   '  P       P  0    V/ 000   0 0   0 0   00   00 0ЍR 0B8#8` `0#0BR0PP      VЍ<0< <0 b; 0(0S"( S8̄H؄ 2/QA-@6 10CSP* 8 R#8 RZ ,$ 4,,,80 @T @崒(0TXX @,  1' c'@P 0YSY0I '@ ' ' @ ⴒZ @I )ᴒ S(010C S)ᣠ** 8#8YX-  'X !'@P 긑0(0 @崒 +H)X) @: 0 b5 @$2$"$b0 5 @崒, 1' &@Pw Y10C S)ᣠ"* 8#8YY0I1ᴐቐ  10@! Z' &@PP  8$1$!$b0 50C 0) ( 0H)"0!10@崐 *' &@P! 10CS㣀:t0t tb0 l5\0\ \b0 c56qq,5lp3|pl 0lk/kjX.jj4.jp@-@`PP :0 00(0`00Q(0pO-H@DƟP LMQDp` &00 2eV  "700%5 0 D0 30jLЍ0w R*R* Fp 0$00 <0@<0 050 0S PVk 1S6 &P䑄/  0尡0 0!00 BR{?ⰰ0弰:1S 0[S [P 0 ᰰ0000S !_& @ P 0崐V` S0! 10CS,*0 P 20 2p(i g0w Qv %`P] 0 p &P BR㢰* 8#8Y* C00C 1! 0C8 !#(!!#Ȇ 00(0  0RL 1S RR  RYG  % 20 2 JZ㪠r* *J [f P`N0V㰐0`0 2 f Sc % Dp 0,00 4000S0(p0000(01 S0"1!{/010CSP"*8#80C S {?尐!0 b0 3]0 )ἐᰐ0`0500\0\ \b0 3D0D Db0 3_  `d'pdd'dc\'cO-(0pM O @aP0fl0PP P FP0 1X*%8J1Z!a@%X0 R 0 1Q@@10CS㣰Q* 0K8#8S0C8#80 V!S10C1(0  0R/ Ѝ@ Q! R b0 `(0p+ 0  KPT  p 0 0 p1 S0C1ȁ434#4b0 3T? Y4 0I 1pP(00(0V QPEUP*0EY*0 p1|Pv YQFQPEUP*X%XPEY Vp崑 (00(0;10CS0I*S ```@0 `p崑P Q #PP @ PA=P_(00 (0J$0!0!0 #PPl 1P0CS㣠>*0J 1P(00  +$0 b0 w20 1pP(00(00 X%Xb0 PE_2 UnQPEUP:x0x xb0 P2s`0` `b0 G2 #jXa$ha_"$_^@"^x^"^T^!d^p@-@PQQp E#P 0 0#Q 8#P 0 0#ppO-P,a V0Fp  1 #@P" `Vp0ഀ0 0 opw 10CS08#8*S0SZ P2P 1!b0 1  H x1 Fp(8V㴠(1!p 0 R 0 1Spp10CS㣰7*0K8#8S  C("( 0 S0081#810W10C1 ># R ZP  0! 0 P%# #(0( (b0 k1x\ \ZlZO-Pp@Q$M #00 2T T Q300$Ѝ(  @l 007崷崧0 0 `Pc  R a8#8Y* P 0Pj1 "0C @iT㴐: 0 b18#8Y:Aᴐ@DT@* 0H$H @DOoS0CB0  0Yp@ 0S0C@0  P 10CS0T*8#8SXP@ !pP 10CS0*8#8SI 1 '1@0CS0 *8#8S$P _"e Z"`Tx*H$HT|PU 20 2$Ѝ050%0b0 0T :"5%b0 0 -"T` %"0 0 P$  0SF @倔`S= 0S 0 "q, W@  @@DVN !q Wv 0G 1d!P A`W@DT@:#b0 403#b0 +0 ! ! ?!pPR Pr D3D#D0b 00(3(#(b0 08@W1@ H$H @01` 1 0@1@`01! !P@ Hx0  !  P 0 k@T )u!T#100u`  h! I Ph ,` 0R X T!qV@F M!q0V$ @0G 1 PG WR  B1 * 崠T0@D1 &!0I@D*0tp崠1 加1 0p !  P 10CS㣐:0 b0 ^/  ! v P8ZZWWPW`WVVUlUpU|UDUTUR8R@-@PM 0 0P Ѝ0 50 "/ THRO-ŸJM M@Pč`pPg VW00?2$0S 0SNIPIT/ P 000P"D2 0 4 30Jލ Ѝ$ > 0X0 0UXS 00; Iw0. T:+[) P0K/S  00P00: S 0000S0I S0?00(1(!(X0 .QP PV# 4- 㗵p!00SY  \0 RK Y [ Pz000W ضp x׶P h0@om뜖 G d T`P@R Q0P:Q0Q:P/@-@-@@ႇ $ @ 4B p@-@P#*P$ | p@茶cA 0@-@T M 000 @僉P 0S  ЍC4A O-@0dM\`P T0 `. \$.\p @p.\0  (0.\` D`.\ ,.\ 0.\@ H@.\ 4. \8.\ <. \P LP.`` ( \40 0  0< ,@8p$0P` " P% 0#0b0ea8` . p'gH, alngx+b(*gLb0`l$`&eX)0n, fe l c8(쬊cfj!g|*g̉b,, bH ,l*l$gx" fb(*錈gl* e\(e!c<+ci eX(eni!c8+bLc fj$n Yc ` WV p 0V  I 8h X0 0 D0 30 HЍ$ )$ $됂 ,1 0 ā C- 0 04MP`0,00&`@ pW:T p 0T &T H0 0 ,0 304Ѝ$ ӂIL / 0@- 0 ,M0 0$00~ @ P T ` 0T P D0 0 $0 30,Ѝ0$ ꥂ\ /  @- 0 0,MPQ0$00` M p@ T 0T x l0 0 $0 30,ЍP P0P 0 2)$ ~j D. @ l;:A-@P` A!8M11!X 0 P 0p0S   L Ƞ,Ƞ P00  000 0ЍS)!1 0C8##Ȅ00P ` 0  ) P 0 0 0pw[O-qpGW@|*8#811 PaP`Fp`5 VO*X%XPpCx0'0岑ᶑ PaP`F ` VG*X%X'X00 000 0 O4Vh&h=*V 00("(RP:Vh&h *V  8#8SP:1 0 b 0]( 0 0b S(1 0 b 0H(h h0h b 0>(L0L LL0 5(y6666T6h6|,6@67L7O-,M01P0CSPᰐ0/*A0@D8@8 08#8T0-*0S> H$H0Dp@`04 00 04 00$PY P P0ES(0001P0P0PYo0V 0@  `PhU&hj*P 0H$HS0SZ 000pxV'x:@@T$P*8#8!01(0  0R 1 S0"8!#8!1!V 0 0C01ő YP0P 0Ӂ 0C008V*0S 0P0@Ps V@ HB$HQ01Y00 0(0"(Sm*0Vj YPU:|2| 0Z'01 P0P P P j01P0 P0P `TP   Ƞ,Ƞ` @ h0&h@HV$H@TN*8#8 Y !08#808 #81,Ѝ   Ƞ,Ƞ   Ƞ,ȠpGx'x@@T$P=: 0  0&30 0  0& 0 b 0&t t0t  0&`0pxYdPX2,4,0l2h0<20001C-Mp` @P&  PP!  00 000 0` Ƞ,Ƞ0@@!! 0 040000 00_@PЍЍO-M@ p8PPO 01 0 0 0رR 0ⲱ 0 1`0CS㣰H* 8#8V: ر `PH 01 00 00Q00岱000 bP 0 0<0 00 !p3'Vp@PЍpЍ 0p!0@P4 404 b 0 & `-t-O-\M`0儀pS:@0< Pတ(0$  n@T XM*1 #0C8 #  a#Ȅ 0  0| 0<S@@ a,^p  8 008,000F 1Pc `V 0`h0 &h0CcS00 p㰑1 0CS&*0S 00$ (0pO `VO 00 0 00CS001!R p0p  0  00!0VS00 IY㩐* )ቐ1 0 0TPLH0PH2/  Wp 00 1p0 pp,0 !0 B(S"8110  p"      0<00@pS- 0S 2  0 O   a0S @ M3@ 00 , 0 S<@p    \Ѝ3<S00 01040封HX㨀 *004 1pCx0'x(0qqᰁpHX㨀*0(03<S00 01040封H⨀X(*X 0 08#8S:00H 4(0 岁ᴁqpGpWx'x*W 0 08#8S:00T#(" IY㩐i* 8#8V * ("( B``F  001`013p@   @  Z`V<@p "  p D.%D EP 0 0 0각HX㨀r*(ሀ10406각HX㨀\*(ሀ1040R!1 b 0# 2  03 -(=@N00t!t1t b 0#X!X1X b 0#*X1X!Xb0 8";  91!b0 &"0PK{0) 1 0p1pP01 0P0@D1 H$H @U0PE10Z!08#80 !"!T4(@R0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/000/8 @-@P , "@ (Y" 0"<O-@2 (P0 $Mp\0$ 0 @`0 @` pP y"l(,"$l$"0 g  Z  &e .e  x10\0@0 ` pP 0 1 cIC$A$ 00#l!!00%b !b  A@YIH$*E$00@0 000000 00 0 0 00 000 000 00$Ѝ 0G-1?p@P` @g(X, ! 0P0 0$0@`F0($0`7#?V@F?p@pp+ 0$ <@P U 0$ ?@PP?`V (! 0$ a0 0$ ?V@F?@(p@ ! 0$ <@P U 0$ ?`@?V PC-@PP M) $ap:?`V&7 )4!`0(0 `x!W``paa8!#4a4# 0e!Y@h  ЍC! 08R(@R )`@ b!(`8  )`8 b (`R @-G/ @-@-@P 0 )!@ ( 0"DR @-(/w @-@-@P 4@  ! P 0$$O-,6TM0^_~?40H0800؁p @P,0,$4 (8 H`D <P0`<p P 0`p 0, $0@0,`P p @P`p(0 8 l00$Ǡ$97Ɍ,%%97.0$ 0;4,; 4.0*0&.0"0( 0'   "0, Ϡ'& .*̠Ì !  ,  , 00$0 40(0[0340~?00<@ P0    ,   @0 !1P"0?0#`%o#,.0#.,',YW) " g Y i WP&  B+7/P  7/Py 0 S 0SN 0#10S0S0壀S0嘣# 0 0 X BuPS0P1 0 07/`P  7/P0H 07/`P w7/Pڅ0`DP 7/P ]7/P 7/P]P$0@ "! R0 B  7/P P0P0Sz,Ѝ! ^ @E"PBPEUP!U  B%QPU P 0 "P 0 C07/PH 7/PP@7/P 7/P7/Pm  7/P e0@S@4 ' 7/Pf  7/PO0 00@哩)YP `c⃰Z}* P  Ut@P 7/PlY Y   0 T0 0#0Q0 @0@ @m0 (0( (l0 -0 M0 ЍR Q0P:Q0Q:-k@-酫A- 4PS@M  $3/0dp 6 QP00 h4P4S  $3/000Ѝ00A- 4dpV:@T@T 0P0 S  00 S  0/h@P0`0dp@A A-`M pٗ@P0: St hPP ˅P@ P 0 tdЍ900PЍ( $$4/p@-P$0r0" @`Pp$U04  0B0  0R 1 00 0 p  0% 0A (4 0@-SN 00AS 0hO-4 MS|@Ap⇁0PS`*0S'  TP [ !P0 00 Q   0     Ѝ P@ 0  QP300 g$R P1)A00@000dS0  pq0Vp 0  $6/ Ѝ c00 Ѝ]00YO000Q 000A/0@-S@  R   0 3h0S.hp@-@PT @T 0 `pp@T0P`p  0S S/P/$(0#   @// / ////@-P0S`@M:Q !S@Ѝ0 0p P Gl @ЍT 0 @00O-PP X 0S L K 0SH p@ap-[0T B,B R`  0S7*V5* 000&P<0@D0CS0 T0@p@pT T 1 ! ,03/P00CS@D03PQQ    D R ! ,03/`Pʼ@00 "R( T`1 `! 00PVQlRO ,03/`PY R 00CS@D0 T@0Tp   P @V`!  0 0C0   BR @pZT `@ 0`V:f0P 00``F0``G  0Y0C00 00oP   0 0C0 `  000YP nd0d dG0 XH0H HH0 00Z 00V̂ؒPT(p@-PP& 0 `V 0@0@DT`0@T`  ,03/Pʼ0@00pD0Spp@/0 Z0 l ꠁT0p@-PP0 (@`v )p@S 0@0, Pf b@fp R0  R/ S/p@-Q@PP9 100S 0  R 0   p-  0R00  0 0c0&0 P @P e0 0 $0 ,0, ,<0 p <p@-4aPP`p@M* W2 T: p   QP0:*C/o" R  S L 0( 0R  ; 0 Ѝ;0t0t t0 WX0X X0 T<0< <0 ~Ď`t8C-"2 R0lM@PP0d00= 0 C 00  d"X2 0 d0 30lЍ ~0`0S' pb0PT ! WP00a0pS p =PP000!1 |0 3 0Sx!$p@  PE T10F LD10/R 0 p 00 0SP ` 000p p00` ppl l0l  0 PP~ꏦ@ ,  (|܋@lp@-@0MPd00TaeV( e0T1S OQd0T1Se0`d 00UTX!\!R Ѝp@c\!d00Ѝp@c00UX\! X\!0 000S/P tp@-0 00PUp@0c00TQdU0` TQUP cpX1P0X1d0T0`X1  th0h 000S/@-@0c0X10CSX1 @cT1Oc0@yc t0 000S/g t0 000S/p@-P@0`cU0 \AQ\ X10CSX1 p@Pc`id0T1Oc0p@Ec t-X X0 04M 0,008 00 0 ,0 304Ѝ䢥4   p@-@QP  p@$d 0 90 t,@|ćO-M8@@ 00DA B QR cp >` R0T3 W  0p| px 0@`> p PPL1L!L?0 C 0p 0>00D+00XS W#0p 0 000XS W pp p 0A0C0B QSWpP pe0p 0> 0W 0@ p p0@ p 4333333i}800 0M0Ѝ 0@-PPM @0  㰍P 8 ,0 0 0 30Ѝ0xt9 \\ D0 S4 0 /@- l{0 S 0,/00@-${H0 S8 0 / 00@-t z0 S 0,/00@-zH0 S8 0  / 00(@-p ,z0 S 0, /000@-\yH0 S8 0 / 00<@-G, y0 S 0,/00D@-38yH0 S8 0 / 00P@- x0 S 0,/00X@- xH0 S8 0 / 00d@- @x0 S 0,/00l@-wH0 S8 0 / 00x@-@ w0 S 0,/00@-LwH0 S8 0  / 00@- v0 S 0, /00@-vH0 S8 0 / 00@-z Tv0 S 0, /00@-fvH0 S8 0 @/ 00@-QT u0 S 0,@/00@-=`uH0 S8 0 / 00@-(  u0 S 0,/00@-tH0 S8 0  / 00@- ht0 S 0, /00@-tD0 S4 0 / 00@-h s0 S 0,/00@-|sD0 S4 0 / 00B@- T,s0 S 0,/00@-r @/ /H-M 0ЍA-`p@P0 8#@T0P@@-M/"O R ?#0!PO$T P!Ѝ  0S RP/0    P/p@- MP 0 0000`@`0@PP  7P< (0 0 0 30 Ѝp轟  p A-QPp@` S V '"RSQ P_ 0Cj ?o/o0CS 00cÎ10VS& /o?o BR Z 0b0Î01pϠT\ ^ R0V0 BV  T$ 0d0?oc008/ooAq!  R! b0r8·V pV000e0?o0c80@b>08Qm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ / 0@-@P  000蔐ܖ / RC/A 0\R#R! R/ 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/ 0 ///Q R Q/U/Q0 R Q/00/Q- S 0S  P0 000S00@-Q @% TS 0 C0 P @D^TPPU0N QP Q  00S @R S Q0 S 00 /0 0/U/S 0 0R0Q0 /0 U0/Q@-# S% @P0C S@  PQP @ ^  0@@U0@ @-Q@ S^ QNP  S^ PU@Q @0SQ RU // Q#/  //s R PS 0 0/0 0/U/0 0/SR  Q 0/0 U0/0 0/0/R  -/p@-@RP` R V  U  R 0 p0 0 clQRp@-`P@ 0S0 0 0R0  0p 0   0kR S 0Q00S0 0/0 0/0 // Q#/Q- S# PQ P P0C S00UPP-Q S0S P 0000S0@-M | @00шш00ˈ ͈4 ,0 0 0 30Ѝ  - BMMRč `` T @P   P2   @XJ4$0@- @-xxŸtr M Mp$ȍP|`@M TF 88" ` (R(" @$@ P0 t!1 0 $8 30jލ ЍBn!`0 @p [ 㘆0 xB^P.`!0 \L100@A@  ,0 ? P0 \ AL+\ \^  \\\\\2  hIL Lx Uh08t |x`g܉ 0 K0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A0@-0M 0 0000@>S@P  !0#00  9P0ЍL000 @-0M 0 000@>S@ "0!,03,0  P0Ѝ)00@-@ᵆ@赆0 00/ 0-$0$0 0M 0媆Ѝ| -- M0 0 ЍЍ/4 40 00S 0M00Ѝ/ t@-@p@-0@ ,p_pPR0Pp,////// //1O-0pPW`,M  n1 0 0  (05/,Ѝss@PM 0S XXX S0 S0S3*0! 00S S( S000S  0S S * RpC 0QW 002 00 0 0 00t0t t0 T0X0X X0 Js@T@,_P_`//O-̟ M00P0Q0S Y [00< 0 0 0<00$00%SSppSN  0Dp HZR X ; 0 `P,0 ,@ S     Q  R0 [ ʄPU* R [ Ԅ ʄ`V* 0BS0C [ ʄ0S*0 H0 H R D  _  \ rSd{- R@0%%%!:0Z0Ņ% 0C` RZ%pȅP  dV0  d/*00  D@D P `pnpk@ph 0  `0P0 ,@, m *XM 0 H R 0R0100 H R ?H|DP @T S 0 P0  BS0P cP0 `C> p(x $ pSPSP` p@0  0P  Q ; Z* 0[ʅ Q  BR B0 [ʄ R*  0E >   0lX pp|      Sp!\{0S P`@0 0P  Q Z 5 4p w,   Sx@ 0  d0R\ @RC0?T0S PA`B 0(Sf      +  epb R  \{Y ,~  , * S ǣp@ "".!d  b,  d  S       R&0 P0000pBP`00@  BR B R& R+ Z  04444 00u  BR B  [ʄ R* R[ [ R   RR R k      w  BR B8`0P0@00 Z0J0(#2 0 0 30Ѝ     0  D @A |4     [  z 0 R~*-P0D4  B @.  + @ ("(  "@ (B(pp-\A@ @("( p   ^w 0  0!Y 0  0'@%   $ 0  ? pT0 0 B걕pV __^̨Xt U`{SSTA-@P@ `t0pP@PU J0S 8/`PEuX@pW$0$ $:0 xxR 0SS S  0R @-o/ 0R0@o/O-((@CM Mp4čP`0@  0 @0 44 30+Cލ Ѝ 00 00p0 `0pP Ut0t  0phwL+  T 0T/ P 8 ((CG-0pS+ S'QU$ X!`@0S  0 0#S0S 0S0S0S(  :P# `VP@ Q@0 R!R  "R0 R R QO-BM MdQčH!d2 hԀ&h Pp 0`V' 0  LP@P UMM0 ZPm(PH <0 0 4 30BލЍe $ O-\\AM @ MTč9 0Y4:0px0(S`; 0 T#T4"4X8%X#8U"U0 0@T jMgM  0 zP PU p   0LPL @0 0 4 30Aލ Ѝ0x0(S̼  O-M Mtϟ0 p  [ !R & R( ` 0  0 ?@@X@0 +0p tt  0 H  . R< R30` တuP @R @P p ᰐ圀P R!RC+P `XP00S 0 0 0[ Pp@uopp0S 0PS 00 9 S 0S)< d l-  L `- T p P Ra0@0040v?D0\84 0` S1S @ 300S S00X01@ 021帡ZU0H0tSp0<0400SlATi @0CPh D0PPPyf 0;S<@  |P} [@Y0PTP y 4 @0 4 D 0 D @0R\80S d H0S"Q 5<00 p  R  H *X{t`pP|@600P @:/P|+: 0 6 30Vݍ ЍY 4@PD0Py !QD0P0 w  0 ; X0d D04000SR0X0S@0`S\0c  s`@V  0p`G0?`<0$0 P 60(`,0/ 00 ,   F }PP1 UC(0 0R0O `1  0 90 X0L80Z   80080M$0 0 0 SP@0b0!0t刐?A9c!e}P b0S ^@\0P qRȟ00( @ Ut  ,80P80D Q"  (<  0 0P bR`1  0 70TX0 800 00  1 01: 080<`0  0|P'  0 Pa`1 q 0 70X0 80_0 M 00 Xd6&Pa0&0@ @ XsV1a 00 0V$00I@0 ] 0T(0P0 `@vQP  Š20[000Q` ]0 0 v(0 01$000Pv 0 d5@X0 0HP80* |P 0D p@n0P Qğ00l$ @h gs0 (0d0080lQğ00$ @ Ps0S0(0ʡ;0+S .0CS43P10 @}+@ P %@#0PoP AQPRr ; `1S 0    R - 0H080{|P8R4`!!! Q0   30 @| X0Q D0H R4 2 qW *`dRP|@0p t@7/P`V q0 \2@X0 0`!0$2 @XrUS0 \01S@ 3`0`00S S000`P1B `0 |P00 `{P101<0@PD {IhP p0< 00 >{<00P00P 㸠D6D 4 0hH ĂC<@}D}|{`|{>{(z,vuuuu8vtPt\tXs(tt rrqqtqqqq(pp TP B("(R D {P0d0P0@@ 7d06SV 0`jH6pSo06(H0"( D0P TP B("(R D zP0d0@0P OL00! @ q{0S\ 0RT 0`1 f 0 10XP0 &0R  T O00X" @\ q0 82 X@0&0R  z PD H0Sm=00YO00#  qa0|p r6 G(0"(0R D0 P T B("(R D  R,#UzPʇUN0@ 0{P`P k1011S1 600 0 3$0 X05+0 4H@X@0" +&0R  r<0d0d000 x4 X00000b0+S .0CSX@0P  O00$% @( p0+ (0d00d0@0P~ Nt00% @ pq0d000 `0  fl05 @XpN 00 & $ ptP0 @k Nd00l& p p^/0-@P@0/M-  0 08 R1#0e(6,0Ѝ/ɚ;M- 0 0S R B 0S N 0Ѝ/ʚ;M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@fzP$Ѝ0 nzP 0"c110$Ѝ000$Ѝ00@-$MP@AzP$Ѝ0 IzP 0"c110$Ѝ000$Ѝ0M0- 2a@@0Ѝ/M0-  0/@A#b@0 Ѝ/MbO-@$$ß CMM,čßS1 PXd ,p0$P0000 0  o 0p q P;QP0p\400? PI0D0< !7 S000 $\40 ; P0 0000 ; PPa P0. >F x`10,430OCލЍS  *F 0S0Q4 Q. Q( F     { 4.48#804"4 $,$p8(#8"(bnEEE게@ n;$@ @| lllC-LLPAM M č@`p04" R3 1n 0@` m P,8ĝ0  0 0 4 30!AލЍRg PP 0@ .R` @@H mD D mER ld D |7\k0kO-AM⨑ M  čRxpPLp PG `nPPB t @+0-P7 0S4 `  0S+ 00@ p P00@S 0S0S 00@ @K @ K @縨 ᴨD ,0 0 4 30AލЍًl P j" O-ß CMM`,čPp@X\ @D0Sa  .S@0SVJ:TX d10T*0 ` D DR\ 0$00 0@@0S .S 0P0=S 1S St Su @0T$0[0 Pz8"02 0 ,4 30CލЍ0R.ST@ 0 @1( PPd!  T00 0 00P00S !  @D DR0$0 0s<  VD80 uP0 1 00S|z0000   Rl@00S}0000 v 0s0S0S DvD됚  O-p0ß\M P@`iT V  0 #à  #4 :4 4U@ 0W 0 P 0FSX0 0 0 F CP0x 'xCC0SUPPn   B RX00 0 BBP CCC PHCUTѺ7L10+, 0  k0 `F 0S0   C C C0 C0S   <PHUT0XU d0d d0 n\Ѝ<P0\ЍPHUT꼖 DpcbD%bC-@0 M`P(p1@D T@C)JC0W BC0 ( 8C 5C @4"40(4"< U @D0T00S  Ѝ\P P0P L0  Ѝ0@a#Lada|aG-@P` p崒Ḃ. F0S@`A0WV!= B@B @,0G?o`D2V0S ?V0*G `DB0?U0S d?X X0X T0 < <0< 8 0``t"_`AH"D`_=(0`( "4`43Z1S//O-0P䡐 M0S5 @@d@t@`p S S0  P&  P0 PI  P00^ 0  SR 0  SRS ЍkPd1 00d1 Hj[P0 j  NP  GP060 <P0 lj /P  (P090\ Tj000<Mji0:0   P  P090090| P010r  P020h  0P0Z^ d@?P 1? # H 0 2M$ 0P0ZC @x?P 1? # G 0 (32 P+ @ P010  P010__`0_^^_/`^T/|^^]^^x.`.]$]0\\\@-@HMuxt% 0`p @  | 0 xa 0txHЍЀp@-AMT ~t 0P00 ``*00 0#t 0 0Ѝp@@@- 0 A0|MT0t00& Nt0p`0# P0 6 @ 80 0 t0 30|Ѝ@@ꐇd ̉ A-@Pr 1!01n0SPpuOp rp0PSp@-Q@U x3s|p E01P E01000prc&tVxrP //9P //XA-pP@>WP``UW@0SP  oP j PO-@;_M M0*0: 0P0507@0VU 0 B01-`, 05p d!  d!. 0`1q1110CPP{  π0ʏy p d10 d1 P% `P aF`0DPS_H L p\ S S00 PpP0S SR#3:0 0CQS0 0CQS000008hP ~?080}o 0p+0P'P 1#S;S 0x(S# 0l(So 0`(S> 0T(S 0H(S0 88R00sS1 S S0 (   7R1 S S0S00 S S SS@@ `0 E_A0P@00Q"0A'A+S? P7R1 S S00 R00S 0P0 S S00 @"@0S S 50 p@ @@@@@00@00806uO 0 0G~Pd4P R`P 0 4P 0R@lJ@L0d!S 0 0 2d1p% Qq|1 |yrp @ όx0`0S W`0`SHPDHp .Sp0SWP`.pGWV0 0jP $ +0$00t4 0 5 30_ލ Ѝ4 Rq W W Z|$( 0$00,` `X  V V` VV00;V0SJ`V 4 @0p ;V  00@`V  TPP 0 0SP 8 Q$h!DP ``V;V d#0 00@`V;V  0 0/P 8 Zl`(,`| 2R1 S S0Sq00 S S SS@@f `P D _AP@`0DPSH  \ S S00 QP0S R:0 SQ 0 SQ0000049}_/P.P `D0!x3!|3p dDPTDQ La`(fQ4G`- P 8 Qh!- qPC-k`P@9pZ 2 = PT렇 7VV(7 domasearnamesortoptionUin4erTlPRDR list<ch\NxNPNp@- 1 P@hlHM QP T 000HЍpp Qx#r cpV p 0 xP00pPT $000HЍp者< A-P RP@p0`  R  @P  R0`\ R 0 0O-0PQMp 0 P4P0f0P0 `?0P0 0@($      -P bPX" RM  0!#X㴠`Fg 0PP P ibP R X@00^PU% 0  0 `F@YP) $@  Q PX `F #Z 8Y 0 qA00`Qߍ @$ 0P PEQ*0$ 01!0 `\  ߟ ` 0 Q0 :0 AQ1 :PACⴐ RC PZPK $  Y  /TP P K) ( p  #0 IQX P p Z p  原X  0 @ 0 ~0 0 @wt 0 p+ T H@-<0< 0@P @:$ 0 0du `' <@-$0$ 0@PL00hu 00/& @-@P @$00d& @-@P+00p@-@PP  P  0 p 0  |0 PEp@-@PPM/ 0 ` 000dPP0 P  ?,P  0 ЍpЍp  0 Ѝp( (0( $0$ J% HD@-A`P@ MK !1 |Q0 Pp 0 RpGST `Dp? Ѝ4A@`P! 0`P 0S@ R `P@  0 `OB Ѝ  0 CB Ѝ|0| |0 dd d 0 `-B0s @|||X(P $>P 0!E`1$(`P 02~Pz''z O-Ff@0 MS`, 0 4 t& $0( \F\V@PR8 H601vW00g(1<06 B0R  50(< 앟ş 1 c0@8'0p(4 < P 0(0 P| tup40Sg0S X 4 0SnX6S 8% 4 0S$up00S S 504 RU 4 ,00,000S4ğ0 ( 0XA4*0210S P10q S^ X40( L40 0Sp 04041%40(8(UkP0440^ 30( p ЍqR 0Q*# 043p040(P8p!@(%0%1Ru4#! 30<)!^ ^ ćrp S:p 0("< !0(0% P^4)20(  p20(<  \20(<  H20(< 420(< 20(0 208  (0쑟 0(0( 10( 꼑 (0(10(0 R 00! 0x1x0 0 d10~Cp (4p ЍBp N=p 0y^4nqp2  Z 00K =@zlp y yPy0V FA0D  0 \   Ƞ!,Ƞ0R000 00@ @@T*80`F0C@J`80000 Y 4)GG$ $0$  0LXG-M( y\X`PpL \;S<03%R @@zz0 L l3< 081p P4,0SJ 2 R ,  0#, ##$\A A0AW@U00X0;(0H8#80ᴀЍ\009\S <0 PJ,0S0S !Q #$ 000#$ P0A 0S$S8#8 C( 0"( 0 0 0 Xx0pT@0@yN@0@P P0P 0H 0O00lL   61Sp@-@M P/aP8 \,0(0S8Ѝp\1Ѝp/G-4Ÿ`0 MMqŸY w @P^ 1 R2X< *5S0@ZZZ0 Ϡ B Ό b3Ό2 0I0pE YO\!L1 0  0 30H؍ЍU80`J8 ᷨ8000S   "4<Ġ"< ̌Q0 Z "Q Cteppꍜ@0⇜@0O00r7 6 L O- P `f.@P H1嫲p0q1 u Jq08 10000N`ⴜAO-40@S`p M0S0040000 PD 0$B1;0C10 X0 M ^ Q Q  0@0 SX!B! 0PR|   R 0S  "  0!2#$ S C$ U @ UX SRR0S5X%XpUk 0 (Pc 000@@℠0ᄐ000ಀXb0HPIᲀ0@ ЍX D $ U D \ RP1 PD D00CD0 0 10CR[  B Q" 8#8ᅅ0X%XP!@ 0C 0$ 10C0S  0"e Q 0S 0^JPM ЍX1 \004!414 , 0@0B YPU1 \000S 0Pⅅ!D PD 8#81 k\00PU PHD充AD<1 X\y00PO-@P`Up M0^000Xg*0QC P @PU \000U00SP ^' PЍ`0SP0@ 00S"w@P 0S00 000Sb 0 P00080080ЍO誕 0008(8⒚40PЍ0@0 00^00` 0500C8#800僼 0S<:00C8#800v0  PP X0:0 H0ಀ0 0 ` `x x0x 0 p0 \ \0\ X0 0D D0D 0 <0 pqXt}xLu 0A-% !@ ::`0$0CQ @A3@D$0@N0qPW T002!@$!A覛pP 0  < 0H@HW0O- @ƟtMTP @p*0P(0u 0 " P4 m (H0$H 000 00P000SFH00@0 ` 0\ D@ ) ฻  I Ა@ `Rڴ R  D@D 0I ȠP,Ƞ  BHL  (@(04P`@AH$HQ 0,0080X0$0<00CS@H$H@0S*<0A0A8#8 @YᲀT0@:0@I@00ഐ0, 噙0P,0 R 80S* 80 <0,080 RD*Q^P0@00Q0 00 RPP ` s000@H$HQ<08#80 ᳠Z100S B CX TP\E0S$0Q0 00 R 0P 0R 0 $0: 000 P1Q0b80S 880,0`00 0 0 0P)d0S 0% `P0U$0 h0`S,0 80q0B8#8 Y0@2:0 I 0( Pഐ0004 000tЍ( 0,0 800<0S80SㄠB,0x800 <0H\ \0\ 0UL 0< <0< 0X 0dTH(O- @\T @0`S0P p@D%P , Y+P( [  8#8R40  < 0(10S0 1$10$10 0S0lP 0 P0S 0\P  00S 1$10$1_00O-MYP@000X00 ``FV*:S 1 !* `p pGx'x  0 F pF000H00 B 00p0@000 ``FVB*hY&hK V `!0p pGx'x ๹0I`h&h08#8አG0Zp01`*0ಠ0`0p00EPP Y```0S0`0F2"0y 02"0 hY0&h0``FVt*hX&h] xxx2 0 0 00000``FVR*hX&hD Vp1p!8#8 R0C8#8p  ` `Fh&h@0Hpx'x08#8ቐF0Y`01p *0ಐ0X0`0p0 00PP @00S+0`0FAЍЍ0 Y00 0 O0 0 F0 0e =00 0k 20`t0t tb0 ' `8H@\x̽0G-p`P@ S  R0 U@ xT8 P X0SL0SQ 0R0Ӳ00ô00 00A8#8R0 BY001 *("(00 000EUU800C80| 剐BY001*d 0P P0P  0D 0R0ಐ0CS4O- R P0@ B( * R(-W ᕮ0P P I$ c@P! 0R  B( *Z`pV Z@  pP@@p@-P@ 0^\ ^ P0Q$ Pp\ p pG-@` 0PS 0S  0 Q@PS" 00S ᲀ\: 0 BS P> 0 \P   00(!S$! 10$1P0 ӕP @p0弐ᲀ 0p 0 S z10 B\x ἐᲕ'xP  $1 0$1(!00O- @T @0`0CS0P@D p M!P ) P(P' 0 0  dP 8#8R0 , Ѝ0 0S0fP 0 0Ph000@- M@ P p10 Ѝ0O-@pM 0 0p`Hpb 1 P PM0STD0Z 00 @ @ 0 pWO0 @  pG W0K*0@p 0@000S p0C8p#8W㲀Ḱ0=*0p00ᴀJPP D0ZPPЍ0 ֔P 0  0 0  00 pl l0l h 0T T0T 0L 0df<\}ܳ|4G-Ÿw?`0 0MR,@pq2SP:0JSM  P P崀2Spp1!pp BRJ:0CS㣠o* 8#8X * 8#80C 00C1!0C8 !# 刀#(  20 2  2H@ PPxPePXP dP0 02@00t0!C!-\\ R0C0<20pW WT  R/ Y  BpPPXPPqT! BT`P "  ㌡PP* âP 0SQ tpYPdqP[Sp`@ 8 p%,1 B R 0S V X S 0S X  R 7/P  R z%$ & c$ & \ZYE_,%~ -l&L آ  ~ ="O-yMPR%0`Hx00 00 (.p8`K[( 0RJ Sp 00 0 TovPePRPGPRf0@S(H0@ SaP0000 0`0 00 `00``0 0`0` 00 `0$``(`,`S7 0S 0SQ0QK4Q q'̶ P M6pP/W  0 10S qRp0S &0S0@0@P0P/S KR 0: S00! [sJRn0: S 00000#/W00S %n0S0(00S00JpW   20P0J `50 0"^0P @/P05 %0CS0$ `% 6 2 `pCPP0S n0Ss 00   B R\ L` V `,Q' /0 典 P@0`40  P0` J/R  S/R/  # C  R:  `  $ t3 0S S/R$ 0\SR& Q0sX/ HL!R\0X\!R\ $X00: S % C C `jQ0: S P1: S  : S!  Sm  Se O S^ S L0S !PPL,0SJ ! .FE0(尥 0Z lZ80 S801!Q pQPP1: S 00Z0S 80X!0CS!80T1T!TNPR X0O .0S !P0S !Pߟ^C[ (0S0S 0 0 Pp!m_&~ l&"W L%T%0 "ã  #I}8& 6Ť" ?Ф=O-@PPT#@&,p8464V@(FvQP60P f +R0S0 /m POP :\R4P0805HP40 RP0%/(0@5RPP8mP0T P5P%HPNP8P H00 0(%43/00P08004 lR4q 0P01RPP (QP 0 P0 S@0D 0 ;TP0; S @,0(D 2#!H8 01/,TP0P$O,)2PP P0Ds崓0 CS 01#SlQP0 0( ,S* B-"!0 0 Q8PU H003/pb0S@fH0803/p$^PP G0 `0d P 0 S * X  0 $03/0  0-Q3  S H!R0  0 -1/ !P0 0 0 0 `0d 0 `0d P0$ ,!|Q 0,ذܠ0Z[   P  00h0 l 0 h0l   000 RR0 0013/t SP S?PXP\`0P ( r(0, PU`00 XP\`? <A_l&T @'iX%'ͨP'=@''t x P'!pO-MMN!?Gw '*p 0 Q 0  pH0(0`7G@-Pn0@00$0<00D00000$0100000$000,00$0;0H00L00$060(00P00 00T00080S P6kPU R0nR oR0P<0,`P  P8k`P,ڷPPP{ C@RN , 0|5 PybPpda4 1SzH0S?80S<@0S9 P0SP _bP4PD0S 0${, +hp P44X(D`尠XV 0PU 0040D0S RލЍS ,0SP sP 娠=`0@0S0H0S 0  FTP P 3R㓵( F }P3m W` tB0Z ₣P l3  \IP TT 0<40`FP MPP tTPPT0S0: SeTPPP4 01! P4L  0R p 0UP0 T0StH R 0 T0SH"DpSTP4T0S 2YX 8SU # WpVJ  ."  ."  $."  (,." 0 4   8<  @ D  H L  3]P Q  QP40SP8`_X'- ls&Gl& @ tʭ=zs@-0D&P000T00Sr0C?o21$(p0 1000C00S8 000-S30 2R(0pP EP SP (0 ,NB$?sP xP  4 3" 3" 3" 3!00000C0T[P#xI@P ThdfT(cQJsYPL 32S ,#,B :U 2 0S 000S 0`P 0XXPֹPC000!S 0 |0S <h000S 㺹P<Yf4A0L A1S bVQhEf៹P2S 1"A:Ua`0:ETPQ100S S )f!0`0001\@P a Pt [Po  4mPn 2S 0"r r r2SAeQPR2Sw |0"PEP( T0"p(MA< <HA 'l& s&-TT0c'$'hL'=s&ñ(s&@-@MP`/9P@@E@P8B8r',"s'p 20 ER!JJpshwPePLP= PP0; FP kf0@ S00!K'p|1Q=0 q E - P. R1 R3 R 0!BSQ/ 6KP*0: S&00 g000 0 0 0 0  Q j=  J@P0: SpGP j@x' _l&Z=r] nO-`M@JJqpP!&p 10a1S 000`F0PmP pP vtQ|KP xjg`KP<[A Lp@,0Z 0JP00 0JP( 000 * R 0Z /0 0 U:{Ip @T<ZiJP U:eIp_ l&-آX =O-JM M@(J)`R"A&p1 @DTϷf0 aS T  \t00$CP@T 30p/SX/ᖰP#0 S:Lp`  sp_4'ѵl&<ֵA-`P@MID4 0I IP  H IP  H IP  H IP  HPhǥd3P0\3P P$P@3( 0P+( P3( P7( P;( P?P ( PP( P 'P8$@Ѝ(P (PP"=(0S (P(0S (P(0S (P(0S (Pq0S GP|!0S0S z}p T:`PLa @1R`;PU 0E /R "P(卤PU  y00,0/00(0 0CS0~P0$0v00S tqe0s00.}@E(s&PTE(XM%r] 'N p'*p@-@PtHu`LP PP ɤ`t $ph00SV{P/e뽤P $夳 0@:_}:l&s&(s&O-MP=Hd>`pXFP&U$p D6@X/,60S ЍfP WP! PP p `RP dP vP iP0p0 `rPxP pp0p0p$ppqL [,1@ES ᦵV8e  0P0SP$0`S 0S@ pP܄ EPP40S d 2@[*0/S /㔮P0.S0S .S0SZ< 4 0 R  @ 50C SN00$S P Pd 00$ @Z 0Md0S $ ?RR00R0SV1 $ D  0SX  P + 0!0 0C0~ FP 0S' 0S 5S 0S 0SRGP0 0] 0 0gXX  ңPQ F0SJ2P D0S 0S= 0?S9 0S%9S  [00PU GP$0 S`0S;DV0: S R<  S/o" R 0: SEP0S  nP S.F 0SF ʣP m0S i0?S e0S_8F(l&  "=G-P@F0`p!"p 1 R1 p0C@P 9pP vP0p`ꡤEPp0S VP /3P 0S 0S EP0p0S }_ִl&`F(=0@-TM ㈿ 70 $ DiEPiE@qFU0 F0T000D 0DP00ՔCpP3 CP 30S S S" 30S!  R h#6 R L#!SRL3/F $3! ,3 003 3  220S () 2 20S ̬0S'002@T$P0"@ |B00CS00  0 @ 0S60016 R0S 10S<0PT<0 01 10SQ 10SM(t1`1PNP10S L10S h1 \1 u0S X160S 4@ 1 E01(m 4 0S0F0S 00q0S0S 00@|P@ToM(_%@G(|G(8P(G(HG(DG(u\ %%4S(p%p0@$@\tPcPSP PPʻd @" nP tP0 aPP dU4 RU SU" QU040  \pUY [/lUT    $>L$ @p< dЍ $0$ @p\ 8#8 ?p( 8# 8Y  H T@DPP`p | p`TE\8 ?pLP4"4!( "0y X!  P Q !*\<0P0(\TK 0@Sb4|_4O x08RP8 p>0PU ,8 5 P P P0ZS C`V   40P`||Q-#l&#G$~D'#D4#{DB#O#|D(^#k#z###}D####$=X $s&yaratcidO-0`pOaMП22242222322$ .pj>"42`FS 20000b2@_S Rd2SVV10 dbV% ``L0p L pP  ``L0ppd2S P>PX0: S0d2232d2o``SmX}0 P=IPpm%0S, e( zPRP3P/PS@'P<1@P A@P<P00j0000|\ ,2!,00SP LZ<P0d2M042J02G02D02A02>@[ @3Taߍ02/202+02;/PᑧP000S zp$ 0 0[ / PP000S hp 0$0U /mP000S Vp耝Z0*2Z000 0B BhP 000S 3 S;3l*00DZ 0\ khP 000SX"\2R$RX2Y/ &P P=PX0: S T: PP %/P  *0  哽P|=Z Q<PPT U+</=p X:{\10  [ *;[ !14(S;̲03U8  8803N(88 P 0@C LR\ 2SY 2S, 0sUb ;phd2SL 3=pV X!\1 D\1X! 0 \02T7,2P702 S,2 S(2?S ?\8 ,"#3P40(02%*:0L0 08 <04`p8 LP<0PELP00 H0D @Qp' H0DL804 05P@0+ ^0 \  ` v !p  ZY1d2S+(1\ [tPPL00<08 4p 40 S8 *"<02#L SpW U[#010R,b(H"L2R0;\2QP 01 SRC !R QR<Q9Q6S 148<0   0\00R00 !14!8!<Wp@(Ԡ 1l&2X(2$ ( -1< "1+1L(H1S1(p1z1@ P(+=11(U11@2]222(2`(rdA2edA2&(60\3>533%v444h((4E55333334E4(s&(MQ4455S 2"0g 2pSB`P 0$    0 2S2 첕[/0@t@2SP"  /`p0 0?`8@P P1! [!0T2<<23S C2AS``尺2S #8$)0 奺P P `p+0!` 00"4,00!` 0,"X? 0,! 0 0("s(| P i᝭`gbo0@T5 @ET @@谝` [000S&TV"0   0sKP .9#y || /d#]P+ `V2.TS .O"20"0]!P1Pk +h-0O-EM MP 00P00`P蔟PP@ 0$p0040pV4$i& ލ ЍyPcP PP! TP& 0P4 LLU/+,@$d0@S0000000 )0 00000J0S : pP2V00[ p# >P|#0SH R) Q(nQoQ0 )#0NPPu "D#00"@ P' P" P  UU.;P ,Dp@.P FD"D<9PB70R$00 7#YpWH ` j=P/ ᷟPZ1!-Z5P@PO?oZ20S@ O `@T  j=`PDj/UP 08p.  ~7>04P(`CQښ. .a0C 2 0TU븨(-#El&й Es& Ш(DȨ(l%D_(\gD:E[Eب(zd@(4E8 =edAlEEEEG-p@`㤁Q!vp$Vㄑ 0S 0S l`d10pWA 㒱P <危0S $凱pW%ZЍyPmPPP fP & n0@ S000000000000000`3V 05PPj &P&P 6Xꈊ-`(H%Hl&` >HO-(4M$$` 8P! 17Pk60pCࣟ00PPP#p4W00S 0S 0S Pp3 a X( 0S00P H0S 4,WPY30S ЍzPOPBP FPG K2P@*P00 dP2 ^P2000b 0 Khy,0X 0GP00 8@P00 0 cJP}x000t00q00n0 mJ1 P :S00000X000T00Q000M000IpG00000A000=P;0S`JP\`U 0vuP] `IPs`JZ 5JZ(<(-(V_m_l&0( Q( ^^^^^ %#_6__>HO-@MP8@6SL(坫PUPE10ůnvPlP,HP1 TP3@ ` 6p@&V  6qp@J0 S F < <0@Zt pKSh2m@ P` D"p8 R 0S00!S0  1 ,0Q =P,00S  0( @nP@@600-SG 80@0$0 p0@P@Ѝ$0W0|1 4 ?$040P ?000R0Sp h```8np\0Sï0S 00 0@@`p @$@ @P \r 03/p Tኆ(J -]x xl& i 健%@-44P,V$0$00L Ѝ^%`(O-@P8M -`$@, F8 ('v`^ 幮p 崮p xR5 R|, 0H L,P00P(\80`叮pXHP U5(EVIPHPUpP5 $h$p(5O005SO .5+) 0 0$00 00 0  FPtPP$R|墮PzZ `Z NZ4 AZ% CZpD pRj,a J0R WZ00!0 0 裟 儣0DS ,lK0L0J0ꠓO005N03Y YH0CM0H0500!0 0 0 V0@S QI02Ypk0zZ0gkZLZc2mJ Z^ PㄒWꬒUUm㙤PH0SI0SO005SR L㉤PN  ⚭p8 0S  0C !P j@P!O@Bp``ᨮp!A |P|!; `Pd! 0S1H!3/ (d8 PPC`Py&0:P$1$!$ @R #( ^p PP 0  (( Gp%p(%-%P(h%h@%l& %% -%2 %9۝̦*j i iui 9m@-鷣P P@噣p (P@-HHo@u<<n,0400j| Ѝ䁣 %( (@-HHU@[<<T,0400Pb Ѝg%4($<(@-t@t :h0(,6 <(:0H38@.@040-0?84Ѝ@BL(%l X G-`M2PHP13P0 p) P!3\"3@P L 3H2HP8"0 8288@n 3 Hxp HQ 3P  @ p1a 00 @ p0 @  x080<0@0D00 0000P0 0 080$@P A 81 HL@P@T@X@\@HP嶬 H㲬111 0400,0@@,0( 00P*pPPUPh0PP 0/`Ѝ@; Xj):3oes("%  (O-`pPH6MDF(` 0 0&p$6U K V0S`@@0VoP 0SЍuPfPFP RPZ 5g@PP0P 0 h`O0#S P` $$0`0S  $ $0`0SP3P >O0#S (4cP $$0(0S x $$0(0S|00y0P (PN'q I'q D' '` @s0KSq0m1Pk1 C@Q 0cR pR bRJ NJK[g0Y`[0J^00I?oP2000 U.Ux U,P 88 0,3/8 RPSX j2@'10S_ 0P|0 0C?oR20SV X_ꅫ00 0$,0$00S 0U00S 0 m0S0P000010S߶1 0S 0P0 0  Q00s  h1000T,0 0081P0S& SR 0@0@0 #  R S 0P(0s  w0pd10S ?0 00&-l&(h آ׶= =sz&`O-P@`p'M M⌦$PP|&8 p-p6pp0@DT00S 0C 0T T!q5@Py XG PA/p`.0S  fAP+ a@P5P5pP50S ${PX `MT}P %000P00pᚥP 啥P 吥P"CP ZPpဥP P( \M}p qN5P\q/WM00 000#0 00$00 0cP@(DPPc=M (P(PY@X 8b1 PӶP(!h̶P( MG`P@ p 0P@ 0(`p` q4P 00 00$0 00 @PyGP ;GPqGP 3GP @PP <P 0P!<g@ۤPY wP( M@p` lP( +B /⬖Pm``9V!:r0 0.p` `!`/P.0SDࠟ00 000$00 0 0P0@(p /pp.n.0Pa0SJ(S'- 29S!S8 1Z/Y F`P'ݍ Ѝ l&(p.[E -ѹ\gD+ = !%N(zd@h(edAp@-P@Z/p@-P@R/ᵺp@-P@J/8@-麻p@-P@@/᜼p@-P@8/pp@-P@./p0O-nM M800h`4PὨXP 0H~0 P 4PF  >R~p>(0$   p@5= 10>0S=D$R$r R  $t}Bt $JY<$.m`|0A: x0@ <$0( (0JH.p00 K`PEB@D4T@@0$0<@ᢣP < $噣P 8 % t<  d<$$r $pL ႣP ,<$0 00 L 0 |0=0(00 L0, n;0@q CK; ;$h0 00 0  U\;Z0!00 d0 | G$; L0(00 ,0*H 9:$>0!00 0  +:(00!00 0  |:,"0(00 0  D:0`:@0:0S P p: 000 X ޴!00 0 0 :0!00 0  :0!00 0  D940c 00 L0  D: 0!00 0 X 888Ĩ@0S C.0$ 2PJ1呢P0@4 劢P@ 8(iJ\8@(|PD40 uPD40D4  H 0P(0u `800 1 1 8_48Cd7@P00\7 000  1OL7 G: PP/ P J0S 0T470 04001<4 4*8XD" PEU UYx V♥ ╥0.` 0 PS 4S<4Y1 H4L$0 V(-paj?HL4P80ԕS $E~G?4GHtLW0.= 0 $?%pp5WLHt4SH$L4R0 %+pP  V -p  4S@  1pP  =I  8PP;l%7PP\%\V,p (:: S4%8) $RX+@P %4@pP$  g섟P0HpWZc$R0 >$0@0p!$Tk = x,0HP,0 r0 4LP GP$803m`Tk 40S0X44S.=0@+R$)SR' (8 # *~"Pb 0T40SP 3X#0S T4ShP`3 c(8p+"ŸR H$L4P*`Hpp 0 L4H/0#! 0[pL2 C  H$0- ;zhp~|Lz 90P0 X  I!L4HϠ0#q4S 0  ?W ip0$$4RT SQ  W   0C*p 0 pWS  S!0$Qg +S0$0 Q$ Qr*8n( l&X-Q( s&u*f\ z&Pax~%Xi (,s"( 4E( ,@Wk# 5  $m%E8{PX WeHL$ P,} P+P *+0$PhS0[ 4S$phP 44崀S04144 0S @4S 0 ^0@4,4S $4R#1ѣ1,40 0(0Uu )t )0S 0+FPp@% P' 0d!|;]P`E}>+ \gP9X+-Q :$4*041$4+T4S# *d0,"|\){)y)w)PD*\4$8: H4d4: x0<$+0@ 0 *p`M^|tP Z +bPiPM  <pp  T< = E0+- , O-0pMI Mi4, (spP_8`4pGs04WZ h⺢  ⶢYaB 4S<44S $$4R0`\((p L ha*p 4 4 SP,0S x0$O t$W0 0N 0$CpW$ t1SE $$4P>*`FZU CUʢl7DPEUPPbPEUUPP6 (j'8#80( R&0C Rn ("(F044s04b0 00 l0 6T0(00 4V0,`0@E H0 00  0 50*00 +0 )0*00 +00!00  00c 00 |0 @50!00 L 0,00 1 1 u40(40S F00; \$V40P0D$Fhe)p 4S 'PP$p$h=`P#X  L(@P@4(0(00`V Z<0 00p"#7$p = 0ѝP0 r0 4՝P НP #0E3}p$p4S80S4l 1S !1B0"H 0S8⭝P (3"$b1p1   $Ĕ!<#RXpX2   zE$ 2ep P xc 4 $$s(4S 0H?W  * $tR $4'S  4%ǜX0; 4 $$ W  0&p0/EpW㫜X0:S Q4S  0 {  '0S Z '!gぜX0⫱zX+`( -/l&(s %*f x~  4Ee(~ ,@W*   $mO-GM MP`h \0t@$$p40PEPEUq@@5P3pD0403003c3哮(3 p0,0p0T3000D30804<3<#  3@ 3D 2H2"20L02"yd2l"qDl2L"i{$T2 ap0V0 (2WWi2 Op0X01!EW 1=`Op0x0p0d1 H'p㸐%  &qpנ0 S Ӡ D V 0Z C0S0SPT0 A/ፐP 0$ 0 0 @xx:@PC Gލ Ѝj l&-^ %1AS_p] 4EO-`PMD \`[P&DOP8C &P%p %%p `Pp&@` .DpRĎ 08 P  Z .>> Z %P t>NGP %Pd<;Sڧ%PL #G $G 0O >OKO PX( { =0 2S1<+02D0WC=0S F=C@4P 09 0| ``0P 00R0S DB 0;8;08; 00<ppGx`<`00S 0FP  ,!.u8P:P :2@0SUȌp Upp̌ ňppPt  A 0@ @ 9 0PUP 0C S0400000,00(00$00 0000000000 0000000 0O0p  Rn PPlWo Mr8;  00 |\0$ph88; 00 D\0$p4*8; 00 \0$p8; 00 \0$p pW  |0 x;0 E y;z+V0;0; ; '0cy;0z;(0x;P+D@>P \0g$P;"0#10@00 0p[`QHf  p   p 0B$P[0S PP [05$PX 0  00 86($P,d 0 BVpp6&$Pp5%$l!2P(10[[[[,Q0Q4QE 0@PPPP婝S,<;SdE#>؀C 0 J6PE@PJ P42N 0^M 0[M 0$胟N# 0*6PD@XPJ 3N 0>M 0GM`"2Rz 0DPt ' 4$44@PDPt40S 0 a8' u@P 0qDP@P 0jDP D2 h0弖*"pt00 eΎ@+lY@0W0 00D4~Pt3 XppW & P 2G#P0:CS0 ?#PD 2$ 0%bB LN`p l2L@P 0DLPZA@P 0L 0@PCP D 0CP 1 LK  h!@.T 0S _I0㈠d0d000p+t!pP0S J<O83)-D){Gz??ieAl& -4V`RMb@Ao$))$@)'@)_)z&qP))u()dL%l)-C6?)7A8~A`)$@)@@s&0)x)P)m8%H)s&)^W:i* : 2Ot!:TfJ +F^w+@Se)m)|{D"t;@000aV WL0 0  dL|0d"R!RT 0 Q @ PG1@S4 2R`2嶰0C(4"<8#8[1LR?L0 d0ᢏ0 d2$2    pp0xt|0?lxt 0hK#|K 0I^KIᰒ BP # !BP #! 4+4#0à3D0h2 0h22d0D#Wp! أ0$#$@0(00"(D02 0BS@ (SH; B 0;pD0S?0#3!(0H0C8C8S!/< 0 0H 8(#8<"( 0 DX4币  x/vxs 0#;    0;m 4 0W؃0$#$@0(00D0"(spd4 U T JwP@0V/W s@ 0RZWqأ0$#$@0(00D0"(>4u%0 H0D 0Xp4 <H&0CS00 P 6Q20 0#!0 #0pD0 0 Pk 40 Pb X7Q0l|0 xPD 0$#$0(#"(!0 dP/ {0 ZP% 0 QP Q Q TXp\n 0 ?P| r0 5P 0 ,P 0 #P 0 P 0 P  0 P @ 0 P d X9 02 .0SD S`& Ss WE؃0$#$@0(00D0"(p  SHZFWH `K F ` P  J<Z0H(`F`J 0XHZFW&:;Z  vuPW   ḫ  QW( p JZ X Wh  ;O-M`P @0-S@QP- @3 pģ#yp*30SP a`F0P[:PQ9 JKP9 D <4P@ 3C d0@S Lp@20SK@HGG 0x 0|X `;Y'3`P2P`4b 2 R  0 S  U+ 0 !&0!00 WX   tp8 0jp_0S DiW-?i` XpM0SCPG0pt@@T 0G; Vti`*N l&=? ְ_02!?U8 kO-PAM M@`z뼦P zP60V00-S% @P ᠑P;@ p0K0\Z `F0S0`@DDA@Du%0p ,0S@bLP53 Q X bPP -00 `@Z-00  D0B5S0 j00S :P:0 04P :0000|400 |4 0S dt: L4 00 8sP ~  "300S Pl0$0g0(0d0,0at0C?o#2p R0S0$0P㵖t㲖P㭖Xw0H@DT43a00@`FrS= RS iS1 tS xS'5㨢в+ 0p 0@00@00S M 0Y.0S  8< Q (0 B/S yJ(0S n 0@W0S (0S |X1 0t0\S @XIV(0S 4? 0@,=N\\<Pp+>X 0 p~PUV^6*h Woj-+X%~  4l&ts&@=d%s&r] D)\O-PLM'P N n.p=,# PER a0:  @@0SC*9vPcPSP TP LP d0@S00D003030800H00 30$30(30,30<00",000@)0,0p  qW3S)P  @ Px< P/P LЍO3S 00^p,Y0T4 O8J<E@@ 0RWS[Z0DSPQL  0gS @{$;0 0EY0P aR @L0Y S a80-S20 @ 3R: "0 0|: ` P0 0\:0 0H:43043{0830<3@30@3ppzzyyx||{U ,0U ,0U ,0U ,0U ,0 0 0U ,0L00L0U ,U S S0X0X(0CS00 PD#8 D#<#  P Q0P0083 00b0 X0X 0W@0W0W0W0,0  ,0 ᔡP 垏PiH0Sx'xx 0>@PH0ST'TH02 ,0XS`X `43 S`IpE/aWF cW1 gW0Bp703S\0S^ 0gS$ H0S!*YP 0x&x  x00S_ XqZWZV 0S00 b ,048<@DWLЍ0000H3p0P xH30`pD30& 4 004 SSCP 0C00 ,0  4    0R:400,R0t ,0 0Rp B p [y<0S $3S 4p0 00 R  B   0Dy< Q $0Q p0 40 R  B   0,y< Q $0Q p0 80 R  B   0y< Q $0Qn p0 @0 R  B   0x< Q $0Q\ p0  <0 R  B   0x< Q $0QJ p<0pGSz $3S0S 0D0S\ @p707S ,00'c<sr=OS J f D x >  8  2 Wڀyp֒0S 00S 0S  Q 0   oxtpW , 8 30(#0<  `"+k J l&]! @k ~ _1O 4%"+"+ "+"+"+"+"+"+9K Q #+ km "+x#+gt(G-PXMpPHh  y5DP b0@SS0p80 6`(pT80U ʫ0$60(60,6006046060860<60@60D60H6$&R 4&<  <&,&R 8&R 4&R <&R 06h'SddQaDbPA07C P &P W0S  fP 0000啋P6T&0 @4 ,PWP061 m(VUupX 0+Sp@(86 000Ҟ<00 0/15T& P 0p00 :XKP00G00Xp8 h5@P 00 B00C2#S0d0P0 00 B00C2#d v>C 0C0 0@0 B "00P 0P0A1#10C0 0P0A00C1# 0 0P0A00C1#0  00 B00C2#0qp(4 0P 0PQT3C4݊JZp=V v`2o`F#P0 0SU030#:U 5%$P冗+P p\ = X/P&T6K/r043PvTS0 0 S5# G@a SPESX!EK/r0Pa 0 0<6SR46SR 0&2RRPT2 01a|<6S l7P W0`W  0,P a,6S m/`P w0PQ! V !sa<6S:46S: l1Q0@6D&S1 0 00Rt!  H&hRd! $&RX! 8&RL! 0&@RP /P0S $P|W 6P \20 0000 q l&-H%4E8 Q/+=yt Ct 0G-pHM`0BR"p 2B1 pGS 1S 0$  !RS@# P+PTP<$f2xP`PAP MP H!a0@S0 00 04044041! 00101@30@3101101101101ДY 000 0tHЍP  PP  20S  r0 `PgEPW a W YpGW R $Sw ,0< sW pt/+-(l&(. P%B=x/+s&C-Mp`ᕎ߉PPEUx% p5U@U`F V/@T tljP d‰P  aP tP(5 R ,%  PV 0S A@D  PV`V v  r tP@PA@3PzP0S<0S000S00S00S00S00S 000#pPU 3 `V= V30SU7 0S4000000S@0000000 0 3 0Ss<0Sn00Si2P0$0:^0S 0SX`V UURpP `P hPC UB U US@2PEUOPPUI Q GPB 0 U2 @U U70000  J. U,*PJ!0000 0 7P   [ $0S  p $qp*O@T  0"600"$0$P @zP xuPh/H4+0 l&{.-/s&00+ d =010K0^0n0+ .0C-@PpMa M!p10S QฑPE R ލ ЍRP fP74p P` 0WOJEP1 JNP/0: S2  S)J P0 JN@n` 04S00`.N͌0S vphlJ PJ @PJ0J@p4+2l&=222C-PGMM )0tLl0 XP0P) S%‹0 tglP9Tv T P 8h(n4P 8T(X(d ?`džP 8h(b40EDS00 `8() D8X(T( 08,8 S8P 00S~ `8d .7, ,, ,q 7,m 7H(iM8PM7, \] h7L(YW+u PR:?@^ 0 7P(G7WMp`P|78T @PH;@@ 8@0@`yPP0@P`p@+Xt0(@0@000pUp,`40U0 (P<P8FM,(PR00S ,R  \0,0S K,8SH= dZ,8S _[+ qR iRRRR?RRRQ S(s&s& Sl&Td }+ R SS-@&ESyd+"s&ZSmStDSS-SSSuX ETqOT?"?,?7?C?[T8aTQkTL?vTT? 7T/Th+| TA-P`eEIhEP03#Wp2S l P ,UڌZ|PO p 9P/P00@˜7' sdvP303@$Hp440pEWQU 4 000`၂P C,xsPE0S3 4# 3PPMJG0XPx+`pd \)XFkPP304^D[4S 4S4[P  +"O P 4SsR"[Pn l PpR|,p`bG1/΅<01 1> 110101$1"Z@><(#2Rkp`d Pa Q18C8S #YrP`q́Y  lQ00S [ P +`3P?o20S R=?o20 P P lZ18C8S 0! SS 0RY  \Z=`S 0 0000 lZ18C8S `[x,Igfffl&z&f,!g> dds&'gl&x&.g?g,, ff=z&_]@-@`ᗇ|PP h1 dq\! pP10SAF01P> @b1)łP  P 0 nPbP 9P0P   c0@ S0VP |R 00@0 P0  @0  00 `:b0Sꋡ4#, ml& s&m&A-`4C0P@00$ 0庁ցP0 0fP00.{닩Ofznw w 9SP0r00"SP U 0+0C0SPP \p<.PPE ꗀsP 0Sk冁P10dP1 0Q U 0SpmPub㬌PEl10S `10PHQd㏸0S,1,ށP#ČP c뻻Pqp 000000S_ë 8'gWy!PP`0S PPt00S>8H#,mt_,me? mf ] mnn#,L`,&n_,p-&Pn`,e,tnD`,`,O-`pPLB D@`4"p(2 0 qQ pPpGefuP`P GP IP EP 0 5 a0@S0000*p:0Pn0C 0 0R080 Vha0 l10 B1!1pq唛0 /PPZh0[ = 0ZoR =-00+I0 80 =0YSVPMP 6P@ ?P7 4PD@=N@PfP j@P=P=0X1h< hVPļ0V30 [0000z00u0 偆Po`lXi 0pP 0P h0$P^ a0 R00 砘PP  0pߗ봟 G84'0娵00`1Zzp`` Lx1SP .6 ;щ:{:0P @@ @0 Tp  lp (  0 R 0P819:\*`1d L Wp,< P-$ (010S  0 yP` 0Y) Y)  +t)>0 |`0@0` ΈM ~ t9t@k{p$T  X .0S` ( 合#PO 0S oZo F0080`8"/0  z 0 2s$8"/0 y2sc!"# yp: 0<S yP# 5 F 00 8@圅p 1384{ۆPXzLw 7@=p~0S h7 0HX~0S<5~0S ~0 Q  8 0 'zp~0S &d pt~0S &0P q |utrlχ{0 G S 0⭋p<7 bp3 P $0$A>0 0T1Y 6T@˃pyXʇu$0 T1I 5T@廃p庇p ap P 000Rl媇)JTl0@00 kP  ,꘨0 @40 xpP F $ $# 43(p z+֢pj 4@`p8_!R`14`11⎉P0d$}! P0!N00!R00SRd1|`1Z  R! Q01Y; @`1 {1pW4180; X >< 490倆({(⪕1PU 0S 2PP 0S  {| 0S y᥇p R080SX R   (0010 S   0`VaZ~0@0@s hdn00 S S S P!W W W x\& ZS YS R!l&_W 4Q O!)O!-Q ,Q DQ W W P!Z O @X X X qBSr] P!#X 9X OpX X X UX Z X X X X X Y Y )Y OY fY Y  O qY N|Y Y Y S nS S Y Y Y Y AZ [Z Z Z Z s&  Q/0p@-x@0Ppp@ P T0E`%bp@2 0 0$010 `O-1bM!0 Mb  [ !1 b0 0 30Zbݍ Ѝ  0 "m !l\ ${`  $; 0 0 +Hp0Gp( 80G( Gp` x8_S0؀00 00 P00 @G0 PwP x8##[`@*EwP0 l8 40GP~U P0 l8xt@J`*/4T*/@-@]y@*/*/*/*/ps_strings missing %juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeara.m.pmp.m.dstmnnoonmiddayiqvwututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!csp != &blank/usr/src/lib/libcurses/refresh.cunknownbel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangeacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error unknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat1.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON/usr/src/common/lib/libprop/prop_number.c%llirpn == pnintegerarray!((*cp) == '\0')/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNELSIOCS80211hidessidsocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)IEEE80211_IOC_FRAGTHRESHOLDIEEE80211_IOC_RTSTHRESHOLD RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: unknown standard formatCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %u%s: can't write sector %u180320360640720123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctlatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvp%s: unknown mode. TYPE %s %sTYPE %sContinue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20251206NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Can't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! timed out at eol chars transferred in can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular fileusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDtiso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARSLESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadtildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileTag not found%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread commandbranch%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 11.99.4 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.4 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.4 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.4 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.4 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.99.4 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.99.4 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog11.99.4xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv5/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv5/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failed executing: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICbase32dtbgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdm/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %u %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartmanlvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorparts->geo_sec != 0t != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interface%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duideloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6vsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %srt != NULL&ctx->froutes != rtsrt->rt_ifp != NULLaddingchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIASepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/etc/group/etc/master.passwd: (malloc) Error in munmap(): JPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSHTVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d dǠPbti ͠AР֠٠4C4?CݠL* I #5 t)$/5 1(J 5 9:|UjUsage: %s [-] [-ESsx] [-p string] [name] 49;9?ACEG9!?4G@NI$2Vkks{PATH=G   6:> vtjPED[[[[>0>&*->>>7;W[_cccc $/:EN%% Oim !Y kfQ ^q) nn dJ O3 $  { 6 I?x  n! " nB4                  $aMr] lt'ԯkX |_`TT͗Sz\o7|D,:D < tt4 tPP}4 &(&[X=THO<p?H@eA pph |8m4jD\I$ %%%%%""%% """"""&"" $$++BBBBB99BB>IKMOQS    2.*0(, 4 ] p O@ 4 33  kf:/ $&$$P$6#$%%T%%r '$IA '$& @'=el'i &$P$1L&`&'uy}#3#3233# @[@fehpx. =@D6KhQnX_ 'C$&C,C$+C)3=FL@T@ \ @  !  @ ====0==0=9 % /"&),FBXi|~&@@,@4@;@C@L@Q@V@]@e@l @j@p@y@@@@ '-39AFMT^d jqy<A     'IVtnrw>, e 0Mo~L@A:?,  &*04?NZjI#,3<AFMV^flpw )!1nrw>, e 0Mo~L@A:?,  &*04?NZjCXCXXSXCXXKXXXXCnrw>, e 0Mo~L@A:?,  &*04?NZjP!?147:&@)SLO,0  ,,-6I6\6r66666 N7 m7 7 7 7777818D8~8888889 29!#$B9&12J9345f968q99w99~9:9;9<9=9@9A :BF:Cr:D:E:F:G:H:J:L:M;N;O;P/;QA;RV;Sp;Ty;U;V;W;\;a;c;d<e?<fS<gf<hf<if<pm<qstu<vw<x<<<<= =5=D=V=w=====> >:>X>j>>>>>>>??7?7?7?W?w??p????????@#@<@/BS@f@s@@@@@@@@A$A;BCA[ApAAAAAAB4BHBhBBBBB3C8C!M KCBeCxCCCCCDDADqD 9Z][-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]+ 5 0 * 5 L@A:?,  &*04?NZjreturning to single-user after filesystem check readDosDirSectionreturning to single-user after filesystem check `gw*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~? wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_read O H5%@$,:$%&x?(%UA,%@@0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-$;V]p{ۈQe0%KKKEKKf4%@LތiwŌӌF^b`dr4 H \ p  @ D X l  ̹ ļ в (   L@A:?,  &*04?NZjގw<%@,-6I6\6r66666 N7 m7 7 7 7777818D8~8888889 29!#$B9&12J9345f968q99w99~9:9;9<9=9@9A :BF:Cr:D:E:F:G:H:J:L:M;N;O;P/;QA;RV;Sp;Ty;U;V;W;\;a;c;d<e?<fS<gf<hf<if<pm<qstu<vw<x<<<<= =5=D=V=w=====> >:>X>j>>>>>>>??7?7?7?W?w??p????????@#@<@/BS@f@s@@@@@@@@A$A;BCA[ApAAAAAAB4BHBhBBBBB3C8C!M KCBeCxCCCCCDDADqD|@%@D%@5PL%@)P%@ ST%'!#%AZ   Е`%Td%@ p%SFH0eCi?SFU0eCoHah!IdontNeedEFIy~(s*K>;u9 |nQn- q+|nQn- q+|nQn- q+ŗΗ|nQn- q+ߗ|nQn- q+j=rGy=iG};Mt?mWC 3KOO(3yD<#*=(>HYbBRuoqrRa3Dh&px\ M}-@Mjy֬-чHϘ-чH0ZIчH5 IчH0 IчH2IчH@7L6 %?aCHS'@ )ѸU\*1@ )ѸvN1x )Ѹ{ST.qBHo6֯ip|%@T%backupstore_gptstore_tbli%@in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercapsBP_[$+-/E[[[[[[[[setifflagssetifprefixlensetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandsetifmetricsetifmtusetifnetmaskusagestatusܦP printallmaindo_setifpreferencedo_setifcaps&ziH%Uyi   %4%~  %ji %(l %X%%%)%d%2%<%C%;%B%alw @˨רߨ 0@b ,   $@ܦP init_current_mediasetmediamodesetmediaoptsetmediasetmediainstGd ܦd d `@d media_statusmedia_constructor֪ߪ%ߪ%ߪߪl%ߪ֪%ߪө%ߪ%1+ paddr_matchX<08settunnel%8%print_link_addressessetvlansetvlanif %D%CDD_(GN^kmoqsuwy{}setifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchansethidessidsetapbridgesetiffragsetifrtsX%%@%,%ǯ%Ưǯ* %? p%!%'t%&p%'f %'f |* %}] % %=\.. ,V4invalid major numberinvalid minor numbertoo many fields for format' !ffs@s SQ + + @+ + + ĺ ֺt ޺%GZ i@u@̻+ 5 0 * 5 + ({\g+  '+  ֺ ߸[; @Ƽ bnorripbgensbextattbnojolietbnocasetransbrrcaseins{\g+  '+  ֺ ߸* @* [; ½B~@+ @{\g+  '+  ֺ ߸ * @* [; ½+ @B~ɽSQ @{\g+  '+  ֺ ߸@ & 2{\g+  '+  ֺ ߸* @* [; @bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirror &)<##03CFI !{\g+  '+  ֺ ߸B~[; @!}d + 1@:AIOT?p X B@@.N ^  @bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacrecvrpcrpc_getportrpc_callsendrecv $v[; {\g+  '+  ֺ ߸@. 2 0 #:NSao}>(IWlz?y2Ov;c6V{%s: can't read disk label; disk type must be specified%s partition type is not `%s' WTWTbSS /+-$ ")7IKWco| -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinit  #'+3;CKSW_goy@BCFILNOS-a>bNcYemfhikmno rs,u=@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:@@,@h 0p4p 8p<p yi` @E@ J $1м|^t0 Non-system disk Press any key to reboot go"&FUX[lru@Ig{  "$&(*,.     @=1&)-191J1[^1a      &C]u,95/ fũ©)+S QJNPTdj_UUUUUU***************************************************************************************************************************************************************************************************************************************A]9>plEt9Vx'1HBHHHP ,:EMT]eit| NetBSD gzip 20240203 0000000)  " $#!%Z^\`[_]a.CH @j18RnMkkk=kkkk>ddddddd+1Y  2I'7+5 +n+ _r !Yi}>MPd{++h/J;#'++++SY+i++++++++++++++++++++++++++++++Qzj zj : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. 2&*.)/35;!#%'+-1]8;2"$&(*, " $ & 1!4]W$F -7=QSd+AHddddddddddddddddddddddddd dDMdVdd_qddvddddd--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data_T   {m$ b$*-5?B5}}}}}}>}}[g}}}}}F}b}}}}}}}}}}}}}}}}K}}Ubn}}s}*}R}}}\  . ' &26: #&/)  #&- ),/ $     "2( &"   >WF0,  , _,# _,/ 8 , I ,Z b ,  ,  ,  , _, _, _ ,  , 6,  , _h, 5 ,&  ,0 A ,M ,Z ,k : ,t K ,  ,  ,  , _, _, : , K , _ ,  ,%  ,1 _',= _&,collect;! ( 7! )   ( EsP=====NBL@A:?,  &*04?NZjNAME=* 0 + mount_disks>    "#$%      "#$%&'()*+. str_arg_substget_available_cds"-L@A:?,  &*04?NZj edit_fs_type_ext+ R XY 4  H ' ( \? x? 1L` e u edit_and_check_label L@A:?,  &*04?NZjdisklabel_freedisklabel_set_part_infodisklabel_write_to_diskijzv   ~ z { H~ \z Xz Ȕ ԁ $ } u | X l H u u { |{ z H z disklabel_change_geom?!@E! L! %7outer_fill_part_menu_optsedit_outer_partsselect_part_schemerD----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_default " %2RAHXblv%/9#AJPV\bhck<258 7:=@C  %0VPS[^agl"'6;Cir{/=O_o %(5%;u9 |nQn- q+|nQn- q+|nQn- q+ŗΗ|nQn- q+ߗ|nQn- q+j=rGy=iG};Mt?mWC 3KOO(3yD<#*=(>HYbBRuoqrRa3Dh&px\ M}-@Mjy֬-чHϘ-чH0ZIчH5 IчH0 IчH2IчH@7L6 %?aCHS'@ )ѸU\*1@ )ѸvN1x )Ѹ{ST.qBHo6֯ip? L L L w?=3L AL =AL L L M M mbr_get_generic_part_typembr_init_default_alignmentsmbr_create_new?!M!M!H|lȏl0\Ȕ t `̦đT̚LDmbr_get_part_devicembr_read_from_diskwrite_mbrmbr_write_to_diskinside_ext_partadjust_ext_partmbr_add_partmbr_free!***************************************************************************************************************************************************************************************************************************************_UUUUUUcontrol_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_start7#&))뙙 dhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_reportssiddhcpcd_readdump2$j;|;dhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2025 Roy Marplesmain duid_geteloop_event_addeloop_event_deleteeloop_q_timeout_addeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_signal_maskeloop_startif_discover pppppppppppppTZ_~2 2-p_222pppppppp.4jn22v2:2?K{23HpiP21ppp",u'pv p#L(-BWlsplitvadd_environparse_optionQ b(hc,d }e\ fub gN] ht] i%pj kb lji mb nvob pq Frb sb kht] ub b -vb wkX xb zyb Ab Bb C[ Db Eb Fb Gc H^ IJ c Kc L{BMc N!c O*c P7c QSA T?c UIc VSc W]c Xgc ZO 1vc 4c 6ETc nb |?~c }c c c c c c c c c c c c c d d  + P` d d i 4` &d .d 8d Ed Od `d ^d gd ed md zd &ee d d d d d a d wb d d d d d d default_configread_configrt_compare_proto4d4daart_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_recvrtlblbrt_buildrt_deletepapasa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_init7Wi X ^i hi qi }] |i script_buftoenv`d c gd Oi make_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_osk k k k k k if_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @CDHDdhcp_openbpfget_leasedhcp_initread_leaselog_dhcpLu Wu cu ru dhcp_bound~u s u u Yk .s u rn u dhcp_informdhcp_start1dhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifa OOOOOOO OOOO'O4O>COHOMOOOOOOOOOOOOO OOOO!O.O;@OEOJ`4`4t4t4P4P4VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\By W X#y ,X)y LX lX/y XQy X\X5y X YZy ,Y;y LYBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~Jy z&Ny `n!hv!Wy `r!pv!y #y )y  /y Qy \5y @Zy ;y |U"xS"tQ"cs_pathX`y  bc_base_max_ bc_dim_max_ bc_scale_max_ bc_string_max_ coll_weights_max_ expr_nest_max _ line_max_  re_dup_max_  posix2_version _  posix2_c_bind_  posix2_c_dev_  posix2_char_term_ posix2_fort_dev_ posix2_fort_run_ posix2_localedef_ posix2_sw_dev_ posix2_upe_ stream_max_ tzname_max_ atexit_max_aaaaae%JaaaaaaT[y D#y )y  0/y Qy x\5y dZy ;y  B 1 A:lhd  pT$`y^v E8% E&&cmvvo !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: -o %s: option not supported`]ZWTQNKHEB?<96 0-*'$!c3 d38- sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU HeNKmakech    #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef'++9L.DDα;15MS7) x;l%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9,1nn|:pZnF$n31RLHD@;75+)++#+/'++ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>ca'''''''''''''''''''''''''''gm''aj'''''X'X'''dspbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %Ktr`+NbP>r`G 2)9'=tr`+NbP>r`G 2)9'= 0C0,8M(*w\m:j kP`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     @@ !1Aa  0@`M #+3;CScs inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_cstringprop_string_create_nocopyprop_string_create_formatprop_string_append_cstring_prop_number_externalize_prop_number_alloc2;85_prop_xml_intern_find_tag_prop_intern_decode_string_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dict_keysym_put_prop_dict_keysym_allocprop_dictionary_set_prop_dictionary_iterator_reset_locked_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equals_prop_dictionary_internalize_continue_prop_dictionary_remove6_prop_data_externalizeABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_equalsprop_data_data_prop_data_internalizetruefalse_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_removeprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_extern_append_char_prop_extern_append_encoded_cstring_prop_extern_append_start_tag_prop_extern_append_end_tag_prop_extern_append_empty_tag _prop_stack_push_prop_stack_pop_tcsetpgrp_tcgetpgrp_tcflush_tcdrain_cfsetspeed_cfsetospeed_cfsetispeed_cfmakeraw_cfgetospeed_cfgetispeedstrmode_unsetenv_int_strtouq_l_int__strtoull_l_int__strtou_l ` F g n t__strsuftollxpermute_args_getopt_longgetopt_internalunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s_getoptatolatofmemstream_seeksetbuffersetlinebufsetbufmkdtempfwidefsetposfpurgefgetposfgetc_regerror__icheckhost__gethostlooprshrcmdrresvport_af_addrrresvportresrcmdorcmd_afrcmd_af__ivaliduser_sairuserok_saruseroklink_addr0123456789abcdef_ether_ntoa_ether_aton_ether_line %x:%x:%x:%x:%x:%x %256s _ether_ntohost_ether_hostton_MD5End0123456789abcdef_MD5File_MD5Data_SHA1End0123456789abcdef_SHA1Data_SHA1Transform_SHA1Init_SHA1Update_SHA1Final_RMD160End0123456789abcdef_RMD160Data_uname_ttyname_r_times   +(&_DB?\\\addcmd_getmodecompress_mode_sethostname_popenpopenve_pclose_initgroupskMGTPEBKMGTPEKMGTPEBkMGTPEhumanize_numbermatchcompareglobextendg_Ctocg_lstatglob3g_opendirglob2g_statglob0globtildeglobexp2globexp1_glob_globfree%%%%%%%%%%%%%%%%%%%%%%%/_getttyent_getttynam_getpassfd_getmntinfo##: _getfsspec_getfsfilefnmatchxgettype_getdiskbyname/$$$$)$$$-$+creatTLS allocation failed, terminating <Q5vf9.z4 }Q5H@5UCmm};Zx0Nm<[y1OnSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec_tcsetattrwcscmp_stresep_setenv_vdprintf_lsetvbuf_regfree_inet_networkCof\$u0LDD????????J^YaTO|wrmhcG unvisAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~fts_pallocfts_sortfts_statfts_allocfts_build_fts_openfts_maxarglen_fts_close_fts_read_fts_set_fts_children_closedir  khwcschr_strcoll_l_int__strtoumax_l_opendir_initdir_alphasortinsertionsort_mergesort_rsetup_seekdir_unlocked_getdomainname @_strncasecmp_initstate_setstate?getenv_getenv_r__freeenvvar__canoverwriteenvvarauthunix_destroyauthunix_marshalmarshal_new_authauthunix_validate_authunix_create_xdr_authunix_parms_xdr_array _xdr_rejected_reply_xdr_opaque_auth_xdr_accepted_reply_xdr_des_block_xdr_replymsg_xdr_callhdr_seterr_replyacceptedrejected_strtok_ry P ip6_parsenumeric_filenoØŘstr2numberget_canonnameres_queryNres_querydomainNget_aigetanswergethostby*.getanswer: asked for "%s", got "%s"res_searchNexplore_numericget_portmatch_freeaddrinfo_getaddrinfoaddrconfigip6_str2scopeid)&_yphostent_gethtent_getservbyname_r_MD5Init_MD5Update_MD5Final @_vasprintf_l_getifaddrs"_freeifaddrsNBCDB atoi**!!**!!SPDGJM d'@Bʚ;__dn_count_labels@sJ}J@7r)E@&?ջ-$charstraddname0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuv__ns_sprintrrf__ns_skiprr__b64_ntopABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/__b64_pton _inet_nsap_addr_inet_nsap_ntoa__ns_format_ttl>ox54ؗҜ<3#I9=D2[%Cod(h4)$ _posix1e_acl_entry_compare_acl_differs_acl_brand_as_sl_add_sl_find  5_strsep_int_strtoul_l_int__strtoll_lfgetsrewindmap_v4v6_addressmap_v4v6_hostentgethostbyname_internal_yp_hostent_yp_gethtbyaddr_yp_gethtbynamegetanswergethostby*.getanswer: asked for "%s", got "%s"_dns_gethtbyname_dns_gethtbyaddrgethostbyname_rgethostbyaddr_rinet_pton40123456789abcdef0123456789ABCDEF_inet_ptoninet_pton6inet_ntop4_inet_ntopinet_ntop6_fseeko_fparseln__fgetstr_xdr_int_xdr_u_int_xdr_long_xdr_u_long_xdr_int32_t_xdr_u_int32_t_xdr_short_xdr_u_short_xdr_int16_t_xdr_u_int16_t_xdr_char_xdr_u_char_xdr_bool_xdr_enum_xdr_opaque_xdr_bytes_xdr_netobj_xdr_union_xdr_string_xdr_wrapstring_xdr_int64_t_xdr_u_int64_t_xdr_hyper_xdr_u_hyper_xdr_longlong_t_xdr_u_longlong_t__dn_skipname0123456789__ns_name_ntop  __ns_name_ntol__ns_name_unpack2dn_find__ns_name_pack_int_strtol_l_vsprintf_l__getdelim_nsdbtaddsrc_nsdbtdump_nsdbtput_nsdispatchbVRZ:{fkkmO=8^%02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04d-00mn /usr/share/zoneinfo/Etc/UTC_strcasecmpbsearch__cxa_atexit_internal__cxa_atexit_vsnprintf_lfreadfopenferror__swbuf222222222IhII xXYIiIIIiyYY  &OOOOOOOOOe@Ce7:I\{~#Y0123456789abcdef0123456789ABCDEF__vfprintf_unlocked_l__sbprintfexponentbk]wznQ_strndup_strdup_gethostname" !#&(*-/14}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDؗҜ<3#I9=D2[%Cod( 7yACnF?O8M20HwZm1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHGA$e  a]YUQMIEiea]BJ|xtDD0*m:31HB;\\9############9ZZ99Z#########################o^_getpagesizeqsort_r__sfvwrite__sflush__swsetup,#,#__swhatbuf__smakebuf_tcgetattr_int__strtoi_l__sread__swrite__sseek__sclose_int__strtoimax_lCisalnumisalnum_lisalphaisalpha_lisblankisblank_liscntrliscntrl_lisdigitisdigit_lisgraphisgraph_lislowerislower_lisprintisprint_lispunctispunct_lisspaceisspace_lisupperisupper_lisxdigitisxdigit_ltouppertoupper_ltolowertolower_lc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB _citrus_NONE_stdenc_mbtowc_citrus_NONE_stdenc_mbtocs# dl_iterate_phdr_setup333333333O << 0123456789ABCDEF0123456789abcdef_vsnprintf_ss_fwalk {__res_nmkquery__res_nopt__res_nopt_rdata/&_hf_gethtbyname2_hf_gethtbyname_hf_gethtbyaddrD!*07 _nsaddsrctomap ]:[=             WEEEdg          DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::clearerrF7Z77<7O__rec_dleafNEXTINDEXNEXTINDEXputpair__delpair__get_page__add_ovflpagesqueeze_key__free_ovflpageugly_split__split_page__big_insert__big_delete__big_splitN??S??E?NEXTINDEXhH9T9@@@AAP\dlpx     $,0< N(`'0<8@D L ,8`DLP X` h l p t |                           l+ <Z xN \  ,+ hp <  4/ XL  |! P p& L " L / \c    $I lH 0p      <h x    W ,,  h$h( ,0 48 <@ XDXH XL X8 T \ ` d lt x|   L .  l   \                    0 00$ 0  &&&&&&&&&&&''' '&''( !%в!9( !(!(T!(,!UQLL LTG TGTG TG TG TG//u//////u "" " ""H#|9|9gnts1\rbmn,$\tcid$ D8, q|9|9yekd d2(5,5Lv\2atadXPloob&8'&""$"$"yara,31<+T*148LvD2AA BB4BDB`BlBBBBBBBBC $C0C DCPC lCxC Cb CCCCCC D,DPD\DutD&PPPPPPPPPP%PP,PP4P<%%PPQQt$|$OOOOOOOO&OO$PP PP$P,P%4P8P%DPHPPPTP<%\PhPxPPPQQQQ !"QQQQ !"4T@TDTHTPTTT\TdThTlTtTxTTTT%TTTTTTTTTTTTT$(TTUU UUUUU U$U(U,U0U8U@UHUPUXU`UhUpUxUUUUUUUUUUUU4TUUUUVV$V0VLVTV`VtVVVVVVVVVVW(W8WPWlWWWWWWWXX0XDXXXlXXXXXXXX Y Y4YHY\YpYYYYYYYYZ$Z8ZLZ`Z&"X`8H4Ģ`8H|40"0"1"1"Fceeeef@fXftffff g,gDgdgdcFcFcFeeeXee t(t8t@tLtTt\t@tXrn,m0m~ bjhj&c fhklmo#o/p@ppUq_r[; u? tfvfwnw{x5xN zzB CJOPST:V! VXZZ   & 3C(i'lk`i'mTiijA(pq`q@r`ihqtvTii=   =3/dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbinLH(}-+?=###%%%}(N(,N(aEVeNFIfiLelmC+ nfpbu qis#/hfv] VV8x\P(@=%%d xYt [h^<[|`Fm8[_ZTZ @rYTZY!b!}!!{!!x_vn_v!_,{!!?_XyaG _$!!uP!!w!!|t"6%6h F ... ...JXii~~-]_BZ_} <c=cՕ`v} ƙC(& @80 %cp %AabCdhlNsuvW:w:z% %(%0%8% T%% Dp% T 4 {@%    %% J4%4% U\%D% l%T% v % 8 % %c % % @%%%T% ^%(x% e%(% %%%%%%%%@%%%%%%%T%%% % % ,% ͧ% % %(% <%< ,O% % %  %  @(l % (l ji % ji  Ǫ d% % 4% %ө %  % 8 0% _\%_ |f%f  % DD%D K%  % $% h P% % '%'  %  }] %}]  ǯ%* ǯ |'f %* 'f ,%  -%? x %("Kɷ0(з0(շ)۷'p)w0(0(=&M9 ('(0()0(0() 0(h F  '@@{\g+  '+  ֺ ߸* @[; @...... ...... lost+founddA.##.%O 4(~p f &  5  47& _ (l  !"#ee $%&'(Е)*+ ,-/1&122>3G4P5WD6%s&I) 3 () ))))%),)2)8)A). (prog_root)`i t 4u?4mP,?"?,?7?C?8L?T?0 -  N `? @8 _  i    4 T h? 7  :  `$ l? XA Ǡ t5 ! T7 U X @ : , L# ~ 0& +  ) q? T7 I  |? > ? > ? X> kX 7 ? 4M ?  b ,  X } ! 5   " 4  …  ? 6 u T ? l%  $I ? H ? 1 A  ) ? PC ? & ޠ + ?  Р 2 8 + ?  ) ? M   ? F  $I ? P 5  ? P ? G 8  ) ? ; ? ;  X ? $I ? = ?  ) H  ) ?  )  $#  !  X! WD 8 ?  ? 1 @ 7 @ 4 g I  >@ S K G@ 5 1 E = hJ 3  ,% t L@ >  C 4  T@ W ?],T S V <<(__! <_x, >`,. t)`4- pD`. |\` $m`$ C`% +`% c`H .` ` `* `* saX( ?aA #a) …h,EhFP+ecB@a7ls1ehhgq?af(!,nc HhdRh ,Yhdch ,jhd5 ,shi 1ezh~h a$!,h)/bin/shm_ppqppp9qi Hqi QqXq`qXqkqXqrqXq~qXqqXqqqqXqqXqqXqqXqqqqqqqqrrXqrXq!rXq(rXq4rXq;rXqGrXqNrXqZrXqbrXqnrur?rrrrrrrrrrrprrrrrrsi sp1,!sXq7sqJsqvsqsqsrsrtttrNtrjtttttrtrtsu?4uru$&b\ & &  &z  * . ` d f o 04?4sz _##)#*#######%%&&H&S&&&&&&&&&&&&&&&&&&&&&&&&&&&'' ' '('('L'L'N'N'S'U'W'W'''''''++P+P+U+U+....////000>0A00001/11111112 2G2P2MNƤ`|0RTfhk`oooopՌ"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp| ( ( ) ) oK_pp0J#%')-Y[ : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----*0-000ooprt} %&,,ĨŨ&-GQ).1256CCLL|| /vz      8 : ? ?   $ ' FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB@4@4G4U4jj0k6kOoOooooo-0Fgi{BD6;luu!#$&*06DJ4&4&4&H&H&H&p&4&""H&p&p&p& e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ    l h b  w  i x X       0  $  k  j [<zzzz is a directory is not a regular file (use -f to see it)&& (!~$.~8~H~(T~`~"l~>, w~~~;~ ̌7~ ~ ~ ~#~2~8~ ~  (!+7!CL9^h…r&(f})5e:%6@4~ +,-.&*3<?LE3S/_/m'yF} }~ܦ 2h}} }(f}fM~}~P } ~ ~~WmkRkRkYcWbkCkc kG ky wb YMYrWca(-&\`,jb -&@ `,lh шB-&$`,5c-&X`,`d-&@`,͉-&AL`,D-&(ti e,&H`,!;Of,&`,oF,&D`,͊g,&x_,;h,&4`,mi,&,`,h ɋj,&Hb J,&!_,$Bk,&H4e ,&Hpe K,&_,ZL,&_,m,&T`,ӌn,&"(`,"o,&` BO,&a Mpx,&Hg Pp,&|g q`,&d`,XrX,&"`,sP,&!<`,WoSH,&! `,t@,&e T8,&hf u0,&P`,V(,&h w ,&"_,<mx,&(0l X,&A`,y,&0`,z,&`,7L"+&Hm k~+&!_,t?+&n #+&c ɐ+&A`,Ր+&_,+&_,?a+&_,}+&(n +&_,+&_,o @So+&_,4o +&_,ג+&$_,`o '+&$_,o E[+&_,{x+&!_,p+&!_,o ȓh+&!_,-`+&(p ZX+&!_,i}P+&_,H+&_,ٔ@+&q 8+&_,-T(+&``,u0+&_,ɕ +&*&|_,Oȗԗݗ '6EWQiuʘИܘ…e~-!5}CUP^nh,&ؙ̙ $4BB~U“Sanv{a, (press RETURN)6!6!B7!h-&h-&t-&tags643{}abcdDgGhHilnNpPqrs tw xy !:#=L,(,-e^H-i^C-k^UK,E&D&x% \D&7 % D&_C&4 _C&7 _ C&d (C&l }lC&  B& |B&P _F A&" <0 _FLA&" x2  A& @&@&_F|@&H 2 _F@&# |3 _F?&|" 3 _F\?&L" 4   ?&# >& >&_F >&L< - _F |=&N0 / $ L=&;  =&<&; _2$\<&6 _2$<<&6_2$;&6_ ;&_ L;&_ ,;&_ :&_ l:&[,:&Zc9&u_F9&j4 _FL9&f1 _F 9&j$ L5 : : @: u*     L& u5 9 9  u\6 eP6 d) g87 h) \D6 ^7 ](7 _h7  I |  5  t 64 HH U\ `p _ j "  ,      ) 86 X7 7 W Qd: R Sd) TX e   O! P! Q R ! SH! TUp V0) x  y <6 =,6 >6 ?7 e< إX t | \ , ( & T9 9  S6 H $   x( 4'  $"  T ; J l ed إx  }6 6 ɨ6 6 !6      6 P 0  88 8 9 6 p 8 |8 8 jH7 k6  09 x9 5 , 5 H x7 x6 5  h6 5   7 X8 8 7 5    p L  ( '  ! 7 5 l# P# 4# # \$ @$ $$ $ # # # #      u $ $ $ t$ 5 5 H T &`% 'H% (0% )% % % " % % %|% <& ,& & % & SQ  *  + D + l +  +  +  +   Xy ̓X ͩթݰ;K[$mz),sFɷܷ %4QkҸ<!fMHiX; o} 2Cʼ FeMt"n7UiUzs:f{!.Zfx-"N%%_!*Bj]}4AUcr -;GSax { Uig&.8uBKZr *66Hamz3Oj0f$=Oh} +4LVcl{S1-<H(wb JW[`jv0MlB&.Mi4DcQa+ e@EISk7$+9FNa4 1 q/4EP qy!M }b9UiFS I S _ ~z L  z      = M c n    8 Y }   $ r y     ^      d   M% 0 Y    1 ) |B d t 1   1 D Q Y c h r {  ҫ) 7 C I P [ b i r |           2 9 C FT ^ s           # . 7 D S g s }           FT   / < D X p             4" = L ] k v         ! > F k  T       % 6 L  % =   V h (m k +) /) 4) 8) >) A) E) /I) / / / / !/4 u 5 j 5 6 + /6 6  6 C 6 v6 "6 0(6 .6 46 96 ?6 10G6 &'N6 (W6 )^6 *,+c6 ,k6 .1/ftpL9 @+ F5 e5 5 S0 @j 5 5 5 5 .ln 6>o #p ?\p 7@n Qm Af< $k Bk< $k Cp< $k D wm E x< $k F 0$k G D$k H $k Ixj _Yhj _Lj _T   1uĖ 1e uĖ A A A A A A A A A B B $B 3B ]G\4]G\Z k 5 r] _________Cy y y y y y Yk 2z z  z ٗ "  z z z z _ *z :z >j:=z Az Ez Iz .s Mz Qz Uz xYz 1q]z #az sez *{iz |r mz !~z "z #z $z %z &z 'z (z )z *z +z ,{ - { -{ .{ ./{ /Z0% 1({ 2,{ 32{ 47{ 5 6<{ 7B{ 8H{ 9Q{ :M{ ;W{ <f{ =r{ >{ ?{ @{ [\{ \{ ]{ ^{ ^{ _| _ | `| {"| {5| |C| }O| }~c|   -dd-ddTdd:dd:dd X! d!@l!@x!`!!!ht|#####$$$$$%%%D%%&&&''('0(<(H(P)\)h)p***+++,,,,----.../(/4/<6H;X;d0p0|011<<==>>?222333$907<8L:`4l4x455 ! " # $ % & ' ( ) * . (+ 4, @- H/ T0 d1 p2 |3 4 5 6 7 8 9 : ; < = > ?  @(!@4"@@#@L$@X%@d&@p'@|)@*@+@&`'`,@-@.@/@0@(`1@$2@43@D)`T4@`5@p6@7@8@9@:@*`;@<@=@>@?@  `0!`@+`P,``"`p#`-`$`.`/`%`CCDD E E F F( c0 c< d@ dL eeP #X #d &t & 0               !!!!(!4!D!P!T!ht!!!!!!!dp t @@xg   @@@@@@`$`04<DLT \@` &33333333uu@AA4ALA3333NNNNN%OUTC33 % %$23x,h-2,L2,33.P|d|||339㼥ͤtgQ>PNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[Sžn&n&n&n& (% 33UU33UU33UU(s&$n&s&$Xp& s&$q&/;A>q8./Jw*י_՚dIwQkh-:Zՠ{k3\ھSvU+aramdiskbin.debug|d.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf.gnu_debuglink /BhHhhnVP0%0k!V0%0k!$bT%Tk!gX%Xk!tt%̉!\y(%(!p{&;"{&;"HX.;"p;"+;"|>">"MSGTXTS627 5032 5057 5074 5096 5099 5104 5112 5119 5127 5135 5138 5141 5144 5148 5160 5169 5182 5211 5226 5769 5803 6486 6774 7482 7538 7612 7708 7883 7906 7929 7935 7944 7966 7970 7974 7977 7980 8085 8288 8527 8968 9406 9441 9456 9468 9474 9486 9535 9555 9595 9612 9629 9644 9691 9729 9777 9859 9983 10119 10160 10198 10235 10270 10280 10329 10479 10485 10490 10494 10514 10624 10644 10650 10664 10676 10687 10724 10758 10782 10884 10921 10943 11042 11097 11155 11166 11182 11234 11402 11609 11780 11844 11896 12167 12716 13244 13675 14013 14346 14459 14474 14483 14643 14814 14964 15128 15151 15175 15190 15265 15405 15582 15737 15749 15829 15930 15976 16002 16072 16083 16092 16105 16131 16146 16162 16175 16230 16241 16256 16460 16693 16722 16737 16806 16880 16953 16983 17021 17075 17529 17555 17584 17688 17794 17979 18091 18206 18310 18997 19256 19396 19432 19602 19643 19779 19802 19839 19884 20135 20231 20285 20384 20395 20432 20469 20496 20505 20539 20546 20571 20598 20633 20647 20661 20690 20704 20721 20730 20752 20770 20787 20798 20817 20843 20861 20884 20901 20916 20931 20949 20976 21003 21025 21064 21082 21114 21342 21416 21459 21505 21652 21808 21852 22131 22158 22517 22701 22853 23034 23181 23339 23360 23408 23418 23426 23437 23448 23458 23465 23480 23492 23529 23559 23598 23651 23709 23730 23737 23756 23777 23784 23806 23828 23848 23870 23901 23938 23960 23974 24020 24049 24083 24123 24158 24186 24234 24243 24252 24257 24266 24275 24292 24296 24301 24307 24311 24349 24358 24385 24405 24428 24447 24474 24496 24528 24544 24549 24559 24582 24604 24621 24638 24651 24660 24669 24675 24702 24709 24733 24754 24778 24791 24810 24835 24858 24874 24880 24892 24922 24930 24970 24981 24992 25003 25020 25037 25051 25068 25284 25588 26036 26252 26516 26788 26840 26876 26912 26963 26980 27018 27032 27039 27056 27059 27064 27073 27085 27096 27105 27126 27168 27206 27222 27253 27278 27313 27369 27409 27430 27450 27491 27520 27568 27801 27836 28043 28062 28099 28160 28198 28237 28393 28408 28454 28502 28525 28561 28571 28581 28592 28597 28660 28708 28752 28813 28846 28947 28965 29104 29126 29249 29263 29273 29296 29401 29457 29573 29604 29609 29635 29674 29684 29727 29737 29753 29768 29786 29809 29839 29860 29886 30083 30126 30130 30136 30142 30147 30158 30172 30201 30233 30245 30292 30342 30382 30409 30425 30434 30477 30483 30491 30495 30515 30532 30544 30575 30831 30880 31456 31483 31515 31543 31595 31601 31607 31612 31633 31649 31671 31700 31841 31975 31988 32124 32126 32128 32130 32147 32160 32178 32205 32209 32215 32220 32228 32234 32274 32276 32286 32301 32318 32352 32384 32422 32451 32480 32502 32545 32571 32615 32751 32753 32833 32879 32927 33032 33134 33173 33240 33247 33308 33372 33376 33383 33505 33574 33862 34000 34141 34222 34269 34275 34298 34344 34347 34373 34416 34481 34543 34613 34681 34774 34993 35018 35022 35058 35076 35104 35146 35190 35254 35304 35380 35402 35454 35498 35537 35571 35601 35632 35657 35666 35678 35686 35697 35709 35728 35752 35801 35818 35842 35885 36207 36210 36224 36237 36249 36256 36267 36274 36281 36290 36300 36317 36333 36383 36391 36399 36409 36420 36438 36455 36476 36498 36507 36517 36544 36550 36560 36579 36595 36613 36633 36642 36653 36660 36677 36696 36717 36727 36744 36750 36766 36781 36796 36817 36839 36858 36868 36873 36878 36896 36915 36934 36940 36959 36979 36999 37017 37022 37028 37045 37061 37082 37095 37103 37123 37147 37164 37172 37183 37204 37210 37222 37244 37258 37267 37288 37306 37315 37349 37372 37399 37431 37454 37474 37485 37517 37533 37544 37557 37580 37602 38110 38140 38171 38199 38213 38414 38636 38803 38890 38907 38925 38942 38971 39018 39029 39048 39070 39149 39341 39369 39487 39509 39650 39669 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-11.99.4. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? - wd: SATA, ATA oder IDE - sd: SCSI oder USB-Speicher - ld: NVMe (z.B. M.2-Karte), SD/MMC-Karte oder virtueller Speicher Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis (leer lassen, um abzubrechen)?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-11.99.4 ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-11.99.4 ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-11.99.4 ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-11.99.4 ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Die Installation wird abgebrochen. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-11.99.4 InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-11.99.4 ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPHTTPSNFSCD-ROM / DVD / Medium mit AbbilddateiDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzDas Verzeichnis, in das die alten a.out-Bibliotheken gesichert werden sollten, konnte nicht erstellt werden. Bitte starten Sie die Aktualisierung erneut und stellen Sie sicher, dass alle Dateisysteme gemountet sind.Eins der Verzeichnisse /emul/aout oder /emul war ein symbolischer Link, der auf ein nicht-gemountetes Dateisystem verwies. Der Link wurde mit einer '.old' Erweiterung versehen. Sobald Ihr aktualisiertes System gestartet ist, mssen Sie das neu erstellte /emul/aout mit dem alten Verzeichnis abgleichen. Sendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd (Secure Shell daemon) aktivierenntpd aktivierenntpdate beim Starten ausfhrenMulticast DNS aktivierenxdm (X Display Manager) aktivierencgd aktivieren (kryptografische Laufwerkskonfiguration)lvm (Logical Volume Manager) aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte Partitionierung (Software-RAID, ...)Partitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen? So knnen Sie 'su' verwenden, um Superuser zu werden.Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden? Wenn Sie von einer Diskette gebootet haben, knnen Sie diese jetzt entfernen. Kann den Bootblock des Filecores nicht lesen Kann die RISCiX Partitionstabelle nicht lesen Keine NetBSD Partition in der RISCiX Partitionstabelle gefunden - erstellen eines Labels nicht mglich. Keine NetBSD Partition gefunden (eine Nur-Filecore Platte?) - erstellen eines Labels nicht mglich. Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm rmdir sh stty sync . .. dhcpcd.confgroup master.passwd netconfig protocolsservicesMSGTXTS627 5032 5070 5087 5102 5105 5108 5113 5121 5129 5137 5140 5143 5152 5164 5176 5185 5194 5220 5231 5766 5793 6359 6659 7300 7347 7460 7553 7587 7606 7624 7632 7641 7666 7670 7674 7677 7680 7802 7987 8215 8735 9086 9115 9128 9141 9146 9166 9185 9206 9265 9282 9296 9318 9363 9389 9430 9508 9626 9740 9794 9823 9855 9894 9900 9933 10056 10063 10067 10075 10099 10181 10187 10194 10206 10220 10229 10262 10281 10293 10403 10465 10484 10603 10654 10706 10718 10737 10789 10993 11201 11392 11452 11501 11767 12225 12890 13312 13634 14059 14191 14223 14235 14413 14610 14771 14905 14925 14958 14972 15041 15154 15326 15461 15481 15593 15685 15708 15731 15790 15805 15826 15841 15862 15882 15907 15921 15945 15957 15975 16185 16435 16456 16472 16525 16593 16666 16703 16729 16805 17300 17326 17348 17455 17562 17763 17836 17920 18020 18515 18753 18904 18938 19073 19117 19256 19297 19342 19389 19633 19766 19828 19922 19927 19961 19995 20010 20038 20071 20078 20103 20121 20147 20154 20169 20184 20204 20244 20261 20281 20302 20324 20339 20359 20381 20396 20409 20423 20435 20447 20461 20484 20507 20525 20568 20619 20656 20841 20904 20940 20989 21080 21210 21263 21523 21570 21931 22081 22250 22390 22510 22642 22682 22729 22739 22747 22757 22765 22776 22787 22801 22826 22867 22900 22933 22968 23022 23047 23066 23088 23093 23099 23128 23145 23172 23190 23211 23233 23252 23262 23292 23318 23345 23394 23422 23449 23502 23512 23522 23528 23538 23547 23567 23571 23576 23582 23586 23621 23630 23661 23678 23705 23726 23746 23765 23791 23804 23812 23828 23859 23890 23911 23937 23950 23958 23969 23975 23999 24009 24021 24039 24050 24070 24086 24112 24134 24150 24162 24182 24208 24214 24244 24258 24272 24295 24314 24333 24351 24369 24592 24898 25316 25517 25757 25941 26019 26074 26141 26181 26204 26238 26249 26257 26280 26283 26286 26292 26303 26315 26328 26358 26402 26415 26428 26465 26479 26490 26501 26512 26529 26540 26587 26610 26659 26900 26933 27188 27209 27242 27295 27321 27348 27504 27510 27553 27573 27592 27621 27628 27635 27642 27647 27696 27734 27768 27825 27853 27898 27915 28016 28021 28098 28112 28122 28146 28269 28350 28460 28488 28493 28509 28538 28546 28587 28594 28608 28621 28629 28648 28681 28701 28721 28937 28968 28973 28980 28987 28991 29005 29017 29032 29065 29078 29133 29191 29227 29245 29263 29281 29318 29324 29332 29336 29357 29374 29385 29407 29585 29629 30331 30355 30389 30408 30453 30460 30467 30471 30495 30506 30511 30574 30695 30818 30831 30965 30967 30969 30971 30981 30990 31003 31030 31034 31040 31045 31054 31059 31086 31088 31101 31113 31128 31156 31200 31247 31263 31285 31296 31329 31349 31398 31498 31500 31565 31614 31663 31767 31865 31906 31997 32004 32065 32129 32134 32140 32249 32308 32559 32700 32827 32895 32932 32939 32966 33012 33015 33036 33081 33132 33191 33260 33307 33412 33555 33580 33584 33618 33635 33659 33711 33762 33834 33900 33998 34015 34046 34082 34116 34140 34164 34197 34217 34227 34235 34243 34253 34264 34278 34304 34352 34375 34395 34436 34735 34738 34752 34764 34771 34790 34804 34811 34818 34827 34837 34854 34870 34918 34926 34934 34944 34955 34973 34990 35009 35029 35036 35053 35070 35077 35090 35125 35142 35161 35181 35191 35207 35220 35238 35258 35279 35289 35309 35329 35342 35361 35374 35398 35421 35434 35445 35450 35457 35475 35494 35513 35521 35540 35560 35585 35603 35610 35617 35630 35639 35660 35673 35681 35701 35729 35746 35752 35763 35794 35802 35815 35837 35859 35868 35889 35907 35914 35937 35956 35983 36001 36021 36034 36049 36070 36084 36091 36105 36120 36139 36684 36717 36745 36774 36782 36819 37131 37308 37385 37402 37420 37435 37457 37507 37517 37534 37556 37615 37773 37797 37927 37952 38078 38096 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-11.99.4. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-11.99.4 ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-11.99.4 ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-11.99.4 completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-11.99.4. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. La instalacin ha sido interrumpida. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-11.99.4Salir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-11.99.4Ejecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si ha iniciado desde disquette, ahora debera retirar el disco. No se puede leer el bloque de arranque filecore No se puede leer la tabla de particiones RISCiX No se ha encontrado ninguna particin NetBSD en la tabla de particiones RISCiX - No se puede etiquetar No se ha encontrado ninguna particion NetBSD (disco solo de filecore?) - No se puede etiquetar Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): NcleoThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located. umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS627 5032 5068 5085 5100 5104 5108 5113 5124 5130 5136 5139 5142 5145 5149 5161 5173 5183 5213 5225 5654 5681 6257 6617 7302 7363 7441 7536 7576 7598 7616 7622 7631 7657 7661 7665 7668 7671 7793 7978 8206 8735 9153 9182 9195 9208 9215 9235 9254 9277 9320 9340 9359 9382 9426 9455 9496 9562 9674 9788 9842 9871 9903 9942 9948 9981 10059 10065 10069 10074 10115 10252 10262 10270 10289 10303 10312 10344 10385 10398 10523 10581 10600 10719 10775 10827 10838 10854 10893 11143 11315 11487 11542 11577 11826 12229 12527 12794 13155 13335 13654 13674 13687 13876 14020 14216 14350 14370 14403 14422 14523 14678 14866 15053 15073 15152 15250 15288 15311 15401 15422 15445 15464 15488 15518 15562 15595 15618 15630 15648 15916 16235 16266 16301 16365 16440 16510 16541 16571 16663 17154 17184 17201 17341 17482 17679 17798 17945 18112 18670 18966 19147 19192 19355 19409 19544 19580 19640 19690 19981 20090 20147 20244 20249 20284 20319 20334 20358 20391 20396 20421 20437 20460 20467 20484 20499 20518 20550 20554 20574 20592 20604 20617 20635 20659 20677 20696 20723 20750 20762 20783 20813 20843 20868 20901 20936 20974 21227 21296 21351 21412 21530 21689 21743 22004 22055 22431 22586 22730 22870 22978 23163 23193 23236 23246 23254 23264 23276 23297 23306 23312 23344 23384 23420 23458 23495 23543 23567 23579 23593 23601 23609 23636 23653 23682 23703 23726 23735 23754 23766 23810 23848 23875 23919 23947 23974 24027 24038 24049 24056 24066 24075 24109 24113 24118 24124 24128 24163 24173 24203 24226 24255 24277 24299 24321 24348 24360 24372 24391 24425 24458 24479 24503 24516 24528 24541 24547 24573 24583 24594 24618 24628 24648 24668 24685 24711 24735 24748 24768 24802 24809 24838 24861 24884 24900 24915 24930 24945 24959 25147 25452 25883 26074 26309 26497 26539 26589 26643 26691 26713 26754 26765 26773 26797 26801 26805 26814 26825 26836 26851 26882 26928 26941 26954 26984 26998 27010 27022 27034 27052 27075 27120 27143 27203 27455 27482 27744 27762 27789 27838 27868 27899 28031 28038 28087 28110 28134 28163 28171 28181 28189 28194 28247 28296 28336 28402 28435 28479 28502 28603 28608 28685 28699 28709 28733 28856 28937 29047 29075 29080 29096 29125 29133 29174 29182 29196 29209 29217 29236 29269 29289 29309 29525 29556 29576 29582 29589 29593 29608 29627 29653 29662 29674 29728 29786 29821 29840 29857 29869 29904 29910 29918 29922 29943 29960 29971 29996 30174 30228 30919 30938 30973 31003 31049 31055 31062 31066 31090 31106 31112 31187 31337 31456 31469 31537 31539 31541 31543 31553 31566 31583 31610 31614 31620 31625 31634 31639 31666 31668 31681 31693 31708 31736 31780 31827 31843 31865 31876 31909 31929 31978 32078 32080 32156 32211 32261 32360 32455 32503 32593 32600 32661 32725 32730 32736 32839 32891 33137 33298 33453 33524 33577 33584 33611 33661 33664 33685 33731 33786 33845 33914 33961 34066 34209 34234 34238 34272 34289 34327 34380 34420 34496 34561 34655 34676 34714 34754 34790 34814 34837 34876 34906 34913 34922 34930 34938 34952 34968 34996 35048 35065 35086 35130 35472 35476 35491 35502 35510 35529 35541 35548 35555 35564 35574 35591 35607 35661 35669 35677 35687 35698 35716 35733 35749 35767 35774 35792 35809 35816 35826 35857 35876 35895 35915 35925 35944 35957 35977 35997 36018 36028 36047 36066 36076 36093 36107 36130 36154 36167 36177 36182 36186 36204 36223 36242 36247 36266 36286 36311 36326 36330 36337 36347 36356 36377 36391 36399 36419 36445 36462 36470 36481 36512 36517 36530 36552 36567 36576 36597 36615 36624 36668 36692 36719 36734 36751 36765 36796 36820 36851 36858 36872 36887 36906 37451 37484 37512 37541 37549 37586 37898 38075 38152 38169 38187 38202 38224 38274 38284 38301 38323 38382 38540 38564 38694 38719 38845 38863 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-11.99.4. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-11.99.4 est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-11.99.4 est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-11.99.4 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-11.99.4 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-11.99.4 Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-11.99.4Excuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si vous avez dmarr sur une disquette, vous pouvez maintenant la retirer. Impossible de lire le contenu du secteur de dmarrage Impossible de lire la table de partitions RISCiX Aucune partition NetBSD trouve dans la table de partitions RISCiX. Impossible de crer un label. Aucune partition NetBSD trouve (disque filecore uniquement ?). Impossible de crer un label. Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationditerGroupeMSGTXTS627 5032 5073 5089 5107 5111 5115 5125 5134 5140 5146 5149 5152 5161 5171 5184 5192 5203 5228 5240 5748 5780 6272 6561 7106 7152 7256 7342 7378 7393 7411 7419 7427 7454 7458 7462 7465 7468 7579 7764 7992 8468 8802 8831 8846 8861 8869 8883 8901 8922 8973 8989 8999 9019 9065 9095 9148 9205 9316 9437 9481 9514 9553 9587 9594 9627 9704 9710 9717 9724 9753 9865 9871 9882 9899 9916 9925 9954 9966 9976 10077 10139 10159 10279 10316 10372 10386 10407 10444 10654 10829 10978 11013 11065 11281 11594 12117 12478 12768 13161 13296 13309 13320 13466 13645 13776 13910 13930 13963 13982 14065 14180 14321 14446 14460 14568 14661 14690 14710 14786 14803 14821 14837 14856 14876 14893 14905 14931 14943 14961 15162 15401 15428 15445 15501 15563 15623 15654 15678 15737 16113 16143 16160 16268 16378 16518 16592 16668 16746 17238 17458 17569 17600 17727 17763 17891 17918 17958 18004 18220 18344 18412 18512 18517 18553 18589 18603 18626 18659 18663 18688 18707 18733 18738 18753 18768 18787 18812 18824 18846 18863 18876 18888 18906 18930 18945 18962 18975 18986 18997 19017 19046 19075 19099 19134 19169 19196 19383 19432 19464 19512 19609 19742 19788 19980 20010 20332 20461 20601 20741 20858 20993 21037 21080 21088 21098 21110 21122 21130 21141 21168 21202 21237 21268 21303 21339 21386 21406 21423 21441 21446 21453 21478 21494 21515 21532 21549 21567 21584 21597 21628 21653 21684 21715 21750 21777 21830 21840 21850 21856 21865 21873 21888 21892 21897 21903 21907 21942 21952 21981 21997 22023 22040 22059 22080 22096 22109 22114 22122 22137 22163 22182 22210 22228 22239 22245 22251 22272 22282 22293 22311 22333 22350 22363 22384 22404 22424 22435 22448 22470 22477 22502 22517 22537 22549 22566 22583 22603 22622 22799 23083 23393 23573 23784 23972 24038 24085 24140 24184 24204 24233 24245 24251 24267 24271 24275 24283 24293 24305 24320 24339 24375 24386 24397 24436 24448 24458 24468 24478 24494 24512 24561 24582 24627 24871 24897 25151 25166 25192 25249 25283 25318 25460 25477 25526 25547 25563 25592 25597 25602 25608 25613 25652 25687 25717 25772 25805 25851 25865 25944 25949 26003 26017 26027 26051 26137 26185 26291 26325 26332 26347 26374 26383 26422 26429 26451 26470 26486 26504 26536 26555 26572 26729 26760 26767 26776 26784 26791 26805 26823 26842 26852 26864 26905 26950 26979 27000 27023 27042 27080 27086 27094 27098 27119 27136 27145 27164 27310 27352 27862 27870 27894 27912 27956 27961 27966 27970 28001 28014 28023 28069 28195 28286 28298 28362 28364 28366 28368 28378 28392 28407 28434 28438 28444 28449 28458 28463 28490 28492 28507 28518 28533 28561 28605 28652 28668 28690 28701 28734 28754 28803 28903 28905 28973 29013 29058 29133 29199 29234 29315 29322 29383 29447 29454 29460 29559 29615 29891 30015 30126 30188 30226 30234 30256 30305 30308 30329 30374 30429 30488 30557 30604 30709 30852 30877 30881 30915 30931 30956 31004 31040 31101 31155 31236 31258 31297 31334 31366 31390 31417 31443 31457 31465 31475 31483 31497 31510 31522 31546 31587 31613 31630 31659 31983 31986 32000 32012 32018 32034 32046 32053 32060 32069 32079 32096 32112 32155 32163 32171 32181 32192 32210 32227 32240 32266 32273 32281 32298 32306 32323 32347 32366 32385 32404 32414 32425 32439 32457 32477 32497 32506 32529 32549 32560 32575 32587 32606 32625 32636 32646 32651 32657 32675 32694 32713 32720 32739 32759 32784 32801 32807 32815 32825 32837 32858 32874 32882 32902 32922 32944 32952 32963 32986 32993 33007 33029 33046 33055 33076 33094 33103 33134 33150 33177 33196 33216 33234 33255 33269 33289 33296 33315 33330 33349 33894 33927 33955 33984 33992 34029 34341 34518 34595 34612 34630 34645 34667 34717 34727 34744 34766 34825 34983 35007 35137 35162 35288 35306 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-11.99.4. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-11.99.4 zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-11.99.4 zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-11.99.4 zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-11.99.4 zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Instalacja zostala przerwana. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-11.99.4Wyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-11.99.4Uruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPHTTPSNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Jesli uruchomiles komputer z dyskietki, mozesz ja teraz wyciagnac. Nie moge przeczytac bootbloku filecore Nie moge przeczytac tablicy partycji RISCiX Nie znalazlem partycji NetBSD w tablicy partycji RISCiX - Nie moge nazwac Nie znalazlem partycji NetBSD (dysk filecore?) - Nie moge nazwac Instalowanie bootblokow na %s.... Partycje NetBSD na dysku %s wygladaja teraz tak (Rozmiary i Przesuniecia w %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766:  . ..zerowd3pwd3owd3nwd3mwd3lwd3kwd3jwd3iwd3hwd3g wd3f!wd3e"wd3d#wd3c$wd3b%wd3a& wd3'wd2p(wd2o)wd2n*wd2m+wd2l,wd2k-wd2j.wd2i/wd2h0wd2g1wd2f2wd2e3wd2d4wd2c5wd2b6wd2a7 wd28wd1p9wd1o:wd1n;wd1m<wd1l=wd1k>wd1j?wd1i@wd1hAwd1gBwd1fCwd1eDwd1dEwd1cFwd1bGwd1aH wd1Iwd0pJwd0oKwd0nLwd0mMwd0lNwd0kOwd0jPwd0iQwd0hRwd0gSwd0fTwd0eUwd0dVwd0cWwd0bXwd0aY wd0Zurandom[ttypf\ttype]ttypd^ttypc_ttypb`ttypaattyp9bttyp8cttyp7dttyp6ettyp5fttyp4gttyp3httyp2ittyp1jttyp0ktty01ltty00m ttynstdoutostdinpstderrq st1r st0ssd3ptsd3ousd3nvsd3mwsd3lxsd3kysd3jzsd3i{sd3h|sd3g}sd3f~sd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2a sd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2krwd2jrwd2irwd2hrwd2grwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1erwd1drwd1crwd1brwd1arwd1rwd0prwd0orwd0nrwd0mrwd0lrwd0krwd0jrwd0irwd0hrwd0grwd0frwd0erwd0drwd0crwd0brwd0arwd0rst1rst0rsd3prsd3orsd3nrsd3mrsd3lrsd3krsd3jrsd3irsd3hrsd3grsd3frsd3e rsd3d rsd3c rsd3b rsd3a rsd3rsd2prsd2orsd2nrsd2mrsd2lrsd2krsd2jrsd2irsd2hrsd2grsd2frsd2ersd2drsd2crsd2brsd2arsd2rsd1p rsd1o!rsd1n"rsd1m#rsd1l$rsd1k%rsd1j&rsd1i'rsd1h(rsd1g)rsd1f*rsd1e+rsd1d,rsd1c-rsd1b.rsd1a/rsd10rsd0p1rsd0o2rsd0n3rsd0m4rsd0l5rsd0k6rsd0j7rsd0i8rsd0h9rsd0g:rsd0f;rsd0e<rsd0d=rsd0c>rsd0b?rsd0a@rsd0Armd1cBrmd1aCrmd1Drmd0cErmd0aFrmd0Grld7pHrld7oIrld7nJrld7mKrld7lLrld7kMrld7jNrld7iOrld7hPrld7gQrld7fRrld7eSrld7dTrld7cUrld7bVrld7aWrld7Xrld6pYrld6oZrld6n[rld6m\rld6l]rld6k^rld6j_rld6i`rld6harld6gbrld6fcrld6edrld6derld6cfrld6bgrld6ahrld6irld5pjrld5okrld5nlrld5mmrld5lnrld5korld5jprld5iqrld5hrrld5gsrld5ftrld5eurld5dvrld5cwrld5bxrld5ayrld5zrld4p{rld4o|rld4n}rld4m~rld4lrld4krld4jrld4irld4hrld4grld4frld4erld4drld4crld4brld4arld4rld3prld3orld3nrld3mrld3lrld3krld3jrld3irld3hrld3grld3frld3erld3drld3crld3brld3arld3rld2prld2orld2nrld2mrld2lrld2krld2jrld2irld2hrld2grld2frld2erld2drld2crld2brld2arld2rld1prld1orld1nrld1mrld1lrld1krld1jrld1irld1hrld1grld1frld1erld1drld1crld1brld1arld1rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rflash7rflash6rflash5rflash4rflash3rflash2rflash1rflash0rfd1prfd1orfd1nrfd1mrfd1lrfd1krfd1jrfd1irfd1hrfd1grfd1frfd1erfd1drfd1crfd1brfd1arfd1rfd0prfd0orfd0nrfd0mrfd0lrfd0krfd0jrfd0irfd0hrfd0grfd0frfd0erfd0drfd0crfd0brfd0arfd0rdk7rdk6rdk5rdk4rdk3rdk2rdk1rdk0rcd1crcd1arcd1rcd0crcd0arcd0randomptypf ptype ptypd ptypc ptypb ptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0 memmd1cmd1a  md1!md0c"md0a# md0$ld7p%ld7o&ld7n'ld7m(ld7l)ld7k*ld7j+ld7i,ld7h-ld7g.ld7f/ld7e0ld7d1ld7c2ld7b3ld7a4 ld75ld6p6ld6o7ld6n8ld6m9ld6l:ld6k;ld6j<ld6i=ld6h>ld6g?ld6f@ld6eAld6dBld6cCld6bDld6aE ld6Fld5pGld5oHld5nIld5mJld5lKld5kLld5jMld5iNld5hOld5gPld5fQld5eRld5dSld5cTld5bUld5aV ld5Wld4pXld4oYld4nZld4m[ld4l\ld4k]ld4j^ld4i_ld4h`ld4gald4fbld4ecld4ddld4celd4bfld4ag ld4hld3pild3ojld3nkld3mlld3lmld3knld3jold3ipld3hqld3grld3fsld3etld3duld3cvld3bwld3ax ld3yld2pzld2o{ld2n|ld2m}ld2l~ld2kld2jld2ild2hld2gld2fld2eld2dld2cld2bld2a ld2ld1pld1old1nld1mld1lld1kld1jld1ild1hld1gld1fld1eld1dld1cld1bld1a ld1ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullflash7flash6flash5flash4flash3flash2flash1flash0fd1pfd1ofd1nfd1mfd1lfd1kfd1jfd1ifd1hfd1gfd1ffd1efd1dfd1cfd1bfd1a fd1fd0pfd0ofd0nfd0mfd0lfd0kfd0jfd0ifd0hfd0gfd0ffd0efd0dfd0cfd0bfd0a fd0est1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drvctldrum dk7 dk6 dk5 dk4 dk3 dk2 dk1 dk0consttyconsolecd1ccd1a cd1cd0ccd0a cd0 bpf0 bpf ...# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin  . .. dhcpcd-hooksdhcpcd-run-hooks# $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use fi done # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  . ..20-resolv.conf 30-hostnamen $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime if [ -n "$rdnsstime" ]; then ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers if [ -n "$rdnss" ]; then new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi fi fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime if [ -n "$dnssltime" ]; then ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search if [ -n "$dnssl" ]; then new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi fi fi # Break when we don't have either [ -z "$rdnsstime" ] && [ -z "$dnssltime" ] && return 1 j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf retur# Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dkctl drvctl fdisk fsck fsck_ffs  fsck_msdos gpt halt ifconfig init mknod mount  mount_cd9660  mount_ext2fs  mount_ffs  mount_kernfs  mount_mfs  mount_msdos  mount_nfs  mount_tmpfs newfs  newfs_ext2fs  newfs_msdos ping reboot restore route rrestore shutdown slattach swapctl sysctl dumount ... ... . .. binmdecsbinshare . .. cu ftp gunzip gzcat gzip less more progress sed tar tip Htset ... . .. chroot . ..misc ... . .. db log  run spool ... ...  ...  . .. lock  . ..