'V+i0N0Z NetBSD/earmv5hf ramdisk 08N0i<  N0iAWt tN0i@@<@T 08N0i<  N0iAWt tN0i@@<@TU N0it`AN0iN0iN0i$h N0iN0iN0iAN0iN0iN0ivA.N0iN0iN0iX`hAN0iN0iN0iwAN0iN0iN0ioAN0iN0iN0iwAN0iN0iN0iAN0iN0iN0iAN0iN0iN0imD!N0iN0iN0i (08@HPX`hpx$wN0iN0iN0i(08@HPX`hpN$0N0iN0iN0ixK$/N0iN0iN0iM$JN0iN0iN0i (08@HPFAN0iN0iN0iCN0iN0iN0iAN0iN0iN0iAN0iN0iN0i!N0iN0iN0i aN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0i aN0iN0iN0i aN0iN0iN0i aN0iN0iN0i aN0iN0iN0i aN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0i aN0iN0iN0i aN0iN0iN0i aN0iN0iN0i aN0iN0iN0i aN0iN0iN0iaN0iN0iN0i aN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0i!N0iN0iN0i4!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i !N0iN0iN0i !N0iN0iN0i !N0iN0iN0i !N0iN0iN0i !N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i B!N0iN0iN0i B!N0iN0iN0i!N0iN0iN0i"!N0iN0iN0i"!N0iN0iN0i"aN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0i aN0iN0iN0i aN0iN0iN0i aN0iN0iN0i aN0iN0iN0i aN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0i aN0iN0iN0i aN0iN0iN0i aN0iN0iN0i aN0iN0iN0i aN0iN0iN0iaN0iN0iN0i aN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i !N0iN0iN0i !N0iN0iN0i !N0iN0iN0i !N0iN0iN0i !N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i !N0iN0iN0i !N0iN0iN0i !N0iN0iN0i !N0iN0iN0i !N0iN0iN0i!N0iN0iN0i !N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i !N0iN0iN0i !N0iN0iN0i !N0iN0iN0i !N0iN0iN0i !N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i !N0iN0iN0i !N0iN0iN0i !N0iN0iN0i !N0iN0iN0i !N0iN0iN0i!N0iN0iN0i !N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i !N0iN0iN0i!N0iN0iN0i !N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i?\!N0iN0iN0i>\!N0iN0iN0i=\!N0iN0iN0i<\!N0iN0iN0i;\!N0iN0iN0i:\!N0iN0iN0i9\!N0iN0iN0i8\!N0iN0iN0i?\!N0iN0iN0i>\!N0iN0iN0i=\!N0iN0iN0i<\!N0iN0iN0i;\!N0iN0iN0i:\!N0iN0iN0i9\!N0iN0iN0i8\!N0iN0iN0i:\!N0iN0iN0i7\!N0iN0iN0i6\!N0iN0iN0i5\!N0iN0iN0i4\!N0iN0iN0i3\!N0iN0iN0i2\!N0iN0iN0i1\!N0iN0iN0i0\!N0iN0iN0i7\!N0iN0iN0i6\!N0iN0iN0i5\!N0iN0iN0i4\!N0iN0iN0i3\!N0iN0iN0i2\!N0iN0iN0i1\!N0iN0iN0i0\!N0iN0iN0i2\!N0iN0iN0i/\!N0iN0iN0i.\!N0iN0iN0i-\!N0iN0iN0i,\!N0iN0iN0i+\!N0iN0iN0i*\!N0iN0iN0i)\!N0iN0iN0i(\!N0iN0iN0i/\!N0iN0iN0i.\!N0iN0iN0i-\!N0iN0iN0i,\!N0iN0iN0i+\!N0iN0iN0i*\!N0iN0iN0i)\!N0iN0iN0i(\!N0iN0iN0i*\!N0iN0iN0i'\!N0iN0iN0i&\!N0iN0iN0i%\!N0iN0iN0i$\!N0iN0iN0i#\!N0iN0iN0i"\!N0iN0iN0i!\!N0iN0iN0i \!N0iN0iN0i'\!N0iN0iN0i&\!N0iN0iN0i%\!N0iN0iN0i$\!N0iN0iN0i#\!N0iN0iN0i"\!N0iN0iN0i!\!N0iN0iN0i \!N0iN0iN0i"\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i \!N0iN0iN0i \!N0iN0iN0i \!N0iN0iN0i \!N0iN0iN0i \!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i \!N0iN0iN0i \!N0iN0iN0i \!N0iN0iN0i \!N0iN0iN0i \!N0iN0iN0i\!N0iN0iN0i \!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i\!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i !N0iN0iN0i !N0iN0iN0i !N0iN0iN0i !N0iN0iN0i !N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i !N0iN0iN0i !N0iN0iN0i !N0iN0iN0i !N0iN0iN0i !N0iN0iN0i!N0iN0iN0i !N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i !N0iN0iN0i!N0iN0iN0i !N0iN0iN0i!N0iN0iN0i!N0iN0iN0i$!N0iN0iN0i4!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i !N0iN0iN0i !N0iN0iN0i !N0iN0iN0i !N0iN0iN0i !N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0iaN0iN0iN0iaN0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0iaN0iN0iN0i aN0iN0iN0iaN0iN0iN0i aN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0i?\aN0iN0iN0i>\aN0iN0iN0i=\aN0iN0iN0i<\aN0iN0iN0i;\aN0iN0iN0i:\aN0iN0iN0i9\aN0iN0iN0i8\aN0iN0iN0i?\aN0iN0iN0i>\aN0iN0iN0i=\aN0iN0iN0i<\aN0iN0iN0i;\aN0iN0iN0i:\aN0iN0iN0i9\aN0iN0iN0i8\aN0iN0iN0i:\aN0iN0iN0i7\aN0iN0iN0i6\aN0iN0iN0i5\aN0iN0iN0i4\aN0iN0iN0i3\aN0iN0iN0i2\aN0iN0iN0i1\aN0iN0iN0i0\aN0iN0iN0i7\aN0iN0iN0i6\aN0iN0iN0i5\aN0iN0iN0i4\aN0iN0iN0i3\aN0iN0iN0i2\aN0iN0iN0i1\aN0iN0iN0i0\aN0iN0iN0i2\aN0iN0iN0i/\aN0iN0iN0i.\aN0iN0iN0i-\aN0iN0iN0i,\aN0iN0iN0i+\aN0iN0iN0i*\aN0iN0iN0i)\aN0iN0iN0i(\aN0iN0iN0i/\aN0iN0iN0i.\aN0iN0iN0i-\aN0iN0iN0i,\aN0iN0iN0i+\aN0iN0iN0i*\aN0iN0iN0i)\aN0iN0iN0i(\aN0iN0iN0i*\aN0iN0iN0i'\aN0iN0iN0i&\aN0iN0iN0i%\aN0iN0iN0i$\aN0iN0iN0i#\aN0iN0iN0i"\aN0iN0iN0i!\aN0iN0iN0i \aN0iN0iN0i'\aN0iN0iN0i&\aN0iN0iN0i%\aN0iN0iN0i$\aN0iN0iN0i#\aN0iN0iN0i"\aN0iN0iN0i!\aN0iN0iN0i \aN0iN0iN0i"\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i \aN0iN0iN0i \aN0iN0iN0i \aN0iN0iN0i \aN0iN0iN0i \aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i \aN0iN0iN0i \aN0iN0iN0i \aN0iN0iN0i \aN0iN0iN0i \aN0iN0iN0i\aN0iN0iN0i \aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\aN0iN0iN0i\ !N0iN0iN0ii!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i aN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0i aN0iN0iN0i aN0iN0iN0i aN0iN0iN0i aN0iN0iN0i aN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0i aN0iN0iN0i aN0iN0iN0i aN0iN0iN0i aN0iN0iN0i aN0iN0iN0iaN0iN0iN0i aN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0i!N0iN0iN0i!N0iN0iN0iaN0iN0iN0iaN0iN0iN0i!N0iN0iN0i!N0iN0iN0i!N0iN0iN0i B!N0iN0iN0i B!N0iN0iN0i!N0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0iaN0iN0iN0i!N0iN0iN0i!N0iN0iN0iaN0iN0iN0i aN0iN0iN0iaN0iN0iN0i aN0iN0iN0iaN0iN0iN0iaN0iN0iN0iN0iN0iN0ibpf!N0iN0iN0i $N0iN0iN0ip$N0iN0iN0iV$>N0iN0iN0is$N0iN0iN0ix$sN0iN0iN0iz$N0iN0iN0iAN0iN0iN0im N0iN0iN0i$N0iN0iN0i $N0iN0iN0iAN0iN0iN0iAN0iN0iN0iAN0iN0iN0iAN0iN0iN0iAN0iN0iN0iAN0iN0iN0iAN0iN0iN0iAN0iN0iN0iAN0iN0iN0iAN0iN0iN0iivC8O\O,;Vwӡe9C=lP<8g=w?:t\O]' ҡ,yb+ $ieK+H4U3l.IUf>[:z_<+r{zs @tqVk #VchkiFU+(4˸~=LBYNus5E1}"H aSL,d]x.'c\ uPK9{x& s&o&h[K"wLeNf߅(UQi=wuZnwS> J)}!gM @VFSD>3hBu}A(u&c4uG=XMۋat . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4!4 (!!![%[%(XLL![%[%NetBSDPKwGPaX NetBSDearmv5hf3D0D 0p@- 0 0 `:Np2 p : 000Z H 1(#  0P \\KgP 4 `+X"J 0R 0p0ZZ3r0S P !Y'  p00R0S `` 0S  0 >(h P <`V k` 0R?o20S 0  0 0R0P `P hh`0S L,` P0Rt00!P /&<|%p/&/&/&/&/&#&8[#&1"/&/&/&G[?&/&/&0@-MM@ P Np  ;0U$C dP TTۍЍ08 iP0 (0P Xm[<|%z[[/&Q@-@ TP DDd,ZP $ 0P@<|%z[[/&Q@-@ XdP HHE",P $ 0P@<|%z[[/&@-8g0 U,[#&0$/@'0$/?'@-,\@-B\@-Y\@-o\Vb@-1  0 0 Ѝ\@'@-1  0 0 Ѝ\?'@-1  0 0 Ѝ\@'@-0  0 0 Ѝ\@'@-0  000 Ѝg?'@'<00/@-0  00 Ѝ8@'\?'<00/@-0  00 Ѝ8@'\@'@-1 0(  0_ Ѝ\@' 0@- 00 $0P@JpЍ\@%,0A-MA!q`!X0 p! R0B=0B  P;0H 8 R8B 4!010,!0Ѝ} PP =2V0P   0S  0 pPq0P      0 3/R ! 7000<040LsD0?'8@',@'#=]]h@'\*]=]5 W]]0p@-|@PtP00 R 0p800 p0  B0Sqs @'@'?'0 0 0 /@'?' @-**6 p@- @-!(6 p@-80@-M0@@(3/P $ H08 : S( 0h 3/ 0P  0 0Ѝ000  1/qpe0S 00pm8@@-@IPЍ@ GPЍp@-(`Vp80@ 0 3/PP8003/(Pp^@-@P`P 80 (0(3/@he PbePЍp?'3 PO-MP`(P,`B  0S9P06 0J S +X0\ 0 X0\ ! R(P0,`R!*0 AJ 000+ xpt| DI  ЍO0 P % Hpp 81/qp4 T  ?P p 4 =d0S4 tp0 0 0 0 "I0 0 0p0 t 0 p0t 0 %0 0 VU0 "SR x0| 0 x0| ~p0t 0 p0t wx0| 0 [Xx0| n 00 0S04L0f004 8pX  FЍ?'^ $^?'H^pZ^~^R/ R 0 0/\\CC B 0R0012/P/ A A A A  A A  A A A A A A A A PPA AC-MhB0 0  T0 0 8   ?$ Ÿ ( }/L/AN#b@ DSH n&}//C#bPoPQ`0!d!!4! P ` !4]4 w" BXX P!d44]4 d" B   !d44]4 Q# B  d44x]4 >/0?]8p<0@! G` @d44[]4 !Ѝ@'MbH@' _ m8_Q_d_{_U@-@R!C- A `00P4 82#&PP0 (1/qp$ 밀pU Ѝ0S0C080$0( 3/P 0 `V`PED0  Y $ - @'p8@'@%_@-MPA P04 00#!8 0 (1/qp$ P9 0080 0( 3/PЍ80 $0(3/PP`#U0:0080p0h( p3/p #U0* ,0P`/RP `?'pm@-@L M 0Q   0   0ЍA'uQJO-Mw M0@S. 8S+ #='0|0S( 0| 00" ! !x00#| #|0 d&\ %ݍ Ѝ$'|HM 0 X0 S 0E0WS06  S  S $0S0 600000S60 060 00 6R\ R0r0C0C00Q0 0S. ,B< @864  0`P V$  ( ( ,0S 0 $0P000(0040 0S $Y# 5%_(0S%0 %00   05 o,0S l50 0d%de\JvXH5%DpW= ?W09*\ 0  s[\0( $i[`\0 _[p004 0 00000 (0$ @<Z@ 0|@ p`L#]\W㐶) ` ?W  :$0吣(0c#` 0吃u'00S0 ,0S#$`V 0 !40S \ /\ * )\0 [ 0P \ !5# |0 뜲$0Z`Ё,03  !x0$ ( , o0  !h004 0 0000@0 (0$ <`1,0S 0`QP V00ZVp- ?V0)*[ 0  Z[(0 $Z[0 Z00,000, 0 p^[V㐸* ?V  :[$0V㐓(0吃# ?V  :[ 2!  0 @<f  0p *8A'_ _`V```H%.?a`__a`A'>aa6 Aaaa{apaaaaaaB6 ac# Gb b6 b'b@-ps PP@`D [P Ѝ`3MU@8bp@-XP8@T`@D p [P<opQ<PpA'A-AP 0$ P0 0 SQ ( $0P d`bh d_`P, R2DaDqU`0``000APG`E B00CS000 Q   0,`0CS0000 (00/U R `8 4D 0$00 0$ XA'#&$dXC'yB':dT0 S 0SP/P/S/@-XA'r) p@-XAXT0040S+@! PP P0P`04 PV R@40 0PPU4 ^*00" 0PE`PP 0P4  P U 4P0C SR40P 0P pXC'XA'L%B'B'p@-@8P0 00@0@00000pB'B'G-PP0 k_i0 ,f(&p 0 R`Gv+@0S ( PI_G D(?$00 0(0 8O0V0? 0"-_+8 4(@Ђ`Ɵ蠻#&yPdXA'$d^d 0p@-?0 @0)PvOP@X 0P 00S/S`s8Ppu-p@ \KP(D8<pB'B'udd{dXA'A'ddpdp@-@(P )8PP ^\ 0TP~p`U(` 88` 0"pXA'M#&d@-P4@(P 8P 8o080oXA'DD @-yP $000<0 PE'#&XA'@@-<pPG0`F [stlV000PX\4 0,K00C0Cf 00CS010:0PUP1 ` 00CS00 P U Rt0V00EPK\I  F00C0S"10 U00CS000 U0P 0@ #\! | V 0  00 0 @00S 0S YIE'B'XC'#&yB'B'&eO-M` R0000200010S uܱ@q0`0#0P 00)<T0J?o20ST SRP -0S  RZ  @T  Z     0010S@@  0 10P00CS000 Ѝ S 0P  BR l  @0S Z0 0$B'B'B'E'B'XC'#&=eB'OeA-P0`!SP@U[S 0O_LpP0!S P 9[7P 0H3H<00S0 '$0@M#&aexeE'eB'A-Php@`T0S P[$  [E'#&eO-`@ ؀0SP ĐĠİp0 T T R R u0p[P Ѝ PP P   P Pp@E'B'B'B'A-p0`!SPP@Z 0b @ PP0!S P ZP 0HH<00S0 wUpGPuM#&eeE'eO-@bP00CS0 p0@g WZU R 0 `001 pTpP@0 pW2tQtTP0PP00&P,Z*8 ', 00CS010 6 u0P0CS0000 S00 @ X 0000  X0 `0U0$0T p 0 #&E'`D'e#&ePC'XC'yB'B'E'O-pLP0 SPEUP ЍE P C0 0X2b U000PY h 00C0S 20  0 0CS0L200 XZ 0 PPE C P 000S S 2 `V%0 V00XP ]Y[x tXp 00C00 0CS0@100 0AXX 0PFH0P 0 ZPF C V'P尀VP0PP00P Yt pl 00C0m0 P0CS0<00jl00`6PC'B'XC'#&yB'`D'dG-P@`p :P`T  0PS>~P 0@^S00\P0S @\Z ` HP X0 @P*0P00eT%eh#&7f@-@T 00H0 P 0S( 0C00S 0C0 ЍB'ht@P%P0 R  QQP0R/@-: B'r) G-`PP@ X 0S@ @0S# @T@@DT qpP 0S  0 0 "PЍB' fG-@P tp0SK`HPUP 0 @+PP @r) B'X0000D@- 40aA R    0/*&fB'40000 01h@- *&B'fG-dRdr@`0 0S0"3(< 0?Y+Y# Y{00 R  % W 1@sW0"S{ @`` IQV^Y0^Y-Yj @ 0@^Y-Y00@R(W0 0勾1@s@W0"SR 0.Y@0 @R /Io@P0 R00R  h@PR 000;Y 00 V@ T0SB'*&6 PC',fr) @-0@00 00U0 P000 ,R;R 0S  S   0;SPpB'P 0p@-PQS@@R0p`V0C PB'p@-Pㆽ@P W, ($ p 00꠻#&yQ 0Q\SA@- /`@-0S* 0@ 000S! P;GpP pPPP H@P |0 S</R/    տ0  B'u@f+( Q 0@30/@-B'00@- R 0C30B'A-ppQ1SPS a00S S @10`! S:`Fp00  1S pLa0S ʼ1`0 BRpE`  S`l  P 0a0CS00   B'Gf#&yd_fD'( Q 0@30/@-IB'`01S @-@0!S @NP /BP /B'Gf7@-A0 R!RUUʐ0\00尺P@R崽 |xq00CS00+ 0 @ R,] R P Ѝ00!S KP f0 Sڰ 0R0CS0000 0 Q  vP   B'*&#&ysff?A-O 0 P,0p W !GY\ϟYPPP0  nQ pQ lQ 0 S @ PP1S P PPP0 nR pR lR 00 S1S P P0PP[PP0 nR pR lR 00 S1S gP0 S00P0PP1S 2S 0Sڤ 000@ `PP 0 nR* pR# lR$ 00 S}1Pr PPPೀ0S!S < 2<0S 1Sm `P0PPPbM ,0100,0Z0S000@ PN 0!SPH :P00 nR pR lR 00 S*0S ( ; xe0PP1S PP"G@oG`GoobPVWP 1019P P00 nR pR lR 00 S PP RPL nQ pQ lQ 0 S*0S  P0 PP RP, nQ pQ lQ 0 S20cS2 P0 PP RP P0  nQ pQ lQ 0 S1S @PPPP0 nR pR lR 00 Sx1So P k{P0PP PP` 0 nR pR lR 00 STY]P0PP PR0nQ pQ lQ 00 S 5 PP? = 0  P1p PP,0S `Vn0VkVpppVpW 0 nR pR lR 00 S1SP0PP P0nQ pQ lQ 00 S   0  d P0nQ pQ lQ 00 S   0   RP nQ pQ lQ 0 S2S060S$602P0 PP R l B R0" 0 S1S 2SqW P0000@ 0S0 0`PPz 0 nR- pR& lR' 00 S^1SU1S0!S  :0S1S d PSS 0S0O 1MP0PPP` gRF  R 0 B RKOD `D@p>AO0"S:b(pR0 rR0 U0 SP0 R"R  " R0U0b0  `P00CS00 (P00PP2P02 ZP P ȷ0b200CS00U. !2R00 2#20# 02 0nS- pS" lS& @PP0 nR' pR lR! 00 S1S"!P20 2 2020P0PP P pIPP0SR `V0V pվʈ0 nR pR lR 00 SX1SO^P0PP RPӮ nQ pQ lQ 0 S:8P0 PP*&B'6 fff_f`%\%ffE'#&r) gg0:- e3gE'D'ufLgPC',fP%^gQP000P0P@t Y`P 00 00 P0 nR, pR% lR& 00 S1S0!S  80S1Sy aWW  0 <P0S0P0PP1S 2SqXP R  l B R0"0 S06PP0010CSM bP岴@p M0"S4mPP00 nR pR lR 00 Sx|2 00S ;PPPP0  nQ pQ lQ 0 SZ0S cPP0S/PPW0 nR pR lR 00 S;P an2S@ P0PP P/ -@-0 0 ЍЍ/'E'-0^S0]S0]S S]S[S .0L0S>30  Q  ]Q RG-`ጁP@0 SS&tPD(!RGdadqU`0``0,0P,L( $ 00CS010 [S \S @@P`0 S @ 0(a0CS,0p00,a KP0  0@S  0GPC'E'XC'#&yB'RgB'!p@-0 P= P@01SE0p0 SS t`P@0P 00Sm 0PP0 00P h0T 010QڲP0SLQ0 ,N(PC' eE'gE'E''#&yO-bB0  %R R 0R0H 00CS00r00 Q0&Qn0C0 RʴaqU`0``00P? 0A0CS0l10G0 P \QH 0 SP 010S lP/ 000S S)00 S [ U 000崳 PK巶 t00CS0L00 0`00 p<P PPC'G'3gXC'B'\D'`D'#&#&yA-0P0 0p@ W 0 `@P 0 R00R00 1BQoK@X @g@pdK0"S,"@gR000PC'G',fO-ScpгM@00 0GS TcsT`0``00,P2K0` \-X00C0+0&SK BR D R: Y J@p RPK 00C0S @Ѝh20   J  BR   0 \SH 1B\C00 BR?ˆr L\ DQ-WpBp@| \  姲 P J婵D @<f00C0 AQ 0 T0 Tpppp  uPu p BR   @W0 `0CS0(00oq0  bG'XC'B'#&yO-M 0@P0P0s <40S  0 0000 (0 pP ߍ0`CԳ0#2P 00 S pSN(0Y01ڐ Y   $ $P J T PL  BR +430 # V  BR 200S 00 b H 0 0(PP.000YX Y   $ 庱$P  BR 200S 0 , H P0 (0 P'0 p1pG Y;xxZ 倱D1PI傴0 ,(?00CS0uX   R   EP> 00CS000^`W 004 00S |xP00S 0  BH8 =HX B'G'XC'#&yB'gO-㴡A0QM0Cp` 01 00C S00`NlЍ& 0 P5 P!` 00000`P00CS000  D[  0S00CS0x00` P  PB'B'XC'B' fG'B'O-M R B000bsp 0shЍؑ؁0S1  0000 P@  0#੟ɐ Y Fp10S P0000000p0CS0C01;  \" \    " L\ B   @      0C LN B'\%B'hG'XC'dD'\D'B'A- `P 0 0Cs 0x 0t0 l  C A^  00@pT ְ@ 0G'B'\%B'G-p@P0 `R0  P(S%0  d P Ӳ0 ,(堰G'#&y@-G0 h#&O-GMeM0PS@p$Q403/P v0: SG00W +92 P8:G?0P0: S 0SnP0: S 0S 0S 0/S&\P7a00poBP- P #0v7 PvO+10P ]H#P#]$P /B/PBP BB0P+I [(H Z% U8..0 0PT9..0 0P @DP ^ PT1RP  oR00S$ 0SS 0: SO#PN 6  0EG=00 04K EG=00J0SP. TqF8XGH X00CS0 \p Pp  pYW  lX0 X p00CS0D0 }0S EP0SGݍЍ0?o25c 00G 08 G'phhhh#&i#&)i#&7i\\A0\\}AX X0p@-@P@@DDT ` U H H0Rp@\\gAppX 0Xp@-@P@@DDT ` U HH Q\p@\LAppX X0p@-0P0@44T ` U 8 80Rp@\\2AppX 0Xp@-0P0@44T ` U 88 Q\p@\AppX X0p@-PPP@TTT ` U X X0Rp@\\@ppX 0Xp@-PPP@TTT ` U XX Q\p@\@ppX0X @-ppt t0\@ ^0@\\@X 0X@-pptt \@ ^ \@\@5S %R R S R SSh -^L^S R 0/0/0000HG'O-QMTh u@ 0 `0 0L0 @@@@@ @@D@H@,@0@<@@@4@8@5 SS$;\ 0 !00`V0S9 0 00L0刐St 40D0800$0S00( ,00B?>$pp>,0S d @?C0000D00H04$0pp>0$Cpp>$0S00<00@00#pp>,0S  @?CZ㸰张 0|#ppk> 0`#ppc>0 \ 0C0CQ0B003/040 0S {YT R}S0~ 00 R0! 0L0S XP, x0|R0 D ,0 0\HD5H 5 <P !p \t @@  < * R(" $\  " & P 4 04080080 0Sb Q> 0! X>X0$0Q: 0x! d4d0(0$=[(= R 0  P 4P0@=0S00P00P00੪PPr\0.S0S 0!{0P$0 #0P(0 $¬ (彬 R P0崬ͬP000ЍHG'*VUUUkIG-@a!80S 0&PP (rpW G '<0SB|X'@P C@&C@C0S 5!0CS0\r$ 婮  j00L0S \0.S0S (@0S40S t(#Y<0?o20S X (040HG'ĘX7 YMiNiG-`㍭T7DP0L0  nP0S$00D0H0`먔pPP00$vp[|4T H0 `F0P 0 \3P ]84X0 s0X00 00dt |  P PRPS W( ?R004(0x |0R S S S3 L0S3 T0Sx3 0Sl3Pd#Q`30VP 00Ѝ10@GS0L00P0 00H00P0L0 0T0X0s0X0 00P0L0T0H0~0 00P0L0T0H00X0t0P00L00T00P0L0 00\00`0c0`00\0^0d0[PPX0<0U080 PP0 D0h l0J0D0h0000000>;(00p$080p$0,p30$00,0.000@0(0 0%0p0"0t00D00h00x00|00000000 0D0@P+B I 00@`0S0\0S00S S S0 /0`0St0\0Sh0h0uHG'ht@d%7 i&$pG'`HTh%Si#&lؖpD80p@-P@T @@\pG' 80p@-P@T @@\pG' L0-SMM\0 + cpAӬ 0ލЍ 00 >04@p l0l 0 0  L00S   pi#&iG'G'G'$0\ 0S  G'p0L0S/0 0 0/0@-M0S    4 ;$pthЍ\0\@ X0R@P0 B ?~% 0Ѝ@TG'XG'lG'uiitG'iipG'P `00CS`0p S00 P0S X0X /X#&: S@-  S  S/ I* S  S%|@=1A-`@XPTMp !\Z@T10S H10S. 00 00,10''pD >@0 0 0) 0@0S00S 0: S@Ѝ0p 0R0| x0B?:: 0T00S PG'jXG'lG'uiG'G'G'G'tG'ipG'G's@- @@P@P `PU00S @GT CЍp0t  Q \0 \@-U (P@$UjG'G'p@-P@Tp0 0C0  $A @C-@4M0$3 30S`sV4Ѝ0 0C0{ 0XPS !$0S 20Sm 4 "; $Pp|mp gQ0( T^H20S 04V $R 20S   J0 : SK( "0 08"$4710S10S61!0 0H 10S|10S : S0: S u`x81萟 01R(1 B?'9 0 'Q p| , lL\,00S G'G'PG'XG'jlG'ui!jG'*jhG'i1jG'G'G'G'G'G'tG'ipG'G'1O-@0S$0010S 10S,0001!0 q0P0S ЍOPa0HQ 30P  0 0`SpWQPPU% Ѝ  B 1`0    0S[  L0  $R,   V PG'XG'lG'G'G'd%t%G'410G-S$0@010S 10S,0000 0 0P@0`VGa0렠p*PUG n0 0C0 W ep0$S,  `YpP U`PG'XG'lG'G'G'd%0G-P@0T$@0@S 00S,000@0`0娀S㨐@pVG .0 0C0 W ,%p0 00 S p0$S,  Gp` PG'XG'lG'G'd%@- M @ ᱧp ЍT P 0@  QQ 80 <.T P S  h#&0p@-P0S``7@P 8PX cA♤@P8[ aPYަpG'Y?jpC-CM@7 萟P`< <`T *F0 BpPPCߍw ? @P<w0S ?@P?oP@(&@-= Nj#& 000/G'@-=0 tj#&-$M 0P!00Q00! 00 ` #pV$Ѝ "$ 0P 00t0 p0|^ t p\   HH""$  ,0G'jjVjpj"k&kjjO-@He-MQP Pn :=0Sr  pP 0S  P  t00CS01p0pЍ0S P PPpPX 6) (4 Rlsp0! 0 X 00CS0p YX 0 P 0S  lPP X0: S P4P P X0: S8PX 2pPn@b0S  P< PT% [ $F^P ?0 ˯S , !00  A (! 0  A{{zNp00@0 P @p lP +<0S X0;X0X P P <0-S PXpPt0S  DJRpY@G'|.k8[#&#&u8kTkpdkZG[ok}kkks@-@ `PTP0P U<nlЍpU  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx 2/\@`^0 |P4@kx%kklkG-~MAM0SP `E0p 0E~P;d!0`~܍Ѝ~,P u; !0 0E~Pg; ~,`P^; ~,PE0p 0E~aPYp  xQ `l/04 0ELP4;>( /x%m4ll\llll00CS0 0 /G-`XDHMp DTD$0@t000000 00 $0S0V"4`0p Q 30Sa3PZPZ:0#b/冿000 0K#hP:h#0N/V 00D30p Q  #KP0 0:"0//V0020"4P:"0/2000HЍp(0: S T. S+@ P00S`0:0 03V-V)Vq 1X  ?3 3 0~\P F ;0L S0 00 00qpF:0S0 0V00 V V  1!00!0S ~<0~0VXHPQVS U 3 XPV P 0x%H'J'Ą% 8 %4' H'am m%&mAm%smm8@s's'%}D00S/@-~M0@0S~, hP~܍H'x%@-0p@$0l00S Ѝ00 0{/0Q 9, =.~Px%H'mL0@- R<-P 0 0 -H'm's'mA-pP@` P@DTP`VA-pP@` P@DTP`Vp@-P@Tڬ` 0Q@Pڄ0  Q @;;S p@P00T@ J9(0, -( m-x%H's'4nUns@-R@T` Va0@$00 ?00S 0CS3P390 S9E-00@ЍpPڀ;;S" 00 0.0Q P?P00@00" 80S @@80ES TT 0$080S80S 80S 80S $0STڄ00Q Qd,T( L,8(04 7-$x%H'vnn|'nUnn.o`1 RS@-MLQ R @!  BR0,ЍQ   RR  RQ     ⍾P000S,@  00T0pSp 0L.Qo 01p T0 .Q/H'x%Ą%`omooG-PP`0  ,p@P"ڰAQ"-Q 0P P 0-Q8@ ,ЍP Px%H'o@-`xAMPh1P0S2 S VPLD!,00ЍV0Ap0p -0Q7 b, P0S(0S 0-Q#7 ) Pڐ0V 0?31 l0 ` 0ȽP7 0@ .,00x%H'#pRppps'lmpO-Mr,M R(`RX0E@FPo0 0S ሢ000 SJ '0S \  L"apD20 000"0T"0NTn" ?Z܍,ЍT ܑ0S =! !6!0`00 㭻0S|1pt1 0000@@z=0 CMzɫD !Jލ Ѝ  ⪫r p G@$<pm ?4S(40R(4 \ \0Q0]0S0(4 00P 008 '+P'8'O||0'4'؄%qp}Ԅ%}J}/O-Mp@ 0W0DN 00S8 00<0 WPP0C080pG0S `0S * 0R 8 00 x x.  P8 n&@0 X2@ ?@Q*_&@0 0嘠P FP` lvЍXX Ì  ` `@}}''}''Rs@-Ѝp@ 0@`PQ&< 0$ ၪP& 0}'}0@-@MPPᩪ00<00S =  J"Ѝ0'G-`QM MJP Y@ #p iP p 00PP=! SR J(ݍ ЍЫPJ%8 8= $HL0Q\ J(L00 0[QJ%8 PT}am} ~A-QP 000p@T+`00CS0,pT0 0S0T@ 0S@ 0  h P 0S@ @@T S P 'D%#& '0 0 S@-0@0R00000S0@000S `尋P PTp 40PP'T''D' %~'p@-PP 0S6p `ᇋ@P` @P0/S000000f PR @@@pT~o~'h0 RX R  H R/< R/ $R/Q/ 'd'L't'`0@-0S L0@0T R S( 屫0@''~#&G-@b- 0(MS 0SzB)(Ѝ0 0p5"0C S70|20S X00 00!P 0 000! " PPp  0!$$! 0!ꓭ  XL#(4 : S=  S7  S$  S03 0\! 0H! J ,1,OP7 S  S/  S04=! 0400S -Ё ;ЂЃ"040+0 4剨P#0d 00  00  X'8 '~~~ 'q-p@-8M@  |D 0`P`Ⰹ 0U` @bP8ЍpGQx1A-hM0@S\ ᶪhЍA>Z`(="(<&p@1Wpp P0 0000084咪40CSH$0"60"$優0( 4 CR+x vhЍB>'TmS+<  k'u]o z@-=XM"@p:(⇌0 IXЍ7@-@Pp -P Q Ѝ00 * H Ѝ0@H0S :R Q/ 0B\/0@ P 0 0B \0@ AB\7@aB\/W@Q/Qq(0C\0S*/ \ 0W!0C0 0C S*CS*/ P@-*0S@L0 ? SR@C:@  ^:R \000C R00 S00 C@ T \A C@T2  0a0C R"  0C\0S*/ \ 02W"!0C0 0C S*CS*80P @-  m//\'A-@,,PQ U?-QQpW `:WP 0 ?`S ArA.0:S@0 R   0`0:-'&#&/s@- `0P PQ10*@PЍp@P mR bR kR%$+ *R xR R wR!$/QP@P$+*$&0!SP@P0PA- 0S`P⸀p 0P T  @R p00T0p0S ,:=@P004PP. ':s@-@ `P0l C300PЍp@00S S@@PP$0  @D 5 00 '@-F#&Q0 Rr @-/Ą%@-00F$(|F yF vF#&؀\VG-pt B4h@\P(p` 4 0pZ/00 ` O-lM/_oP&c@P$ /0`0P/吏`p0 P@x?x/  @p`?\?A0sQ S  R8/8?00 CRJ|?zP<N>P ,c>@>0 -R.Q0 00 0|> t>t. l>h>d> >0SPp2@> = 0S>  .00 .0-0==P====-000X=00j=@ T PPlO| -1 ! ` S=<-<@0=,=<PE < -<-<,<,<,<,x<,<{T< d<{ 10S510S ;P:4 CSR ! Q0S 0/S0S.00 ` 00C00S0<0 `V">_ Y P:4Co S Q  S  FP  ! C 0C0T T0A0 B!"00*&>: A-@QpW :PZ 0 Q PQP (0S0z@P P p `(A Ѝ| ЍO'= A-0@T `pP1AT  RQ( QP (0@ 00||'=/@-`0M0MSPp 0/S  PP ۍЍ(z@P x T ۍЍ@a|ᢷP 00$$`!#!0 00  @0'?V'A-P`@p娀TЍ000S$0S 0 0 0 00! !x<00S  ||@'4'؄%Ԅ%Є%@-0@P@@0@ A R\ 1  S:0R ЍP`^P ppG-Mⴑ@TY `!PApT 0S @T ~y@PP T00 0QC gP5]"` 0! A*00!!QP  Uލ 4P    P] $0 P  0D 1{( $'G܄%א1G- pWP `LY @ y@P ᜶P` ᖶPAL{J{t@T  P` P 8{yP$'`Ed0A- @T`pH PATg P @'Qq@-0C\N \ @N@N@N\*0000L000\:0L0 S  0 - R 0R$R:/0AA-M M RX!0Tq`0 . ^ 00B0/S$ ! 0ė -P0ڍЍ@*Q.P ?Q0C PP\P0PC0@0C0  0⟗ P d X 0┗ P 8 ( 0∗ *& p@-`0Se\p@ 1e #,@ (PRz000p 0곑 y00S  /'l0-0^0 SQ 0QP' Q#p@-P0Sp p S d0P r   H] @Tp /)%ݑp@-`@PpP7 @Pt1 P d0 2L0D L-p00CS,0 0  Ą%`Lz'M-`PpЍ@":J0840K0CS 2  `=0 01  4  d } (l <t @|qp  {=/ 0$  4 =C@2Q! 1Q) ($5Q/^)0)40($84K ARKQ  $ q++   @04(4 :(40/S0004084(49)($ q++@k$' 'C-Z4$#0CEM@S$030S`` EߍJ(]J(J(J(D ; 00$0$0<0 0 0 ݍЍp$a:  'p@-@ PP hp@Bꠕ@-P0-S0S' B@P#( &w 0N0p Sl0 CP`P40T Ѝ@pbɕ#&-@-0@P   ާ}Ѝ@Ѝ/'p@-@ATp@0 R PSP ` `P`p'-P@-000  x0x 0 0 h@0S \ T00L0L <巒 ,垧$ T Ѝ@ Ѝ/ 'H'''#&'p@-x4@PlhPP \P p5000S  pu'p' -P7@-000  0 0 @0 P0S | S00l0l h` XGTWvD 8T0 S Ѝ0@Ѝ/ 'H'''h#&'#&@-  >#&0@-MM@P@Mߍ00/S~MPxyMP p T p  0RP 0RP И 0^ 000/'@-  Ҏ$#&A-`q M@T pphAPDt00CS0>@ Pp< @Y@DOoB0S@ Ѝ0P: S 㫐P 0S s X }R 0 R@@0p x0 pAT契0 @00CS04F0 'K#&Yu#&O-PQAMS 00@<S =S 00@|S0 0@&S0 0@=S0   +R0'  -R0( )%#$0 *&'A '`''|: : 0 @-'՗0s@-P0`0}W0`0S@ P 0R@P@  P@0S00S 0ST P000 R  Ѝp'(%% A @-AL ^`X sr^0 \ 1#P? L 0l0̠?00à cΌ SQŒQQP0R0R0P0QPQP !: *6GO-p`p됰0%SP@q00&S T4e! a000 @ P@P@'T0@-4M!@p HT` 0 P@4Ѝ0@P S5WP@V P@ 0 F?P@( P@ VU'*p@-@P0)Sp'O-@,,Mp`TP TS T( T) #T! @$TO "T 0#S@P  +,Ѝ'0DSYA `@V@@P'0ISV'Y00`0`  H~ T! z!P 0 @@! 0 @PV`'T@@`4 @P @J 'bp*O-M8Pp`l! @h0 X@0DS '00S^^* PU@  0 c 0DS00SY Ѝ` pUU ': C-pᐐ`  0BS0p0@SP! 000 P@@P@@ Ѝ'G-`d0SP@! p000 PP@'@-M@`P>1PL0P  IR NRpp PpEp@@0SP@ $L1Ѝ'PG-P-PP* @0耟0 `0 0R0Cp0W S `Sp00 0 P11Sp0@0PH0@P 0,P@1u%%'(g@P/- 0/SSS00'0@-@PMMMߍ00/S` p p  0RP 0RP^ p@-`\B0@QP 10D0p@n0m00"SP Vpnz'p@-T` RpH0@Q 8 QPP  0pp@' %ИG-pWR 0S)P lB000000000CS020S @T  St S\TFHbH/Tl42@000/Sp=FpPJ0S0/p0CS0pppW000000pA0P00 Hl00/ lRd R00CS0<10S 00CS00W00 pR0S/S0@D00x0@fP  R*0000t/S0S TP 0/0CS0 pG0S 00CS000L0@I0@F0@'''͘И'%%^ A-p`@000wP 00CS000S W00CS0Pd00S H%@ HW 406 R0S 0O''Ԙ%'2G-M6r0@TLS@P 0.S00.S000/SS?X20PpTePZ( ,`V DPP 0` -. E`0E5k@k0-S0Sp1@T@hRP.NPw W0S Sp.P  `P Dm 0: S W pj.PXQP pW "0S pN.PЍ贅%'+H= '=D@-$0Q @ ]Q@'ИYp@-L@50P000S LTPP 0Se@@tM 101M00CS00 zM 0 \M0pl<e''Ć%G-PhR@ @1`0V1 @P ,P  `I\TQp @p0T \0DQjSh00@ p0BP!0 BS@p@00CS00 M 0@0 @T0S 00CS00 L 0 0SZ00CS00 L 0 L 1 0l1@ @ @ @ @ @pp\@@Ć%, X: ęA-@ ` PR 0R 0S SLp0S0 R M0S  MU  LTMk xL Td@00CS00 {L 0 A\Lꬆ%'0'Ȇ%p% 0@-PH1 0夒'40@-@Q M'@-x0@T   @@@@ @@00S 4060S UЍ''%-$0@- R    8'-@-  0@-8'-@@-00W H@-P@`L =-@@-  3@-@--@-001 " ЍЍ/p@-P@% p@-@-   ЍЍ/ L 0P< < @-DL,P / : Й'0/'p@-@mPPPP ቄp` 卄`P }p` 偄`p7@-P30@T t0 6 N 0d0@T PTMP0 0 @ 0{N@B Ѝ0'u%'0(B @-`p@PU'(<0P&{ `Fkk&Zg{[[{06S 00S\ - Ѝ% @0t0S0T.S N@'F0    /'s@-@` PTЍp0P0CS0 000 P 0 4@ 00 ; 0@-MP @T 0 @@ip E+P   0L@@sip @0 Ѝ0 @g @'H%$%@-@P 0S0S 4P 000  Ѝ0(0G-`S q0P00#p@T0SPf&@D1$@00CS0$10S 1Ѝ00S p Uci<  R S)P00CS00S UA0SBAU8P5@"'''KG-@P,M^P` U*릐 s)2Q0U2$PP20S H0S 2$PPPU I ^0S|2 0S@*T ^0S<"$0 0 *^0S2 R$0S0S 2F@ P0S $F0S F^0Sd1 R$ R @T$@0S F 0S E 0S E 0S E  0 $ V $0?o2$0Mx0$ R  0S E 8I4ZI Ѝ贅%P(; 'X(`%O-M@Pp&*0 @뤀夠夰`?P@ WJ*Vx0$`W T ^0S W LP  0`S *Ѝ(%%'P8PG-P* @0䀟0 `0 0R0Cp0W S `Sp00 0 P*}*S p0@y)PD0(00$l*0 $ 0$/ᰅ%%''A-P@耟0p0`0^0S 0S S00CS0 0 0S 00CS00 00$`0C00CS$` $0 R Ss 0$`S S'%G- M䑟A^`PV $`c)pWT0尡p0p00WZ 0S- |1|a3HlH H00CS00 oH 0= I00CS00 ]H 0 ?H  K^ $`R 0S S00CS0 p  0S pS00CS0 0$`0C0 () Ѝ贅%'((%C-$M@쀟 p( 0 0`@T+ 0S0 PU@ 000}P x0 0 SP00U$0 @ R^PU $0($ЍP0('%G-@,Pp0ESo᪢' 0S$ 1a1d2"H HY.HUH00CS00 G 0 G|aU000$ &PD U@q C0$0  B DPP00CS000S (A900CS000S U0S0SH0H01GPG(0G=GUp'#$괅%(%(p'''420@-IM000000 20S 00S 1Q11GG0@TzG1GWPP& |1 1@6>0S @T H1G cB@YG8WG1F0S 1 $ Iߍ0A 0 000 0@P00CS0 0@ 0 00x0 =00CS0 0S #Gl!GD0FX00S j@00S d'%(%(p''''0@-$M0000 00`^0oSP4P @]'000p\  pr%P 00S )l=8d000 p0CS0(00S  a'$Ѝ贅%''?C-@0mM00@H0?_00?0,@0P@ '0o000@@`pPdpTd0lo@0hP 0lP@T 00/Pl 00$0`0S$&`0 S 0D0>60S >0S$0S 00D0$ 01C 0>0S$0S h@T @ xPP H0E7S 'x0R8 @>0S900SE $.000a00,(00 0p(0&p  =&0S(7S%00S 0 0S= 8 l= , p@ P h=0 KT=8 ,=, R , ,( $P000<=0S @U0 0*P@I.P  @J$ 0 $ R 0Th0DS4' 1A-@MP`Rk01000  ;p!XZU p@@ Q X@T@QD@ 08AS 00CS00 1@ 0* 00CS00 !@ 0 ЍQ o@@U P000.K 00CS0T00S DU@S@84; 0(H`ipĆ%r''|p@-P@@Pp 0S%SpHP @xG p@-P8@Pp 0R7Pp@F L0L-  R0S P P\ 0P%<'G-`@嘀0唐0P0|Up00CS0h00SGA0S0 S 0S00\PPp'<'P%'0A-p0@0`P Q' Q:R @":QR!@P 0`EJ0@S`@?%R00S D$P`0W:SP0R@0('P%A-`P倀000|Vp00CS0T00SA0Sp001K>\@T`'<''0A-PSp R+ᇗ`a@T"W p000`0 @0 0 [00CS0H00S `KP `@4'''p@-P$@Pp0@P0F @-L@000@00 [00CS000S@^'4''O-PM/`@ 0P @@@k (xP00š0 0S 0S 000V#   P@ 5P @cPM R RA R 0S   0  003 0 03 Z0 R"00в0  *pP7Z { 2 @s 0>00Ѝ H" R," R8pP B0000S R pbQ  0X/R0XZp "P pP t"P8 R 4 R 0(xP0 * R; R 60@@DN P R  WP@0000S R   BR 9D R5 N3 P0(P%4'%M'%'O-`$MPp `x%t2@P, 0S*[ P0 00 P0p0Rp`#0`2|P& ZQF=01 =@$Ѝb@DT@ P  p R  U 01W VYXU' [10 0al 0aS v00@0S v P [>W 00SY0 0 S0 P 0< S0Xǜ< '<'< Ć%ќ0(P%< p@-P|`0000S S@H000 00 00000CS0p00Spp@g''0@-Mt@ 0P0000X0>00{H 00CS0$00S Ѝ0@FЍ0'%'@-yP 0SHO-`MpP@d$P0cS @@ <DpP vPP VP@ 7 R8cS" +U<rP3QpPA U=< eP4 <@<T 00S pB00CS00 *< 0 0@ T  Ѝ 0RPU Dg<d<@X pP`100 0 `G`pl1VD0/ PX81  0 000SZU0WG<uPU;<U~[1<UU Ut Ud;} $6'uY> Ć%n0( < QĝٝO-M,B,RpN0 @0`V% VV:V  V /V   BR <` F R \ Ѝx! R  \a[  0000S( @@PtnOP@ @8Tp ~ [ /R0/S0+OW 0 BR  R  BR    BR   ~ 갅%'$< '%+C A-(A0S 0PS0 0aqP0S00 P000W00CS00S }P 0SRh`hp0P RP000W000CS00S X''''s@-0!S1Ѝp*S@SP``00 R Q0C R R00C S@ `U@0S00S=STL00 <0 R0AD1U0 S 0S꤅%''A-``pP0@S  R R00PH @'O-MrR@002 00 0$`42嘀0C r4`0 SX@00 000CS0E0S00CS0 20S  HrP*0X00*PrP W P 10S10 DC}0@0CS0d10S yЍ0SHH Z- Z`* V + 0S<@0 NP B?`F@ 0S 0 0 0CS00 S00C0~0000C0 0`F0CS0V0S@@''%'''C 1O-0pS0 Ѝ1唱 @100 Z :[X0S @ PxQ@ P PX`% V800V ``@@% T* R" RPP >P 9P@P1P P, DoPQ` @P@'D('%A-XPX@X`P0p00 V0p0CS00S '''p@-PV@UQ0 @ p'Q@-pP0` 0S*00E@`P!PP `R@ Ѝ `0P@@0`SP0S0O-0R0 [1 GR00#S000 B0S0p0 G0 B0T,Ѝp U   p  R00SPhTsA ('%%''T< C c< (9\O-0M P0 4帔0@0~Q 0 `p0 @Q Q#:Q =Q Q  Q@   4  BR  P AA `3A PW 0S@ЍQ Q@Q =Rp `p(`` L  BR  wp w     BR u   u   BR   z ( R 0BQRQ B  W `   BR  vT v 0AS Q AQ~@P 1  Q @S(~  ;@@ X  7@P  #  ~R =Q0S 00    @D(%'%('h< t1G-Pf0hAhS 0000T1T0P0H1p ` (pppV0 S000`0`0CS0!0 p0开@ p  0    0  R 000p 0p 괅%'%%'(' @-0n@n갅%O-PAP`0$M`FA8q00CS0@0 PP 0@K0K P0 0C0S0CP 90P0 R"Y 0CM0PEPE0000C0$Ѝ0000'%'(*O-R`P@p[0  0000PPX P X 3 0 E0CP00S HH /-(04  @D,0,0D #3''%Ȇ%H= ~O-Pr0BS,`"@(   R [0  0002``TP `? Tj T Y@0T: 0P[Z  R@0@Y@F0T: 0hPD BU# 2Q0 TQPR D2@Y@FT: HP7 DU0#0 2S 0TS0Q00R D2@ /PY 0S@@T:@PF0D0 0 C00PE0C`F0T00 0 D0C0CS@0 000000C00000000''%C-M@Pᬐ`E 00000吀0p0p00CS00 p0@ @ZЍ00p'%%'A-Pp@.A00CS00 <. 0 ` V.00CS00 %. 0 ` V `l.00CS00 . 0`Ć%N@-롞@-롞00S/ RT%T0QH0 0Scq o/P0//'T%0    B /'A-@P堀0p000` R$ %0 `0T    0 0C@ S000SAO'T%''0A-P` @0p0W0 P 0X S S0 000 00 0h0    0 0$PT J00CS0 00SAT%'%''A-bB0 pWcr 0S ;-9-0S@0PP0/fP2b000r0S\00CS00  w0S 0Xo0#S f P  fPn-0  0p0P0 R R A   BR 0E0CS0000`0\00S D-H0,`8 QT%'%Ȇ%Þ%%@-L@00CS00  bp00CS0@Y'@-8P@P 0      00000 0$00T%'A-P@`000i$ ~eV |`0Pj$p0PS H0  0000CS0 00SA '%T%''@-p0aM00P0Ae@PfP(0: S$ 0U $eP  pP5e00 0< (eh#T eL00CS0,00S Ѝ' *D'A-Qd@P0`00 PHpP<0`00CS000SA''T%'p@-`P@00P0#P I 0S00H0X 0000CS0p$00Spp@x+T%'''0/T%p@-@(`(P0SSSpT%'\p@-P@0SpT%'p@-@Pp P0Ppz#0@pT% 0 R/\% @-@0@1^ `   VpPW  Q Q 00 r B"Q q A,PU 0  04'5rO\%A-R0S20SPB`T p ##dpp " #FP +1 N gPpWadp Jd 0P G''':d qP dpOMJ  Fp,CAJ d P jdp42J  iFp)'J "00c'`']'`4''\%x/s%'ş0S/p@-@PP1PL1D8a 000P0R 0S"00Dl05#0s  0C?o2^0SP㹔pP IR xP0S *00CS0p\00Spp@  PAoQP4'5rO'-'p@-@\P0P00 qG@00CS0p00Spp@''O-@TMp R0 TЍO*ؠZ* P`PZ   0SPs  0 S S S P R00S0S@TЍ0S|22 G! R0+  p  !R-   |" h*  0X" ]* 0sT0 F   *00CS0)0 X )؀` 0S 00CS0)0 00CS0)0 | 00CS0)0` 0Z 0Zk)000u  * #40  )  )P S#4H  0 Lp@ h  \)Ѐ 00Cs 0`F0j&4'\%5rOOX]ens0 @- S  .^\Q    @S0C $00P0R0S O-PP10 0%SW P 0@S!!Q@ C$0S 0S  R-S %S +S D1@@YZT X@1 r9 002#00S 0S 0p?Sp  QP T"@` _ P P b `0@00SJ R Q !" R @\%4'G- a 0S Qq0m0@SA @ (А0Sʬ00CS00 R( 0 )0 R  0 S0!(4'u'5rOՠŠĆ%A-pP`4P00Stp10P 0S TjPp pPP gP`W@ P1 1@z(`V Q U` 00S`AJ 0 ^(P00CS0 '0 S 0 000S0 S 0 0'+4'5rOIĆ%800S /@-P `4'8 P  /Q 0SZ//4'`060S/P00S/D0Q<0  40 A!0 S00'괅%'%4'5rOOG-`Q0SS@00SjZqP000M:@0 C @ @ R0000CS0L10S 4q000$100S010000<>00V00CS000S 0S @pWZ00萠 @_0 Z,DꙂ! P00 R @4'''%A-@S`!1pP@! IU%Tp1@WV2 `1N0SN U 0S0P@aPT`V 1XBpF U#R#060S$ K#H#E#VH%E%U 0S pPP_`~_P LLmWT 0  V'''4'%\%şI08 N R S  0S  P \괅%O-`RBM0p0 pP P Ѝ0S0S "0000@00 !P:TR 0S0L 1 0S1060?o22T97 S 500070S а 0 Р㒺* S :^ 0R Q0  r; R-z!  Z B/o" R" \    P 0 00CS000S \  V@z   BZ/o"  "0X('4''%%' G-pPK@P EP1N0St `QA@`T @`.ApD o㠠`@0S0S 0S0S.`@Y 0 X 000 8괅%\%jş4'A-@w PPT0P 0S %nlP@ pP@ ZP@nt06 R0S@@PX` p9 0 P mY'p%Ć%O-`s$M2 PPY30oV &P *P nU pUV ``L3 R ZP$Ѝ3P\!ZpP'0?oQ20S P V P  Q6ZP@@=Y pW  42pP QY QuVP  R(160SG\  \@ /o"/ S [ -(\@ Q 00pd#Pu@T R *  W R "0S  RP 0 S0C 0 ^ 0 R00YXcX `Z^ R[00V'z'~]4'%p@-PR]`a000@ R 0S 81?p ^\C!0S 0 00E1  S h00P0  D@ RQ D@@@Q00R00S 0S|00CS0000S |p'\%ş4'5rO'<1p@-Q00@S-$P`0SP00CS00 # 0 $0?p B.a!P$lP000V00CS0@800S #p4'ŠՠpĆ%\%ş''@-p 0@0u'@-@ e @up@-`@00  p 0Qp\ PU#00p4'O-PRPr@HH 00T$ T 0"  @D@ Ѝ0CS0!)0@T0 R 0S\S0 S`0S S S=S8 " CK 'SI 0 ` D V@!  `0`F V`0#`V !"0 V 0  }00 S$0!"0^ 0   :0 1 }S`V0 0 \0@ $08 "0 4'r< =ˡpϡҡd%աۡA-@s尃M`TL 0SIPU0|S 0S h##?= 0 BRS8@(#":P(&@`@P@PUV0S 0S pPdTЍ@P8P 0S P wPlPxcPT tid`0DPU@ B0 =0 SPF CyP 9P 6P 3P 0P -P *{xv4'{< ^+pA;Xc/0%*4$?fp@-@PTpU0;U 0S 1@p@-Px`x0PP6 R@N0S@2@@0S@D. 0    p0 p4'%A-0P@`Tp R@ 0N@T P 0S@@ZW\0HU 000000V0@ '%\%A-P`pp P@ 0 AIG@0 EG-PP- 0M00S _o1s q100 00R00 Sڨ @PЍ~0SE  0 Q S/R CZ P" Q 000S*  RA ``0S:SV@!00S!@= @00CS00  0 ( p0SP0@ 00X'(`'(H= 4'V%'d%%C-M@$8T4App``P0S 60SP 0|P( 0^0| P1U00S^0SP60S .0S PP PЍP ^Y8 0 P0C?o20X(%%Ȇ%%sH'0S/p@-P000X@PS00CS000S TpP@T` `@V00`T0@0v0S V00T00p@''%p@-h@P000XP 00CS0 Sp@ 00S W''p@-P@IPU\)p@-b:Pc뻢@-;P\뻢p@-Pv@<pA-P@P0`S~U0p~00 p0 000CS0h00S 0p000000C000CS000S 訅%''P0 @-W" 00C00/Ȣ%00  000   /ᨅ%'p@-@tPt`0000S0000H0 00CS0p,00Spp@00%<'%''@-D@ 00040 00CS000S@'''G-qA0@0000V 0YP0kPSP) 00?0 000E000PS V 00CS0l00SGb E  P0) `0`00'%''T 000@0A00CS0/00S/3'%'p@-$@P0 0C0C0p訅%'p@-(P(`@0@D00C0p訅%'( A00C 00 0C0/ᨅ%'-A-(M@@`DHpPpPVP u 5T(01 0P @ @p@DP`U(ЍAЍ/T (01 p@';0 P  pӢL4O- DTP00S`0KZt eT@ U8 L  B R 0ä/+,'''%'%H= A-P`Pk000TVpRV00CS020S |20@T[UU  r0@000w @ C@00x @ C0 @0 0Dr000  w0B  x0B00  Cr0P 000w P C00x P C0P00E\ 0  LAw01 4`ЍP00 C R 00C\C0 P #SR$ 000fPP epy900CS0H00S UP; 4U '''8Ć%HNmO-PMf`@9pP 0S 0S20YJ U0S SW@ aWP HW@` T @uPh |Ÿ|  00 C RS\   ` P  j& :7VpN0.; U0: a:#P¯T@3UQ `UV 0 U@``qp\5V  h0V P 0SLA01 4pЍ U0 0 aY   `UP :z` 0SN0qpp 0ܳ 0T깣< 'ݣɣ 8< 8Ć%u2Q'jg BR00/00S/@0S/ R /0@-@0000C S  RR R1\ *ЍҤ000C S0S//p@-PP @P  ᘽP l ᒽP TP9P 000C SPpppp saQX0 0@-^ @P U@R000/ᴅ%p@-`@`P6No0Spv@TpT.TTS@T 0  p@P괅%'R͡A-pPR@YQ3 a쁟@0S 0 pW@A00CS00  0a @ Q 0d!S` @TPDa0 R R  @TP@00CS00 R 0 Q P @1@ZT@Q@`Q PAI`V0@ 봅%QĆ%a6",Ib3;80 \*P0@-봅%QT0S/p@-@PPEPp@77A-@1SU@D`pPU 0@P00` PQ'O-@Pq00T`0SO  -R  RB -R0SC P0+R6 `:cP[ T00PoP0S P  ``T 0`rP  R dN\ gPTD0@@ ЍT0S ЍOz''Qh|%A-PRB00і 0`00S 00S0S006X pWP P6p60S0S60N0S60N0F0 0CR?o20S  0-S0F01QP00SQ 0S 0P   000S  00^0 PA' R   R0 0괅%'0'P0 h@-X@000D00S 00CS000S q'''000C S/ @-3P 0  'G-0p `R PU4\ 0S -R Q 0L@C10?P@! ,aPP P@Y@b PP P-U0S 0@T0:SF 0R@1T0:Y " @P/@ P0 T 0:S  @P@?:\00|@Y00 X @0 0CC!08( @ ЍۥĥȆ%uP@-HD0P  Q 000CJ Ѝ'' $0@-S Q*0S-QQ -Q^ R0 P :R0S0 ^ HPP0@:T  ($'G-`R@ 0S P@ -R\@@$0P 0S b0-SL@T@E@D@0S 00?q 0@B00`FA!0S:0P:0`0#1@P0 0V:0 000CS0 10S 3,3"@0Sp` 0C  0XZO0a`F  R0 0CS0H00S @0S 34'.?Q''hp@-H@HP080Sp0u`0CS0` 800C80sꘆ%' 0R @-@T 4 0 B   B /@-@0S@p@-@P0S0ڈ700@2B ! ! !!  !!p@-@8    @蘆% 0S/xQS  00 S/00 0/0S/0/A 08 0/=P/P/0/A 0 0 0@-@똆%'p@-`R`@PHP "t00P pd0 Pp0-S0S0 0pV ($00080@p''<%O-MRp00cp R XT2T"Tb@P  0SRy RR00CS0`1``@t10`0@Ѝ\Y.R %/ P&  BR 000"p 0 S B R  Y000pZ@W@  BQ@ Y Y  YR  Q P Pp P  Q  R P000<00 KX%> %%'%0@-@M0P ` R @pv0 Ph h "mVP 0U<0< 1 001 0 ꘆ%Jb> }@-M@P&0 00SP?p@`T*vpPT @T1PLP @0 P2Ѝ@ꨅ%%'l000S p@-XP@T T D0T@p8040@p 0/ᘆ%,'uҧ(X%(0@-@Z,'p@-d@dP&\Pp# P 00008  P8  p@X%%fA-$R0@T @ : R 0 @q 聟8 0 00CS0!0`)V#V V v vZ A J`p! 0F S0 V0@000 @\V. |V ;V&P0 @ ;P0 @ @0 Pp&P0@ @0w|P0@ @00@0@p P  00P000S0  |ꘆ%X%''E h= G-pj00@ T T+P,0S)㰀" 5PP @ [qG@`P  0RP `FFa@@T 0  蘆%> p@-`0$P P m 0R$, (@R   RPEPx    Q b 00000S@p 0 BRp@ c080@ p蘆%@-y0 000蘆%@-@oP#p@- @fP P @0 000p` P #0`@`ꘆ%O- 㸑`P0 b P@BPp0 CR00 S 0@@0XX U @P@W W. V. 0@PpGW PV VoP 0000 V wT000Sa 000h000S@ ꘆ%> G-JM05P0@005 00 PS400D0$OY`P K 0S '0 $4 0  4 =Y$0000 `SYT4 ` 884$ 4$00CS0! 0S$@PUY3 0RPPS p.0PS Px ,30S ix3|@|3|pX000 0S 0 `PPB P6 \P p(300p# PP0000 0 0 20 B#200#"U0S"P R \00\0@0 $P00CS0 P@0000 @("00CS0 0010DPt 9o@@k1000S K1 0 A0 SFp!倁V@0  {0 0C08000D/0 000CS010S)0@0 0 0 0 02 P B1 0R z@z0PEu`0PUZJߍ200CS0`bR \{00ꘆ%'%'X%'%'O-؏دM"/0ϟ@/0 Q_  `00202280 00x/20S@0S2@D" 2 pWdR00S  /00CS0.0R00S 0@0C0D0000Pm210SxPTP"PF 2P%p}@k<.U0@#S00 p6 p}00@ S0p@ A0@S7p@a0@SaWp@ [\ P0000P-'P 0@YY00@SQ p [P'P8Ipt= 0 0CS00C0~000p@<00@S0p@2p W00C0t00j*`0@? @?o2;R0Sp |\P\Ppt ?Pp YW6;G S8 5:0 S`@0 W0C *0?0'3?pp000 S0 0C0~000@0C0p%W!*00'60'3?00 Q ~ B  ?pAp000 S0@0C0~0@0•3W5*00'90'6?00 Q ~ B  A0'3?00 Q~A• ?p Bp 000 S0@0C0@~0000C0w300'<0'9?00 Q ~ B  A0'6?00 Q~A•  B 0'3?00  R ~ B   W?p00'?0'0!Qp R00C0@R 1 00C0v001`@G 0`"0 !00C0w001 00C0v0`(PB(P00C0y0@0 0"!0C"  0 P$0`2  !!J00pS 21 0僐0C`0@50 0C0  00S 00C002  B )Pp( "10C8#8S1@00C0x00`00C0p0 e00S210"QQ 21Sx0pW 0 l0 m00CS0< 2pP0@D21S;0 0#<R00S2 0S+0SP@ P1P0U1 UP>Y/UP2>P0 |P!000P$@C0 Ѝ@P@0 ,  s0P+0 &P00 0_<P >P &P 00p0pr0 ((0 @0(0-P   p 00@0Fꘆ%X%%D %'B r= ''= _v<ŨҨ''*&A '? %E C 0{P B@ 80 <0p }  0D 00 B{Y #PD}P@ 0 0005 }P' @ 0  BR '~  =0 BR@ =0@[0%Yy :Y4 #Y5pt0@ 0 p0I Q  BR J[ 0 @ Rp 0 B p63Pr KPp@< [ B + R:p%pp02!R1S 0GS2@0 Wv /W0`2  !j !v@R n@pYp}Y K/o" R 0#p0CS0p pP@'P023Q  w000`"0 !1  $00G-`Ѐ0@T@@0PU 0@S 0 0   B/o"W`0 0pS 0 q$ 0 0 0ꘆ%D @-,P20@-aM0$ 0 1< 001@00c1|0000RPI1| 1@Q  @@003v dr 0S $Q. 4QG Q 80 1,4  0<  ,0000 0 ]0 0 0 S00aߍ0 t0 `0 DH0 D0 H00S:RS,0ㆿ 0'%'%D %'uG- Up0 000 P    x5P$00pJ@("pP 0 R 0.`     00S 0 00@: P0, RP 000@ 00 00 R, RպP3 00300 0000    BR   0`0 P 0   CR S0  P P`  ``t 00008 @0C 0 \00\`0 SlP X0 R   L|000`0S0 R Ӻ0-0P 0 R000:0  P 0@S P 000x A`@`00P0`c0 P.    00PU# T 0S 0@P000S0P0S@0S 000@Ѝ$00pnꘆ%= %%A-QQ@``p  @0p0 P 0W@ 0q R$@@`DR ( X% R"p0` 4 P /U`P 08 000C0@04`Ѝ Q  0Sppp0 00 00 @p 0ꘆ%X%'FA- @0P P/ 000 `P o000p0h@`c`@@P 0`0 U000 PPPe``0SU NPꘆ%%Xp@-PP @0 @dP P 000 00Sp qpp蘆%k  P/0S/80 P/0S Q/0@(A-@Pp`00p` P@-` 1CP:0@ pT@P PP ! JB Ѝ ?@P?B&#    C% 0P/@(RQA-pP`%BVU``P``V@  B`0 R@BP PWU( 0ؼA0 ꤆%?YA-`@|pPT@Q00C0U U &@P 0PA@(p@-T@T`0P0000%00CS0p00Spp@m'@('P0p@-`@TpV@PU PAP@(|0p@-P @R QP A0 bP ټ`A' Xp褆%up@-@pP0 S0C0 T  D^AP 0SaA,0O@dA0 T @@p@꤆%gfff@(p@-P`0 Sڜ S :A@P t0 R@U 9Ap荼0S 0 S "A@0S @('%p@-P @0Pp 0  0p@(@0@-@ P  R 4%@A0@( 0 P/ R/@(C-M$P0 U00000p#0C@S0` @@P 2@@,  孻V @ @2 R@Ud2T /o"Rm @h`0"0@@P2V0S' `@p@! BpP@P1 л 0: S@׻00``!l`P!` `V'oPP & 0B V U0S00! 0 "1P @姻& 0H@00CS000S Ѝ@r(T  0P& 8X'? 8'%% ۪ 'Rp@-@`PP Vp ^& x?pPV Q?pV GE& 0P0 ppG-` PppW@p  O0PȐ0S TX  >G:   40@ l.V X (T 0S @V@ PĆ%2u? /<p@- P@ ?p R  }?p d0 Rp r?p k?p e?pI@(%5p@-@PpD0 0RPPp03/S?Pp@(O-0$M@@000`p@A 2 p @尲娒V 0S2" 0S2" $Ѝ@0Sp2 R@00CS 0SP P h% ?Ps^PP jT >0SX hPS>딡0000P Sk\1 0R  >pP+0C S $"%  O >PP 0S( >PP0 RPU >0 400CS0p00S WT0 00`Y0S@('Ć%܆%%''%'O-Px#xcxM0@pP P00T#*p-0U8@D0[T$Sg 0Tq000`V_ %@`00S0SHP0SU0SR0sS vS UP0+S -S P ` $< Q, ` R:  冴 P    "PT 0 @0SA0MЍUF ` p0      "TR .00+)$ 學r   %5S =p$ 0=0pX0 N J0 D (:-&0:-'']? Ć%$A-PQT 00CSPDq10SK R@ 0`0CS00 `01L00<S R 0qL0S 0CS>S RS|l R 00CS0N0 - ? 8p@-@ᆸ0T PR R R& 1S#0 qPpR!Q QT " "D0600S0T0S 00S0P(''%@-@P @ "PKPW @-@P iLP 0 > \({Qp@-@ 00CS00 P `d 5?U UL?Up!P0P0CS00 `pA-@Pp0`00 T 0000CS0H00SAB0S 00S  @'P('L P0  /Q Q0 S//P(@-@bM0pS10S 0SPP10SR WUOT T TP160SPPP0SP;x1N0l16 R6`! R20SPP0Q: _p3 0S$ UEop' W`RUK@D0>T000 0 Y00 ;TPx0N R T  DR 60SЍQ Q2 1 @$ P('%'PO-@`PGP pAP <P0@DpSppTPA T/P@DP:P5@<%P, (4  @P@sSa0S 000T $00CS030S 8@@T00PpӪTW00 T\W! Hs@P 0E0`P 10STw@ T@@VPT @bP1 R 00STV@ Tx@P@UT X@Q0S 00S 467@@TppYW `ԡ̱PEPe ?P@1 z10S VP`0-S0S`TPhOCW W0S8 _90S4 0@ V0 S R0V00 ;`1 R T` F00CS0400S Z ;a{Ć%P(''c# %*G-PPp0E` o@㨂 TUG0S 00S 0@0@000CS0 00S @T(P(''p@-PD@`02S@20CSp2V02pP(40T0P?o20S 0S//P(C-p@`1010r!Q0@S10C1 ЍqXPU X2 Pᶷ9P 0S P($' 0?!!R/P/P(p@-8P\2Sp@\BpP(0-MM01`"R !R X"R   1 1d"1!d2S ,GPl1, ,GP L!0,00F@P$1, a@T0d;`0P, U @T 0S ~P:00CS0 ! :m00 0$0(00D>S Ѵ00 D9:b9"!031P($'''0@- `"dyP(p@-@H'Pၤ0PPp0C/U00p? p@-T@TP0 0P0 h0 0000CS0p00Spp@'%'A-@R`P`p 80PPEUp WDf0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP000P00 00CS0h00S sDP`000=00C0 (''p@-@P@0SH00Spp@00CS00  ꬆ%0ꬆ%0ꬆ%@-@PhЍD-@-  Ѝ Ѝ/-$0@-  ЍЍ/ᬆ% -0@-Mh0, @P(0 00SZ0c1 @00DЍ0@Ѝ/G-@'`sP$ 0S! p>0S00CS0?0 " v00CS000 " 0S pW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU UPP 00CS00 ' o? %0Qꬆ%@-0@ꬆ%@-0rSlt0G-p0 P0R(0帐@0=00妢=`ᢢ`F@VPpPER000 S=S B`` R`ĥ`PGƘ@갅%'%0@- 4@ 00C000 08Ѝ(0P P PR00/0@-@HP^ ^  R0L00A A-( 㴀 R (p`@pW p0S 0QPU  0S 0S   3/P@P00(0Sfp@-@۟PիUl 0Sp'SPTP@'PP,p@H  ED꒬p٭ܭA-P0@S`p    3/@P@PX %W  p0@=S0U 00 00CS00  0 00CS00 z 0 T `Ć%*=O-@00pS 00P㜠`V  X0 ᴟ@PU* ЍY   [ QʁaP`0p((t@0 S =SR/=S/A-`P0S=SPERPU@'ガ\0\pV!0@qpT 0S %PVpp@((1@-`0@S @ PPT 0 ` X `姰  `P Ѝ@@Pw2 000F @PlpGW 嵥Ph TTH`0%SbyPPX[pW 3sS0S`3pV`/J0SpFPPW1 000 P@@@Tak>p >P tݩx1h_@P =@PPU0Su@C>pWpGi0 0 0VP 0S  P1r0*Q 0S 0`Q xܩ.puX T Zr .nu*&0pO5Ć%%   0@-DM⺶0   0@@DPU#8. @0 /  #  /0 Pxtt, Ph DЍ0=}P '4'l-%#;ۥR͡|ġp@-!00S 00x 0p p0p@0   PU P@P0P H0H P pF PpI'''%(@(܆%Ć%%%Ȇ%p@-&0@@ѵ^0 0@0PU@6D000dl0A  R 00CS0H00S p@@C0PC$'%<'%'h('P/p@-@PTp000@A-@`pPT0   S*0 @A 堢0000  叢0000@ H H 00C \ /p@-@P 0`P@  0!S00 0 000@0pO0 0  0 000  00 3  0 000  H H 0@-@PM  0  U  0 00P0 0@Ѝ0@-@`PT@ Ѝ0000px@PP000/0P/  R /P/  000/X( 0P00/X(A-@pP 0` V  V @00CS00  0@ 000CS00  0`X(Ć%A-`@pxT [TP'T TG "T Rῧ|1  p\0DS0@@7T/T @0`00CQPRA`ET@0P@0  aCQBW0CACQ70C00CP@V `R|zh0 ` \@RXo<0  @ @ @ @ @ @{X(H *&5P@-P`p@P \P 6/*0 cS 0<0 Ѝ0S0P@00 #100#7Q0S0AU@MS0-S@6/P^S   C@^S@0?S0X(*&0 0J0'%p@-0S @0AA00p0@S tPP0 0CC``00p"Pp0`0PPEEQ 0Ѧ00pX(ޱ&@-P0`V) 00  70 000p@ 0lA Aᬦ@00T0,A Aᛦ00 ЍX(*&5|@- P@pO ` 0P h@h0 AAc00 ЍV@@T @ 0 AAfX(@-`0@T/ 0'R"RPP0 Ѝ@o Pl +0BpP d0000 0HA A600 Ѝ,pPX(*&G-`P`@V@P @0`0pF ,ދp@0P0X(ղp(O-0hh,M0X0\8P P1@01%Pp PE@ LP Xp (8p70PEAU,Ѝ0  000P@`V7 0S 0S\V $`7P00CS00 07 0$ %V0%S@600CS00 o6 0P`0p*Sp`0.S0@*Sp@Z`xPָ`p<иp@0xZ0WZ%Zo A0J R %X0J S00%S00;눅\P ;  P \Q 0p\\ s00vG t 0 zD\ \LQ b '\ \\ "\  \ M\^0? \@^0-000fnrtvaet 40P030  C 1 01ᒤ똓`P d P`  db  \ Pd  x㊣ s0v0 t <0 p B`0 0@ 0 ָt0  ͸#l cZv t0 O <"0P 00t W 1|j  1v t  j 0et 0^h0P $0'S"S {YX0S$ L v t   0# n8<0$0$  Yt 0Y#v t   0Jt 0NVBT0 Hѣ X(Ć%#&I XI fI *&ę((dp'0C-M`q 0P` Pp (@P 04 p(@PC 0p W  ) PuY <YPP0( 0ES  P |ژ 00S00H pl^YPH0?S0 -S00H0,Ѝ(|I `J 4V\d07@-@0 0 X)TPQ  P  , Ѝ0@)00 ) P |I ;4A-p:8P008T@P3 0S0 =&PP T00 a`cVxcP 00 `8iVTXP 00 <QP, a 0$00SЍlV?P 0 0oV5P 00 .P a 0(0 Q 0SP00CSH a0 0 0SPJ e|I ] ^0K00M00P0D0 0C0D080;800,0/(<0Q8 00,,<008 ,0/@0D 9K<@0(080$00= 0D00<00,0/+$@˝0@-d00$ 8 Ѝ@-@4a000@-@4Y000@-@(0(S00 0(0,0Ѝ`t p@-@ 'PPQΒGP[`8ʒ<Ȓ@ƒDĒU\徒`, 8&`'V0,0p+M@-@48$ 0,0@-@4 8 0,0&(5@-8@ @(( R o8 ", 8 <  < D ,-D  , /(0S ]@-@8 @0<<@00,0@-$ (PUS Ѝt@-(PHSnt @-(P=Sot 0p@-MP`0@-S00(000 0P  P%P 0( RX  0 0 S40,03/ЍpX$J 4A-@`PpQP-U@QȜP00  PṜP0 -U  `0p@-@Px @0P ,pT 80$P< D0TP$ <0<PpK L 4M 8N p@-P @0S g'00Pp(Q+  0 BR @-6' M- 0 S^0@Q 80^  ? 0  / /((\p@-@dP`V Pf'p躚`HV4^'0[' V'0(F pO-M`pA PU \ ='TP D 6'XP 4 0'PW *'PU & P pT,0p zR S [ Z YXW0S@0S 0S<ST00?{[ZYXWP4T <@†{ RS [ZY XW :S 0S0S 0SlPT`7pPP X WU(P6TU P&^R@ 0&T 0~S Tv[TqZ TlY TgX TbWp lT]0SX TTX@0S@ <TS 0S( $TN<S JTO[ TJZ TEY T@X T;W 7R@ 0T 0?S pddT7[T PT2Z@ <T-Y,(T(X T#W}T:SuT0S mT0SeT0S ]T  VT| xOxLT X\XETWH D>TU 0PU$3TUPT;S < S@ SU@S@ S 3  T:v`XS&[& Z+Y0X5W:U?,sP0SSUA =t;<S@T[ TZ TY TX TW TUp lT`jBPUdЍ0k,"0d @$T   Q ! $0R녡t! P0 $ UҲ вP p  -9@Gvõĵ̵͵յֵ  $%+,3289@?GFOPXW_`fgno~}Na]i|I eȶɶжѶٶڶU\e@- -%"j#&00@-( Q 0 0 %!(‚#&s@-@`0 00#S@cP0S 8 PO00S 0 @OЍppq0S/#Sp@-@,P(p0P 00p(‚@-PRP@ p`*p 0R" Ѝĝ0"S0SO 00SS  00@O*&@-TPL0 p@0"SNЍø(Ӹ@-TPL0 p@0"SNЍ(p@-Pd@0S 0S 0SS <<U84  S ($000P 0p(o9!p@-Px@Ql NmP L0 P      pp@ @4O =(0@-@MPP 0SPH00Ѝ000 0>P0 0 V(nO-PXMp` 0S8;$ , P 0S ߍP? 0Q 0S q@  R R@  R@[T WpU: 0S D 9/PV?`0(U޹@-婜0S S S8 4 ЍpS$ ЍZ꘺pE7@-lP$ R`M;@ Hh$0S p0 M  M Ѝ0( (-Xp@-@P 0Sp@0PS P00ᖯ00Spꌻ@-+@@@ @`P0S 00=# 4R #&C-PMP` 0S00(p0 /pEP" /Q0`@ 0p@5P T0 p+PH$0@@ 00ЍV((0A- @LL" @R<2<<1H#"( ,", "0 "8 "4 "#4R! "!4S "!4S |"!4S `"!4S D"h!P0S l("L!T0S T "LPp8W ЍA0S. a``0 " 0 }"0US !S| !3  \p"0US83  0U $b"0x ]"pPh#&4O 0bu!*3<EBBNVJ^mY(G-Q| ,@QhP0QP 4QP<PQ(80S,00 80<0S804 <0P;PP;P1 QB"8`8X0apSp R t <0R\P 00< S8P0S9`(Q (Q @P0S0 BS `a 0|h0S  0 S* 0Q*ha i8Zwۼ(]ؽ+/\O-;$M p*nb 0P$S M ߍS 3먲@PT[D0 00@P뉔 4ᨛ0R YSA ("$0f0Qjf/ H,2!S1Q% RR 䡟 0!,21S 1b"!b$!R! R,"b"!4b4# 0C?o2S  0 pp`1R8 R,2 @P0 000(4"48#8 R* 0S 0p P 0S 0 p1So   @. 1S  f/ Ԙ01T T%H ((VEW}}yWEVѾu :e(h#&A-P@`#pP %R 0R000005S P vL $0f0Q4 J( ( ((p@-@,mP  P$p@DI0@-0S ,(@-P ) (O-@MzM:P 00@ p P5 ` ᙄXPP00 0S : P`( @00i0S``(`EP+V0` (`嬩 Y 90 ,0 0P,0Sl  ,02P 7P HHἂ(P,1 PFV 0SZ 0 0,0P2 @h`(b(P,00 |P ,00,0`V 0S,00b<P,00 $ l@8, 1\ , @W0P ,0S  S;ǑBT0;\V0`(P( /ᡓP(x pᘓ P(`00,0P,0S ++RP0 0  *| P (`00,0uP,0T0 k P (`00,0dP,0`0 Z P (`00,0SP,0X0 HI P (`00,0BP,0\0 8P 3P (`0 0,0+P,0d0 !P (`<5 0,0P,07 p P (`40,0P,07 {0 P (`40,0P,07| j P (`l40,0P,07k Yܒ P (`00,0P,0x0Z Hp˒ P (`00,0P,0|0I 7 `aF0 S0S  Q[0Y: Y0  0J 0B뼃(0bSTB 9(`H 2[9  ᧪0S(I `3#   0 R M 0 43000"0,0(  00,0 kP P@, 2![ 0ȰÕN 00 0, (0 bS P (0S, 孑H@pݍЍ  R $0婐$0  QP r$0P0!CK " Ȱ哐 0R ( [ K0 S|1[ 00 R  (0 bS Px (0S, T (0Sg  b(npY|R (T())s(q (FSgu1(R *&RVN 0s@-`PU V  P69@P h4Ѝp`PD!h<0 t0@⒪V.R 7$00S c@-L00%p@-@5S4 0PSP p@'Pp0S 5S 1S oGPp5S X `Pp@ LPp(( PpVG((lIedArdA7@-P@0(00(0;_5S * 5S( P0S 0S005S  Plh0hP>L5S Ѝ0@ @mP0(WEVfd md%hX(gd+@-@P f/㬔@( 0 L% (md0S/!  -3@-P\ VP 0S S@@ _P@Ѝ0@ Ѝ/#&@-0@Q1@`  @%@-Mp@p0l Q d P0cS CS SS 4}sS00ۍ0*( 0@-MMd@ PP 00YSP ,[ۍЍ0nP# 0 5 (h#&@-@M,0 wP 2ۍ1~@-@ 0 @(h#& (,@-YMMt@ p\YލЍ<0< S <fEP10YS<0<0rdAE^*@-0gj z gz z4 'z'&z'z{zgzzz{Ѝ57@-P0@ 0$S0S/ 0S' TQBQC0AQ QVJ00S 8@0  000! S0c0A R| Ѝ0zg{{' Q{ zg{k Q{ { { @*(T @-MT@T0P Q H P 0nS00 yS rۍ*(s/P `00CS`0p S00 P0S X0X /X#&C-` 0pP06@P `E[pG嬍T@ U @0 @HbWpPF 0l QN V ቍPUP P pX Ѝ>Ni<[h#&G-MMP`p$0@S0#!'p- P ׎P㰤 P%0  p P  `D(<p P $ (RP  XCP908`D( p P  RP 0(0`D, xp P H QP D0,0`D0 ,p P  QP 000`D8 p P  QP m080`D4 p P L QP @X040`D< Dopu P  QP C0<0`D$Zp` P  QP .04`D$EpK P P sQP t04@`D$X/p5 P  ]QP $04`DP p P  HQP 0P0`DT P X 5QP 0T0ۍЍI(h#&T [lAa/Rr1NO-M M@啦p PS `V20S0`S.P`P8aEX``0E` 8ġ@x 00A"S0#1` \p P& A@OP4s((" ŋ 4P0S  3/ PAJP+ ࠰Rx%9.A ip P" 4S@4`S=".4`P82a0C" 20< S :A -"[A%x5|%.A 5pe P0 x5< A B0 qpAA 0Q<0PADxZ0x5< 0RA| nmP 00 00S" P0`(V R s S 00 0 0`PXލ Ѝl%T ,U Bp( (h#&*( - BR0 R p@-P@7 R1!/0 *0 %ሶX0 ႶX0 p|X0 \v j( D , 80 ,8 4 < $$$$P T @p 02Q0S*?X`\PQ Vl,p@OU  2EZp}O-pᔀ 2MSR R@`aK 8QH ,[E 0律0 ḋ  0`"@` n 8 娋,  ᡋ 0"@ X 0 f !R11` ] 0S 0C R]!SZ0  1 0 0tB8QI ъX 9<0P+8\Q* 8 0A0๊ @!2<0P+8BQ *ЍOs0 0 0 0x h< X ЍOMЍ )U EMU 7uRevA-@Pp(D@:`8SAY 0` 0`( "4`#/A-P @4"40 4"40 `p⬎ ⨎(l(,,004488<$4"44$4"44<D$4"44$4"44$4"44$4"44DPPTTXXQl`pW(4"48(@4"48d0`PV@P ~ {0T0A0T0A T4"40A(@-@l40Pm08f/%WEVT@-@P TP8#!00Q@kWEV(80@-@0S B08f/( 0\ P0//@-ŎDD@0 <44D R 0 %#&7/P7@-@ PTP0 08P8 0p0 @ Ѝ0*4*(vd0@?o2P0S@- p`PÉ@P ᾉP ṉP ᴉP@V@l嫉PH@T@T p0 8?@@ Ѝ譅uOyc*(udP0@-M zdPd@ rp H? 0 400+ +Ѝ0*(zd@Rcqs@- @Rp ?0  }0 w0`P   n0   g0  h`0  PY0  8RЍp*(td@uBfp@-( PM@`P㣌 p  ( V V h %PЍp (yxH( p ,?0 *(}d(@M~d(P0@-M @  XxP@ >4P4 p0 >Ѝ0*({dЀA-`!吁0@Pp(M00t!p0SPP@AH p  0>eP qP p` $0Q 00S*W@P >QVW )V0 ]{ R|0|0 0S(Ѝ00* *D  `@(:-& *(|d#2g$snuP@-$M 4@P ,p tb>0P _ ;0P 0P7q0 P p@諞p@ 0x@dp@;1U@@唞Pptcidyararbmngnts gp0D S/ 3C5C$1 4! 8<0/.(0@-,A„QU0%Q ? /@.0@1 ^ L043c 0P0Q ? /@.3P0@1@ 2@D4P5H@.( 213/P//(A-PT0p(,`@,0T@@DA?@?@@.(@-?00@0 (20,20/0P!P30.(> 0R//G-0`p(,BP  EÄ@PPW ,20CS(20CS G0.(IDp@-M@`42S%^  E 82<"@ 0(2,"Ѝp@呝<"82El@`儝,"(2H0X"\4Ѝp@.(|%MVI]s@-P`/  (0SЍp00S@0"S1Ds@-$M@ᶂ0 0 0 0 u#&A-P`0 p @Tʬ:: /,s0d  ? ~qp  RЍAh L`e 0S`@D@,Ї Ѝ|%.(A-0ppP@`pl!14P S H d" R S R, 0g#U.(p@-P0@0Sg( EB01p.(O-TM0(00,0x0$ #0P㈰匠s00@304<000S: (2,3`K(0, 80ց808 D$0@?ˁ$0 0ā$0 00  ⻁@ D04䂟"d P 9$00( ,04 zh ` RL` $R0 S p200#1-R0" 4LL`P@0u00P00S FvP  @vP  :vP$ /0L00 S? 十0< |g2/kE%KUP1BK\"?C$50DP@\2S@0x0XR@x0 X20P@x0 X20UP@x0 X20UP@`L`(0U,0000[ 00S (00,00 0 h $P @TЍ P @.(|% P1(#&?*&_bf-7@-@~ 00CS0 >P Pp pt80 P00CS08>0 Y@o Ѝ0@Ѝ/#&O-0` p8Pp/B$0e@O 0|qp Ѝ  R ЍO t` 0S 0|qp `BE,  r 0S |%.(p@-P@2S t`0n/(21!41#41U @0&"UU  p@@PC @⒅@Tp.(`8(1(G-@r,)`P 8` VPpYTLE J$`l,f0U !VU ! [E@s_Ps ⠅X2  I $! (! "4! 1"8",1!#$s_(P, "!"",!000@0 0 D 0H 0L0 04 8 < 0@v000.(>A-@PXPAds 2FC t B B$k00C0.(O-Q40 ЍQ^H DaXR XD 0 0!R 0:80Ԣ #ZppWPPUJ U @DQ ČUȌ̌X L X0P0Z 80S yq .(O-P0p0Q`@07 0 $4 Q %C?C0V% 021S 02/ .0 1  Q  32 $450 (, T02Sx Y< ЍPT 21倰[R RS$ [0 0 2S Y P6Y2p00`@p0[ Y 0S S01S 2SLPD `b/ .040 81 < [S  R#ZY  0S^   BN R@1SO148<$j00C0@@PAy`d1S  P0148<   00P2S. Y  a14a8a<0#d1a#h# 0 S 0(00 ,00(  ,   0|0% 0@PT0p  0V0S 8`@00V(0`S,0 @0m 000 V 0S7X\" 0y`@@SR 00 RX00 04p ` 0S 00 00 0`) P2 S2S/  1@ 0p S ʼ6! R0Y0 @p`!R (0 \ !A(0D!H!L@!$(,@|21S  "/0.0010T0 3p2044p5 8<0 T @p@ H2(0L2,00800 S- 1S* ( W000P,  00SW0!14!8!<!14!8!<W(p,)(,00L000D(`0 S( 21S$ / .0,40 81 <W ( S  PW 32 $45(, W\(00,0`@ p00 00 0`S0S00 00 0` 2P  LWU6 0`` ~0S '0S 0s X2 0 RS 0 \PTo_P$$00D#$0 #(#< 0&4 0&80&< 0 0p `70 @12S` BT0`PX 0 1<Ap 0@@j,2 0C0@0@P`x^(2? 00@@pTTpp0`Fa ?`1<A 0?``@@>,2 0C0@0@`3(20? 0@@)`Fa?`?``0S\ 2S@X @TVJ041SM.(\Yu81(gm9p:A-p0B42cS 屒P42S  0PEU42S 0S 嚒P 42RSfsP:卒42S]1!$1(1,ЍA0S\ SL`兄d 0 4rW2S {`p` 0YPk"PR Sa0SЍAA@D 0ЍASPJ 0Ѝ.( 2/(iB\b~A-@T2 @PyP xP xP@ `p@T 00S p`V@xPD00S @@x@PDOo`X(%A-Pp`@b_000 0@@@A-p@`T 1w.wPP( 0@j@<@mC-MM0X4 P@ T@D xP$@ xP4 00(03P (T(0 ,02@` PF#L434P4S@@(4儃4T0F@p@0l`P5P0 !0P1P 3l0 < 00S#  dU8 p@8 PA , R ,< 00\S< 0 0@܍Ѝ0GSʇpP0S -S@`a=lP00@@4%P, R ,A0 uMP w8800  0 R00S% <10\A40CT!T00C^-|0S0S|0S0S C \0S C RCMCH $ VP?4#j h PSe j P `X(uMaru%? j0/TY(0/TY(0/TY(-@-    #&G-P`p(|@0S m 0S X|d U TYY0S 0S{@ ITY( -@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  @-M Mq@` @PxPݍ Ѝ`!r=Pp=0D@@rOP0: S0RP00 0PP }P81: S P% S  R  rPPpJ'PPPU rzPP$0@PTY( 9HdY(Xrp@-70P  44 05 Ѝ   ,d](0@-4S 3/ TTY(@-/{00 @ 0 $z#{@T^ TY(@-{@Yzz{@@-p PL`@@0 7/0P S Ѝ Y00](O- MM0x6@  @  @ 0p$000 (0&P=((@ ܍Ѝ 03/0P00  P @$0SP  (0S W0SU SUtt 0000,;p` ,0 p; 6t50@0Y0C @4 `V+]` :0  0 000h4   ` `  Y!E"  00 0 ,0cuP,0 0S `duP pW <`V|wp@P ZC Wp` Y40S5 #  @ 0 0 P%00Q00R00S  000 x 0 S   Z0% 000 0@@0 00R0C0q V B G SE SB `V` 0S 0S^%@U 000 PP,& 00@ E  0PS P `Ѝ0S U0S\0S\ 0/@ \0Sp0  @ 0@0vp 0S0S兌 @g0Sz  @" u @0Sth @D LP@ @0 @ `-0xP|"%   T`  ` P @| @x u 0@``a U Pb R`^(^( ^(Xp!^ntSG-0@  0P Q< 0 ZPP,  A 0P` 8 pЍ Q*l !URQ L l Mv0 p H0 0W40p P  0Q0   040 04! !$0 0 0( 1 0, X0`PX P< 0SD00D0Dpp $0"X0(0R+* 0H0p,0#804 3 00 0pl00 QP    0P SP| yRpP1S1S1US1S 3S3S3US3S,  pP0p* 20212 1300p 0pl00 QP p 2  K 0Pp00S1<01@040  0l40  QP   K 0PA0O  A0RP 4$ 0R   eYxvtX`V P0E(q 06#++R`HX< $0S,0,  RT0C qD0"#1P0P  0QL \0  0P 00P00h00dl0d@}1[uRRaArrAaU3g@@-p@`P 00 P0Pk 00QP  Ѝ 0P< !@ !0 P0k 00QP 4 `0P}@-@L0 \:0\l00l0Ѝ |p00p0l0 \ \ P0 S |H |<00L 8  8 (P00ꀣtOzG-`XpP @ $P & Ѝ0!0呗 0HkXY D ^X0 X0 PO-@,M0p@$0l@`P Ppr$PP 6@,Ѝ t 0 RLŸV^S PP8 PU @4p2 P ^ ^^^@ \ \\\P   @P@CL0!Sp sppP0 S 0 P p 0$r k 0L $ P 20 2 p(p," "  @ "  p@! P0 S@  2"!"0  0p@1oX0P s s// /3tOO-M`@PpP0S Ѝ X  H r0A D00 s/ r ql `6P0p@P x q `0 P 0 00 P 0 00 ` P s `0Pt P0 0X `<P  iR0/0@- PBU02S0P^0A-p`|P@P  PP P0S"R0R0dPO- p`0\PPX $P  qQ 0 @T 0Q\(2 R0@ PS C 0BXT" R t0D s   0 TX  R 0 0 p| *P YP  L BPTR2 Q PE-dO-X`0Mp@PP\Ѝ q0Yl0L (2 R0 r00 PP" 0 STR rH 0/OP q  0L˜ Z,$ z ,(  \l  ,΂0l\ll 0\l lP 00Ql"! CClX 09#! 0 dh QP 00 PlG-@`PpP0S00S <q.p@q8WO$0S  0S 0S,0( 0  P0S.P  SPpl Q P l0p<0P0Q*l0S 2Sp  l\PP 0 RQ@0 P 03@-XP?`P@@\@#T@TpW @@T`L_(O-@HHM8p1pP0 0TP0S<0T D0S Ѝ1@ 00`0 D2# ᓲ00 0g Q P `P0 W:00 0g Q P PLJ 0 'P<0T 0qB^(1O-M@L0S<`@DHp S_P PJ V_oR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T:Ko^(0 A-B?$@[`/p0S j0ES PC Tpp@@0T?  C0^(0 PK %/^(O-`cM 1V, 01 SP0 S@0P`00D@H0(0$0@@hD0' R$ X0p1#r#<400< 0,40f<04 QP cߍ0P@@`00D`H0(0$00 Cp`02# , uPW00q280pG0L0L08 SD00S   80< 28000,40f<04 QP (100  RR R0(10H0@L0 p0L0B = #lP1 (1 0(11  J   @ ,0B0 H0P 0H S1@0S  ZI@(1 0A@  0I@0;+ ;n 6P(10(1 0S[ 0@ D D000/os" R$ (00 ,P(0o0000$0D0 `SD0! 0CD0D 0㓲" X 0X  PP :X R: U$0`(00`P0 4o UA `i0D\Q U`V$  (   P`( P\0K/n 0x! Qp0q P b QQ0S*0hQh  0  U `$P(Pq000 000 0P`,@P  Q b.0 Ab  @ @bρ G?@ L0C@s PQ*V  04L |1r 8 <|1 0V4 8 <1 , u5Z000000U\`0& V$  0 0\T P0000 0(0T 0P0 0 0,@eV 0$ S1S IxQ1PP|!xR \`\P PPL0 sPP|!I6@0|1|QUP0U* 0" 00 0x 1S \P@ I0@ 00001h:jPP 1|!R `PPP 1b |10|1#40L0s_?00010I@P30 0Q 00RA U$0(00``P91 S}RhiP0S 0S \elKR P0S 02S 0S0S} 0\2SK\F|!+xQP qPP00@ s 3 |1P )HXP PPPPPPL0Is0PP@1>@<hiP0PU+ `|1VS /P@ |a``L0Is@`` !RP \PP0 1A@`PP\< K/\?mPP05P(. 50Ph00h04U U0@IP0U* 0RPd01S\!0DP %4QP0%8%\0 P0PEd0U03:\@u<P |!d1P Zb" : 00|12P0P0(00`P#P,18 ,<80PI 020SP0 S0 ( U$0 0`$0K000 000$00 0,@ D00S< 0,40Pc<04 QP80,R$0 PI ^(1^ _(/GpC ^ _ !      = a G-@p r W pP\aPP Pp( PK/kD08QP0Q:" 0PS00  Q puxPhdP80 "8 R 00 05 !$u^({    =   k p@-@5%SQ%5 %SPQ %UUQQp  0 0Q0 Q 0^(A-`hPp5@ @ 0% Ņq@ŕ\^(O-OMPphP) b5S5@ ET# T 5d 50 ! S!$5"R$%P0S88 gP @TEOߍdP  RR @`0d B2" 0 b JQP d d0P Eh0K/0h0 j0D! %,qrd (001 .k j  j  j,10,1#40L0sK?000/1001001#40>000310 00 000L0 Ca(%,5QP Hd fd0P ^(Hc(      @-@ P 0 5^(0/Hc(0/Hc(0/Hc(-@-    %#&G-P`pk@0S  0S X| U TY0S 0Suk@ iHc( -@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  :@-M Mq@` @HPxPݍ Ѝ`!rPp=0D@@rO0P0: S0RP00 0Q PP P81: S P% S  R  rb PPpPPPU rPP$0@PHc( 9HXc(Xrp@-'0P  44 0 Ѝ   Xg(0@-4S 3/ Hc(@-j00 @1 0 $Njj@^ Hc(@-j@|IAj>jj@O-M$M`pP`"NPX1 b: S/we0P  rR j00pPP ZW oUP 0C P"Va8R V  VePN UP P W\1` 0F`PIX1: S<V2"58rpPUPPV9 PW00``2! 0$ $PPt 7P5j0S3]`P S R Sp`P-p `P`!\1 S R U:Pk`x!|0#PaY $ PtpUd( FPP XND% ܍$ЍsJ  " F F F@ 0`( "4`#/ p@-4"4 04"4 04"4 04"4@0P#J( $0 $(h XXhddhhllppttp p@-4"4 04"4P0@ IIIDDI@@IHHIL`LPPTTX~X\{ \`CI->?n}C@X=X\:\79>rI9>:>CmI:>CFiI 0? AC>`IC>mG[IFXIE~EnFSIGPI 0X J~pXV}m  $$((,S>,+IS>G'IF$IHHLLPPTTXX\\O-@P`Pp !4"4!14"41  $$((,,00WС\5 S L5sT`0$ $ 0Q`V,MzTvT`XrX\n\`k`dhdhehplalp^pt[txXxH0[ O`LIpp$5S\5 Sp`0SP%@ Sز ,*%TU 0`( "4`#/+0P0 C@ /p@-@R0 M4 @8 P b"9<Q08u@5ppL0p  0Sls` a0 0S a  000 St:0 02P0 @S$0 `0;9:  \08%@5  L0  0S_h RHX-$P20SO Dv0 0 0 000(@$? x0t 60 P 0 FU 01S0 : 00(!( ({xh{y h(u N  G 0{!0P000 R0T 1AL PIFPC8 G2x0 y1( @( 3 P0h3@1hXh(j(pj(4h(% (h(  h(O-M`@ ) P0H: 0 0@40P$? 0 62쒟2Q { B("( pqsἢQ0< ,#42 0JR wXQp 04  0R  @PЍ( 0QG1  0 4 Y: 10S<000D0`1 0` (0%G 1 010S 10S 0X` `$110010S Xp1p1000 G C8C80_4h(h(%pj(؈%j(j(O-FM MP` X _넕p@#: 0 h5 R`"0Sg D50S00  000S Fލ Ѝ,u00 f1000D0yȤ H0T00X0400 4QpQ\t` #  3XR"0S* L0 00 0 HP! #0000S t0  0 t.P3 l.P0!"0K 0 : @ 8C80  0 0S }"y  P0 !;.P РL00 0R0 H i | 0J0 X0 x20G0  000 B00S,(2jp0 G0 h0G [0 Y0C0#  4 S 0040QpP!Dt1p 0p+D 0'D0  ks000C0 0 S  @q  0xs00 p   8C80I0000 0 T!0xs  000S (h( O j( g(%I j(  h(  B ` @k Xh(   C-@PN`HXpaY 10S t10S 00 0T P< ЍC)@D`T> 1 RP1H s0  P PH H0S$00S T Z 0S |s0S G L@ ЍCfX -P L0 ЍT0h((h( 00S 03 00 XX8ő @5D0LT 031 a> QP R. x!PP!0  S  @ dP   . 80< 0 @`80< 㽸P0 P0  #0 S00@ ` R Q\Q\tk((h(tj(lh(wPh(h(8h(00S4  /h(00S0`( "4`#/h( 00S/e2h(O-M,M \@Q"[:$0: S`B[ ` p-P" -P 0 0 00؍,Ѝ`0 (-P L X-P h0S  0  pP I0S, P: z: [   054%00! ?0S S :00/0S 0 S :V00#03*  R00S D:0S7 8  02(:* 0S R &P0P4`Ɵ @U9U)9Q00e0 B?U5pQP"x90S  | 0t 0l  0$ 0P080S, P9V  Z9Pp⨸ U0 00(p UxPP0X ZP (0000@P_P8HWDP"$0 S7Q9 80S5  V0;R00*h0S- 7('d0 ( #0 ^P d70S  0` N @(B660S 0h0!60(%R/V+: <V3#\Q RnP   hPpQ^q U PE" #p#]:U PpXh RUPp%Q_'qP tPE! p 10S0AU 0  Z; 0S 1000S x50S 0S 0,  nt ?I 0S 1000S 40S 0S   P 10S0ꊡ 0000 04 $0 S 00  000 0Q$000$0 #600S440S L4P P t@pt30Q00 0pQSLtQPXd00H00S1 0S \30S? \P  0MP2 "0 \00&&p2 0@S0:000S0840/<0a0#QP8`

hR=\NP 0H0HP0`0Ap`IP1PU 0\785  @5D0L 0T 32 b< RP1Q 00 V 80&03/ UV 0 H` P00S ,1c0S@ H0S8  0 # P0L #-Pghj(Xi(i(j(@j(Lh(i(h(4h(k(,h((h(h( Hh(j(j(j(8Lh(shh(lj(j(h( *R5O-pş|M@P,0S%40AHDLdP T0AX  GM5 $00 dtP 0@, R<T5@|Ѝ 1o\%呆( R  `  0`oQ0P P0_ S /  !.0P?00 1> (@` 0 ^%Ϡ<#\ ğ Q  0  D ?0 #M#3 0R< S< 3ȓ0`S0x0@S =0, dH 0t l`d30S9 X30S5 L0 S 3 S?X ਁႎ0 % s\@T`S CT0 S\00T0  @T`0VT? @`1 0t20兑A0Y 1XS D 0+ *0P0  "y TL000Y 0;* 0 0VT0Q@`` @ T\@@R0@3T5Q`1:@Q`$ 0@04 00  P k00VT 1PS 9  P 0R`* A Kj(4h(Ttj(@dPh(Hh(|j(k(j(h(j(hj(#&(h(h!hy D10 S& P^#R0 š!ȡ0S  0R ؀1P 00 00lPd0`P00C0ZCP<` j(j(Xh(j(^ ;h(h(= |Ub,h(_ U(h(00000C0!" p.0S@0 0 0C0 00@z _ Jb h(|` aj(j(j(\}}hj((h(xj(;#&pj(!  R1[ 10SJ0!T  0 S@1`0 ? o?00 20 !찟00S0H0S 0 04040c/0 P0L 0 8 QT $  $ $ $  L32   ^[0{ {<0 剮Pp@4h(j(Tk(j(h(U xh(h(tj(8h(Ph(00S0`( "4`#/h(O-lMX xxID`p200,0SlЍ0S 0,P@d@0$ Pw000Pp1 0@1  0D R`T04:1AXpX\tX`Xdh  X  @RF X %P 10S  0|@P;P 00S  0z 0S  Q\ {{00 K0X!  X  P  @0.4h(hj(@#&h(j(_ ,h(?hh( gs{O-M式M@PP!n00 C0t0?0SX0S $5S\0SVPPWX0S $Yk S Y Rd?娀pW\ 0P%T਀X僀 H\VC00!` 1B`01$dQd0ڈP0C00h01`l0R!B1d0L.0CW P0=SLq QT00H   0S 0h$5p> * *L>@>0S <0 0ꔭ S0B$5111`R B- 10 0S8 $~0S%  0帐- 00$%BR㩑0`S<B11@%L0 PP  @ PP 0S <P *堐)<<0S 0 02d0pA?P0;3A?`0 =<0T0.L0B; 0WHQ RX0>F@ @0wB8 84<ϠQ bT{ S Q,0 SZ?^@ P< T;0S @ A>+@B@  CP; @@ B000$:J*#)::0S U10 0؍ߍ0<00

A! "$5S8<(0W8,(2W42,2<0002SV0@ x S0!!~ 4x0@0 $ST0< T@$!0S\0P @V=SL5s35`!~? X00S-["!>R\ /  X B  R\ ?0  020C02`H0T SD0\ 0$3!΍0 h0DH0lE 0#0AS0000 0"0C 00S\0X00!!!`V0: 0phppPp P`lXX㧁 X姁0 8PPK,2!~00<0S. d;0 ST0Tpp101"P Rh"!>2 ԐXd]<pY<0 0 S<;000$5S `0|63! 03080H ` H D /D VQ 42!.0$00` S`0?00S0\04 0s4h(j(h((h( j(h(U +j(tj(hj(N#&Tj(vh(h(j(0k(j(8 j(_ ,h(<xh(4h(h(h(j(`h('h(0/k(0/k(0/k(-@-    #&G-P`p>@0S  0S X| ᩱU ᘩTY0S 0Si>@ ]k( -@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  .@-M Mq@` @<PxPݍ Ѝ`!rPp=0D@@rO$P0: S0RP00 0EPP P81: S P% S  R  rVPPpPPPU rPP$0@Pk( 9Hk(Xrp@-z0P  44 0 Ѝ   o(0@-4S 3/ k(@-=00 @% 0 $B==@_ k(@-=@p5=2==@P/00@-@0S  @ (h(1Q0@?o2P  R7 P0 P0S 0 0SS 000000/ PP  P R ` -X XQTTT 0  000  /TTT8 h(h(xj(|j(j(T 8t0t 0 0 \5` S\0 X SP0\5L00S/\5, S 0 $ S/0\5/j(h(T8 T 8h(0p@-000 0 00@P22=000=000X0X0<0<0@0@0\0\0p "H3H3L3L3P3P3T3T3u/" "h p@0p@-000 0 00@P22=000=000X0X0<0<000@0@0\0\0p a"H3H3L3L3P3P3T3T3u/U" Q"EEP  K"4444K4K4h ?" 5 5d0d00000-P5BP5H5H5=Ch S>S>p@W0 \\L5SXPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//j(4O-MX hDhhdhP@quP@D@:0 0 P\cpKЍ ?W50p  P\HP0S 30S30S t l3l#0Sd `#SX P L0S @90RS  c*N!0S @"\5S2 0\"0C ?o20Qh [ŚX2 0s#p0d p4 02 ? 4:010S=,A!Ϡ\<#P  0A ? 0Sd0S 10qh  0S %t!\5S\P h10S(\TA4 H!0 00 0p 0<&0&0P\7p0p 60pw>0 P0p(2S# *5P *5P *.nVXZ hY 4[ 0SW?관X V. 08  ^40 <\:P$ V( Q3C ?%3PeP 2S|3%8 S20#"20$#20PA 2S@404040$4տ`02P$V20A\2@02 42C`4 `Fb3 0 |2H ? 0`PTT#0\`P`Q=S/0 5P` ( 2RV0 S4S 1c 5*< 53 30S 0 0`20S 0XP3 0 S` V 10S0d"S`` 0Hz2= C0 ,0"t000 00C`r'? `0(" 8r0S10S10S0=S0S pCq000M ` 0L%000X30P%,Y7a *F4 l10S yU0 0j(h(5!h(H!h(k([!k!ph(g(j(!}!j(j(!!! "-"Y"""T"g####"3#T##T#$,h(5$0!kA$f$$$%L9%m%%&h((h(N&w&&&;h(&'j($$%%^%u*&%j(&j(j(h(xh(h(h( 'O'0k(4h(t'j(`h(tj('h('j(Xh(j(j(j(j(j((h(j(j(=S$0S) `0 <<00X3P%0*0 00S 0 00S5 0 >0S sP@a 5*N> 0:#: 5d1} p10S 0 000S$OPa00*p1] 10S ~0 00<cQ/dPPb 0<0*Pd2= p20S ^0 0r0S0L%r0L%r0H00q" P 000cH00STNPc*,3 830S P,P#0 0 00L40q"  400cL00S&Pc*330S (#0 0 0t4 R.0E q\ `PVR d0SPl4d*440S $0 0 0$d0Q,%R0%45 S R! p0040SPHu*X5d50S |%0 0 00u(0S xQ$ W0S0< x (%0Sv4Pu*f 6S60S t0&0 0 08%<5HSR$ ) H00850<SNhPv*86%60S jF&0 0 0v@%D5LSR$  L00@50DS%9Ppw* 770S ;'0 0 07 70Sx(w0S0Sp0L5sl0Sd `d(000 80L50P5?T5V> X5-0$0B0^1 `@R$@@B!!@H0 000L 00*880S )0 0 0d PWt P1RQڨ0QUڜ l0 0S Pi*~9k90S )0 0 00S0 3 I0S0QQ'` :0 0S| |Pdj*Lt:9:0S ~Z*0 0 0 I0S I0S  I0S-(Q\KQK H R0P;0 X E~0 ppVaF !` . R ` I0S72 I0Sb]<Q| I0S yI0S sI0SH  8%L < @%DL<0,5S0SO p t,l000h<0,5<0(5H000/85L0<%0/@5D%4*<<0S ,0 0 0=0S (=0S(4M*D=P=0S 0dmh ,= P: P5= 0S= @FPL Z  q3p@TW.  @?00@1>0A@O@@$P.P\7  N3,@1|>P* ^ P.0;00 0 S 1> >5 > >p >WPppX?  !008 @DT@H4L0d Lc B b"30x`@P Y( 0S  8 H4L0d @ B b"30C60S  6p00_|Pp6@ ጟT6PL ,Y08& 5000(60S 1S /P6  5@ Q JU @ 0`P@@  04 8 <%c#!$c4"t%S T50S \=XP 0 0 f ``0  0 04 8 `0@p 05j(>*C*j(q*O-pM0P8 0̀P0`Ϡ,"  ᵖZ0 Ѝ 0x @Z ЍOĶ ? 嚖P  ? 0@`j(ph(8*C-`P@U (1 U 0P PP0 0T2p`*0 L@D0T@S   ?8 H4Lđ0Ϭd @  Bt b"31 }0S   %0P00`0@T Ѝj(*u*xh(4h(h(j( 0S/A-@p dQ A0\0 a2Pa0 SR P00@00 0` PЍ4h(4r(j(j(@-0P@T@TAd pL `l0̠p `V W @ 0 0 00P@0@00 ЍXk(4h(*p@-XM`P@X . `P @"XЍp 0@-Q0H0@S \00S PC00<@0P00x_ (h(*p*+p@-@8`8P0 .$00Sp p@4h(j(h(0 /hj(\@-^* 0<80@400 01QXh(#+h(4h(%O-\M@pSR D00 00S` P [00CSX \ЍO`T `-0XYH`o`00D0002 000D0@ p | 00@pDP p (0F 0/ `@V @:@ p?00F`F@D0@0+ B\ЍO 4r(I|I\%2R/C-@=MS|QPG PVaPV.10S C10S0 L5as0倀Sp  -0S  00 X0S  -0S  # $ $0 \# 0$$ 48$( <@$ D?>L H$C0 5L5s0P500ߍTF+,h(m+j(h(0 \P/Q/ 0   Lq,PŒPŃ ,TPD40S/8$0G-0DP(4 40S1 40S- T0SC 3`3 30SA=S> vS*3`30S 0P 0ShSXSTs廖P`UU00Q AP 0S ?@?B'囖ᙖ`P"hR0"00S8 lr003Pb0S* x90S* 00RE>0X4*J 2p610S {W0 00SAXP10S A1 PQ`1*X1` H10S N*0 0H10S <A,1 P0*0`00S ,0t 000S 0dP` 0za 0бGͱj(h(j(j(xh(j(h((h(+4h(j(j(h(h(j(k(Xk(++j(j(+th(,j(h(6,,h(4r(P,O-PPMLp8 R<@B0S 0(3 ?P00@TaVa` 0 SQɑY\ 7 \P  ?``  ? v0 +,",2 0Ri Si r0S 3S  !0? 00S  00S`0 S  0`Up!Ϡ0008 L3R 25  B # R#  B ` 0Q" P*0`00S 9` ` `Ѝ 0_S  $  B$ $ R$  B  4h(`h(tj(Tj(k(j(h(U Ph(xh(h(t0A-P`p`ATR 㔒@P<G0S @ *1p0Aj(p,<0 0 1S01/ 0S00/j(`0 5 /H0P 3S P 3S P///4h(^FPO-0(P,p0@4`8 P P0P \ 0 S   0 0 0  0P  0S L0 w0 0 00 0 0 @h(4r(j(Q 0`( "4`#/O-8 0`1 0P0@8Q ЍS@hp8Q Q 00p 0爀ቐp_ a b 0` RP/! 0 P  C1  1  @-|_ _ ,0` xRo/ 10#/C!000P/  @-_ _ ,0` |R  /  /C! C!/! !/  @-y_ _ ,0` |R  /  /C! C!/! !/  @-S_ _ ,O-$5SX @ lPphU0 01X` 0000$p    @R ![ 10<T+EP 1 @C 0ό2 @D R&p@PP U P W@T @ Ѝ \00@0 0S0 B0G-`RMXr@ PPl sP\` `IeP P9 4 .p *0S  ߍ<0H(00,0 00004008004004 04$0D0(0P W[  pUt p*h 4\ 8 `( <e 0e $e e e 0,0e0 e `o( ᦯p 0`?`a8S)Pb   00*P*00n @ 0* ,d@edA,zd@E-,*-,,-!-6-A-@Mp`;@ @p@ݍ P0@0@T00 ## O-M$M`pP`P"NPX1 b: S/,$0P  rR A)00pPP W $UP 0C P"VR V  VC$PN  P P W\1` 0`PIX1: S<V2"rpPUPV9 ᖭPW00``2! 0$ͮ $pPPt P5(0Sx3]`P S R SUp`P-Mp `P`!\1 S R U_Pk`x!|0#jPaY $Pt᪮pUd( F᤮PP _XND% ܍$Ѝ(J  " F F F@00S0`( "4`#/h(G-pX10P0@ʟ 0   X 3#15`05aà121 R0` q 0Ppp!0R00S! q<% 0%# 0!ZXl000Z T00!ǁ8P,04h(Hr(j(-(h(%j(-;h( 00S/h(O-,Mp0댡`P@0V000,Ѝ00 ?U0$p$0 0000 P$0S b?F!00P0   0  r@ A @`P@* D00S 0 0h(4h(j(xh(h(G-p`M0/10SPP@`1@710010000/ 0 0    0P@,P@00 ?U0p15:0 0000 Pp0S 0Ѝ? pp%&` % Xd00 0a'%y0 S    j(.h(h(4h(2.d.j(O-pP,F,6,64M000cVg` rP !共 U 0ş @Q` 50S x:V 1h0!4p `\D0S4!! Q 1  (0 00 00 P( Q- a10! 10  t40SI ):0Q(00 0p00`P(0 R7 $\ P\Q \ ("(P"$("(Q !  F( 000lPn3 4ЍtP`3P0QS? ` (3$3 ,`Q0 C,0(,0h @PX,*?̲00 ,0R.( 000V0A+d2  Q,`` (,0!@JP,!S 0  B `㌑!#@  V8 !!R!' 0S& _9, R*0( $ {000{,0 0  0(Q `@`P0,00~\000$00?8000P$ 0S g4h(‚j(0b |.(h(A..h(.3/ E/^FF^/Lh( j(Hr(H d/%;|/G-PQA a3AS0a M` 1Pr1100`^00 0000P0PU <q@p$yp@YU 0001 0}@P  Ѝ0ATP   0S 8    eP@L/P@04h(‚j(@h(j(E/(h(///h(p@-P0 % .  @Q 0S p# #3 0# #:>0 T0SpP8Pp4h(^F(h(//0R/G-P `$ 0p@V` 0@`` V`@&!D`( G-P`0 4J" Y0000008#8$#48#8Y\dp 0q0! ## ?@Ѝ :^FF^: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- P0U$PP(,`0p4@*^ :^0 *^*X@40P/ Q\/O-@p0P2#U 1!! ` R J` U9# c! SV Q V3  P! I` P09# c SV!Q V3  P 0  P$ ` U 0 Ѝ&06b J g00A-1àQ`P x0x xx 0Sp@@ P` pFQL @$ @PQ0࠱@&0Fb } g0p@-@P40S:a80Sd0d dd 0C800S   0剋00PP80Sp0 0Yb , g002 ,0S/`0@-@0  L6,i0,0080S 0  S 0@YLr(00mb g0,0@-S ,0, ,,A @TP E@B0b  g0O-p-\MPU`@8 U810!@3 @#S41@D2s2@Ds1@DS@D50  00 0P吨 U0#03?Z[[UV㹈@D `0P$005Q (tO0$0 D 0 XR @"<p!8pL0(0$0 0H(0 0 `,0`4  0 4$HP$0 iPH40  (00P 0P3,05S00SUSP3S` 4$`UQU `F0 00<040@00 38p4` <`00HpL`<0@ RS80 0 ,H0 PpT`f@P ,Pd3Qk 0Q 0CQ @O@ $@$\Ѝ0,03p(0?D00T P  HpL`%VW 50, `S24040S@p( D0 0 P  X Z ,2,",Z(H [`ч400 0Q 800800p?(00T 0`RZ@p(0  0 P 80S010!00C800S   0` 0SP THpPL`P@ ԉT@Pn P0xT`V@ !‰P` !T@00P0V0$0DLr(0LBAW1@1b g0J11b NBAW111b 0b  G-0,0S0 P<@`40S*ᇉЍ00qW! 0 W@P   k@Pp0b F g0A-0`c,0@Sl0l hPPpQ H0< D 0P@DT@0b g01a C-0`c,0(PS0 %p@Q |0l x@PEU  0P !  0 P P Ѝ0c q g01s X0sC-@0Ђ D`P 004 0mP 08ЍpLr(j(2X0sC-@0Ђ D`P 004 0RP 0ЍpLr(j(620p@-PQ {`@0P Rp   T0`! /@P 8Y4P㬣/h(Pr(f2Lr(22@-,@P,0S ?00Pr(@-,P ,\  E ЍPr(p@-@PYp0p 0 SX0d0RX c#!$c4"pD006.8 Q#3SRppj(h(4h(27@-0S S2+, R0 ELh `Q tpBPCBaQ* Q( H<5P 4,B 5*< 50d30a3210S . 0 00@ 7.Bp#x3@ Ŝ & 0P xXPA 5*< 50d301$10S 0 0@ d3S+ CQ+aQ# 0AS"|P @0a3d3*|0p00S ̵0 0@S Ѝ08,h(Lr(4h(233xh(h(h(Pr(:3\3t3 @-or O-M`p0@  @bcc 0$0c# ُpPc0S@P7# 00" $qp3$cAtUhUaU bU XP4i0E S00$p$; @" 80 (P 0 @0S ,00#!( `9 P P0V mЍVp FpxP`8 Y pi P`P0V:P0V ZP p90[0T$$0 !' Pp  @0 00$ 0S Z(0,  $ 8 xp B @p0 00$ 0S Z(0,  $ 8 [p @0P* |  P0 Pq 0 ! P4r c 3&$c 33334i4D4G- 0pP@P` V   00000G `00000O-mM0@` P0@004080 0bW, AW- LW% 8?4=cW iW0p `$኎ppH40S 0mߍ8 40H4: S@ @0(00,0000408`0P  P 0 0! CTp .p 0Q=  0! $刡匱@P 0V$0 0/S <<Y`Å`0"< 1P0<0$c`P nP< py yw <墅V@Hآp n/B  < n?n/ C0Pp < !$|$0 @#0P!S( 0pSp`V|p 0S `0S  R  R 0S( m0H $8HP`$pF0pM $ 0pF fp>  T 0S  (, PQ S RPQ8c 4&4zd@4 505^5Q55555O-P-,M@p`$P("Up($0S0$020S'$p P V 00 0P0Ne 0 fP AP PP `QpP$fp,Ѝ`P 0`P , ?o  00 00 ` p 0P)qp p Up`L6&R6h6Lc }6U6G-@pP\!Ἄp`:D10S:  p o09 6X $$ "ip+ P%W00S $$ Yp YPPU `fV rV GTP$$  =p$Y&666 7`c )7 @- or A-@P`pP 4\ XT DD 8 U  AA `c꘩#&=q@- R0Ѝp` P@bP 0 R SR  R $Â!#0BR R P 0:-, P/00#01"$#xc O-@PU \  p U@00P`6 [ `` `7 V `V*!ƌʠ?,͇Q`V*  Q*`V*?!Ì?G-8a8q@ @ 0P^ \ ^0᳀ 0S@ 0S@ 0S@@00\# ?\CTムა :^ *$5@0C6;007;00@R0@U^(PO-`$0P @P 0z'0 0Q P ނ@ Ѝ ᎞PC-P$4 p咓`㓁(`@ 0Q P Ѝ  SP404-0@-  Ѝ Ѝ/-@-00@Ʉ 0 Ѝ@ Ѝ/-@-P 4(  㾟Ѝ Ѝ/ᘩO-MP`@PЍ yPp P 4S T 0\T0Pp$Q$VP 0S 4S $X 4P S $ 2SpH0!!`000  0 0  0 @P 000 00 0 0 P p1 T`嘖&P$(0,p 0p$S4pS ڠ 0x p"  L0 `0p"WPb 00P0SR7^777J7N77p7O-$MХ@pPP? 2R 4S  0᥁$Ѝ0m Q Q0   RSRQ"  "S 0 0000 00  0 PPs4S 0S,  00 000 0 P0P0 <00SS PẐX  , 00`S4S 0$R V P0 RS  0 000P\ H0H 0000 0   H;pFR7U 8&818D8a8k8}8G-PM`4p@P}@C>dtC@ $$0840; Zp+p ὀpp H4$t: S! W B.L p< $4S0 (d,T0.B. ڝp (d,T0"W(d,T0|4$t0dT 0 (d,T  00$0  P0p 044S   0 08p 0P Pp|  0Ppu P P 0" RpP5:Ѝ Y0p["8898d@88d@9949c99@-@P 4B BRP Cp <W4( aЍ@ǛЍd@99@-@Pp P P+4PS 4 :G:l:A- @PP0T p` `Xp0 p::$$ QS40ŲEA8Ѵ#8"( 0 / 0T 00 /$4 0T0 / $4 0T0 /G-`Pp @P0sP8 PP㤐`0`0000U:Ѝ 1000XL0L `oP1040$ fPU ::u#&:C$$0A@-P@-@ t`RdtЍpP CP 4g R 0 0:-:;;O-p!PR0_otM`@R(0S00S "R0 U tЍP PU 0SGQD (0QS@!RS R7"R S R.A 40[ P#  7/p ' 7/p 40 T m0 $8  P P  P %;A-@pP`P 5/p 4 5/p 4 5;C-(00pS4P Ѝ$d@ 0   l 0` 00 ( 0`WP ?;S;;O- 0 0pP~댐@T  aP ZH V` 0 `~@0:-xg ;p@-P `@0 h@Tpxg ;O-P܀$Mp `@0吰     Q o kt0 p ` X0 X p`՚04S0 U Q$Ѝxg u;O-PQ04p@ 00` ЍP P0S* E 0`P      04 p p#p p04pp  ;<<;<0s@-SX`@ PZ0 ?o2R0S Ѝp0:-;@- iR sR aR p` Oz[<p@-P@P (`Pp [p0:-<p@-@T 40`PDPSpp0:-<iR@-- 0 aR bR LR( ?sR% tR@P 0P0S`)00p`(j0 <0:-<p@-M `@P` P00͵000S  ҙЍpu<QG-@MP Q  ЍA~␀ p$I{`Px hB~0 00  0 `PP  a|<<H=O-$MH@`P ,`$ЍPP 0 0 0 $ Y># P0*Q P0 0?Y S0STP pY0 P pE00 PU 0pop $ zP 0000 0 ppP {4  $\ `  0V,S( 0$84 0`p| $Ĕ%{!#,[PP  {T P R*L0Sh 0p_ L004 0 000 0PM 4$$   $ 0$$@p7 9=i=====>00S 0@-C^M E@$$$E0  0&P&Ѝ0 @x("(!ɘ"`#XT 80 @廘P8帘&h (?3?D?V?k??????0$ 8O-DMP`p4 븁1<0!vp 0S& ! R"! DЍLRR a0BSS0H10S 8 G P ( 4@P  E wz@ x谟P 4z T a0 o0@  ! T O0@ @ P@ph ?@&e0:-^0h #&<@A-p`(P@dyP 0p`P @00! 0$0@-@P$0S z@zO-20SK@0SD00h@ DP 0SD0SA \^<40$ 400#9qpp, 804<0P$ 0I,0, P bU@OqU H04 8P3pPTЍ$$0 $(`Vt0Y`0X0 0000 WX0 0 0S$ (0 [ Pz$00(0 00qpp 0 QP Р 0 Zkp , ep p ,  fF&r <\o FFFO-C` ILM$@P0$0d%B|pP50S DjLЍqP sP @0p0$  0dqpp PP`0$0$$IR0P00P 0 00 00h 0N0P(0  0 0(0 040>P 7P 4  0,0$000* & 4PS,00 VU$0SxP0T ᒃ!088 X : U S   0 <0P<0P (, S0 R S ,0, S00,0pU000U0   00R 0 00S[W0[ 4SX 4SU $0S$s 4pW4 4` P 4\ "$`0 0S 004 Q $ 0$ R40H L;p 401ST> 0S 0` 0T 00S!Q `$NP$ a@ P PTpT T 0!$ЍP`o I&o G p@-M(@,`6#,P X0T P00͵00l0S f "ЍpugI@-WM M`p@T4 &Wލ Ѝ0S@ PF 0$$ 0$$ 0xI 0DxP x x# 02tm0 $8 XT#D^pIII.?pYIJGKsKI@-0@ n 00 0 0Ѝ1@-Ma qP@Pf0Ѝ@׎0 ӎю` pǎЍÎ t!80pp`\X0 0 $宎<嬎 P @08 0@TS- Q嘎 $m0 8 0 0 pp1S1SxЍ@r2\Q\ TЍ@go IId6IIIIJJ8JJI(Jx6I,JuP `00CS`0p S00 P0S X0X /X⏏#&A-MMP"` 3" /j2rp@TݍЍ   `Vk 8  ! `"0"0BBP M0S91!BBB$ ! @|<#ⳡP%$ !L<#ɍ sm0 $8$忍 彍# bR@B對 0B姍复   H0S 0CS 0L 80L卍 OJ9UJnJgJuJpY{Jr(JJJu<&KRKIA-0hMp@ P` @!H"Fxp420SP=+ lP`P a@ PuP xP RЍ@@ dp@@@0S00` P 0S0S \^ 0 Q   <0pp`V    Q p   `4Ռo K&Ko OJ9UJnJgJKp@-HM@P`4 ' n 1D0!wp T  <P 00S  0%iR TR LR a0BST plRs0BL~HЍpT pr KK&|o G  !@-0$M\q` 0 0@P!!P !0xpx ?P !0xtx ?P "|?P "h?P #T?P m0 $80S aP p ?P@'0T ᨸk00Ѝ0:-O&r Or P)Pu^r +XLP5P@PMPp\PePpP}PPPPd6PPPPr 3QQ#Q Qr q h#&O-@-ZM`p*7sp t:0S dЍO[0FS iS@:PC>`C$nP X Ѝ`P[P X00 9PP 4PV0P 4 PPj 00pP0W0000\0S 00 0(0QWP 8MW0P,0 *`PP b`P b$hPP0z4 >P 4`P `P @ <Pv H <Pp @0 SD00H0 RL0( 0PB` 0qp(  R$4,, 0qp 0`. l$4P `$$a$4P`V V`P' tVP# LZd&XVP _0P$0 $b`P$b &? ` 0qpsp <Pt9p o  <P   <P  <P  t x<P   q<P  @ j<P q( c<P   \<P q/  Z<P r S<P 01S [r/s?p'(Ѳ Ѱ  ><P s/t 7<P{$$Ễ$4P,_P a`P  a$$0` qpS/ p0l< =Pl <pP < ,A< =P\ <P ;PQ  ;PK < ;PE (< c=P <$ 8 ;P5 8 Z* 0 k$ Bp $ KP$4`  0qp`$ 5Y$ v, 800(0 000K(040P08\ p$,` 0$00P00T0  X0`$$Lqpx$$$4P0H00L0p`$4'#`.qpm$$܃$4P`CQ&s 0:-GQxE8Q]Q)PP~QQPQ3PQ#QQQpr qQ!RGR9Rd6+PUYRXL5P@PMP\PePpP}PPPPR rRRRR0@-M@ P  ᴛ  Qp@ @f8 'p(^0Ѝ0s !S'i-S@-SM@P, 0H0P0X0`0h0p0x00 00T 0 0\ 0$ 0d l 04 t0`@pt 0 \00 DL`|`p D Sߍi@=SiIS!iUS@-@  p  0`( "4`#Ѝ10S/!p@-MPM@P% PA. (01P A!:Ax܄P 0`0?oS c` 06P ``,DŽ0 0A. 00P0xP A  A⯄v娄0 0A. 00Pl0YP AX XA\␄000H 04兄ލЍpgs(x(uaSjSqS~SSSs@-6PP qP j "@`TЍp/P  00SUV  @&s Sfb0 R !O-M@ Pxpp"2`P"   {SP- 7WSP:SpP +Wp|SP $W `9P 0"h 0R00  p!  8Pr 0SohQl @ ᥃pal V! R R RZ  0PW l Z ` 㹮X (s<㰮W 0j0S, @ hoP@ `ipd HQ L 40R !KF01Sp0S 3/p\ U 8 XJp \ [ 5@ `=p Ѝ0s !SSXSSSp.TSTDTA-p}R@P@RPPRP^`P "TS P ESP]@A^T @- R:P ЍA-MP p8@P00p`ЍpP  Z4 ؂p !0 :Si@-@p @A-P`RpP00VP@?0V  FIA-P`xRpP00UP@:?0U z F+@- $"8Pi00 Ѝp@-8M@ P8P1!"?RP U0 Q0s0S00CUPP  R@O\Dt Y  +U< PiR`8\V8ЍpKT@s TTTi@-BMM@  1p 0S 7  /  (0定(@0S700$0/ (d 0堚(@0S BލЍ<,@ $y@iTTTp@-Mt`QPP $UP@ T0T TV%U  4 p ЍpTTMs TTiU@-M@  V pЍi@-M @D7P0 CU p  1Q0r R08C88 1p`ЍKU8t RUiis@-`P p@@@ 7P0 C@Pl㚬OT P@ L㑬DQP 4  dЍpUCt RUUUSU7@- P@?pX XqP Q P@00 <<0400[Q@ Ѝ0Rt SUURUSX7@- P@p` `J0L=DP P40 002Q@ Ѝ0at SSSURUp@-M`PPP00Ѝp-TP@UxJa@PdP0 -p@8 P@ PP c$^U V&Vi=V@-$MpPP00$ЍS`a@Pp d0 pPҫHP P`@ p$̫Oc[JV_VixV@-B嶀 ЍunV@-000 0  Plp ``@P㝫| ` @[pl 0 PR00bS E c~U =|Pxi VVVps@-@`2PP  5p$ gn0}Vp@-` MP@OP oS ЍpX %   R  P5P@ZDZvi 0@-,M@ P5P0  p,Ѝ0 0R0s0S 0 $0RPP 0 O@YDVpt fRUZp@-P1hp@@@OPH0H HHbRQ P$۪_bpUzt RUU@- P@15Py00Ѝ  p  ?_Vt p@- W@-MX @5PD0D DD 0< 0{ p$_ЍV t RUi?W@-MX @4PD0D DD0< 0Z p$^Ѝ" t RUiMW-M0( 00D P bЍi=V@-@0N P$0$ $$ KO@UUt RUS00@ P/a CRWC/A CR=C/@-00@- M@ 0, 0 p" ЍixVP@-M `@ @j {< <G  Ѝ  =?unXWdW@-@MPP mqpL`P`j0 P000t0@`Vm`Z` X0h@ @@@@P0D xXM|03/`t uW%uiWoWW#&8X//// 0L0L0/% 0T0T0/% 0\0\0/% 0D0D0/% 0d00d0/%p@-@pP '00p00D S 0A0CS0$P>P 0@p%@-p0s( 0`P/ R/%O-0 4M@@ !T 20( D}ďp6 P(0$`!pSp D@T PoS@ڐAP`@ UptpP`[T000 [  { R  P Q R. 0S $P\(P  1/ P $|@0S O}p "SR(0 SPŨ\ 2/P W0s(Yɚ;6efbYO-MMPp  U p`%㢨  IpP$ 0Y000$ -} ˓ I}p] ⾓t <}p Q To} @*} K p$(Q ^}$_X@T ▓X00@0 0}PE}L 0I @0~ ,0@4@|p 0c]0Pd0o 0P 40,@|p<e 44}_(H0S !P31}H0S;I0S8Z`@T 0 3/@: " ]M0S:00!  l"QM0S T|5@8|-@03/@t J I0J/|NpI0!S㻧a`"%J` 1 0 d1 T|p 1 d\!1 H|D`#%Jp!1 @ t1 x!|1  0|P@Th 03/@0 3/ݍЍt !SYYbZioZ~iZZZ%iF[iZ[t[[s(8t [Z9['[iH`Y?& [[[[[[O-@PpP  p 0T K@KPT!:KX `P `PTU D1O0S {UU yW P.Z  P'  3P! K0S 0 L0S 0M0S 0 N0SO0`S PPV { Vt [fbs(h#&@-,MP@xpP OK`P(  pU0S h㠦P 0P00@ @㔦0, ㆦ,ЍS_x(8i(_0~ )_F_@-P@=0P rX_G-@KPP0 `@ Y㔀|NpnNPP  ᫎppP  H@@@]@p_j! C~ 2z_x(Fs@-@{J@P00ЍpHNP:NŘ@P <` 嫎P]u _x(^s@-@QJ@P0 NPN᜘@P T` 傎Py]u( iЍp`j! P~ z_x(^A-@"zJPP0 S`@MpMjPP 7pD >FJN@j! \~ z_x(_@-@d 0PP0P PP L 0 S@@00 >00Ѝ_e~ z_x(#&_0@-M@JPJP JPtJP d0P P P P< P>p$\Ѝ0`_p_x(7i!`7@-@(dJz HP HBzDPV P! (8z Ѝ03z@p.`7`A-M`@PK bppP"(  ~  U yp% (p( pl"x <@T h8Py`2PPy RU TЍ0 P U;,[@P٤ $@yp 卌yu 0R yl)zy xy` pPpQyp R%PPy fymIP;ЍA'\Q\ 0Q    1 0PyP0 RS>{yyy$ 2y0` R P U 0pD` PSH !S8i(iD`T`t~ ^`e`U_y`X Yu~ ```Pp@-P`@0HP V   Pf!>X5T (X( R R["00XZP 000 Ps0"CQn BQj Qf4!<5^ XppWPPX Ჰ  Z$P KXJp"ZWF  0 Ep? 0STt 1PPX!0兢8!100#R0S +0m8\@pG 0 YP@T 0CS0 0 xC0X0^ :T 0CS00wRxC 0 aD\W@DAD\ 7@D@S @00@D@ T030ZI@YTh l& GPPU8 @ 0 0 0`0% aЀ aUUA-X Pp@`UP0040P 0 p 0 `P0O-$M`@ HpPAX) P W0  Pzp` 0p0   000$@p`PT20Q 00S   KP  FP@0-S ;P(Q Q  0R00EP EPJ P  077 R0 0 p 4000 p0,40 Ȁ /aA-`p$P@gWP0`0 0P@܀ A-`p@PTWP0` P@ A-@p`PPPU00SPoXV0PPP ! P0000SPVXA-`(pPW@P @00 0  0pPm-mpp@- M@P` tQ4P aPp@@M Ѝpi f@- 8@#P(0( (j Ѝf ~c@- 8@"P(0( (T Ѝe' ~c0@-MMP "\m@PۍЍ0@CM P P+kP@4MۍЍ0@l0S0S1iSf9f@- P@"P@0@ @@ Ixp$㊘Ѝe3 A~cHf@- P@"P@0@ @M Zp lЍ = ~cdfO-MM`@ 4P04 lP7EgE/PF7U$0'S`@0 00 `F@( 0R tP~ 0S0'V 0l90h90d9 0`9 0X90T90P P9!m(@!0! P g0 /C BRZ  0  00=C$0Cȟ"!0``F ^v `㬈E0080IcCP S@BAp (80`P0p l!0h@"0(0(0SD l0$ P0B'S$0؍Ѝ 0 0'S   BS>C0C'S Q:dǟ "!! CR  ##9C0C"!% <'Sǟ"!2.Bǟ>C"" Ɵ"!/B Q 0*Sy S &S  2S% Sq 0S R )Sj&0C'S000S 0 t6Ht0 @Sl0( 0 B@( R &SBlpX>k 0R 00lp0S 'l0S 0 l00C!pᩐYP0  @P lp <l0S $ZA 04 8 <$S5k0S 0kf k 0pW&q0,00Jp [p4#,003c10S1ׇ!Dk~Z,0Sb $ ~] ,0,pG k3    #P# P# ß P# kKt#S0S  k0S,  h|k'SPvk0S <pk84 p0W W"    0pYk WLSk0S 0lKk PDkp 0DtX0  0J ,0[P2, p0'"R 1 !f ,,H k1    !P! P! P! pkhK  IS !Sxtplhd`\XTPLH <iDgg gggd_ggx(g`s( $p x ggffpbc$uggggghhPhhhffP$hhffPX (:@P 1i@P @@ @$@g1 0@ɠ<Qit4 ļP @ XHpЍp@aPS00!0310@- Mx 0 L@P \ ILPP @ , 0@@LP 020Ѝ0舒%Dy(U@-\0 @(yi   riIfk#&kzlP@-d0 !X !T@0 60\ (0000/g | Ph0@-d`  !TD0 60\ ,00 00/g | P-P040#^4<\$0000/g | PD0 40#\00Q 00/00g | P-H 0:# ^4 0Q$0000/g | P-H 09# ^4 0Q$0000/g | P 4 <# \,4Q00/00g | P@- 0:# ^ 0Q0P@d0 :0# TDH#^<0\ ,00$00g | mm $0@- 00eP ЍP%%A-P@p`WЍ lP f3M@P p7@-0P@U , ~J Ѝ0}mA-@0nS0oS@p p}P`\OJPI0nS0oSGKPPBKPP'@-0 gdn#&O-M MPPea0SQ xU'`d0SJ P\d&` %d&P %d0S;4!0 P0  P00@P  0S Z P@dލЍO 0 0S 00S U0`  0d0P 0` pUd `0ލЍOd+oԇ l un>oSopPy(aosoo~nopp@-PQ@@pQ(0opYP0p0z(PA- 0nS0oS0  :@P0DtCP,WpWDPP`8CFp@,@P@0z(qU@- daq#&O-@M pP"P0PD0@"` P0," Op/2 00CS20%|000& 0|0`P0 +0000 0p00*0 &0Z cpHh rPdPMP UP4 GP 01e@ P 00 0 00 0< 0~x`|P 00 0 xP㿎w 00 0< 0ft[,0t0Z00x0V 0;;0|0Ѝ(:-0:-&KrR" @r-BMMI^@0 P@M00d  0bpL0 ノ0 0/  0~[`WZr 7@-P @D0Lo SϜ 0 V Ѝ0r@-@6;0P @‚@-@<0P @轧@- @C0S 00S0?  *Ѝrp@-@P?P0 $0/Sp$ p@$rrs@- c`"s#&O-`@ Pp(,夐h렰0 0000 Mp0@DTq oPX0 /wP@ w9 O4&0:-(:-O @r@-M@A> 0@0D00 p0apn0S SH geG 00,0 0㣍1`GsXsnssp@-@PᴢP0 㙍0/Sp$ p@$rrs@- 6c `"s#&O-`@ Pp(,夐렰0 0000 LMp0@DTq oPX0 vP@Wv9 O4&0:-(:-Op @r@-M@A> 0@0D00 p01ap0S SH F 00,0 0_GsXsnssp@-@P)P0 0/Sp|# p@x#rrs@-_#&sG-` $p嬐0@P0 Lp00@DT oPl0 %vPT،v  Z_A+$G0:-O&P @r-MM0An @H 0P ,0@`p 㬌3_!Wsp@-@PṡP0 㞌0/Sp # p@#rrs@- ;b_s#&O-PM@ P0dr`T"SLp)@20 R. +x   &  x `!p0 *00)0 &0_ `pM FuPfPMP- 9P GP p1g@PUP|0 0|00|0|00|00|00pt`x 0PuPAuxPZ,0p0Y00t0V 0;;0x0Uz@$\$00|00|000Ѝ0:-`t&R"` p @r-MMJNP0 @PG00 0_pl0 0 0N/0 4 @{000@0`3^VZr rt7@-P @MA0Lo SϜ 0 ㋋ Ѝ0r@-@k80P @‚@-@90P @轧@- @A0S 00S0?  _Ѝrp@-@PtP0 Y0/Sp! p@!rrs@-At@-40 0000,00(00$$0 `]u+uHuuut#&7@-P @@00PS\ 0  Ѝ0up@-@ \0P u0(p}PP,P]p@B8z(qO-@H p0T0H $$e$% Jp50pGWQ. 42@FP40S 4 40S4 0<007a0:8l$0000000Dv09@0;glPO04P 0Ic08(0@0080 sPP0       +  @   ' B 0# R$#  # R" , @ ( "  )            .s20  &s000$0 \s000 0 8s080$0 s0:0<0 r0:080 r090@0 r000,0 r000000"s0909R41r00$00 0 0t00,w00 x00007000+ 4  Ѝ%h%0:- v& d{(\{(h{( @r*`{( uuuuuuvl%C-RMMIN@XPpD`00EL p`댑Hp$L0n]p 0KS 04  RP0 #0/Sp p@rrs 0`( "4`#/ p@-4"4 04"4 04"4 04"4@0P'( $0 $( XXddhhllppttp p@-4"4 04"4P0@ DDڳ@@ԳHHγL`LPPTTX~X\{ \`@p` p< p@7p@-`"Q@Upf@p@-@PᡳឳᛳᘳpA-P@M4Q->Cታ->?n}C@X=X\:\79>v9>:>Cq:>CFm 0? AC>dC>mG_F\E~EnFWGT 0X J~pXV}m  $$((,S>,/S>G+F(HHLLPPTTXX\\O-@P`Pp !4"4!14"41  $$((,,00WС\5 S L5sT`0$ $ 0Q`V,zTvT`XrX\n\`k`dhdhehplalp^pt[txXxᘲ0[ O`LIpp$5S\5 Sp`0SP%@ Sز ,*%TU 0`( "4`#/+0P0 C@ /p@-@R0 M4 @8 P#` 1R  0  ?<#΋ 0 `x 0Ͳ`0 C c00 d0`c Ca c0b0 0  0x  ᯲\41P0p$Ss $$TGQT`P@Ul 00 ЍO cSt hhȀѮ XȐPʮUP,E(|(U  TTt0p@-`0S[\ @L00S000000B0E0p(p%|0P000/000/B10B1/101/ T4 7#&O-pPUM  dϠ 0@Ì `0 150S  C0 R0S@`Ѝ 0 R` ` 42 b< RV1QV RQQ R  $%R /  l!. 000 0P0C030S30 0C0 0003#0 3#00030SQd  0@ `?40 ST0T00  B 0Pu SX0000W0,d00? 0 0@ `4? 0댠 ,1#  0! ?0 00C000 rS! 4A8 0 B0 080$ 0C  $$ 0$080Ϧ0C40040 08 ROʌ10S  a dϠ 0@Ì `0 1%ÀQ,  "C^C C!( "^ !S 080@o0T0@` !  R` _P/  1> ( (|(U U8 p%{#&O-MMO⾟D`, >%5_Q0uPSi`50R*Rx%?D0Shh,/nD ?0?D4hPp؍ߍ 2@ŒD 0L 04;20d04 0{0  00@4T@:T @:T @9T @ 9T @8T @8T@@048#807Rp0 0` 40S7{ 3 0 000p0  8`  Z X &0Z``a 0,oF Ϡ\ß ^/F022292?"""0Pa 2@őD L 00 /4;2QdQ 0"d00 0 o 0p,2 0r 0` 0W8 IQp`xSi`10Q 80pW:,0 0 0 Nt{(((((ڮ\4 P@P`P} P@ 4 spP3 Efp@ `3T@  76SP@ *b ,6P (Y`0S0,5 Sx0<0(5002 0,%S0022Q04PT 0QPLtrt" 0 04 0A TP> 040A 4P5 0 4QP, 00 Q*P# 00Q(P 004 QP1 @00T00D-\3SB1\Cp啍WXpX1X0SHoP X0SS0$50 40bH00aL00BϠ850A<ŀϠ@5Dŀ0\P00\T0R380^S`R001AP @4pU0 R\0 a $((t%x%…((Eqʆ(x(0H(Tۇ((p%T(|%((( Q2! dS,QS18$Q<4R:|O @0\5 ?>C0P4p3x00084$0%<0D0t@000匐XL5P5|G   ?8`F ?   ?݌ pm8 PEpG0!/0 p!"0 p4%p8$``05<4Rp`O!11 8400$0$ 0<pS_Px8S @`@0 ?@`0QPP* ?@P`(6#R0:`@0- 00 0$50SQ 0PӘ&"P0 ?00 1>00S`0 c2#, SZ QZ3 ?00 1>!00   B^B0Pp0/2"0$ 0$ ?Wp1Wp#T0p10G 0&K ?   0PPB@TP`P¬ 嘀 00B1  B1 R ` U"B !!0 R0CQE0E ?P0 p᛬똀 0 1 B0S0`0US0  B110S N/e @P`x1 0G<Ĕ84CP0Sp84<Ą-0$5BPSQɑ,pRB@L0 0 000060S|0p ?4HL4P0@0 6@ᷭp9' MK@00 Q<>yD7\5?>C0P奁%4tx0]p7(T0#2! a, A3 31  0L@`0 04 p  0H$4  $ ( B, @%LV.  R*h ((E < 4(r X @( \ H( ?.@Xt@+@B@A.@B,-8 Hup @40 pK ,p8d A YZQ  Z0 {X R A/  pW <$?.t{4Ąß  Rï80\@$D04 0H4( 0Āp@2 R 5#< 5$23dr0S+|됺 zz000d0S CQ c6Rc,`P 'z'z {'+SiM @ z0犸 08z'(yȊ (+Sl,WM 00 SP0\h!P !0@ 1@嗬0 pQ0& 0Sb@ R#M QP0 뀠@t9 0J0jF 0j`K$00S>(^F$_( (#&ht@h#&(G̈kITx(U uTe(t{(n(p%|((8 ( h00S<  0 (#1 (0+ V.w|00S  S 0=S,0S10$0(1H@0p  kLPP04SP0 0R0 S00C0> S< 0,00P0lA 0,0S8 p开8嘥ȿ+" < Q \%`R 0  ᐡ, @400(0 0 @DU@, 4Aw<2, R40@ `0```0T01(tb 0 p ` I20 P$5"S`0 9pR8<00 t x00Sx0x 0\0  1`0  B1$%Rh# R0C00h0$l`0 R#00B1d0 R*%됃U` p 0 0 0 (0 0C0 (0(0 S 4`R` | $%R l 0! `04 p  R2d 4RT T  4P%QXԐ R, d0 0   ,   8 @ zi`Q 㫈H0+:H, fP+H 㛈H0c0S ,00C."\ ^  00 0?d 2 B< b10 X&J$01=S,00CU .i010T0010X0 00&S\0?0  0  B  R\ ?0  ` 00C 0  80 C  0C1448000C ST0C0@ ph`l48 QT* B!44 T: $5Sl0h @0 pp^:S $%S0! !H`$p$p(0W0x0S ,4 I d,04  0,4 $& 00`  Vjh0S   0帀0 Xx0#`8y X\H># P 0?d @ `0 <k 9\%R i0SP Q``ƌ` $$S $:`R` $%Rl 0! ` p   R2dዾ :RT T  :P%QXԐ R( d0 0   ( `  8 @  t;R` /  `@$  $ ppS $S00S@0P뀐 HF  00@8p`0x(1pYU0I@X!@@000T: 5@$\ Q 0@08(0  (0d0O@N 0NC n 0p 10SD=0S0 000S.HI08CxM = R0ł."\5S 00 0 d 0/ @. `3,0 0$ bI0000P0S 0,00C0S0 X>0S lLI0S I>0S 0X H00@P:*0ENP>0SN`E C>`>0S303040404 0#pCVW*D tV.P\oV.GVo0S ?0 PS?\5=S,[??^ E?0 0S 04 ] dLĒH 0@Ì `04 1,$0S0S 04 E d ,04 0bH 04]H)ݍЍSmfG-`RMXr@ sPPl sP\` `qP P9 4 VHp >0S   (ߍ<0H(00,0 00004008004004 04$0D0(0P ;"W[  ,HpUt &Hp*h \s\ 8 ` < 0 $   0,00  ` Gp 0`?`a8SQdPb   00*P*00_ h 0* ,d@edA,zd@E-,*-,,-!-6-A-@Mp`;@ @bp@ݍ P0@0@8FT00 ## p@-@PP0 r0/Sp:  p@6 rrsR/G-P `$ 0pႥ@V` 0{@`` V`@&!D`( G-P`0 4J Y0000008#8$#48#8Y\dp 0q0! ## ?@Ѝ :^FF^: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- P0U$PP(,`0p4@*^ :^0 *^*X@O-4MX00\0p0`P`0 ,0Y, 0S P 0 qmS2aSMS ASB0Cd0b0CX S0SSU0@0T 0DS d9R$ 0 }"P T 8 0U$UQUDT P 0 sS@ @ @U00 @@@ X 0x0  Pq0S00 000 040 P4Ѝ3zRz uzzz@-( $1GD랉#&d{ @-0 @    0G-@vP| ľlPE`0 00000BoH0UB?E ᴀ8((P0  /PPP\!1cQ\\/p@-TPL`(FV@ d0 P 6V0@ \0<@p8(0P  C @-p co`/ᴜ 4s@-PL@` 008%V  @pЍp(8( Os@-PX00SL0@`ă5#000<f%V @pЍp ((8( nh10 PS/C-@PQM@MP`6`@f$a 1 P0p9 0 T:@6S0O@ mD6 DۍЍC+ 0P \ 010 S a8!#4a4# 0^ ;0PT᮹ 0+ۍЍ (8(((((Ĝ G-@B`p %PP$"$Gp 0F04( 0 06# R 0 !1p0 60 0 ! p0006&0>06 0  B 00C0( 6V0:!$``Vp 0آ0$&? Т0(0 6 C c0&0 $&?Ṣ0`L0SV&% Ꮍ0: S &0 d ЍGR'< (({8( ۊ%A-Xa00S FT:p$PP  0 0 A1S0S&' P @D A01 S o0S @2106&0&0& 00C00&101 00C 008( O-CM`(HPC?O8fK  0 Q 3pcQ010!$0  ᒩ , 0UC, 00 40 ,0,00 4P L Q 0  0 p$ F0(- v   00 0 6׷< 0(0,, $(200UH,0000@ P  D`0 0H\ d04LP6CB 0T0,<<05X"<0S,i( X! <PU ᧶P]  ᣧL 0R V0400& \p# @ \  110B0f0F&am0PeeC0CP!Pp\p :H#P 0   v0`Z0C `$00SGj 0 00S ,!*&A P7 h( B* 0 (p "*B 6 !"0H& 00 4:,P(pD ZH&10S^9 R0J0mL  X&' d  rP &X p \ ,p0&s0&$0#0  0vSsp0C 0 0 V0( " B("( 0&`  0rT BRP(0 x0Sw 0Sv00|8|@ p BPPYP 0R SIq So ፶`P0S }p7L R d0 P# 0pDu'4oru+Uۺ&0#պ 0H&哥*6 B6  [ 02봦 s6w0CU 00C0CS : B^87! S/~0S0  C02#&0zAx`0 00 Z:0ZG:u3006`  0(01 0 0 KU2  060 5&̵(6ZC:,0USL0S d0 JP V840S X-P6! !!0!!!0 SH$$0 ᓲ" 匎$0 0d$&S: 060& 0u0. AH 0X5#(0004 >AY0SMf`F`VI 30SA -AX @3PUCL0S \08`0 0~  PP1j P#wT36@6l0H0p0t0x0j@086309Pp`$@k ~` @g jJ26@H0p0t0x0@@f&1 #?1# 0RP*d T"<y 0 lP0$PPP"g v0 `P!]  P 6 !T!PU:< U+:0U: #0  #0 h℀%L0S^`U,!%$%7*p0SL:Wb: 0 6 P(8(5(](ߋ %%D(( (S%QN(0(ƌ(ތ(= (t$ #&ht@h#&kIueA n8h4 ܎6%A%C `%(8((d 00P Wh %h%*  㓠 p001p1Pp0  !;P `U&0 6`0U/0 h hGL0S `0 T1 #'$/%d16?tgH0p0t0x0l.?&08020lP :1 `p2& 0h?Df0?o2UD+uC&0#=6` c2Hdz H0 HD?CߍXGG-`RMXr@ jPPl ^jP\` `4P P9 4 ?p 0S  ߍ<0H(00,0 00004008004004 04$0D0(0P W[  >pUt >p*h j\ 8 `~ <w 0 $   0,00  `Z >p 0`?`a8S[Pb   00*P*00YV + 0* ,d@edA,zd@E-,*-,,-!-6-A-@Mp`;@ @Yp@ݍ P0@0@<T00 ## @-`pD  @P<00S0?0\ 0S 0 uiS\F\GL0 \ gL0 SDKT ЍE%KUJ%FZO%A_0 ꇏL @-޷HH@P @>88]0 , P>U@;뫏ȝ #&֏A-p`P@P V 0 i뇏G-`RMXr@ giPPl  iP\` `P P9 4 =p 0S  {ߍ<0H(00,0 00004008004004 04$0D0(0P W[  =pUt =p*h h\c  8 `) <" 0T $P L H 0,0B0 > ` <=p 0`?`a8SڿYPb   00*P*00U ֡ 0* ,d@edA,zd@E-,*-,,-!-6-A-@Mp`;@ @mXp@ݍ P0@0@;T00 ## -0<\   RS  0 S*&0 /ᄊ)Q@-$ Q:7IO-@-MMh Võ0d00h00X00|00p000 0\0$0l0(0t02000040<080H030<004P04040F00G00H0040P0050<0p 0S00|0000000S00\?00H R00S <:t0S Pt/|0p 0l0- Sd0h 0>0i/:pD |0@ Sp0@0D :P pD 0@/q_@P\#:pD ?<P (Tl0S 1 : S  R 5   -`P`0z W`r`Foobr PV   P  @DPH 3}pTrd0h 0 0d 0Dh0唫d0h QP  h0@ Fℴ0S@040x0 0P0T0@0`0,000$0 T0R0 T0R@00@00S@0S100 S0P00RS 00R0 R0S0P0z /ua+a`0P00 pR  W 000QW 0`S`SV Z T @0S T0S2|0p 0/>0D0 p| 萝쀝pcT* ppv @@0S ?X01?0#*@0bph T0S*Yp_ TpZdh 0㠮[J U  U* >05[R[:\0Sd `!0SV PX` VU \0 0` V pI`DP0 $  0  , ` $ ( @ , T 0 P < @ x @ D04 0p`D:pe 2"okk`0dkp?rp0ok|0k`p0 ደ`V`Q`V\xDU" U U X: U0S <(0S P0S0 0PPRD0(0 0S0S  T*,0 U00S,00,0<0S$ < 0C|<0S*h t<0#SPn< $0R0$00S S \H0S H 0CH000 ,0R0,00 0S0`0 0R0 0R400 40R000X0S /X0PL08& 9 (X0PL0 L8pLm:0P!* R0r4b k 00W 0S(dR0Lz800S0U00Q$`80V`X5[P0Ah,00pSR<Xg'E][ pUp W,0SJ0pD[PPd  ?:P U40S 58 R 0 S%PX0L000080 U $0S8`|80$04 8 R Q R8` 40`0S|4V8040 4 R Q R  R V R ```$0S PI  PP3P0!01$0,0Aڭ[0U  ѭ%1 0$00pA`0[ U U 0s#ḭ0 0 U0#"2 U Z* U 0S:<$0V,  U ,0S<,0ꋰ $00p 0S !0 3 Z5s:0%q!  p J0  . Uha U\abV10A0 ] 0S0 0@r"0p 0 0  ,0 ז @JD 0Y 1!XV;Xƒ ڒ ~p~*&Fg;d+Guؓ;i>]f?/5Xun,:V^fowzSX#&)gfff\ URRaArrAa U0 U00Q*H [00R H 0 U0 U00 `Q!A 1 Q",0R0D l8`0SP0S00`0 Ux00x0P0 0S !3# U U00 Y00 00 0 0E8000$0 >8,0S 88Z  38`$08 0S 4*8P0T @H%8Y T  8 0Sx p8t8l02~3p%`P blt7&>C!3 0 S0|0| 0$02#dl0 U00l 00 00H0 l30R8 00R000\0\0S0 U0@0$0Q #   t  00 4Q0tp0H0( S (40S (0dH߫H0 0d(0lC8p$00X0S& U!0( R030"S 0R<00d h0!80< S 5p P < L *(0<0 ɯ(0S U0( R00S~ $4 0$00000,00#40*40`00 01@01T01 UP0 @ 0 0$00(0x0,040303)00000 0$ 2?@1c4 04v 08#$0 #(#< 0&0 6 =Q p0QX0S0000to00 0 R  PpT 㗯'? D 4p_ P^ ( DH74 R ( 4R  R 0( S7071011l0( $R030#R03S 0$ |CQ`000S  0! UQ0R0( lR00S \I(0 00 25 010 0P B24 01(00(0S  PP 0`( "4`#/   k B* {S@--e A 8 /eAD00@- 44@4P\P 0B"" ꈊ)-@=B')@-ï 637#&G-@P ` 劮!>0mP V0 0  PP GcpP`05%X 0`0S < `0 ᥮V ꈊ)4:-ܘs@-@lP 0  2X X0Ty5LЍp P `2$ 0h5ꈊ)p)@- 04$#$04IQ   5 Ѝo@-$MP p W @1 @00 !0 05))51 l52`APP52@}5TV@D:$Ѝs5]x`p@-0M4AP`   0 0 010R  4   "!0Ѝp@F5R  $   "!R 0S1$#$ 0("( 18#! 0Ѝp@50Ѝp舊)ߙ  @-:3p `밋)P@- 0 R * 0 #  @0ꨖ)P `00CS`0p S00 P0S X0X /X.6#&p@-`ቮ@8!RP#<10<10 .810CS81V <1S 0<1p0 hd`0bPp <10C<1(0 810S81ꈊ) %h#&#&ȋ)0@-@-4MT 4A`4d4hQ 4`"R d2RK|4 84d2SA |= hk0:P{PSP1A k> * +['Hk;[E{7  (+S PPP O4 0 @@zj{ k[@  k[+S544Ѝ00B:|k{{'*k[+S'4@@?-C6?Y@))<Uk| %)0)p@-Lj0d2SË1눊)@0@-0S0@d2S6`2"R2 %)@-@ 081  00t1 t t*   <(8(DM*0C @/K+ C | 0#-S<888xS`S?S DSg .@ Y 4 , 0BK+ 600CS00 M)a0CS00   ⍤PK 0@P: 0@09  x90Sl90 0K )K = 4  gPK 0 $ PK. @0 K  ܢ  JPK P 0K. 80  ¢l  0@Puww D80S7  ⪢  P]7<07807407007,07(07$07 0707070707 0707070'7/ z  `P-K PP 70Sh'0 0C!0R3 H70S0S K  @PPPh `MpJt0@Pp&  p@thP@@0X"T  0T\  |pW ppS  0QSL0Q 0P@k0D` X\ X0D S@0S2 @DU1 PP PPK 0P@0 K. C/K>l%l 0 (.줟D@@pP @ XHl 0S$0 0C!0R3 0S0S 0`03P `0-P c=0 ,C0 0 S;.0l0 .+ e0  d0d0@4 HS p 1 01 Q 1 \R \@?p@1cFD0X(H`p3 R  .  Z   tY   \0T0S4 D00D0. L0 SH00H0H P0S  ,  ⚢P0S* | 5 h  ∢PcݍЍ 8  $  uPPA0S, P   aP   TP ڠ  HPP@d0S\X000+ őr<4P|4 HH*8*ؖ**#&©.   *D%Xҩ3c*;]qҪ.W˫/8)JԖ**gfffKNi^^ wD(N^NȬͬӬ@0@-0iS03S !8HP*됖*8* @-@hho` 00 P @4 0   >P*CKS\Q*@-`0@Px0 B0PU1 S2P T0p0S 0@ S<<4, 0pt- Ѝ@%Ԗ**eh#&jC-PD1`0B8! Y!tMR!p@  10S P- tЍ000iS00S 00S  d `P%,W @ 0 i P LP000 p 0p3 W@000@%Ԗ**th#&**D%`0@- B@T0@T0@1 S2 0P   0S @%Ԗ*G-lQ0S ``N @P 0S 48C4a4qP0 0@0C!R! 1S1 5Y TpЀؐP` U0(@P 0E!0R30S u | X,0S2 @TP`/00 $ @ꠖ*h#&Ж*Ԗ*Ȗ**P*O-0B$0 pQ0US P`P PP"/ @P0 D  0S= 0S: P05"  UE  (; V S 0S00V0C?o20SP@Yt PP`30S  &,x#0ES0000D30S ЍYK 0 X@00020S >P,0 +X0000  000SH 0@+ 0 0@0010S P0 YQA 00 0X@[0000S X0000000S~ @0 0 n RT 0@s0S @ 0 $ @ 0r@WH00S \0 ,}L (J+4Ԗ*ʭǮ*h#&΢ #&9KhP*`1A-0S PPLqL@` T0 :41,a PU @T)$PWP@`0S 0D !0R3 P U 0S 0S  |*9P0S0S `0S < *!s@ꠖ*h#&Ȗ**P*Ԗ*0A-0S 4|P @`pT V @TL$@ 0S$p$00E`@ꠖ*h#&2P*SO-!1 0RR㤑S q儡@P 0P0: ЍS DP`P( 09C u*000t PP@:SR  0`* Q ]`P0to0 000 t000ꐖ**ؖ*h#&l*Ȗ*#&˯2O-0S b00 K_ 1࡟P3pP@'0P0p0Y: P0 *@@ $8 W0: R0':,0 R S U :SR00W 030"S P 0000 S 0 SPhw \ X)000P@ Ѝ蠖*h#&*Ȗ*ؖ*ʭ#&C-MM$Q@P0S  @p T0:ۍЍ0S 0 BU000@T`PP@p0 ,  Y $  3000PU ꠖ*h#&BȖ*30A-0S |pP` U0(o@TP` 0Q0F00S G@ꠖ*h#&MȖ*fA-p`P@P )pEpDorPT 00 0CR?o20S $P |#&p@-/0@P  0Pp SRpt*@-8ա0S$ $00  0 (%뿰x*%#&A-P0`0pO0000 Sڤ/0>+b P0 P<⭑P@O 0 L0O0?t*l*N%0@- @00H0@0Ѝs@-@P`P @TZXX }(?0 00?-+"+R  + %ЍpT#&$0L<S/ @-bPl*N%2O-@`CMV{ qP@ `0DUCߍ貀TX B/0 S4((e ښj@0PS  b8"#4 b4#04!40010S 0S 0S0000崐{'{{g W:0000Y&*Ȑ0S c0 0S Z0 000R*Q p`'0S L >`X0S  ` ꄖ*8***h#&xD@-Y%p @,CPe%0@0N% \3O-p0]MS DD@c@C < 804#&00RS   #0&op"& URPP "Q'W  0"f&00RS[  0"[&tnpd"lLUPL"L  Pp HBHHHr0SPY : SVH`P؀/0 f10L<aS$ @ ( D {`  8<P  8H\  T Ђ X ` { P (>-'8!88hL/0>+b P< P P _0?0H @P WVP)PD   &L P FVPOP|]ߍ蠖*h#&α*x**N%ul*/N%M[ * pt*hId))*#&N%@-$@0 00: S*G-@ q `0S+ 2$P 00S P0 S00P R HRڄ00S t&  Y`⟚P 0 Y00:$00S ( k&Ȗ**#&߲ G-AM`P@m0pP004 0AލG/00 08/P1 00C 0  R+ d T&0 r 0 D jl*^ >#&fA-MMp00 0/R @`GZPP 0S P@ۍЍ D :h`D @P 0S ϙP`l* p@-0@ @P  P@p@-@E#@o3O-tM0 S ppl00RS\3\  P3P#0n$HC4#S<:88tЍO, %$PL  nl   i%+e%0p`00o#ܢܲ@L<` $L\0@ |#WI< h`VV#W@Pp L<0@'pi0xSiSPcP 0'0@$ 000 $L<0@ urX`iT|fL ^TtЍ0 0C0\10S 0S`%0` S\"X"h0SS  .08+00dS X00\ `0a0P!~c 08$"ꠖ*h#&**N%x*MN%ӳ#&l***8Rs*ƴA-MMp`@PPx 0pGh!h"@PX T$L {y< 0v$ۍЍ aD D< \"PpU " " U`k !p0P O$MK xH$!0S !p T0TP 4 6$428 [E#&!l***?j@-3P@-H@4#S 0  "0#S 0@"N%0A-@P` 0 P0:t 0hp ?0@$a@00S$`V SRȖ*t,** 0S 0 0/ R  /0Sꝵ0 `0p@-@ PP0*D` ?ـ0Pp UTp$/pȖ*,*0p@-P@ 0 P0: 0Vx` ?ᵀ01S 0Hp@F $ P\@P@ p$0Ȗ*,*۵@-MMP@T 0``p/VVP   ၗP @T@ۍЍVP @p@-/P.@P@p00/00@P 0S h0A-P@oC/p 0TD@D΁ZU pD@DP0* G-pPᵕ`04PSp@P`0PP0C0 T`4 $D@#,**-G-ᜡ FPTpA_`Pt0&(0C0@V$Q@$0( 6倚00v`PPEPP vX @$@@(`/ሖE` 00 @ `P`P0P p0@0 P $@ ,**Hj@-@00$ D,*0@-S@ 0S 0S  0S |0 Psp T` R 8dD0&$ FЀP 0S00꯶¶߶ ,*p@-@`PPA0S ? 0P0 @/P᭔{'0P 0 00p2O-p0lMS ||Wx20SGl"PP P L!H0<`000@Q /*` R 0?*a@0Sf@01 $10 8%1 0`008<嶊0@  p!eQlЍ 00`V@ 0 /0㑊` 0 @T`$ +000 0 0$00(S0,00S0(0 0S000$0S0400d@0 1S0 0 0X@ꠖ*h#&,*u#&GȖ*,****t3C-0MS 塿Yr 0V~P000 ;000Ѝ  PP d `!\ 8 P 4 $!( @0@D`P P    1RQ rQS! $0SP P0h90 ZP`1 D1L1D10S0" 0 AD@(CD(P@\ (00(( CT( (0 P < "< 8 R"8 4 R"4 0 R"0 , R", tH R" ꠖ*h#&Ȗ*,*ȷ^ #&1jY**{**|* 0`( "4`#//#*w$""[=00@-@MT[0Q@X0T L0LP  @  C Ѝ0@Q@8*I*ո#&0P @-. *#&0@-Q 0@T0 R ||0AS@ ЍH0H P( H%ؖ*8*#&"P%mLA-p@@P 0 0S( ` `~ `8*]L0@-  Q4 0P (( Ѝ8**w#&@-0xP 00S@%*S` :P@` 40P  $ 0 Ѝp8**#&0@-@0S 0$P B5/x00SdPP AqpH0`P@偘4 0@$yP Ѝ舖*8***#&p@-hPh@4S 0SP LLH H0P0$000R0p 4g*8**!KȖ*[*0s@-@0PS  40B3/p00S\0 pH0@P`-+4 0`$%Ѝp舖*8***j#&p@-P,@P@pNP @ \0p@-XP0SpH`@P ~P  \@p耖*P%8*#&1A-Pa0510pS :p將@P 00PRP'PP× 0ltPT L0000@,A`ꀖ*8*|**#&ƺI*C-Mla! 1T\ X 000 @! $T 0A0 08 !Q  0"Qt/pX. , T e 000 `  S W8#`Rp000F"Lt FHd嫼00@ PHЍ`*h#&ں*#&*GK*0<YO-@`EM08aSP  <<80 @00T*0 ?o2Q03S 20S 2 T" 0S  WEߍ0S{ 0p0"00S 0"p! 0tPV- V V: r  B B B0 0 '"p0H0S  0 0P- ޑPO 0S; 7  B B B0 0 !  B B B0 0 @! V     Vy !p 00S y0@^'  0S  V     V Rp p  \ L ꠖ*h#&ٻ*uuP%#6J̻ 0P/00S VP%8*P5 O-M M)$ `R P  50S@ލ Ѝ90dUY00@T L500RSM <50SI,9S' 5050%5  TEPtB 00 (4 S B⢰@P$ʤ:6B@9S4 B.|\0 Bhw@ T0 V@30T9 49m  ij&B d0弰 BⱐPq(4 S B<% R  X3p H  n2\R(@93B0 05030Ȑs3303Ȑs0P 20S )F`婺00-40 S 49|#R Q`SÝ\U J $ Q4  Q  1 )a#090)S )0(PU <10S1$10S 0 X `y 0W0) B?W00pBS @!W<1<0 pWJBIBE`FVU //4S 04&0 YB,I8*[ؖ***ռR|#&*Tl>u ӽP%** h#&-D**unʾ**O-dCd5)SW0pW_R44y`u0SW  0PS9 S00P0S 0S ù09 R V?o20SJUMU5D R4 pGW`pVp``妹\2 RD R: R; 4<囹820S>,P: %+ y909909 Ѝ0 +"+R ! R | EUY0+5p`PlP d< T(`e 㣒0S X P 00 ?ፉqp V00S |/0S 906;#;S X%tE\+\y8**P%*h#&#&H*_*5*#vϿؖ**'0 O-RBM M@xWtPP P P Bލ ЍDW0S870S ,,ܸ00P 70Si ] "4"42hshs004488<<HHLLsssxx||s9^EsEs:^EsE"4"42"4"42T%0A Z 0 0 8!!P30S` P [L 0  0#`00 0~20S  20S620S bP 0 Z 0 0 8  20S 0 0 m "`e00 04Z10S 403/ 88 !TCZ00  0X10S00S 0 0 8 00S  0 4\ 0 3/Z 4   0,*,#&*th#&**8*GD%Z0J(KKT** hI*X*LM91@-M(   0 !S= 1 1R 4S5 !4pq04?\a0@P/ P0S  R+* SR-P- !0 010000 QP 0PT0 $M P ЍPB0P;C0P|80S050 00c0 @ 0@0 0**T8*Ȗ*tGY@-Mxc0S ll已hChS0S YWPB@0#00,< R03 r 0500K rP5"0C590C990C9000slP|n xn0S \2d"`2Q09T09 <0S 420C90S 20tSN2"CC2P4܌ 0R0%S P Ȍ HL;#;S ;0``1 v0@%S ) <0+C? R 0 0B 0S \P 00S )XI0STP=S 000Ѝ蠖*h#&8*P%*M#&ؖ**|***5kT*I*p***^ \o* Ԗ*Ж*-@-  7( ЍЍ/#&x07@-@0PS P ;9H0 <4 Ѝ0000S 0  Ѝ0@'ꔖ*#&*h#&|0p@-@PU 0dP D 0< p000SP ꔖ*'#&*Oh#&p@-@T`P T0:p'P 0S 0@PȖ*p@-@PT0*pP 0S 0@TP@-@~ 000 0  xl0 dT0 P<0 <$0@ (  >*clu~*p@-P@P @0 4 0D !0R3 ~pԖ*#&p@-P` q|00CS0B@ T 00CS0 B P yTnTyDop0 @00  p0 0 S꼖*N#&-@- T %'L00S @P@0PĻЍ@Ѝ/#&*NRs@-`P@00S#P 0 ЍpR00SP h0 XL00S8T4 0 `((ꔖ*#&*8h#&@- @  P   P  P ~ l$P vl L0\SX 4 P H@0TO#&v^nQ0@-@MPPPP<  P$0$ $_Ѝ0P*0@- M@ \0 00& < ۍp@-@0S g t00SPd0P 0@0020 <p@04+000Sp p@"0*D#&*Uh#&A-/`y@P@Dp/Ѝ/SpPP 0 00P0000S@-@0S  0S 0 000h00S@ !Pى <@04000S @cz*D#&*h#&@-@0S 0 000~d00S@ P 8@00,00S @*D#&*h#&@-@0S 0 000Pd00S@ :P|z 8@00u,00S @l*#&*h#&C-0M.S4P@A`p0/SS 幮0 0IU ! 婮  壮  7  1  +  %p  xX  d s00@ @_:Ѝ蘖*2%uJRY`iryY@-D:A-`Axp@P` } P P3:00 S00ЍU00*p@-BMP` 0 @E CR V k뽈P℣0FS`0  BލpAS SP0P S00@$P9h*A-P@`9<0 p1W 9A*@-,AP9  0S# P  z NP90x,PP `@/xPL 00t1 F0S6 0 00D10@0`V 105 S:; S0*P 0P 0  0P 0  P 0 Ѝp_S-S t `00T H0 P0;C*q[MA-pTQ`1S1S@1SFV1 1SV AV1S 0A mVS D@d0S VA0  p1S XQ 1S<A sV*8%h#&itA-a M0T 1!0!sr 00 0-04 0*00 0"*|O-`bM0弐SP@ tpTp= ,p|,0 pXЍ  [ H0S  |0S@0 poKpT 1S!1T p 0  T 1!0 00 0     !00 0d,H, 0  000!008 0d,4 , 0 *0@-,M8p0P R/ !!lP\,Ѝ@B`@ @!{(0`0$$0F52P8%*0** G-XM`u@PQ% 0rS 6P @0  07-0000x0 0P    RQ  XЍS @0 g 0P@*H A-8Q夁X@`!1  0 0AP!pRS4V0 1SV AVS 0A kVpTPDP@XU HA 0V*8%h#&0@-P$M@0000 PPp$Ѝ0 R p ,d0 0 1S40000 02*LO-XqM 080@ D @CT Ѝ0ZЍOR`" 1!0 0 @@dp Y PP 0 @@ Sp R Z dd 0T 0CS0<0( *0* -0@-P,M@0 08 0 PPp,Ѝ0 P  ,!! 0Q P0PB7 08Q( 2*8%VgQp@-`M@0 0( 0 ``p<Ѝp R  +|P10 01SL0L 1S*ZJP !2*8%^O-DMhYp2 0S 0 00 (0raP (P(0 %"`P(` P@PDЍ`(Pv$PP ( $0 PPqpDЍO(` 0v ( 0C$ S  P+v%圡Ppv00Y0S Y 0I0p!0,,p1!0< 0( (`(Pv ( x( V((0$ 000  00 0 000  00 0P$ 0 0$1SH"<!!!! *f2p%gnC-M⬀`` (pxW0P0 000 0`PPQ ЍP@P. PP 0  PPp ЍC3 0R $ *0W400(00 (P 0SQP v 0Pp!0!00(lP0Slp1S\o`D0S 'U 0d $`Pf2*gp%0@-P,M@0080 PPPp,Ѝ0 R  7*0 01SP, zZj{e[fk0KZe[KK[K+S2*O-MhrM 00`S@ aPTL P")J@ `w Y:@0@ 0E p,oPٍЍx  p Yh )}x"QPX8% !*1 210T 1S1!T0 0*T 1!0 0*Pq 0 D @q  0 Dp* pO-JM┋ M`P@pq03<0q0`400c?c8000S0P0S@TK&1X0 + ;4 0@X욟4S ЪU08* <0: 00U0*:4 0@t:@#TRT 1S h  GRX:X1P W00  4  @( 03p0 ,!b,b䩟 , b ,b봩倀  , b ,b넩  ,p atd ,aT  ,@ aH4 ,a$  , a ,a  ,a,aĨ  ,a,a딨  ,at,ad  ,PalD,a4 , a@,aX $(0 , a,a 'iHQ d(a W`7$R [? 0WS; XQ;X PED0u4H0 1L00 1H`00 D0ApMXL0 10@sX&4 0#Q0X00Cs 1SPlX0@sWG4 0BWPE X.- XO/H48pS㬥 ,a,갠Z 0 R(0 R P u 0 0 03AP8/$%00D0 Jލ ЍW@  RH 1H0 p"H0S# 0 0 @3SH  F]8p$W"RY 0 000@P0@3A4/4pGWpp 0 0 @3SP1R 0) 403001P 0 gp 0400 [*Y u0 S P40Sr 000   $ $ 0 `p8`0㛣#0S P   B ( P R0X0,( <0P$0 ,( t$0H0 p0?   H0 p0.;㨀H0 H0ppu0 Sp HpP H0 p1W D00H0 pH0 ppHp0pH@P0P NpH0 ppp H 0w0*x%u u^ p%*8 f +*>GOYak'oy! 4`* 8%O-qM쿟`=P`d@P U#*0T?SD00K`/pP0.0809p R  `1`STP`  s00 14Ps 0,@Py- &0S qߍU |t 8Һ80U  0Skt0SpdoPYPL}oP,U 4voP $qoP040 ioP040 aoP \oP040 ToPy  Ko PU  t 8 v80U4`  0St0S 4-o P"U  t 8 ᪻80Up  k0Ss0S1!R00:q{oP"UZ 080 Rn aBQ@IKKLGJ 5p  -MKIps 8 V8 W   Rs R0!P  : <0<00140KS0J  X01S( 4PU U0H?o20SU0H?o20SU0H?o20X0S `s 8 8 W   RNs R0S*  %00140KS% 0400ql4PU4KU* l%s 8 8 W  Rs R `0  0140KS0 }LS01wXu40S(x  Kv 0H0l7X' aXg zXpp41^,'0 @D@QP900.@8Am 4@P8Bo]8 0V80 R@00@0Y-1 `0400<0,0@pr  @c40$ 0@ 6@\ 68 80 p@T1!0 d6d1"04 @1@S8 0 +q 0H0c?DpD0H @6p\HPp&0 SX Zq-0E1 d! n`0D00 0``pBr@ P1!0`1p00CS%$%1" = a@P qߍOtor4S 044(0 0,0c?0040(00p`000, 4 9\p:X|,q RT=0`0DH  m@P0=S t#8 R`  lP 0=Sc <#8 R @_  lP 0=S #8 R  qߍOg( T W04@00, 0@WD@.0S T1S( mY-  pP PU- 7 0 0(00,00 03A5/00P9T" Y%k(,p@\PW`0,S(P T'&gq XqpF ]q0"S YqW 0 SX0T R 00S+ S Sf FP00CsL "7 \0P LpT00 T0ppUXN0 &p000&00' T00.hpT0*28%4 $+ <^qpu4A_9;(T _b~A8 fx%\=73<Rt`*M0*0p0SK@@T T TC0P 0T00L @p5@0' @00& 00.0000h 0%P;\0 p XO qߍObp0S\0 \P00p0 0000( , 0Jz@-Hp@ e |a| l]p \Yd LUX <QL ,M@ I4 E#&3Tbt0p@-P@T`Uk P  Jp@4p@o i*%@-M @ ! P( Y! Pۍpp@-IMM @` PIލЍp P0 ᧷0 pᡷhP 0S 0S0 0S  PpDi*@-M @ PDۍ00 R  Pp*H-3MM p@PPYWj`8jP (jP  PQ 04jP00 S 6P 徱P00 S * 崱P2  mt 媱`P` \2P TsjP ,_PP00 ]U,00P` 0S X J1! PJ AP J1! @Pp10S h 06j 0p0jPPPUX$ PnU , 0 GV, )PnP`ZZE_oR 0PPnU  $4S J P ᏶p- hX0Pp*1}W#  #&<\O-MM@`;.@pp P @ p @0T @0Z:: \0S *ލЍ0 0TmPP @P@(0HT*20Sa00!1ZpJ0V90 ZVP 2nZ.@oiP0 Z@/V㟹 0Z ;P nZ.h@ZoP nZ.DZfP nZ. |dedA*<@-0` 0 0CUPP 0 P@H6UP Ѝp@,/P IЍpd O-@-lM8 400PPlЍBX0P$0 $ pPU  ᇵT T T;pTH0l4 0[gL6H0P4PT 01H0@4@T 00SZHL 4T 0P00 0S0R0S,0 00 $0@` 00@TF*303 03030#L0P׋$0@`P@(@pW6*00S 0dS0ktDᅄ p  0Xps  ;Ppk P X$!m0H02R 0f0BnS01080S 04 S? ?<0?@0,0S+ 0竸S相/H ?fL0 ,h JH 0f?H 0D~f {D 00{'{N(0 0(0<0P00@0@ Bn} 001 0P0p\?` 4 $;Xp J?  4!; `$p P0 0L0 {0` X0{'{Hʟ 0%f 0Pf 0 lUY@U _`am\eaa;B.?nyiu 0SP0勤d400kS% Dp $0Ppp $;Xp~ 0@U 04$;`pr `0X PHɏ 0e 0pe 000@U  0`e 00 0P(0S0fd0kSㅤ7 q 0PpJp3 4X`$;@p) 0U 04`$; 3p  ! A!P00 L0@ A{ {'{> !HpǏ A!0PU  A {0 {'{Ne 0Ge 0 AeL0 Y@uAGa@-k ~#&A-p@4`S  qPzT0DPEE$UX  fPV00fP V0-08 P (3MDPE@D* ~ pp@-P@Q0 i0 pfP@ R 0S L#Pp 8U4 00, 0p$~#ة%+п++++@- 3800S ,0,0 p #++(*G-MTM0S0 DpW,Q44Q`@`$0 \0A+<P 0  0ۍЍ0 000nS ?S aS ppS qS|0 | 0h 00L0<@0 +++#&.+*&&IaA-X`0S L00S @P@@0p0pP00.++++T0@-@@p2@00S&,0, 0S00&++++,*RC-PtM` <ş< @ !Q RP ğE R`S  dt`F0Q ğ ;   T-P ׇ Ä CR ` 0S $ Lh@4 \ P00 4ß@Qk [Q \Q< $Q  DR?` R @T$P \P" P!0 0^\0 1Np$@@$@ l  P\p\0H P 0 P p00$0 R  "DQ"00" t 0Q "F0S 0QX ]Q \QQ0 00DS000S+_T`tЍp1A$^? l0HQ pppDW\Q> $Q" 傀ಀ 0R㜁F p1 B!$Q, ltH R' DY  DR R DRڵQ 1 ֎00,Q ]Q 0 $R p0 Q,Q ]Q B + 0R0F p1 B!$Qd lXH R_ pppDW{  DRw RQ =*&*&+++++%Pp@-@@P@T D-|@| |P|`0Shzd0 pX@ P ,0< 8$0@pp@ة%+9eп++AA-@Pp@0S0P0`x0 Rh ) R0T @ 0S 4!P@` !ꄷ+8++ة%c+P@-,0 Eп+P@-,0 9п+ P@-,0 -п+P@- , 0 0 п+++P@- , 0 0 п++@+P@- , 0 0 oп++d+p@-PAM C0 0@00 0S0! X:P7 0S40=PP0 0T00aS` 0` 0R`T0 0 0@0S0@T@ @0Q0 00S0&AލpPB,P0 P @4  :P+ؿ+Կ+п+O-1M MP",<4 1ݍ ЍP $9P 4@@/ PZ30S cs؃ 5PPQ /3 ꠃ夓P0S0S `V~`30S5 0@P/ T300<3 0 %,3(3Q 0Q3@OoB0B,&Q20S 2 ` 0gP0002`P0 0R R00 R K@P 42H"000 H22Q U1@OoB0% Qy10Su 1@#P0001@h, e0 g AP0S0X ,`V pQ 0S 0S0 0@P+ 0! 000 00Q Q0@OoB0%Q|00S h0 @ 0P000<0@`п+.+ (*++ؿ++Կ++++ܿ+(G-JMMPp 70 0@00 0S! 8P+ 0S(0<PP# T0  1 1 R0 0S0QW`5 p1 0Sd1dP*L1 @JލЍP @ ! 8PJrW#Pʡ0 xf0S G@$00 R000S0 06't0P04qp P0ST00@ܿ+Կ+ؿ+Զ++Dп++Ht 0 0 0 0 Y+yf 0 0 0 0 N+yuG-KMMPD*x2 KލЍP\"8P H2@@@2000((aP 2 0S@2_- P0 )qaЁ0S 0S 00 3@P -`1@0S p 5PH1` 0PP 818!0001 0-0S P+ 0 0 000 T  P_oR r&t0Q00S 0@0aP0 00d0@` Tп+|.++Զ++D (*++Ȳ+Կ+ܿ+ؿ+tyu++H@-PAMM )0 !@pPP0 S` pF O p0 0pppp0+6PAލЍ0S 0 `Tп+++yu0 P /a6P@-@)0$ 00 0п++Pp@-o@P P `h:P X5P )pU ( P$0 0 pa6+0 @- 0+п+P@-((0 00S/0+п+++0 @- 0:H+п+Pp@-0o0@PP  0S 0 0S P (0 0pP@`P@P 4P000 0u+6+aj++п+I0 @-Z 0+п+0 @-P 0\+п+@-(@(0 E 00S0  +п++0 @-5 0+п+P00P0SA- V(0 !0ЍPAaq0S000+0S 0S1}000PPJP00BP ,Nc7`0H 0H<\04 п++(++a60*+0 @- 08+п+0 @- 0A+п+P00P0Sp@- '0 0pP`P@P# 0P 30P xl00?o2`SP@8 8 <00S000п++a6]8+4+wP00P0S@- '0 ЍP l5P 0Pd00}S`00S T0T很0HP80 0 00( 0п++++Ȯ+Į+p@-0PP0000x8@Ppp hp@P p@J'2@0@ 0S 000|п+d++Ȳ+P00P0S@- ('P0 ЍP8 4P 0 'P0 п+#+@- P'D1 ЍpP,! 4P 1@@*P0 P` /@P*0@0 S0 0S P xPl0  Q0S P0 @ 0nP000$0@п+|.+ (*+#++@-P&0 ЍP 0Sx s4P 0S0TP0@P00 ( [4Pп+5=E++C-@`ppPH_oR`j]P=10S|1| ЍC蠇ThaP8Z&\1 ЍH5U@ 000 (1"T:pXg(PPQ 0RP[p\5|0 @0LT %]0`P`TT TU@T 37@P \P(0  ЍCԶ++WMп+uzWRw/@-$MP%2 $ЍPN0S!3P 0 1C\P 00|S 6P zP 0t\l1@h@v) PP 8Q@a@0S 00CS0S `)0 0 S L r3P0 0T0000 \!2"Q|00S p0 p 0$0P00D0p@п+.+ (*+|fRuw/++p@-PPMMT%@p1@ۍЍp)`D@PC@@T( QA/P@[+PK00S `i00CS0 U000 0/p0  0 /.P(t@$п+M8+++k0@-M0P 0$`1 Ѝ0PH! 200CS0(P@.0S0PB PP P@>Z L_T0S0 @ʴ- @P @P)Z 7_U |0|T0S 0L @Z  _00 n,п+++p@-0p@P0 p@w$\0\`0XPS 0SD/0S0p@觅 $=00pп+Į+Ȯ++)Op@-0`@P0 p@Q$L`LP0S/0Sp@(充 00pп+Ȳ++eP00P0S@- -$0 ЍP 1P 0h,PL00}SH00S <0<O00P 0 п+z+++P00P0S@- #0 ЍP 1P 0hPL00}SH00S <0<00P 0 п+z+++@-MMP`+ 0@Sp@-#@0 p4@0PP0 Ppп++LVPp@-#@0 p4@0PP0 Ppп++chQoP@- "(0 00S@B+п++pQoP@- "H0 <@0S 0S kп++@-c0P@-000P0S "P0 ЍP@ 4@P@$X !]п+up@- M P"1 ЍpP! T0P 0"p`1`它0S@1D0 0S 1( )P&P 0 0S 0@T 0凃%`K@P W d@ C0@ H0 @ 0@3/H0T 00S00%п++~,*l +n++0 @- 0ܿ+п+0 @- 0X+п+PA-PPPPU㈀ !00Ppp@h0hP#00P0` 00ZHT,0PA PHп+ؿ++++P7@-A P00000 Ѝ0P!0P%0SʰP 0 00TM00S@ 0 S  @HM@00\+H0 S +< H4 `/Pп+Կ++++++P@-0oP m!0 0@~P yP ptPX0H P@<00Q$@ 4,#0+п+a6++000 0@-S$000 0 + +Eп++000 0@-S$000 0 ++Wп++p@-@Pp@0 @- 0i+п+0 @- 0v+п+PG-uR@Pp]P\T- ,`PgTP( ,@PP_$$U; W P10S- D1D!0@@ S 4! ,P`KU1`1@W 00S 0 0 S  ~ Y$ V$l0`h0@P`pP `P PP Ѝ+++6+a++ @-r0п+P@-e |0 poP \00}ST00S H0H咁@_P40 , 00$ 0п+++-+Ȯ+Į+P00P0Ss@- 2 0 Ѝp0` 0S P@P ⥣0Q R   L 0Ѝp@K$Ѝp@п+Զ++D+2PkPp@-(0 p@0P0Ppп++A-P0 "0Ѝr0S2P70S10S 1 a0@ ` EF0封S Cc!!b"  A   c# P0U0C00CS0<\1 P?00CS0@8( P7,! t-PS0p00 P0 b" R  c&0P UR PE 00P0 0 Sp(0L0 0 Sп+p+++|-+|-+|+#&8P00P00@-SM  A0 0Ѝ0Pl  -P 0(qpP@ 0 $0$U@00п++dP00P00@-SM 0 0Ѝ0P ,P 0 )qp L0@0PY)4 00S 0000п++mP@-$0 Pп+sx@- (0@P0 @u+P00P0SA-쀟 00ЍP ,P 0/`P PPP 0RPT@T@@- pE HD Dv00.,п+zWP00P0O-SM  j0 ЍP  :,P @P@ 0R@Sp`x-|0 `@P0D0 Р00000@@0 п+zW+++tyPp@- !0 0p`@P0P +P &P@)p0 ` S P@@ @00 0(0п+ +L+P+A-p`P @Pd0 `AP 00-4 RU0 A++@- PP   R Ѝ@P   HR  @0S00 Ѝ@`pп+48%+uA-0p`P0 APPp@P @A^P /00 T00п++=Pp@-nL0 p@00S40p@,~(@0P 0kPpп+Զ++N+{0@Sp@-Nd0 pX00SL0p@D~@@0PP0,IPpDп+Զ+++ @Rp@-'l0 p` RT0p@L[~H@ PP0 , Pp п+Զ+++O-MMPPQ 3 ٍЍPʴ#EE*P 3cp@Y 3  S`P@T)RC0㓄(p @0S (30@ @c0S09001p`J2}2`0S@$S \S00@# 0!|"  0 #" @00B   BR 0 F )bC0 Q`0S@iR0@S 0 F)bB0Q`P1}h1 0S x10SL1h`10S ,0}00CS0.  E B0 03/00S 0S 000CS0 S0  )tB00000h0 Y 0pS7 п+p+|-++Kn+*&+~++++@-@P 00P 00P00p0- lM X00S WH d0 P000p  ++b+0*-lMbT00S jWD d0s P,00p q+|+0*A-@P p0 0C0S13 Q `EP@ 0 B RQ@  0 0C0S13p@-@`P:GP , 0S!PR |,pp@,*`(P %FP008 ,S!0Rp@-@P ڿ00PU P UPp˿00p@-@0`PP<p0 .0St  h0 S Ѝ00S 0C @P2@+P/0S/0@-@Q0%Q#0S P   R   07W0C2007W  B*&G-pP(P SR@ DPP0   DPN0 0010S / 7FPe )`@.FP 0PS(2  `P):`FP P)P :FPP000S`UK ኜ0S 00S1 @RđRp0 \ `DP0 0 U |)x)u) 0 011 ĝ.Ѝ @PD) `@ 0S000U) 0S S St0 0S 0`S@C)H0PU :),P0++ +u - BR0 R  P R HO-M M@t PE$@CP0DHLP0($0,4D (00,0DHL` 0p 0S 0S X 0S<@DDHL`0$(0 0,0`ލ ЍP0V0 0S ;BP@P `嘿P TᓿP DᎿP4,  000S V PU@ /PV@0S ?P @0U0C?o20S b4pWp 00C00p0Tp pW H_@pPpUP 0S T@0P00$ 0R 0.00TE+ ?Z0048<03 0 )3 t30S6Zl#l 6(@D0P0 $3@@+(:D@0P 0 @(00 @`i `00PPy P00@tPS (P Y0@ 0'T00STeU 0S} W +X'?+X>+X>XP+ ?!0 0p4P80L YA+ P0?E>00002P1@@DcT@@/!D0P  00T+ 0> 08 04@ 0R 0S10}Sy0S @0S 0S@0P/NP0Y80<0 @K.?GOW ++0+++++п+#&+O-jMM@pTltQx|Vύ<84PLH0 !0PP0A6M00 )p7 4A'H8'0S<l0sp0st0sx0s0S|0s | &X>0S0 /:NP&&>0S 00SU o 0 0 .=0S |!P' Ui=- )0S L),P$.4?4O0 0 (00 HQ /t>0S->@ PR*  @,0 R`NP<0Y 00|SU p'0St<0Gh ⨸Z N T> = "$l,d= <`0S00  U ;+ 0S 00S 0Pz 0Sw &p& 9&P0$S0&,&0p800S`a4TTP80S (50S 5 @8 &V 40S L5` @P &T %t&p  ]X x40S 4uSK`0<0`0#@ 0D<wP: ;@pPP`@ P S0 R4 D3000@ #@P` @p# <0GP f@P p ` @0S P@p PRРZ/ 00P 03Q00S 8P (P 0*S0 ⦗Q0-S 嚗QP P00 /R *R0 ⇗0Q@ 0y000St,"0 0D受0*K+9_++h#&4*ж+ +E O +hu+p+|-+"n+++P @+y -,+AV<+ihv(%*& ?|BQ[nH1h{+f^u P u ,P+Ik~++@B0*+++++++P 0, uT0MTuP 010Su@P "``P pP ٖPі000P P P Ϸ c"|P40S S WO $40K/CR032 V 0S` !0 0t 壷W5V6ZO Z0 $@"2S"42Q0SM?0!80p2 SML24 Dif0SF20? {u00P 00Sxy43 r|00 P 00S% 30S003s 0st3 @ Q P <mDh0S30dslp#xxt4 Rlʘ4$Lt4R P 4Dw! 44`t0Əs t0t0@T> T  $P<ΕN0 0  2 R@p M0"0C?o2? M ""0A0s0 S ;S0 IP 0 R RT 0SB0S(0?&"( ,0 R /  T /͡@!͡h0P q"@RD á 0#PP#PP0S0S60Sw#@P bc&P000/ R0HL0$/0 pwx'x\ XX\ pd `gM`d P #P U  R70S 70S7wP $>0S @DTP80S \X~0 0S( PZ0S= S Ew#a8 8`00S0T0S@ sPrI  #P $ (HP0 Uc e@90Se89 Q ``) Q0p9 +U9#&m> 9R.sr . 0A3/@p:@P  : R0 8:QH:E!h*h0 0 S +l)p |(tx'xt&"0S,: 0R.MRwAu0S Q000S J000S C000S <00jލЍ0S 03/0S *00s@- P@:P  :P0P SЍpጎ`P  y:P 0 FuUptP Ѝp@y 0S S0S $ [:0PP6 @-M0h 00P P10S 0S00 0 Ѝ*  qQa @T0 S 00S 0s 0 :;P 0 S000Bp@T hFP 0|S ኴ00 0S00 0000l++ x 0*0++A- M@`p @600000@P2E0P/S:S X)E@V P"6D 5p$0 6/@PF@P/:KFpP &@4P 0 Ѝ@/000p0 @@PWp@00l0@@DcT@@0,0@0CcS1S@ .п+PP00/@-K,0 @  000 K@+@*@-Kx0 @ d00S X0X0 p d<0000S J@+++@*@-J@`00S T0T0 p @8 10 10S J@++@*l0 @- X00S L0L0 p 00 101000+++@*.+`0- lM@ fDd 95800 p cz+T+T*0-@lM@I 00 00 0rS sS phd  5\d 4P00 p 0L(d +.+@*++T*@-`PP@ 0@s8#80@U 0s8#8000@(B(2b!! ZP VU 0A0T0Ѝp00CS0 S0 S 0 /O-TMxp|W0ʿ0? p00p 0I0`P0V0W B@0 @040SD H 8PZ0S= S D$0 S00 T@P(I0S I0#S I|0Sp `1 R R 0Ha# 3;Itp uTЍ ? 000 $@0 PPI0S I0#S@DT|0S ld@"\:$0V 0 `{#M"00 "@B++O-BMMU@@ A1,? 0a>0@@0`5 pP`5刵P< 00CS00 S(P50S5U <% 00e :0We S00G00S+ 30S 0 S  Z  S800CS0PP00CS0l0d u:0 @P00CS0 00 0 s`83 ap0SS 00  00BލЍh3@@<30S VW@@ c030!%:3 0tqV S$ " R 5U Q Q$Q V VR"d 0l0H"0L0V T"  0 C " T! RBd@Q@T [ ! @ S)S   @  @R04 5T dT(S@ V-S R !   A.U PW040 00S10S 3/1U0    0ZR\@\0 RY P 9/ 10 XS P 8/0E,@*؂ t п+@+x++D++|+t+gT+ +ж+0*&+-A-` @T 兏0 ЍAЍ/p00$  Pxm49l0 h BoB0S@ uP 5/rt+п+@*؂ T+pO-FMs M`@ ( @3F /F +F0$0`30(0$ 0H,@}O0P ScGa0 !3 Fލ ЍAO0 @,Q(12@@Ȳ@aGT  2  2O 0 PD0P|2d :DP `"`d1T 10S 00S ,, 0d  PP d@0S00?o 2@P E06N6D01@ @p  hṬ41  D0(66S0d000 d00Aa*0PS 兎P P 00S t0 |0OP@0H @0c0h,@]0?P* +"п+ж+++`*;x+ut+oO-JMGMsn0p0얟VXv600S00p 9 KP4X6   t60 99PL"JލЍ860 00$0 97S 60SZ6k50S# 䵟0S5 Q U 5R "P 0S 500CS\5|rk00l=0S P97S( 5D 58%80SX0$000(00000 PL 40000Z40܀C XSX P4`0(  $   dT C_P 4L!>\ 0h0d<` ((0#$0$c# $c4"($ <7 $ &R 3^0 R0S R3)0( 408'0P30S@97S00000 +0S  0 !p0008'PP2 0 0080I 0  C pd 087\PD 97R^ Ś 0S [R0sO0010S ;70:70?70>7='<@P0S0,< 00 00,x1 BP!1 R  D 0 0ZP 0S 0097S|0 0S [[}X  S[00000IQ@*++\+`*4+++ +++8++п+|+X*2YkX*#Qq 2@-`pBWLM LЍ@ (pP=  !p7 0001R1 0S<0 |q?!(E(00 Q 00SZ=9Q ='/@#b?!"/p UD0S QD0#S !P 00+0(60 8pp 6D0S 2D0#S  pp 90S0 000 0xLЍ++@+Mb@*A-0H`D0 82V p R R B`R RB`b2 Q  ,.00EoE?AA?R1 $!$! 1 (!(! t1 ,!,! d1 0!0! T1 4!4! D1 8!8! 41 @P V005T/00PP贀]~H+-.01`@5H@dUXt0th9V`P``0` PP<0V0T.S10000D^ 8 ++ h+0@-MTQM0S Dϊ@11S41  ۍЍ0@ ,@ P  0 >P è u40 PP  峨01S0  T  +p  YPkP000ScaۍЍ0t+2@*п+Tmx+0@-0D$M00 0=P@`4`$\4Q00P4@T D40S@ 440S@@$40SPy40S3go3 3g$Ѝ030SCP UhNPDh5 `3 0 HP@-!80003 & oP@#R000" 00 0 RP  tJP h@P  H 2@&=,20P S R0S S @T% 1Ao0S3 1o10S 1 P5rpX10S  P01S0  0S PU P 0S 0S h01Sq|e80 t++̶+ȶ++++п+v@* + T* +T+x+A-MP8  ? $888( 000,8@P@ 8@P@80$0 80SP 7Q  Ѝ 00-S0S 7 ;7 5770SJ040080x<0p7 0@PdGA`XP8 ;<PX<7,06P1PP7`@0 %<P  <P6Qu AQ ,0 p,00006Qn 带 0Sl6 80sl<0smLFPv0040Sg00Sk5$  0  r 00|S  0P<,,0S|L5@540 ,,0S | x540,0Hp,0PP0: S 4 84 n00, 0E4 P4 00S,  P4 000S!8;D4@08@ST4@y LTP@00S 0000 4 (r 4 R4$=4R P 3Cu<0s <30SP 30S 20S2P30S#Br, 00CS0~,p` VmU。[000@] Ut,00@ 徥000@ 30CS,0"p,000q002P001!P 埥40S 40,3/0,0@00@^1 R0&P?0 S@\1#/10 ? 0!$$P0 x0 0 0 0o0 0 0 z, 0`$P0 X0#S>8F< B,0S 40,3/0++++++++ ++T*uT+  #&+п++^y +pL++ +;8 ++V+c@-EM D,$ <@_4, 00(,(0,0D@PD0<@@P@<00; 00*:o<<0S>;0SV 0004 8 + R<00S0 @0PKN|,1S4$`:P $00|S $P$/9@>0SR >0 SN $ 喤): (1RS ,1S $00-S0S : :$ <0S $ Eߍ=0S\: 40sl80sm0 S$P$U>0 S$LP$L @90S<49Q0SP/PP=<0S!0S' e+80S 2(P  @8(t80sSx8  lCPw00S  D8Pl8e,,0SP 7 7 R0Y^V,1SC$ 9P!7(0H7,! D7 (0xp(0p 0: S '00&0d7 R,X7X'XX;$00|S 88$((0S$⁣t6,! p6 600$ ((0S6$6R P f6Fz60SP 50S 50S5P60S~ 0CS0<0S 5  (p(3Q$3,0%p,0(0q(05P001!CPLH=0 SE4100S 00(3/0(0,,D0S|4 S<Q  h40S 0 4RO qp X%$&X0p0(pw$4P@$P咾  0kxҢP$d̢<0S s0 0 @( 0@崒P` T0 00( 0㧒Pw\sh( 00CS0(~pk P @`( 0@#H.0 ? 0!$$P0 0  , 000CS0,O@ T@0SB (00@ UG,00@ <0 SO1(00@B , 0@( aT!000t, 00CS0,p@ TD0Da0D0 TUA @(:, 0@$P1 )0#$l@D `5Ta@ 00S ,-48 (0S 00(3/,s+l++++t++X+T*T+  ++ п++ ^ +v+p++ h#&P+ 3;u^8 +++ /0@-I8X0 R0@D00S 8080 p 38@+++-?$M0 0 Y$Ѝ-4M0 00 0007P4ЍO-p-MM(EUܽ " pӽ4 0 P0 PU0( RPU4d" R 0*Pğ^ $0S 0s\0S &P 40~,40S` $1⧽` $S 06 {0 A(T# A0f{{zdWdp0ች3 3R - B`P  61 BRڒ`\"B 0P# f@#2j`4ß 0 R#3SPSs01000 "fP0 $` P(0 0SZP=9 =:k{D2 AP09ڂ A k Q 5 P;!%#3[QO  d 0@!0f !1`P0F|1p fR P 1*!3^4?^036t!P00`100 p h,0S "%+0!iU< ļ`0Sf 弼`0 0p 5MߍY@.A++@++ +l +p+u +QuL | 0   ? +l+ +@~  0P PB0  A<L0 A k{I{7{ZUw0P  lpgP<<`0  X`  R@-b6@Q^6@p@-Bd00` pd00CS00p ,P P00 @R0S"P7Qd`d00CS0*p "P \Pd00CS0p000S8A PA p0 0 `V}p0 Pc`d00CS0p 0@S P,P \Pd00CS0p `V0 0 1Pp@8+4% 9+A-@lp` P@ .%PP @P PE $P@OoB@8+O-$UmM0S pỼEPd 50S nmߍ0.1dPP0͵`%4P(0P/S SUpF Pd4P PP P4$0CS0p- P P P0 PsdLr0P P j0P d0p NP 0? l|h|dp P 0S d0p .P0? |p P 0Su0S dcg0 P P d00CS0p`2`TZ P Q82<0 0 dAQ 00 p1@S P0S!   Cb"c!   c# 0`S<1Td00CS0Lp0 dL\0<0 p P`, ^0!S^0C0 h.|P\\ !+8+ |-+uж+4 -  : l +  *&|+|-+  +p+0@- @0SၞP  "P 0  00@|0  piPX0 P`P40  0WP0  *&. Զ+3 ʷ?  - BR0 R  P R 䖻1A-0aS0P0!P3U !P 00.S Pl`1h׺`L "T1@P H, "P0T0!0!00(1   eU 0!嶺A0p000 00000P0 0p0S0000PTl0l0  @U x4 .P$0`X8++D +|++I f +mȶ+̶+++AԶ++{ k v p@-@P | 00t 00l lP0h @Q0T0 L0P@D0@ $80@0S, 0pt++̶+ȶ++0+++++p+P0 @- <00S 0000 p +++l+A-@3Qp0S `0S p ηl00`Pķ媷00000S t`0S p M0000<0uT $ '2p+t+++ O-`"AM |2 MR0pB h" R S4 P 04 SP 4SPP004Aލ Ѝ$Rg1+M;004P/S ++ Pcꌡ4pV0們p| 00g000000000S H1oh810D 1 R100CcSppW000S 0oK 000000e:$RV00zDzPPT{  "P00.++++$+  ++++uRfп+|+A-@Q0qS0`00S Q`Ѝ0lW7P !P y0 R 0000@ Pl00}S0s00T 0S$@,?W 8++Զ++1Z|+*&п+O-4M聟a0AS000qSP Q 1W4ЍPF }!.P00lw!P00XB+P"LD ,P$4A(!0司200 000凸@, 90%+P 0 y@ xP 0$0qp00P0}S0s00U 0S(@8V A8++Զ+п++b+|+0( (2@-ӢP~ +%A-`PR`pNT (@P @ "@P, @:Sm@-@NPȲ+0 A- 0p0@S0`P0)밀P"  P 0S 0"S 0S R00`P"S0"S 000Į+8++п+ИȮ+|+0@-M M P c f@+Pۍ Ѝ0Pl{4/SE* @ +P;0@TP/P^ O-@`pPV1@@P`3:+`E +0టP Y/  0*PT@1SZ 0 10S 0U0 R @)0S*00 030 Ѝ++@-80P0P0 @p CpP0 0SP0 0%0@Ѝ+ht@+P  R @-e Rx000 0R/`0000/0S < S0C00S/ S/0C++++0@-0 00 0S R 0Sh0000S b0C("( R@ S0 Ѝ *&*&8 @-`$A0S0 0 0 0!0up 0S:S50P0S0 0 00 0]p0S:S5000l d0TFpTT000 $0$:p(HЍpP+L+ -JC-@㌐pA\`\P ^T1:00"\ \ L 9̠^@2\\WO-`p@A R %R Z0  0 @PcUF 0/U-UA%U  GR0%R0PMU30S2 2"0S0mPE C_o0RGQ .Q\P0mU nU|2G0Sx2l" 0 BQ P082 R 8cU.U00  0" R10S /S0S  0R 01B^0 B A R : ^^/XR \/ B/o" RQ00S 0GSE.U GT]*0SPY*0SPU*@PL0G RS QK 0TE*0/S@*0< QS8*09S2*+0S-*> @ S'*000GS0P#0!+ж++uĮ+Ȯ+/A-p`P @ vP0  T  `00T  '0@ R   `FVp`00CS0 X PpTD000`000 T00gu#&C-Pp`'0崐@TUS  00)a@x0@P`0 \ٴL0L 0 P 0 Ѝn+?+#&++O-M M@ P<` 00\ <3  P`*P #\O K30S)  PQ PUP Pp-0F.@00002*P x"xF&|-F@hMލ Ѝ pp80\ 0= p \2020(PS @ +(0, 0/(0, pQC-0$S,F␡0I00S 0h$Q000SZ=9Q =*/@#b?!"/E 㯱p4-0S -0#S [-0AS  \0 0 PE0 0P²p 0S ,0, 0 ᎱpsP0\ |P,<00`+yc@+MbQWp@-@Pp@腲\p@-@PP`'P <'Pp0Spኒp#;% P@-@/P t@-pP@-@ qp P@-P @-0lMPQ@00 00 T  40S P A00 P 80 0 0 PrCcpWX 30S %@%@@ `L  P p`dP@ 0S @P@ % * N P@% *T0S @P@q% *0SHLs0S 8 000$0P P0 2 2 PP 00 @T y% * P 0 0@T j% x*P lЍ`帲]DP@Q% _*T1 1@T1 0P`V&PP)32000v 00 0P@T|Q PP0+- h+++YpP5#&Mп+D+++p+|-+"n+++Ȯ+Į+7@-Pq1 Ѝ0Q0S 1 1=Pʐ! 60 CRtA R Sd10R L1P 0S4eS(1 0P 0S 10S 0 0@ @0@0 @0 @0 @0 @0 00S 0 Sп++ж+]+'Z++(+++ +++@+<+++d+`+'+++00S!@-0M@, f)0 P0S8fr%@0Ѝ0@+(-A-0S*@ 00<ЍA Ѝ/xaP0 01PM0 0@@q/0 0S e* ͮP,]* 0'(2(00 Q 00SZ=9Q ='/@#b?!"/xp B*0S >*0#S @P4*<00/*0S +*0#S 0@P0C 0000@+Mb/(/@-$0S 00 0 ͯЍ@-㙮@P0㟑P᥮0@$0@-`P0 `厑@P  P$`凮00 0+᢯Ѝp@-@P 媒娒ᦒO-Pᐒ4M0pS`@ ⛯0 0/0  @T T@! ( 0`F0C 0000V*  /p)0S1 )0#S- )0(0)0S0T (0 @0p`F@P0,0w)0#S 4ЍeP @0p00000S  3 0( Q00SZ=9Q =*/@#b?##/ G) up ?)0S ;)0#S 7)0 P40@)0( ,*)<00(0@+Mb+? 0@-S`p@  㜏P;0) 000(0(0S,0SP U. 0 00 0,P (0S,0S PU` ЍY0 0PUPPӐP !0 S 0PEUPG '00 00 0@-p`P @P,0S T000(0 ЍT00O"0@ R   `FV 0P 0 ST(000(0T00gu/@-(㖺+<0!R/P(0<18C8S/10/+`% 3p@-BM000030S3@TBߍpx'l'dPP ''@}<4#1S,! R< 03/3CPQ@RTA 00@Sb@+R7@Pbi;#P @00S 00,S 00S0 @10 3/P00000S0S 11 03/0S+000P0 0P 0 S8y000 "PB0p 0P0 SH^0000S 00,S 00 S00S 0 P 103/P 40005!0 ` ,000P QoP@+++ +cg`%+t%+D+-ƛJ+ 0&+@-& 0 | +@- 0e++P `00CS`0p S00 P0S X0X /Xخ#&C-@Pp  l18C8S t` 嬫0S z 0c`V $ Ѝ+`%+w+@-9;&& p( P@ HP %;&|&Ѝw&t&X0/LA! P00:L,!4L`%#&0s@- @-1`8C8S P0S W  L @0 20nS Ѝpx+`% ++@-PM\P e P H00S@0\A PЍ @P̬:8+`%@0@-@ T ᷬ:6 =+D0@-|AT 0S  0 `%+@07@-PLA/)!00 0P. Ѝ0`%k @-@0S S S 0 \R0 R \ @ RC-@P M?   ?z p ?up@` HQT@D0 @ЍC#: s0,8@T*Q!s00ꔱ%pG-AMMP`P{B|R p2 h2h 7\2\ P 0 0 0 0 D 0R  0 S"Q姷8%@D`Ppᨡ0S1  "10S0 0SR'@@T  T H9D1< ȠLȠ\ S P0 [!1 ֩$ AލЍP0 SS  S0 0< ȠLȠ\ ᕫp 0圠0CZ ᬩZ <n90 @+4++x+c++L++ `%<++0@-EM,P ┪P@PG9Eߍ0 ,PU  嬩 ᚩꧩ $x0 <  $ETP_呩? 9Ẩ-CP `%q3O-PM 〣@pt>`l`\$`#kP3P MUPE!㚊,cP00CS0'\p 00R0S kP18C8S9 P%cP22l18C8S  'S0 PP 1 P8C8S  P < P^S,18C8S / P 0 S 18C8S <18C8S ᡪl18C8S 00l1 Ѩ \1/ R Lp8 U 118C8S WpG( P`#<18C8S0 ㇨ ЍS R   RMP0 UA 0QDDx++cd L+++`%++4++<+p@-BMd,@P4P1 HDd#a#,!q 1  SPP7`1<r> 04Ѝ00+`%@-`0S@ P0S 0000q20\@0+m 0s@-l000Ph@` R R l  R  R@4:03/ЍpQ P`%0+%pA-` q QAT 0SP @P00000P P0 P0 xP hh ᣢ\- 0L@L  "  \ `%0+B )1 {#&4%+00@-18C8S 0P R`%+(0( @-0@ +++p@-BM` P@0 S`0018C8ST01y0 b0Pn00x0 ⰟBߍpB/ BR 0ß00P y0001+`%f++ 0?o2 0/`%H-AM M0r0$0P0000000@00 ፟Pڶ0 ȑ ဟP0SS WS BS 0 +pP  uTcp0S Wd 1 0S0Y` -18C8S ؠ0S Q      |P Y 0@^S00CS00 S00 P0S(x+@ ++4+`%+p@-PH@P@pP P P @`% 0/@-qo/A-@PP p 00CS0 `V hPPTP0 P00XAh. 0S P0000 !0S0R 00 Hl WA-`AP0E!Sq p0!00CPPSJ0`00CS`0p S X0 X 0P"SP, 㑡0SP`0P0CS`0p SX0 X ! (X!v 0 0P0 Pn000P pP 0"S00PA-<0 0P0 +#&t h#&p2d@-0S S S \S ^S R@ B0 000 C@T0 0 B@T1 0 B\10 P P0 lA-@tP0 =`P`/ PP2 00pPF 0P 4V @P  @0S@0Sؼi-00@PPP?P PPP P 0!SPV+`%{wp@-M@PP\1   @P`u00u0ۍp0 S P 0@ 0000S X %  P00 f0 `P'`%8+p@-`@;PP 0 ~3Up(PY@p{7@-@P d 媞 R 壞 㟞@T|՞ Ѝ0(R( d 0PPP @OKP ,KFP +}f@xt yt +0@-M@@0(@,0 0 U@P Ѝ00,x0 ԜPPPP0S 00@SPTN +`%+@-v(,8+@- @/ )mP  u0P3P xMtKh \ bc 吜Ѝ+xt yt f@p@-0M`5PPT 1<18C8S |xAxX   0 9 0h4@ *4R,P( "0F, RQ  ;P 71P`  0(0S q=R۝ 00FS0xҝhНP0Ѝp\XTP D`%"+h#&.49+|  ?JYf0@- ɛ@6+-@-0 R   ЍЍ/+-@--@-z_0 R   ЍЍ/+A-ARp`P@1T ᎛pPG`@DO-dM @P$}0P 0}0P0 0 880 0(P40P0p`,@@0,@ T R3 U&T ( 0 (d(0gp ` Z0 000,@ @0_oR,@ 0T ZPPU <v 04 JR (0 R 0S0bt r0S  dЍT3 ` 0@D(0,@,F00(0 RR `:0@D(0,@(0 R40@D(0,@x(0@Dp(0,@pWm( pG  (0@Dp(0,@`(0@D t(0,@XWT Q ( Q @D( ,@I F ( Q p >W : "80(*PP (A+ R 8 %Q  R P`(1c8@Ht  E  $P T0`000S(1 0(408 TU (0 $(,Q@D0T,@(0UT(0 $(,Qt0(00@DS,@T + / 5  K ] o       !/!O-lM($ |` |PVPP:8@ 02| y 0<0hh2 @0`2 @0P 00B@P 8%@P EPp@0S$("P @ ~~[ lЍH<`@40S(( Ù Px  , D, 0P¯4 p0=P00=P<  B,$( ( ,0pRQ @(S<`@ 0WBP%<0%800%4000 0'<0'800'40` 00њ$ P$@ %/ C! (W!f!x!C-pᐑM00PS@ t(`0` 00t qp@  A?sp W@`0 P009 pppppW0@ @ Q@Op`6t0` }>?@` g00 S @.  C< 8o0ЍC踚0ꈶ%!!!!!h#&c# 0@-MkP 0: S0 0 S@ P 000vЍ0 Θp P @TPT0dHS 8$    +!! "O-]M0 M-SP0S 4P ]ލ ЍOv/y]ލ Ѝ踄@pP* 00S0W0S 0S d ` ozpPH  @pW ]ލ ЍO|0: S  SQ WPPhu c`șP [|Y0v: S+pNI (3 P@`P2O| KP p  0 0C00 03  0S0S`-P`_`vL 0S 0` =P V P z{ R+\RZǗpPQ >Pw!1Z[ d 0ŗ =Yᨗp`2 0S!Pv00!0 P: b  0S -ᇗpPLP-S጗ 0Sᇗp<+%U+":"g#L"x"Z" """""#K##&0 R R /0@-0S0R @ PaPLU APLU @P AC\ 0T000@- @P@@  wP JGP00S D00S 80 -G!iOXV+@,t+%@-H|@-zPp@-P @{p 000/H+p@-P@0-S@@p GP0Tpp0p@-@0@MS`P0 @ $ V P@ЍpPU P $ y00P긶%H+v$?@-@P @,00S@9 H+p@-@PPp00Spp@ H+A-p `P@P000 P P0 0lu@-@P P0P00S@ H+p@-``MPU> 0S; TP2 @@?T/  `00 @ C @ F00 *S 0 000?0`?SXP10FE>WP `Ѝp$| 0@-$M8P0S 0@V@$Ѝ0踶%0 0/H+0 RH+A-@0QS`0@S` p098p QP@@qp00P00S 0&)ņ(\^# ;#;0bQT |` 0X R p 009 00R0II( ,0@x+,@-P X00S S9 (,0 @ T x+p0@-@TI0 qp0@ @}01px+,p0@-^ 9 @ 0@&)60 P@ ^@Tx+0 R& 0@-00S0C(0,S0@ 0S!‚"\0PQU00000@/x+P0001S0 0/Ķ%7@-P R I0 00# Ѝ00R 0@!"0@@qp Ѝ0@`?x+&0@- 00qp Ѝ80098<@ q|/ 00\ /x+A-`p PP"@ 9 @0@  P09   \ 09 r`A<+x+@@A-p`VY@  @ @ 0 qP0 0y0 ]T  00q0@A& x+<+0P /x+\ -P0S0@  / P2:1S0BS /C-@4QM`@|@0S1UA:ЍbS9 .S8 00C S 0  ? "OP >cS@U:>0@0CS000 000C/  0?NP @@@++%&5&p@-@P 0SP`pPQ ;P@dPQVPB>h*P0S  p P̶%$%M&A-PP`p@ 01S E*0S  R@ *Sn#0S 0Sn0*S0S sS0 dS0 k0C?o21@0@ 0C^S0SP@u0C?o2+@-TMqL@D N@N<N8NTr,3,!4!!!8!! ,p,,p<, #,,,H%--2-M- +x----,u-,--<+͡---+.T% .4+,+p+,+U@  U !UQ0-UQ00  \@0#0P2 PR 0 a0CS00 0-P  | 00P= 0Sa0@S @P000S. ,Y{P& 0e`0,0W0@0S 0! g,P 0Sw-P +a0ES000 +P +0 /D: 0*U @U !U<30S 97R0 <430S07S ;07S 00l##4.10@S @0007S9 P 0S S30S PP d0S7 40Sxn ,#0CSPwd ;P $0FcS000 e`!0 S $0!R0)?040S $ "/0 S 4%0!R0)?0 b!R00 !ı50S!R0 !R0 0!ıy v5 p5 !R00 !ıd(60S!R0!R0 0!ıR !R0)?0F60S 60S <`@0 S 0-70S y0 S 0  6!(gR00 !00V 0R eSd0C0<0S d 0!0<0<pP0yiP0b-`Q 0!(8 STP3IcG\80S0SE=> X8@ 8D 8H  qP- 1,9000!R0 0!ıX900d90 00!R0 0!ı 0< `0000!R0 0!ıp ` `<0P 0P0 0!ıP *P s P !p R0p;p;0/>P }0P0 0!ıPs ! R0;;0i0P0 0!ı=`P \ QPXh=qpT 4< gP0P0 0!ı=`Ph A0P0 0!ıP 5 351<`P+)P #!0`0,`LPY(P 00,004 =0=0S:8-T V D10 |p)PP U U ?Vo!P0 >]PP U U !@0 MPP U U E!8>0S H%9PP U U.P6!0P. %(P0 0S .00S>0գ?00 ϠR0  B ? 0 S /00S0?0գ?0/0 H 00\? p?x?0S080k>00S/+@-@0 S!0O-S`MPp``@ pP Z:T8 00"1 0T S@D0X0@D@Ѝ0  0=80 0 @S/o" R 0CS0 Q  S P R 0T@180 0P R* 00P ~  80 _P ` [0J0C+O-pZ鰐X& RP H P`Px` [ ``F 0R@ 0R U *0@S0S  Pp.p@-`R P@ ]0P @@@ 0ppM-@Mp @00PC  RT0Ѝ `? `<P ?0? `P<P@7@-@PPe Ѝ00;SP0;S@@O@U AU \00SCBD00SBC0mS$00P#0 t,h+4+p@-P\dpHPV@^8^LP gP @P%C @@A@@T AT T ep00SCBp00SBCp0!@00CQ#t0 DPp@{T ^gP 0S0^  PA0dP fP pipt,h+4+@- @ @+ @-p@++. @-p@++:.2G-pWyPP{ P0`ypЍ\@P 0pqp] yy?SZ ]0F0P 0S0MS0+S0GS 0US 0US0UES0UnS0UdS@0vS cS eS0@UxS 0@Ur0 #@U00Yrp*p++_.p@-`l@PP.;O,*;0XV@` `#;D Op*p+_. 0 + 0 +7@-`P@ PP 0S  P Ѝ0+Po/@- * ЍpA-`QpP P P@P%U0P 0 P l @]T @P 6/P\.+.@-~x 0pl ll0P \ \D0P P<0P@04 4 l%d%. .. ../ ///T1C-M0SL @10SH 410SF pP` FPUi0@?o20S@ [PWVUe@ЍPЍC 0@Sd@ 0DSd@ Td@ 0DSd@dT`P fPE!U@@t+p+x+G-@M`0PSS00/ @ R S"\R" :R R D Z Pp P 0H3/0S@00ЍP P/@-ˌp [' )!\Ѝ00S @  h t)\0PT T W' 8@qp $/p0,+/Q/s/O-@Ġİ`PPPPPp0SWpV  S P0F@p U0 PPUP@ RpP SpPP%Q%p@-@QP 0S R SppQ0 R*A QR 0S:/@ PRS:/p@-`< PPp@pWp@/ 0@-M * x@sr  , PP  000Ѝ0<++400S/@-$@P P@0,<+@-@P  <+P/ @-p@&&0@-M@%vPv00S@(aP DP OP AP dP oPi(|0t00SЍ0 vPP0 00qpv00@S(0+//%0O-M,0S 0S b0S@ T z P 4X ЍQ @o Pp 00s pPPP``P# PP  pPPP$0S P``40SWPTPQ ((@'#PP3`00P0`0 xP0`0 .P X ' gZ 0cvP% 20SP `EP   @( YP vY |2 hd2 p EL2p@20WF0b,2P 0S ^P (&wP11P %0S (.1 \ >P H9P h1 PYL10S Y 010 (0 $qp 000Sp 0 :3P  R0  [ R 0 0P: l X .<+8+#30,w0+pK0+@+,4,+,+D+p+H%X,,<%0P0@-@<+00@-P &@+0A-`pP`VYPU@JTZjP0, 0 <+@-|P@0 @ <+ 0 <+ 0  <+p@-P@!@P Pp@5pp@-@`P(PpVU p@ Pp PpA-@Qp`P `XXUrG-@䠟@P`  @PUЍppPX7EP X8p0SkЍG<+@-W00S@ @y<+0 R/%R %R0 sR0/@- @PP +10G-`d*d@p00CS0APu U   0DIS  ;XTX"p@P0 P00@- 0P1fA-@ 0 0Rp@`0S00 R0R@@0`P0S U  QP@00P%Q%O-MpG@ P!`Q[ Z@P[@P) 0 000p0tЍPP P K X P VPAP WP00pWpP%Q%$1@-@LpgPPP Ѝ@r@o@@RL0L 0P0`tW @W Ѝ胥kW# A-PPЍ0S `pF@C@@7VPP D00@ 0`|tW sP\W-s V@-@ @+A-p@`P@0S 耟P@0S0# CV* UR@ R %S0P @# CV* WR   R %S8 P0V@8+<+C-EMPPEߍ@ 0@qp `,rPڬ嬐P ` P:T0S EP @  a0Sp`P  OP@+,A-kT10S@Fn@1 RpP> (Fa1Pt`q`n``PP0p0000 00`sVP@VpW #UpzVW P0SnVЍ8 UeV@+41+1Q%P%=1T10A-0S@`"@0P P`s@p`P>V@;V9V+\1@-@<P 0{P vo般#30@-M@P ᦳPۍ@ ۍ1O-0S# 10SPpP 0 `|R@0 -R` h<P PP DE#@ ЍP  PP 0r U ` UV @T P uX%XrqP V@T@P@T 0l000g@`<P(@=0SU,+o-`1300A-`V8@P|!pP0 PЍA"rPo`D@A>@@@ 0 `yr`U^U@YUT ЍAЍ+11-M frP  @oЍ0@-P@M0SP @UtU DrPX @Ѝ0@T@0: S *@T,P%`%@-M@BrP͡00 0Ѝ0@-M0P@  rPh0  R\P0  R\ tu p0St00Ѝ0<+++/k@-@P P0@/R@-@ (0@0Th#@P,@-40 R\00S@#@ + ,h00S /pp@-qp @#qpP@ QPpp|+@-P,#P3#0 R/   +O-$Mq0Sw@P`0S\0SOk@HP`@100CS kDP`@ 0S"P`0vu0 @ 0尠00Rᤐ000  00 0k 0 00000000 0000P`HP$ЍP,L,+h++p+O-M<`8@p@PV t30Sh30S`o`V D3``F`V`utV-$0S 300CS QP ""Uy"QP ""0S6 F`&+20"`Pt0X 0SJY/Y @ Po"V<"0 40 ut  20S1"0 000 f0 0 10S*P10S v1*qp@PZ "P"P41A}"P  "qp ,10S R"P ЍO0G00 ЍO-V utS 00St001 ?Q*)@P9ut`dh+,,,%+ +,,%1P,|+ ,+H00S <0P/000S $0@/// +,,h+'G-pP(,`@qP"V 410S(1`V``ut 10S100T T00 0;*`+*00oᨂY J) qp00S@P W ЍG~!Vv V 'h+P, ,+,O-M`oP P @,P! ЍO&!qp@PV00SЍO0A!P00 0@YЍ!pP@PX p 0Z qp0 @P|+h+,A-p` qpP@VЍAw   0@2Ѝp@-8P@0SPpUqp @h+0P  P/%0P  P/%@-P@p@-@PptP0S T0 0S @ 00C0QQp@Q  B 0<+%8+0/8+G-`$qP@U P9 Y* QgQU&8Z@\|0 "0XPP00040000( @0@000S < 0P00RP   0%8+P/P // / /00//000////0/0/p@-@4PPP GQ4Pp4/O-M cDa {rPX 0000 0 (MP 0000 0(XQXQ> 00  0 'P*Ѝ=ЍO# <O-4M(0PX0@ ,0utB @P4Ѝ40SU400 ?QW('@PP@dp00 0cp P7jf  ` V0,@ Zp` P P@㴣Pv V}- `6V@P,0S1 h3Z1 @P(L30pW0, 0$ `P" R $0 S S` P P  `VʏZ:P `@T_ @P[ |20S  P0 Y (0 S  %PO 20S @0  1 R00 SA> P Pe p 4ЍO V  P0$ 0PB R \A0 Pp``@1`@P!Z 0 0@P_ V V@P P P P P@Put 0u 0@P_|l00S V V0 0 0S a@Pn`0 ,+|+,p+,,,,,7@-P@P ,0 R  000 Ѝ0p+O-`Z =R+ =R-b [ =R<Z +Z -Z0Q =Z0 QP0QQ0QCo0S) 0 S(#S 0BS 0R\S 000S@  RG = Z* P+R( PE0P-!$,P3% R R R000#=R00S 0=S P,0E0P0 S0PS   Y PdP  PP 0S 0P /%<+a%#&2222223u.3Z3{33$0 RP  /X+0 14/X+$ 0Q/P/%@-l04 ,    00++++G-P匐剀H@HPT`ppP JT J  ) ! $ I I @`匀X+A-@4pP0`S 0P0aP X+@-@$ 0 @zX+P 0 R   /\,p00S/p@-m\@PPPpP 0S8@pPp  ,X+#%u6@-,@FP00$?Ph0 09  5;0@'<'8&4&0&00}6X+i66++ ++$+P/0/X+p@-0@00P0 0R 0.PPPPPPPPPQQPQ&H&D&@&<&Pp P0 Q00X+++ ++$+C-P᠁M0@Sp`"p`xx!0 0 0S[0@ 0 1 @,aP00CS9 `PU: 0 Ѝ 0P  Uqr   Q   R l@S `P 0R } yP,tP,,T,h,X+%%d,,0P$0 00S000/,d,,h,p@-H@P0S0000p01S 0F&PX++Pp@-`0 p@PX10S P@@p(1@0PSP5P/`0P@@S  1CP0 1C"@P 0S000|  0p  0d  0@@Pz 1CP +X+++ ++O-MdXC00wvP1S0& 1S8 g 0C# RfY) Q 0 0000P20S P 1wvP  S  ps000ap1U 0S Z 0 S1C10510S)X4 1R.sr0nS`/ S`0F[/ 1R0Ѝ  ` 0rP  00KY1 0[0 `0S% U "% 0R 0Q0tP 0C001萄 S vI  0X+T,h+,++|,A-p00PS` HP ` P 80@0@D@ 00@TЍ,X++p@-P@ 02p@A-`HPp@GE$1S 0P $@@t+7@-8PPU Ѝ0@@ @ Ѝ0,0 (! ,!/X+0(! ,! /X+P 0@-P/X+P @-@P$0P/X+P @-i0000/0@-S@ Q) 0S \Q@AOoB@0Sh Q S Q000S0000Pa p@-`@P 0Sp(P pG-phhE0PS`01SP00100P0W PP- U p P Ѝ010S00# pP0,Fd0q#0 ` F$ F#z 1R P@#1 R0,dP0 d0 0  0U*P0C0#0E001VX3 R 3PR 0 ЍG0SS QQ C0  0ЍGRP*pRS 0 0JP 0S0C 0@` 100P0C000jPPUF` 0Q 00}0 PQ_VP P0SPPA0SV_0Sh QPd v 0 ЍG*_V P` V10S t! RS 0  m_PP  P P0 6PPP0  B01S0R4ABᏀ@D  pP@DT0CR0S*A8A@DP  0 )0S pA,X++ +++p+,,,+(,%+DA-`ApP V P = CP  V10S ! 00|QS 00 0S$8QQ 0XP< R0$1a 0S0S G00S$1R0$aʈPx`P F F)00z$<0u0$10P0 0S $X+$,,++t+@-(@0S =\00X+G-PApP 0P0U0S = CW`dq, `0S( 0 0S0000Ջ00 0C0S [10S0 0S  N G7 GjY 0 0R  7x00S U d00SX00S D00SX    X++,|,T,++,<-0 R!  ^ !0X+04/X+0 R 00S P@0~0/0P 0/\!4 0 / B  0/X+,0 /X+qp/G-p`@P?pP 儐u U 0 " 0 W 00V@00CScP P 0P@PX+,PG-P0P`SPpЀ@ 0@D P V 000U00C0C0y Tʌ'P 0 BJ 0 Q@ @D 0@DSBX+,G-p@0@`P@0W  S #R0C00C0Ѝ RP   C 0 rpGA-0T@Pq1`EP q 0P 10X+G-1p`P0@\\pqp 00R00STDP 0pT@+h+X+p@-@ppP P0S0Bp 8P%@-p 0%80P/ R/0 0S 0 /+00 0S/$0$ R +,64+A-X@ 0S0dS 0(0,`Pp` p U`0+6X0QH0H 0.4 00/ 0 0+++A-P@T  ^#0pP4 044 R0@pW T  4`0P ^@Q 0࠱`@ 0+O-qp1P0PSPU @PP0⼡p`@` V  RXWA  0 V 0 0PW @SU)PA `Y0 0 w W`@TP0 00 0` qp )@PPAp ` W0 0K0 0`qp @TP,+,P0G-`pPU0  SXW@ U W0S P)BP @P P`@V0 0 0 000qp0S@P`P``@W 00 000qp0S@P`V@+,G-`딐P@?ptu00V00S 0SP@`P@tu TUPh+G-@P匀ሐop0`P80 @p 00 0`Pqp080v2+,800S/,00/PP//H,P,00CS0 S0 S^_0 /O-P0-SP   ~ 3\! qm\pC\P\@P0S,@ 0S 0S%@T AR@#\l\\BBX C A  g0  ЍO*`P @@ @S4 0 A5]@V64+W# G-@ $P`P,$xopPa `c   @yz  0Z Pp@ ;p Tt |p@pp 80  p6un4+C-`Gqp p_qp@@PPW.Y T0 0 Ѝqp 0 p 0a0@S@-TA0@S<0'@ Ѝ'P( #P   ,,`,7.Pp@-9 $P" 'P= P !srp p^P 0 &- P& J?06 pPxd0`d0 T0f&@PAP,@mf006p/7<+,=2h+,G-@tPp`4T#0 5T Ta0'000P0p0 ?@6T` P'0,@-o0@-MPh@P  ) sroЍ08!P >00 0 &<+,@-HP!sr@Q 0!0 &,@-H sr @@@6P0&6 >0606Ѝ,<+G-6@PP`j>T6k.sq 00P6 >06PU p~>P0ЁPP  G P ,<+,@-P ,0 0R  <+<7l0l 0@- ^ @^TSa04S '005S #<+,,00@- @P QA6R 00,G-X@pP Pl`P>`>p6W @,00S/A- M`0\@pqpp6W @ Ѝ 0 PUP8;P P 0 \l,,U7@-  0mS Ѝ 00 Q @@P 0 S# B PP0P`0 S  Q0 R pV`PPp =pb00h+17@-PU0P( P@ PF0 Ѝ0 00S@PP s=P2l=5 Ѝ0@jH00S@ Ѝ0@ 0,0 0 +d7,+7%7770 0+<07@- R ,0,@P?@0 Ѝ0 %h+@B,@-P M# @0.S 00S Ѝ 0S0 0 00S000d @h ZP0@ 0R 000@(@7 %77,78$8<07@- R ,0,@P?@00 Ѝ0%+@B,@-P M# @0.S ~00S Ѝ 0S0 0 00S000 @h YbP0@ 0R 000@(@͡%J8b8,x888@-@PWP  @ Ѝ8@-@PP  @ Ѝ80Sp@- Sp00S p@t l0p`|P p@qpP@ 0 p@+8,,P07@- S Sl0 Ѝ0XPX0@PP <W@ Ѝ0@ <00 0i X%\%9P/L0@-@0S 00(0 $ @,D+, P7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@P; Ѝ04@P,0, 0 10 H%D%P,L%,p0/0q,P/\P @P/;@-@S|C pl[@0TxSPLHD~@|<z8x@a%&9,9C9l9999<:p::@--0@dS!@S1 CR&0C  R 0Q0 . Ѝ@A C#R k C Q 0Ѝ        @^P @f \,:q :;O-`-@MLP00P@*0 S  ?  000C/  0?ppT*000C SY E0!R1PT*0@ S 0,S UH0@ P0EPE1!0C, 0UЍ +%%@-PM MP 0@}ݍ Ѝ@` @:0Spl0 ;9| @ݍ ЍU \:Y HP(90SO(a:%2;+%H;p=;P@-  0S 0 0ЍP  R lЍX 0L H 0<040800 0000000Q%P%X;|;P@-M 0   0t0c @l{d P 0S>000D ;0Ѝ,0P vg,|,;P @P/h 0 /;+P/00St,0/@-@0SHp,0/@-,@0S0 0B00Ѝh,;0/@-,@0S0 0000Ѝd,;0/400S/(00S/@-qp@X,<+P@- 00@ ^S00S00 Ѝ0 % <p@-P0M % @!`P@@0,S  i0S 0 ,R 0p 0Y0S\ 0Ѝp40@00 00( }V @P,L,9%<=<W<P0@-MO  AQA0S1Ѝ0RS'DSSS 0e C R E C R   C R S -S 1 CR 0CrSdSWS ^S wS     0  E000 0 FK N R WR Q S-00 0  <,t<<800S ,00S 0P//,L,P,$0P/0 0 0C/,h+P,A-PU  @Ѝ`p@w㈀[P`V 00S0\V0S 0S@`W ፿P @`$V00<,@-0S08 04*U( Ѝ * U<,<@-Q00P 0R  Ѝ<<@- 6<,P/0S/P 0  //oP@-/7 0LP/, 0@-L   Ѝ,<A-`@P0-S0p00Cp S  P T00W`O-P$M cLP 00S S03/0L0$ЍeL0 @@@Pp 0 R @@-PJ &$PP 0@093@!+P0P0h0 P @0+S9P 7j79P/P0z@ pZ)EaD[@T>0S.nP0S -P00 0 +P0P0PaM   00 p @ =RP    B  Xp00aK[0(!00CpS0 0U ?o200@S 3/T_U 0 [ 0S00S000 RL@<0 0 R 0 eP.00S ,,D+e=,== @-@PM @PU`p0@ tTЍU  i  B U R{  0L"00CS0U0S U3/U@`y 0 LV00SYS_U 0 1  U# U U 0?o20 0?o2P0U U U W0 0S00P0S000 P W 0  0S00S000ESU U U I 0S0mPS000 00SH000V S=== 4+=>*>p@-P`@ឺ000C S0 ` 0 B ^ ST00p pS 00 000S/P/,,@-XP@PL0  0S0S  0  03/$@E>%, 80S/S/ 0CS/$%O-@DQMp0S [; 0S 00 Ѝ`V$P  & 0P  AAQ-P $YQY0 r0 p@@OoB0 0S `0 0S 0Wpp% @-PqP0vP$%/@-0M@20S4响P 2      Q2 0S@ 10@@0Ѝ! 0R0< $0"1 S 10S 10S|1 \11S(  P2 P!2 R@ ~$10P!@0000 R  RP 0000S@ T0 0S T`0 !PL 1 10S 1u0Ss 0#So @,,,,+,$%|+%8,@- ,@- 1 Ѝ@-P6`@@@s 0`pQ Ѝ@-@6P L3P ,G-` @$pP 0(S%0 ߯ P@@@0^3#@- d 0 Ѝ,7@-2"P@?@ Ѝ0@B@-<0?B3c/ ( 0 0 PЍMb@B404@-@@T OP0  (%4,4+@-@0@(%0$R/ $埾4,p@-@8P 00R:0 @0 $p(%3,4,p0s@-@@d`D \0 Ѝp吾0U4@1PP/,4,4+@-@@PC- `?@P!M0`p0PƟ0 0 0 eT-00EPN3ЍPA-PX 0`p@ @ 0&o0 P dU-  D@C3ЍPO-0M` p! 00@C QaCQW@CACQ7@C@tT?0! `?0 !@P4PX ZЍO-PMpP 00@C QaCQW@CACQ7@C@tT ?0? pQ ?0 ?@``PZ UЍO-PM`P 00@C QaCQW@CACQ7@C@tT? 0 0 `?0 0 @ppPY UЍA-0MP@PЍ%P p@0pnP$ cP& dP %PsP xP   @`0P`D@0 0 ?`0P 0A-P@`p(<ܼ[ 0 $4,@- R$00S20 P00S@Fo p@-@ 4P0 4堻P}p@ V00S민hʼd0`l`P{룼H0@뗻80@0@S(0 p@ 4,,+0%++4+0@- 0 ЍuP7@-@PP Ѝ0@(0  0~ Ѝ0%PPp@-@PHP $@?P Q800S00 QT㰶p +4+@-@1P0pSQ )ƶ000 @2U'Q㶶0 0 R 0?o2 `Z=P 1W Ѝ@HP 1`1,`,+P@-@P 100o/O-|MpP `@< 1 Y0 \0ACX 00^YP P0@     0 W" !Q0S|Ѝ@0/0S00 0 0xL P00CQS XH 0 R 1 @0^AA ,/Pp p p D00/40@$0@0@D,h+800@- ,00^ʎ1C0@ @h+D,@0@ 0 C\1/0@-LAC\@c0h+D,000@- $0@0P0CQ0 @h+D,`0 0 P0H0@-0^@P C0/D,h+<001P/0 R2:/D, 0Ah+0Q@-@ q1!0sr X0L1!0sr $0A Q D,h+A-pP 0RX@` P0@00yvt 02C!A`Ѝh+D, 0P0PP@/h+0 :Q Q .Q 0?Q  \QQR/ R//A-`@p0P; R0C @1@C" /0000L,p@-@XPqp00T00S 00CSp@_@qpph+@- 0 @ Ѝ@- 9 Ѝp@-@0PS b0C0Spt 23p0PjS BS bSp0mS tSpp0000kD,p@-h嚴d0d 0`P;@BS⍴N ≴,PVⅴ₴p , L,D%C-$MU0`S@p`d$Ѝ:S/ %S .S 0 pU@0S0S ?S \S0S 00@ 0X 00~xX@KXBX] DX. @4LH,X؀PP6qp@40S(4 P40S I30S qpv P s Pul P3 qp nP" fP0-~^P P3Xq 003BH@6Xg Q0R 0 Yqp 0 O|2MP0t2t"0 \ P B B?Ⴟ8qp20 PP01P 1011N1J1Ef. P \1=0  0R0:P0P P[˹xy 0RQ s0  0R0:z0P ꨹lSA Pb ] PPP$0UPL,uP, p+<+,@+ P,h++8c0D%H0@-@@00SOoBü(0(01x0 ,,L,D%@+0lD% p@-PPp P$R@ @Tp `$@R@p\ @R @T @R \ p @$R \^ 0R0 P00\ 0/ R0 P00\ 0/@-@P -00@p@-P@T `0S` 0 p`c0@_0000`S @@0@A-@QP` @$ @ap0W0 S 0 R 0 0 ]PЍ -P 0`0T X0 @P d-0T0 .=-`,`,A-p`@V  ` R P ( ^QPR(;P" ^ U!R ( ^ P0 0 Q P$^U $C 0SP` 0 00`Q!PQP "Q P \U!0SP `0 0S0Q  R \  P  RQP0  0 U A U0QPA00  @-oP/`,A-M8@0C0p`pGP4 ϦA XЍ0 H/o"^ R  ? 0Q 0( XϦ@x,O-$MP`T0pP@0L00SG RD L  R Q R*H)  H00@00000 0 YH  )-  0S0S @ 000 000L000`0C <P$Ѝ@`,0    /`,0A-@0S rPT(`V0(0l00Sdp@ c(`qp Cf@00CSd(+`,4+h+$1O-`wvB 1!0РS ЍO800S 3PА@00CS>& ЍOôU 0qp  L 0ZqpV Q `P@ Ѝ谶%4+%(+h+p@-P@T <0@@@ @p `f+d+@`,x,p@-PH@U p@\Qp@(0?o2(0`,P,p@-P@Ĺ p0$ 0P !U@p,O-M,0`70( @40pqD70<0<78 @ 70S 70/S 0Ï0@{t (0, Prs007S(00(00 0,00$0 `000|60(0, rs  T0000S (0S0 00000S0S$Ѝ0H 0C000L0 " 00 000zy+  0Sqpqp0S`+00 00S0 @ y40S PIUPe U 0< 2Pm40S 4L H@0|4Px4U 'VPR `400PP40S <400S0R0S P 4L0SP```L0PH e3PPU7  T  qp R#T0'L0`     h ` D0ND0P T 0P@TX\P* * P ` @ PUaP 0 0`0hP0p`PL0 $P  000 00 L0`$00CS$0P20S r000 00 L0`p408 CPPI h0S8 Z5  `J!` 0C pQ0_00 p0S0' 0 aP0o 00 0S0<1YPPYPUp1) )0S0$0`P0S 0S < @B X0C  BS pa oZ0Yp0Pp0+h+,D,P,,,L,`,,,,$,,, ,p+4+p@-P@ < 0 P !U0p P$@,p@-P@᩷ T 0P 0 Up PS @P@,p@-@`PV0000S0 r| 00^0tu00 U 0S! 0P tu !R0(PpVp00@00S 0Sp(0(0Sp p,%%x, ,`,p@-P`uU 0S0P@T0 P@|0 pP(@[0 00000@pp@(0P00`,4+@-0PP`,O-P34Mأ@0 40`p 0P 0 X0S`p$$P4Ѝ0 $ $X0X8< rq ut00T00S04\0`ut 200@_$0ut  sy00 $0Y0$P @ut00V 0S 0$0(00X00$00 0 P#srJ RD R 0E0P 00@PP; 0  <qp@PN ` p%ut \0@P$100@_V `p000/V0V`p ` p @ P0X0  8< Z000rq0S Z0 YP 0 %qp`p000 040*`,+0@-MP @tu 10 }Ѝ0@-0 ( 00S@`, ,h0p@-@^P HP0 pp000S(0SppL%`, ,@-$@$0S000r @`,d,,O-0,M "0Qp 0SGyP pC 00#  `PH Q ,Ѝ,S0S 30S 0S(0S 0(0v0(00P2 X`@PE0qp@P[J)@PutTXPJ1\R0 0#@p HBHb0 0 0(0m0S 0S >20SX` 1``FoZ@P 0 @PX SiX1)`R@Put0`V@P@P 0S 00SL YJhG qp QP 0S 00S3 `, QP ,,,h+,,Q0@-$ 00000S@[T ,,0@-$ 00000S@J꘹ ,,㦪@-鞯8Լ0 000O00S@3 ,,@-@P 㾼x0x0Sd㴼㱼P@㭼㪼㧼㤼㡼 + T ܹ 1A-@TPP0 ㎼8뱮vƫㆼー CA}㸫0 @ P`p 0RW 0` ?00]<0 ,00SA", 4++h+4+,G-pl0P` X @ ƷP 0S 0S S~,A-` pP!@6E%0Up0P ' 6%p@-HP@T<0   p 0 ?%=%;%P%,O-AM,b MoCp+%W A0 0 PP r0S0000Aލ Ѝ0!S  HPA>004S S S `0PS  00 QP4 M0S  HH P? 0 ^R0 P\ S$R0C 0M00`000 \P0C R  C0P%,O-pQpPpMW M ۍ Ѝ@`S`ETpL3LC  DsD4c PU Y< 3T U/P2@DhPpp;@ 85 @@ 0 p"W V$x S@ P$T<"0S000P ;04P S@ k0 Pp 0S 1T TP 000000@ 000S @0\0 0@ 0S @00 0Q @ Q0 @0S 00@ 0 S 0 S 0 S  P ? U00`0002,P%#&,*&>QD MQ0@-@PP P pP `P R?Pd?P%XQ^QeQkQ@-@PAP P @qQ~Q|1O-M0S" @`0 ЍO`8Pp00 0 Ppxy@`Ѝ00S 000S  0P @`;@ է0 00A0 # # 0S,,Q,,\0@-PP R^0S @T 0 B,P%\0@-PP R^0S @T L0 B,P%0/,0/,00S ;/,@- MP t>Po>P@-0,//@-L@I '0p P S0PЍ,\ QR0* /QS QQ*/0000/@-@P i"000000/0S 0C0//0@-  0#3@PP @0@0@-@ 0PSR? P ߦQ`  R#"` PЍpA-`pP@T@  G-P`"(F$,@p JQP 0$ GdFP@P7P/P?/80@SQ 0@/a0@SQW@Q7@A-`@pR   ?PP@PT*?P #SP0s@-P00 a0C@`S0 PЍp  000@@0 0 0 0 0 0T A-^\^1!0 i ^Q1!0 [\=[^Z ^\00]QQ$ ]Q0\[Q`.FQ5 `@p 0]QV 0@Q0 0 @\\@0[T T nT  \TR  @0\000,/,QQ R p@-0P @R RP D D <@D@ p@軝 @*&0,/,/R1C-Qp`Mp넁0@ `P0Y 0 ,,PH D1@<1`40 *i\Y R T R 0 0P@ 0  [R .0B0S83 0  00]RT[T@ 0QT 0QST[@[T0Q[S@,0 R Ѝ/,/,0,LRX8,0@-0M M00P/S $S+ +S00+ 0 0 9S#\S @P0 0 h0IS@P \00ۍ Ѝ00@00 S00@0,/,RbRO-@T Ѝ0tS bS rS aS @{S000pW G`p 0S0QU 0V<P0 0 PUP @0@ p<0 Qhb`P,8,0,/,RO-eMo?Mp0 P\W ?/0 .h00 ϟ0S?/0 t0^0L/D? 0PhS ^@/ ? 0 h Q0S 00@00000S 00@0p00pS 0S @P#S ;S 00 P00@LP  P 0S @,S|P0S 00@P  0S  00@aW = -0 Q@pQ< @;Q }Q 0,< 0XP @\P 0`,X< 0xCPU P@0(, < 0D5@ 8 < P <<0 \\^ 0 ^0\ APP00v0I S mP0S 00@PH;0S000+0G:p f:*0 0S 00@l0S 00@`00P0S 00@xQ0S  @P0SH X 1@( u9)0 |RP0U 0 ~Pp9p)0 P\XX090)0 Z$ M0P8(0 LJ4%]P M0!0 < 8 SR$0 (  %800H 0$0  PP R00C0 0C S000dX,< X0P7'0 0\RH [IQ␸0S <<00S ,d< 7P00A i 08 [0%] 0   0S 00@\0gSk a9SX0SvS S 0&6 0[08 9R/RR0C8 &R* P 808z\R \ 00BQ0 S 5%0 L S00( 0  \ R5%0 n ;Sf IS00pS wS, iSY 5%0 R00vY. E'0"S Y4$0 5K  0S 00@<<0 [  RR< S  4 $0  X(40S $ 8p 9  U@P M[ 0S @;S ABg0110P\SS,3,#0 %MD  P2"0 x< @P 0S 00@0@ Hpd`2`"0 0 Hp Y 2 "0 20S%000 S90S 0Sw @;Se }S 1!0 4v)  9099090H 0 p000 XH 0S  p Usd  pYP9 )0     囱!1 ! 00$ ( 9 09909 l*&,',0,/,Rl Rh%S:SRuSSSS(T/, p2TMTZTq,aTvTTT,^UVU)UUUUEVVVV(&W00eݍЍG-`@p夀@rPU@T00S Gh0d0@T0 0S0 0,ap P,0,/,8,D8,X8,T8,RWp@-P @"000P @p%@-@   0@0%0p@-PPUph9@P 00CS0ip hp0 h/,A-lBp` R3 RQ R P$0SV0(  R R F9$0 P,xcP0 P0! 8QP$00P0PT0, PP (00S(0 #R nR0V ,0 0200#0$0,0$0Th( T0R #R nR   RpG QT000(0V0(00P R R0   $Q T0P $w (0V0(0 00  T0(0V0(0/,p30,OX@-|@X0  0S 0S00CS0Dhp X崈0  /,O-M DMX0`Sp00S 0S b3X0X0#\030 `00d0弓XSXP 00CS0 hp X|X $pP0 V0 X PލЍP2 gp0S *706P 05P p4S 750p0p4S \PP gP 00\05P|p0`0d0S0000d00S 00Sj 60P  Gb0 2 026b00S +厛+V P0 %b0+‛0+J|d6J'e|! 06 P*6\PP g@7P\c ( p$ 5\0p !5 0`PS(0x07PX30l00,p0\`0P l000S SP@  0 l 8(00(03/,UX#&^@4,80,@0,yXXpXXXYXu@-@P aXP@-@@MP aXp@-@PPp 0 aX@-@P`PP  0%p0 % Ѝ@8,@-M Q qM`0S000@03 0@0S  0Wa 0 0S S ` 0l7@P *0 f6 POf0 00ڍЍD8,,0,00,@-P@  Pxa \0 P`p `P 30P S x a ЍD8,XURG-pA嘁0 0`PU , R:(,>00( &U# \U   0 R`Z &R\R`P , R:(,00(P    "pr P qu PE ,  R:(,00(     0D8,*&A-@P p0R`*W0 0 ٔ 0P P O-0p/pOM 00dPЍ080D?PU 0PH0 \ 0y Py P\^ R2 0S >00C S0 0S4 0 P0 R h>0R*SL>0@o(P0 00H0P 0S40P 0 R =0R=0 0S= 0RR0S0S4 0S8=0@oP 0-=0C>S00L0 R: L ` 0 p``c0800400S|<p<8 00 X\4 00U<0S   +H0SP80S4PU 0`  EP0800A E4 ړ0T P !0|  004 0t 0dd  0D;v 0{40 00;0R( <0p l0P 0S P 0 4P2S 0 @❬`0S0`V: A$5 200@ \:@ͭ0S ȭ8 0 _ @0 P y0 @0j [0`V: $ `0 0C0 P x0`V:T  `0  ኝ[ p SP 0`V:`8K8 m40 aV : ` 0 0\40 SX88 00 @h4 00O<0S  P108060 P+80S'g4 00)<0S  ~80S04p  Gɞ`P <000F pp40< ( 0 <0S  ^V 0400<068 00 V4 00<0S  FL0 R: L }` 0 pc00p[ R  Q 6 D6@0 ^4000  P 04`Z Z Z000 G 0Z0 00 V~ Z0 0RP  l0 @0   PQC p0V `XOd@0p0<@<p(0000S \t4 00V<0S  p P[ 80SX0sFL$L0p@0 4]Q0 0  0p V0`0  `?0P  0 RS0 0 p0V R`0 0 !PP04 0g04 0P _0P"0 000S 00P80S0s"k0p 4 0>040P, 70P P RP0v(`<pL(p<80S4X ! 0`Rl0004 0V*0000p pW10  W0 d;0H ! R0U0P pW*0$ ("1 0X`xp@0`h0<@<h`x0h0G0 0G2@/,D8,t8,, ,0,/,8,h#&%$ht@700, Y@YY0,Y\8, pu(&8,e<0 0R,,0Q 0{Q  ,u8,p@-@P`Tp0wS {S sS 0p /P 0 HK\0`@p /P `pG-`pNPcPU00)\01 R  @PVAGWp8!p!Q <0A\S00 0  [0 0 00 00 00:Q 0Sp0S X00 0p00 0V 0S`: TpP 000BS ?U8,HY OY0p@-P@`T P ᇥP, 0S)00 00C?o2S Ppx0 0S00\0 0S00@0 0S00$0 0S00@8,% b1-0@- MMP.@P X r[ .p8j[+ . P.ۍЍ0plYH0  BR R R1 /#&#&@00CS0 S0 / 1#&@-(A0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@;f9,0-01S ^00So^ P0\ S0S Q0S R P0S0S0 00Q R  x6-9,0@-  `Ğ\ @ T\    %R    9,x6-p@-TA0 5S <0S -0,!0<oaP0U&!0! R8  (P \0  ,P S0  4PP 做p@㼇00\P P D 704 01P$$ASpx6- (:,$:,#&p@-@0`  %,T  /tJh pdPPT p ᅘP000ST  @#&#&|Y8,Y@-@P P;@P @0?SP@ Op Ѝ/`P@NP 0S SH08e0Sa00Y YYY@-5 S/*,Y#&0@-@<TQ T00 ?/0001S R0Slp@TX` T@0$P@ 4#/T(8  0@/9,#Z*Z#&x6-1Z=ZFZYZcZ@- /+[#&7@-@P  &0S 0@T 00 Ѝ00"S sr@-@P  p YЍY[A-<0``@c# ^p "RG ^<0c#N 2 R%0 0p2#L @ "L /0 0p2#L  "L /0 0p2#L  "L /0 0p2#L  "L /0 0p2#L  "L /0 0p2#L  "L /0 0p2#L "L /0 0p2#L "L /0S00//00//H0H 0p@-@P@!R0 U0 ,١0P01pԡ,,01//00/00/00/00/00/ 0  /`,V 0  /`,00/M00/[00/[00/_^00/[00/[@-@茌,00/@-@贜, 0  /ጛ,M 0  /ጛ,[ 0  /ጛ,[/00/00/00/[00/[00/[00/[00/ \00/\00/\00/0\00/=\00/H\00/G\00/R\00/ᭅ00/100/B00/ 00/00/\\sO/gb@-0  0Ѝ@- @+@- ,r0$%@-R  +@- ,k @-0豟,, @-贒,(0(%@-R 贜,  @-e\ @-0艏,, M@-苋, @-芎, (0(%@-R y茌, < @-pl,< @-gi, < C@-^茊,< @-Vk,  @-Mk,  q@-D蔛, e@-<, e@-4ޔ, e@-,, @-$l,  @-貛,  @-j, @- 0-,0, @-l, @-i,  C@-茊, @-., 0$S00 @-0, @-@DJP d 0u 0@- 0|1.ԡ,p@- P( dP& <PV 400C`F V$P SuP4P 0CP  @@PPt4P P0S 400C`[zk1SR !0C B/?!1TB]1NSAPN0 P ^A88#8xP  R11@(zP`PxP@a@1S020,(PJ @$3@P, #0@S002P0CP?P <P>P P2P 0PUvP tpP1aA P pt2y1S'ʰ1 A P at#yP 00P1 RE40S 3/d PPP d P,ЍPR0v :[ 0SpW 0j 3/pd P 0`A P t d `xd00x00AJ!0 b02P `00P000^xed 0:,. ]#&]]1-*& 1-]S*&R  001/0:,P0 R0//0:,O-PP$p`*@ [ ! : 0P@ Ѝ000 1\$<0P0 000400800<0 <1@000D080H040L0$0<0UP q`, (P1  @0:,^P/D0 R/0@-A1 P c< @㦘0:,O-0dBp W`H5f0 00p09 Ѝ0P@P 0S 00@ ['0 0 mP  5V0S  /V000 00 `[0S lP  V000 [0S lP   V  V0 00U P0IS0SPPl0 00l0S lt ?C S UPU  )i0Y!0C0S( 23PP PEUD:,*&VUUU @O-$MH0[S0P 0L`Dp= F0Y0 0S 0g σeǒ뤣`P`lal nl 0@@0@0000. 0ESET0D0T00Ө?0S0 CR C0D S0  0fIlX 2 e 0  BƊAS P0{ P>  PN P P!VUA`E Ds~@DP`4pe me je@`"PD P AP;  KR !   ` D0K~0@0!P1 `V0p00@  d`Xw`F`FV0p00@  DPE ~@DU`E¨` Y @  @T`— R   BT00000S 000 0 0$ЍO0Y S D:,_*&#&A-`PlPp `k@xk@0T `P@ P P0000D:,@-@Pp 00T0* p@Ѝp0 00㪍t` 0 0 @}@t 4P ⠲ %D:, _h0p@-P@XP0Ps H` R :P 0S@@Q@pu%D:,@-@>0000D:,0hD:,0hD:,-@-@00  Ѝ@ Ѝ/-@-00  Ѝ Ѝ/-@-  ЍЍ/@-@@p@-@p@-pMP@`,0 0( 00 0`Ѝ@- ЍuO-M P`@pj@jUjT0 0`P0 D0SPY 0SV L00SRDÐPPL00PT^y@DO@W ;p ߆PSWpV`KЦo`0 S`K0 o@PE0@ 9PT0 0Pj00L00D H0T =Z  Rp `u``ЍD 00R00S 0S cL0X3#PpuoP 0 "p똰8DCbb =}0 EG-o``PDC`bbD:,_1-@-,, ($ *Ѝu@-`$0P@ 0  00 0`Ѝp@- Ѝu@-pMP@`,0 0x( 00 0`Ѝ@- Ѝu-@-00a  >Ѝ Ѝ/up@-Pfi@kipD:,@-7@- @倆A6$VPU 2% 叇aL00h@PU "%T QL00000S$$N Ѝ0d,+,h:,#&O-CMH@`PP@ t& @啅Pp  PLCߍp@T R q0P0X Y \ ۨ @=R@<Ө<@70 01#& 1@-nC-0MM 0p@O}`P0 ፂPP* P GqP 0S0 0  y v HPPsP 0 Q00:0PzۍЍ0.0P 0 I90 0C9 ,00S/ 0P K@-뼔,T,X@-邅P P <@("Pq@+ C-@M S@嫓00{%P,  ⟓00S#{P  f0Sl Y0] M)PeA@Pa"Dy'(Dh*A^&'ЍP@R;W|P'P'20S @`P'.Ap0 $!P_;-| $ X$P 0)AT PxP AP p PP 0i+Q !S0p 7'SpT+ApW3Spp0W3:X# @PQ  R@4Q p0Q  R@@P`Vp003/P,00  h0S  R l 410!8p ,ԡ,,p@-MM+@(~+(h~B+(~B+^~(?PލЍB?P `0 @@@@@ @@@@.&B(>64F-MM+ c~P+ +~+ [~+0#~ ?P  >ۍЍ640@-M T1@@@"#P @  P A0$*!PRU)QX&Ѝ0RL00S 3/P 0$003/0$Q*gm@P3P/[P+W@P'_@P# 0Pz 0.:z  0S 0_ Z'P 4@P4o0m%(-*00 ,ԡ,b=H1-1-@-M ґ0@@@>(#P* <@8  TP 00*!R00$Q )@P  0S 0` f'P%()Ѝ ,ԡ,O-`M  0 0X#*0S ` 0 SS 0ip0 S00C `@Z0S :ƍPP @B pQ %S0S iSc %S, dS 0T PsS,200P 0 倠ಠ@ZR  @P %Q0 @0S0 aRT @R$R0PPR@  T 00S 0 ! SD 0 @S$SS0P @U: R R 00 R @ 0QR\P 0S  S t00@Qb0cR^0  3/PW Ѝ 0 |*&7@- @PU ! R uGH00 Ѝ0llP \@ !L : ]Α( (0['긔,uScnp@-@Q`T80800P0S0S   0p@{4긔,d,7@- @PU  "G00 Ѝ0PP |  d00S ywL L0[pn0 ,kBd,f,7#&s@-`4Q@?8hUx '^fbx]bt ^[b3vb]4xyd 0Ai@Pxx厶3~P >d>]!] txЍp1-p}#&O--}Mp@` 0 p V5 0S  P RF 0S  xP QhP L~tpPT Pfa_ ,F$(QU0B? 0DM)P  FPP  F00媋Px奋P; @  T ; :0S :fP : =#00x4$"0}ߍ3>_(3|3 40"!03140`040&2ȋD 0Nj 4T0 T  (0P+00  >"!!0@#  PM  XT $ th2P ttFA0S$@0 dU0 @"QS 1P l2 R0V$2s@T ̏ @>0XC+0@0S@ @  0R0SQ &0S  4 0 P9\vu0  PS $2l%,ptbt(f@d,,I+:j,= OT,(tY`0@-0,M 000000 00P0 00h0 PPP@P DD塴@0Q ,围 ,Ѝ0@(h p%#&d, -O-iMs?!0Z P 00iߍOЍ/Px!`P<1P 0!00F'`P z[p uP@& [PpT00Z%@EU0P 00GSW 010#S 00PpP@ P/(d,$ -O-0MT@pX   p$p屢 `V  @P'U` n~PP9P@P ?H E0ᤢPU m0'SP0U*S / TP00 GvX/0 0P 0@ 0 0H0 z{PX1Z * sᐡp`PUQJQ( Y2S022SP0220C2  S |S`` u$00 0( 0 0`0VPMUS5Q PPV   0%S @S B B*⹌ 0.S 0 0P1Zp@P^ 0A0 H 0 $R4eFRwu00 (q@0 0 (iP aq a0S  ZV0A X0E?o20S dMZ^$JZ^OaDuV @ x 60S. `@R3Z0u00CS00004DP0S gW$0S  `_4QduWU ^Z^X PZu,l5G0ЍO Ѝ/ht@1-#&0@-CMl1PP 0S .Q}@P8 wCߍ0 Pw l:,k;,G-p 堀PB`A@T:00Y W ,/Y 000 |P EQ 0@*&A-`Pp p@ ᨋ4 pw P@j<,A-Pႆo@~t p|w0S DQ0Q.SP @$ $5w 1wl:,^ k;,p@-M8 8PLP   Ow 8PLP  Aw {p@ ( E 2w P+U %t@ pPp` w 00 %@PЍp v vP!ij>,%i>,j<,8i(>,`O-MNQ H孱DD媱ێ,Pz`0尪S څ W:-8 4e0w=C $ C/y̽ I00y=0pQ>e0 vP400宅0 40P  U Ur0YR?; 0/sp @*<: R0 :P'P P 0X60,09kPt<|I.d̟ 0  0/P `0< 0 B0u`````UP0ۮ0tl= -D0+lq0k,ݍ<Ѝ>0a X1v| ᝆpP h ᗆPT; p{ 1sS1lS +2 0P%QP \P;⊆pP`~,v*0x*0worP\8 0\8WV*0yU l*0z\*0}\8@*0|y(:( R0U:$ R *  Q9ɟP \ɟW弩^L9    +X9 @H- A|)0p HA0(rp p=SrL9)10@@ FP 0H0H0A rp  AfYpP( 0W` Q|PSUppkvF n! JjtH p.~p0<((0~GŅP (P 廅P 嶅P 居P 嬅P 姅Pe0:4JP '0\6S '0,||pP 4l `XPH'<[7S/ '$@T&P<6&A!A~0\8P 6P 5&oP p:4S 5p _P \& 0APڴ  [L\8$&08\8~ pPڀ t  y%8P00Pڀ t  y%8P0040S\80\8Pڀ qt 0S <%8Pڀ\ bt  DyP000S\80\8.P0S\80\8p?h4S3P 0@?S @Pp 31t 0{HR##hRp#xß$`RX#W%R28#   .0S1 uP 2@T Ữt H+Hst#t00S p"X0S d"@z?3S3 UZ #s?00N?C0C l0  0pF0plxPP8A?%ێ80EpE,0x ,P"H pW0S 噂g VW5S 5!1x,oobXfgzX60Sp0 <EC V4!S< "0 0 U~ xl:,5d,S#&v%*&\, uj<,'# k;,j>,?,?,,c+>,>,J, -i3@,A,f6AMhvy~i"vX?,}Lu '2h<,B,AayP 01/, uC-鿏M`@$PoP3S0 p0 p :0 00p@00p~0/0 0P 0P/S/00 0 /S 0/0 P0%R  @ p @0 ߍ"*@-pCM`x@PlP#`0R\PP @ W<00040 `(*PCߍu7h,l,; 괜,@-@ @0,@-0  0L P @0@ 28 0/P   Ѝh, j,,00@-@XMPA0  0@$ P x0x t0E1l@P/Q  0 LL o 1 /R@0 @0(e Ѝ0l:,h,ď 0,j,h,,@-M@DXP⇂P  r r0 D 00Sލ`0` `PP0  0@ ) 00 $ ꌊ,h,i,,l,,R,@-CMbX6S 1P \8lP9XT20S H1\6S 81424" ("2 rPP Z10 c`:4S / XU\@aU A10 J:4!SO *00 0 B?|<||1@P) (1l 2`/X,H)0S 8!8"0!00S     = eP\6S U <xCߍ 0 Bl:,: ,j<,uh<,I(y|>,fk;, j>,"`&?,3i}FR@- @T^ S C @TR 0\0S0 @B_TQ "#0  @ ! 0  @  0  @ S00\RQ @  Q  G-PhM`p 0S%hЍ0 L03/@P 0 @P  Q 1/P @ @@08℠0:/P 0 083/P@@ 0\ P0//!01000/ 00#0//O-`$MPA@T Y pǀP00 0S 0S0S$ЍP P00 S ⳀS, R ,0S R : 8 80R:P3#///A-@MM` p" *0P pQ  Xd5\\ SS=S 8 d3R 40 $0 ڍЍTT9MA-`QM p@ \P  PP PЍLPTP t0h@$PU@@T @D :0 @wP[i0G-Pp0 '"M@puPP А`0 R PЍ 0L03/P  0G~놁0 A~D @@$0S P @4o @0o`,up@-P`o00S@ 0p@x'0A-!qP0ML0` 3/P< 0t@T 4/@00 } 0@P} 0g $0S  n$0 nT ` n n~0S0C,$ +'Ѝ,p0S/p@-@PI 0000p@3O-p|M@P Y0P,0+`,P|Ѝ ` 0S0 !X V 0S0H L03/P X0p``P , 10000U00 0P100 0<0008 0pP ,0<<0@Dj@0S P 0@  !D00 0S0 !Z Q 0S0H L0 43/4P X0 0 0p  @-Y P 0P 0Pp PQ` QXPQH "P <080P/,/(//d :W{p@-Q4@P0@@DPp 1Pp%p@-P@P  m m00ppf@- %@-x %G-@MPP N/ m0 0 0S1 0S XP a,P ލ0S 0S1S P ~P @l0 1h0$1d0(1`0,1>1S nP >8%0>`@bԐpp* `$L H $0WX 4` J0S 3Si ht Q M00<?` `p䀍0-P 0S0)#0C?o27 #3RR  0"R6p7 'Sn`0F'Sn`0pF'S``Vn`0F(P~ 0C QX > 00B,04! `<#k"0`!PP  ᐿP ,04! ~x<#G`{d2P  @000@A<"0p0N?P0S Jp  ᥀ ⡀KR ✀00pK?(0811$1n0 1t00 <@qx1q4pP( {1S%4` ᐠ0!] 0AX 0S,0! <#@  0@,0! <#@t 0`zSbq}}DC,QNEFXup*&'Q`@-PM`p 0 PPp @P l 0 PPpT* 8P 7/PЍ @-0 0P Ѝ䘡 @-0 0PЍ, O-aM,MQ0`aݍ,Ѝ@`lPh 8| PP- T2|pP, U@"8T+"uk b+bmk`zP@``V"aV+"]k+bXk~,P 0 R@3 PUFh0$P 00S 3/p0$QCbbn`Eo`YG_FPE{P 0000!8PP 00S 3/p003/pNo\RP0 0 QUi $P 00S 3/p $QUZ 0` p `` pb.x;8/0  ``px`".;6/0S.   j j0| 0]{`PU  b +`P"  @VP+"jb+K "`P L{P# G{P B{P ={P 8{P 3{P VxT {j  wj` , {P ԡ,X,pOoD800A-p$0p@` PCAP0 >@ p C 01/@P00pЍpP@00003/003/$AmO-UM M`Mx.0Pe]~.Y~ QeH@,D6g4/R[@,0p%SppW 0,0,Uݍ ЍU  n? h4F>D 7\4 04@0Pύ⌗֯N#` 54, Q~W <S D7h4F>D0C2$7\41 [ V?h4F>D0C26A\4 040 000000000 00p@ }0 xp0< 5 5s 1yt0 00 0000 0 0p@ 0< 5 5s qଔT1 @t00, nE "i5@0\qW 42XL1`⺀0Nόpjppr຀q ph \ $t00? 000/0,0S00Ӥ?'N?,$"x@T`0 ,0S E 0S N?,$"T4@pWD4 0}10  A ,i "'i #ip,1,1 101$10!4141(8H!L1 1$!0L1H!,\6$ 1(1)\,, 1010q$1441>(8@ $$pP  ~ ^zWx! Hp#W0$100$4;P Ip2P p>{T {$1080$102P0 0 0:k0G5  5Sp Ph $003/$`yPK `qH! >,!  5$F0@>S  GPjPA y;?S= $10>C418<10S2 @'` 0bVQ!!10(b/Y|0,1014181>C0(1}1S0}1$1S ` E@ ,1-#& Zp%ԡ,X,,,ud,*_PP$030/0@o//BO- M@MPAD0*!Rp0)Q`U0 $0 @  P b Pp ,O*l'0d$0 &L$PY(pP 44\,: ܍Ѝ 4p 6k0Spp0 @0 4p0SW00l , Ri  000;x8,9/PV0  ,x8;;/0  ,x8;9/T0S8S "0CS0S "S S/ Pp  R <pWP00P0)l2YP0 U @5' 'pP 0s q&P }d0S !88 ⸐Qd0S !8w\0 PS !o8`0S !e8X0Sl! hSd! 80\ E⍐L0@ DQ\0S ` R  !8E8 x Q rQ{lPufPoX0 S\PecpQWpph  cԡ,f  H  , #;] 9?RVdpx|dO-MeM08*QU"pU{&hh'du@H&\ R X @&0<0 T hQ >ލЍ5 )qWd nP7 FPy' vP  @ xP' @H0 pX l40v40 PZ\ P tU Z@D`@ : p PfU   S0SA   0S # 0P00P F0bP14s10H#5:h#h `%\%X%0S H%D%@ 1lup80pP0 0 ,0ST0 S00 P0p800SS40 0  0.x;8:/>P0400ST0LL S>@ S?0(0$ <0'v<0PPL!@  PP ,0$ 40 ( P 9 S-  S `(0{ PP uP00(5S04+^Ze14  y0 S r0 n$%Ȱ0ԡ,ud, 'upޔ,<Uo͡yW V f pO-BM@MTh Pp ` T@PpT0$(PpppPP@BލЍ䓟SC3ܣ0@ I3#$04@(8 @3@0P@0T@D0<\ P d (430(30< 8@4~202000S0 jP  b댲夒  8@4Tl20`2@DDAT L2L"LLw#P <2 4%PI(2(  *20)ATp !0 bP&!$0 U@0S   D#P 0St C0 4@ 0000@;x8 9/P1  W%P !F,%@P 0  o @$$0 v`@'`#W@ p\ *<BThT m۶| @,ԡ,pub@-0`M2 pR !,^RЍ04P0 @ PP@4 xp8;7/P  #PBC,E,(0@- @"!P(@C,@-$@2S 02C,O- @P@BY`P@   PP@ pr0Ec#ะ@pPU* ЍI TP  TP BI@    R0S p*&@-@00 SP Q P 0 fЍ耗 O-JMM ؒPp`-w G)wP)NU\baG2PgPXa EGIXK  |sP 0000 !L00P T"XT1P T2X"TPZNT"R0 0XPY 0G,001 010100 0A000P00 xPPPP,P0S9 0S)XJݍЍQUP0 X$1QQP SU T"P 0 003/PT2X"S 0S(0S 0SX(0S003/PT2X"SPX,$ h& 0S/p@-@P`!a(0S  R 0Q003/@Qp@w@-@4M`pP0S4Ѝ0 0L03/P 00@ 0pP180/C-`M0MPp PPp@x; 9/PލЍ0A. PPxP;5/P A> o 0@o/b 0!!/I,10/\rp@-@4P0 `a1111pI,O-P䐟䠟䰟@p`0/ C !  !0  Pu00S  0 0S 0P1SR0B 0 0`p@P X 00,0 000`00 ЍI, p 0@-MP@/.u1, 00 0d000 0X0@@@@@10 00@0 k,PIߍ0 I,O-P4Mp@` 0SpGP `Ppp 0S00V0#S 4Ѝ0L0 3/`P0 L03/P)  0Q R  a0 0P  P  H  , R  T  X $ \ ( ` `, 4@8pTd pA- 0R0 DQHa@ 1QRpB   !LAPAPk0` A 0Q     TTAU @@I,YO-pLBMXQU<2PX\1S2\U \QUЍ0C`1`1S]`o001PS \1 XX1! 0`1Vle.X`00 T1c "X t\P6 \ ! t000: S.X1 2 \1`00X1`bP 0 S 0.S N`hp ` XXP [ SX1, 2 $ e_I,&  < p@-MM`ePZoۍЍpP@P+` P*p+_ P*+_ P*9P' ϺP? p@-&M@(LQvH`Pm4 g< 004n P (Rl4(R fUq\D @P tލp}ab,$ O-M@P! c0 e 0a봢p`Y  qpP 0 0P0SwߍP W%0]PoP0 a0CS0S p `YVp08Sڠ0S`p R SX0 0 a00  &p 0X1U0ů0 0s [4+ kp#Y0  @00t00 00S 0 @PP0[h!R@PO O0㏐ 0S*?0 !CV4a0 G d@edA8K,RI,@- L@01SP@ 0S 0   I, @- @-G- X1L1L1  DADh9'Q   R 0<1LPDT PPH }mL` ymV !Dpp1 p!qmW !T``1 `!imVpp1 !p!bm<0< W P!P@ЍG' A - I,P u@-M@ P @oЍ@-| 0S pP`0 X00T T0PqL008 80<j, Ѝ Ѝޔ,X,,h,i,,@-Ml@p9t)0 0 0T00.00 0 p $0t !ЍI,x @-H:@,$ @ }Rk}-?@-@P  4 R4 r$(0@iЍ0@ Ѝ/@-0  0 P L0L aD@D @08Y( @0 Ѝh,X j,h,,-3M MX CP0  4nP mo3ݍ Ѝ Wq-3M M CP3ݍ Ѝ 0@-M0  0J 0S@Ѝ0h0h h@PX0 PPP00L L0PD@00, ,0P,,,,k,,h,i,,@-0  0 P <0< 0440l000 0$eЍ䌊,h,k,i,,$ 00!S//J,$ 00/ P /J,, 00S0 10 1/J,I,11<0@ Q !@-0 " !/I,0 10 1/I,@-M/.p, 0lh6 0X 00000@0 ,@ߍ& I,H 0D /Q/QQ Q/I,&@-@0 0 0@YPЍ@- @0S00萛,0@-AMlHhP N@ i\  GP<04Px9/a0Aߍ0'I,#6,P@-@ 0P   Ѝ踔,-@-  Ѝ Ѝ/-@-0XX0@P D  ' Ѝ@Ѝ/f?Ly-@-0XX0@P D  ' Ѝ@Ѝ/fhyy?0@-P P @@-@jP@ MoO@-@0JlP 0 P .,i,,@-@06lP 0 P .h,,,QA-@@1@#PP1P#T|p|` a^P (B(A`2/<<M5K5>XA;X1-,7@-@p-P @p 0 Ѝ0#&0@-EM@DDP Z[ `P0000U (0($x:@fEߍ0,I,T@-Md`A ^ P`5[0j410(!x k   . p<%0 00000H0 0 00 00 00 0`` PPpR02Q$oUx:d J6X (Z(0(JߍI,, 2| &Y'@-@P !0`RxzJkP :PP xZt P` 1X -01K@0Pڧ@T q4dW ЍI,&@-@<$@-0 0x Ѝ@-0 0n Ѝ0@-@M00 000 00WЍp@-P<@0/SpQ jPp@&@-0 P h,l,G- M@^p`P'0   P(0 PP0P00P|0 @P P0PySa00ͅ0݅ 000͕0ͅ Ѝp^u`,,s,j,O-`-,Mh$u@u"_[pPd $_ePd@T00S@ hPPEUM T1T!TTl$0P0  @$0VSS00Y00S h P E H $^0 0$0   0$ VRR   P # 2R @D m0@Qh `P$ ^@,Ѝ  G-p`j@PPU  fPP 7/G11PpO-@ M$^`P Ѝp0P 0`0VSS TP$e^-@-0 0Ѝ Ѝ/0Q -@-0 0Ѝ Ѝ/XQ A-@PMM``'P ``ep@ F43T0(3T$$c3T  & 0So 0CS+PDS0 ) 0 0S9 0S r0S 0S QN@P% h0 X0 @oH2@P 000C?o2 7o00`D(0SލЍ!7SiP1Q! F?@0F@od!H1Py0  0M(N 'W 0S 0S| q0Sx 0Su QN@r P 0 (0 @P_F? Q. QFQNnUoq"d ,J,,@,&m}u7o,l,-MM P  RP ۍЍ-MM P  =P ۍЍ7@-cP% P_P %P0| S0P @GP K0@T Tr Ѝ0 ^ x0|+R/ @-d|+\0XT0PL0HD0@<08}40I,,$,",,N , ,V(,P@-@ wu50@GT괓,p@-@MP H(@k0H 000,0@@4P,P$4hPp0: S HgP  dW `W܍p,hk 8dkQ @P3@Pڤa@ <*PT8|1|!||ajx8<eDQiT1 08808PP  Q 1P00S nz<  R t00 00000 000lp@ m(?(0tQ!ꌊ,4h,i,,PU, , ' ޔ,,`U, O-CM00qSP ` @h0!`Z30S`PW!0002 @ @3/@P CߍW! 000{Z 0S.X 0 '@OT W  00 0 * 0S l00S `  P0W0 ! !  000h,j,J,=epP,I,7@-PQ0@ SS 80 000] Ѝ02S   O-PUM$$0 s4Q ܐ )j#ß0/S_P3s؃C00`/Va3 P QJU|c@ A@ hPKNP @80@1 U y `PP$ 0RP P \^ 0 10S 0S7 0 1S30S OPpG % 2  BP/CR 00a 40 0\ 0R R` 10 1000p]R `01S RB  0 P a0S  /SPR Uߍ` 1 05UX U@P@T tT,,&I,(_ /1-1-h,p@-Ph`@TUapUP`P  pT &pG-MM@pLpp@ DS~P P0P   .PڍЍ D8~P D0~P8P `P 8P[ dXPPR  00 K0'}c dP 0=Sp  < ᠱP- + W  P P P`tP 4 PP?p3AYyu20p@-4 P@Ih 0Pp@@-G-@Pp4 6h0pS R p2"4p0QSP pP`p 0S!40Sp  Vh`/0 R/0@-SLM`p@`aP 0S0 L03/P (0! "!P 3/P 0S00LЍ0  1/p@- @PgP  p@P@-@ (@A-P@p`p0S 0pp RA05#Ph00200#X0S0Q #"0hPhp P#"4`V000S 3/0Q #"04P4 A-0FpЍP@` p p ޾ 0ԣ`/Vn뢰 t@T d cPL\P <XP @Sbq}}Duqp@-MMP`;  p  @`p HhPDhPۍЍpp@-@P f`L P  0QpPp|d zd@@-M MPp; P`n p  @0P\QPUgPۍ Ѝ edA! 0 02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/@-@p HPf00/00/4\80S0 S001/\80S 0@- ``@0"SR0(SS QU S!0$0S\  0 1Sp@- l@$\ P0"QS:pQQ   P \ Q0\! 0 ,04S8 000803/P,000403/,H0 , 4 T 8 X  40S80S0 S001/S S 8 S S S0/0000, 0R!R@-@ b4 BRp01 408 00803/P,000403/,H0 , 4 T 8 X  000/0O-p4M@ PPp`314ЍO$0 L03/P% Ѐ 0\ p* @D Z["H* 0*P T P , [p e8``pp 0S0P 004Ѝ0\,O-P4`ȁȑȡ@ Q 1SQ " 01 r " 0SQVLLSSDSQ R?!S,0S 0S00 0S  p!"00 0  SPH P00P00 0 K`03/P L Q Q  Q R S! N h&  l #  T 0O-Mc(0<00PSp@Bp`00 # 80s 3 0y_h0@l0S@3 `(` 0@ "<0P000ЍW0W*8q @ 0L03/P 2PR  "00 0 00@0002Dp0 0 2_HL0 48 )_00(,(, 00 0_P23U 40p0P<0SPP0 M T00SI0Sj00q p0 0 0 000000  \0 0 00000PX 00808/_0 PpQXQ Q(00,0 0p4 80\`\p a X0S l^ 0$0p0 0(00,0  04 804p90\,,^\,uC-``FlM0pSP^H< ^0S 3^0S ,^0S%^0Sk^0SG^0SH^0SI ~^0SJw^0SPp^0Sai^0Sb^0S000$ R$000 "0& W40SV4 QQ00Q00Q00S 4 lЍCb( .^0SWB@4W?048P Q Q  0 \3003 0]0 0lЍ3003 0]0300 0$h3 0]0 0LS(0p`@ b0 SH0pP0`@SH0pP0`@SH0\000 SH0`000S"H0d0S hP`@((0 @"0 P0  R>0 H0L0 H0L0 H0L0 H0L0 H0L0 lH0L0  TH0L0@ <zH0L0E $lЍCq!SH0000%0PpG0  d 9/0 00(00 \,! h& N T u ,, l  : : <$ "' # C- pQ0EMPE0@ (000S 0CSEߍh0 3/``0d 9/0 00(00 ``0 0pp07/0@-EM0@0P 3/P 08 00 @@003/Eߍ0@-`,MHP M@0 0 0PP@k00 RS THP pW ]P00H P00P0,Ѝ @T@0/W  /00H _MH P00*&p@- MP@D0T ` 0  040PP`H0Dd ЍpG-%(M+@PV X TP`H<, VV !R "2 Vr PpP`"pVp$UpWb$U  0 `0 0000 0 0000% 0MppppPP 1 (Ѝ 0L ; 40C-S,MPJ S S S ,!S SB @P? q``o`X 0+(% e"000  00000 0 00 0 0M`P f80S<,Ѝ4 x $  O-P(AM@0pP U !b p<#`0!(<#@ U`P $P =L00 P P K000PZ!@ 0 A@BA  |!@Pt00SC  L!0J-  (!0 AD`~pZP@!@3@Z`0 -@DP_ @0  -U!ʨ@   P.P嬠Y 00@p `PD XAߍ!00PRPV u,\,t],o}`5O-p-0M<@$zP TP,0 `P%Q 4 0@0D  U 0$ p0pC 0@D @0 0[D 0S , S00 00@ Q`42PP00(4 0 4P00 0A000 00PPPL*o0S@82P 0P40 0H03/0S0P, p p0C @P0D P000ŋ`@0SP`P 1(0p(1QPP ! B B2"PQ% ,0E ,0R BE" ^, ^ 0 R80pPn 0 R01(1#0ഁ000Ѝ<0X ∑0L0 3/ 00X0 ,b0  * 0 P  1@0 B )R R6PR Q0r Q0CFS0TR000US0a0Ѝ@0 pp 6PT00U00Ha@0 \%41R7 (R3 !R/ R-R H ` ` 0R 0R`[XoFT00U00V JT @6P0 /S`Sp`` [XtT00U0,`0x ],^,(],uT8 T^, 8Ta,@, O-0MSأ@pЍ`  W0 @0 P0S% cS2 %MS) CS, GS R 0SP PSS! W+0C?o20S 000 00SmS sS gSR 0R RO-OM M400 00 P00 <0 0PP0@@00P P(0 0H03/000400 0!6 0R 0 ( 03/ 0`` S08 d&PX&a0XU\a`0$080,&00,00$0 h(`p0JpD0HWX0h05R0p0lh Y `Vp Sh P`U Th HPUh BVU 00D0 TPmdb_]0`000@ S40P0O>0=C0H0<0dP000D0 004R$xWUT0 R  Pm0 000H0P0 F0PT0S %xqTP 0S80Q00`Q0S 0 L0aA3/P 0P P  2/``dF pBX!ZP0?RUP 0 Z [ Q P <0 S@0 D  R8X# a`0"$0$0,0(0,0$0!$0倒 D` 0XR 0xlW0  0KR` 04I F0ARȐ 0 ?x0h00l01 0Ht0p^D+)C+ %CL L0 S*pV 0 TlU 00l0 Tl0@ TlP0+,0$ Q00Q03S (0A"PLEsp 0 P &E00P3/` 0``APQ5VP04PT1(/ Oލ Ѝ 0 Z C 0 [ ? Z 8,16;,AkIT\QD@-@! 0$   0 P 0"ġ0S 0$ O-Mp( ,P|@`1/0@T0P5@PZ@TP0 0nQ 0pgQpW U T 0[QY00 @$P $ W<000$08<8p 0` S04 $i$a0LL0d00h04O0l0d Z pW P޿d QpQؿd KWJ 0 Pk qom3$ 0X0 0p0p0 0\p@0800<00#poWP0, R)  Tk0 0p@0T0 F0pTP0P =pRPP6 $Ѝ L0 PwkT0 0S! 0S4 `Q00Q0S 0 L0aA3/Pb  0开0S S 0%PTqp; 0U%PJ003/%B0K0 p01( 0R, Q ( , W (p,  R\ 0Wp(0S,0 0>9003/p 0Xpd0%WQXcpE0 Z00 Dy+p 2PpW000 0Cpÿ D0'PpWP傿0W000 000W 000$0=,kI16,QT0@-@M@0L0 3/P" ! !WQ 0 0 SS@Ѝp@-MMM`P; `@P U @ fMލЍp{dЀ@-@P HkQP <fQP ,aQo +[p@-08M@ ! 0`P 0 @@wP8Ѝp>QPUJ0 00  0 ^P@o`1C-M MPN @a0P *1SE$A T )1S ݍ Ѝ Q 0 1/PPPp@G 0S0 L03/P ,0X0uP 0  H x;8/P H{@ԡ,},@-0 P u@,@-0 /PR ЍP/R0 R/R  p0},@-@@@-@@ d@-PP@eU@`P  ^Fp0S  FT Kw T @LAP 4 ;5U@ Ѝd,u,#&@-@ @0o@-@P@@-M@  ?  ?< R܍0@-MP@~  ?x  ? 0TsP< 1ߍ0@-@_@A-pP{N`U@P P  S$@0 !PP ᖽЍ0$ D},p@-@P4Sp@Tp$ @Pp{Dp},G-px`DTP OPP@8 0 PP$0R04U},A-TP4SA p`4 4 @0? ? D},p@-@4S04pTU TU Tp`04<0 0 4},p@-@P 0p@ pp@-@P @op   @- @- @-  0P/},0@-PM 0 xPPS ~ 0PP @HIDDP0>P0Ѝ0@跼 #܁,@-@A-aJ?pW;$AT"0 0PPЍ @> C 01/@P  0Q$AHL Q>0 R 0S P P 0$003/$qԡ,#0pQ@-s #"T R0//s@-(@T@ЍpH坻0P噻0 w003/@P/@-tMQ`P Q@0 p@@(P  90@Tp@tЍT0 @T0x p0p d p  `P P a@坻㛵h,7 @O܁,eIq@,~/@- l@iF///@-0@Q sr@o?0 \ 0P000@-4M@0  QP0PUXM0U 000 0 0 04Ѝ0܁,//A-pP@`VT0S0S XMPH0P$1U*M0U00 0X0`p@I܁,0SR00/p@-@PK<0<`P" 6D0# A@$!p,,A-`8P@MpP( = A,@-n\@-0@-AM  P0p 0S YJPPL00@ôT 44 0|( xAߍ0c,[1G-`1MP@1!Pt1t10pppl$`PBL@RD 0[_ ߍ ř@P 1eK M@P 0=SK ?A@0 @6T@  @P t0 RCP P IC@ 9:??ȡd,$+p1A-@1P%`p1!PP0P0P`P`P0 D C 00[gd,9:PFh{p@-M0020000`0P0@P @T 1X 1T1O/1 0jP1O/1 Ѝp.;R$0 @- P @,@-CM` P@OP p0 0`弳0S1O/1 Cߍ5Sl| |p pdPX \\X[0S D T81, 1ꌌ,,+, 1NM;Jp@-P@U!1 1  p,1p@-P`P@ 0  p@op@-P@[P $11P N/ p{V1p@-@PC1(1 P1 1 pV@-0@{C-aM@.pOOTV PS2彸PPG aߍP V}P L"Q080E0"0HlP ",@2X , J 0], I ,X1N?L0 !0, P P|1|10 tAtaPpU U UgP10$0PU@8!88A`,ppP0S S  @N 0 0`P@)P0@p7 Ah7   & 0F 0 0 p000  ᜵,@zc ,5d,:=9: &,,,,+,1-1-hk (k KA-P$pPa@P-@T E ?吵P( 0 2P 0 4A P J@uoЍW``tX < 0`hud,x+;?!h//O-c@T Ѝ@T@T) ^' P@ U[Z [Сԑ YZ PUPE P P$P@ P$@0"/,,O-$p6# S0 A P`;#S0Ap0 d00`0\ h0x00Xs P$`P`t0(08 Hy000 00 00p; @-`X0S0 gF\0@S0 h`0S0x id0Sp0\ jh0SX0@ kpP S 0&ß Ѝ; SlO-MpD001PUЍ䠟䰟`PE 0S Y0@  0 0 p1/Q S@@@  Q  Q @ 0@0R0 0p1/P @<, A-Pp@`0S P8p0 S7/P 0403/P 0D03/P0403/A-d@p`P1S 3/`V@Td0@@T0P0S@000S4000S(0000A, 8,<, 0 !p@-@4`4P0Sp@10S 3/@<,8,0 0#0/0@0/p@-@8Pq, 00080sp` ^/ 4R R0 0`40$ Rp `083/<0 0"0`P0000X0S 3/ 0P001S01 0S0P000 00//00/00/00/10/Q@-@@@ 0A0003/@P   @pC-`BEM0SP;0׮p J@0SήC@0StǮ <@0S 5@0S@幮.@0S(岮'@0Sk㫮 @0S00$ R!000p!@0000 >!封$0g0p@` @p@h`X>@TP  D!0 8G  !`0=! 0p0 R  t/ Pp/ЮЍ 0p! 0i ` `\/NT 0p-0ȗ@0 NR S3#:`@0u,,Ƀ,,}PJ0A-@\0P3/ `V@@@pSP< 0DV  \-V0 W    ! 0  0 1    x  "l , 000SJCT T0T TTGB0B@@X rɃ,qĦ  ul  ys@-@,`P401Ѝp訃,0p@-(M0P,03/`0@ S:000 00 0 0 0 ީp` Ầ0A0%(Ѝp0x ȓ O-@-MP4,PЍ pP 0p r@ @< B PZ0H03/0S@`H@`A0 0偫`P |" 0 Q"l2 2h"I0C 0 0 000 0A 0 0 0$qO弩ᔬ0S("0P L0 3/P X0P@T`@\0`0 S8?P\ 80S ,0 0, S001z40P ∡0L0 3/0 0P0 $% % F   0 0  qd 00吥p`嵨@ 0弤8 @,0p`$0`4 4!0 ` 40000 f0,0 pB0$10֧0$10\Ч\0d00h0@ 0l0`pN>00S<p0  PÁt ,l3 000000 000 0  080pp` 3d,0\l0S> S@; SN`p%P H3/P 0p0072|0 00p L03/P x0| 0 00S 00CS`p 0SV 0崧=P2Q dЍGP$00SZ 3/@@OoBS P00&0 1@0@!Rx!@!x@|@pPpt@|t0S|0X*@.P PQ 0!R@x 0T:x0S@ 嘧t@OoB@|0xT:@ԡ,\  ,,4 P Ru08}  8, u 6 | d,t>SO-[?UM,0844@8 ` D 'pP "PU Uߍ0P P 00PF30 40S 0RB 80S8(1SI 1<00H ,HLAP4#0?4  H@$#; $sqn @0PⲥPO@T 2"B 00!P0S 3/Pt20 SU0%0c@D0`t T2R=&1@Y,N 4H@`/(HD! @<#!P`T@P ` 7@ 7,7,00 0040^ @ᓦ |7   , 刦 q7, ᘦf740P1:1!; @0 000000 00000 0Qp` D-D0S0 5#7Q[T Y fdb0`v ႣY8,<,u no G-JMM/0`@0PP+ (P& 0S" h"`0A!p/58P T` H 0@T* /R  P<=@m+' P:1=?0 `H)P+0: S pW"=>00ꨠ|! PJ>0@0/SjH!0+ ' SxP`+' P*<P 0/S`0oo`bS 6p60&000 SV|+M' P*+G' P*sP<@q<@`lJލЍ^  @-*@-M @PЍ(0  7@P , P CA0S:$c(#"c  8#8S G-``$PPp X`p)@P!Ѝ0S @x 7Pd0 PpL6 P Xp $0 @堭 't}A-Mp `PXP HP4+&.@P@ 0s@  @Py+J&rJ.0Vj+J&xcJ.P0GL[P @PP|<R, 7PPsg+J&CJ.0'PPcW+J{&3 JB`+ PPL@+、Jc&hp0`!0J>P 0.P UT ލP@[+J7&JPPpJ.@0ͬ+#& ìP h lJ>⼬PT -Z9LYji &+i!/00/00/00/00/0@-4M@0#|0$P 04P` P0T0670 PT P @%4Ѝ0,kI,,O-MA Ad2,000PB,0 0000/ 80s0`0P, p $  ?(0$0K 0s$00 0$h5 S`@ @`o@0S 80< 03/P0p80<P Ѝpv'80s D@0 0 0Q:8`0S0` L0$3/$P & [P T0T2y@X"&(@=@@,0S:0x,"(0P1P@0@00 +0@080s=0 0@( Y W|Ѝ#R!@&( 00\1 02`!00 XTq@!0(P R P@ )!0 0 h0 @ 0400t0S00XTH00P0 P@| 0(ι@h p@8q 3/P,5g?K.<D0@-)@M:0 p\*4 +Ҡ@,ϠP 0*ŠP -㾠 F 0t.㴠0  0kЍ0!0P80 S+P ,㘠P # }, Z, A- @"(0M 7( x0PQ2d2 5  L! H! D!, 1 0 8!8 @`0$ P$p 0PUp 0S0p\(Pp,P(FAᷝ(00FC0Ѝ0`0 PCp0 L03/P 000P 0p0  UPp0  O-p4@`00Y)Z]p !!џPV 0p  0 P 06Q 0S  n"00,0 84p $0T0 0X05p0 P,[.[ P Q  020 P8q84p T$00Q[ 0  Q QPPZ 00 00 Ѝl2O-M04p@$P ` PP $0 Sz22@|x 1 0100 0A00000@l̙l9x0SS(*PPL p0(P嚡!1P0PA x 0R`( b ",0x  B 5 5 0 8凝Ph lY,0( 040x0?o21000Ѝ0&#ԡ, u O-pᨑ娱,M@0S0 /00  I0S,Ѝ/S  g/00P`p0U1(ᦞ`P p㙑!埞PP PP%0(` 1`S5 O50400,00`T00 X08`帞0100& 1p0P _奞 P&E` ,WO-\M@P4 p`儰50 SU 0 Q$0S   $ pܝPd9\ЍO*.P55  P%0#p#K*,9v`00000YF(0S` ` 0 RH03/0p``0[ 80s ȟ0 Q0 0 \0  BR0S0pS 0[p08 r  *   * PU0'0U " [P R 0S  0,/ PP p00 . P 0$ PU$0[00  [tp0 PU[n0[( !P$: p00 00$0 0 $0 0pS 0pW .pWZ 0 p 0P Z$0 0 S*0 0S  0. 00#0 P4S 0U PpСZ050@ D Z0)  Z$ R Rp 0S  S0 0Q0000 00000000 \Ѝ,PT P 0Sp  0 ,4P80 TQ 0X 803/P0  0, 0( 0R T RR0  0 ,0S P @0 0 0 , R 0R  `xR  /P` /P 0 Q ``T R T  R X `( 0SY0( L03/P <00S D0SS000(( pAL0( 3/P 80<00S (0, S004 Q 0( `M0Q =0G0[^80s[ 0*0 PQ 0N[pq! 0 QQ 80s 0  00UPppy0  R 0S  0i- @p0  0  .\,@ ԡ,, O-@-M`,p0 40PVY pepPT Pp0Z:`PU`J6ERUA 6&|100#h R 0  80s0`F`pHU p 2h0S 00  80spHY pPp 2h0l0 0L03/, 00Y:pPpFp0 0P80l5ЍOp0H03/,08$ $( 0RPP$P(0<00WR:< R4*,0, 0$` 0S `0S< p$`Sp $ PR( P`$ (0,PU` P0 Sb@D S [0S 0 8P`p0VT:00S40000040,0(pWr틟8`0[:8`pp)p < p00<<* `8q ,0,( 0L03/0 0000 0V `V0$0( 0S ` $ (09,`V`P p0l  008,0,p(p<0yS 0| 1/0 0P SR 08到 0;/`0P~0H03/v8P0@00D00Z|*p 0<0 `80s_00\ <0 0RV04@ RD0  0H3/PB $ <0 %P 0 0X 80T,3/00T00X0 0\0$0`0(0d0,00 03/p 0L0 3/008 000@0 `0[ `0  + V00 400Pm۶o ]\,! 0 0Q4 0ppP80s00  h0S l Y|* 0L03/Po !0 儐X09/Pe Λ000400$00(0 0$0 0S(0   0H3/P, X$ 0 03/p8  0L03/ pPpP$0( 0S pP(0$  + W00 40000400$00(0 0$0( 0c<,$ 0 0 0  0H3/P0`p 0R04$( $ R( 0  0H3/P+ $ %P 0 0X 0T80,3/00T00X0 0\0$0`0(0d0,0T0S ,0S| P0 P  R0P0t000400$00(0 0$0( 0c<,$ 0 0 0  0H3/PP80s0 00- Q ( 0 S% 0 Rj80X T,3/00T00X0 0\0$0`0(0d0,0 0Sz 3/p^p0`0W:0p Sn:Pp`,0 0Um:8哙P  0$ $0S p 0p0 SpJ`P 80  p0R:pYP Y:PpW 00U0#S ap`ЍL0 3/P@D0 RP RP 0 L03/040T0S ,0S P0 P  R0P0ꌀ 8/ #"08,0,0 L03/P 00p开8S  8y\ X W08P@DH0Pd00   8 rp0h p`o!8p 40U 00 0S 0P*` p /_80s0 L0 3/P 0400H0,8 00,0+$0T00X0pPF 00 80sh p .P=p@-@P(M/(0Sc(`,`b000P0 F0 0PP` p P(XP,(}(P(Ѝp000,,噕(q0,`(P1- R0 ,O-`XM)1$qS W W(!0 "@PЍ00> p C 0 1/pP0$q Q 0 >  1/@P@p 0X: @1XS<1@1\1HL1X\1Pp(, !L#0h@ 0$'8a '0 [0 W %&, R0N80000,  0 0@0;80000  0'\喗0,0H(H0P00T0(0P X0L-W0 000850p0  %  %  P%,  (P 0 %<  5 000000 000 00X0app Q<5P,09ᦔXpW* 0GS0.>( CP$ 00S H @3/4pGWp@ 0 L03/P 00S 0Sp003/0pH03/ 0! P7/P%$%$)@0 QIYb @J@DpH L0 YZ03/ 0 0TQ  01/ 0S 2"+$Є  0<P 0k Hp0  @D@儀 0X60X< Plw,0S$)pP p@H0 0H008L0P 3/P p0`0 0`0080P 8/00@D@H,pP 0,QQTQ@Dp pT Q  Q0p p@08L0P 3/P `00`00p80P 7/00P  P 0000000 0P 000hԡ, ,up408} 8, u 6   @-} 0@Pp`4M#@0S $d0 L03/P 80< 0 ` 80< 8PUV`4Ѝ R00S 0 //O-@0SpP 0< #80s#    ` 002+  ؠ`0SQ,  R) 0 0#Q! Q0 2+<{# 8 0 r  1# 000 S   6$ 1 SR8C801/,0! /,p@-@$P x1SP 003/p@x1|P$ 0SO-KMM~p@㻞G<0`DPI;0S K2 @,0?+,0 0 o=(0< 5#Pⴋ 娫 K@T80 00U 0 00000@0萍0 I@@@@0 pK܍ЍIQ+R*o=(0<2#8 ;c&@@ u-O-M0M,0t1`l@0pP 0S (0 S> 9 H*00 0 <0.%"P@~40k`0V,p0 0000000U 0 0000000p0 0岑p`ލЍG⊎,0S*< !,00+C#X0S000C0C0000S0 0,0B$P, u-@-@*0  !<$10(10,1P001.@-@}*0 0! 0O-4M\`XThp(0P  啒"\ @,@;/,P R7P 9PpK J*p WpF2 @* "0  00 0(0 0 0`jB(04ЍO/Pr4Ѝ[;0p@-@Q*P傓 0  P{40 Ppu<0h p@PTl80 P@f,0 P`00 p ')*+p@-PBM `@N 2 V`PA0 P8 Bߍp`-00PS'0`"40Pp`80S80P8 < X0S4!ɰ@$0  P\0 `0S ⳰@ `d0Ph0Sڴ ⣰@l0Sڌ ♰@p0SL ⏰@T`˒t0P^ 9: ;=>>?#ABCEp@-`M<P@ᯒ  % 1U%PDPK0 @00S    8PU@叒 0 #P凒0 '܍p(0Sx  7@h,0SP  -@D00S4  #@$^' /12#3p@-0M01P@Q#J 0`N   0S (0Sp |  x,`VH ܍p4' 0`N  c 0S (0S  Y  U,`VP$0 P 0 P0 Pt0 P`0 PL0 P 0 , p'   C-`RGM8 C"\0S0 `F`| i0p⇞ 0S [L W`,p WV o$ Q` u00"  `"ᛑߍ@ 0  0S  + `PV 1 `SN0  `Ґ 0  0S @0S @ ߍC_<0040!00o@0Fo$ 0DL03/00 N0S !0U{D` 0S , 8`Y40p x Q0X 8 < RFO    & 0 /@6@^ 0  m R0_ 0   6 HYp%d&pjxw.@-x @&+0 @0p0d)@ j@-@ @&000(0,0000d@ Uꐯ@-`dQKM0@sP!   0n1!S=0DKߍ0@ 00 @@0,P(@UTpp (`0 ᇭ0  0`0`pXBPTBAP:AP\@P`@d0?o2d0h@_`Pl@p00 S0p0t0?o2t0 0 V Fԡ,GIJKM18"@-@EM S500 P 000 "PP峏 0/S  !0@ 0/S0 0Eߍ1?o211St!Nl,!@< @P1?o211S 1?o2 1 1S 1SQIOUTpp `0 ѫ0  0`0`p]@P@ 1S 1StPJO 1S 1SKO_ 1S 1S0PN 00d ԡ,!"#%O-,MbPp@]X  ʍ@XZX2Y 0DPp幍 @Pe@0 $V,ЍPp嫍1PeS` 1S !N !U@p@d⒍ P0Pp劍1PeS` ネ01S  1SxH!01@p0@d 1S 1S$1 !!@p@d 1S 1S(1 @p@d 1S 1S,1 @p|@d 1S 1S01L @p@@d, n ,kIpO-0`QWMdv01 @T&0P 0T&<)460S ((000S'6L@TP| }1AS 0S@  1P11$P |X003/$}1S}Ax0 00 x 01!+Q9  Q 4  0(%X}0S/X&0 ΃}!΃L )!6<1,!X  X"0S0b㄁0b/# 0x0S 0XX0{0 P}!11VUj @<T0e"@T30S D 00D0C 000H30S >D00H0P3@L00P00 0000T0D030S D 00D0p@ 2"b"`0""  "X2}/ 0 S"0C 1šWߍ "0 p2 0@00 0)1S080.$0X80p$P! 0 SL0X 3/P h W pW 00%$1/pt0S _PWC0A00M  000A" 0" $!  8 0X L03/P ht0S 0_Sʚ  0" 0" 0 0p@080 0SX,, ,0,, 86, 4,, "d2 K60S/O-@MU腟 MpPi 0 0x Rp#`R0ZDad80  @Q D0 \PY P TPC 8%8u  % o `V800(0S$ڨ$B^ 00,0S$ͨ$BQ 0000Sڔ$t$BD 0+ 0 d0B/P `ὠx 00 0; Q <0 Sn0y0!#器#B 0#0 0=,0Sn0y0≨#B 0 00;8 R3#0xT#B 0l#0 0=<0Sn0y0h#B ( K 0 R #Y"B  0 R "K"B 0x 6#0= 0Sڨ";`"B x 00 0=$0Sh"*"B 0 00=(0S0"!B 0x 6#0=00S! !B x 00 0=40Sڴ!\!B~ 0 00=80S|! !Bo 0x 6#0;! I1P/S L(Ⲉ0(0 00a0SvU (+ (0S `P& 00!15:%  ᵐP r Q 0, ($! d$ 墐P`0 0 8a4Q101V$,l,X,u LX0S@0@-S@00 0S/p,2 O-EM 2@PT P0 x2Pp |1S$ $P| 003/P ,2P $  Eߍ$0 R P 01/0P 003/P A10SW aPPD  <0 040000,00800 pP@2@0S- $P* 0 x0D 0,̹,$,l,,N,CA-0M$^@ QP`p@0 L03/P 0 @p$ 0S0Ѝ 0Q@#*11P0\  R'l1@h1@T@0SP-D1@1^0P@@T @ T6 @pW3dpW0V82# @  R @ RD RV @  @H0p W P^ TXV ,0"0P0 0R,0Ό R8<0,̹,,, ,0,\0p@-T00P DPPp0AS@  1SAwꈊ,ԡ,X,0@-P$4M0@L0 3/P T  0P  0S4Ѝ00^@ ^T 0SR2"@,p0\ Q0/\P  ^U Q0000@-@,O-GMMz0l7d2@`(T H2 00V 0 000000P0@@@@ @E0Zp@a(< _(G܍Ѝ$1SpA08 L03/P `7Z Z ZT7S p$ 0ST7S8 P P PP C 01/P ,00 H$L Q>ԡ,80S 0 @-/ᳰ m XG-`ᔐ唠@PX0r2 S80S00 00 S80S0|1 P%S$1S00 0VUp@-8M`8 @ lT P $Q~L$00S U  0|1 08Ѝp~P FP P Q K P 2 z P ,A-M|8 P(U`ЍFP $A003/0 R   01/`P 003/@P$a0H03/0 `pXDD2 08 8/PD> 0!! `7# 0 3/P"0#"#0 03/p 0` L03/t ͺp` 0SWp`?`B414!440<0S P L3/00 L03/P @0D t0Rxp`00 L03/P @0D t0R 4 d00`RP  v00`p 0Sv X  0|1 0@   X,G-`RMXr@ @PPl P\` `QP P9 4 ᝜p 0S  T|ߍ<0H(00,0 00004008004004 04$0D0(0P vW[  spUt mp*h \ R0 >h!M000㛓#000X    ,_( [: {T  ` P ؀!\R 00 0Sx 0 0<0< H0S< < 0 yd|d*&_{dЀ 0$\ (00t S S  S00/Q 0P/0S 0S P//!R808 88@-R )r0@/  80R*@-0M@"P0 0! 0!  P0Ѝ/00S/ ,8_p@-@(P0S0S0< 4 p ,@-@0S ,A-@lP0ST 0S` @ <0P@`PV@ ,Ss@-@P ' `{ P |Ѝp8p P |f `P (PP )P` S P M P(  E P` Dx; PhVPP 0SP` P + `P @00@0-4:@HNU4 @-  ǁP ڈ"z  P yЍX_V0S  0t$ zPya O-M M@@P;B/$@pPz(` Fɖpt Yp00@@Q$D0S8 R( x0 PY0D04@T,4@0@T30@T00 0 ҽF z P P    0wP  p 00#ᬁ؀2y@0V  00#l #ᚁ000G  `#HP܍ Ѝ04 040RP8< 8<0RPx0( S 00#jPDD < P x#\P@h Y Y#HOP@m  P #P0&$ D0S(0 D [w0S؃  0 0 0 `@00t#Y@#000@40 D `d@;$,T@-M0 0`t 0@S|( FqxPXwT x@08|8  P 0  O Ѝ般s\2 @-Su0SЍ@-M@ tT0  CR$00S ЍwA-@lP0ST 0S` @h  x0U0Q0SpPX  x`X x0P00`0S  ` `P,00W80@00<0P0$000(000S L mP sPP H!u$0S(00,uVލЍ` D0pp0<00008``#404S``V NPp0p`00S00PP 0P0 0@50 . 0!$00(0080 0<0$0500D0.;`_0 PpUP PPTP P X`0prT`PP,tፐ0S 4 R 000 0#ᦰ0P 0S ጰ뼀 08$ <0S P 0$ 0800S`P ̑P`\0S 040 Q\8<0 Q\ P   ?P` I ,  ,* IJI\ |d@-a0P0P,(,7@-@ P00n 0 0h 0 0b 000 P   S Ѝ0O-LMp`@ P8L 80 6(080E 붳 6⼳? 붣  B⾣@A5 0sS) 0lSq` 80P8 6# p)G0$0F0 0E00D00C00B00 (0 x0p 8,0,0P P 0'"0 p LЍpW0`Vp wLC-`P`PT\0(Ѝp!0SQP ؁1/T 00 O-DM  0000 00 0 zp 00 4`Ro04`800,00$ (0  fp ,08<\@?! ( _5#Z<P0$P00p/2#*_.08 RP0 \X I PTuU G" ?P1 0HL R0@ p ?  ~0 {`/G$'@ T R@`000 00 0  p 0S #"01# 0?04 SQY H0V`00P0pYkXUDЍԡ,/C-`@4M0`} p\ X \^ PRPR VS  RQ \R   0   pЍO- ! @-1` QPp@-@pP0S0ST 0DSTPS$D  p# @0p4,,08S^5/,,p@- @ 0(  P0R0PS 00Sj QppM-NM`<Р@Pp Np`0  p `x000 ;PP@ ᓈp#Nލ ydG-xM` ✐堠@pSP! !0@P 0S PU 0 R<D1D!DD00S 00" !P@&P0 0S0H L03/P HL 0RPPT $0RP0 0  x@04/@xЍY Y ZL   YZ( ( ꠊ ! O-pBM M@P`/0;( PD@0P0P0iP) Y $;$  g P!14"S5 0Sgto@ oU01U01Bލ Ѝ 0h0P0  g?XY$0 0I0,jj?X Y 0oS 1 SR 1S  RS1S1S p2?R_0Q ! @0 0@QD 0H 0LD0!1F41Q 04 8 <" 0PY@@Q Q' Q0PUTi 0"0S0S0@0hP P `@@=02s 2 02@F @DURX A- 0MHL`Pp h1h!hhPh@P( T00  0R`0 !?020!20S02p 04 pi0Ѝ 0S" $0Q00 L03/P Q P 0Q 0 SD S003/ ! >,P/@-\ @  0 2BS20D0C@AuOvO0w.#8\0 A- P0\\@@ \ 8\ @T h@ `Č `Ȍ `̌b` ` p SČpȌ`! 2/ ``~``a0q1P ip`T8uBpP08} ^\ 0Sp`82S04@1111111110 8l2~`S@0 P P0c0@SP0 0HL R   ? J ?G/Z[d0P @10`d ἐ 09/0P@\Ѝԡ,G-p0@PH8L041\`  S ^ ?Y R  0\ X0?Pࠡ࠱000^ 0 G/ԡ,>00@-M 410@810!a0 P00 0Lua0 J0PU ! 5/5Ѝ0ԡ,@- H_@ }@-@  07}u" #&@-@@0s ~,00p z`0Co\ &,-?$M0 0 H~$Ѝ-4M0 00 000P4ЍO-p-MMDU~ " p~p4 Ѐ0 `0 `V00( 0R0`V00"R 0*`ğ`S0S 0s 0SMߍ0S P 0 ha30SP #1~Px#S 04 ڭ{0 A(><# Ae{{zdWdp0t~3 2R - BPP  ! BRڒ"B " e"2V~PŸ 0 R#3SPgShr0100 T"e<~0 $P P(0 0SZP=9 =:pk{1 AP09n A k Qx 5 P;!%#3ZQ/ q  d 0@!0e P!}$1PP0& peS P *!5"%+0! V 5 }P0Se }P0 0p @|Y@.A,, ,,,p,u ,Qu!|     ,,@~  0P U0 A PD0 A k{I{7{jV0P x  }pÛgP<<`ṛ 0 l}P  f}@-v@vr@SRG-@  g700pP ą`P:X:00X 0:}P @-Pp@`P0S -S :S S 000`  0 +P00 ЍU0S T  ^P*&p@-@P{p  `{@{U700@pp@-P 4`{p@  d{P{@p@-M@ |p$ ЍG-`p@T2 P  P0IPE PP& PE0P @ R R0 RR00#R0;R0S Q \Q  "Q0# #QS0 @-3M M Pp 3ݍ Ѝ p@-P R`@0 @ L|0 00S ] UPE P3ЍpA-@Pp p`" j 0W0 |0WxX Uh0X`0 P U <0H  0@ 0h0|Ѝ P 0'u* u } ^  @-`0tM0FP?o2p @p| {pz|@{p h2S{p L0V#4 - tЍ|h"zpp@-P@@{pPpp0 p@-@ z0 S " 0PUPUp@^0S   0 0S ^^0S   0 0S ^^A-pM@PU `0S@PE7  P0P00ۍXڐ700S @ Q@BPE@C000  pLt0S p0#S @UX !   @-MP @  yp8lۍP  !h1p@-0SM` LLЍp@@>  <P  0 !   yp0 S 09S .Ѝp0 S   000 00P0 PS l0@ k pDLj  Ѝp@p !!  p@-@$`P^[Pp0 @ `P0 002 0pSp@-PxM@`  >j0 0dyp@) Ryp$  Lyp Fyp  @yp  P L0   p(0xЍpt .y!  0 0 s@->@P`<p @t0 p``X0 )p <0@  pЍp ! p@-@PqP  x01CpP`qpI x0#1/pp@-pM0 p @ xpx@pЍO-QMM700ۍЍ   Z ` @V [x@pP` @-`R00 Ѝ0Pp@STn[@PT  Q*R@00 S   0 0S0 S *[P `\\  00000 0` @@0P  @-@ @ (!L1p@-S@T1S"d1S,RU6lRUppbV7lF\lbp1CA\L10CL1SP:\0P11C4\T10CT1SX-\0X11C'\d10Cd1Sh \0h1]2,P0C2bV\bPp2,P0Cp27@-@0 PP$ H1 0D1-0@80@ CB Ѝ0@8 Ѝ0Q@-@  z  bwP p 00`b Ѝ@ Q @40 P pЍ@M Ѝ ?! Q@-@  J  TwP p 002 Ѝ@ 1S70|[1YP| 01 @40 pЍ@ Ѝ P! t0@-M0@Q0$)p Ѝ  a!  081/@-@du&P0S  P 0800L0S S@\&8 . Bp@-\M@ Q t0  0p\Ѝ@ 0@-800@@? P@-@~p t10cSt14 Ѝ@ @0d  ЍH ,Q7@-@  ,, _ Bvp z Pv Ѝ0@ P 11P,|1@ R  |%vAQP |`00CS`0X {y@X0 Ep 0< Ѝ0@B X0 X Ѝ0 s!h#&#& p@-PDNvpp@00 @&wp p@RvI^ p@-P@ ` 0x8 , [=U\% 0[ 0 008 , 81pp@y n f p@-`<1P:<1x1S0p0@Tp 0S   ʌ0@-@T 0S @C-p`,X0$:0P   1000  qH,`Q 0a(!"4a4# 0)F0 >Q & P X  h080cP040 Ѝ 0b"!4b4# 0S %/0p@-8P`J040 :0:G@ PpP  Pp%pp@-8a P0S t`QP  -+t R P 0S ;T: 0S 0<" ЍA" Ѝc ~  .  !  B 0@-@x P $ La@ L0p@-S`@P 08PU $00P   81 0800S>? $0080S  p, A p p@#!@-@@O-`-M@0IR@pPT0Ѝ |P R+W& 080 C F"0  Z0800 >X  R @@ FX   7 C-`HMa0@  ЍPPe p0 P , nrpnP1 P P2 P7 TlP@ P8!887@p$R! ,Q0S000 0M 00  ` x}D!\10B0H1x=l l<xF :Pʍ<! S 5 C  K   8,   &  $ - @-@  , rp oP<1 ,(,r0,1ЍPDH0<1 P$6 M!   Q/@-@  0S@qC-`@ xf @P-00@ 0S  ay0 Sx   0@ Ѝ0  pPt~< @P @00PEU  x ) PP 0S  )$0$0> > R **X 5 0S .@0 S   000x1  @  0SP P 080 S   0  \!  A-M0 P0 0E0!@0Earp 00`+q`pQw07S |0 S X d0E 0\!`1  `Px1  ލ ' R PpP0 S   x 0pP 0 PPUUxx x x1p  P  0S 0|$0 Ps!' 6 x $8Q@-@  ll6*p 07S@\0 S 0VS0S@l !A-`R@M@p PP U 70 0@ЍASP"R 0S 0 'r>XU$  *P 0S <0 *O p \ <0E <V>P  *@ЍA@Ѝ!   O-@P$MpP  P 00A0 $ЍOPw P000 P`P`PVQ`P  PE  0PE 00[PPIcTPPP P00#3Yp`r 8118100x1pW*  oPx1pF 81181kP NP00 6PP4PPUPpP xP 0: 0 nP P ` 0S 0 0p  P YY p 000 0S 0 0pW81181$Ѝ  P YY  op 00W0 0 0 :0C WUx1  0 2  R @ [ P W @(00 0Ƞ0  UB U  H0Ƞ0UB ;6 0S W xx0P 0S ``W`ʁ'`0x x    ( 1 &F !@->@T( 4"4p P`0?"@4"4 06W PL L0 b"!4b4# 0'@> *">0@D Ѝ耼p1p@-SMP"!` "$@P T 0p1!V R 0S X\myPP Df@tAtЍpp>0S O0x1@T l1S E  @>0S@ 8`l1S   {0 @ PdP 0 @  B00.#p ,l1S   p! L % x 0 R/ 1/<,/A-@P 1 !  RSXp0 RqP 0`0Ss000S \ \ 0 S   000S00@00P10 paU0OP !G  0P@-p0p ppq 300P R(0   U ! p@-`@TP\@@^0S\*\@\0 0SZ0 5Pk9 <R0p@-M`@Pn (0x`p`FSЍ R*p 0  B\ L *R B  ʚ;G-PP $L1L!LLY@10!<`41V(@p 1!0 S0 R S,   @T0@T 0 S4  0(p `Q ,00@,@O@P0S 0S0 @@ ,!  ʚ; @-@^_00 Ѝ ^   ʚ;@-0 Ѝ@-P`p@l,p0 000"#l ЍMb@Bp@-P(0 PUPUR PU PTP,PP@PP4PP4\pQ@  @! P 0 )@-0PT0/ W! P0 @-0T0/ b! //P@-(0( ((@008< D0 n! @-,MP` 10U@0$00 0@p000 0<0S (lp,Ѝ8010C>S00@( ( 03(00@000 0<0S80 pp @ !Y @-XO@P ?mpIP@0  0  (0,  0004 P0-s@-@T0P0Ѝp@Ѝ/ r Pp @/o" R 0Q000p k00C0PPU 0`0HP0HPLPU0 P(P0P0V00 S   0O0 S ,  0O0 S 4  0O@-@@OC-@PM b夂pT0SY 00C01@0S D3/\2\"\\(PU0S Pf0S R=0 S ,  003/00400P4P+!0 P0V0U0S/ L0 S*H ᯤP% HLH0 R |Q    00   CCU 0 HoL0SP(py0S} u`ЍT0u0S 0S   ,! Q 03/PEU[ YW<, ! @-8 00(@ .p@ t@Ѝ#&A-M`M4Psp Fl0 lp@ j@ۍЍ4F P P  ӣ#P@@#C 4,0 @4   Qd &#&-@-  Ѝ Ѝ/@-MMP`@0 p kP  0pۍЍ-@-  Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  l ЍЍ/-@-  ЍЍ/-@-  V ЍЍ/-@-  ЍЍ/-@-  @ ЍЍ/0/d & 0p/Pd &@-M Mx ip P@;00 dSV X00@ۍ Ѝ$Pp0 4Ndd &p0/d &@-@ @QP4 @KPd &p@-@`Pf;T 4  PP   6PT V00ppd &#&+P@-@Pv9>=@M@-@ p !jp !jp`@-q@ i01p i01@ jp@-MP@`   t0X jp 1@ R! (0 p`Ѝpii$0 /L0s P/P  //@-\M>PUV0P0\ЍU700@` pR0 PU B0>00 0<0  ,> I PP> *h @-@T=@Q/`@-@T >@0P/- R 0 R00^ PG-`P M00(0S @ P P P:`P 0!00 0  0S80 00 Ѝ080 00S # P`p  P`0P 0iS.S  P`~0S4 040:S*&0@-@PDM QP@T 00p@DЍ0U  P @0S@-`@MPpTЍ 0S P 0S0Qp   <@P @-z000Q/Px1P/$0/@-M@    0 jipЍ~iO-YM `F/@H9X0IpPpYߍ0pL 0S 0S PP@ Y AP @T0SL05P 0@S0@S@@T1S X1 ⛑PAT1S@\1S`1 ⍑P5\1 S S R@L1SP1 |P&L1SPC_oRPU@+P04S 0s0P?AB@@$P00SLQU GJPPdh1 <P Pd1UP H@ `  0 0[$0D  H' `0 S z9X001H \0hp X0 RB000S0 15S4 S  CR.T XX @@RS! y R02 > 0*@81 000S p S 0 S `@@0?H0cp 0P0H0}>H0 @70000LPPP!fb7 c i @ A-p M X`P00 @R  RT T 1 # 0@ @ QPUx!@T00 Ѝ R @gfȀ- 5S @00 5A 0% 1@ A  + A+": A !9 R50,@-`pᯅ@P@ Ѝ ኟ0PXYJWJ pQ,&P PP!@-`R$MpP 0S0U00$Ѝ/0@P 0 00 0  0S hU 7PP0 T/00DU 7  O-@`0"Sp0W"SpG` Y PP u700 ЍTUYP T0000W YT X0#0%*T X3#: 0\S^0PxSmS0S< bS ST Tn C R T0 `T 00T 0T 0000 0    00 PP 0S& T  G0 `P0A\0SP0S  GT PT0P!*&P /0 S S /S/P0/S S S/0/O-M nPPЍO=#`P ЍOI@Y@S   pW ILPP   .P Q0A00Ѝ=0@S. 1P( 0S *@PH@`@G0P 0 @ 0 0 @ @! p@-@ H`P 0SH$`P PP(0S $H0(0$0p,` P,` PO-@/4M10CXP`pSt00pHU- 9 `Pp$<P@  ⤝P7 7  '$ !/P`0@T\0S @U0 @5 0H050U+ H0xt>0P KH0 E@PA t014ЍEP 0 1Ap 0S xP%H01@U  CUH070 0  pX P! .R@  0R77@0U   0pP  H RU H0@1S @H000zU HP00p ,0 00 0 K,0S< _ czU ,0!00 0 ~,0S J Uw <1D8b0w4儒0000 0 PPP00 0 P p@ 0  @P 8 UI <18b0w4儒00p00 0 PP00 0 P0@  H0:0H P0<0UH# 0S /8`P /3`P00 V /0P0 Q00<0000H060U ,0 00 0 K,0HST  Ah 0A  ap$  P 4@AK0  U uU ,P 0SU0 pH0 50fh0 50,0 % 00 0 ,00,Yp5$ UkPePU700 50 $ 5'@p 0 *  0 |p P H0@40U 0S 4S 04S0:006S 06S090PU, ,0 00 0 XJ,0HS <U H0P SPH0;00H090U `$ l`,#pP C`P 0%-c CFH0Q7;0UlQ PP0l1 |IP0l1 dBP0l1 P p E0PHp1tH000~UH10 2xPH0 2p PH 0 2h P  PH Z H000TH020OU D 0pP(_ H0 S;70<H0207H0602H0;0-H080(UV <1#8b0w4儒00 0 P000 0 P0P@0PU2 <18∂04gr000 0 P00 0 PP00 0 wPp@0  @U =(PH < paPWH0p000S P0<00 FP WH p P  6PWHp  d )P P #P < P ( PWH  BlxPQ ~ ($upp 00v! ` &I6 C ` n         T  p  ~               0 9 C H W d      & C V g v    XL b   @# > Y  dW               ^ !tOz        ,p 00pP $ ( H,8  }P B eP*WH[ B $p pP (( ( H$8  LP  BX 4P l .PW ,0 00 0D G,0HSy  P /o"Bi ($|P/H P0(0ݘPp 7$ ! (0'0K ($^Pb/H  P0(0PR 7$ ! (0 '0-U[ H0'X U X!H020H0 000T0H000H000 H0 00H0 00(07600 2R 1 *,450S00T01=5 =5H00U <1(0@0P@470'kP R0SxgU H$C^~P$U 81 800 (0 00 0  G(0`S, 6`( "4`4# ,,0H0800 PP0 0 P 0 0H010zH010uH000pH050kH050fH000aH,';,[UYH090SAK3O\ 00` U0y Z@AKοOAK OAKҿO"Uf \0@T$(@ ;`P  ,00F,0S (/PP8  :pP00cP  ,00 `F,XCPPpP`==PCP`PpPh 0CPjPpPX  `CPfPpP  uCPlPpP  gCP`, aCPi& [CPl   : zl?o2= , sW8 @@CPb T:CP`Y p ]-CPc 'CP "CP` CP` CP` CP `  CP@` CPh BPd 0BPe DBPe l \BPe pBPl BPg BPg BPlw BPlq BP f Wv ZP0$, vPP", EADPP00BpPb x|pP  R  R 0,PS0P , S%00 0$0(00XH`  p @ 8 dZ`0P ʎJZ\0PZ ZUp HP70P7H0"800H080H07 00H070}U .6P0h2uh2S H000jH070eU o`P 00v`lHp؀GP P PVGC P P91Ȁ05H0400H030+H, 4,%H020 UN H0 rpHd .H000 H000H0@00U1 ,0 00 0 ]D,0HS U ,0 00 0 HD,0HS| yU ,0 00 0 3D,0HS, d Y  O-pPУ8@` P UP `nV<1X ЍOR$ RZ8 ,0840 ЍOM Ѝ! 4O-S$M`04 0@ QpP  8Ȑ̀ ⨠娰<1H0  00aEp0`   h   P` U (   $Ѝ&F E !0:-A-PQH 1pS`01S`5x1hS`8  ??$?0g47S90?8g<7S:8y?@gD7S;@s?HgL7S<Hm?(k?Ah?g? 1`P`?^?1`PW?X  JP T0 ST47,`0C47<7,`0C<7yD7,`0CD7rL7,`0CL7O-MDM`P 0=P<exP E$3&7 E000 0000 0P70P7/ HE000 0:00 3000%0  Op Z +8 0 E@@ 0@0 E+ 01 P#Z \0Y,=P0047`(P3 @5:_ ؍DЍD[P iPA0 D  D 0 0 DDP078247204<',0Rᓸ 28>@D',0Rᓸ ,@|>H'0l"L'87<7@7D7p"H7L708 0p  l2@0S R R P\R @0@ R #P0 00 y?o200p0S0pp@0p DDwP 0 0# N00dDP P0( %8 _ P9P4 Z#dh /pP"($$0@0S 0 S S0P\S 00@ p:0  ᫃PphqdyPd p@ P 0S P   P 0S P Ppp0 0#  Pu Xs0D00D000 0 g0 S E:$ E000X!!X,@ !!> i Z 0Q//Q *///G-p0000@P `P` Y 0 0 R:@CS@D"@3X HG.U( IGrA-TpW0 .T`@V0 L0LS @sP X X| |00 S HH0P 0RS  ! 5 p@-P @Pp<@-p@-@Pp PPpT0 p@1@-0@0T @00T0S0 @-  M! T0A-p `R0080810@: PP?1W U t0  t0 +p@0S hp0S @p? @U4 hC.P P @$T T0Rt0t 0SqPt0 t0 88fPT0$0x x0R\ ^@RP70S @1 * B Q : ` A-`PP c_@T T0Sp @Qp@- M0 zT0S0 PU|0h xPc_`@P H 0  W  Ѝp Z!  o  G-0MPp $   @P 781@0A 81S(P  0Ѝ |B {@T|   tT0 R0 0800, P T8p 0SS90SSPT0c |  `P7 R|0   P @T T0R88xPY0Sx x0R K& FT J00XXWPR @P T T0R88FPq6p%0VS tc_ @TG 0SS`-90SS) PT00S8 0 H0*: S R   p 0S 0S W@6T 00,F @Pd!!t!    }!Q00@-1@LS? @q@dRl@̠ BR001 BS@P@-404 4;a0S /00 ! P@-404 4QL0S {/00 ! P@-L0L L}70S So`/00 ! P@-H0H H0S SpD/00 ! P@-L0L L0S S,0@o)/00 !  ^p@-@Q0 RP0 _0`S0 SQ 0h Up@p0 p@W0 p@P$ !{  N0P@-x0x xxQl0\ i P R !P BR #@৫@ ! % p@-PP M0 0S@T 0d($"4d4#@c@Ood@T $S 0@0 Ѝp/0h`Q I0000P 0  ! `,1 'A-0S00@Pd` pW e/0000Pp 0 "`,I !n P@-808 88Q,0 v!>000 ! c @-@QU!p C-TM@` P `fp) 0 f ````f 1 pW0`pV& f  0 0 T@ fT  @TЍ00C>S00`"P!@03@000C>S00p"P!@03@0!!!!-3@- P jp@Ѝ0@ Ѝ/@pp@-@RP`@p0Sp ppx A-0Pp@`S:0SS 0   RS* R0 Y`V1S* ‌P a 0@DpR: Q  H!~  O-A TMP` zy#A@PA(@081 Z  xp 00hȀP bP ]P XP SP NP |IP lDpPpZ T Ep @61@ R 0;p 0;1#3G0 800 00%%)p L0S% S% p H p P p $  p q| pw P0S t00$Q0p 8 pe x0Sz 811L10x1[sTp M wPw p@ PP 00Dd lp0 \ p* %P %P0 x1`2@ p X00SXppW0h 1SPp@$½#P |p fSp upp$Px lp~ 0S P fQ [ T  !Tp  r"Tp6P| 1Pw ,Pr 'Pm "P P X00S 0Sa!Za!Wpb%P `V%R_ pZw0Sc  pl 0t!pTdpQ0SS  @ ypW 0$8!pCNPpH 1 R=Z  P; ЍZ p prp!  8 B. ~   f  !& 2  Y \C P \ j u ~ d!    ?    p  5( p@-@Ppp p@uRRA-P`p@@L0s  S  U@ p@@@dW0S R H R U p.  BQ p@-P0U@S 00pH ,P@E@T:唽p/ h#&@-`PM1pSAT  p@lbЍ\ PЍ@!R 0$  00 p@ @a@V 0 !p@/`P Op0S lt00#40 PP D SP 6( 0(y!  !) j!  A-PP 0S 1 p@ 0S @@s00 S U   ^ @ .S0.S[0_S-S```&00  @RG"0T0 0D0*& @- @0P P)T00Q  HDP `00CS`0p S00 P0S X0X /XR#&p@-h1@SP`oPPE @p ⑵0.SSPP \P LP < P 0  .ᢺPPx p@-@P'Uc 0  Q0 tQ0 dP0  TP0H/@,8)0& (#@        P0  P0  P0 P0 P Np@t IP  WLb                 h#& 0(HLǒ -\ lp Q^ ,\ ,@-QMM@pP~\0p0 0OQލЍA. !. t l0Op`0SPE@E p 0S:0@D0    O--,MlhpP. m|`  Z@P2 0S   j,P$P@P@ X^P$0X2200,Ѝ P,P, R P,PE0S p R* 0j20 l6$ R, R P Y6$ R R ,Pp!@P !!!( / P/ P/Q0@-00@Pb^ .^^Q\0Q CL \0@0Q C B\  00/O-MpP@`UQ:T 0T00D0S00V`F@@V00ЍPW"0$?S 0[ PW RPPUT  P70 0  .0@I0 0IU:D X0 0 `TT  DSPO-`0 2"@p Y*QP T V700 Ѝ%P`F@p  00T V 00  P     @3 \Eo   ' U/U$Y\U0 T VPPT V\%0P00PP`F@pT V `FPp*&!G-RMMPLHp`p< @<pE  Op V=jp h<4 OpTG    x0 Ip P; IfP 8I/   -RލЍ   20V002 0I@ p  p@P0P@T*p0S4 p` @T* T 0 Np @ p    H0X$#$("( H|Npn @   Ht0Xd$#$(B(   Hg04!c#!$ c$" \NpN @@  HT 0b"!4b$#  HGJ   .0I/P+ `I/3Np% 0S @00SP%D$Np00p  #;ryA-p @MTP 山ЍR` R 00P0S 0 -0 0t00#Q0 3$ 0V 0  0LM 3 O-4MX@p 0S\`d` (0S:0 p20"4ЍO3 0  ,   xp0,0 ,0SPCD ,<`p 00"0,h/4ЍP V0 00!00  , p0Gp00X!0h `F,P 0 S(0SVP$ (0S(00 0$ `;/P $P(0 S0 0`F0$00 (000$ ;/(0SP, $0R0, 0 (0S ,  09,P!h r x z p@-P`@P 0S $`P(0Sp,` P,` P  0K0@-MMP+ p P0@ۍЍ0;0 C@P S,P @- PΠ R00\L  ^@-Q00P`PV0 V=`V xЍp@@T   0x@ `DPЍp`Vx1@P 0>0S *WP PU@P PPd`a/0P@-000 00$Q$0 @ Q P! ! A-` (MA00>0@SP  '00x B0dpp 0t0 0 01 0 0S0S|0@0|0 0  X00Qx0 xPT (Ѝ0 8 0=0S 0xPT-A-@`|VPFPPP2Xp`Ex,P x倂|"x20 V0  p|20|2@-Mp@`P! _ ([ (HX( 8pJPU@ T700@Ѝ i///0@-M @ |*PPЍ0 3"Qp 00000)$Jp00000@ Jplp 00  0" Jp< {p ]! Z!(! 6! I! p@-QUp@p H,0x1p@,@-GM>`V P00Gߍ@PF/ 9  0岮 ph0 1`0 DF?J> *P0 F?J ii@-@MP4@ $P P@Ѝl!Q@0@ @@@-0SSP`///g! ! $0 /Lp/Q @-@?t0@0Q00@-,M@P(  U  BT Ip 0 00S p,Ѝ08i(p@-MP@ 1 ` ,   (PIPЍp:iO-PQMM<3<#<<(T0S,3#pW3#@H`#0J01801\0t0P0 0K`T0`V3P 0P0T00T0` P T0X00T00T0PT0 0T0VP00P0YP0 < 0| P0 x ;P0R h0x 0h00|0P00`T0T0 (@)@@FF@T0  弱 T0R B   @ Y@ X1F0FᶰF @T0  YI @T0 0F0FᶰF @T0  XP UPEPPP@ D$("(Gp`ݍЍ  ;  YI @ !  o  C-`Mp"0` 0$` 0 ,pP @T@+Ѝ`Y*PPA 0 ,pV0 S '+ `@`T*x0V*F00+T00V:0 (P|P@ (+ ჵY 0@P!@-DM`@ pP@    ᶬ !> U 134  R2$ $@0  DЍUi@i|@-QM@  00p |20 x2"GЍ@-]MM`@F#P\Fp PP VR 000S0S S SS wR0S H^pVPS CQRS 0  Vxp@P V$0 Bp 0S$H` 3  l Gp 5 $ L 80Su S S00,0S  R000@0S  R00@ H @ 0 H!>50H \0SGp\;0S 701S hhQc0 0 0 00 0 0p`URZ1S SN F F]ލЍRIx@P= @0 3P0 0- H)@ GTY$0S! HM PPN0 0~Qii@!w! @- 00 000 0 +Ѝ!2S/2S00/@-@@V002@-S0@0 @@V0002S  {/!A-PM`p (PEP((@P. 0LL`0Ep00! fF EPpq0Sp  }Fp PU0S p E.)@! (( cFp | P\Fp 7/PP QFp &P Ѝ@! ! qB@! lBpBfB@0O-0@p`M0PU  D0S2P    P崡 00S U 1!Z0  P000P0 PPP0PU:000000x Ѝ@-  E ЍgB0p@-M2S@P`x (ȾVP@0  `(E갿00ލp@  !B@-P`2$MS@p0  0*00ዾ4%40 0 0p`C$Ѝ@-@D I(@F(@-@pp uEp`~B 0`( "4`#/R00@-0@ ^ 0 # R 00P0p@-@^P T/00p``0@D^"000œ\p@Tp0,O-QRM@@001`Q V00ЍP0p Q :8Q@SI 딂\> \ plP p,lP U  Z4\[Wpp\X @ Q*S0C 0 &P 0 0B 嫽 0 S2X00cSc@-@ 000P 0S00 Ѝ@-@ 000nP 0S wЍ@-@ 000YP  R c Ѝ@-@\0S \0\0@-@`q0`B0`00@-8@$@0p@-800P@ >Q &T&0x1 RpR 0S TT0Q  ꈑT0800 >0S p@ ! A-p`KP%P@00<000S@ (0? @0K0cScO-@IMḀȐpqp0< FIߍ0RS* R? ;0 000K CZ%PP d0S  GRW ( Q  R (Qh 0 0000200> 0BS0* 哼 0370 RS00 T' $0K0 `C70$`Q 0 DPW WdP h  Q x'/$ ]\7 FQL @p$Q DQW R <0S @FT60 <0 < @W 0FS80 0 /@ G 032ၠ:0 0d 5S 0 FS+00 %A C 50@W 00  0FSw20 0 @8 R  FRh3    0FSY 7000  2@,0" R07,04'R SI B F P41(1"<1815%#8108ZW (1S 0 F0S"=00(  ⬻(100@0S W0 2S 0 FS <0 0 " ⓻ 20@W0081 0 Z00 FR P0@  y 2S P 0 FSQ0Y0 2 0 0000Y00 @  @W 00  ^00FSt00pp@x 6S 0`FS^00 &A 3 60@yW,=(, "  P W: ART ,00,S P R:(, "   PW: ART^ ,000D0C0W00FSP9000 0C4 < 1Ժ@ 4S Y 0 FS8M00 $A  40@B?S7= B?S7q 00PD0 KS:KUKe 0 S0P0"1N E0F R 0   ᕺ @>0 08  ]$Z X " " cSc25@" [" 7@-P\ R&@P\o0S x0x08  Ѝ0PP @0@ p <p&t" !$ A-PR1! @ `:0P pC R0 00 R0 6 30 00 P0 0:000 P00;000 P006000yP00ЍP 00000000 0]p00 0Qp0 00" !" C-P@MT a"P@, 000`0001H0i0P0 0 븀x0`  (y#0(10< P !P( # @B  ) 0ta !P( ``(1  ( }0(t!pw0+"70 (P  0  >``` P( `(1" (> *>Qߍ 0*  8 !" " @-0p M$M0i0PS`n 1 !p >p@$0S i p ۍ$Ѝi@ Q0 Pp 8QQ0500 0bpPy P(f " #&$" !# @- 0080@P PU@ 0S@ W `P@Ѝp θ00O-IMPpHLPL `PR Z1 0@PIߍOz"0,0t"600 0400 0 P` p00,0S2 V30a2@0 0!,0 T<`0 tP <]@PIߍO@<0 P \VT` \`00T<D0 ` I<P+# !@0# @# S# G-P@pQbP,`,2S#PU`,@ ,xn?PT`g?, Q 0S,9 $Y? @P,`0!h# `# RC-00`pP@T:Mp T  X ⢑00U *߸"0 8p Ѝ0R0  з @/<L0 ?p  ·"<@ ?p p@-RMM000PS`B S@ 00 0ppۍЍpt p p `F D;, z?p Vp@- 81S Q S0 000 LPЍ R S0# DPD30O-S4M@ h@@ `0 0_0P o0 00 0 P 3 00 y0 P3 0 0S0@0k00T0{ @P0t 00 0 `Pk 0 $ ( eXcpP  ,$(,8`P@ X0⣡  Q*ٷ"00pP 0$00S $˶ h0j  ,(忶xt$f(c,8` P@0 Sh0` 0h0  0304Ѝ 00 !0 pPz @ uZt $ℶ ,‶,0pS 6P@,0$S  S St 0P !R "Rp( $(,8zP@ p# ut# O-PM0@0400``2 ##`pp#`W9 pW6l0S,0S0`r,0v 2S0`80w,0v 847S0`lr,0v p"Rr0,p802 S0p0g,47S M:| 0 pߍ0$000 `2$Pp$`  `$2: 0 p $`v  0 p 00 `2(0p : 0 p( :| 0 p#0z0P,04l0<40 pl#0k@0"04,040 p]f`]c`d``k,0 !P !904ǜ R6, `"N`P, 00`1,0,0G0 0 ` kX, 00}R0S 0C00P 0H` ` 0 ,L,p1S  ,0 !P !`" P ,0 0L00` 0 )p,`# # # # # # @ $ p@-PUp@0L0pp@- MP#&p 0` 0 0 `@;p:@ Ѝp 0 `;p ` 0)`;p  |0U 0;100x;p@-@pP`V8!(0-080000&0S  0R  Kdp`H Ѝ@ @00 p Ѝ@ Ѝ!| O-`@p 0帀SP$H` A000 0 0000 ``0 Р0 `  $8 00003H081v H= ЍO4<0 $8 0003@0St3H000s$80408 LrS< 0008 R":kg{{'{z40S& zkg{{'{ z0S+d0S( $0P$h0!Z800 .R::kg{{'{*zM8 S zTkg{{'{* z?$7800 !H0S0SU h R 0R<0S 0S11H000s8040 P14 ZP18 TP|10 N804 d00@0S0i8 00.0 p ̀h`0 : P0 10S00Hf T P 0dh0 ЍO Ѝ??$ :$  A$ ^$ e$ m$ $ (% $ $ + E% PY% % %  L% S% A-P@T 0S0A `hp` |  S 0i0-hP 0S <0S $t7  _ .p0  p pp000 00p0 pH  00 0$0 F#5 FAd0h0% O-RpP\M@`$P X0 #3P 0 RT000 p` hPP. dL0S0 0@S@0#/L0} ?I00P X0 "2P 0 Rzgjzzz{T0d0S  $h P $[ <Y y' `20\200(4"<10,00000<00@0,0D00 <$P(P Q48`LPPPTPH07p_ pX 0 0PPN  8h0&h 0x100(4"<8#8  10 E00`0@008d#l `0 P00\ 0k`v t04S 1S0810 p \ X  @0\Ѝ7S zD% !% % CDC& F& S& /&  @-`pP@`0 h0X $7S R h0@Z0 < ` 6 0 Ѝ@$0  X& % ) & p@- P@$ \0 00L0p@&  p@-PUp00CSp@0D 9$5  (00,0L0p@&  p@- `P@p800  B\00L 00<0L008 %p@ & &  U@A-@P` h 0R 00 P3 j081HA p` P08!(0 A|P     Ph0h hh岯 0 d0 P0 $A' F' O' v' 8! " h00h0 C-@p0 PR  R $ RP508Ȁ `5  )i@0S PP  P0 _ lH81 0S; 0 S<$X3  C0 <`0  @ R 0P ЍG 0PS 0 PD0A 0 00 0SЍGЍD! ' cSc'  ( /( P0p@-800P@  D h00h00L0p@ ViI( q(  \/0S/0> d0S  0R/;. /  O-M00000PS`@pTQ 0 ЍOu> R*2P 0S 07S ǚ ǚ Y  S2  X!  Q 0 S:500 0p00 0 ЍOV Y 0 0Cs0'0S0 S0L0  p    0 0P 40 F0SY0A060@ 600 0Jp0 0  `P  "0 S 081`piH6@P RP0S0 0<S<0P0Ѝ 0    0} 0PY6S700S00 l00 0P Rl532Y@0L%KSK?305M40 Y0S0  e P   [ iL0 x4 @0S Y0 % 2)  Br  Br$0 0 $ 0 0P   0 ;Y 5 0 3 @S R@00 D$0Y<0<0818 ?  ; 0 P0P4 000Р 00 0 0P00S* >P *  p嵬 @ 0yЍO6600 0<P08 0S * hP   p冬`81 R000 0 0000H ``l0d\0S   d!0-YP 0 8 R $1@ЍOOY 0 ^Y 0 .0Sh00 00 P0 PY0 "0  tЍO* ( ( ( ( ( ) ) +# ) ) .) X)  k) ) ) c) P! ) ) ) ) p@-@l PT`0 p@0HuD N`\P d  p@s`$)* O-` 0Px1@pTT 0S R T0S> R* ᢈP$  0 D@X* O-,M@`P Q0 ,ЍO"`F JVWP0@SS 0SP0t#tx'xVI:PQUE0VB:  ძ"4"48#8S50V2:1 S/ 0 0P!' h0S 0000<`10a  & ! P /  0,Ѝ G 0 B 6`!{* * p@-Q` M\@MP  0000x p 0S TH  ۍЍp0 X`V \@T l!$A- p`@PAlmPUX/ A0Dm0S0 A\0S0 Ay!* G-M0MN0 ;p`p D Pd`8傪0480EL80H8$0ED80@X@8<8 \\ 7W0` 0E 030p ݍ0Ѝ`!   p@-P@T ge c(a_@x1S0pSq =$002p 002G022p R Rp07@-PX0B @P 0S40>8 Q0'Q'+  A R "'     0  Ѝ0@8}#z  P<gjzz+Sa$0@  Ѝ0zD* $p@-@P0 0Uph0Spp@+$O-`P@T Q Pd0S  0 E0pd0 ЍP0AQ 0S 0P ;.  08p|0#  帐81- 8 0 $ 0R0hd`h08 R0, 00C0 }-0800<0  P`00 g00 0S $0 pWp:#<0 2 0 0 R0H0@Sl 00ppW\0H0H\t   pV00*  + :$ ,0`( "4`4#S /0 @Rp@-900pPQ0`PE `@@d@ $,b pP/<0`( "4`43Z!R 2S///P/P/Q 0\R/ 0\/P/-000P b8"#4b4# 0Sx1@-@T P@x10S/ R0 " /Px10S/ R0 " /PP/h0SdP//0 SRQ RoQ /Q P/Ph0h   RQ P/@0 RP/R/@o//cScx1C-`@TMT. 0S pW$ P T PP@0Sh0S d0S4$|:d0 0S PPTЍ|0d 0|00 00d0 00090O P] ۜ PU9$0 00 PP 00d8dX w ⳜPP Ӝ|0d 0|0Xx/U" 8WPMP ħh| ⅜Pfp{0S 2P 8- P  IU` P < 0$Q S "  Q  SPp h  5< 0S  h,pP: t0<0t00 00 80 dQYx X P ?}Ux pP .ȐY $0% h  5< 0  $0<0|d!+ !*+ + + p@-PP1!إ Dp`01S 0S 0S 0S  `0 @T 0Q0 PSP 0U d0S0h0d0p@c !+ , p@-@T P>P@0(p!G-Pp`P@Ѝ0E @P00 4@P 00000P00 000* p1 0 e-$00PP*0 Lpe0S p0 0CP  0@R 0 0000@@! 'gS6, U, @-@T PQ0 8 00*:SR h0S dP HH` Ѝ>$` dp P (0Q,0Q  A `P z800000( ,0?P0S 0 h dW $0Q 0h0d`0SH.g, , 0S/0S/   O-MP<`RH0@8 0xP00ЍpP P0 U@ UP R R R0 P 0S8Y0000000Cs p@UЍOC4 @PЍO    p @@0 0)0$  9, S! 0S/G-P@M T 0p `xN,00 0@0 0 @e@ЍP/@-@TP@0 S   0p@-@PPP 000p襟 P 00p0000 S0 @00:S 0S @\S000@:S @h,*&0@-P:P@A0 P\:R \:\P@\\ @R0/x& 0@-@AP:\|\00\0S^ 0N:PP |P P O-CM M 0d4 !Sp$  SO0E`VK `0P0E@ PPi 00pCލ Ѝ@@;04pW 40p(0= P 0 `R0 :R `d4@0  0(8804 PF0P {0S ) p PP ;000P p 0S#00 0Ț8`p@Z +8)0P R 0)0SF @ @ )0P 0O008`0 SWC @DpW:SY @\Sp S Spp00T:C @DP  0SQ c)Np0@P0 0 Y@ S 0#SS `P@@0x[ P:0p0e= p0 R0 :R0 0KI 00S B:S:0 00IS! PBP[0i @D0J`FP @ 0S )9 b 002 @ ` P D,0  ,0@PE P0S ($ D0A00T*0 PP 0P:SVrh,x&@-0  0 Ѝ@-(@ P zZ0 0h,C-MBM000pS 0S`! \0S)  R&    RA^0C R[ {0Pv Ps @ EZ Q0*P ލЍ {0P P 0@P*Z0 PP U P*P   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R 0 A0SPZ\R    B{:R|R  h,*&p@-@PDp@NG-`= @P@ d PiT 00@^S0S:SQ @0 R0FAd7 P= \S@0S:S: 0C\ 00C Z @ 00CY0TS @ ASBC\ 00bC ^\ 00:0 0 0 Pd 0:SS0AR0@A P p Pd !!A-p= `P@ d^ P`FPd0բ 00@0S @Ad P Pd0 :RRAS@A P @-@# P 00S 00XS@ 00A ^a0ASW0AA0AS70A\2" @-04@0P )P,, G-A0SRPp`ʏ 0PU00Ѝ +P00CS0X Pp0  Y( _P , P P00SW  R00S 0σ47,P R   S@T PR   R ,-,@0@-0S |P cP,-@-@ZP08G,p@-P@PPp3XPp,@-@EP Q 087S@T ,-p@-SP@ P@p p@-@P * 087S@T ,-O-pPW`@P @ ЍZ K P 嘜PT  RT@ Z //////O-@4r00SRP` 4 PU00 Ѝ  P00CS0W Pp0 0 ۟l Z @PD 8 P hP00SX00 S P TP00S  rP  lP | fP ` `P H ZP 0 TP$ :㡐P-@-04@0P <'P-, X0@-0S H@ ;000D@IP0DЍP--@-@`0P0`Sp 0.P PP Ѝ-@-@P08D-p@-P@PPpVPp-A-P @`pPЍ0 (084SPUP @-@- 0 00B;P Ѝ-A-P @`plPЍ0 (084SPUP @-@- 0 00B;P Ѝ-@    /A-0@@`P@0 .Dp00D0& SQ 0@/0PA/A/O-@PDqpDpG``b0Y:0z  Z # 0@@DW 0DA\0:Z: [=0 S: p `$ Ѝ `p -A-@`PpA $; $5 #/A #00@-A^ 0 n$ P/o b2 0.0AT d$ Pon N$  A000R0@-0TM00`p<` @Pp TT0 6%p>@ A<0@404 4/,00S 0TЍ|&, -A-@` 0s P0$0p0pGWp0P$P @P @pT0 @@PP @ -p@-?@004@ppG0SkX$0S` D"0ß0 R 40><L 0 @TC3^ B00@  C31X  02` 3 d ! \C2 h00C0'0hS8 0t 0 00!\\@"H`| <7 ,`9PPDpAލЍ响pP #P 00PpWA C9RQ 0000&000%0}0L 0 R0Cu0s0Sp00$0k00S0Ce0cL 0 BR^0 0S0CX 0VL 0 BRQ00'0L00(0G00)0B00*0=000 0垜d0d :/1, !njP 0H0 -|&!- x3Ud!h - -- 1- 0H0S/ -0P / -@-P@ADM|0`S)0S&"0S S f"0P 0P@ DЍ "pW*P 0 000忏0pP"pX@ [`0p0X0X 7/0S 0SP 0 P0DЍ@蚏 - -|&, G-dqP@0L P12C1b05R0 0 0&0S  !h0S*0s0PE`1``d0 R1 *! q ` `  !`` 0R00P0S0PS ޏ&0S,P O,@GI --!\  0L0#0 -t0@-M  L0@31 ^AP 0C! 0ЍlⲎ - @-L 0 0@11D ^Q       -A-@@bM0u L0 @2# p PW%cP_  Bc p\  Z$0 HD@,X#10000 2R01   000 S" V00 S 5 ЍA X 1(4/00~X1威0 ἕSV Q`ЍQ0S sЍAm`\c  Z l @l%0S  Z㮙 b00@ -D!A-`QM0S 00S` @P9 0s$@Ѝ ⢎pW   @嚎廎00|0pS0S a@PpE 00pFV@@< P 00T l@徍`pW 0S:S* 0b 僎00ppp - -O-`PqL10PSU$,@T,P@P6 h0d 0B1 `P 1⼍h L0C R P!050%Pd @T: ? 壍0 p[L0CY1T*Q@@ -G-qT0So:\0`S& 2 c@Oo @d(0d$0P0@U1 0S.   B 0PN %Q * RG  ᵘ0B408@S 1:X 0@D8C 003 c0< ?o@@D@  ᮍPP  ΍PNPP  0 @ S :   b1"0!00000P00,0P -|&A-p0@@ `P PP00`Pl P@%Q *0S  B -$00S:@-@@R -@-P`P U(0SP@P )@T \0@ET0T 4/` 00'0S 0, ( @ Ѝp -|&u. UO-$MPpPdE00U0SPc )Z@ <3@434 4/W(0Sp0eWD@XU0XU5 0PPW00 # 30+*[@C@dQR: =L5yP KL ` $ J2 10X0D30 2%Q a*0S ^Z^1)Z @\ 1@嶘1 ꆁ`K K:1X0<0< J 0 @D@ T1 L0 43   @[ [@K@@d PP P00P K D K0@D   %Q   80@P0'0S 0T 0p&$Ѝ*0S   -|&u@. y. h -U@-M@p0aPD(0SWTP )@T: 0@(0 4/0#880 ђP0Up@P  '0S 0 ( @Ѝr@P %Q|0S0S P 00 -|&u. UO-@QT$Mp(0S@ P wP'0S  p@P$ЍW !0T`M\0T*P* 0`0?o 0c  `o `S PP T 1b*ɖ@4 T!P030#P0S X $200301S%T#2Q FZD*0T00S<PP 00PPP0 0#  0|0S0S @ Pp凊<q`0<0 0 !pP ʊPP% 0   D  帊%T#2Q JZ*0T00S  DUKP )PU @0@<0< 4/PP2 004 -U|&h -u. @-@H0'0S 0 00 0T Ѝ@Ѝ -UH////&/&000/*&000/*&000 /*&000/*&000/*&000/*&000/*&000 /*&000 /*&000@/*&000/*&000 /*&Q P00Q////////0P/ R//A-`Pp@0 P @U*0Q R* /0/(&h 0 0CS0 S P0 /p@-P0`@hPp@ Tp!0A S010//!0P/!R/P/P/Qa/P/0000 /*&P/ 0S S//0R/0000/*&000/*&7@-@PD@P 40R0PP 0  Ѝ0u./ #&PQ 0S///&0 3P /u3'0 ACP 0AB0P CSoPS//O-M@X @ЍOSQ`pu rTp 04S`\k P0@`S@T~WlЍ_Uᚔ!` x`PE`0r>T 04SJ:`\H  T  QX Q(      Z P    GT0`[T?o20S@ 4@ @0R @T`0-@0S S @0V @ X 1@@V X*  00`00P 0-!4!00S00/"*&/ 00S00/8!d&/ ///@-@H0D2P ۔(  0@\#&i-@-  Ѝ Ѝ/ -@-  ЍЍ/ -@-  ЍЍ/ ///@-  Ѝ@-  Ѝ0-@-  ЍЍ/ //////P/ @-P 0A r00ЍQ@P d@ p@-@P0 `P  \*. Q  Rp R  (  p 0 B *& -qA-P @p`>3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p@-0 00y Ѝ0S/1>3 !/0S 000/ -0S*p@- @PQ P p Pp/0S/p@-P0 @R`*0 PQp0Pp0S/0@-0C@ 0 0  (  ( 0 S/! ^R/0@- @0 0  $  $ A-P0S@`$0aH U ( U ( S 01 BpC B!y0`A-PRp `@{P 0!I000A-@P`p0 SV1 V00W W0Sc0P 0 B 0  BV  B* "M A! AC`0 F  B8  B "/ A & pG`P  B0Z  Bv`FpGPo`FPA4!A-@aP0S0<R&*1 21<0S0 0PPR0 ,S*!!!0 0R0 ,S(!!!,p (P0P A, (0 ,P(&*&*&A-P` P0PS\ ]\ xp@BX T 0| jPPp&0@-S@* Q 0S0000 [Q.Q000 S:0S008000R .R ]R00 -< 08 C800/`Q'Q!//*&0A-sMp00@P` p0000pSp 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0SN u P0( S,* R)\\&|\#00 |R 0S |0 3/000Q R R0SS*|\0 Q QQ S: 0S   B 0  BЍ 0S 0 c 0000  B 0B B0m0 "0 00 0W -p@-P4`@d@P@p Tp5!Q 010//5!,1p@-@0PS0<Q:1,1 R40S"`$0V):8p1PS58 0#p(00<^ 00^ 0S8opU 0! R R0 0P`(&*&*&O-@P 0RMp\  P&  @ P 000Ѝ 0@  NPP ЍO 0 PS@ ^ 0 00<00S*^Q0R08 ]R00-R @@g Q* ]R -RS\V0]Sj-R0 Sc:0S006000S80S 00000〦 0 hSFh ,VKX ,0Sq40Sn$0Sk<0Sh(0pwd  0(` pc 0@`F p@ Uh 00C0c-R [RS :R =R} 0S: N .S0,S00``0-S]S0S00``40\ 0 IY0 S:0`S00`0S00``E0 ˎ0I{P  0 (SB(0<R$  MP    t P $0  0$ 峠S0tS00``0-S]S0`S00`=  0 S:0`S00`0S0 -RZ QW]QT -Z00  YI 0S. Y0`S 00`0S0<Y00 Z0S  Z40 ?MP  .  uI400!0ⱐᲠ40  7P0S 00100  *P  %P (B(N [ 0]SS0<V*0P80 P <0S P Hp00勰P00 0  EB#ЍORW =RT ]RQR :R ]R001/ / (& -*&*&*& 0p@- 0(M@! 00 x l0R 0`0]00000P0 `P(Ѝp(Ѝp@*&*&*&0A-``Pp\U@ [U_0V:0dS00`00 4\U=*Ux .U; 0Sf0 `S xAPu 844U\ 0CUUt0SU 0`B }t  t 0 D OU &83U F 0  , 0000h308@0S* *Q2  0  B  BA   B0|  B5Ѝ 0  0S 0S 00t200}PT\QR {RO00j0SP;* ,R8 Q 6 2000/ UU0 R  !   h0 S*R\Q}Q00 S*0R S\Q }Q 0<00S 00$Eo/JU @0` V1@`(p 0 S *R \R0)S ) \a V 1L  0 S *R \R )R003 0S00000+ -)>{^ ]*&0@-``P?Q@ $0A  R % S 0^Q [Q \Q 0S Ѝ{Q |Q720V:0S00500 @0` V1@`(P ?0 S*0)S  ) V 1L  ,0 Sf:0S00l4000 S**@?PQ{PR ($  "!,Q 0S 00300\0 0S 00300?P  *P 0 B-  B   B0!  B0Sw* *B?RP {Rp Qm 3000f b 0)Sa  0  $  $  0  (  (   0   0p000<20to kmi0V:0aS00`00<Q >Q x`$P |O &   B 0  B  BZ  B. "Q A% l0 S`0* ,R-  0000< V0 R   0 S*}Q00A R 0}Q 6000S 004! -*&^ ]0S G-`M pQpG UpL/@P 6W:| Ѝ<PPP P $PPxP @DP 0   uPP6   $ ( , 0P4 8 < @ D t| 0000L R:0S005000 S8:  0A 0NIP0S 00,50000Y`  p0 P>3S! 1Ss Sp S <0RQ00p< 0 g  SV S<0RpQp< 000p000Q S S SS7 S S3 *S >SQP>3S S& "S 00 0\ S:_00PS, 0E10S*P8H0@0CU00C0 RB  \ U B!U  E 1U, X0C ^ဗ!1L0XRU!U!  R0>P P PS 00 000@0000 0H @ R00d000J 80S@ 0Q10CRZ/TUUt`zp` -Ee,1p@-@0PS0<Q:1,1 R40S"`$0V):8p1PS58 0#p(00<^ 00^ 0S8opU 0! R R0 0wP`(&*&*&0p@-P0@SQʡ@P80 p<0S P pH0@0@P(00Ppp@(&*&*&O-P-MLP0@p0H #W # 2RS T| z>#R  Rz R R Rg 0pR0R T` 0PgY Rm & R *Ra &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Rb R 0R  _ R Q R* TQ_RoQ_ B00/o00"P _Q0R TЍ0@P T @00S00 0S000S00t 0S*0S0T S00S 00S4 000_\0S 0S00L 0S *0T _0S 0R0S \0 _\oP0S00S* T00000_R0W0 S  _0S 0R0S0p>3p1># R{ 0G  a>#RJ RT RV R ^R Ra R 0>c0D2H0 00 P0 0 A>c pr8 pRd[2 A T0,  cP%0a !0R@pH00 0 P>cp0A0!RH{AH >3 0G  gP 0G>#`0 @ [P01!># R 0 p`>c`1>3"S`F 0 D>c2 H00 0 6P0 0 ( \(*&S2 O-P0Q,@p` V >\# (\ \Y \F \Q `P \Y \[ P >\^ \ \J \04\ \ \9 "\\ \I \ 0K \ &\{.\' *\ \08#8S \ {N ^0s 0@0s08#8S{0[00>@4N5>5. `F`FPV00@>N>0> \0C~>!0>#0 R@u @O-4M0\00(0, 0 00$002   0 @X = Q  0 R  R  PZ$P  (    R    ``S  R  Uj k V pw p (B( _U RQ v   _V R up  (B(   _U R w v  _V RQ ppX u0^ v  (B(    _V _UQO  X 0FPyu   p$ V    upv  w( ppu  v X pX qX0wo u`  _VX 3"  Q$,ZS (  X `M P0#v  _PU PRPU00000S 0R0 4Ѝw_Uw^RwOu2*&O-pMP`80U:Ѝ0!>3S S8 S6>S1 0 800 0@YS  D>31># R 0800 0@~Y_  DS S- S* S( @` PS 0 b800 0@YY  DSU S S 0>#0FϠ2@P0  =P0  0P P 0, 0VPP   W` 0 PE >#P   0 0T  0Q>SP!>#"RPEP0>#2  F O-P-MLP0@p0H #W # 2RS T| z>#R  Rz R R Rg 0pR0R T` 0PgY Rm & R *Ra &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Rb R 0R  _ R Q R* TQ_RoQ_ B00/o00"P _Q0R TЍ0@P T @00S00 0S000S00t 0S*0S0T S00S 00S4 000_\0S 0S00L 0S *0T _0S 0R0S \0 _\oP0S00S* T00000_R0W0 S  _0S 0R0S0p>3p1># R{ 0G  a>#RJ RT RV R ^R Ra R 0>c0D2H0 00 P0 0 A>c pr8 pRd[2 A T0,  b_P%0a !0R@pH00 0 P>cp0A0!RH{AH >3 0G  gP 0G>#`0 @ [P01!># R 0 p`>c`1>3"S`F 0 D>c2 H00 0 6P0 0 ( \(*&S2 O-,@pP W`> ^* +^` ^i ^O ^a pP ^o ^Y  GP A^x ^ ^` ^07^ ^0* ^G "^ ^l ^ R m ^0 &^y$.^03 *^ ^ ("(R0 ^ y  ȠLȠ \0 00 r0     0s08#8Sy0 ("(RY 0>0 E00  R?o20SpG pGP t0 00> 0 0 0i 000>301> \00 0>000 1>3 SLO-u!*&O-pMP`80U:Ѝ0!>3S S8 S6>S1 0 800 0@~YS  D>31># R 0k800 0@bY_  DS S- S* S( @` PS 0 F800 0@=Y  DSU S S 0>#0FϠ2@P0  !P0  0P P 0 0VPP   W` 0 PE >#P   0 0T  0Q>SP!>#"RPEP0>#2  F O-u!*&O-pMP`80U:Ѝ0!>3S S8 S6>S1 0 800 0@~YS  D>31># R 0k800 0@bY_  DS S- S* S( @` PS 0 F800 0@=Y  DSU S S 0>#0FϠ2@P0  !P0  0P P 0 0VPP   W` 0 PE >#P   0 0T  0Q>SP!>#"RPEP0>#2  F O-P-MLP0@p0H #W # 2RS T| z>#R  Rz R R Rg 0pR0R T` 0PgY Rm & R *Ra &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Rb R 0R  _ R Q R* TQ_RoQ_ B00/o00"P _Q0R TЍ0@P T @00S00 0S000S00t 0S*0S0T S00S 00S4 000_\0S 0S00L 0S *0T _0S 0R0S \0 _\oP0S00S* T00000_R0W0 S  _0S 0R0S0p>3p1># R{ 0G  a>#RJ RT RV R ^R Ra R 0>c0D2H0 00 P0 0 A>c pr8 pRd[2 A T0,  nXP%0a !0R@pH00 0 P>cp0A0!RH{AH >3 0G  gP 0G>#`0 @ [P01!># R 0 p`>c`1>3"S`F 0 D>c2 H00 0 6P0 0 ( \(*&S2 O--lM%PQ0t @%Qo ppl        Q 0"RS. 0 YO,Q 4^ 8[ <``F0` 0Z01S` 0s vQBo \R 0C1!S` `0su0 0Q[ 0000,@4H80<@ ; PP  TX0\ L0`az Vd 00 S`FY10`0 0 ,`NP XD0S 00D0 ,>`PD00D0 0R < 0JS : TW PZ Z `p3`XD0SZ 4P ,0@P4 pj,0@ 0S%00D ;0$00D0 ,LP5DQ/*0 F0,0D`P% 00 0,P0HP 00000D0 ,H0SPHDhX 8 D0`F0C0X?4@` 0 ,0@`\ 2ŁŁ XP4P HP PR [S. 0 Y),Q~ 4^e 8[b <``F0` 0Z"01S` 0s vQBo \R 0C1!S` `0Mt0eE(& 0Q00000 V,@40H08 <@P0T0X0\0 00S`FY10`0 0 ,`P XD0S7 00D0 ,r`PD00D0 [ ` 0R< 0JS: 5V PZ`XD0Se 4P,0@P4  p4P HP lЍ,0@ 0S%00D ;0$00D0 ,[P5DQ/*0 F0,0D`P% 00 0,P0HP 00000D0 ,H0SnPHD_X 8 D0`F0C0X?4@` 0 ,0@`\ 2ŁŁ XPpS0 0 Y,Q 4^s 80 0So <``F0`$0Z"01S`$0s vQBo \R 0C1!S` `03s0$0Q000 0,@4H80<@PP T X 0\ L0`xV 00S`FY1*0`0 0 ,`4P XD0Sd 00D0 ,$`PD00D0 0 S` 0P< JP:$0 U $0PZ`XD0SX 4P,0@P4 ,0@ 0S%00D ;0$00D0 ,4P5DV/0 F0,0D`P% 00 0,P0HP 00000D0 ,H0SSPHuDjX 8 D0`F0C0X?4@` 0 ,0@` V 2 (11( XPppp pnpl-Ѝ///@-q // //p@-08P00@S PpeP p -7@-@0P0S TP Ѝ0P -@-@P 0S r@P/7hP 00 0/ / 00 0 0 0/////0P  P@- /g2 -_2 P P/ /O-M@`DpP0`pR0H@ ~* 0000N 0Y00 R0$ό030#QZ^A2  # T P@P2*0 0 0T 0C2@TPT  # 3S R 0 RS# X#0H0 X 0Y00S0Y Ѝ 0R #3SQ 0X  0 0Ѝ 0S! 00HS X00X0 0[ @8   PtX0H0n 0P Qp@-0M @$P0 $/"O(0 Ro0?,0P@,.A<T-00ŵЍpG-0M@p`0W PV P%Y P.X PmZ PNx P4  aW Pf   a aV+  a aY  at aX5Z! L {a< vaЍYXZ-  ea `a  Wa RaЍ Ia DaZVY  PЍG P h  O-PQ0 Mh0dR00p0`  0 @P @0S nSc a0CS0qPL qPF  ЍqPzZ V000U000qPLZ V070U070@{qPZ| V000U000jqPZ V000U000ZW V080U0800oS LqPU000V000~0@D9qP 03qP -qPiZL V080U080]qP~ qP qPSZ8 V000U000@U080V0807U000V000.U070V070%U000V000 ЍU080V080U000V000pPZw ZppP XpP 8 `t t | T A- `M0 0 !!0@PH@>SHPPP PPP7"`!P`03 pP0  p+ 0 :up@ 'up@  p@@@dBu P$u``00`EtppX`p ;t``00`/t 006`.p@-@PCM0 /cP2 pPA ` @t00t2 @ 0F0 Fh0S VS00 SCލpt@@0Ss@\0\ 0P@0  P@1:s?00@s00@, p@-MQMP4@SZ TE /cPB QP0s+ nP QaP` 0s)pO @ 0@\iqpF @ p? ۍЍp/0si/!00p! ++^_s@0 P@0 c P@1:rs?00@p 04es0#S6p@ \s00Xs@Us@(,4+3+> %@<3+  @-rP`O-$(X,p.S`P@+Wu00Sb [0 0MWP: $" 2Q > !"04x"3S20*rW00Sa [0 0W P : )" 2Q >@AQ!Ou0 {0Qq w{` W P : 4#0"Q . ![0 0VP:t' 00{S' w{Q e 0VP:  4#0"Q .@AQ!O[0 0V P :[y'@w{ 0VPy: 0ᚔ)Z@0S20n2" U%> "Ww{T V P \:4# IT0S20R2">" R01Q"Oi 0S20XC"""""""""""p@-@M@ P, `$<Ѝ00[pG* 0C!R Q!,! R@( Qt08$0p|0xpx0(0|0p $0ptF 8p0V1<PS. ȟ ,!\ ^( S*P0 0X8P 01<p \ ,\Vt08$0px |0@x ( | pt0@$ pP4  N6?0,^0w <P0r  0=R< l< @%0Dh0H(00(0000,00,0> G 3,0PIP S G"x&  RQ9G#0 S0G P\'0sG `0d   0 Q0*0^*{ r0s{P T80< D000@ h0 0$% 0S 000000(00(0,00,0(00(0$Q0P S %R" :"  R#Ό01"?!x"0$00$0 00 00000S <\ X  NR HL\ @0Dh 0R{AP{{$hv `&0P 0v> 0`0?d000P0?T0080?<00@0?D00H0?L00/X00\ 0 00#MP0L dSH0 G`0G0Gd G 000#2( R 0S $0S' 2S0 :646 0Ÿ! 0Ϡ!>! 2#1110N 0pP<0d2@#! (1#@ 1110N 0  ΌD !` R<l?, | 0/  "1? A D  D @0<0S H0Q 004 0 2 0< Q00:P0 0<R$0h00c 0<0@e< "0RD01H0<0@ #:6 00" 0Ϡ">! 2#< 1110N 0  ΌD ! R@$?, 4 0/  "1? A D  D <0@ S0H Q0#0  0C0  BQ $0 h00$%l 0dR  P~<@ \@@@Qm&<0P0T8<J  \0a Q00000SUPT8< 4G !/ G! 0 ) ! 0 #0S(0S9 `5d0 Q00/: c 0<@ e%20SD000@0H<L#:@6 00!$Ϡ0!>! 0H!!!0C" . D @" 0D, P<8? D 0/  "1? A    @< P0LD \0#G0000$02p rp t t   0 RR  0 & G% G RQ#!G RQG# &|(0<0S$0@000<\=QH NRL0X\q<0@0@0D0h]0 000 0V0 0S Pj#Rd Ra  \QU% 8<&3 dP(  01) :60 0!$Ϡ0! !>@)0!!!0C 0Phh)! /.P P@<΁!@? < "AL00 h00H%00<0@ C00 00S ^0  $0h0 C0000S ^ 0@D h0 BQ0 D00@ h0  \ps; 0 *R" O-Mp@$*j4l`00%j0W0 T$ 0 2c1  ?<0PP O 0v> 0`0?d00 0P0?T0 080?0 <00 4@$@$$%"0000  000T ;0h0PK 0TP dP< P= $`Pg0Sd Raʰ  R]ʸ  RY 0 0] 0S0`@dp?O$@T'pET0}Np0`@dp00i0@D HPv^D PEJ000000 0H0!00R0SX0 0h080000R4 t PQlpx|PP\RSY Y  h@p| Ux Zt 0Sp0Xl0[h0 Rwt XXڼ8弸0>C 0CP0p00@t0p`VPu x0S 2ipt00 0800@4p0 h00 0P |0( x PZv> 00! 0#/!! !./ B 0S!?.P  PɊ 00#1?Lv.C BAQS| \xt Pth00 qp  A 0~qp `pV@P 0R?o20Sh00ߍ 0h0h00 qp@pS Q#! !pY@1NRp. h0 P0,P_000 `0  ZR 0`S 00@ nh0 0h@eeh0S 0V0ZS0 dh` I ?PhT0A ?8h<09 ?@hD01 ?HhL0)$`X\XZP Q`hT00h0S@Tph0S? 0ß園"b^2):##c2S# \TP-j<PP 0l#0dT0HP30@pCg0h8P000 `0@4pP ? /( Rß&0Q 0Z/0 #10">/ 0 C!a0C0 0"#0R"P#. X#0,nX10( #ΌQà3\!=30S C! B^ D 0 E1qp> @p(pSPqg#00ng0S @㼀p h @p_g00@pߍ輀X) XXʕ 0Kg0 Q  s!P =gT00:g0S10(` #ΌQ0"c01 2c1@TfgT00Ts| lK)\P(\ ףvɻ %I$@-@2T ptqnTat X00 R 0 R 0Q/  /  \ L  DQ p@-0l` SPPH 0@#  T\  Q p/pظ ȸ H  Q j.0 0#  Q/00Ɠ\ 0@-o>lP 0@" \ 0 /|A-@P `p@P0% P @PPA-`X@@P pjNP0& P @PP|A-`X@@DP pH@P0& mP @PPO-` M 7 pP8 찟` nJPP P @ & CP @P0S  Ѝz P W _ K0p0S| A-PpQ `@Q  P 0@DDB(000S  (/@- M`ppPP( e  00S@ e0"S" 0p000S0 7/ Ѝe0"S1Ds\0pT000S @ Ѝ1Ds$ at <L @-@A ?@ 0  PЍ- M? 0  PЍ8-0M  0JPЍH --U( 0P    0/ 00p@-PNU@pcc,0,0? `0  6/p p@-PMU@pKc,0,0? `0  6/p$ @-S@P 0003/x @-@P 0003/8 p@-PU?o20S@p000 3/8 A-P`UV00P00S@ 0 0p0 7/ p@-PU?o20S@p000 3/ll p@-P`@Ppb(0( 0@p@/$@ p@-P@P p 0 00 3/p -@- M  vp@(0(003/ Ѝ@ Ѝ/xд @-vp@0003/, G-@- M 00`P W0Sp Ѝhb4040 P@:/ G-@- M 00`P *0Sp Ѝ=b4040 P@:/ 10!Ph/////x/p/h/`/X/P/H/@/8/0/(/ ///////////////////! X | ,   $ Գ l D ,   ̲ t ` L < ز ( @-@$ MP05505#0%A0!0%sP$00$0Ѝ R/,0p@-S@p(P$ARp$0S* >$0( 0C\ 0 CR$ *0#$00S 53$07$05 0$0(0, 0 !PpO-DM@Y@fP , p@_ Z P a@O Z Z8$0P$ 0@Y Q< `@@ QQ3 Q0 S0A1@ 8 ,0R h S 5,3407,050,00 00 Q, P0Ç0,  0, 0 Qa@Q8,0P p S 5>37,05  50Q,0g 0 CQ * 0CQ,*0#  ,0 0,0S 537,05 50S 5,07,05 50S,0YR0#0C RL00C F5$0qS 5<37,058`0,0f[= A/o" R  F[:AoP  f[ AA0@ \Qu`0 0,0S 5#37,05 50,0 QS 57,05 50S,0 R0#0C R00CP,@DЍQj p` 0FQ)Q* AR bQY fQ ?R0@SP p7r bp@S B:p: # C,s 0c0#80 S ,0 S 5,3407,05 50,0FQ0 00,S Q 507,50 , 0 5SQ05= 3 7,5 0 ,Mb@0`fN2$0?Qa R^  2! a, A0! @ `3 8 Q,Q 5<37,5 5,8Q,  P,  , Q0@ `0 _P$ P! QP3 ``` VRQI[  R `S` 0P`0\ P\=Q,0 S 57,05 50,000 R,0 Q ,0 0,0 R`0S 5<37,05 50,00804Q 5,347,5 5,y ?R0@S@`0%#jo%#jx%ju-M{00{Ѝp@-MP@` 00 4/ЍpG-PRM\  `UpP*a@/NP D1< 000pp Ѝ80S  1 00< 0 pp^0S Ѝ贠 ^0S 0 < @x0< 000@ pp^0S^00^00꤫ 4 ( 0  (@- @MЍ$EO-EM MaX@Pp+`E*I Y0P@)T 0 Y@0PT 0 S0EAP H HUEލ ЍT^00Eލ ЍM^00@ @-`@M pPVYP) /Y R rR  P   0@ P@ЍP  rR 0rST 0 @0 Ѝ@y ^ 0 ,  A-` @p 0P/S /XP @0 Sp 0 S C \p@-IMM@`PP p 0: S X0 0up IލЍp]O00@IލЍp]00H p@-IMM@`PP p 0: S X0 0Jp IލЍp]O00@IލЍp]00 - M 0  PЍP 80Q 0 08080//p@-@P PP` ץ ?PP u NP  p@* PPp-40- M,0   ЍЍ/?HP --M  Ѝ Ѝ// -@-MN<@@P 00  0Ѝ@Ѝ/ ?H0-@- M@NP  Ѝ@Ѝ/O-`Pq,Mp;  PR$ Ppp @P$> PX P@ 0 @XP N ,Ѝ000:Q!0P00,Ѝl>Xp@-0(MP `o& (Ѝp0 0  =Hp@-@`PuNpp p@808 0p@-(M P` H& (Ѝp<HHp@-P@0 0@`  ONpp p@mt<Hp@-(M@PANp  &8 ](ЍpX@-@P0 0,M`P )Np & E,Ѝ;HC-PP,M/ ``FV` @R p V `@0 @T M,Ѝ00 0:2 0,Ѝt;Xp@-0(MP `% (Ѝp0 0 X:Hp@-@`PMpp p@808 0p@-(M P` % (Ѝp9HHp@-P@0 0@`  Mpp p@y9Hp@-(M@PMp n%8 i(ЍpX@-@P0 0,M`P wMp V% Q,Ѝ9H P $ Q80 8@-M80@08 Ѝ880/LL0000 0<Q 80880Ѝ/8pP/0@- M@0@00S 00000 X x PP  d00B/P00 Ѝ0@KP,374,0H ܘ 3O-0MPP 0 @D `p@ P P00U pp00C Z 2ATT00  RF LD@D T]:[ 2 0000~`K L0 V0 W8 \2ATT 0`Fs 0Ry L  0% 0 B0SH L0Ѝ V0  0  }L ` 0 0pHX;0S2 0 eLv 0 B@  0 B  BSL`FtY  B 0  BCL 0 z 8L 0 0S B 000Ѝ 0 ]7 0 0 h3Hp@-@P Lpp p@0RS00 /D0D0p@- P@ Kpp p@2H808 0 QR00 /2Hp@-`@PKpT T   p@php@-P X @ 00`KpTT  p@p1H"O-P M q 1D`00 SH,0?e@Qpa A10A1[10GPp`u ,  PPDEQ "$(Qp|0Ap7 @[0 S8 0?# R R!R@[u`p ,0 0 00NC11P00P0,0@ Ѝ@ 10 00u|/HD0D 0@-00 @T AP80@080\/@-@P @P80@080-M0 Ѝ-M0 ЍO-PؿiM ̑Ёqf Q`P@ P?`K͌U P\?K͌T P?F͌(1S P>F͌(Y P>C͌ X sPL>JB͌8W bP>̌1S PP=^B͌`=@ 0S708x H0PP `P, P  P P P P P` P@@ (P PpP (qP PD PxP'( Q780H0x100CS00000C(0h00Lp P 0QP ,0 `0p@ , W @  gpV/!01AQ 0 0 @T @wT, W   @@daXhP 0Y  Piߍ P 1 S ,0 0 0 !1S 0D 0| 0?p00B,(00PpL!!\V( @  B  $48p< [$ 00A00@S9 00a1 P Ua PU, [000 P,0匐0Yp$0p1P,@`@P㐽P ` V ,@0@S 48p<PP 00 0R 0'LpP1L00P@X1@ @P00P0$001T00PP1P PX00P0000(,p A8 P40P0@AT 0<O< U, p@PW 0g1pY@10P00 `00V00 `pV,0W0 P `ܰ少[@`@PP  ` V @pY @ P @T 0 P8 U`T,p40@T`0 (!  A A$@ 4 p,`0[T0, q q000 p`8@<\V 0f1`W10 @ 00 P00U00 PU,0 V0 @ PqZ0P@ 㔼P  P U `W 8@<\@7P,0@0 0 ,0pG0H W0A10D|aD>pU( `T( T( T( T (  T,( JT8( TD( ^TQ,0 1@-( `BU0,p4@A,   ,0@0H T0封"1D|Q=p T Pu[3p,`4 TP2 00RV 0Sf ,00 [D k! 0 SW !L011@ @ T @(T,00 0 @(0 pPCT,`4 0 ,01 , 0@ H 0T1D|=p! 0R1B@P㚻0P @T  0 P (0 SQ(0 00CP, P0p.X4 X" 0 0 B00 S3 0 a0T !1 @Tap @宽T,000 @,0,0Q@ 0@1P`PD0P: `V  0PP$0SA ,00 $p1@T d!@W3 !P011D ` V `hV,0 0 0 `Tq[V` ` [  0 0P,p40 0 (0 SW(0 00C,p @0 [# 0 0 B0!0@SB 0a0X !1H P U a PU,000 P,0|!0RP0P1 `@㭺0P `V  0 @ p3 00R80000S p,`4 O-`YM|0cS PAX3? 0K͌00 00S 3?HPK͌0H00S2?p`F͌(0p00S|x2?@F͌(000Sp,2?pC͌ 000 Sd1?耍B͌8 000 SX1?̌  0110SL1?<1NB͌ 0810 @iYߍ 00"0Sk HP0Sv p`0S @ 0S p0 S 耍 0 S  10S N X0 D@-<@M $( ,Ѝ H0 D@-<@M $( ,ЍH`0` 0 R/DDQ 4Q(00?H/hH$T0P0/ D @  R 0  R$ 00?H/$0P08 A-D   R'P?UH0@aaS@T,p10 0D   C(   S@T,  R 00/$0 0 tHl P  `0H?30\ -@@  D\,00D//P$O-P␲4M  0pS4ЍPD H0 L ! 0 0|!0:|@ Pq 0`D0ZP`@P0Z0 T㔸0P V@H 0`@:1 0?3Q |QN D pH0L  00|"(0S:!:`P0S R,@P@RP 0 l: @RP0`S4ЍP U|00 =0Px ``0T `@004  0(`Pd @|`$0 0 LH`0` 0p@- PU 0@S hP7eppHp@-@P 0PS QP Npp0P0& H -? \| 0DR0S  0R0000 0\$( /0$0 0 lH 0 0 /ᐥO-MpRp2P0@`0Vu T":L"@"4"("2 2 $ 2 T 00 1 X 00 1 \ 1 ` 0 0 1 l  1pmp00pnpp@z20吲唢園 $0TX0\` 0lm0n e1Q0' 0 0  pЍ|0x0t0p0l0h0d0`000X000P0L00 0D0 @000$ l@40,HC-pP␂M@ |`P {h2@0@Z  @03""BBB {6`@"C{@@ÅCCĶPU CD pP 1pK 0p RZ @B0 @@@(P9 0 @@@(P. yp* $p& p0 @(P  ?'f(000S :3S ЍP ZB2S@ T宸ᬸ`h0S,;@pPc\ 4x|k A-Z`pPp ZB2S@ T[S}000 R Au A p @-+ hQhP@EM`_0  S*<10#  !!!- !!!!>  !< !^ v : !' !.{_ !| !o !* !Q>{ R pp1 R 0S8ЍQ L0 0 0CEl00TЍ!fPl@0l 0 S/̝O-`Dt@M[p+㉸(($ X=0CS0S433? DP*40H @08p{8 t%p{ġ\T(ÂLLßDDßP<<ß44ßx,,ß ߂ß@ßÂ`h"Ÿ! ⼁!: R 0S1810S XけЍQ d2 0 0[DLr'>ppGl`( UM(@ T (0Ѝ>㴷@ <㮷 ^㫷v㨷#㥷x:㢷'㟷#㜷0# 0嘷H#㕷p-㒷-㏷`_㌷|㉷oㆷpヷr〷y}zz{w@|th}q`a0` lh %+!,!-!.%0%f&i%j%k %l%m<%n#qs%t~$%#up4%#vr,%d"wy{#%e"`"|oxz@h 00p@-0'N[( L(@(0Sp O-M4g47`,0 Jҭp7划00 7 `0P `00 S00U0S}U p @00  4` S  00 4 `0 s 00bR$ 4S4 0((&0 0Ѝ$0 s 00bRS4 0㋰ ?<21 R R3 $ ` r  aR$ $ Qt l   P5U0pS  p! @00 4 ` $R{ 4 0 0 ; 0e $Q B q/ 0 ;0 Vp4 S S040ST 4 0r0  cR0$0GU  p p P p0np P 440 s 00bR43 $0$ 0fS t30l3#`[ pS 83003#`L p3 0 B ` 40q0cR 4S02$0$ r0 0C aR?o$2#R p SM p  0 s 00bR40 ;0 㵵p P `R pa 40 s 00bR4 4$R40 s 00bR40 ;0  哵 pE `Q q 4 00 0q0cR  0`  Ѝ 100 ?c p; 000 ?c pv/` 0 `00! 0; 4 00 40 s 00bR 44 `tTA\ Qt0D\ 80p@-P@ 0 PJ TT Tp<O-@Pd4`DM0 8 p$Qq  :Q#R3Z 300S 8E:P@P@P@x@-@EP `EP CP10S. 0! P:0@S0S0[S0mS S@ 0S 1CQ'0@S ;S 00C S0000@S0@S mS 0C;S P 000@S;Co0V U O-P0\fS`MpHvpJP T0 pr(ʍ"(0I"Rp (0$00 03SH:PK ҰT>:P ɰ XRڄ5$|50T l5"00\4S03P00S5 p0S2 4S, 4S 0d%V、匑Tp"2 2Pm 4p2Z& LQU# P P ڋP YVoH5S4S 4S0?o2 C04Ytx2 PtX  DP3Zx2  zDPx2?;~0x2V  pDPx278x23X|2 PV t3|2gЍ0 D $l h $ <% p 0$0(0LXi JDP Y CDP Z# 0 0@=00@r$rht@4HT@-,@@0S=00p@-$@@0S=00o@-MT@@ 0S Ѝ< 000 00=0 0Ѝo4@-Md@@ 0SЍ = 0R  (00 Ѝ = $on@-$MHBH2@PQ :cVW0r3p p10Scqp 0SQ1p0SB "0  B0*1`00|PN 1@ 300 R 8 D 300 X30/0 7 :3,p 4 P`$Ѝ0`00|P @ D= 0R` 00 `<00T @8 300 '=\nDnplpC- M` S P@<0@00:3S W  Ѝp  0 000:3S/D̾X0X 00:3S 03p @-0P`/᜾D0D 0@-0 03, p {P`4@0@ 0@-0034p 0P`0@-PP MP* 0Q0@00xP 000 2000*C*. Ѝ0|P H000 24000*. Ѝ0脽p/ 0 0@-P@ M0:R# P P&tP 000 20- Ѝ0`P D000,PP Ѝ0証p0 000:ꬻ!0\ S0 0 Q/p@-@Pp80pPU,LQ (0 P0C0S0 U@Tpd#80pP 0S,01///A-PPM Q@`Q00?`FV`V` ,p(L 0@pVЍA-PPM Q@`Q00?`FV`V` ,p(L 0@pqVЍP/\ , 0 B0/\//A-M`V,P@p(L 0@pETЍA-M`V,P@p(L 0@p+TЍ@-PP M+ Q@7`pV00Ӣ?0`FV`V` W ,1( @Q Q( Q Q V Ѝ , B(0 @T0 p@-PU,NQ Q@(`@0@@`` \0C 0 S0Up(,  0 R S0/0@-P0PU,LQ (@0 P0C0S0 U^00@-P0\0P#, 0 BP 0 PU0,LQ (@0 P0C0S0 U0\0O-4 PlMVCT_ ,P@Q@8 =$^8R@ 0000@0pP 0-PPp4S-`0@PP#@  p) ,44,  [ 0 3 0 a lЍB 0-9lЍOS0*O-0$MP2Ut 0$ 3`V} 0` 0P  W):0S`H9 0 O@P$Ѝ 0SM S7 S0W  80 04S $ЍO@ 0 @S S" S0V   8pG0 0@SG0Wᨀ *H0W0 `@G0X0  \8pG0Wᧀ*`@0X0 `@ 0S S0W0 @Wᧀ:0X0 \O-PQM0 43pS`.0S+R= @00! 0@ @00@ 3TP/  @ ` 倢P @ PER 0  ᜢ`PЍ` D ) P 4F " 2 Ѝ@ 0ꔰ` P0  0 /Q 404 0  R *P /L0L 0 \ ʌ-P  /Ḯ404 0  R *P /\L0L 0 \ ʌ-P  /404 0  R *P /ἭHH0 @-0^ @P 0 @}x0 0@-0@T J#0R4 B0pQ 7@.P c @ 808 0  R *P Z/ᐬD D0 00SP:P4@//H000 000S :P /L0L 000S :P @-up @T/ᴫ0 0A-0`V* Z3 S$P! #Rp@4Swpp3@Tw AhB0tQ 6A!.X((0 -0 i|000 000S :P J/D00O- M X% p `P 0 Op @@P  0 PCp@ 0 .@ ၠ Ѝ@P  P /p@-JP }3S P`4`b30PV\  03s S 0P 2 $R 0X0S H03 20X #$04p03ppKHp@-jP 93S @P4P30@Sp@A-`Pf JSU?sW< 3$@PS3 SW*0N, SsH0S0 WP3PSSpP4Sjpp3PUp,0\4000?a000401C0010L10|1spp@-@P X0P:"C0T0XppG- ؀\/P@p  `ᠠP LTL VW PT VW  T000S;0 ዠ0 0 蠥O-($Z Ap`PHP@8P ( '5T2LP* T BP 0 5 @00 50\ WXP  RX8 @(  !A5@0갤d @-?C0 @   @ ((  5  lXA-@PQP% pW# 0 0S0۞,ٞ000 R   R   R  P QĞž4從`T `TX *P Q Sp QW02p@-`P X0@:R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S BP00SpX@ '(@ 8Q0@0ppp@-@PTa`Q X0P:20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  \00S P000080S@078@0pHp蠟H0H 0 R P@0?30Q@ 080//4H(0( 0 Q /؝H(0( 0 Q t/᠝HT0T0p@-PR ` <@78H@?`pphHd0d 0 Q R X@078@08Q 0@0//H0 0 ꈜH0 0 (dHp@-P`0`0@T X0:20T1S@0?;@0X<000080S@078@0xp8HP Q@0?30R@080//R`/R/p@-`S 4@HP@?KppRP X @0*"7 8@08 R (0@0//P@/*p@-@Px`P` X0:20T1S@0?;@0B8000080S@078@0 pp0 0000TP PR  R ! R! R! R (!R !R 8!R !R  R/L1S/0 0000TP$ PR  R ! R! R! R  R4!R R! R @R@!R(!R !R 8!R !R  R/L1S/$p@-P,@0@0p@  Hp@-P@, p@p0p 0p@-@ QP00S ^ p@, p@긗HL0L0p@-@ P $pp, p@8Hp@-P@$pp, p@p@-P | @ 00`$ppT0\ ^ @ p@,@ꘖHp@-`@P$ppT\  R @ p@d,@Rp@-P@00S ^ p@sL, p@lO-`,0!p 0 Ѝp4Hl l0 00S X  8Q Q @ ,@ /&R//ЇHH H0 00S 4  !R@ ,@ //PH`0P0 T 0008!R !R @0<@0/6S//<0P0 0 0001S@0<@0//ᄆl0l 000S X *" (Q Q @ ,@ /&R//8H$0$ 000S @ /ἅHP X0:20(!R !R @0<@0/6S//0P @ /A-@Ppp" 80  P P`p  i D000T $000S0 LL0 - 0?o20QQP T\H,0, 0 RP00T00/HA-@P``$ 80 ! QP~p P eT  800PU  000S00 0 H?o2?PRPT //PP00T00/,0, 0000P/P/ᄂ,0, 0000P/P/HO-@Pd30Y Q T# PU D#00SH04SPPQP0pGP0HS``HpHW, 0 ^  1  !!,pGPI@Ye0pS a[0 SqU,0 !0D|000 P0pP`a`0IS`IX`a,1 \  0  !![,pW`YH0pSa>0 S:,0 !0D|000P0qpI PX 00C /0HSP 1TX[00CS``[TY0IS`YPY0 0CPY0 0 ~Hp@-@Pp`P0P0C(, ,1C B00R00@UpP 0S 0@//P 0S 0@//P/P/P/P /P/P/(!O-PP , 10, 0DS 1H`?c``  AAp0@!qW#갑@W0 8 0| 0p@ P@ 0@00C `2,}0 00{H\000S  Q R P 0!00//((-(^Q,0 , R1S ^^1S ^@O-MA!1@ 0Q4p, @p P `0S" S#A 00 0C ```P 00(00(00S00C0T0 03/p 0PS@(  Ѝ'z'4&(0A-S$'p`4@P(0PS@Q Qa ppQ p 0P(0@Spp(0S/p@-`@0P (0@SpP0@-0^ 0 @ Q@R0%O-@ M`P VTppD0S  00C(00@00 T0@ 0 S `&, 0 S@p  Rᰁ@`pD埔 ` | p Ѝ@0 S RR Ѝ, P d,00P `00V  ppG , B,(pqqA0 ` T` 0Dp4ےP ,00 G@p`4 0Tp `0Dt@U   PB   0SQ 0 0PC $ 00\R <@U 0 BQ 0C R G-@Ph 0Sp: P PR E PPQPEPUP ` `R F `0`S W0` XP0`F`V` pW 1 $p00SC 807`PL! R@! P( 4! R# $! R  R 000S1Q0/P00` 0S0  0V(W ѳ`F`V`0X0P`UPW`V``0 @p 0 $p0PEPUP tH4@ PQ0 /$ $\/ P/hrA-PQða@`؜1Pp0$ TY 10 0 QTD$ 0R U ESpL @10 0 QTD$ 0R U EAp: u0 0D  Q SC$ 0R U E+p$ 0$@ P0*@0B0TP @T 80@Tp` 0QrH4A-PQÈP0P`@0*$ P uT00pW  0T4pP- 0S* 0@- \&@T!\8x ƌ8 t ,0A@0@PU 0P0U00 S0/0?o2?=XA-P$@0S00â?4 0\/@0 T`A pB 0S%0^! 0S0X K"@0 0 0 9@U/P 80Q@0@08080//A-P 0 BS0@( p`0,,0 0CA1!0 0t`@0S( 8XE?*0@-0B  80 P R00 8  $P R  R0 00S00!R0$R0 R d1S0800800080$O-RQ M40z`pю@Ps 0ሰ(ɎP,o ޏPP0^ X4% 0080!0Sa0 ` `8 < X$p@0H0|0L P0T`7 4!8 \0`0d0h0l0p0 Ѝ㮏P4, ㌎P& :"R- 0 R80SJ 0  V 0P 0PʬR Ѝ ᴐᲐ ᰐᮐ@ Ѝᦐ A-@P0QM(PD QpAR`    B P2 \/X* P%ʤ,APP  D0HRD0000H p0$`!bP@0SЍPЍi@-M @ 0Ѝ@-M @ 0Ѝ- M ЍO-M@ā` HP`JU@p_WNVPED   0  PI 㢐L1D00S*Y p$`(D0@0S0p`0,0U00 D0U@pC@`C0Y Ѝ00H00H0t  P PEP` V IIP ЍP @g$400@-@PM0 pp  00C  ?o2 0 mPP <Ѝ0PЍ0fHH@- @  0M 0LЍe-QPDM00  ( 0@4Ѝ eP8 /0@-0CM 00 @0C0 0 0D NЍQP<O-DM@hlp0tx`PP RK TNP@[ B^@D࠳UEpAPpWAA^APU0E pCPpW\[4AAA!p @lp0,00@0@0*l@0 @ V 0 000@ X@* p0Y  DЍ   Q Pp X@* 0Q0 00C0CLdO- 0@000DL0 0  0SO (@@000h0S80@080 L00S$0>, 0(0\ ,0!0 8C8  S^LPQL00 (00SCL00SW ( R), LP S800,0 1G$00Q$0 0\ 0(0AQ 0 , S(0 0 00,1$00 04 S 80pLH0@0D00|00p 0SL01H@804 0,0000t,04 0Y 0Y 000S`S0F0Q804 0,00 1 1 01IY0Cڸ@LHPQP  YqH @ R  T000P P 00 SPS P*0 R00S 00P ɟ`V0 0CS SjpO 0 AS0 S P0P ` P R  0R  `9,00Se@ Q0C0] 0 S00( 0S(00000 0 S(00 R0 000:3s P  RP   `   (`R r @HDHT,0Q0 L000Sdl8, 0@000h0S(00S80y00S3 80r 7r 8, 0`V 00PU0 0CS<0 HDD<0NN Œ Č Ȍ N LL\mɟ`V?A8 T0T T@00D R 0 R PP! YR  uY $Rj  0E0 ~0pb   0E  @000$R , |6@  _@000!R 6x; 8000Vz00C000C05, 00SA0X *1h"0 , 50H 0 8  0 4P, @ 0ep$`t00S000 @0p 111qWP4$0 @00 00S~ 0 5# X0:h280V @ t40S 0S@4, 0pQ0A0 0C0 10 0 SPP 1 11RY@z RRQ] 0    U,Q Q !PB#`F p0p`P@ !?3 pGWaFP `/p @ 0  L H P 0P0P00} XX0P0P0;^O L00S6(080 } 800  L,10  p`dЍ80LL008 0080@080- R d1SdЍ( 0 09x \0, p0, Q0A`0Ջ8`! ,\)PY @NLL4( 0 r p@YP P0@, QLJ   8@,@ APX@T `P `pPT` P0 `, @ pPAP(UD EDP  P! Y   @@T` Q0B0CP`P P8p0 CQN @0p  0@4$<0S P 0,0[1,01`w @@[`o P  XPn0$0S000 $X00@4< pPLPA\L0(0 0R( ,0, ` pJz5 @Z0,  \F `0v8 0(00@ 0Cy(@ 0 080 0 w 0XPx    0Q0000CP4` 0X0H0800D\#  LP 80P0帀L Z J D| p~Pb d1S_ , H5@  pUP:X XP@ V@DT H HHE@H00:  80R0,`0A0000X0C 00@P ` 40 0E00ጿ PU U R0 R  X R RR)0SE 0 RAA  ;, @` H0  `@0 0p;0 `00P  +0@` 0 B00 0P v  Q@ 0`00 0 @000P  T P$ , (=@ 000 @000P" , |=0 0  0 A R! U =, @@p0 0p1S U >, @`@0 0PL5S 0 0RU l>, @@p0 0Lp00 0  :@000D, >@ 0`C00`0 $@000tW + q 0 U@`; 0 0LaP2Pj @00 pRU xʕH%Rl0 @@TI 0$ppP@<@U; <PP$p@`0 0H`%UnH50S0X0S* 0 0 0 0, @p@0 0H` U~00 0  @000jP$pPb6IpHp@-@PPMP0 0`0 R    80x t000 0 00P 0  Ѝp80 D000 0 B/ 0C?0Ѝp -0 00 ,HC-@P⨐M 048! \` d0hlp`PpP_80  D000 0 B0C 0/? 0ЍЍ+@-@P @T(!G-PP 7 1D00SHp0?sppS/, ` !a@aT :#| cp @V0 S0( ?3 S 0S1S0 S  +0 00)H 0R" 0R0 0#0  -QR ^ Q QR 0P //op@-PP @0 @T $`U0 VP `YVp`}0P 0@PUpT` @AT @pp ! !@-@P@+T R/0A-p,SP` @T @T0`SP RQ A0@ ", "Q//@-pQ'`P@0D "! "T "! "U ^ 0N "! "\^`WP@@-@@@0S U$0P0C$0MO-M:z*0p$P( ,pP `*00\c S@@s  nRXan HR@ @j`40IS0c0@T ^ጰOoB@TP AA  RT0)\ 0  |  bR\ `)` R&P) R! CP'(I@, 4R S[80S $ 0P00B$0X @C, 4R CPg S ^\ p( 00Q P80, H04(0RK0((H 0@0( ~ $P)0S700S00l0S$ 0 S! , 40R$0l P, 0S  n0P$0@P$X70 R(,Ѝ<7 0( X$(00 SB G @ `5 & (00 S5$&P0C (00xP0S 2$0P0C$0*x&  l&@ 0,@(@ R 50060, 40RofF`@0,0 $P,40 P@0(@Sg 00 CRcڴ%%  pp% x%@ 0p(`Y ʟ| `nR`F`V,00P0S  $ 0P00B$0X@@aV  @ Q[Q $ 0(@0C,000 0CS[ pH40,@4!0,01010zd4`000 P ^$ $@$#@ P(@h0 Rv ,,Zq  P+ x# ? l# (@$@ ?#R W( , #\ $6 (@  P 10(@$ R '$@ P  @ lP "  20,  , k40 S [ (L2 0$ ,B@0S $ 0P00B$0 $ 00P0 ! 뼱 00(`V7ڨA@ 10(`0 V0|!0`Fx P(`0S $ 0P00B$0,@%A@0S $ 0P00B$0 ,@ &xlH x440|8ltHO-lsl3phC@00 M S (4000400c`(,P Zn34@3`0T'#0C S402PL좟 >0@DS(00S0 0l0S R "0 0 204@,P0T0hP \RP0 @P 0( 0CS L P 20 0 P1040 ,( Ѝ00S00h0S00}1 0T0  P,P@ ᦷ@1(`0 R*T$ !P00 @T 0 R 0 P$ 00 00l P @T00,P0 0( p0  04@SRCPE@D4@P,K 00SL004P4 l|p h,(@- 004 (,\(@- 004 (,(|1|!0O- p *⨒YX!X P!0P[& Z( 0S!,ppG`P@0   R    P0 P00P0`SYPU0,@a@DSQa@U S@00 0 Q  ST 00 00 08QD0S0l%R h%R /!R!RtP/P// 0 000 0P/XG-MupP/ 5` 80s2 hD  SP̠r HR!1S85@050 50 `\P 400 ~0P 400 s40 0:p@00@00l%R h%R 0ʀl20 h"T0s# 20T0$,,h"h"+h"h"+h"h"*h" h"*h"@h")h"h")h" h28h20SJ\Q*gnSt@ Q _SP9 Q ZmSV2 Q iSPV+ Q j`S`" Q _SP Q kS` Q[PS ڃ0Y[=20  0S R!=@-pBt000 0SD"D2 R8Ÿ8 =01U+ 2bA`PU" 0S 100S H0 0YH0 ,N 0Q  Y,PUЍY 0   0 0 00R0 0 !R 0ʀl20 0 !R 0ʀl2%R t5S 0ʀl2Sp Sn Sl Sj Sh Sf STc 0LpL\1P0PP PKPK 8 QD\B @- 00ʃlœ\ 1:t“ '@T tƒ'> 'tƒ A\ B\ ^tƒ    //H0_A1P0= 00` P7ʀ:l2 S3030 /@ P0000CS000000000000000000/ W1@-P@M@&\\ Y #3t P P 00 &000 0 iЍ p`P -P\P Y # / 0 0 |  0S h h0 8=0!H00 R/@- l Ь0((1 @-00*l"R !@@ R  ,Ǡ 0:'.tB00 R @R  AR   0 0 000:h/`p@-P@0@`M0*l"R R &Ѝp`   P H000 40@ 00 @ &Ѝp0p|02C-00$RS MP@ "2` @  "0S 1#{0 Q  l"R R, !`@ '( v@ Ѝ1=00QM0SJ\1`20lL100 C0剑Q:20h1=00Q!0S0`20 000 #0剑Q:20t 000 0`0`U0!Q 00`I0!Q hp0 0 0/,|0| 0p@- @00CS0 S 0 S P00 pP00p@-0CS@0 S 0 S P00pP0000 0p@-00Pw@pp@-Pw@p 0 00S  @-@J Q P\,Q    @/H0P JP\@-\,AP /P/0S/p@-    A BJR@Q`,PTa@@@AR  Rp03O-0PP`$MC@ V wpP 0h#0C S-000$ЍpT0 S80  2 0@ɱ  B@DT p`$ЍIɟ,0 AA!R1A0 CQc(^01H1H1PWZ0!! ! :  Z J T0@ ?Zq $`P@ sP, @ T  @ PW0(@p TDI0WD@0 (0C\00Cb$Ѝ\ X@ @  D0|0_p H0001@D T `V `uV ``  @~P0 0 Hp@-@Pppp@@0@0p@- P@ ppp@HX6O-0lM@P,0 g Q 0pv`P^ P#s0P0X W  0P <0R0 080ąP 0@SF00800`P0S P0 0 0PEPUS 080 00PS0P<0< ,5 000`Pp0 @R <0T R8 / 0<00800C?80(v0P`F"vPY`00 v, h480 pP p`K 080 `0`p8ppP P8 0E<,Q4pQpP Qձpp( X< R!! B qH" RW`!: pG UH0< S8 8 `< (P4@p$0,0 1400H0p@0 @0 0D"PU<$0 (Q0 0C0 Ss 0( 0C04 Q00SP{ 80 0B u,0"8 P ̯0PI00 08p0l8 0n800C?80du0pGP0C00S`FTWu0pP0000C0P00 0PS8 0E!q Xi 0 0H000ᰡH XD0|0ptlЍ80< p` 0<0T pR0`<0 yPo 0;slЍ`~sx0 0 ZHp@-@`Ppp p@L J0 0 BHp@-@Ppp p@5Hp@-P@0 0@`  pp p@!HHD0D0p@- P@ pp p@ H0p@-0P `@0000 0PP`U1000C1.V P*U /UpR00ppP00 0PEP``O-SؑM D@HP 0T p @` 0Z  A 4/ 0[ 8 $[0<SD100.0S0!10>0P 0@0 0}00 0GP8  #8 S R0 0?P4/ZXЍ0G\8  #8 S R@0p0upP4/pWDQ# @-@M  R ! R "R pP^ 0 0 @`Ѝ/@-0QM   S S PpP$<R@ @ 6Ѝ<@- M@0 @!ЍL0L0 @-@ 0 ,M@  Ѝ p@-B\\@0N ^\1  @ %  ^ ,\'\{ X"LB!!N0 ("!! L0 }p % !  ; { \PU@ 0 ER7d!@`PP   P0 B! {c\ "0  '  p @ p %X  + {p\\:\ c QO-$M BoPE@PP 0@%pp 0 6S pp; @`\,S 0  @000 S  P~%S+0LGS00 %0i\@0 `f` 00#1.Q0*Q 0 S @0 SPQ0% p  0  @0d\% 00 @ d @ 0 S4p300 0>0   0  00 < @ )0 0@D0 @00{0 S[p  00P$Ѝ0 SQ0%  p  0   0 @%@  c  t 0 SQ 0% p    0  V0% +c@ @  00@Q0 S0 0 @0  0" T 0@40  0 @0  0 T0 S\R$ W. 0C00 S $0< o>0 / 0 w0`f S` 0S0\S 0 Sa0 000<@Lp@-@P0P`M0S SP!  00 0Pl 0 Q00Q H  < x0  Ѝp 0(t8A-M0PSL!00@0@P0S? 0  ` !~r!!`"bNL LL 0 0210B q0P pW$P@WP 0fSPЍЍ 0Ѝ0NgA-M0PSL!00@0@p0SE ] 0 ` y !^RRN  L !0 120B Q0P pW$P@TP 0nSPЍ"0ЍЍkL>G-M0S!0 0`0@0S[  0p P  T1T I $L0!b!bI4ቐ გ1c1cL0 0Ã#3cl 10B qOP)0< X" pW $@r0sS;P @WXV @T nPPPЍЍ@-?L*S0 O-TMlllPPPQ ,$   0: 0 @P= 5e000` 0: @P 0S  R 0Z I #Z =Z =P  00pP0 p WKZ p E0 0X*Sm0P0 0S, 00    ZP  :nY P Pnq0,0@ 0|s6 l3$ 112cAL3L112c B L00'pr!qpC 0sqP  0 p@B `@Hp, @W 0S  m = @P0P m WP00TЍ  0   !$p΀‚ €‚ N G !1 qrpB qPJ  @:p 0ll \1 $ ϊ0K $$N04!b1c$!b1c0N K 00  0ɉ)1i1c1B뉑P 0tS0cS0Spp@ < pPVY jm00vꔶXgݵNkL>̲*S-?L$1 A-pP`0\ %\0@pS sS lS P0\UUW b000@1CP0PCV`1E !Q00O-Z A0J =R* =S00C?QRp  Wp1PW -.R0 XZD cJQ   Rp| PA0JlRpY PA0Ja0J Ro11OSr|00qߍI@[/iP 00040iP, 000#pRp  Pp1l X   QU PEQQQ W! 340`0 R,R*P  0(p 40P040 P PPp1  \1SB 0C111S? Z! J 02( R 'ZPOQ0S'Sl! 0S'S'SX AT 0DS11a x7@D!&J0qAVZ ຠ `OTb1p@ aAl!AT @DAAAa0J RA0JS3J Aؕ 0000 0 B10 OQ6 10}RRl1  R}R}RP!R[ 1h BY!u ;400 P1`Q,*P  0rpa 40040l10J Rg1lp1OS!!0Pl1XAT @D`1AP OT1a@0A1B0Sl00l0 0St00t060S&   ?R ;R P0S %S0 01S/ 0C11AT, 400 Q,,*P  4 @ , 40,0PPp1DA0JS30J1OS!0l100@1@`iPx 400`,Vp p2iPm 400p,000S   ?R ;RN eRQf P0S %S0 0AT @D1! AOTA 01!0l1`V ```&``VP``P``ø`@oobP``V ``@Q AIQ AAT6 @D1!Z!oA媢Vp p2iiP 400p,PWh0`0b`00^01 0&J GZ @ppP00L00xH!J0o ᪢0@00*;0 0vV@``pO`V@`pJ@`fpF@opB`@p>@oopb9' D V8z- - M00 ЍЍ/- -M0 0Ѝ Ѝ/- - M00 ЍЍ/00/pA-PQMp@ 0S XA shP P` 0v0) V T~ 00 )PP0T0h 00ЍT  0 0 R T Tp߱P0S T`8 ϱ( ᖆp 0S R 8(C8B((0 000ST00P ]g  8C8(0P Pg  8C80TT@44/ 0 0 t0 0 ht@nD0 0 . . l/ 0R@- ME@P Ѝ0A-pP?P U) @T`0DV 0PS |@PV  P oO-PRM pQ 00Ѝ@ `Pc % Pc Pd `%0 ES  gP  P p  0PPP0PS  PP  0S  P  0Sq 0S 0PS 뼐Y$ P Kh$%gP !gPgP ]뼰 0$[PP " [ $@P F 8C(CnR sR fRR0S  V R00000@H$H TP 0:  0S 0C8#80 P p0     V0Y P`Y 00pa 뼠PZi 쑟  ༰ 8C8PR 0VJ *ZPK  PU; o`嫲  PEX%X U !  X ` *  `0 00 R0V00j0S00   0/V  R000WTg  fP$( v0(C-@Q!PMp` 0L P \00Y0S< @ЍPPP  p0 p  R 0S 0LP@ P@" @Ѝ & 0 ^P  LPP+ P*PP004|L( zzO-M M0p0:S$0S:S@ 0PS:S``E[ P!*  `0  kP 0P:S ۍ Ѝ@ۍ ЍC-PŸMM p@`t&P2 0/SB ˡP fY PD RO P 0 ۍЍC\0P L! uP4,0P 0S/S pP IfX0 ۍЍC0  PۍЍ  p 0i'f XW P0P 0 $ۍЍ404 0 $ly% d% D% 4% ,% $ w$ pw# G-p`@P  _PeU  VP `P@P8P @T P  0@010G갫l-@- M@00 Ѝ@ Ѝ//E Ѝ@ Ѝ/@-@eee@ee e0e@e 0p@-S@M 0  Ѝp0`P0 0  00` 0 Ѝp 0p@-PS@:pS dP!pcC- M P@U pᬐ`0fV@@PU   W0 nV sV x PU  @0m00 Ѝ R@@@O- M PU( `pfSPU  O n@8C80@P 0nS sS  :@PU@@000 Ѝ 0S00PA-P% Ppp R,R    0S,S@Bb`P   `00pp@ l C-p M@`P (P:pWa*nUB sUc fUH0D Y2R4 @ cP( H0D@ pH0@0 H0H0nUp@0 H PY sU> fU' L00L0 Ѝ @EP Ѝ@P b 0S0080W < 80H0@ HL00L0 80z400H0@ 400nH0@04 H00fH04 0H0L00L0 @H0R ,0 0RH00H040, R0 0FH00H0,  h 0O-M@0[ ` Z p p(080H0aP; P  `00   ἀ0[0   0 pZ0 0   0 0 0 @ 0@Ѝ 1 !00@- 0 @S0 0S0:PA_oRQ@ \T  0S0Q@000@T0\SET00 0S00S00A-`P0PUM@p"S& vbP !P  ᴀx00V0  pm  00 0ЍPЍ` pW  O-P@ 04M 0#P c`Y`5   p&b0P  0+ b`| @P  @ b0P b4Ѝ  0  b b,0Y (0 0$0,0% T@ ,`, AR   0S00XPw Y  Tr  " bLp W@H @ D L G ,` $fX7  0 @P- pW;  BHDDnXDH sX  "0 S   ,@ 00 Vb4Ѝ } B $ Fb$@_<_@R\ @ A-P`0`VM@p(S, HaP$ A`  㶀J0 00PA00 09 0 0 0ЍPЍ_0@-P pW M@`R  aP 0 `0  00P 00 0 ЍP Ѝ{_O-LM<0 <H*0 0,, 0@P| ||P0`0PP p00}YPXV vP?r9PWPe`PP @ @P W 0V 0,P $ 0p100#$0$90400 0IyX 0s 0PQ ,P 0S $ .S  ROS9 = UP# P@PV nhFhv 0n P Dd_D00S P P$ 0   0S v 0! 000 000 0 n0=0TS 0  0 00 0S(00W8 ( &`8 0S)`<PLЍ @0@S' Hx00 000 000 f0Pr[J (p`@V 0 Vp 0P: '\VQ,W%U^VP< P@U P0%0HS y  0lP (p70 FQ4E F/R) ` pV@ V,h%`  @ ` @ ,%,  / P P``P` p(^8 ]@T@@B`  4X Yx0 0MPDP0 80k80P p` P P P P P P P 0 80E80P P?U P#v 0 S00Pp`@ 0AP, 0  80W80V0@A T@@p`I 0 00000000 s0P (p`@ Hx` hFhv8 @0n JPK 0S00 EPAwqPRVp oP8p0 0(p)ӚP00P hFhv0 0@s 0 P 0 Pl 0   0 a [_LЍ 0~  xO0| 0 mDd< g> p%2lF 0  p P P/b$P00//0@-MP0 @0^S!1l!1"b2cNL 00$@B!A@C0>PЍ0gݵN P0`0K?//p@-MP0 @0nPcl b N00PEK 20$AB@C1dPЍp>kL$0P00?//0p@-M`l0 @@?MD@DP0ec`E $`L0b!b4!b ER1c1cL 0P0@$D$C!d!bA@C1PЍp-?L*STp@-0MP0`2@P 0Ѝp], 0 0S Q20Ѝp<1!0G-@q0PP03 0 4`S 0`02,0PP00|Q``  VPe`EȄQ  V|0`0ȇ`H00`(\[@-@P ]]] ]$],]],00!R  !Z 001/Z001P//lZP @--@X@X0@00s@ H !PJI HH @htp@- @-D(M4@ @`4P0R kU{F{{!00 (ЍpP P # 0U 0 k {Ukkf!00 P ~P P# 0U0  0"uP  0cP0O30{U 0kk cP  0cP0L20U 0:2Ũ2""NPh  0cP0x20U 0t 0"<P7  0cP0t4 0U " *P5  0cP0x10kU 0 !]1""OJP(  p0cP0ʘ 0U " P b0cP0d10U 0<1""P  P0cP0 10U 00""P  >0cP0<00U 0-0""P8  ,0cP0Eʘ00U 0 0"P  ??td   < G  L   `  < 0cP0(00 0 <0<0U" P  0cP0xp00{U 0kk wP\  0cP0ʐ30{U 0kk- eP  0cP0qL30U 0b<3""SP@  0cP0O 30U 0@2""APG  0cP020U 02""/P  0cP0Hʈ20U 09l2""P-  z0cP0D20{U 0{  P  i0cP020u{U 0{ P<  X0cP0!10U 01""P  F0cP0ʀ10uU 0 P4  50cP0n@10U 0_1""PW  #0cP0)00U 00""P  0cP0ʸ00U 00""P  0cP0Et00U 0680""P   Gt 4 L H x $ , 0cP0$00 0U0", iPt  0cP0h00 0U0" WPr  0cP0ʬ00{*Rk 0F{U{ BPk  0cP0\30U 0y3""0PS  0cP030U 083""P  {0cP020U 02"" P  i0cP0_ʐ20U 0P2""P-  W0cP0PP20 0U0" P  E0cP0 20 0U0" P  30cP010ekU 0{{x P}  !0cP0ʄ10U 0`1""PK  0cP0 810?U 0$ P`  0cP0b00U 0S0""P  0cP0fʴ 0U "4 {P  0cP0Np00 0U0" iP  x ( G0  p L T  | `  X  0cP04L00U 0%\0""9P   0cP0ʌ00 0U0" 'P  !P  ~0000 U","00 o1010s 101 U""00 \P10X10`1 U" "00 L101 U""00 ?10{Ukk!00 230303 U"!"00 "\30T30[L3 U"!00 (30u 3 U""00 20202 U"!00 20202 U"h!00 20Z20x20 L2 U"D!00 H206@20h2 U"!00 201 U"r"00 10101 U":b!00 10,10_X1 U"R"00 p101 U"wE!00 @10i810010Q( 10q0 U",!00 o00{Ukk !00 _00L0 U""00 R00 | T X  ( X X <  {Ukk!00 #30z3 "ZI _I 3 "U"00 t30{Ukk!00 D30{Ukk!00 30\"00 "00 " " A ́ :PI S @ "00 "00 !00 |!00 kku!00 p"00 k"00 f!00 a"00 \"00 W"00 R!00 kkK!00 F"00 0Sg >!00 0S0 6!00 y0S .!00 q0S &!00 iP  c0S !00 [0S !00 S0S "00 K0S !00 C0S] "00 ;0S= !00 3-DT! @ l  0S "00 0S !00 0S !00 0S !00 0S !00 0S !00 0S) !00 0S  !00 0S !00 0S !00 0S !00 0S !00 0S z!00 0S~ r"00 0S j"00 0S b!00 0S Z!00 0S R!00 0S J"00 0S B!00 2 H "pP !H H 3 "0SO(!00 k0S !00 cx# ip# |"00 X"00 S "00 N"00 I"00 D"00 ?"00 :"00 5"00 0"00 +"00 &I mI |2""2l0 02L0 0 2,0 0@2 0 0\20 0820 020 010 01l0 0"1L0 0M1,0 0xt!00 P10 0kU,10 0b\10 0Y;0 @@0 L>0l0 0C? p D H p h ` P @ H h 0 T  8  0H 0P0 040p0 0 2X00 0|00 0`0 @@U0 s0 @@H0 100 0u,1P0 0,P1 @@)0 o!00 10 0!10 010 0G2 @@(0 82 @@X0 l2t0 0|20 0s+@!A*?B0CS Ϡ-S)!R#  S Q0 {+C 7G 03S S 0A.B B03200P1046nT kȠȠ+S 0+C{6F{7 +S0+C / /P 0S $0S 0S P? @4@P//A-0Pp8`P' , R( 0"0, 4000R40G@BT@! V @D8 ,0400G,0 4 00(  @(4/P8,0S0Q 400 @-P0 R 0 `  ) S. p T P $<@ :+˃4?0P R $ R  R S /0?00T?0$ R&4000  0`@>@0U 0PEd@T$0S`0  0@=`0U 0PEd@T$0S  &$   0   0c 0t $ @R`xP=`0Us 0PEd@Tf8?N?P?5? J?pM? H?A?L?T  < (( :?;?0p0P00X0?0X00 p0tP 40040  @u 450050f8 0p0P0X 0㽯X0tp0 (0$$(0P1 80080E80080 0c"YSR: 3@ 0@l0(H9@0D(@ `d p T  \ \  h {P 900900S90:Cp@-@'PP80S $ (2/$0(3/00pPA-@`PP@p0 QR 408 B4 08@V000PA-@`PpP 0R| S  P00S  : 70S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /X#X3 C- M0P000@P`^-@\3 R < 00 2#  00S "$< @0 P0cA Q # 2RN  S=P0Sd2 R @< 00 2#\p0@< l0^ppW} H Q0c& R#2Q3 S"Q0S Q*0 P  Q*0P  Q:0pSp R*0Q  R*0Q  R:0l00p0C0l0pSp)x 000 0P,04P0p0 p0 0 0 30 Ѝl0Sppl0 @@@ ɆYS???VP 0S $0S 0S P?,A4 BR/ Q /@o/A?A-pW`P 0!(`3/@P] 8X: (0 ( 03/PM 8 8!P S>0Rp*p  BS>00p0(0 #88@oRS B P T X B T p 0Bp8 sp oP S>0Rp*pS. 0A p oR$0(3/P 0S $0S 0S P ?,B4 BR/: +/P 0S $0S  R 0P0?0@@/O-M@ @㬰P~X 0C00$P $`0p sRpW0- p p0 Ѝ0` Q`V00p=J\S30b608#8P0X 00C∀ R"P @X\!\ 0!01 002T 0# T 0SЍ0W0T0S Ѝ 0D?o240%R00S0020 0(0@0 ,000@(,04@ 0 B80 0 0$ 0PU?PU@PUAP0UAPR@oPP 0CX20;(8ӗ1Ӆ1&=tPxl0PfPEN N0NxtPAPWNl0:8HPXT!D`4PᵀH@ᰀ00SxAPPh`l \0S8 B0<l0\000Sm tP `H0P` R P lp"p  G R lp` h0S:l R1#P0 6SF \0P8 Bl0\00PЍl08  :R&ƃP&ƃP&Ɠ) )hP\0P8 Bl0\0~00SЍ?O-tdt`,M Pt \l 80H00XT0#D04@@QH0  ,0BA?C0CP`PƙYp00B8#( ƙ#<0ƙ3@0 B0(1I>RX30;"8ӗ1Ӆ1&=  `tQL \ R㠆l@80XpT`tR` l H 07#0H0Xl \0P8 B Jl0\000S,Ѝ806&6!Ɖ909t6l L Qtl \e /t0 S` R S; SY`l r (l `m 00400D @$H0 A   @`@ Pl @!0 PPH0P  `  @P$ll R1#\ Q \P80 B0 l0\0l0P,Ѝ\P80 B0 l0\0Y00S,Ѝ0:O-@ ,0K[ 01PQM  o 蔟   PBS0U000u 0 0 0B 0 %B  0B 0 #40B V \0U8`1 v\0 0  PE B    \0UW %6*0Q1A4:\0l` p`F0 S P!P1UP!U:Spp   W  B0  0 PUp` , 8 RKAƋ-,l &\ PUp`l& RƋ5V`(0'

 0001&=  &6`Rt0l 0C `t0l u\0S8 B0 l0\0O00S8#  #800#"0 t(hB0 0 0 0 0 S0 S 00R01 00 q00 R000 0 0&*W6: &R \ R80l0 C 0 B 0=L0DC0C t0S*l0\06y\0l S8  B0 l0\000S10f\ R80l0 C  A-`pPTqP@B Q00V0SI0S: (0sT Q 1@0@!A00000 |0`cp( 0S*t l00\ R$6S S L D0 B Cx060@D0 0!1 0RppL|p@-@3PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0$ (2/qV0P0pPO- Mp`80S04< 08Q1S00PP 0 0S{ $0Ss wpVjV`F0HSs0FSRo WmZkYFo᫲[dV @!( `4/@Pi !@  X  P "L  BT *   A0`, `4 ( P6/ `, 8(6/ `L @(6/j 0 D(3/68 R! ( @ R% D PR! 00C60p删$0 ЍO|v `fp00$0` (0} Ѝ8  40 000&t-M 0 0 AЍA-PCU_8 `p! 0(3/@PR T!@ 0, (P3/ 0, z8(3/ 0L @(3/ 0 D(3/08P. @ R+ D SR% , 8 x, @@ sL DD n&!i0 0C006& 0&;> 0$0;/>O-@QM R0p  0S " !,"pDP` p@00 + p % *0 @p'0 @$000Q  B1;`,:)7(463041 R P%BQ` p@!0A " Q"$, !!   R!,  " " Q"$,     R ! P%%   R,!@S4T@ RPR aR,d&P%PN&, QR,T% R%, QR,T% R%, QR,T% ^%,  C @0S |0 " !S," ЍL ""pR1C2Pv>Cl=@==<<<; A-PR` @pPp 011   0" C  .P p@1   0" C !&; A-PR` @pPp 011   0" C  .P p@1   0" C !&,: p@-@P |`|`P@P 01ē1   0" C  @pPp\9 p@-@P |`|`P@P 01ē1   0" C  @pPp8 @-18@ 0,C    G-Rx 'xh Q ROSRCW-o`V @0@0\\\0 p\ \  0p0\0p\ 0\p0\0p\ 0\p0\0\ p\ 0 0p0\\0p00 R7Ǡ7 lŒcVV-2P0 pGN0 P"R 0pQ1W1|G#pG7&c20N 1pW|GpG|1^NNPV=F10C=@L   0R`RPR0`P0 `R0` PR0P `R0` PR0P `R0`PR0P`R0`PR0P`R0`PR0P`R0`PRpRP00p 0Q0@  0C 00 pQ80'7b"c2pGNq'R'@-7Fc20B c!'b "0C0,  LA P A@<R,C,0 BR,B B/qR'@-7Fc20B c!'b "0C0,  LA P A@<R,C,0 BR,B B/q/do U/0S0`0//(4 476@-S k>@@0 #400k.06S0 k΁ς 1O- p:PTU$0!`Q U @0ς!\KU` ẠZ 1 @1:  V:0Q=0^  pQ Q Z @O-@ 00 0p0 1Z \Q ⵟ 0100W0 X.0[ A  װ& 0А#"^& 6 2#60 SZ+ ೞ0JYJ Q LG⋰@ 0p@Q0C Y> 0@N0A0 \0000C0/ LQ @00^ P0 00U00S@ T R 000 R0@ T<ЍW@  xyQ / !02@X1Z Gೠ6;#6pQ^p N00=C-@TppR!ಐN0+m^\hT( Y!. Q A^0 pR% \LANpR 9 ^0@ Tp9  \ʰ Q ^0 Rp^0@ Q ^0 pQ^0 p^0@ Tp@@  @O-MⲰ[00Rv!+z   k@T`[0 Y ANP@>d8Y#8WD@ 000 #4060cUS8#8 P >b8Y#8 000#406 B 0cUS8#8@DHR$H&"0("(P P  0#4PP0&0bTC8 B#8V0&7 V0Q PV  ANk`P弦P0ᾐ:`i8Z#8`I 0 00#4 0编0iUS8 #8 R0἖P`U0S P U`0^ `0 V \0ʀP` TH P尐P eY*P0帠PE0#406P0cY ) UV BU@X%Xk>PP@P.V@nR$ N D0Qi PU ` k Pᶐ>i8Z#8I0 00#4 060cUS8#8 ^S B@P.k>@P.V@nR$ N 0Q$ PV(0S `0 _28 #8 P `0^0  U4 `P 0SЍ@@DH$Hk>PV㸐V @DH$H>k.V0v `0 %0S `0 0S `0 ^ U P   @ Mʀ6O-SM 4004`003k^0 0300300 !A 9@b8 T#8@p000@p#406 B 0c^&6S6 @ 编0`$0 pḀ9n8 Z#8 0N 00#4 060cX8#8qX tq@DH$H>phW8#8挥pH000p#4060cTC8#8 BR@@@CqԕrԅAqಀph>Y8#8H000#4060cWs8#8 p0@sWz `D B("(>@g8T#8?@000@#406pGp0cR#6 Sv\kN&02Pa8R#8  P`0`00 @#4PP0&A0b^8 #8k0&Ѝ 0&0p0v, 666660 0@-&̀+ ; J(0,+8; k> G$ˀ0 0&)0S0 0xS0 0LSI00&&&&ʀA-Pk@8` R   pp "$ &bS1 B k>&0  8#̠   4##<V0 0 000*60@-S S00k@@6 0C60k>@@@!PPƂ00@-k6 # S("(00@P P 0 #4@@06 c\  ( 0C"(k΁ S 600@PP  0@@@#406 0CS6 S00k.@@6 0C60 k>@@ @"$PP Ɓ0O-0 QR M@Y, R 0)p&]#P+}(+z0N  q/ ! RF@P j   Q& R \3 "[$k 0("( Z:38#80 00#40缦0jR#8 J#8+ ZB!(:ἦ 8#8kΆ000#4 0缦0jQ8 J#8 ! Z:ἦ8#8kΆ000#4 0缦0jQ38 J#8@! Z:ἦ8#8kΆ000#4 0缦0jQ J!PMk>⼦ / ! Z! ! 缦jR! J!^ἦ 2 / Mx  \ P+R +R ,RE R  Q ,Q3 "[R&k R0i 2 8#8000 #40&0bP8 B#8pk0&N.V G.0 0R0 0xS0  0LSI>X&&&& Ѝ R3 "&][Pj 0 ЍOi 8#8#8#8!88#8!28 #8$.+):Ɠ0@-PV Ɠ!DPV @Ɠ@QF !6@o0ƓAƃDQ  !I.Ì!ܕ"܅&  '0S A-P 0@ Cp`1LVUV `'P L&/@- M`@p`*PP Pƿ   /L `p . @P  Ѝ  0@0 Ѝ0@0@.T  Ѝp@-P0*@P @喿00p 00p@-@ *0P 0冿00 00p@-MP` *@P P @r 00Kp .PЍpP.U PЍp0A-S ` 0@ Cp^PKU 0 m&0PP%yara0A-S ` 0@ Cp:PtKU| 0 I&0PP%tcid0S A- p@0 CP`PKV `W/0S A- `@0 CpP6KU &,0PP8R%/yara0S A- `@0 CpPKU %,0PP0%/tcid0@- M@ Kp  P Ѝ0 Ѝ00 0 Ѝ00@- M@ Kp D  P Ѝ0 Ѝ00 0 Ѝ0yara0@- M@ Jp D  P Ѝ0 Ѝ00 0 Ѝ0tcid- M Ѝ- M Ѝtcidp@-@P}%0PPptcidp@-@Pq%$0P p00ploobp@-P`P@PP  P$p@-@j@ @-@d@ @-@^@ @-@X@# @-@R@@ @-@L@O @-@F@l @-@@@ @-@:@ @-@4@ @-@.@ @-@(@ @-@"@ @-@@@-@@(@-@@;@-@ @S@-@@j@-@@@-@@p@-P` @PP  GP$pp@-P` @PP  5P$pp@-P`~ @PP  #P#pp@-P`l @PP  P#pp@-P`0PX @PP  P#pp@-P`F @PP  P#pp@-P`4 @PP  P#pp@-P`" @PP  P#pp@-P` @PP  P#pp@-P`0P @PP  Pp#pp@-P` @PP  P^#pp@-P` @PP  }PL#pp@-P` @PP  kP:#pp@-P` @PP  YP(#pp@-P`0P @PP  EP#pp@-P` @PP  3P#pp@-P` @PP  !P"pp@-P` @PP  P"pp@-P`p @PP  P"pp@-P`0P\ @PP  P"pp@-P@g#(0P pD0P 0pgntsp@-P`@PP  P"pp@-P`@PP  P"pp@-`PM@2#<P pP U patadp@-P`O@PP  PZ"pp@-P`^@PP  yPH"pA-P@"X0P p(`P  P `*gntsp@-P@"(0P p0P 0pgntsp@-P`A@PP  8P"pp@-P`5@PP  'P!pp@-@RP P!pp@-@ P"$0P p00ploobp@-P`z@PP   P!pp@-Pj@PP !P!p@-@ @ @-@ @ @-@~ @! @-@x @> @-@r @[ @-@l @j @-@f @ @-@` @ @-@Z @ @-@T @ @-@N @ @-@H @ @-@B @ @-@< @+ @-@6 @C @-@0 @V @-@* @n @-@$ @ @-@ @ @-@ @ p@-P`@PP  2 P1!p0p@-P@PP l P !pp@-P`@PP   P!p0p@-P@PP I P pp@-P`w@PP  P p0p@-Pe@PP & P pp@-P`T@PP  P p0p@-PB@PP  P pp@-P`0P/@PP  P pp@-P0P@PP P pp@-P` @PP  P p0p@-P@PP Pn pp@-P`@PP  ]P\ p0p@-P@PP PK pp@-P`@PP  :P9 p0p@-P@PP tP( pp@-P`@PP  P p0p@-P@PP QP pp@-P`0P}@PP  Ppp@-P0Pj@PP +Ppp@-P`q@PP  Pp p@-P_@PP Ppp@-P`N@PP  Pp p@-P<@PP Ppp@-P`+@PP  Pp p@-P@PP Pvpp@-P`@PP  ePdp p@-P@PP PSpp@-P`0P@PP  @P?pp@-P0P@PP yP-pp@-P`@PP  Pp p@-P@PP VP pp@-P`@PP  Pp p@-P@PP 3Ppp@-P`y@PP  Pp p@-Pg@PP Ppp@-P`V@PP  Pp p@-PD@PP Ppp@-P`0P1@PP  Ppp@-P0P@PP P{pp@-PJ@*(0P p0P 0pgntsp@-P`@PP  YPXpp@-P@PP PIpp@-P`w@PP  9P8pp@-Pg@PP uP)pp@-`P@<P pgP U Upatadp@-P`@PP  Ppp@-P`@PP  Ppp@-P @PP (Ppp@-P @PP PpA-P@zX0P Lp$`P  cP `f&gntsp@-P|@\(0P p90P 0pgntsp@-P`@PP  Ppp@-P@PP P{pp@-P`@PP  kPjpp@-P@PP P[pp@-@QP PQpp@-@RP HPGpp@-@0 P %%p@PP"#0S #p#0{@- @@"{lP 0R @-P Q o//o o P 0 0 t@-険) * @-P Q @@ @0@ 0 fㄺ( (0( 0 g{t ) ) P ) ) 0S p@- X@`@@PxPpP p@ A-P`pl# #@P  P` pp|"ɯP` us"U @6%j"-%*%8_d̠<P p0S !S$0-S-P00S00PP -P 0-P P 0>P 000/SR `,`0 S S0p p S :S 0 S S0GU0 RxP0/S7 0(00>S: SA 0S p03  0B0SR 0 S S6 S4 /S 0 S S,/S >S S`FVx0Su `Vp0(00>Spj 0  $ 00 0  S =SB0"SP0SM   0"R "R R@C$ >R;0X d G-MX@`pI P dV W$ P[ <PT &P@ aR lR gR' qR uR oR  tR ;R@" tRT Ѝ mR8 pR oR sR ;R@' tR ;R@>P P"Pp \P@ V   WP UP PS00S@Ѝ pR ;R@  uR[RD\ BR  ;R@<{  @!1 0 J"R /R  0hP 0 +("( R:Y ~ Y +     SP40 Re \Rb  uR^ 9 PX +  PS6I0     0 # <  P,!*-"-  ƠP  *  (  ""0 . ".  ~ PŸO-` M @ 0D0S<_SS @S  0>S 0 T  @P (0SP  R @U ЍT T$ @QPV` iP @P ` ^Px0S  0STXd,3 lDG-P-MƐ`@PL ,4pC C6pF 0F fppSp>D0 ƕPP 4u&  0  p `5Ѝ00d0 ࠕp``5`Ѝ 4`Ao/A-PP qP`p @O@P@@G@P p480,p0P4080<0wF  @-@ ,dF@-$@@ ◢DFXwᲪ⮪@-@@O-4@T ,p` ᛪP @D¤@@`T P礀Qㅑ@0@ @@0 -PZ PZ P<  @-R 0P< P 4Q ,  D D0D 0 ), ,0, (0 $v ,` Tp@-M@4 00R1SP,0SFR 1`V. P` 0 0FP 40, 0C40P& `ЍpS( R{ЍpЍp 0 0D Z㩬p p0p l0D ⠬\ \0\ 0D c㗬D D0D @0D ⎬8 P y d <iA-P`,pK@P W 0 !᧭,@0`v,@0`C-`0SM@PpF  P\00Ѝ! 0mP ,0SU ! 0bP ,0S(0S00 0@P 0S>0S0"S40:S +0}S "S000"S 2P  ,P d @@ 0eP , ,0, (0\ ߫t1 0   0p@-S \  Q @PPp 0  0 㺫q| $0S 40 00$ $0$ 0 @-餫p(  4 @-R , B04 P @ @ @0@ <0 ≫, ,0, (0 ‫ ( L80O-M@ Ѝ@Pp* `P @ p @ЍĒ o ↠`P0 004QY  4 ,R\ 牱Q1v  芨 P 0YIV  B B!,0 ` 04 p<0 04 <0 W`,VM<V7V+Y& 唡@ ? ` ; 2`P( 5 30,S<SS= dP2 @<0 0`p4 <0y<! ⯒,0` ZY` |,wx x0x t0F/ⶪd d0d 0,W㭪L L0L 0 㤪|#=m<l 2H $ 0p@-@PPP0S L  Q<0  0p@A 0  0K/wkp p@-@P 0`0V9PP p p0 0  0@S<0  0pPp( (0( $0K/Hxk(, X$0O-S M@PR z`40SM x `;P@ ЍP pP 00S 0q 200PX 0S. @0R* P# [` P 0P 0S P'j X H` ЍOpP 0  03/P  40R 1#PP 0 0U/⴩4 00C 0P `@zh h0h d0U/⛩T T0T 0]/㒩jj4! Did Lhh Tp LPd@-@ᣟ0,S<SSz 0  0 f6, 8PG-V pP0`WSW@6 404 S @  S3 F000,0 100,0$ 100,0, P   @ ?o2\0S0S P@P :  404 SS@  @D D0D @0c/0 000 ,0c/|f !` 7G-PS @- Y`' T 1p 0R  ' % 004 00R% NP  0S 0 GTd d0d `0i/⮨0,S0 000 ,0F/❨8eL 1 x G-PP' 0 0R"pG4`P 4 R @,0儡ᄑ1  ,04 儑@ 0T:80804 )`c0P 0  Q@-P80080/[O-0S@9 0@S7  `R P. X8qPp@? P 9 P 3 P HXPU0UU !B< #1 0@?,B PO 0 0 sX% X0@#r 1]P7 0 03/P0  40R 1#`P' `P 00C 0@P  @ꀐ  pG \ \0\ 0 98 808 0 -DC(C@ d<  40S 0C40/ 0  0 @-묥 0p@-S \  Q @PPp 0  0 B(  ip@-@P 0`0VP0S R<0  0p@D D0D @0 ˟0 000 ,0 Ÿ@B 8d \wG-S p)W@ `V 0P 0R 00 ^V` XV 0S  Gr@ @0@ <0F/₟0,STAd \A-PP 0 0R(4pP 40S @,0a, 40a@T:8 8 40pX@@-P80080p@-@P 80 0R@ pP0@p?p@-@P 80 0R@ pP4@pL?p@-@P \0 0R@ p`P00S@#:p@>p@-P@&@pp@-P@80080p@p@-P@8@@@pp@-@P 0 0R`P40S ,0AT p@p@ 0  0O/ⵞ=0 (aA-@P 0P 0R@ p`a8040S ,0X <0, 0Q<0@J@>@D D0D @0S/w0 000 ,0S/nL=8 h0 X p@-@P H0 0R@ p`P@p$<A-PP1 0R`@4P%80,0!qW% P P ,0P < 0@ 40< AlAD D0D 0W/, ,0, (0W/; ̿t Pl0P D- ?o2 ^0S 0 Sg/:0S /p@-`P@cP (0S p p@ 9  90 //@-UP0 0 p㱝뀾 O-IMP  @T p `0 R 2/0 U\ P X @ 8/@0 p;PV @T!1 0 |003/X@ 8/Z UZ Z X" 000 R 2/0 U' P70S+ 03/P. Z :/ UX 0 0( : 0 0 1Iߍ 0 0( & 0 0( Z :/[ 0 03/X X0X 0(  뼜  ܼ d \@ x8 8P0/O-MM(p@ ]T 000 000R+`P$  T%0 `P4  0@ 4/@P`P@003/0 @ePMߍT00 0P $ 0R000 Mߍ0 000 ,0H ⌜ R00 D# 0/0/@-@@A-pPM`P1 @T. E0@0W  WN 0/RA 0CW /RW  W0 0/Q B H!0C@T@!  y@0 0.0 0 0 S* glp@  "U YP"C$@RPۍM?00@ۍ S0"p \#PZ#D&#p "p 0P"@ p@-R 0@S PR :   Pp 0P  , 0`0` `0 9ЛL0L L0 :ț808 80 ;p茷 t |T \p@-@Q PPpQp0A-SMz@`PA7 Q <Q& >Q &Q a`Q PЍP QЍ|a&`Q ~PPa&`Q rPPU q/UpU"0E'S0rP\\P WP PU /U\U fPnPtPbPUx 0 S# QQ 3P0 000 0 | Г Դ 0S p@-P@ Pp 0@Sp/p@-@QP Q PpQ p@0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Q>p@ 0 0@ ⪚ $#0p@-S+@PPU Q PpQp<Pp/P PQ P Q>p@ 0 0` Qm 40p@-SG@`PU Q Q aP<\Pp PU Q PP QPU Q CP QpPQ 6P Q/.P >p@( 0 0| 및 ШcA-PP_ 0Q ppXpW`U@PQ  PJ <V`p p0 8/PP`<``Q P P 0S (P P PPP P P P 0 P܎ *د)p@-P@PP y %P͛`ɛ`p |{011/A-\@`pP \1S 0 €  P 1&P1 `p P 0808 80 A\$0$ $0 BTt ؍ l@-@^ P ^%QRS  T00=NQRS"  TŒ 00 0 0 Z ԭpG-@R0(M0QP P 0 ` p Pt p `HT0?o20S00(Ѝp`0 tp@- M`P@000 00 0 0     SЍp0@- M0P@  ۙ000      S Ѝ0 0p@-Pb"!4Mb4# `@0徙 4 40ᶙ 4 40ᮙ 0     SЍp0@- M0P@ᗙ l,0p.l ጙ 4!40⅙0$!$       P Ѝ0p@-@P(MP`/ 0S, R00$P (Ѝp0-S 0 0 0 0 0  0 0 0 0 X P0V00(Ѝp@ R 0S V00@- @ݘT00@-@p00T000H @-@T @-@T000 000S/@-Ι2x000 000S/@-㾙l2x000 000S/@-㮙,2x000 000S/@-㞙1x000 000S/@-㎙1x000 000S/@-~l1x000 000S/@-n,1x000 000S/@-^0x000 000S/@-N0x000 000S/@->l0x @- @?^ʎ0 !00@S  \px ? ? lR ! 0^ < 0  0^ \#8001/001/0 01 /x0S@-@1/00/T0T0p@-@ P`\ qPppʘ.x/000 000S-/@-㸘-T.x@-000 000S/@-㥘.xAo//p0@-@ MP 8 P Ѝ0 0 0 ;੖vt p@-@M P P pЍ(0( (0 ;㌖wt@, p0@-P M@ T T T | 0 Ѝ08 @ Ѝ0 0 0 :ct 0p@-@ ,@ n 0 0 8M^t H p@-@PP (P$Pp0 0 78ꨬ ̢p@-@PP (Pp0 0 7%\ p@-@PP $Pp0 0 7 @-@P  Y.<+ < 00 0 ;ꘫ 8@-@P ( 0 0 7(T @-@P $ 0 0 7ѕ$  R/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@ P//-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/8@-@Pა8000 0@0 !0#2 /UUUU3333  ґ8p@-PQ@t : Sj H Sd a Sp  S?c r0-0!-w- R00E ?Rx  -  l r - w- Q  8 'Qx-$1r-@w- T% Tt0 T-x   p Ss  Sw S?lQ s! R0s  S  0TS S?bAa-$0$ $0 9>@py ԛO-P4A@:  bpPA PA  ṇpP% 00d` 0@T' /P0=S AP` AT BX!  ດf@D0D D0 > 00#@x hh"h2C-@`M 0P@D H0LP@g X`P ㈐@@@@@孕pk pp 㦕p` n{ P  {j{{-p[ X0p 0S00R4@8@<@@00000;-0o-r-0\-H1H000@0 00+-X  #ꄕ0S op@ ] Y  ЍKoЍ @`0 0 ? 9 5"pO-PMp 0GW"S00` 0w@P-TPh +T@`0? ǿ 0 Ay 0 9y P! @00D Pa0DSW0DA0DS"70DWu X: Q\ SP P"000T9 W0 0 p 0 U00S 0 |S 0F0 Ѝ0S U 0@ 0`꺔000S   Ѝ p夀夐 p XR A B0A PR `@X0X X0 ?㌒SWp pqW ꙙtr |00M 00Ѝ2/O-PMp 0GW"S00` 0w@P-TPh +T@`0? ǿ 0 qx 0 ix P! @00D Pa0DSW0DA0DS"70DWu X: Q\ SP P"000T9 W0 0 p 0 U00S 0 |S 0F0 Ѝ0S U 0@ 0`000S   Ѝ p夀夐 p XR A B0A PR `@X0X X0 ?㼑SWp pqW ꙙ4o <00M 00Ѝ2\/O-M8@<ЍP@0P@0 Y( @@P PU /P 0  0 2  ᢃ @Pt@P@h0h h0 P0 0-8L\J ppdpx pI oo- MW ЍC-`|!|1 !M0M@PP0<80J 04p0040 41pPP !1 0 <8 30;!ݍЍ W00 0Pp媑PP@T Cn`0 P8T哆PᦄP @T@ro404 440 hL-hvpG q!1 A-@P0!M`0<80c Q P00 4 1 TP?4p l1pH P3T00 $ ( ,  0 0 pp>PP!@T Cn`0 P8T'P:P @T@0S  : p0 0 <8 30!ݍ`00PH H0H D0 ,,toE nnO-@$FM`4 M 0PQ␴t嘤0d40 T V [ ZX ( 0H0d ;0RP0S 0H  PW 0  P(00_lP C $ PyPt$7 Wk , Pk(. ,, BlP $$ W ,  b X#P3 0 d4 30Fލ Ѝ, 0 P3 ~PyPt / 4P@ @W  E0Sw SU2"0 @ 8xx L\0X B P(( 5"2  0TB!1  0V9!1  0[0!1 0_&! 0 80$0Sd / ḂT! 0 P  8,1,!0 @ 8 z@  {+ s p(mmhmhmLmLmB ,mB lB plxB k|kyLB kPkz B k$k{A kjktbTbtkpk A j@ j@ j@ j@-PX!X1 0M`P@000:  T p T0U0P @6 @P@ 0 0 0 30*Ѝ?/000U00000P 4"48#80L L0L 0( P P*d> ig @-@P  @ 0  0< ~H> hTgO-GM M '0P7 $00t404 0 $0S 0Sd 0Sm 0ST 8 0 X0IP ,@(0B p= Ph6`p0p00 Jp@! V  X PgW 뭆00S" @0=S`T`V`W`V fepP`ꖆ0#S: ePU(  @000C00ꂆ0 @p0 00 85僃P%s @ CP0 p0 00 4oP 4 Z $ p$ p 0S000C00  040pP  0pL$h`0    0X045H@PPH0 0 Pڶ5 ,0pC   Y 0q0Se Sc P g P ` P Y  s P4 R1(V "2 0 t4 30Gލ Ѝ0@ͅ"0 ( 8 @t (  0400! 40 S  8 P 0pW 0J H (  00004  `垂PW PS PI!1 H 0vx!x1x 0H l0ST!T1T H 0`8!818 0H V$0Su!1 H 0JkL0S   $0 0p)tLff0`fe fe\ dc88 a@a8 aa7 `a`7 b`7 ``Db bDb(bC-`"p2 0TMPPpt@0L00E VN WW X` 8D# W' 0    0 8P @T@T 0 pPP 0Ѝ @Px x0x t 0~` `0` 0~V@ @0@ < 0~TL& QPO^$& tR,O% QN]-$M|0!0 0 (0 0 0 30$Ѝ$-$M|x0!0 0 (0 0 0 30$Ѝu$t$G-p PP`  B=0000 C Ra CRE@0@Y)00 C Ra CRA CRS:Y 00C QaCQWCP00C PUaCQWCQACQ7CMS00 D0C?o2R0SX ? R0T*@D T T-@A CRSb @ A BR0GD?o2Z0S\  Z?0X*Y 00A Pa0ASW0AA0AS70AQ P,1,!,0 }00C P 0 T:aCQW0CACQ70CS 0  0}}   DACQ7Cz|0| | 0C} D@`S| P[@0@ @0 `}@O" NNX" @NM" MM! Mt1 0G-@P?  @RP<T !4*4444a4q `???p.0S   Q#2 0* 00 P* 0U 0 R*Q * 0U000?0R*00t?Rp1?p#` c~ R ? Q*:  T:  ! ! @-PL@L0@p M`N400 0_@D Ѝ@-@PM  0 0 0P L  @Ѝ$0$ $0 3 }K|g( K@-@P(M! $0  0 00 0 =P 04X  8< $0(Ѝ( (0( 0 B|tK4\ 8QJp@-`P0M@P! T* U3 ,0 0(0 0$00 $0 P^=P+! 0" 00Ѝp 0 0 |Tt t0t 0 |UT T0T 0 |~ 0   8JIT eI( II0"02 O-P0TM`0L00v Vj 0  000  0 !8  JnPPO @ p%0 p@P< 0+S+0S((P,00$00(0 P 0$Y,$,0S4 0 0 L0 30*TЍ0 >P YPi4~00h h0h 0@ Y{L L0L 0@ X{~!>/?O- M0@Q000 0S @ TrzTX a! pP.b"? a. *b i!*DPP\@]!  "P dX$%T\dT%``.lČfH&bȌ̌$DLfD$Li.`  i,-a.d`ia` hh(&d@plhphd&%gX'%T\gT%$l͌hx(b!aA"8'tp @|ht'aA$i) `&@(l"<`t`i(aa.%jh*M`&dlQ l jd&Px "lQ%P d  'ix)  l!!'t| it' "(] n(|d!. i)dd!"*hH($Di*LhD$ + e.  '0,k+.-ak.eq! `&p*eq'4͌epiX)b!} %Tl\iT%, ( ,(o&@$O$,`ba,`H@@@ba& g,`hH($D !LhD$,++ ,+0 ,+...$吠bj*. j."$ " (,+, $ , 4P%++H (" m_%_%` ,P gQ PO$O$gQ%f P $@gA , $@..@].apf!O͌@f.e! OfA O@lea,`?ea&e1ꯠP* )!P@,`(o)_(0P(P **P!!! n,*pyM !`nQ 0 P%P =d  ]n,c1d#!.... 4 0 $ ͌e# dq .O,p/$/"p/"  O$O$4 O$leq, @O@p'?p(aA,}e1@$n_@a1. P0#0_% ,, _%_% M_% g.$P_aQ)0_% !/!,_%_%_%(PX=dAg$_P*㝉cQ$魊i P%䗟 ៉gw Pc.p )O$  O$'O$(' wO$],@jA.cq@$@ ?'?#$ 0/# 0''坉?'eQ0jq%?0 p'p?j1i%诊_o%o&Mo&} . dA$`_%i1$0#_%` 0ദ_%PogQ$iaP%Po&,((=o&(no&o&g.o `(]O ca.午gA`&eQcq%`Op'@@ pmc1 /'/"./", ... 0 ' 'M'h%uf! h!f10/  Pd1f1d! 0]?h1 $`d `10f0.,,4..-. $(`e`e d@Ϡ0,`!! ,,4=,be bχM` cbc ePd,pcd b/p"++0/"/"/"`d( `! c?  #`!o!`$`?#?#`͌?#n`0n1 -0dlAnA0lO=`A`bAlAbOnA4`O.O$$@..@.cA pbAca`OlAϠ`,(@))@ ,,aAcA paqpOmbAp`A aA`! O}cA, fA0P`Af10OaA_!-_% 0_%4,P(P!!!$PgAfA0gO`A @O   ,= bgb돉fcbca`ꏉ g`acaqpP菉b /c!0O$0O$㟠?')?# )*0?#*)' m) P?'0`1' Pϋa1` 0P捈fa0忋`!&a "= - 地 h&⿋` !c1h#  l( ⿋ ⿠o+,PL o&o&_ꯂ$`` +o `b1# ꬸyZnܼb@+ ++ +0 0#+⯊< +/ L 뿉⟉h⏠ 0()t )O/ 匐 (⟉ abb!! "= `!-!c1` `#P b1#0# 0a=bAb!!`! "! $Q @-c1(O`A`# b1# 0# 0a=bpb!!`!!$@ " -`c1`#b1# 0# 0 abb!!( "L@= `!-!菄c1``# ͌8<@plDPbb!# "0\"0`2  0 0 30Ѝ2"0 t0SY2"0 tP@-@P TT 0LLL   004 404 0 t#EgܺvT2\ +@+G-PPp`8 W, 10.!00% "0 ?0%0?S @@h  u 0hS@H"p ` *0V@@p`F  GpuH H0H 0 `t, ,0, 0 VtD )$* L*)!1 p@-PP0M@0 00A TJ  R00113 R0 0~? S ``4` 0~? S |U PE "001<3 R0 |0 0 0 30Ѝpd d0d `0( sTH H0H D0( s)L  ((x (T( 0 0@-@P0MP000' U  0 @  "" 0S0(0p d0 0 0 30Ѝ0)4PP000 00 Fs0 &| 'G-p!M@1M 0砐 050(U,ePG0R W0DA +@P2  PUo0 ;u0 UB @P  U0PUo0Yu@Uu@  n 0 0 5 30 ܍ЍDuP@uTP  0jQP?p pP|`- M0  Ѝ@-P 0 0lMpP`0d00 "   "X P0 0 d0 30 lЍ0 000 0 r  $${$0 k $0{0k/ܺvT2#EgO-0|M@@ 8s @/LPp8`pPp, p'+phkg| `<뺅Th,`&P !`l[kP@a lK+P%@$P 8@g[h[DHhKh )k!.h \ 隠fl j (nHla$j ,L͠kˌkd . @艠eg g*Pp` a n,+aTddKdi{ꨠfpf p' pl +@Hhkxe{ `e`&lP `K 4XnKn`!+\llˋlj[mikPiP% Pa$+ Pg\h[h) `ɠ`ˌ` d. +d` a at霠jjfn,* (X hgghpꨠddKl{ p'epl@ g}n{+n<@@ffK`k*`&i`pllk+lˎ`@dIeKej['hP% Pt+[`[` Dani+iˌ hd g&+lʠhˌ;h+ )Tkjf+% f+"j P i#M(a, ,$ a+n Hꬠge+   g+e( d dpX+)l hlpfd+ !kK*@ f+kK$nDp@ +` ik n+`&T`dL< eKj{(p Me+j{'ph$lkly`k{h+$ kˌh+"P! P`[*j+d'P%P jd,\i[ L8&a it.ˠhˌ g" n`lhg* %f ꬠDd`)b , db iaLఉ @.eKhg a@$l*@gl!KfK`dp)n{fp8` p'bpj `ze{bkj(MѼ`$ik$e`& `h\l`+!P l[`+" L(j+a[(Pja[%lnk Pनt'd [@`[n,h" `h.X \̠ iˌipab% & ag b+ h ` d M,ќf$d ! d뼠hhXeK.0H @MeK$ь @$ggI\pbKb; l+s "Mx |b-$pf+f{D`n+ ndn*hlj`eek`P nTk(X\芠Pnn[<0!`;0#M08$l;l@p"a{Ìp'MȌp̌ `$y`{`` pdk&`nČiȌkǩkˌj) HP#b[nČP%iȌdP̌ dˌh tZmČƌ͌3a[aˌ\@@ncK$ j @ jf,LKm3bKbt n$g.lɠ(hˌ,  h+i!< m$&-3 cc+X0n4e(8f<  0f;`+" D0舠m46g`=`30g;dk&`<0)n48i+p<p0Ti;l{'ࠔjekp00 en;#@ 0xt`{PP `a[%p PcpmnܼvmzNSaP<@nKi[%Pze\mb[ &cK vg@b.cK$D @lJiK`% hhi ,`!f+  hd "฀ac e$ ce)H+g+gtp0.l;zt0#imx`0v|d! p`{d(lpc88P4g`.g 0 ``('g0PPP#Pg`pg 0``(gP P NP @ dgflЍlЍ'L(0( (0 HSjpH@H@Bx @- M PZtqt1p`@PP@@T 0Q P Ѝ$ uZP @ Ѝ@ iZP"0S- -S?@0 0000 `   V RP +R@@D!0DSX ?ZP0S +S!@?@!@{D>4QX ?P L0P00 1 R/@P/!R/8z0@>S 00 00//y@-Mp @k``PW P0D>S 0!3100 0kЍ>SH 0!3100k00k00y/-p@-M]kP@U@0 ` ` ^Px0x 08 R;0Ѝp@Ѝ/0 a07( ( @xCTlC$ CA-@PP`p= =U( X0ES! S0+0E0VP00V&2!0` 0`00+WP -W =W00V-00h00+0+0`00@@00000 00 ]h00L  p@-PP@F ccF0P R@ O-P4M\p@Pu WiX0S- `00 S 5/000 00!S5+0 0 00!WaW0] Y[ X00Ud5S`500 0 0 0@P0` (0`0p5`0$0X&_ 0S30`hW A, 0`^VW ,@P(05#[0xQ` 2P X $ 0 8%*&  # #.ğ BPU 3 2#0!/#1##ʂ0# 0`V4Ѝ3+00 00!o3/0 00!hh30$0H\.Ld0a#0L0|2pST @ P, ` !e^`P 0V ^ ,@Px ^}[`"$:600%$0D"%><!!!0C,"0TAP%"$A0O#QX00 0 0$00?S%4 P! (`1T101! T$?01>! R01"_0A`(0 x10X00`d(0@t0P`d(0 s%^  R1k AP5!Q4 0A` X0A0PE$0 `0P 0 M`4`4 0 @ 09Ob 0 @ 08Eb`( GzGQ)\(\HĹ \SQ< x XO-PP M@`o Tw V Hp0T:R P- Ÿ P2 1L PPq@pQ @T*RP P 1L P R 0Q_ SQ Ѝl P @ @0L0\? 0 \ @ p R@p\ p W R:\#Yp 0 0 aT0 0 aV0 0 avp,@ \?[*!]-tt tpH HT p@-@PP U p@IX X0X 0 eaU8 808 40 Zap@tIh \< p8EG-P@U T^ Pp ppq W00"1gP: 3Pc 0Sb 0 R 0C ` PP0 XA V  00S0 0 Q 0  ! 00S3*_oRe`VP( U ! a 0 0 `Tt t0t p0 `\ \0\  0G`b00Pꀱ @tT H, $A-P!1 M0M@P`040$ QE U9  00S0 0@ $03/H!@1 0 4 30GۍЍQq1p$p0 `V U$ 0 0 Gx` 0 0$ n` 0 0$ d`0 0]`p p0p H0$ S`7UDU <C  Ed XD dO-MMMp&0|6 Pp0 TDe040f XC 0SL VU 㰰bUe0U@@ R R 50B?o2 000RU$00S0E0 @y0S0000SfV X0+0L 0@ 03/[o 0@ 0000,00G(00 3/ P   0S00* y 0.S Z~00S Wx:0S 0S , P80: S $ wP (0JQ/030J1 1000 @P}000$0 000S  0P)80: S%V 00S 0  000S0 P@T  00S0aa4/P/ 0,0" $2 MލЍ  0.S0Sn 0.S}j0S  0@0N  2/0S0@  000.SQ ` P J0 @P@ @r  2/0H(100+$000  `P0!1 4 0^p0` R 0 YF0L!L1L 0, ^0S(!(1( $, 0^V ! 1  , 0^ 0 , 0^0|$ %QH`0/ 0 0@ 0 3/0q F F0j{S|S*HPP t/, $ Ш  O-P#`3 KM0MPؔܤp040; WD VM YV \] /\@ 0@ \/\0 U'"2 0 4 30KލЍRb/\;/00`/\U\- pp"p2p @ 0%^WP"P2P L@ 0^V4"424 0@ 0^Y"2 @ 0^@`p `7P 0   R  T 0T/S 0: S+ S 0 0 0 0 `X# +00S0 0@ (03/0S0: ST/03010301:d R0ꨰ`0 `H 0]0G0 ]_/0 0ᲰDLKh `< 0m n $od dSO-M$M %5 0P`P0003 UE @0~S<    pH 0S/S;RR 0B0 4ZS 0H*0 ;P4S 00C PR3 IR*00S;R) 0X @H p S   儤儴 *S1 0@00S ?S! [S!^H QM00 S@000XS 0H , R @ 0<@Ⲑ 0 0R  R QR Რ@  +PW@PU P#<3 0 0 30ۍ$Ѝ@\0 D SP 0]S2!^0m 0]S 0 00-S]Q 0]S  0@< 0T20u  0BW 0R S0BW 0R S@d 0 Q{  001A0 LY0 [0!^0  @E  p 4xN0Pe H *; P =0$10QqAp@P0 ,\U 0X %\ 0 0P \ 0 0X \0 0 \d0X \@1@/H?**E[-]d! @ 4 `<O-`QMM@p R W T  D \I^ @P}\ @\ [\ {\PU PE0]\\ \8(/PPލЍ ]RRRF 0@Q`0,^* [^ ]RR6R` T: `{^0 }^S0CV  B00S08( N0 SV 0F0C  0d\0 0 @ ]RR ]RR x| |0| xd 0A[X WdX X0X d 0F4[X< <0< 8d 0*[Lؚ ` @| pp@-@PM`P( V1 0  0 S 30{S 0\ {\ 0 P Ѝp0}S0S Ѝp@rd d0d 0p ZVD D0D 0p Z\ 0 l d@ 8A-MMp`@P00P00 0< 0000000 < 0 ; S \00  ލЍ⌀ @R0B \ 0 \\ 0\@9 ލЍ$ $0$ | 0zZ\@ Hp@-`P Pp@0T1@D 0CPP =@T*9000p 0  0 RZ `0S$ - *S ?0C\S0P0S Q 0S 0 0/ᴖ 0 RT 0@-@"RC ^ 0QP BP'  R7 "R- 0 @\R "R  R&   0BS0 R 000 R "R @0 #  0 @ .R0\000/ᔖ p@-`$Q$P 1 QM0MR050 4 0 0 5 30-QލЍp  @, 0  p x @EO 0{\PD8  0P0] 9t9 H, 5C-0$eP`M >500S tE @p#S!0Y[0 p墲P$ 0S %P @ 0S?[0SЍt `p  0@S0 04 0  0Sx t倄倔p 0fS0fS 00#3R0 4$ 0000@SV 0oS 0oS0nS 00#3R0 # 000 UP 00#3R0 p# 000 UP 00#3R0 # 000 UP( 00#3R05 " 000 0#S 20@ R@@rJP00Ѝ0 S S\ UP 00#3R0 " 0@00q  UP  UP2 00#3R0) ! 0 00T 00#3R0 ! 000ElP X0@S0 @  LUP =QJ  0P00 :UP=Q 0 0@0 աI  0P0 0 `8\ D  d  t  xP lXDp xl8  p@-PP xUP f@PLPPP 200p( (0( 0 IW X@-,@@P00O-`(@8 0M0008pP00P UVYTy 4 MpJ09, A0$0 0  0p P2ZY<000S[ XUZ P'D7 0 0 30Ѝ `s?0l0` 㰈pp  PWpJ 0BQ #S P BQ #S Q BQ #S V BQ #S S BQ #S R BQ #S I BQ #S  H BQ #S G BQ #S7 L BQ #SO M BQ #SE N BQ #S; O BQ #S4 D BQ #S E BQ #S F BQ #R 0S:U 0p0S8 Rg BD{P 0`000  00  H$   (40000   $   30000S0 @  # 00   pW p[ pIX00@CX@W 0Z 0S0 E0@0T9  T04 0R/Q T:\% 0 \/RT0C"0C/QT :0 BPU0P!Tp00p`@@PX K0<@@0/S (@@ @@x`Y<XX@JA-M@PE(a`0P: !0C p0 00    0 b0C S&0pK0 00S`@ 0S 0SK0"S &4# Ѝ V1r0:K00TV D@-@P1 0S* CE@T. 0T)  /Q0C T !@# *0P@/S 0 B@T@!p0 0}J  TD@8@0/S @`VPVG-0DM 000p 800S DЍp@-`P/p P@ep V U pS@p`UP p` VFLQ?o 0?oA-@c^?c^' ^./ "(0C0;:P@5$&pc`c&0gCh5(5D0c1c  10 /0 @- /(0  +C0 @ 7+C 0/0E0E0C00 {+C$0 G{6+C{7 Q/0E0E0C /0P!Qo oC-@@`T?`T* T? 1?1>(@04!50;:`P6&`p`3x@y66U`1p 010000 /0 @- /,0k{   +C 0/A0C0C00[k {{+C{7 Q/A0C0C Jz@ @-wp A Jo@ @-lp J9@ @-6p J.@ @-+pPP `@-J00p@-@PP  (p@ 0 0 1GnO p@-P@` 8Ppp@-P@ 8Ppp@-P@`D 8Ppp@-MPP`V k@T |00HЍp 0 : _/p@`$ HM 00 R v,@-I00 0S@4P0#/"br1 0!@0lR0cR0A1R 0< 0 B``C/  "bQ0"Q$I)\P ףA-P0E \lp`0LPSa0@E: T@@ X@TS^!:O-p(BP`B @v7P PXY  P A-p@  1M00`0S 00S \P#P3.000R`0@ p `0 0 2 30ߍXPP @@ @(@$cpO-`Pd 00YP(<Ѝ0 P( 00 0U` 00S SG 0 @P$ph08P pC @B P6P  X R0 0 @P$p0 pC @A P6P X R0 (000@ 000@(Y(Pv(PzX0  GS( } +Sx -S0`000 PP䅐ಐ,P:U V P( 2c2c2 ,S \0c$00P 0(0v50 ,P(]U0X0,0h000A0 P6P4 wAP 6PP( 0(P 0  R7,0Y0!0 @ /Y- 0  0 0: 00P(/0 ,0c0,?0S,0111v>C 0C,0P(   /"b!!A0,0 Y0 00 000<: ,00:,,0 v>C 0CY0P( 00 050 ,P(0PY%S(P 0,, ,0 0C0P( 00 0Y` 0 0 SP(E 0 0 0Y 0  0 09 00ZP(Y{Y80 0IP(=0 P( Y 0P( X8,, ,0 0CY0P(m 00 0y0 P(_ 00 0k 0,},0!/A!b!b0C 0P( G 0 B0 SZ`(`R0Y0:<7 00P(A c0,S0S, P(: 0<0?2c11!, 0  0 0 000Y60 0P(Y;0 nP 00 S 00Y((P40  P()(P000c0 ,P( 00 000  R 0s @p 0 @00v0 PP `8 0@aa0K1c B  B00  000  /#b!!"A ğK/"bP 3:bQ # 3P b4l$  Q0 00 00 0 %0@0?3c112A #K?###cR 3:#cR # 3 00 0010!00C0 0 0@WP7 R0PR00G0PY @$p(P& 00 00PY @$p(P 00 0P,  /#b!!"A0 K/"bQ:2bS0#03  x 1 01 B00DRd , 0 40N0 S0(0!0`@YPO"  FP@ 0 40N Q@(P0Ps 0(P0 0(PP @ ACLC  \^JS S  0 0#3P0 z H(/o"PzX (PUSX ZSP @  0 0$0t0P0(0<0I Qvl'ttn$IhrP)\(\ ף@ ? 0? = ,Q 10PE0,P` ( P& Pd!/"b!C;R, a2ba12TQ(tP ``@CP(fMP P(P @j @0C2c2c2P$00( (0  @_ 0 @Y~YP(  00 0ShYP(  00 00@>0S; 00@70S 0@0 Db0`,0 0 0P , P(01(000C.$0y,^2000c^\0M0c P  0P , aP(00(000C.$00 0R<# `  0P d#,   P b((0$ ;00M 00Ѝ1A-0QPHP P M@O Q&T10 P1%@4@@\p . R ! vΌ @p `U! Ѝ0 P0  @@a L p `UCT 0 ЍH BC007 7 *tg$gg0ggfffv6qύˠ@Ѝ,0  (@P #3 P 0 0 5 30ݍ Ѝd0d d0 Dz?|A00@wA00U@W`!00!1 004 Ѝ媩0XPC0 P P004 Ѝ0 >`9pPP V 2pP `P@0@ @0 ?>b\, ]]Hh+ \\@-@ ML4(0S2 10 `(0` 1/qp0Pp)  0 0 PUR <0PU24 ЍPPTp 0S  0CP4T@00Pp4@-P M4(0S: 10 "p(0p 1/qp0@`/  0 0 @ToR <0@To31`V ЍP@T` 0S  0C@o @T003@003p@-PPE 4A0S5 @Tp1 Rp0P00 P 0S P0崨 0c0(寨 0P0 媨0 S,P 4P 8P p@薨T0T T0 M=0Sp000 00 K=eE4Y' YX' Xp@-P$@@᫥Tp@褥lĪ@- @@ᝥT@藥lp@-,PPᐥ U@ብpTl\@-@PQMPE 1 `0 Pp00S   0 XR0@ @ S8 <$ \80CS0D0 S0^U*:Ѝ\   "^  U #R.S*@ 0A a 0C0 0 F= "U #RPEUU E0 0Q@|V% V4  R  *4 8/ 0X\S 040:8 R РS /TqoxB@-Pp`>L@L0@@D尀 U   0L@-P`@>0 "A-pP|`@P( T0  0 SSS0 S00 S 0050000005%0 r<T5%0 h<|%0 0  00L50000  8 70L0 20-V00 ^V00;\ 40000 00B0!0000LS0 100C0 0?V`00 0 00000 \ \ 00y $40000  70L0 0 h", 3010P;\ cP3`b0001dP0j R SXc\Qx3 0100 M \; =\H \7 00C00L S h0100C09"00 0 0  Y 00L0f" 0W0C0_2 F0nR! \0F?o2%500%0F?o2300&0F?o24 00=`Foob%d 00!0 0   00L0! 0W0C0 0 #\ 0 0 00Pk00L 0 0000 0 0 0 0 0 0\ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0dP@cP'dP<00L000L00<00uP00p\X# HT# tTtT# LT" ! |! T O-MR@p 8 0SA XPJ TP 0 0`0 @F0PCT@D 00X `R)R) V 0@F 0#<00ЍU 00 0 0/}:0Sl l0l h/0: R @T  0E0Ѝ<00  MdM pM0M0  00   SA-@ R`P0Sn !"#b! DQqU> 0S$ RT 10 R RO 2/!1 00U00' 1/0P p $@&0081003/0P !p0 $@0V0 00 R (㨢000P3/0P! U  R  SV  0SX㠣P000U x/>3 __`_R<^^=A-@R`P 0Sm !#b!b DQqU> 0S$ RT 10 R RO 2/!1 0 0U00' 1/0P p $@\&00810 03/0P !p0 $@0V0 00 R (00 0P3/0P! U   R  SV  0SP00 0U ,؛]t]]O\x\A-@P| P4`Px rpPh  00^c<!"#b!0CaqV8 X pY6PXU $001p00S %\1003/P00> 000$0(100S100S 3/! 000``0S 000S 3/000(tP` p  0000Sx~P0000H0003/P 0ؙ/>38ZܘZTZ8=YA-@P{ Pa4`Pw rp Pg  00^c<!#b!b0CaqV8 X p5PXU $001p00S 2%\1003/P00> 000$0(100S100S 3/! 000``0S 000S 3/000(۠P` p  000$0SP0 $000D0003/P 0pԖXx8XH0WԕLWSR: G-P000pS` 3/0Y @IOP T0 0 0 0 Y @IOP Ӣ TT0 0 H H0 0p`P   /Vt8V`SR; G-P000pS` 3/00 Y @IP T0 0 0 0  Y @IP TT0 0 H H0 0p` P $  /UؓTU@O-PPM M Q \ /\E P*3P:p/\ p P/ `K`\o @ /RR.\)  B R/0 D 0e8 I Z pd 0: S$  S/ L/o" R/\ @  DQ7 .PQ X0  [K/R 0W0[0娐 !u᯽P-U  2   RW  80/\0#p0@ /R0 X0/ ލ Ѝ@  ǡލ Ѝ.008 X 0/ ?     \PE8008>008008008?00800A-@P Q AP`\Pហp@P 2P`V 80"S n800@p@- PHaM`=  -24QP00 P; 0^0% 0@0 :^0@S \S 0@ S @ 0:S:^ ^000ЍpL0P <0 0  ?8 0 @ܬЎȍp@-@P`P3 V( 0Pp:P @R0R P:U P0@Sp P P@Rp:UR:Rp@0@ @0 5(0( (0 5PAl (A3H A00/0Np@-@PP" U+ 0PER R:Q|Q00Q0S"P0@|R  :RRpT T0T P0 5U8 808 0 5p` 2@4 l.?O-M M ( 0P8$ p00D40u 0S~ 0S 0S t4!S S\h`P PP5  pP 00S RDP 0P-DP ` P@U"0 S* Z :S `\S S S 0T:H8@DP U@p +ûP`0P SZj[@00#QQ 8P6P00@S0 6000040 p(0,P= P 0:R~ pR0t4@00 0(<Q G<4`PC pP> :00`00 [00S  e@`P  ¼ 0 P- P^Pu0Sᙟ00`Y@D*0 S :S `b[ ` @f `b 0:R& PR0 0E`F00S:S:00` F0H[0 D0=  9 `0 @Cy `# pP H @DIpGlP @ p ,P pU  D0AX0$0p#3 0 D4 30ݍ ЍP@ CPpF6 00%@ ÜpP X3@00@S0,P`UA `PU0;S= "6@6@00"2 0 40S"2 0 B40Sw"2 0 30Snp"p2p l 03d 哺 叺0@ᷞ0S> 040/PP9 c03/P0p0H?o20$0PH0003/B00$!$1$  035@g5@p,P `U0[5 0  003/{5 00Z 0UPFU J=<$lG 9x9 9L9h \99 8 h'8  &7p@-PPM`@ V T 0  Ѝpx x0x 0( 03VX X0X 0( %3T8 808 0( 3T (6( 65 4$5@-4@@ P n0 000܀O-`(($M  M0pP ( 0 V 3C0 @R` 0S S P@T 0S  @P 0 0 C R |3000#30:Q0#Q0S(  0R\Sz 83@0 T  P P  0 0P0 ๻P 2 0   >0S00S\S00 RAP 0S7\S5 00S1 :S000 0 S4So A 00S :S|S@0@ A@0S'!1 0 8 30Y ލ Ѝ  @P 0 0 C`1 0 Y P @P @@$QP P @ 1 0   05P 5 0 04 2 0 04 20 0qP\ \ @Y먞ldD ),~}x}X}' 1t1 1L1p@-PP@ T `` P 00 0x0 0p@   T T0T P0@ 1T8 808 0@ 1|{l "0@ 40/A-`P@P T Ux = c@P dP 0:SS   Pr`pd \S@+  R0 0:SS ^S0S:S 0 R0@AdaPi 0:SS`d A0R@A0,`0S:S 0C^BC@2P 0@0@^1 0@P0 0 0 00:00!`P( 0 0 0L 1| 0 0L 1Tox x0x t0L 1e@ @қ@2 00` - tt- p-H-A-`P@PH TQ U: = `Pe d\@Pg 0:SSpppdP0:SS   \0@@AdᶚPI pd@ \D@ATp)ᤚPp@}4 0 0X 0 0 0X 0T 0 0X 0 0 0X Fz0pqP @@G@n2 00 +$ +" |+T+#| +4+p@-`PP@4 U= T& # P? 00S 00XS@<,00A  RaPAU70AA AW0AR^p| |0| x0d 0d d0d `0d 0UH H0H D0d 0p D*)s )q )l)rO-pT# P3AM M 0@P`0(0 0 0S2 +/4 !PP9 P0D 8T 쒟  0}100CS0 = 9 40:S 84So10S100T"<2 0 (0 30 K("P( 0B.K:SS B000$ 8T S#衟 440<4 0 S BKJ ; /04$ (4I0<4 0'$CxB>K0CP 04 8 0S:SZD H R0 0  Q!0 A00M@04@0Y0 0:S M1 00UiPe0 0 E8/J0 :SS008$ 0:SS00 @ ꐒCX H)0)(' &<0 0@-0 -H-M0 S0 00 0 0 @0  00^100M^ 0@    RL00 倵@ 00 0 0 30KH Ѝ/4@-I$@@00D%o8%O-P"2 @`0,M0$00㒗d20 R\ 00@`pR 0 IP Z p j P p J 6" 0J0PP0 S#: {/% U10 r 1$4S1$!@00 PKP0S "<100S (!0 0 $0 306 ,Ѝ U r pP Р P 5SX0(, VT00#    9+PP P0SRN|41don##$n~ @-;(@M@@00?PЍl  { k{ {G[F { //=A z z k [k'kFKE{{ //=A  { k{ {G[F { //=A A{ k [k'kFKE{{ //=AQ@-@0M 0 0$0(00 0#  ,0T m/P0 0# 00Ѝ `/0Ѝ-$M0 00 0P$Ѝ-$M0 00 0ԳP$Ѝ-M0 00 0 óЍ  0/C-`@!<1 0sMPPp010. V6 @X0^00pAtA)0Oe4{PP0P >TA{ (0 0$00 @8 0 0 1 30sߍd0d d0 G,VH0H H0 H,L X\ 0$$0 M000 Ѝ<O-pM/0? P0030_ Wg 000!R !X P  v'P4%X 00S)00 R .> 0 3 30 ߍ. `0zS 000P0C0 pXgP o@0 0 8'P P0C SRP =- 0 ],W=- 0 S,a`0`F p0p0S8@0 'P* 0P0CS00000偼0S0p0@0 0 &0P 0C P0 SP 00 pg0p0SP 0Sb0 0_00S 0p000Sp000b  0 P\PY+PS  PO00SVp!p3`0 S`0 ;P 0P0 0`00020p0S 00hʠ@0^T@pp,(0_,TIN 0', 0$0 0$`-QX ]QP0 ` Q8 @$00!0SVp!p3@0 0h:00`P0 P$ 0C 0 `l,0  Ɩp PTPpG@0SW `P 0@00:0偼0S 'P /00SF0p00p0S00 P 08pG0Wcp8pFWᬈ mp!@΍p(H0 +0BMS00 [m0H0 00CS0a000pWH%\0XS 00 ( 0# 0        0H0 0(0L0 P0000F SK*N (@娕`Vp0,',7 0 $'(` 0p>(00S BP V ,$00SNV`@ T@0  R  R=  0 BV0 5 RP/0pH  R{ @0H  R'  `V B   H 00 0SP HX A 0p0 0000P00pLHHHQF@$L P (  r 0 d D p `4 Y< 8  `pG00P0W0S`J 0000P T0p00$@00@ 0LpP00( C P4 0C 0 )0 p P p/ p 0S $0 PS0pS`F V  P0 0@00[NP ($@X T 0@0 0]0S=P [($@  ( 0pI00 =l00 8V.$   ]R R@Pp00@0 0m00Ps$ ( n$ 4X @WP0 0NP 00,p004@fP P P P Pa P 3#0 '000C ,0N[ 0$@(j ` @vV @ ](0\0LH0\ 0P-@0 `!V`p ,X@0Tp@H0 _"H0P`V B   H  0SqP H0 p H00CPZX0p0p50@LpP0 00 -"V?o20SX 0p B0V 0\ R:PV0 "P O P 0C ?0C >(. 0(  啒p0 P s ےPX P`Fp0S P [[ (0 {/(0 SA-@P`p0 #P@-` MHP@p<0P000  P ЍdnA-@Q@R`Px v ,200S8 0P1S010t G000P`$ pW@0PD ᧐PP` 0 '00P0 0 C `C000b0  Q  Q*RQ3 <0@08 00 0B`0BP&00P0 P 00+ B #A ?#@ 0#T0T T0 `Q&} B0 `nD Hp@-@P កPp0@-P$L MT` 0S pW 0 7/@P Ѝ(@ Ѝ$0$ $0 8 &0p\ 0 00M 0Ѝj0A-P$LMT`p 0S $X 0 8/@P Ѝ'@ Ѝ( (0( 0 p%0$ 00M 00Ѝi0A-P$LMT`p 0S (X 0 8/@P Ѝ'@ Ѝ( (0( 0, y%0( $00M 00Ѝi0A-P$LMT`p 0S 4X 0 8/@P Ѝp'@ Ѝ( (0( 0D _%04$ x00M 00ЍhO-MD@@`PVp` T6 0US`$[G 0SD `VA 0 6/0S+ $l @V 0S HZ 0 :/@PЍ'@Ѝ0$lV 0 0 $0H 0 0 [$0h h0h 0h J$0`D D0D \ 0}$ Pl X@  (@- @MsЍe0@-P$L MT` 0S 8pW 0 7/@P Ѝ&@ Ѝ( (0( 0 $08p T0 00M 0Ѝe@-Pp`e&t@t0@l@ }U  b@0 sn$ jAd0 `60ӪO-$M03`0H0 U 0P 0u 3p000ʿ0P0! B0 b8<B p  UQPE @4B 0L3@0S0 MTT  MT  ^DQ #2!Q   "  R  R  \000!#300@ 00@00 @0`PU*$Ѝ@0 0M  00P- S@0^^?0 0`0  P 0J ZS0 { 0J ZSw R @ \1 0000 $Ѝ0\  v  `0\  f  `0\  r  `0\  s  `000C0S\000000 0``0\  a  `0\  b  `0\  t  `y0\  n  `r0剎0PU 0 D RQ0\  @`bd qA- Q@Pp` ᎎP=0D! D?o2]R0S h0$"0 !@1= 0 V V 01 P0 A2 2 A-P@p`P.T T p0! D32 0 A_T <0$"0@ !1% (0D,TSI6T2 O-`x(pt8SM 0PP0D10T8t0 0x10 ?o2V0S Y W w@sP  l0P0 0 0S00 p1#0@S Pp#T, U T 0 1 #P00? PPl@T`P @  O#TP 0@T0P 0HC1S@1@! <,`!0P$0@ p 2#0S V <0$ 0C BP$0ap1  H6* 0 0  Rp1  6' 0 0  Rp1 00p1 00p1 00p1 "00p1@\00p100Tp1  PP@T`{Pl5l%l0 !@KL5L%LL0 ! 㶋0P 07 00L5%0 z! "TPNx4$0 !4$0 !Y4$0 ! ꤔ T (P$Pp `@T- 0 P9/P#00$壌塌 ៌坌,$3 0 D1 30 Sߍ$0 <0p< $`၍aDГ (P``w0S@v 00S  S"Tw U| 0 0p,40@ 0, 0`P( L l7 ,P`O@@@Q@TAO ( [O* 2,@) 04(Aq  00,0 0R,0' 00 0000S00 00 0,4P0 0S0"7 000$P v0S 0Sd 0d1!0 ~pV20 0!T4#00I1 `0 PP@0 CQ lXP 0Y,* ! PU@ P VP0 SPU@ @ @N5" 0000$0x^T^( T8   D d @ YP\P P@- M@(  @0 @ 80 0P@ 0 30 ЍmXUU@- M@, @0(0 w@ 80 0P@ 0 30 ЍBThTp@-@QM`P0 0 `PRЍp0@-@RMP0 0( P<Ѝ0-M 000 ,Ѝ-M $Ѝ-M $(Ѝ@- M@ @d0 D 80 0P@ 0 30 ЍR\R@- M@  @0(0 D <0 0P@ 0 30 ЍtQQ0@-@QMP0 I0$  PЍ00@-@RMP0 20$   Ѝ0Tp@-0@QMP0`0 0$  `qЍp-M00  `Ѝ-M ( OЍp-M ( $>Ѝ,-$M 0 0¥$ЍO-MMn)`< R 9A P p@0  @Fp IBTIp`$pT ` #P 0 ST U ȉ ܍Ѝ  R U  gPP  00@-p@-PP@ D!!!!@Ỉ0P0 @p0 0  yA-`P@PD T% $0S:0@@T(0 0 E R ( pO 0S$ 0 0 ?w$0S%*v ( p3n 0S$ , ,0, (0 Z  LP@-PPM@`q ,0PXPH00@PW0: S Se  SЍP P 9"P - p'`P@& 0` \0`D`@.S0H08< 0L R$0L R 8< \P@D V^0 0U :0]0S \040. SЍp $p Ѝ( (0( 0 : l ,0A-pP`P% ,0H@P \0 00X0 0 0P$05%0`.@P0\X0@ 0  0$ ꄰ @D@-`QM@ ᠥpp-  8<0RP@D0RP }P00V Ѝpp pPi@e@ЍPPЍO-`P4M(u ,00P0(0t S , @C0SOoB 0 0P0 0 ,0 0PP0,0 00C /R 000,00$00 ,PHL0000p00 R 0$0 0500W000p@@# P ,0  0.Sn P  '@P XG0 0L00, 0 0S5050S 0SK 0S 0E,0\00 0 0$ \0| t R0@PS000B 02H00#0Q 000PPS0 0u P 0 0y0P0S , 0$000 0H,0 0\00 05~0S 0.S P00 00/  00$0T,P0Sp,0A 0 S: Y $ 0U0: (0YS6L0S,00 S-" P& ,0 <%,0KPpWA P,0%<,0p4Ѝ0 00P 00$ 00BUYg (0SY 4ЍOmP  0^5P0500,0 00C /R~ 0P00S  \R   B  0SL0S0{ \R   B   R00L Rk 0 00 )S050$0$0UC L0S,00S (0S05S]P b0$0SU l ,,O-`P MPp U0>@Pv PV(p,P X P5UP1QP UdPYR PPO [L PP P[!  PO P\ 1  L,  PWU0 PpP[WX HpP P0 %,0N X  PU @ ЍPUP1X0000 ! 1  0< ` 0 0H Kc E P!P P0 %,0 vp,00,0 P , 0  080 ( ,p@-PP5 0S %#L R6@T@L 0R၅@T @{TP us,0 n@p(<04p@ 3T T0T P0X |@|`"MV t`  A-PP @TQ ,0,NQ Q% R ``@T *L0S 5S0T $4 0d  BQR@' @D Q\ 5`V `V`05,0$ P ,0<,0@`V   <,0`߄V`P@,0   ^P@ 50 $ 5@T 0   0S00 ,0 C/P0/0 \ }@Q"2 0d Tf@叄L0s~ ,0 `L0SR 5 ,0(MPt(MH,0CP00\p ,0B/wP W? `1 300 00@hS !P/ 05 PU,0 RDp(6 505G,0 $0S005@=@n(0S P +,0 ҟp( 505 4``0`(֟,`)0 $ 5#0 $ 5 $$ U4Pp@-@P T UUp 0 pH H0H 0p ", ,0, (0p  Н A-PP`E L'p@,0 $5 S8 S@T @奃T V,0`<,0L0`S00/S , @ `00 Bpp@ MIPI, ,0, (0| :\d $1p@-@PPP 0P0S 0`00SMp@(倀(}({(A$0$ $0 B^4x$  1 0A-P (M\`@ @Ppp 00 0@+ P% 0 0CS%0 p0 0 0 4 5;1:(Ѝ 0@0<0"0 0(Ѝ04Л x 0 00M 0Ѝ2p@-@PP P PpPp0 0 *t p@-@PP U p@P0P P0 BU404 4C0 p@X$ X p@-@PP U p@P0P P0 BU404 4C0 p@ 4\ O-PMp 0GW"S00` 0w@EP-TPh +T@`0? ǿ 0  0  P! @00D Pa0DSW0DA0DS"70DWu X: Q\ SP AP"000T9 W0 0 p 0 U00S 0 |S 0F0 Ѝ0S U 0@ 0`000S   Ѝ p夀夐 p XR A B0A PR `@X0X X0 ?SWp pqW ꙙЦ ئ00M 00Ѝ2-/@-LMp`@$0 P 00P LЍ`0 LЍC-P!1 M0M`0p0<0"t @PU h1 0S P(0 ~ 0P( 1R P$P PP( 0 0 < 30)ލЍ0 娀R 0 P P0nS\P0S  ,*S@POPMP(W~('DPX-(-xnfs,uniop@-`P@ʜp@  P@P p*`М&`p`@-@P @(0( (F0 @< @-M @p 0: S  ᝜p  HЍ00Ѝ3O-0-,M$@`0@ P;#;S%1pp{V00Sx00w e0$0P@P`0  U 0 * 0@Px `FP@` 0l  Yp P@PE0S7 PUS0  Y*0Pp R   U T 0G UA~PP @Vi 0`0D00@ @$0,Ѝ0 <000  $00S$0p0}P R  0! ۛp B p @ 10 001[ 200 p 0 0 S 0S[ DP p 0S  [ T0T T0 } @PP pd*Ľ$ p@-P  @T @T0 0pp@-@PP U  p@ D0D D0 :U(0( (0 ;H\ HP4 /O-pP M0@`& X. @T fP W P5@1 P1 5* P 8/P  00[W@D:P PU ЍD0D DD0 X,0, ,,0 |\@ `rd 8sO-PLMp@< [ TW> <000D $0|P [ <0Sy 0PD0W`p000G< 0 000p `;/Ppp Xd*  0 b @( `P RPp`,004PZ` ;/P  R ,0VB^P5P1@1*`Ip ;/P  R <0 @I 0 @W@ 0Y:W0@  Y:p I0;/0P  <0 0I 00 p' R` P0S <0pP00Z ` P@000CSv 00`  F Q0#03Q0SU (p, 04P8` Pp ;/ P0 P0R` pp`;/ PZ PW  0X$0 S 0 U 0 EU B  3  S0 0 SQ1:(p,04P8` 0S"*$Q R0B0C0 00W0|@D 0pS+ 0Pi< 0 p`<0 S<  ~LЍ <` UE 0N W00 Y ( 0  S``V 0`S`j @p@pPꊠ W@[` ;/ PP @ pT00 501 *p`p ;/ PPT: ` 0PX$0DSa0 U 0 EU B  3   S 0C 0 JU 0 U0E0C"030 00c   S & @0PCUP00p 0;/0 P0UpJ p a%;/ P`pZ0 P00 JU0 U0E0C"030 00c   R 0Q$ @0JS J 0 0Q $0S 0 Q 0AA0 $0`S 0JQ 0 A <0SD  0`0 P`( <0 0I 0p' 0W dPh `R^ 0  0{ 0  0x[]x x0x  0yS\ \0\ X 0Y00ꀂ ȶ'X (p, lD @&- M0 00& Ѝpp@-@ PU 00S  RQ Qpz0P{ P { 0pD0D 0 Rp@-@(zyP(uypxp@-PPM`% @T@T T0 Q 0QP `` 0`P 0 RЍp0 0 i, 8p@-MP@'PUP`0S$005000 0  弘P& p" PQ! 0 00CR 000S 0S$0Ѝp00`$0L0L 0 Rp@-@(xP(xp(xA-p`@PP0 00S (xP   (x0S tP   0S `(x0S 00x0@-@PMP  0! Py  0P|p@ @Ѝ0h0 SdP0 0 <V$| X!X1p@- @0(MT0$00: 0PS` RT= 0TS@ 0 0 $0 303(Ѝp (0!@$R0@0T$0B0S 0S ( !0$ R0 P <0 0 $0 30(Ѝp@ | { \0P@- D  R4   Dh 0P@- XS HH@ r0( ( @ȮA-`PpPp@ U! T 0 F0P^ 000\ LL0L L0 ?U000 00 @THy Py T00@-01@UT0P 0 !0P00@-01@UT0P 0 !0hX0@-@UTQP  0 0!0DP00@-01@UT0P 0 !0000/ /000/00 0/в0P /0-@PQ@0/0P /0P /000S |0| 00 9/X0  \\ $0 /0lmNAԲ A- `PV(Ep@0 Ï@hC12c` P@ R0h0h 00 PQPP@@U0P10`_ N4Աp@-PD@@ v0S,000P p@ ~v기D1A-@Q`pP`FP | lv0lS AA0U0HU8!8 0p000 0 Lv?UU @P P0p0p@ ^  B0B10U  ?ࠃࠓPT0T TT0 @` v@а`@s LYԮ1A-@PppG8 `1#P #Qu0S PFÀ@@A00 0 0!,UPPP t0&&``` dd00A @uD D0D 0  ,hЮr Xp@bH H0H 0 X, ,0, 0 WzO N \p@-PP@" T+ Pp )bP 0S S5`P p@/`p0p@/L L0L 0( wCT, ,0, 0( x8N M hTp@-@PP U  p@-bL L0L 0< gU, ,0, 0< hlM x@M 0@-PP M@ T# _P Ѝ0aP 0Sp00 bP P0P 0L T0 000 0L <L TL (Ѐp@-PP@! T*  0Q  p_P aP _P _P p@_L L0L 0\ T, ,0, 0\ xK LK 0G-PP@H T  R# R `V$ V  0 ````q pl P 0n R R1 00 0 `V00 0`V 0| N0 F0R$  0  0 0l I8x 0  `1 00 00 0000 0 `J <%J I ~T~  @-/ 0SAS/0-$(0@# A  A A A0/p@-PQ@`2 V' T ^ 0S^  S 0RR00p@@Tp@0@ @0 ;(0( (0 :}\H |@l8H |C-@!P1 0MpP`030L TA A< XP7 6Y` 10S d!\1 0 3 30Nߍ(#@- R? R0 ! V p0S dp% 0 0 0 0 L0 0 C  -  RP R0 D,|{F l{H{F L{{O-IM,M`p$@PPJ d4 0I $000 pW W0  $4 I0$ 0 30Iݍ,Ѝ0 SJ=00SX302 2 0? J=00岰h} 4#+4J8#8  Έ vJ- 0S p0UV  SV S RNJ=0012 0000嚏:00H0 ,0 9TP @,VU  W3 0S_0S  0S0s S0S RJ= 0 J=00[WK O<  WP_ 0SJ hf1a! 4a4#Q #< <0J8 0J=00x0 Po J- 0SJ=  0orS SwJ͍0 ~%Z! 00S_LP P P J=00W0  jWPJ͍TP ݦ0E y\D Z(wO-`<$@84 0MQP@pDH0000$0C S0#3 0 0 30Ѝ#3 0 0 30H0 D@pЍOWXc 4"4 T#8#8 ᘈpPT0S RK 4"4$!$("( "8#8 DPT7VT00QWX00 R0SX 0Sd S2YP00SL"0 TT@@O 00QWX00VT;{! 0  9 X: pYp 1嘡嘱 P0 pY@D 0   T00? 4!0  piT 1i #Y70PpP0 p  T00?pW@D 0 D ۇP^T[pB\  ·xd@ ut(tshsTsTr(rqO-`!p1 0IM0107 P@p/ P PW PWD H0@S0h 0&h00a 00  0P 0 0 1 30!Iߍ Z v0VX 0S GP 0 0<A-@ 0P`px0 { 0P -p@-MP`P@@P@T 0S  R0S )P@PЍp!PPЍpp@-@P PuX%Xp0 0 @ J9 n0S/ AA. 0C.S .R Q P-S Q P_S /@-0S0@SO 0RM 0^G @PTO 0S`V DDp Wf U` \# DPD`VR S`/ @@@0T*R^00^00S 0 0 0R0C?o20SJS 0R 0^ 006 S0S0^ U. \2 D0D@T 0U& \ D`DPVS` D@D0T\U \ D`DPVS 0R`V\0Sp@-0d M."P0'  @ 0R0 0S  R la  haR 0Sd .P 00 Ѝp 0S S0S,  R R R  R/@-/ 0 S /0S S/ 00S S/0S/ //0@-@P M 0S PP 0PF@0S0S 0S  Ѝ0$0$ $0 ń4 Ti@-pQM @Q`P Q Ѝ0SSp P*(4"<8#8V R" R  `0S Ѝ Ѝ00S S<0 P 0  gJp@-PP`@ V T! 0pXPpx x0x t0 -V\ \0\ X0 "T@ @0@ <0 2 gg2 gTg`2 A(gO-M`C @80:0 0ᶀK\pP0  03/P 0@&<00&, SS 0040R0SY pWp@`$`4(48X#8C 0,P: P00(Tq*0C 0\`Pg0  03/P_ @\\`\V `M40S?&<00S !Z?\z` \\@X50 0[0P4   @, P, c0P( $D0$0D0Q d $RʆY $R 0 00 Z &<00 Si 0J'ZS@00S00(`Z,PH Yw D4H 0 P 8pph@  eY5 {0 0{%%{ E{000000UP ("P!0P R R 0   `R dYVw 80LE0S3 \00[0020 0&<00S1@@PX 8(5$%0 5s (0S #0S d[00@ $0R wZ? ZZdZ @b@PX[(0S <0C80D\G Z<0 C,0P@ 0P,0(00(030@@T@[@@dp@01z00 Z@P"0  03/P Y 00 S @@p p80RCP.@]&<0@ X $0 %f, p,X# pXx" W@WH" WW" WV! < <0< 0DD $0S\ \0\ 0dD 0S| |0| D 080`RC`P.@@0%.pDfX@p0p ;D0lZD0P`0 0 R  Q QY Q 0w괞O-PSM$04 0@0D10Ea`P AapP $0  0n8X0`00pS0  PO 000 FPK @@PX 0  5P_c]c@#|3 0 D1 30SߍY 00vrZ00 Q0 0 .Q0Q RS% d! St*+ 0 P*c(c @S Rd! Sf*.[ 0 P @00@$0 `` pY;9 i2 I520Y0 0 S   S  R  R Q\}  ^ \Q/o" S R0S 0 PQ -0 0S Q0S %0P 0 9P:  B  0 (C(PBY 0( P p0`4P8p`P,@<Y 0S@TF 0S[ 0S S 00SC P(0 07= RBP R? R<0S0S `;0S%PUD;35 \ ^ ; 00U Q  P \ ^  R R  # p' Y P` 0S   0?S C" 0c6#PY  ^i #\S㔐Q^'@ pTp0S 0` p$p@ T ;4 d2 D52H 0SE0 S > S PR  PO @0P0 0`P`&0e/0 8(0 YP @`( 0@S0`P@T $PP@P ^^T$PY@T@ pTu W 0/0 `P 0PU`VX ]PS 臟PpH0!L0 0PPHP$p+`PPPB ^0S: 0S ^ 0`@\'\7\ Xy/0QRSP㔐  P   P \R?o20S b R㔐P NP\IR PLV `$p(,PP00 00SqP@T0 ,6$p0(,PpP S 00 0 P@T 0S00S`;`9  0 wP pY 0{P-y0 P R 00S R00W  P5 0 uPY 00S)$S㔐R0S |$|4| 0t}/ 00n4P ,@ p0`]RSQ \@` T" PP@ ]]TS㔐b ``]@  0, 0P  0P ` @P ]]Y@4#434 0,0 ` `S_] Ph]`00[P 0 PP^PP HpW0!@%`!!:PZ@P  H HFsH`L WP @L@*@` :]$"0 (`h$P` ,W 0@VP` @GHV댠 pW0|0E0B l0 0 0  Tp`h !zP xPU0ED $0DyP00EJ$H|$0U St S 8^ $P"/8H@ hDpD@ d p#A ?>c d>H=u0Ii Q D 0P03 P Q$P0Q W : ixh,pt0(`0 q" 00S0 0~\H@P P0U 0Ps\P0U k\0$p(,P`z$PEb.:> fp yP1x00x0 E\L@`@H`P0U00L0P1\P`O-PLMa Zj  븱Q P@   `P00 PG p0p R R R0 T@|0P p R ((0(  *P00 V pW Y 00  YppWV$@LЍTT T0T P0".Z8 808 40". "" 7H6h T H66i G-XMp@HzP `P@ u00  \ 0RzP 40S0- XЍ OP u[B  05zP d[8<8 .P 4PPxR 0 6d6O-MV 0:   ?0hS@H"p ` *60V@@p`F  GH H0H 0 , ,0, 0 | %l%T D%$!$1 p@-PP0M@0 00( T1 `  !? 7R8 bx b$   0 0 0 30X Ѝp@7` `0` 0 rT@ @0@ 0 gKx @ ,$ $C-8802 M,"0 P00  `p 0R @  0XS @@0 T .. 0N l!\1 0 0 30 ЍT  0A a 00C 80BS.R ^V* 00ߐRP 0FS0 S S^*0X 0n(."4n4#0000@^0 8< 4^*0 8<@- McP ЍH!H1p@- @0(MT0$00B  `RP?o2T0S8 0T0R0S A 0 0 $0 30((Ѝp F(0!@$R0@0T$0B0S \@0S ( !0$ R0DL}} A-P!1 0rM`Pp010: UB @X0^00pAtAKR0OR0,1TA Ό 00 LRP5  0 1ypP& 0@"TP 0 0 1 30 rߍ0 0 <Uh0h h0 =P T00 0P0ߏ0|BH{  $$0 M000 Ѝtz -- M0 0y ЍЍ/-4 -M, 0 0 iЍ Ѝ/zp@- MPk| |@|0`  @  P` @X@nPqU  ЍphPy0LL1 @- 0M`!000zqp P@ C 0 qp (p@ 0 0 0 30'ЍpPpW @@T PU 0SP@`T[Q00@.,yix 0p@-P0@ 0 p0T(0PT(P,P T 0t0PP 0.P 00 0p887rP 00 0pp|P 0@-@ 0 0 0 0 0 _ 0 0 00@-P M @0S 00P 0 4B?o2 c0 Ѝ0[3 00 0p@-@P 0U0 0pp@-@PS0PPS(0PS(P,PpO-p0Pi `Pb 0@00 S S0 S S pPPQ 00d P[(4"<8#805 $@P 0P00S S S@ 0AS AQ@P$ 0 PS0000VRP  QPQ@M@P`0O-P Mp@,0(Sx:  6(T] .0 T0T 00SP 0 RJ@D@T0`E   RA 0@D@D0`0S* T0T 0 1  @D@T`G 00S#0A S00 ᫌ0S000  ⚌0S$ p@R0ppR(0pR(p,p@ ЍQP  (,@(  Ѝ0 00@- M@P   p P  Ѝ0 0$  0$0 P Ѝ09p 0$0$ 2 Ѝ0O-PTMe Ep@,P @0 ppSPd,O`P` 0 ppSPU,PPU0@ \ \G \Q \C pp 0U00S OP. p0 0 0@ ` R  R2 R[ R 0 @U ` 0 Q 0JX0L 0 TЍ @\L@ 0U  0⼰  0 ` ` SPE0h u4 E0 :0; 0Y= S81P3 P#S41PE2s2PEsSPE0i W0 E0 809 PEPE0i EU0 8PPEPE0h 4U4 :P 080 4:0X @-pMkp) @mp, `0v0 0 0 @Pku l00 @P Ѝyk00@Ѝllk / p@-\ ,@\ \ Q :\ :Ap00p00A-@$MPJ P 0( T 42~|:pB8N87 @8nj;p$`137<Ǡ  B- @0NQ  Q  000<8 A90><à 0 (0 AЍ00 01 0D 0 0@-S@ 3/@ OO-M@Y Qs 0`  @ AA! B B&"@@" AA! B B""@@a AAu! B L B \᧗" 00\ |3 L0 1 00p0` 0`Ff& G B$"II࢖)0F 0C)6# B B("IA!0C0C1# B B%"AA!0 Ѝ ZTr `   P 0 p 0 J 0 E! G B$"0C0C6#AA#! B B("0C0C2#AAa! B Bu"0C0C Z㧗# 0Z " Z Z 0 00  0 0 p 0`\\ 1L0 10`ZZ- Z) Z+ 0 pj 0`p0L0 1 0p0`fZd Z Z Z0d0`YHp`F8p`0|0x0t0l0hy7 @-@P  @+L0 0 /!( 1p@- 0@P0 00D@1011.T 0@\0 S@ P p0  00C1000L   00LDL,_ ʚ;$ C- M`Pp&ᕗpaapGQaQNLL0\0  M@ N *  Ѝ Q02Ÿ0@-` 0P 0C0@@@m 0@@@f 0C0 @@@@E 0@@@> 0pC0@@.SM 0@00@000@ 0pp@qE0Cp2Spl 2S 000 @ @  @000n l `Ad Dn l lAp00@  0pGqqAp00  0pGq@p0000pG00 @ @@jP] O-XM`P'M< 稄 |$ `!P@@ 7R@@T0L07^J0P40 0 0 h&6 0 @ < P0D060H00U000p0,0 0  QP00T00S <0`1  D0PU 0P 0U VH jV0h0S 䵟 ,0U?p5P00P 0U7 W,0?p50= 0Q8 Wd0 hj@V,0? )R ,U4pP0p   8P*4 +40 pT4P0 p40 p8p4@p80 %0SKP I0P40[(0 $3 0 |4 30ݍЍ_3P0 `u^0S 00T00S <0`1   Mp i40S T#2 0 |4 304ݍЍOKp$P,0!?0"( iUX" 8 " \```PT@Xi@F`DV?xT 04  S D$#$*D(H"($H3 Z 8i pJ Ji T0 P2L p0 J00 .J* T@F0 `DnVT@X\``ꌱ0   `Zl0 X 0 R@10d` `ppG pGCiT0 d`<0L p0 K00 .K* Tʴ'%M !i=tZ4Zl`PO$LN N D<^hDV V &pP0O-tM@@ `EVPPh0P 0 Pp 0 0 `14,Sἴᾤ0   (6< 0 V 1806< 0B>PPU  0R4008 0h`1S   ;`1S0 0 0 PJ0 0 P7P P P$0 0 sP0 0 gP0 0 [P0 0 OP0 0 DP`1SxYz < P_p0pW  0R  0"hNpW 0pW  0Rx  0h;pWf 0pWa  0R0 ,0g(pWGpWD 0 PS00 g`1S   0 ` 0 `@0 `0 `, 000 0I tЍ   Y _2P 0 (001p0 001p0 001p0 xx1p0 L |gtЍ tЍ 0 q10 j0 c 0 \0 U 0N0 Gx0 @lRH$ G DDlC`48lL,  @-`0AM 0M@p 0 40 0 \?PP0S kD 80 0 4 30AލЍ.&ՃKJ0,@- M@ pp P1?`PP 0S@  Ѝ00S.S 0S Ѝp@-Px AM p00 ` $ 0 @P 8 ,0 0 4 30Aލp膃IlI0p@-S@` P0 @S 7cPV 00pV00p@-@ M`pPU 0PU  0\W 00 Ѝ_00P0 `W00 Ѝ0p@-@MP`0S 0 @S 0S@V00ЍpO00@0 PV00Ѝp0@- MP]0@0@0@T  0U Ѝ0l00 PU:H@@ Ѝ08800 P@ Ѝ0<tMQp@-`M x00<@#P 0PU  0VЍp_40P0 `XЍp @@<$;p@-MP0@0@=@T  0UЍpt00 P3U:P@@Ѝp@`@0``0 P"@Ѝph;LL0@-@ M Te  T T 1 D0R  T8 2@TP |QTP Ѝ0TM  T/  TJ DQ TP 3^41P0( @T T: QTP PTP PTP P TP PPPPPPPPPPPPPPPPPPxPPpPPhPP`PPXPPҳ 0$h|d<0@- MP; O@nP Ѝ0 0( 0Pt Ѝ0|0@- MP!h0h@0@B>@T  0U Ѝ0O,0@0 PS Ѝ07Mp@-@ML ` 0 Q0PP@0<00 00. 4T @D E000T H0 0 <0 30 @Ѝp@Ѝ/.0 T2ꀁApAO-@Mp@@ 7 ` P0 Q ЍSq SR@@ -R 0 0+R0  0h300 00 B10 11 .R 000 @T@0✑)SQ 000R#3@0SQ #3 00R0#03!3 T$ (<0(80(40%<0%4 0)< 0%()4 0)(0 P 0R0P 0T00@0SP 000R#3@0SP #3 00R0#03!3 T  0T00@0 S\ 000Q#3@0S\ #3 00Q0#03 3 T   00 Q @0N0000D00 0 0 >@O-Q dM0 R 8 $ Č(Ȍ , 0̌+[P T0X ? Z A Y C ( L $ 0\ H0 0@ <0, 0D 0Pp40gC[ DZ DY DdЍ00N\0ꄀR(P t dЍXZ HY 8igMbQ$@(@-@SP 0D .R S0@*ST .P@Q QA.@P@@$ $0$ 0( ܧ DX@-$Mp`p`_@N]0 v> 0 0    $  MaPc$ЍC-`@P@ MPpOP @U ^P@ W @ Ѝ ~@P@t0 0000 + 0P!#0S0Y@OoB@#|-7dC-`@P@ MPpx@P @U ^P@ W @ Ѝ 8@P@t0 0000 0P:!0S0Y@OoB@#d,06Tp@-@P00CS0 S  P 0` P}pQb`0 0CS0S P 0 /9b0@-M@90 0I00 !R !PGЍ0p@-@@0S"0@0Q R"  004S PpR Q R 8 @0Q    /4Lp@-@@P@0P`0pp 00,p@X013L0D D0 p@-@`P0pp0,p@L3LHH0 A-@pP0`p0 A2LC-P0 M0`psp@ HD@ <80  @Ѝ 92LxC-Pp0  M0`pIp@ (0  @ Ѝ 91L0 0 /p1L0 0 /P1L 0 0 M ЍT01LXA-pP0 M0@P` p 0 p7Ѝ0L0 00M0Ѝ0LxC-Pp0  M0`pp@ (0  6@ Ѝ Y9d0LC-Px0 M0`pp@ 400  <@Ѝ 59/L<@- @  $M0 ЍT/LH0H 0p@-@0pP p@ 9p/L,,0 ( M00 0Ѝ[.L5 R) p@-P`@V /P 0S.S  0@S \S 0SBp0S @Dp DU!B2p/@-P0pSp M@` 0T 0C0 ЍL0L 0p0<0<0 7/0 0 -O-pM`@PpM WC*00V>:Y ` <1<0 p p? `P 0 p- 0 p& 0Z p `0 p F0?V0S0 0 7Ѝl0 op /000000Ѝ8h\` lO-M 0(0=000=<00 0P D8 @ 0 ]P` 0S@; H = 0< P@ 0 bT:p 0,00Hk= P 0= 440U@P U *( ? 000=0 8/0`Hk= 0PE$P=00∀HP=d 0P >` 0P p , 0`%p =000S==000Sb -0 = 0 BR p  R 0S .S 0S 0S00S.S-x<<< 0-< RX, P@ C=0;@+A0X 10"3A C0;u'P'(` ,Hdȓ DE" P%T*@@l T d  ==, ====Љ p8D\VUUUh\$`T\|رh\ 0{ Xz (=000+SE =<00SE@0@d 0 0u`P0  2p  0 d e0  $p 0@T0DKI*xQ `pPTDK> 0d 0 0G0  p< 040 BP0DK 0T*rPp\Z `PP 0$VM  R @0 Y$ d0d   0  p @T0-< 2!?C0 Sd0 p@ 0 p=<00SH n2p0d D;3 0 P`0  pl <040@C 0 P`$P^0 tpV 0 P`PMH=<00S -P4< 00  P9-4< 0$004d 0 0  Apk"=<00Sw -4< 0t=@  <<0 ~ 1@1@<`( 0Y00DX50T P@0 p -< 5B !?C0 S0 p(=<00S^ 005d 0 * 0  p `VLpD5 1RCP `@ $ @@@@= 0Hp 0% .WP *( x60@@60 4/$0pG= 0p0VHD 0 S@P0 p @P<040pP`@C 0 P`4Pn0 pf 0 P`#P]0 spU 0DK 00CSt 70=<00S0 H[= @ 0 0}%T` *( 48X04p00l80 7/=P@D` @ 00H[08d 0 s 0  2p 0YD2*xp`0p@ DPY V 0  p `0d  @E 0  p `F@P 0Y 0 p< @P040 B@PP 0 p PDK0 0@0H0@ 8 2= 00P@ p:( t  0P0:0 5/P`0*@1p0:Z0DK{ 0 p< p040 Bp9Ps$ 0 pk DkDK`\0PD[ d 0 0  spU J0PD[ 0d  0  apC 00P -0` *0;d 0` 0  Jp, Ht=<00SP,0 S00=<00S L0@d 0 0f `P0  #p 0p00d D; 0S 0  p  0 d E 0  p D= 0DR =<00SO /@/P/0P0@2 D;=0 `p0 p < 040 B`puPH< 040 BgP0Dk 0PCUhQ@p@T 1 W2 50d  0  p|=<00S d/@`/p?@@02 D P`0 {p] 0  PU |O@0 DgpI 0  PB 0 DVp8 0  @0P0 0D;0 Cp% < 040 B@`Pc=<00S 0 C? 0l=<00S< 040 BP0D 0 S@/ C 100 Sz0 p00 H{= ` 0 0#`V@ *( >0P00>0 5/0-p`F H{D`T0 p0 H{= ` 0 0"1V@ *( = 0P00=0 5/0-p`F H{D`-0 = R -=< 0-x=< 0 0 C`=0 0 CP=0P$ 0 PU0D[:=<0- =< 0P  `P%VV |pP@ 0T00 EepG 00d0V0@D0 Wp8P<  @PNT~Ts $|pP` 0V00 E9p 00f0T0`F\0 +p ;d 0 `] 0  p U `l[PVDK  0d 0 0E 0  p=<00S-;< 07-j0`pD{ 0 Pp :d 0P  0 P p  0 p X 0 p - 0 P`Dp = 0H{` PPV *( 9 0|0090 9/p=H{ `Fp `` 00 `ps h 0 pk `- 0 D P, |p^ =H{ ` 0PPTV *( 800080 9/p=H{ `Fp `` 00 `p4 |0 Jp, !-0 D P@=p =H{ ` 0]PPV *( 700070 9/p=H{ `Fp `` 00 `Ep 0  p ,@0 DK PTp = 0HkP @PU *( 6 0p0060 7/p=`PE PHkP` 00 p 0 Pp 0 pX0 HK= ` 0 0 V*5( $ 0`060 6/0 HK= ` 0 0 V*$5(  0`05 0 6/0 pZb 0 Ch50`0 spT A,0d D 5 00  _p@0 Vp8  PDK 0 Po0 Fp( <0dPC0@`DK@p0 5p 040 @pP0DK 0S 0 pI+` @DKXSd P0 Jp0  p +@DKB0d  60  p +0d D;D3 0$0  p < 040 BpPD  0PC 2 iP`&P rpP@ 0T0 0 Ep 00d0V0@D 0 pH2H"0 <0 p rp@ 0@Y0Dl:P  &@PZTT qpP` 0V0 0 Ezp\ 00f0T0`F 0 jpKVH0 _p@(0 Vp8 qp10 0ct`pXDĵȴ|ز DHL  $ ,4@<*`t<4h`P,h8lpp0e VL0 p h00d  )0  p0 p ppn 0C00T0 p0 p qpyV(0 pXnTT0 pt0 p qp=<0!1 0+J X0X! ##1 0  +J X-- +J XX" !"  +J XX  #  +J X,- +J XX! "  +J X 00;J 0^p@ PUD ,@- R MA L  ,@@0(@;@ Ĝ0 ЍPM-(040 1 2Ѝ/DA-PS`1p@@W0 V:0 $4"48#80@PU *)P@(00T0T0@DT0S,0, ,0 lP@D,c XG-0PU!::0` @4$#4T00 0p4$#40  @T#0 T4Ġ#400S X T0 $( ,0 P @h(00QA-Mp$0PS@` 0(010$,0v(`V|0Sx(0S! 0, $P(0, V3100(Pi,0 \, d0U4#4 00,004#40,T(0P0T(0 S0P$0Q0 ( ,0Ѝ0F P5, (` , Q/:04800XS: 0ST.C+S^/+  ` 0000   0 C R 7ࠃ0ࠓ0CR 00000   0 C R7 0 0C20L0L L0 ?2404 40 >) $dU 8t^U A-p`@LWP. T @00V 0Px0PV0 G.`U` P7000 200p0 S700W0 U00 0   0gdT /<o/$///@-DM` @ 0p0 < 2 20 RPl.00000C0< 00 0 <0 30DЍ~i P O- Mdr 0\婒'`rDB( 0 rgqC0ሀB " RP C@$A i!dP @3@CG*TNXWnY1Z$* @ 0 Sp: [ @B0?R0SJ  Ѝ @ 0 H|p# W0Y[0S    00000000S 0 WYp@@ 0 DN p XW  0 MAp Y L0L L0 e Ѝ @ꉈ%I$: TP A-`pPᒾ0S-@ T 0D0@D0C .R T  S\RT  S0C\R@D @0. 0 @@( 0 0p@- M0P @0 80p k`d p @Ho4 (0 0 8 30ލplhx  0-@- M0@R0  YJPP * Ѝ@Ѝ/ + Ѝ@Ѝ/ShPRp@- `@PrPaP0 ?p@&JON00pPRp@- `@PPP?P0 ?p@J-,00pp@-@Q `P0PP0 ?p@I  00pp@-P@IP  p@ p@p@-@P 0PS <0S P 00p00pQP@- 0R R  00p@-PP Q@ @Q Q Q ARt032 00pP @pP Qp@-@P PxP  U 40,E0S 00p UPpp@-@PTp (0":k0cSp: A pO-0 -tMP@0 R,pup@`50S @P/008% 0<0-X000X 00H S0 100H < 0H P-\\Ё0H4010X @X `V @ ER>    0S PtЍ P EXG  @ 00DA B QR cp `> S0T3 W  0p|| p 0`@> p PPL1L!L0 ?㞶0p 0>00D,00XS W#0p 0 000XS W pp p 0A0C0B QSWpP pf0p 0> 0W 0@ p p0@ p 4333333% b00M 00Ѝ  r  Q0?0S @-!\-- Mv ЍЍ/G-P`pP WX 00`F! R !V6  ʩP 0PE (`V PUU@@nPP X4 00徫  @@PE  P00箫 000@00ᣫT0T T0 B͵W808 80 Cõያ|2 _P% _A-P`ᗷH@H0@@@p >U  S Aꈩ 0L0p@-@PY00CS0 S  P 0` PPp$?`@-@P 7 0`00@60 0 6b# d^- M? ' Ѝ 0 0@-PP0 M@000 T#   J 0 0 0  ?| t0 0 0 30 Ѝ0T0T TT0 %T<0< <<0 Z  t7( ]MX7 h]NA-pP@`( T1 V: 0S 0S0P00 00S0 00000 R` F`Q000x x0x 0 6״TX X0X T0 ̴V< <0< 80  \\\ d\,\a D\\bO-p#@3 0OM″0410PP`1 dh`0 V Vw Z.` oP 30 00 [ .Q Q\.Q b :0 L 0PY [ 00:[.[#4O[0Q.SI Yg0IS00`0 0IZ 00 0W \ 0 P00 ` `0 0C SB: 80   ` 0 +00&/00P!@1 0 41 30GOߍ:[ 000$0( @,峯0 000 0 `P P00 ZW0000 0 ( 0@<4 GPPF U.Rz  :ᬥP nY뀥 \ 4 D DY, P'XBO-`PM@p  0W0p W0^( 05PC (5000 00 P @ ppP 00 0 "P > Q Q 0` @V 0`VI:`F0V:\`FW @pn pZ`FF R 30 0 X00@ߍ Q Q0 S S   噠 pP ` Q PG [PC T :  "@DP  0RP@- #[{0fpp ỮX  [`F Kq `F  W e ᠮ Z V P0 0`P `p R R R RU T * )P p RP?(@D PPV @`V2 P( !T>: `P  ЯP T014 @1:p 0 @ 00 0h; 0 @ 0 @0`P_U' 0@ 0@ 0 PP P 0` @+\V( \>LS^@-@d!d1 0LM`P0D00E Dp0PS, @.0 P' U' qp0 0 0  ;P   0  0 0 D0 30LЍ;Pppp M@ T@ @0@ <0L W LRLH Q h#PA-PPM@6 p`p@T( X pp00凭  0{;P  0  Ѝ|pp @T Ѝ?;P @, ,0, (0\ ଱,;4;P "O O-UMM( *0|: 0tz0L50`P|5pxU別0 (0S 0 S00W :0$0(0P,0  0 @[ S#p`P ,M0)09 0 L5 30YUލЍ50 0 P0 $03/P @[:0CoᨂS  Rl  P0 `PPP0,4'4Wp8#8X uD PT4R pPHL@8< `\ T]*`P0C 0 ``PR0 $03/PJ @ Y(  @ T`0@ 0S4<0S 0 S  R06P0 0S!0S H0S0P|P0X`*\0L 0R *P  ƱH0`0H0LPZ84H0S , 0d0L P0QH RXK p XPHp `BZO[ P0 0 00PW ! R  ȠLȠQo \ V SppQPW  WX0 B@GAq 0SPSPڰP!^P"@Qp`0S 0 ,0`@D @PC0@P0CS`@:Dp` @EL0X C0 0CS`:7040$0S?0@0 s@Pe0 w VB@X00`VX@ `0@帜``(PM S  C'SRG 0,P 0`P 0`%'4#3 0l (0SW#3 l 0گM(0P04D0,0\?R00 @P0 9 VT D0,1Q;*,`PbP P`P[0 CR00Q 84,`@PPpE0`P CR00@T@;P`@6$03/P `r.,0D(`C 0T0t0Pv  , D00D0DIr0 (5PH0 @P0 E VH0S0P T D0,1Q=*,0P,0X@LP~,  0x%mz   N481, ) =O-DM ,$0(4 @Ph00<00 (pPP ` p0 p.`P .P ,0 0P0Ý RR RR 0 R R$0 S S 0  @P 30p  00S S S@ 1U h*@ @P 0S 00R$0 0APEB@ Y  9:I S@ 4 ჭ 0 @0I Y$:  s U@Ir 0GEPP `p   a@D  Y>p`V `p#!J 0  0`!L1 0 <0 30GDЍ(-PE P Pp =PB? P0 0 0  0H 0 Lp `pP 000  0 000000pQp`ꔆ  p@-M`@P 808 0 0 ɠgЍp@-M@ ((  9Ѝ蠒@-M@` pϭPP0@0 ) <0< 0  0 p@έЍ0H0@- MPP@T x 0 P00 000 T 9 @ Ѝ0@Tz 00ȑC-@PaM`P^ Uf !0 `   p0S  H  0C ^0 .SQW 0@ Ѝ0 XR   9S 4 @ pG W 0  RU 8 <04 c#!$c4" 0h0h h0 mUL0L L0 n @S t  5l 5O-P#3 0,M@Q`0$00 UN Pj PX`0:V000 0m Vo @ß0 0 P @`0  ᔜP ^ PUY @ZpWP  p$`WJ(4"<00S W0G@ S0 s fP ᔫHHrH2p04 JၪV VV / 0 "1 0 $0 30p,Ѝ!1 0 $0 30e,ЍO`:V@ p .P :ZBU8 0S 0$ S$!, `P$$$q p 04 I2U V V 0@ 'OT0@ 0 0 0@ =0S@\p$`j `.V0p$`WP\OWhT~  3 | l| \ 2X  D  2@-P!1 0,M@P`0$00& V.  00  0 p 1P* v 0 0 $0 30,Ѝ 0 X0X X0 h㯩V<0< <0 i㥩O\z D1y  0 h t0O-ptMT%0P5 Q 0@0l00 W P P/ / 0 %4 0 l0 305tЍdT4`P0 IjTx T 0S4 0]$4 0 T 0 4$ ( , 0 4 8  001@ R@0`S U P Q 0S0@S Pt0Su00 Y0S @\T<000j0:0@0T0` 0= Zf 0Sf* 0CR00_:ផo"2 0 l0 30 tЍO@PPUE*0: T00S Cl"H0 0[P3@T` 0Z00S RZ  @T`0zu YPs S 0 S P0@o Pb0SD: 0 Y Y Y@D!0Q 0 H P #y8 @R0`P`P0 HfW Tr T0 [uA@$0[& + RP'p 0;/qp 00P @ P 00 0 00ᥝЍĞp  / P0 Q+ L WZ p  0/P 00 0 SM  00 0;/qp 00PPßQ <PU;0 {0p ;/qp0P r 00 0PUßR <0PUß`X0p\ Rh0ݛ0cX0P[NS  00Q] <P800CPU0& Z  "  RPLP0Pe? P ;/qp? 00  P @ P 00 0Z 00  `P(0 S%: PE u AJ 0C09PPT 0S  0CPß<1Sc B P_^p0Q ^ QC S(00H0S 0Q* 0F S0S 0 `  0AS"`!0@T`0\0Yp 00'(00@$ЍAT{0S@A@"@pZ @0Ġ?  0^0A>Sp0pS000^ 0AA^ AN[ ^( SQ0SP9 Zp? 0.$ @C /Q R 0 0R/⻙긛00@G0?Q0S 0 0R/⠙~ Vs*p*Y P HP @ @0@ <-0<ꈰ HJ <jȯ p@-P0 0M0 10 `004p !@p < 40 0 1 30ލp@p>]00D`" [*SP# K@00D P a0D0SW0DA0D0S70DS| Y[SP;+ꡙꜙ0S \0J0 ЍY@0Tf UFap P 0A0C0 A RSmUPP\`=pa00Dk000 S   ЍY @0T- U%@a Pp00D0T00XS$@ 00DAA PQ2Pp>ck p>cP0 0 ?.APp>c00DY00XS UPpb 0M00XS UpbPPp>c 0>U0@PP/@ p>cP433  800M 00Ѝ. A-`,!(1 0rMPPp010, V4 @X0^00pAtA0O0 TA0Ό`p 00`L PP%0 @t0 0 1 30rߍX0X X0 F㯖V<0< <0 G㥖<t. - ` 0 h$$0 M000 Ѝ-  -- M0 0 ЍЍ/-4 -M, 0 0 Ѝ Ѝ/, O-@SM ^ YXd 0pS000!R !3   PP E`#3`9P*Q30A 0#1#2#4#8 4 P:   60 A 0U0 pQ OP 0@pQ 0S  ЍT000@00808 80 @0000H A-@`Pp㰋0 yP᱋$0$ 0 M ЍzD* T${0 0p@-00St@@@pdddPP@PB@P 0000 0 * xz zp@-P@᪗ p@A-Pp`p@p0@h@ U  |3<0   A() 0L A-P p@` F  }000 Y@P p@-@P}Ppp@O-M@b@R`PX 9$B@pw r@0p RD 00nK1P[ 0S` P U [0@Z P 0@[P 0`V P:Z   PP 0 0C@aa0C0C Cr  \\.N2?#c!!"N . ! bQ.5:bQ- 1p.#c!!2N0 ] 0@ S[ 0Yv0 `R 0o S `k 0@ E``0 S0C0  B1=Q/0A!b0\P  @YG0 `R 0@ S 0,  B1<Q/0A!b0\P  @gY'0 `R 0 S40 @` <Q0 0\P  @DY0 `R 0 S0 @`t;Q0 0\P  @Y0 `R 0 Sd/1 ; b !PQ0 0\P  @Y0 `R 0 SE:Q0 0\P  @Y0 `R 0 S- t80 @q`@0 @`9 Q0 0\P  @Yt0 `R 0m StQ!/ b !P  d)0 \P0  @YT0 `R 0M S)Q0 0\P  @{Y;0 `R 04 S Q ((0 \P0  @aY!0 `R 0 SUP&UP",(Q0 0\P  @@Y0 `R 0 S7Q0 0\P  @(Y0 `R 0 Sp040080 0<00@00D00000 0 P0@]('\P Y0 `R 0 SJ 0@K0@ S0ŘY0 `R 0 S3Y@t0 `R 0 S$00&@2?2c  1R11Aãd0Sâ/c1S0c05\P0 Ym0 `R 0f S 0@0   0  900 S0R05`N0045\P0 @YB0 `R 0; S0 @`-0\PS004 0 @_Y0 `R 0 SY@X0 `R 0 S,0 @` 0@S0 @ |qp qp 0 @Rdp3 0S-Q LS@ b83Q< #Y"300"bLR YD `Q \P Y0 `R 0 Y*0 @r`0@S !YI0`Q0| R`xUQP 0@Sp P  P Y 0 S `Q0PX0@ @`O0@ Sd 1hYF0 `R 0? Y0@ST 1Y30 `R 0, Y 0@bG`122d3c@By:E.€Q_uk9"mnףp= ףs Sc$IųQ\(\n Tn Q)\(\m c 0㭅0 ):60 0($0(>! 0)Q` _P!!!0C0 YÏ(" ?00 #2>PVX c 0 ):60 0($0(>! 0!‚)a!!!0C00!YoÏ(" ?00 #2>[?G'PE@@Gp1#! +"Q 10,U#1 ?0 25:$20 #4"".<2Q D2 30 #1d0T\`"2? B4sppp0/SX0 is c 0"):60 0($0"(>)Q!!!0C"0Y_("Z0%R^PVXPo`v c 00#&: 600+$0+.P3& 1110Bh#`V:+"#2 >t3P0 PcRP@ U0#V B!a!b0CX0 c 0㳄$):60 0($0!(>@$ 0‚!!!0C0\$)YÏx4(" ?00 #2>0r/D B  1?A1c1c0R@ 0B05@ @ 502c,%2c2A@" "b1C S/  0@ p0\X%`;#吅  00u!ό#1 W?0|:5&  +4Ϡ! 5+111A V 1# 00! C2 ! 02">"`V0t&`000  @000TP@DP0S@ @0 @ 0$ Ѝ& vc 0 '):60 0($0'(>$!!!0C4'0Y)("0,".L<0@0P<0000' 0 P<0@0POT 0 @-M00@xP T 00t0(0Ѝ 00p0m m O-M00S 0 P $  @0P, `&/"b0"b!U 4J#.""_ ` +b P!"bA0S/x xk V ?%P P00 #1? 0B!P/ņZ0S< #ʟ"_``APP 0Sl/"p ?&Q!Q0037 >R'0  Z0S  `*` ϠϬq^Z R pS}$ $  WPE&@@$[i( V.i5:IPI%^ 3#adO0RS@HXEW``  p x@F@Fp pX%HpH@@H嬘@'Q_Y$AXO@P1:H.BXN xT3#dPPS@X0 p0HP@1S\p WPE 0": 600,0!,>00C|0Rh?#00 nC1( ၢᡍ $ 0R0`&^ `3`#`a P p WPE  Uʰ6 00c\S;Q$0(080p P`P@Lp40#XTv YV V0eQ#`? 00?0S 8@<V 80<8`<  05/PT `0Z\ QAX Q=T Q9P Q5L Q1 p0pS P Q% Q!S, Rgl0Sd Q 0 SJ1F P,Ppexp0S  BrI$00Ѝ#XTxt[ @8@<8 <0RwSR SR V@ 0vYV? `V8`S 0S >Sp@0GS|ЍS*S0S -S0 C Rp@0GSH`P [ 0S0ƒ! ⃑10hh "0Z OX1000\11001Z <Z!0`S0S >S@ HN<)`h0hlpt р*ZZ -Z00J S@0JS0  S ,S;SQHAL f ;S,Se SwH^(- Q 019mPhi`@019mo\@ `Ko`PhiR`@L 9 bp&k htl&ug> 00 0 0N\hP b0@0 @Z @ P 1 00R1 0BP00sP 0,S d0(0iP 0SHL Ʌ ah& `p& u&g.tl60$` ,p0촟섟`p $  $cR-:$cR 0#031d002c2c# b?0cZY  [  R`p K  @$LP 0 S 2J$`,p`0 380胟 0,`0p4 cP":cP0#031d002c2c3`?0cPpcs V P  P㞋# <38343,`01c00 S08 0՘30`0D004p<@p@ `,8@Z"28#!BcRf:"cRD 0#031d002c2c3ZTV @R  *`Ÿ Ysc Q,  \Gce Q!Q*R/ ! !c 0p?0  c@`(0X$ $ ( 1  1Z  Z0`Y,<@@ g>fΌ000`,<@t0 HR0C°1}`,p0 ȋlH )\(\ ף{dG P3`F A-PQ@E 0S ɀ001N  phh6l6~`S`P 0:S aP `VpFPPW N h=yP0T`VLPNLg@P`_p\oPpV"`P C A-`PA@pM yPPPWzPqpATU  P;UF QN p1p!0 t0`000V0 m``@ vI=D0C0C P S\@0d/@D  8@DPt00#  1PWPࣹ PN  h~U|,dP@P PP p 0 0p<tA 4v xx8S4@ t 0@-x$0$0!@R !ntt tPt @-\F ! L3/L2S @00P2S T? # 3T #0R00P0P@T@@P20CP2P2SU PU Ѝ\00P2S `@T 0400P2S| p P @  \ A-l!`h1 0M0100P0Q0S@P1 V9 T@p`0 80xq|qj8OT8@D@@@΀TA `pP1`LPPQ0@ 0 0 1 30ލp0p p0 P:xVT0T T0 Q0x2zT 0 ȴ  p- p\K- p0- 0 M Ѝ0 @ - -M00$  0 0 0 xЍЍ/ 0--M0 jЍЍ/0 0p@-@PXm`00CS`0p S  P X0` X PXmpXr`p 0\ \0 `00CS`0p S P X0 X /X SԱ 0-40- M,0  X ЍЍ/\ 0-8 -M0 00 XЍ Ѝ/ 0G-@SpP] 0S:X' (S" WH 4m0` V V,* lx0p0J0G0PQ`]yT000@00 `pp`50P/0`VpC0 00 m ?x0 0SJ 0 00l0 0 Q$w0 0 =wIsPX0X X0  w0 0Cl Is7) l*t) tldl<) v@  @Lj' j@-@P Ml 0#C@Ql0 0 ;{v0(' djp@-P`@r R T0U:T0T:p@gwJR ^@-Ep@-@QPJ 00!R ! 00! \ P 0B RQ`' Q0AP R 0 U00SpiP#iP `iP 0\0\ \0 Wv 00B808 80 <vx 00i\% hP&,% hA- R` P$@ R0 0,°0` 0  a0R00SH PA@\`20[ 1!pP  w0S<0[ 1!prP  w0S p w0SB0[ 1!pT w0S,0[ 1!pE[O[Mw0S0[ 1!p4 P>   w0S pT 0[ 1!p@@PZ@P"Z P PP 00B S01 00B 0B P$R w0S p% 0[ 1!p0 *R# 0B Q@ 00B SP i  w0S  p q  w0S op  ;  w0SV0[ 1!pw0S Rp 0[ 1!pw]0S0[ 1!pw0S0[ 1!p~wR0S0[ 1!pqw0S pw40S0[ 1!pXw0S0[ 1!pK pu pn pgs R  0 0pZ  [@ 1, pJ pC  w0S p6 0[ 1!p  w0S0[ 1!p I w 0S p J w0S0[ 1!p }pD vpp T  jp$ cp \pI Up)_ w0S0[ 1!p] w0S0[ 1!p , wy0S )p 0[ 1!poE w0S p$R_0@' p7 w60S py 0[ 1!p@w0Sj0[ 1!p3w0S pXw`0S pL@ wC0S p? 0[ 1!p  w0S p* 0[ 1!p p P  pC p pD |p P  0B Qc@ 0B 0B P$R= w' R 0Z0p @0[ 1!p P  P  P  P  P  P  P  P q0 S p 0[ 1@!m P u$R@00 P j P e} Pz `x Pu [s Pp Vn Pk Qi Pf Ld Pa G_ P\ BZ PW =U PR 8P PM 3K PH .F PC )A P> $< P9 7 P4 2 P/ -! 6"  P( & P# ! P w0S p 0[ 1!p P  P  P  P  P O-oMMD @/0P0? PL@0060 D0S 0P00!R !0s00d00 O 0SL   RR l $/0 0 D   ܰ00040, h0 \0 0G?@$匰H `00@T `%T @T0PFU~ 0pJ0(0QPPu pT 0P `@r01(0 `0 0EZS00PJdP3   R00s D0SR P=*X1RRsXOX`>pTQ`C.q0N@Q(8 0<D,TPDDlD PK`P `cP` `0@ 0@00300EpPqp00E S$U (pS1 U {UP [b000P$|0 040S 40倠0@0S 00 00ZZ +; 0 6 30  oލЍUY +;   0o@U`Q pQ@m@PrXT8@ 0P( PR00S<00儐0 BRQP 0G0^0X@DTg L 0 R`p0 1  ( PBU;S<0 0000$@T0S{ awaU` 0 P X0@ 10, S000SL0100 p | L0x00t0 `P x 0BH00?V0XH | r !Sv 40S 5v0P40 ,pt0S-0r0|080s P00 00$ . 0 R +0    h   d 0 R   0|@TL H  4 pC @s0<0\0 , R MRd  d`0!"0 , 0f 0dppG,Q0 `bSdp`F00dppG`pG,,0B<P-0  P0 St [000P kS0 [000P`r0Sg 0rQ00[0PK$LS [0P>$P400NS `Urxn`0P@p0X@T@8@@0S80Sp0pS@@X%n$p``@HX 0\`0S S[000PHX0 t0P0  .@  RZ ,0P 0P0 0  SL0, L0Ϡ 0Sq-0r00S P @,TX  쯟/s@  XP@@P@T 8pUT`ڐU@ PEI@D0Q 0T8 BXX ڐ0Q@0SXpApWWڌ 0p`P@JZ R Q Z PYJZ$@0P` pT 0^p0_S0 Z000P5$0S*0$Zc-$ @⌀JZX 0R@0 S bZ000P 0 UZ0P$u-=  0 h ,<   0hl`S0$3R ,0PV SL0,  !00L P, 0 P  0.S0 Z000P$0 _4`@X0T0@010\Myo\ { P8 @TX@ `""   . B Q/h;2#0/0 0 !.BϠ # *@ Qʯ P  A0F,FP# 8 `P QP Y <N8""P 8@N@8@ @ `N, BP(Q B JQ/P2#΂0/ 00,# $!L Q. ! A0  @8ϠBP!.u|)|9|  0t gx00CH0 S0]$0 ,, s 0< 0 <M,dp\ ,P`pG`, @0mj} ^G ,  r0RoP @W@  a R ,0PϠ? 000SQ8+U;b ^E ,0r 0SϠP SL000 ,pL0`p, @0@jM ^ ,  r0RP @0PSL , 0101,0@0pML ,0&    S ,S09$0+;% ^ ,0r 0SϠP `U0ڌf`0p@P0rXT8z\0S 8  B0S0S S0p\8 TX@_4`@@e`S0$0S  L000 ,pL000e`j S! |0s7 H00S0$051SF 000S00G00$B@ 00 ER0 nn"!  00Bh00?R0ST 0h Srp@p_4`X@T@8@PPX0P$ 80SpH0pS@0H00$0W000P W000P ^ 0, SrP  l PS,L10L , SL0, @@L0,p0^x 0S r`P @^a 0, SrpP ^{ 0S r` R! ,0P1 adR  ,Pw W000P *zW@000P !000 a` Q`&  .! FQ 0#e 0 M 60 c`39!\LW@000P S  L000 ,pL0005W000P L0 RrL0@ L0 R rL0B@ 010h0X@Tdp@pG,t4$ 0$ "  (1@030p 0-l-xl*) $%    t< x D,0 p|>S 1(0P`tp x0@ RppS 00C?@0^S$0bt@d@pp$p⌀@DT4 0Rp0 S  V000PK0 080w_4`@X0T0L000 L0qPSJ V000PB *!0  P@0 |@_?P P5eP 0p@B 0 @00L 0L ,pL0PL0L0 00rRL0X0 P[L0P00L0#bL0 00rRL00 PDPD#D3D 0L cx00CH0{XP8p\V`!6L0L26040e 0 0SL0,L0 00, H 8 BR@ d@`gU 0P$L0 RrL0nL0 RrL0/|$|4| D 0cSl , ,p1h > 00$ Rv ,P1^z ,0r`0S @I^j  ,R!r0k9^ ,0r`0S @1^;  ,R!r0<l@@L0PL0 >AL0PL0USk|@$0O,&,6, 8 0cL0 RrL0 dL0 RrL0L0 R rL0P @p &6  0bx B0?V0H  @ S,L0L0 00, 0D 0p 0S#L0 ( L0 L0PL0Ϡ&T 0P|@$4L0 RrL0L0 RrL0L0PL0L0 RrL0L0 RϠrL0 @dL0 RϠrL0W @W 0@00V0X0T0+0S* P,pP`00E SIpqp00A S$Q0!S- 10P`Sd 0 0C  S,L0L0 00, 0D 0pfS,L01` `0,, L00D 0pP 0SL0  L0 p,Pyꬔ@-` MHP@pW<0P000 PW ЍZ A-@P`pW0 PWO--@0pj/ 030P   O{(0:j0S 0Q0Q Q p 0S0$0G$&R00$0?0!**R8 0P000$02100@0S@(@P5 p0 0[0S0SU $G00S Y Y P  z0P0 4[4 0090 0pG04a^ pl0G040S @(@ 9U Z$01PP000 0009 0 00400@- M@P`6] p 4\UT 0S*P  $\@]p Ѝ @@\]p Ѝ$S ]T@p]@P :#46*0/Q /46*0/P@-@00 R@P@Rp@-P`0@0R@*0Pp@  R 0 R Vp@ !0@<0O- M@SX@DPa`101 02WYq`": 06  R0 R0 W *00S 00CX:X@D* R @  P  00S 0S W0*!1R 0CX:X@D* R @` Ѝ0- UM0,@P.0L10D[k {k{d 0 p      \\G; @-@-@-p@-`P@ TP 0FP R @P  [00pP P(0( (0 ?YPHhxp@-@P U`aPP  Zp0 0 :Yд(-M Ѝp@-@ P` !LNV !@Ap- M) ЍP/L -2M")2b3c1@2`1  0,ЍC0@-@PMP 0 00 0 Pp`Ѝ00 0 ;nYꄽ0p@-@Q r  P p0 S 1P p PP   ! FZ @0O-M`pDG@0D0Q0P+5X! @0S Sj @   b 0P16 P T@@  0  WT` ЍW Qz@ 0Q AX00@P00  j 0`00QB@`VRTQ`p0 0"!` b  V0 ZT@P@0Q=W 0000! @TQG 0P02@0~  000Z"000@000, @g 0Se0T0 2aPPlv"! 0#000 0 0 @ 0j`@Pp !R/0S 0C0/ 0RA-@P'`Bp1W@* R0C@C   XV X@p@p0 `f360@p1W@:b Q PPO-p -M0 S '0l0x0 0 Pt0-P000P00 00@ S0,0s `@ a`0`Ft@00@ STT!Ђ 0 B0SpЍ 0 S0 EP 00Sl 0 $@ < SW ?o240$ 0R0$0jTpg{p TGڬ5j0f1k5ZT 0 S 0SC %0dS{ 0|  pDpW 0Sp ,%W 1  @pPxK |0p0 pLW|0T |0 0p|0  A R8 ( QrpCW px Wpp\ws0p000,0( S|  800S(08000 0$ 00M `۟<0 﫟T˟ﻟ 0H0 0DS?<040 B 0S0$ L0D@] P  H ! !Xx0R P x   !Xp@|P PD0P 0 X$0<0 ( @pC0D$ U00XS Q0Y j00Q )Q 0Ѝ|<^0 n 2>0 00 R)AoᨂX 0v Q>0?0l1 c 0R:j O-M<0p 偺HJH:@`00S 000S 0P0S EA R[ % @E  \  P 0PS8 Z@@@Ѝ @0Q[V R 0 BPS10W ^@0D0CSڣ0SoP [ JT 0 TD\ @N Q T   @T 0CC10B1P0DS0 SE@TS@DTDX`  `R ߰ BP[10@0+S -S0 R: R800BA\ @@!~s 000AS0B[0bZE^ @d\ [ 0 S S80S 000 0 b@0P"00IZ@0E^0[ @T0 QL 0SP00S P3 4^E *@C $`P D21 `2 Q\` T00 00S@0T@DUQVD`b 21 8PE 8 @0T0 T1 T@00@0PS  Z PEP R, 0 R Q 00PS00= 0@0@E GP 0 C0 RZ@Rh@DU 0S{ S SUUv E Pq PP@"00ЍSn Sh S4 `Pb@00@0 00V@ !NT 0 PeS5 00@0saF PeP\  0 S S GO@"00ЍP?0PS- @ l@0 Ѝ80S@V 0S S S@80S000L080S80S  0h800c8080S `T0D  RP!@I0@0  B0 Q@[ 0Q S@߰ P[A1@0[80S@[- Z0b, E^  000@0E80S 0  BR "@w0@03880S P `Z ^  0`p"1P 50PS@ @   /A-`0P R#@pn3 ^P 0 W`00 p 0U@PEPT 0 BP `@ pVp  0 BP0U@98C-- M @KU0  B00C2S6cА*ZKE̐*kWzkG@{ Ѝ@-@0AC^ 0S R0A  S@-A *@\LLT D B @ M0"S1 1  !2R / 3RS/00 0 c R\0\0 a c R8080 A c R/<XtXHXA-@T0000bQ1 !0U2. n" p(  U2.0D10C#0R0! 0U U0D1 0CC!S R 0 P@-@M: Q @ 0R Q @ЍA-P$a$1`pM0S3 U10AT !0S 000ỳ ,@T  0S00 0Ѝ  @00D1S@000ᓳ0S 000ኳ xWl 0p@-@P0p R pPQ`00App@7D `k80 0QApp@_| x4VlU0  ,0#10/!Q#8Q#4  00/Q #2#01  //1A-`P@  1,0@Up00p 0S1pP@P#pP   ! Kk`gP081#3S412ss /"r3J / R//@-@P0@0O-0Z  @S MpP; PaU* F B  LK  ^ !*0I0C X00 ZP`V 060Y00ZP`T@T 06S @ ЍG-0䁟PpS%Q@Y A@iV'10SQ`P] 10i1000000S p1F @P4 P1 p@T `P@T10SfP@$ 000S 00@T 0C  pP@h0iV0S <0 ,0R0i QxQqly0PG-P`0b@Tᡢڃ0TP$ Zp  yJ p0  a !  \2)R0L`0C\0030 `-pG  \`#-0P!1^$23\ *G-`@0P@DT  !1QE*32\ H*@@P`Pp @q!P@0 0S 0S W 0G`WL3 PP`R@ H0 0S3# R0 B B  02NS cP 0 00P` A-@PQ`pE: 0` P0T @ *\ l1 0ET56 501 P56 +C0T `6<5#11<?@-`- M@P@P  46!z60:S W  0 C.G B 50c 0 Ѝ u0P c2# RW C>C0C01` Ѝ00S/0 R /@-p`aM@`PB L1P5PP3 (pP-0S  Q6 p 0: S/?P  8#80 @0 $ 0, ( 0 0ЍZJ00Ѝ<0T0T T0 EEHGJ00CJO00 @Lhjstp@-@P =00CS00 P=pP0 0 =HnsȲ@-@P 00CS00 @ 0  0 IGrnXp@-@PPD 0rS= wS+ aS3`0S  +S" e0C\S00S``p0S0S0S`0`SI 0 p` 0 0 >GPr(|q,p@-@P8 0S> S=P00 P! !' 0S 3/PP೼000P @ P R00 00L00`aa7=d0`` 0p=:P404 40 8VGXI 0P0kdp,@-@P 00!R !+P 0C 0 0 ;2G ko@-@P 0 0 S @}:0 0 ;Gjop@-@PQPP 100S3 0  US 4000S8 0"$0 3/0:0P6p00P @ P 00< R 800p=0PdL_%:P002;h h0h 0 JF 0 @0 0pH 000@00 Dn i-Ѝ/@-@^S S S  \0 @k @0 @khH00 0 @v6@000 0 0000/@P@- 0At @bH41Sx O-@ MM Q 5/0Q PP $d |@ h|0g'( $g* ph ` 0 Pp$   T`  8 X| lp`0 tP  !p$%d),P 8 $10-` (4 td8 T59ċ<= "< # &'(* (+p. x/`2 |h3P6 lX7: \; >, ȋ? $l` ̌+$a(!`+" 0 b"a +4k+b$! 8 ,` k"!$  Q 0pmP4Q 0pmP*Q 0pmP Q 0pmPPQ 0pmP YMߍFOFp,qMߍ/alQ@-P @41S  P mP0FA-4!@ pPP/1S 0L1冯 @P!GPPPUQMoPP oPQp :eW Fp_oRFpFppp@-@P PMpPA-@` P] VapPPQ V0E ( Q Q Q Q Q Q'  Ǡ   Ǡ  V Ǡ Ǡ Ǡ  V  FPDFPSSO-P M1 Sz$aVp$q q(SSp A`TR X`D ( Pʀ ರ[ `(q^ 0 @P A Ѝ C$oB/0S" (tr ₰^ Q `VH$8 S pVpGp@(VK ($ 1 AT$$(0 [ `(0 A^& S :0 ? @P~E@@,A \$Q(!r8 V(, T001000 aC([$;(~( Q 0 0 GC$`@$A a(T夰0 6C0P(1` 0 `sP\ [ px$S`РP``vv`O-,M R0  1 rp3/,0 (Q0 P{ @`P@P^$$P 0BZB  @PUpWW 0 `PS @R㲀K PUJ[Mp p,Ѝ 0 rPPu6  $`Hr$`P  0 h`P) @R㲀 BP  | P^ ^4 ^%  iP 0  lPp@ P`@@,Ѝ 0 l@ P@⁠Ằ[ PಐU 0I   iP(A DR 1V(Q0  rP 0@-@ 0! \ @!5D,/D00,1S@-@0 @  D00,1R@-@1  0@ D,D ,!O-`᜙0S ]M9 pPwᔫ@P Uq   @{ C0S 0  p/  ,p  8p4 0 1 DB@ }B P XP /V  PpW4p^ Z !3[@ @8([[@43>P3 0Ʉ  D H p $jP00 A G, <0(  QPVY[ ^P  0p pt 0~ V% 0S" A/ 1*$ <)$p++ *<(),<('4 '<.0<.,4,<0!4<!< 0!4<!$0 #<$!<($0!4<!(,!4<!,0!4<!400#<4!<840!4<!8<0#<<!< <08 8 8 4  4  | pp ̀ 4 (  ( $4 |($  p, p0 ,0p4$( ,, 0484 48 x< @ < +4  8| + ̂0 8/ 4/G?O00000 0000I.0%P00KPh0h h0d o=w?q尀  8<0b1DHT)@-`@MpPP  .00U' `P$ 0S r?(p0 f# 2 pЍ .Ѝ .pЍ!?00p 2/QA-@M .$4,.,80!<004.T"48<08#80CSP!4< Ġ!l 4 ̌8 0<04 80<"04"80< 0*0(S"( SR~  B("(p`p0#$ 0F0VP   =0  '  P        P  0  V/0 0 0 0 0   0 0  0  0  00   0ЍR 0B8#8P P0#0BR0``      UЍ<0< <0 b< 0(0S"( S8(C4 2/QA-@6 10CSP* 8 R#8 RZ ,$ 4,,,80 71ᰑ0I⩐1Y ): 0 b,71,0@1S 0 @0( +(@P 10CS08#8:5%0 b6 @崒 @P С0 00(0 00(0`r?@帑 H=p 2  @T  (P 0 p@D 0S? 2  1i( '@P3 XT X2 XP (0X@ R(TA  '@P 10CS㣀*0H) @崒0S 0S 0 =@T @崒(0NXR, @崂 1( '@P 0XS X0H (@(0.10C S)ᣠ;* 8#8YX>  'X e'@P  ' ' @I ) ⴒ9긑0 (0 @崒2H)X) @: 0 b!6 @ 2 " 0 b6, @崒 8#8Y4 X0H 1' '@Pt 1ᴐX0C S㣰):1!0 b51ᴐቐ  10@! ' &@PN  60C 0) / 0H))01!0@崐 ^' &@P( 10CS㣀:t0t t0 b5\0\ \0 b51q0q0ox/o(l+8lk4+kdj*pj@j)Pjp@-@`PP [0 00(0`00Q(0pO-p@D&`@6 0LMPP0D00  '00 2eV  ]700%5 0 D0 30jLЍ0w R*R* p 0<0<0 0@0$0760 0S PVk 1S6  ;&P䑄/  0尡0 0!00 BR{?ⰰ0弰:1S 0[S P 0弐ᰰ00 00S !& @ P 0崐V` S0! 10CS,*0 P 20 2p(i g0w Qv %`P] 0 p N&P BR㢰* 8#8Y* C00C H1! 0C8 !#(!!#Ȇ 040/(0  0RL 1S RR  RYG   & 20 2 JZ㪠r* *J [f P`N0V㰐0`0 2 f Sc % ~p 0 0S0,004000000(p(01 S0"1! {0!10CSP"*8#80C S 0!{/Ⱀ10 0 b4]0 )ἐᰐ0`0500\0\ \0 b3D0D D0 b3넨  c#c|c8#cXc#hcO-(0Mp O @aP0fl0PP P FP i*1X J%8(Z"(1a@%X0  Q1R@@10CS㣰Q* 0K8#8S0C8#80 V !S10C1(0  0R/ Ѝ @Q! R b0 `(0p+  0   PT p 0 0 p1 S0C1ȁ434#40 bA3T? Y4 0I 1pP(00(0V QPEUP*0EY*0 p1Pv YQFQPEUP*X%XPEY Vp崑 (00(0;10CS0I*S @```0 `p崑$P Q $PP  @PAP_(00 (0}$ 1  1 #PPl 1P0CS㣠>*0J 1fP(00  ^$0 0 b20 1pNP(00(00 X%X0 bPE2 UnQPEUP:x0x x0 b2s`0` `0 b2  $j` `^T^0^@^]^]]p@-@PQQp x#P 00 #Q k#P 0 0#ppO-P,a V0Fo 1S#@P" `Vp0ഀ0  px 10CS08#8*S0SX PiP 1!0 b 2  H 1 Fp(8V㴠(!p1  0 S001Rpp10CS㣰8*0K8#8S  C("( 0 S81#810W10C1 q# R ZP 0!10! 0  P W# Q#(0( (0 b1[\XZ hZO-pP$M0@S  5#00 2T T 300$Ѝ(  @i 0⬷嬧07 0 0  `P`  R ^8#8Y *P0 Pg1 "0C @fT㴐:b 0 G1Aᴐ@DT@* 0H$H @DS0COo0B 0 Zp@ 0S0C@0  P 10CS0T*8#8SXP@ )"pP 10CS0*8#8SI 1 (10CS0@ *8#8S$P "h "cTx*H$HT|PX 20 2$Ѝ050%00 b0T n"5%0 b0 a"T` Y"0 0 P'  0SF ㄔ @`S= 0 0S ;"q, W@  @@DV M ,"q Wv 0G 1!P A`W@DT@:#0 bn03#0 be0 " " s!pPR Pr D3D#D0 bG00(3(#(0 b=08@W1@H $H @01` 1 0@1@`01! X 00 0UXS 00 I;w0. T:+[) P0K/S  000P0: S 0000S0I S0?00(1(!(0 ?.QP PV# 4- ep!00SY  \0 RK Y  P000W ᦶp x᥶P 0@om Gl  OR Q0P:Q0Q:/@-m@-@@Ꮦ $ @ h; p@-@P#+P$ } p@Zp: d0@-0 M @ 0  @多P 0S  ЍX Ph: O-dM@\0P T 08/ \$2/\p @p,/\0  (0&/\` D` /\ ,/\ 0/ \@H@/\ 4/ \8/\ <.  \PLP. ( \40 0 ` `0< ,@8p$0P` "  0#0b0 P%a8 p'egH` ,. alngx+b(*`gLb0l$`&0feX)c8(n, e cl fj!쬊̉b,,g|*gbH  ,l*錈e\(l$gx" fe!c<+b(*cig eX(enl*c8+bL i!c fj$ n Yc H$H0D04$00 00 @p`0 0$PY P P0ES(0001P0PP0Yo0V 0@  `PhU&hj*P 0H$HS0SZ 000pxV'x:@@T$P*8#8!01(0  0R 1 S0"8!#8!1!V 0 0C0 1őYP0P 0Ӂ0C00< V*0S 0P0sP@ V@ HB$HQ01Y00 0(0"(Sm*0Vj YPU:|2| 0'01 P0P PP  j01P0 PP 0`TP   Ƞ,Ƞ` @ h0&h@HV$H@TN*8#8 Y !08#808 #81,Ѝ   Ƞ,Ƞ   Ƞ,ȠpGx'x@@T$P=: 0  0%'30 0  0' 0 0b't t0t  0'`0pY0 1301/100h/l1C-Mp`E@P' @PP"  0   Ƞ  ,Ƞ 0 !! 0 04000000 ^@PЍЍO-M@ 8pPPO 0 0 رR 00㲱 1 1`0CS㣰H* 8#8V: ر 2`PH 00 0000000Q0㲱1 P 0 0<0 00 !n'V=@PЍ6Ѝ000100@P4 404 0bE& h,,O-`0\MS0:℀p3< @0‐P(0$  n@T XN*1 #0C8 #  b#Ȅ 0  0 0<S@@ a,^p  8008 00,0F 1Pd `V 0`h0 &h0CcS00 p㰑1 0CS'*0$ S 00(0pP `VP 00 0 00CS001!R p0p  0  00#0VS00 0 IY㩐* )ቐ 0 0 0 LTPH0PH2/ 00W p0 01p0 pp ,0!0 B(S"8110  p"      0<00@pS- 0S 2  0 M   a0S @ L3@ 00 , 0 S<@p    \Ѝ3<S00 01040封HX㨀 *004 1pCx0'x(0qqᰁpHX㨀*0(03<S00 01040封H⨀X(*X 0 08#8S:00H4 (0 岁ᴁqpGpWx'x*W 0 08#8S:00T#(@\ IY㩐i* 8#8V * ("( B``F H 1`01001p@  . *@ $  Z`V<@p "   p    Dh%D xP 0 0 0각HX㨀r*(ሀ10406각HX㨀\*(ሀ1040R!1 0b3$ 2  03 +';@N00t!t1t 0b$X!X1X 0b $*X1X!X0 bq";  91!0 b_"0PK{0) 1 0p1pP01 c0P@D1H $H @U0PE10Z!08#80 !P" !\ l<L@HXR0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/000/h @-@P , "@ (" 0"2O-$M p0P`  (@$\0 0 p 0p pP`@ "l(,"$l$" %  0f  X Ơ d,  .d, 0! \ p p P`@ 0 !b!!    !`.  . "  @X!)!   $Ơ c,c,.    000 00 0 0 00 000000 00$Ѝ 0G-1?p@P` @g(X, " 0P0 0$0@`F0($0`2#?V@F?p@pp& 0$ <@P U 0$ ?@PP?`V (! 0$ a0 0$ ?V@F?@(p@ ! 0$ <@P U 0$ ?`@?V PC-@P MP) $ap6?`V&7 )i!`0(0 `!W``Āapa8!#4a4# 0!Y@h  ЍCF! 08R(@R )@ b9!(`8 1!)8 b+!(`R @-G/ @-@-@P 0 ^!@ (! 0"R @-(/r @-@-@P 4@ >! P 0$$d O-LM( 6,p0`00( 4^_~?<$P,< @$ 0H@0@8`8@40P`pp  00$(0 P00p`$P`p,0 4 e0%)'&ɠnj)000000%  &') "ˠČ ˠČ "  (0 00#0')  ,  ! 0 0 Ϡ' . (̠Ì  ! $ $ ,  ,  ,0 T(03`0~?008`@P p480   @0  @$ 0p0 01!  Q!声#$ ,኿+* / 3< ( +1牑 0媃(३1p>ဦ*1砹 1ᅶ>%S 0#] P% #$7$ ᇑ90#  ..YW([T0#P P[T(P  P%0P P P%P 0!(pP00,p/!~,! rp', /!!0 (,#p'\ )S  $( "P p P% p PP%4pP8p p0 4PR8 P(,P]<` 000 0 00 0 0 000 000 00000 00 0$0P(0$P0(0,000,0008 400 408 <0 0<0LЍp@-@@DQPU  0pRPQp bDPPo Q>P0P0H @ ~p@FR Q b(PP;p  @0G-1p@P` gPX? [@0D 0 #@0D  H00H0L00L0`FP`P6VFppp@0D ;  SP@0D *H0L 0 H0L UPP`V P@0D a0 #@0D H0L 0 H0L VF Pp @0D ;  SP@0D *H0L 0 H0L U`‐V PR @-t/G-@PM ,PH8 I `p ` U@ vЍ@-@P 4@  Pg 0$$DR @-</nG-@PM PH(  `p ` U@ =Ѝ 0` a!, a c,/0@-M0<P0 P9 8@0;P4zP DP7E@05P'7P %ڰ7P 0P0@ 00v P0H 叉p Hߍ0300ߍ0?CP 0P@  @0H dp HP ߍ0D0@ 00 P EDCB5P0@ PH A50pH<,+*)(&}% @RPA@  0@ 00PVp\XGbF^P0@ 00P' 60@ 00P (0@ 00P "H-P H#P 0@ 00DP 0@ 004Pv 0@ 00&P      d0/00 0H p h0  00 0H pt D ?m kige c=@00S,[X_0@ 00P6 E|0@ 00P( 7\L D p0|<  iО[{G-8M(`pP {{?R@W@V@U@T4 0S !Q4 0S3 Q!-VM W0`c U pq P\L 0 020  @ 8Ѝ0S[  Qq {0 0h2{`" P0x ! ("(R  #m:VW$ Upm P`10   0 0UU0  P R& U  Pl\ P0 0VvW0 UpM 1 P0  `  | y00 Rx000 ̆P0SQ 0Sx Ya @`U] PS`0P0  S D  ȝ ( |` 0 P0  7p@-I0@T 03/@T 0PP 00@T 03/@T\-p H00@T 03/@T$ p H L  @-M@@P Ѝ{ 0 { Gp P000 00 A4H-M 0ЍO-@Rp M ഁУP  `C80 S" 0SL: f0  0Z 0"80S8  0Q@0 P 00 Ѝ 2  Z  00  00 0 P 00  |P00 2  cP   \P  000 0@-P RM@PQ    s/ r? DP 1013/Ѝ00 0@-P U1!^ 0C B^ \ L0D0p@-0P`U1!^ 0F BS @\ `fpUpC- MP @`( ``0pV!ؑI@ T`1 `! @D z T@ p PP Ѝ ЍỂpP p`O-Mq  PpG  0O PU @P U`1`!  E[  0PU0 , ЍЍ@- M` @ } P 0 q@pG @DP @PPW : Ѝ Ѝ ^P/0@ 0A0SO*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R*0@/p@-@Pp00Sp8PUp4002U!*4080`P2U:080pO-@R"2 0|M`P0t00] 00S80S p`"X2 0 t0 30|Ѝ4P  cP8~ 01 0#\ $`0P  8 0 0 Xp; P&8Z> !10! ` 04 4^ 08P  R8P84P@P`0XP:A@8n 0801248 Q:0 S P8YP8P 8 ` 0ȂpP 8l00hP8;dP8m`00ph=. t. @l O-M$ ) 09 @,0@020D2(0S} pWw 0H"4SnSl90Wo 400l0h00~0P . Sd e  S h` I dPP& EX 0 *0h0 0 00@0S000 R!@Q  :SY 0S c/d Z c/V0 0U X@  0 S  0S$ R000H2S708 R400W 4p\ p0r4040p0h눐4`0,~ 0 ` pA 0PW:: w` 77's07_U04PP8 W00S  0 \' YPPU PEWY0– 2\8 Q(( Q :PS 0 SR7@T 00$0S  J00@8Q 4Y  [` TpJ 0S8 0 5 RP 0到SqT2 c/00< SG 0 SR@T 00$0S ,0S ! $0(0S (0@Tp 9 0到S c/d g R   P 0 SRPU 00$0S  ?00 0 SR@T p00$ R 00"00#3 0 2 30ߍc/d &  p 8Qc 0 SR@T C00$0S  00@Jc/d@0h@ .rX *2 `0 R(S Uᅀ00*PHY`l2 08`0p4p:Trp/5p\0 S ((Wࠓࠃ\^` `0\\440 0 8 8 \R \P0` @ eP 0 SR@TF h00A@ @ h3`|(0PP `  8@P@@ ` W x@  0 SR @T 00$0S  @ 껹 +  8 @ % A-P`@M@`@`p{000,00(0 00aP{Ѝ 0 ! ƒC1p@-S@P  0P ! "0 2pp@p@-@P` VP(p0-P@  P 0S RP0/P*0    PP0/0/R00 B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/(!(1@- 0MQ020# 0S0* /!PR*  R @ 1@0Q R Q*Q  Rh `0 0 2 30ߍ@ 40 0 2 30ߍ@8 AP  ` /O-p?o2P00#R00,MSP NWC  00$00 R 0   00SW 0SS0嘣#f 0 00@C(S0 #@P!  7/ P7/P_ 0S 0 00P`cPU0? E B R Q @F"`B`FV`!V Y*0SE* Sb:P 0C|0 0000S0  Rᘣ#R0@@ 0 P   P7/ 0P 0@  ` @U* 7/PX X 0 0R0X 00  0 @0# 0P0 0 XP  SX0 00Pd" Q0P0 S*S: X  QX E ^ @F"`B`FV`!V C  B+7/P  7/Pz 0 S 0SS0#! 0 R 0S0壀S0嘣# 0 0 X Bv`S 0P1  0 07/` P 7/P0H 07/` Px7/Pڅ0`DP 7/ P^7/P 7/P^P$0@ " Q0 C  7/P @0@0Sz,Ѝ! ^ @F"`B`FV`!V  B&a`V P 0  %P 0 C07/PL 7/PPD7/P 7/P~7/Pl  7/P d0@S@8 & 7/Pe  7/PN0 0@0哤$ T P@`c⃰ @Z}* @  Tt@ 7/PlU U   0 Y00 #0Q0 @0@ @0 m(0( (0 lT\t- M0 00 Ѝ(R Q0P:Q0Q:z@-麵 4A-SMP@  $3/dp0 6 QP0 0w4P4S  $3/000Ѝ00A-pd 4V:@T@T 0P0 S  00 S  0y@P0`0dp@A A-`M ps@P0: SxxPP ˅P@ P 0 tdЍA00PЍ( $$4/p@-P$0r0" @`Pp$U04 0B0   0R 1  00 0p 0% 0At 0 0@-SN  00AS 0y4O-S M|@Ap⇁0PS`*0S'  TP [ P0 00! Q    0     Ѝ P@ 0  QP30 0v$R P1)H000000S@p 0 q 0p4 S   $3/ Ѝ k00 Ѝe00aO000Q 000A/0@-S@  R   0 y0Syp@-P@T @T 0 `pp@TʔP`p  0S S/P/$(0#   @// / ////@-@ RM`P:Q !S@Ѝ0 0p P Gm @ЍT000@00O-PP X 0S L K 0SH p@ap-[0T B,B R`  0S7*V5* 000&P<0@D0CS0 T0@p@pT  T 1 !,03/P00CS@D0/PQQ    D R !,0 3/`Pʼ@00 "R(  0 T`1 `!0PVQlRO,0 3/`PY R 00CS@D0 T@0Tp   P @V`! 0 0C 0   BR @pZT `@ 0`V:v0P 00``F0``G  0Y0C00 00oP   0 0C 0 ` 000YP nd0d d0 G XH0H H0 H 00Z 00V8čp@-PP& 0 `V @@D00T`0@T` ,0 3/Pʼ0@00pD0Spp@/0 0 Vr 0p@-@P0 )0 P*p_ 0P0, @t rPtpl R0  R/ S/p@-@P QP; 100S" 0  R 0   p/  0R00  0 0c 0p0 P @P v0 0 $0 ,0, ,0 < p D ~ @-PP0qMp`@* V2 T: p   P0 :CoR  S L 0( 0R  ; 0 Ѝ;0t0t t0  VX0X X0  T<0< <0  T |܉8<$"2 @-@PR0lM0d00P= 0 C 00  l"`2 0 d0 30lЍ ~0`0S' ps0PR " WP00_0pS p ?PP000!1 0 |: 0S!$p @!PC \10F LL10/R 0 p8{ 0 0{4{{ 0SP ` 000p p00` pp| |0| 0 `WPǰ  ,{d|І$dp@-@0MPr00TasV( s0T1S O)s0T1Ss0`s00 UTX!\!R Ѝp@r\!s00Ѝp@r00UX\! X\!0 000S/ x0 0p@- PUp@0r00TQs0`U TQUP |rpX1P0X1ws0T0`X1 xh0h 0 R/@-@0ar0 X10CSX1 @XrOT1r0 @Qr$ x0 000S/g x0 0 R/p@-@0P8rU00 \AQ\ X! BRX! p@(r`?s00OT!r00p@r x\ \0 -4M0 0,008 00 0 ,0 304Ѝ֯  p@-@QP  (p@ 0 0 9 t,@8{HO-M8@@ 00DA B QR cp `> S0T3 W  0p|| p 0`@> p PPL1L!L0 ?I0p 0>00D,00XS W#0p 0 000XS W pp p 0A0C0B QSWpP pf0p 0> 0W 0@ p p0@ p 4333333hhx00M 00Ѝ @-M0 | @  JP 8 ,0 0 0 30Ѝ譬c9\  0< S0 0 /@- Tv0 S 0,/00@- vH0 S8 0 / 00@- u0 S 0,/00@-huH0 S8 0  / 00(@-px u0 S 0, /000@-\tH0 S8 0 / 00<@-G pt0 S 0,/00D@-3 tH0 S8 0 / 00P@-0 s0 S 0,/00X@- |sH0 S8 0 / 00d@- (s0 S 0,/00l@-rH0 S8 0 / 00x@- r0 S 0,/00@-4rH0 S8 0  / 00@-D q0 S 0, /00@-qH0 S8 0 / 00@-z 07Qm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ / 0@-@P  000@ / RC/A 0\R#R! R/ 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/0///Q R Q/U/Q0 R Q/00/Q- S 0S  P0 000S00@-Q @P' TS0 C0 ^@DP \T^0L Q^ PPP 00QPS @R S Q0 S00  / 00/U/S 00R0Q0 / 0U0/Q0@-" S$ @P0C S@ PP QP @\ 0@0@UP0@0@-Q @P ST Q@DP  ST PUPQ P00S@Q RU // Q#/  //s R PS  00/ 00/U/ 00/SR  Q 0/ 0U0/ 00/0/R  -/p@-@RP` R V  U  R 0 p0 0 xa`gQRp@-`@P 0S0 000 000S0 0p 0   0fHR S 0Q0 0S00/ 00/0 // Q#/Q- S$ PQ PP0C S00UPP-Q S0S P 0000S00 @-M0| @00000ee00_ a4 ,0 0 0 30Ѝ  -BM MRč dd  X @   Pテ2  h ԣHУt0@- @-`x@t"pr M Mp $( PrN TG <<"  P,",R @$@ P`0 t!1 0 $8 30jލ ЍBn!` @0p [ +0 xB^P.`!0 lL100@A@ 0 0 0 P \ AL+\ \^  \\\\\D1  G  Tb6 Ȃ,b( 0 J0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A @@-00M>R@ 0 000P001 200 :P0ЍM00,,0@@- 0M@>S   "0!,03,0 P0Ѝ)00@-@G@G0 00/( 8(0(0-M 0 0<Ѝ -- M0 0 ЍЍ/4 40 00S 0M00Ѝ/ x@-@p@-0@ ,pZpP_0Pp\*H*//////D{ //1O-0p,MWP`  m1 0  0 (05/,Ѝ=@PM 0S XXX S0 S0S3*0! 00S S( S000S  0S S * RpC 0QW 0020 0 0 0 00t0t t0 R0X0X X0 H@++(+$+**p*\*H*@ZܘlZ//O-M,0< 00000P0Q0S Y [ 00< 0 0 0<00$00%SSppSL  `0p HZR X 9 ,0 `P,@0  S     Q  R0 [ ʄPU* R [ Ԅ ʄ`V* 0BS0C [ ʄ0S*0 H0 H R :  c  \ rSh{- R@0%%%!:0Z0Ņ`% 0C RZ%ȅP  dV0  d/*00  D@D` prpo@pl0  , 0r *X] 0 H R 0^0100 H R? T|P @ T S 00 P  BS0  cP`C 0H p2 $P p x SPS#P@ p`0)  0P  Q C Z'* 0[ʅ Q   BR B0 [ʄ R* 0M F   0lX pp|      Sp+\{$0S P@`0 0P  Q Z 5 4p ~,   S@ 0  d0R\ @RC0?T0SPA`B  0`Sf       +  o P hpe R  _{\ z,  |U P ys   S ǣp@! ""d    S       R-0 P0000pEP`@00  BR B R) R. Z  04P4PP 0n  BR B  [ʄ R* R\ [ R   RR R f        BR B80`P@000 Z0J0@#3 0 0 30Ѝ     |@   , 0  D @A [  y 0 R*' `  0P`@ 4R PP  6 @. + @( "(z  "@ (B(pp-\A@@ !  p   Ps 0 0Y 0 0@    0 ? pT0  0<ڟpHt lZ\ZdYPS4 OyNdNSlA-P@@ x0`pP@PU J0S 8/`PEuX@pW$0$ $0 :( |l4Mt 0SS S  0R @-o/ 0R0@o/O-p$! 1 CM0 M@`0440PP  0 0 44 30+Cލ Ѝ 000 0@0`0 @vP eft0 0@\\P+ c 0}c/- ȸ 0dAG-`0S+ S'QU$ pW!@0 S00#S0S 0S0S0S& P# YP@ Q@ 0S1S00#S0S S Q O-0BMMHtQ!t3 xؐ'x P`0 pW' 0 ZP@P UZZ0[P6PH <0 0 4 30BލЍꋞd  O-T!P1 AM0 @ MT0406 0Y3:0px0(S`: 0 T#T4"4X8%X#8U!U@T Z Z 0 xP PU p 0 YPL @0 0 4 30Aލ Ѝ0x0(S.0  O-M Mtp /? 00060 [  !R & R2 ` 0  0 ?H@X@0 p 0t   0 H  . R< R30u P`【 @R ?P p ᰐ)P R!RC*P `XP00S  00 0[@u P```0SP 0S 00 9 S  R,ڀ= 0L0t=0T0<0d0p0P0 0 8S_040v?D00@0\4 ` 0S1S @ 300S S00X01@ 021帡ZS0H0tSp0<0400SmATj @0CPi D0PPPyg 0;T<@  ᦝP~ W@U0PPP r @0 40@ 040D00D0 0S\  R _ H0S/80S 3<00p  R  H p{*pt`P|@60P 0@:/P : |+; 0 6 30`ݍ ЍY 4@PD0Py !~D0P0 y  0 ; X0l D0~4000SQ0X0R@0`S\0c  :`@pV  `G00`P?E0$0 ` ;0(,000 0,000F000 0'}PP2 UD(0 0R0O `1  0 9L0X0 80Z80   080Q$0 0 0 SOb0!刐?A9c!@00|P \0S X@V0P Pc0( 0@G , 8080PE Q!   (< 0 0 PdR`1  0 7T0X0 800 00  1 012 080<`0  0|P' 0 P`  `1 p 0 70X0 80^000 M 00h6X P^0&0@ @ X~S1 00a 0$0V0I@0 ] 0(0T0 `@vPQP  2Š[0000Q` ]0 0 v(0 01$000Pt 0 \5@X0 |080HP' |P!0D i@g0P ab0t$t 0@X~0 v (0d0080Jb0 $  0h@A~0S0(0ʡ40+S .0CS-, P)0@$@ F @0PpP AQPRs 1 `1S 0    R # 0H080x|P8R4`!!! Q0   30 @| X0Q 0H R5 3  qW hRP*`|@p t0@7/P`V q0 T2@X0 0`!02 @X}US0 \01S@ 3`0`00S S000`P1J `0 n|P0 `0#{P101<0@PD VhP p0< 00 z<00P00P 㸠D7ꬳ $B 8C$~}} |{P{hzz z9xyxt4t8ttxstrrrqtr`rdplppooo0oXo0no TP B("(R D zP0d0P0@ @ ,d06SV %`i V6Spo06("(H0 D0P TP B("(R D pzP0d0@0P `0! 0p@|w0S\ 0RT 0`1 e 0 10XP0 &0R  S `0T"T 0,@|0 D2 X@0&0R  y PD H0St}=00Xx`0" 0o|a0|p q6 G(0"(0R D0 P T B("(R D  R,#yPʇM0 P i@0 0x{P`P Y1011S1 '000 4D0X0 $0 D4h@X@0" &0R  <0d0d000 4 X00000Z0+S .0CSX@0P _0<%< 08@{0+ (0d00d0@0Ps _0% 0@{f0d000`0  [ꊘ0 6 @X{_44&4 00 {l P0@c _& 00 ~{V/ /MM  00   ( R1#0e(6,Ѝ0/ɚ;M- 00S  R B 0S N 0Ѝ/ʚ;M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@yP$Ѝ0 yP0͡"c1010$Ѝ00@-$MP@yP$Ѝ0 yP0͡"c1010$Ѝ0MM {2aЍ{/M- $ <{LaЍ{/MbO-,#(3 0CMM0,401S03Xd0P@,p 0$P0000 0 y 0p q P;QP0p\400J PI0D0< !7 S000 $\40 ;0 P 0000 ; PP` P0. dS x`10,430OCލЍS  PS 0S0Q4 Q. Q( ;S  d  ^ , 4.48#804"4 $,$8(#8"(`_ySS S 9m$@ @ tk|k8kPC-PH AMM 04@`p" R3 .y 0@ `x P,8ĝ0  0 0 4 30!AލЍRd PP 0@ .R` @@L xD D xRꄖ뀖 j 5iiO-!1 AM⠑0M  0 40PsxpPLpPG `yPPB @ t+0+:P7 0S4 `  0S+ 00@ p-P00@S 0S0S 00@ K@ @ mZ @眨 ᘨD ,0 0 4 30AލЍ  \i! O-p#3 0CMM`0,40PX\@@R0Sa  .S@0SVJ:TX d10T*0 ` D DR\ 0$00 0@@0S .S 0P0=S 1S St Su @0T$0[0 Pz8"02 0 ,4 30CލЍ0R.ST@ 0 @1( PPd!  T00000 00P00S !  @D DR0$0 0s< |Q80 uP0 1 00S|z0000   Rl@00S}0000 v 0s0S0S BQv=Q$  O-p0\M 3@0`PiT V   U @  4 400#à #4:W 0 P 0FSX0 0 F 0NPP0x 'x QQ0SUPPⴠn   B RX00 0 B-PP PPP PHPUT7L!0} 0  v0 `F 0S0   P P P0 P0S   <PHUT0XU d0d d0 q\Ѝ<P0\ЍPHUTT H bha$ |aC-@0 M(p`P0@D T@B)pP0X hP0 ' ^P [P @4"40(4"< U @DT R0  Ѝ\WP P0P L0  Ѝ0F@P`_``G- p崒Ḃ@P`. F0S@`A0WV!= P@P,@ 0G`D?o2V0S ?V0*G `DO0?U0S dX X0X T0 < <0< 8 0` _T^^A(^t^=(0`( "4`43Z1S//0O-䡐 MP0S5 DdDtD`p @ S S0  P&  P0 PI  P00^ 0  SR 0  SRS Ѝ d1 0P0d1 Hu 0P u  LP  EP060 0P iu -P  &P090\ Qu000<Jui0:0   P  P090090| P010r  P020h  0P0Z^ d@f?P 1? # V 0 2M$ 0P0ZC @K?P 1? # V 0 (32 P+ @ P010  P010t^^^T/T^t]\]]<.\-]\\\\,,(\[d[T[0[@-@HMtxutd {  |#0 %   { 0 0xtxHЍp@-MAT t P002 ``,00 0%WP``UW@0S1 S qP l P;O-_M M0*0: 0@P050\M0UU: 0S`p-, d!0  d!5. 0`1q1110TPP{  0πʏ yp d10 d1 zP% `P 5U`0SH _DPL p\ S S00 PpP0S SR#3:0 0CQS0 0CQS000008sP ~?0}o80 0p+0z4P 1#S;S 0x(S# 0l(So 0`(S> 0T(S 0H(S0 88R00sS1 S S0 ( 7R1 S S0S00 S S SS@@ `0 T_A00P@0Q"0A'A+S? P7R1 S S 00R00S 0P0 S S00 @@0S S p50@ @@@@@00@00806uO0 '0G CPd4P R`P 0$4P 0R@l@L0d!S 0 0 2d1p Qp @|b1 |rp x0ό`0S W`0`SHPDHp .Sp0SWP`.pGWV 009P $ +0$00t4 0 5 30_ލ Ѝ4 Rq W W Z|$| 0$00  (,`` V V` VV00;V0SJ`V 4 @0p ;V  00@`V  QPP 0 0P 8 Q$h!AP ``V;V d#0 00@`V;V  0 0P 8 Zl`(,`| 2R1 S S0Sq00 S S SS@@f `P YS _AH P@`0DPS \ S S00 QP0S R:0 SQ 0 SQ000004;}_cP.P `S!0x3!|3p dDPDQ La`%qQ4`- hP 8 Qh!- qPC-k`P@9pZ2  J Pꆎ8 ( 6UpU/ h domasearnamesortoption4Tin3erRXPPy list  chLML p@- 1hP@lHMP ^  T 000HЍpp Qx#r cxpV p !X0x0 0pPT $000HЍpA-P RP@0p`  R  @P  R0`\ R 0 0O-0PQM@0 X4X0q0P 0 pP0P0 (P0$   @  :P mPY& RP  0 !#Y㴰pGj 0`P `P gmP ` R YP@Z`V% 0 0 pG`Q P* $@P@  a Q `U pG #Y 7[  0 ZR00`Qߍ P $@0` `FQ*$ @1!0 bZ  Ÿ ` 0 Q0 :0 AQ1 :@ACp㴐R F pZ@Dp p$ Y  2U @D ) (  ( @DpW  Z   qY  0  Q0 0 0 ~ 0 00Qw W 0 pT$ 0T0G@0@ 0@-@P @c1 0 0o\n  (0( 0@-@P/00n 00/T @-@P @=100o  @-@P00p@-@PP  P 0  p 0  0 |,Dp@-@PMP. `0 0oPP0 UP o9P̞ 0  ЍpĞЍp 0  Ѝp( (0( $0$ M8 (C@-`PtA M@J h!h1 dQ0 Pp 0 RpGS< ` Rp> ЍA@kP 0kP 0S@ @R kP  A0:S Ѝ   0.S Ѝh0h h0 PP P k D&B4%B\B%4BAAhB$$B0A-0PU" 0U"0PUP!q@@``FOP $OP 0!E`1$(`P 02~P@''O- Ff@0S M`, 0 4 xxFxV$ @P(0R8 H601vW00g(1<06 B0R 5 0(< 앟ş 1 c0@8'0p(4< 0P(0 P| tup40Sg0S X 4 0SnX6S 8% 4 0S$up00S S 504 RU 4 ,00,000S4 0ğ0  ( YA4*0210S P10q S^ X40( L40 0Sp 04041%40(8(UiP0440^ 30( p ЍqR 0Q*# 043!0(08Q(%40%1Ru4#!$30<)!^ ^ ćrp S:p 0(" <!0(0% P^4)20( t2 0(< `2 0(< L2 0(< 82 0(< $2 0(0 2 0  8 ( 0 0(0(1 0( 꼑 (0(10(0 R 00! 0x1x0 0 d10Pp (4p ЍBp N=p 0y^4nqp2  Z 00K -Qp i < \?\4HPL  |dL(D ;:(:41O-0 MX B*1a001Q0,`P0 ^/^_?+~ 0 0@S@ 00T 00}O R :R,000P R 0Y $00 Ѝ@ (0(0 @-il@ip` 0T2A-@@`V 0 CQPqJMP pG PLP 00`7@-@00 R \\  !$00D0 0@ ($ T@-@PL  0S  T0S@MM@M\P/0d 00 0Q,0/01P/0(00$ 0/p@-@P`L  0PS(  1T  0 $000`pdp@-`0P8K@P  P3KP 00p05 A- 0@S  P p00   ($ 8P P(p`P0ꬿ|<+O- ,0嘻S 4Mt 0 +倫   /+~ ` PL+ @08{8[pP^/^_ @   Z@ }@Q0 :Q , @T  :R^@Z x:0 lZl:P0d0<0` 0 `@ P 00 H4  S   !$R; PSl00Q0,090( RC 900 RB ) 0S  !R 0 0($ j`Io@(p` 0!090 4 R Bɟ  B QR80 `0 PM( ( ( X 0 80P `Nt4Ѝl8 0备`P .P H8@p0 00  $( 00D0DS:8B0`700G@004  P``0 00H 0C 0 1 ,Pp$p($p,(\r*ppQk(pW pA$pW PG@`@`A$ppW0@  ^(0 1,P/ @P&x@ @(`P, P  JP P  BR\`Ap0@(`P, 0 P1#S0 0 PPp`@(( 咘( p Pr $0 0@SA  1@`p $P  pW+00^0040$p ^P;  0 @000`P000(l4000C?00w( $0gJ$0( 0P A ,P$ppV (0$0 100!0@`p $P1(P$@ i@` p$0 PW$000\KW 20$1,k, 0, $@(P020@ (niP  R-P( 01 (0ehPP$ 0 (P1$@;0 (P$@$$)ZWT 0ppP10<0S  pt! ^O0}ς00P +.000P,! / 1:Q0@ Q10 `@ @0`7l\ |,(T@pܼȼxH, 01dTܺĺXع8 0ഐS0FI S)0 0 B F0V F B 0D 0\ Ƞ.,Ƞ0P0000 0@ @@T*80`F0C@J`80000 Y 4)G2$ $0$  0TX G-`M( yPXPpL P;S<03%R @@zz0 L l3< 0@p P4,0SJ 2 R ,  0#, ##$\A A0AW@U00X0;(0H8#80ᴀЍP009\S <0 PJ,0S0S !Q #$ 000#$ P0A 0S$S8#8 C( 0"( 0 0 0 Xx0p*@0@y$@0@T T0T 0L 0O00\  # 4 51Sp@-@M P @aP8 0P,000'P8ЍpKBЍp/G-P0"M(2M 0` p0 002Wpx @^ 1 R2Y< *5S0@ZZZ 0/, L. l3.<  0$?pE WO\!L1 0  0 30H؍ЍU8 0`J8 ᅨ8000S   "4<Ġ"< ̌Q0Z0 "Q Ct:pc@0]@0O00|T0 |/ O-P  `U?@P H1嫲p0q1 ~ Jz08 10000N`ⴜA40O-Sp M@`0S0040000 PD $ 0B;110C0 X0M ^ Q 0 Q @0 SX!B! 0PR|   R 0S  "  0!2#$ S C$ U@  UX SRRS5X%XpUk 0 Pc 000@@℠0ᄐ000ಀXbH0PIᲀ0@ ЍXD  $ U D ^ RP1 PD D00CD0 0 10CRW  B Q" 8#8ᅅ0X%XP!@ 0C 0$ 10C0S  "0e Q 0S 0^KPM Ѝ1 B\00 0  0 q@0B YPUڬ0S 녅0P!D PD 8#8TPU PHD充AD$|xplO-M@P`V 3pQ3⾐ Yj*W*PP @`V Q0p  V\Q  Y 0 PPЍ0S `0@ 00S#@P 0S 00 000S_ 0P00080080ЍO茕 0008(8t40PЍ0 L0000[ 0p 02 0 0C8#80  0嗼 [8: 00C0+ᰰ  ` `  0 Y0:0 I0ಐ00ര | |0| 00 70X X0X 0 0< <0< 0 0 Tl$Lhl@ 0A-% !@ ::`0$0CQ @3A@D$0@N0qPW T002!@$!A菛pP 0  < 0c<DVO-@ P 6UP0tM p0P(0v 0  P4 n (X0%X 000 00`0SHH00@0@ 0 \ EP) Ի  I  ᲐP R@ڴ R  ED @ʔ0I Ƞ ,ȠP AL  H+P(0 4P`@AH$HQ 0,0080X0$0<00CS@H$H@0S*<0A0A8#8 @YᲀT@0:0@I@0, 0ഐ0ၙ0P,0 R 80S* 80<0 ,080 RD*Q^P0@00Q0 00 RPP ` 000@H$HQ<08#80 ᳠Z100S B CX TP\-0S$0Q0 00 R 0P 0R 0 $0M 000 $PDQ0b80S 88,00`00 00 0 P)d0 0S% `P0U$0 h0`S,0 80q 0B8#8 Y@02:0 I 0( `ഐ0004 000tЍ( 0,0800 <0S80SㄠB,0x800 <0H\ \0\ 0TL 0@ @0@ 0X 0 \LS@$O- @T1T@0 pS0P`@D%P = Y<P( [  8#8R40 V 0 S(!$10$10 10 0S0SP 0 P0S 0CP  00S 1$10$1z00O-M@YP000X00 ``FV*:S 1 !*p `p pGx'x  F0 pF000H00 B 00p0@000 ``FVB*hY0&hR Vp `!pGx'x ӹ0I`h&h08#8አG0Zp01`*0ಠ0`0p00VPP' Y```0S`00F2"0 y02"0 000S`00FЍ``FVi*hX&hR LLL2 0 0 00000``FVG*hX&h9 Vp1p!8#8 R0C8#8p  ` `Fh&hS0Hpx'x08#8ቐF0Y`01p*0ಐ0X0`p00 00PP @Ѝ0 v00 0 l0 0 c0 0 eZ00 0 kO0`t0t t0 bDpd d@d|8 G-0p`@PRI 0S 0ؖU@ zTP5 0X RK R Q00S00ô0000 0A8#8R0 BY001"*("(00 000IUU800C80| 剐BY001*d 2P P0P  0D 0R0ಐ BRܶ8O-` @0 T @@DH( $HR1(PX{0P(  R`JPP# @0T @@DH( $HT pW  T P  TPPPA-`P@0T @ Tp Q Q\ PTG-@P `R  R  0 R @PR#  00 SᲀR; 0@S \> R0 ͕P  0 0(!S$! 10$1\0 ṕP 0 㼐ᲀ@p 0p 0 S 10@Rx ἐᘕ'xP $10 $1(!00O- @1T@0 p0CS0 M@DP`!P : O9P' 0 0 cP 8#8R0 E Ѝ0 0S0LP 0 0P000@- M@ Pp10 Ѝ0O-@Mp 00 pH`pb   PPM0STD0Z 00 @@  0 pWO0 @ pGW 0K*0@p 0@000S  p0C8p#8W㲀Ḱ0=*0p00ᴀZPP D0ZPPЍ0 ἔP 0  0 0 00 pl l0l h 0T T0T 0L 0fl4L} l$G-`"2 00M0,00w?0 @Rpq2SP:0JSM P P崀2Spp1!pp BRJ:0CS㣠o* 8#8X * 8#80C 00C*1!0C8# ∀! #(@ 2 0 2  2H@ PPxPePXP dP0 02@00t0!C!-\\ R0C0<20pW WT  R/ Y ~PPXPPqT! b`P "  クPP* ᷰP#0SQ tn~YhqPPSp@`< ]~%,1 B R 0S V X b 0S X  R 7/P  R 2$ 7 |$ 7 \YPuzX|%4 0:-&XXXXpX4 pO-yMP1a6Hx0`00 00( =p8`K[( 0RJ Sp 00 0 T}vPePRPGP*ef0@S(H0@ SaP0000 0`0 00 `00``0 0`0` 00 `0$``(`,`S7 0S 0SVQK 0]Q4[Q q' P M6pP/W  0 10S Rp0S &0S0@0@P0P/S Q 0: S00! [sQn0: S 00000#/W00S %.}0S0(00S00JpW   (0P0J `50 0"o0P @/P05 %0CS0$ `6 t p `p7PP0S |0Ss 00   B R\ L` V, `Q' /0 h 0D0 P@` 0P` J/R  S/R/  # C  R: & ` K1 t3 0S S/R$ 0\SR& HQ0sX/ HL!R\0X\!R\ $X00: S  C C `Q0: S P1: S  : S!  Sm  Se a S^ S L0S !,cPL,0SJ ! ?QE0(尥 0Z Z80 S801!Q pPPP1: S 00Z0S 80X!0CS!80T1T!TaPR X0O l0S !%c0S !cխpN[ (0S0S 0 0 yPp!{u/&4 X& Y?Y4 4|%Y<|%0Y4 YXYY Z1ZeZ/&Z5 6ZZ5 ?ZpO-P@^T4D&;p8464V@(FcP60P f jd0S0 { PNP :d4P080540HPLdP0%/(0@tdPP8_{P0T P5P%HPNP8P H00 0(%43/00000P84 @{]d4q 0P01@dPP (9dP 0 P0 4f@0D 0 zfP0; S @,0(D 2#!H8 01/,TP0P$ODA2PP P0Os崓0 CS 01#ScP0 0( ,S* BE"!0 0 'd8PU H003/p{0S@fH0803/p$^PP G0 d P`0 0 S * X 0 $03/0  0-Q3  S L/d0 0 -1/ /P0 0 0 0 `0d 0 `0d P0$ ,!c 0,ذܠ0Z[   P  00h0 l 0 h0l   00 R0[d0 0013/t Sb S?cXP\`0P ( (0, PU`00 XP\`? <Lu^&@6 ?'@%@'^^?'p@'^@'l p @'^ NhO-MM]2Gw' 9p 0 Q 0  pH0(0`7G@-Pn0@00$0<00D00000$0100000$000,00$0;0H00L00$060(00P00 00T00080S PyPU R0nR oRP0<0,`P  /P8oy`P,PPP{ OKRN , 0|5 PpaP`p4 1SzH0S?80S<@0S9 P0SP pP4PD0S 0$, +  P44X(D`尠pXV 0PU 0040D0S dލЍS ,0SP s P㨠=`0@0S0H0S 0  F gP P 3R㓵(F  P3m W` <0Z bP l3  \I/P TT @0`F40P ^MPP fPPT0S4-0: SfPPP4 01!P4L  0R p 0i0P T0SxH R 0 T0SH"DpfP4T0S 2  YX 8SU # WpVJ  ."  ."  $."  (,." 04   8<   @D   HL  3]P d  cP40SP8`uA'0:-bcl6 Tbybbb#&/c&c \ccpcbqcds@-0D9TP00000Sr0C?o21$7p0 1000C00S8 000-S3 0R2(0pP EP SP C0 ,aM8JsP xP  4 3"3 "3 "3 !00000C0m-P#x-X@P ThdxT(cQJkPL 32S ,#,M {g2 0S 000S 0sP 0jPPC000!S 0 哰0S <hJ000S ιP<x4#L0_ A1S bVQ,x᳹P2S 1"L:Ua`0:EgPQ100S S jx!0`0001Un@PNs Pt VmPo  べPn 2S 0"r r r2SA8xePR2Sw |0"PYP( T0"p(`L< <[LB'&g~7 #&ng0:-LT(c\C'ggE'`LD'gsfph#&ggd#&@-P@M`/LP@Y@P8B8r'4"^6p 20 ER!IpsmvwPePLP= PP0; FP M}f0@ S00!66p|1Q0=q E  -P . R1 R3 R 0!BSQ/ JP*0: S&00 )v000 0 0 0 0  Q }H J@P0: SpGP |@꛻ G'7 u&Bip^ .O-`M@Y.IqpP!5p 10a1S 00`F00PmP pP QYP |u`sYP<-[A PDp40Z 0FJPK0 08JPC 00*0 * R 70Z /0 0 U:(Ip @TGZJP U:Ipu&0:-X pO-JM M@X). R`",5p1 @DT a0S T  皆GiP fP hP +vP00`000 00 0`QDIpP0: S! d PP tP 0Y/S J>00/ P$C@T F0p/SX/{P60 S:PN p` . 4puG'k&(kA-`@MP DW4 0冢 jIP  H `IP  H VIP  xH LIP  nHl孳h30d3PPP P$P( <30P+( P3( P7( P;( P?P(  PP( P _P8$@Ѝ(P (PP"u(0S (P(0S (P(0S (P(0S (Pq0S VGP|!0S0S p T`PLa @1R`NPU 0E /R ")P(ŶPU  00,0/00i(0 0CS0PP0$0v00S xső0s00Ri꿏'#&P'@MĄ%^ udH':: H'p@-@PVu,`LP PP `| r3ph00SV}PsP b$巳 0@Eue&h#&#&^O-MPVh>,`F`pX&@3p D6@X/,60S ЍfP WP! PP p `RP dP vP iP00p `rPxP pp0p0p$pxhq [,1@ES ẵV8e  0P0S$0P`S 0S@ pP܄ ;PP40S r E@[*0/S /yP0.S0S .S0SZ<G 4  0  R @ 50C SN00$S P Pd, % 00$ @Z, 0r0S $ ?RR00R0SV1 $ D,  0SX  CP   0!0 0C0~ nFP 0S' &0S 5S 0S 0SFP0 0] 0 0|B00CS00 2 0 @  0S60016 R0S 10S<0PT<001 10SQ 10SM(t1`1PNP10S L10S h1 \1 u0S 160S 4B  @ 1 CE01G( h 0S0F0S 00q0S0S 00 P@@BToG'u%'$''8'''+H= %Ȇ%(X%'< C-PM US(b2@@@0 S p lW"/pC 0 L1 0ŲPl7h DPT$Px DP<y$88 DP$q$T7 0DS 00S8 0xL@Q0D0@0 0Q%@0SV L &{PQo!a0@S0@qCP do@@L qP dP P 0@0 00 @L &L&0@0 00 0 NPLD0S lx 9DPX#Au&&Bt @ht@t@ķ*&շN 0:-pϷgt߷@-RnBAO-MpyR$#(ؽ@T`@@@ @0o0C?o203#U,p3 X XT 0S9 Z`7 [``3 oRPGPP `3H@ P`hP dP fP00vP003@0 0`00`k0T 00B0 S; : eP" @ A0S #S(dl<2  П`P5 044#p@P/o0Sw '. L0P0  0pp b BCp n0S<0 0@00tn50C S?0 0S $ p.(p 0 R qX  Pp P    3/P00 S "$ p( |p[p000S +@u(%&N 0:-N X(XXpdO-M M`p4YlI^^ Y50 0 50p@$@9ktPcPSP PP.d @" nP tP0 aPP dU4 RU SU" QU040  kpUY [/lUT .  $UL$ ?p< dЍ $G$ ?pj 8:8 ?p( 8= 8*Y  H$T@DPPp`  8`TE\8 z?pLP8"8!(  z"0gX!  P Q !|j#0P0zjTKz 0S@u?r?!=x082]P8 p#0PU ,8   P P P0ZS  Z.!`V I  ?0Pꀰ倐`Q0:-&/~DD{D*7|D(FSbq}}Dp #&yaratcidO-0-OaM`p22242222322$ .)pj>"42`FS 20000b2p^S Rl2SVV10 dbV%L0 ``"p LpP L0 ``"ppd2S PR>PX0: S0d2232d2o``Sn`}0 X=YPpn>0S4 f0 zPRP3P/P/S@'P<1@P A@P<P00j000\0 ,2`,00SP TEi<P0d2M042J02G02D02A02>[@ @.>Taߍ02.202*02;/PᡧP000S .p$ 0 0[ / ᏧPP000S  |.p 0$0U /}P000S j.p萝h*0Z2000 0B B0vP 000S 3 S;3p*LZ00 0` vP 000SX"\2R(RX2Y/ 6P P M=PX0: S9  PP " /P L) 0ePhR[;PPX U;;:=p X:{\10  [ *;[ !14(S;̲03T 8  <803M,87 P 0@B PR[ 2SX 2S0 0sT  k;pd2SL <pV X!\1 \1X! 0 \,02T7,2P7P1(|%^/(7(-jS 2"0g 2PSB`d $ 0   022S2 bV/0@t*@2S-P" :0 0?+@ ,P 1!` V!0Tp2<<23S b-2hAS``t2S 58$)0 ,P //0*,P `0` 0"+,00!0`,"+? 0,! 0 `0("+(*,P j ṭ`gb N0@T5 @ET @@Y谝P` :000S&TV"0 820sLP 9[5z ): dP7 `V3 :TT :P"20"0^A/PXz;/PlDti-#&P1(9O-ME M-0P 00P`00PPP@ 0$$p0040pV4$y8 ލ ЍyPcP PP! TP& CP4P L`:77@$d0@S0000000 )0 00000 0S : pP|d00[ 5 JP50SH )R Q(nQoQ 0)#0PPu "T500"@P' P"  P  *dU.; P7Tp@.P FD"D8PBq70R600  G5YpWH ` jM/P ᔭPZ1!8Z|^@P>^Z?o20S@ 5^ `@T jM`PHj/cP8 8p.  #7(>04P`CQښ. .a0C 2 0c`X(0:- &$d\ #&\ xX(pX(Tbyb%uhX(DOo"CX(zd@0Y(pedATrG-pᬁQ@`!Y#p$Vㄑ 0S 0S l`d10pWA 㤱P @㟱0S (㙱pW%ZЍyPmPPP fP 8 n0@ S000000000000000`EV 0 *GPP9P8P n6X0:-^( &^ &O-M$4$$` 7P! 6CP쓟죟 6p000PPP#"p4W00S 0S 0S OPp3 a X( 0S00P L 0S 80WPY30S ЍzPOPBP FPG ]2P@*P00 pP2  jP2000 0b\h70X 0SP00 < LP00 $ 0 c\P}x000t00q00n 0m\1 P :Ib00000X000T00Q000M000IpG00000A000=P;0SrTPNrU 0 hP`IPer\Z ]5\Z,p((h(0:-k(>U& 0p(^ 9o\F% t&O-@MP8@EfL(婫PUPE10ů[vPlP,HP1 TP3@ ` `6p@&i  2Fqp@]0 S Y < <0Z@tt ah2m@ P`L" q!p8 R 0S00S!0  1 ,0Q I,0P0S  (  0@;P@D00-SG 800$0@ p0@P@Ѝ$0W0|1 4?$040P ?000R0Sp h```8[p\0S֯0S 00 0@@`p @$@ P@` r 0 3/p Tw 0:-EChh `C&th lC Clx%@-44;,A$0$007 ЍIꔉ%s(O-@M -P`,@@ F8 0;`p8^ p p `5 R 0ᙌ,0P T4p80P\80lzpdH X64EU(5@uDuIH吅Bh%m p0( 5O005SO 05- + 0(0,00(00 0  EݿPRPP$e`zS `SNS7 AS( CSPt 00pRR,aC QWS4$  ㍣$ 3RD +K L J sO 05N H3 W WpM H $0%Ls0!0 0  _$0S@ _I 2Wppi zS ekSLSa"m0C S\00rUrSXmぶPH0SI0SO005SP LqPL ( ₿p8 (0S 0C !P R@P!M@*p``p!? dP|!9 HPd! 0S1H!3/ 0h@ PT`Pa24P$1$!$ HR #0 Fpr PP 0 t 00 /p%s(%\%8\hs(P%P\(%&t uW%%t 0:-i\Ȋ%z\"t h%\\!SS\\*RU\ZUt i\\t iui !]m@-韵P _g@偵` x(@-HHW@]<<V,0400Rd Ѝi%x(px(\@-HH=@C<<<,04008J ЍOp%x(x(@-t@t "h0(, $("0H8@@0400'8Ѝ@*x(%, @ G-`M2P6VP0<3P0 p) P2\2@P L+3HH2<"0@<2P 44/| \3 HԆp HQ 3P  a@1  p00 @ p0 @ 080<0@0D00 0000P0 0 80$@0P ) 8b1 HL@P@T@X@\@HPƬ H¬11~1 0400,0( ,00@@0PpƬPPUPh0PP 0/`Ѝ(k@kiRkkk"WkMV[krk% TR~p>(0$  p@5= 10>0S=D$R$r R  $t}Bt $Jh<$.m`|0A: @ x0<$0(0J-p0, Y`PEB@D4T@@0$0<@᫣P< $ᢣP  x< h< $$r $lL| ዣP0< $0 00 H 0 `,=0 L0(0  0,R;0@q Y; ;$h00 0 0 9\;Z0p0!0 0 +$; L080(0 P 0*:$>00!0  0 :(000!0 0 |:,"00(0 0 D:0\:@0:0S P l: 000X  !00 0 0 :00!0 0 :00!0 0 D940X0c 0 0 @: 0 0!0 ` 0 888Ĩ@0S C.(0 BPX BᚢP0@4 ᓢP@ 8(XX8@(ᅢPD40 ~PD40D4 H I0P(0u \800 1 @1 C08Cd7@P00\7 000  OH7 G: PP/ P [X0S 0T470 04001<4 4*8TL-* PEU UYx V⨥ ⤥0.` 0 PS 4S<4Y1 H4L$0 V,p=j?HL4P80ԕS $E~G?<GHtLW0.= 0 $?-pp5WLHt4SH$L4R0% 4+pP  V,p  4S@  ApP = W  HPt%;PGPPX%XV,p (:: S0%4) $R*@P%4&OpP$  p脟0HPpWZc$R0 >$0@0p!$Tk = t,0QP,0 r04 UP PP$403m`Tk 40S0X44S.=0@+$R)SR' (8 # *~+bP 0T40S P 3T#0S T4ShP\3 c(8p+"ŸR H$L4P*`Wp 0p L4H/0#! 0[pH2 C  W$0- ;ivp~| z .0P0X   X!L4HqϠ0#4S 0+?W ^p0$$4RT SQ  W   0) 0p pWS  !S0$Qf +S0$0 Q$ Qq8*mp{(z{{{ &@}m}0:-9o#&{]Ł|NDg~*&8|I|`f|%@rrw|| ‚||o~(||}}[~}}x{(}}}~}{(ܘ ~(~?~! ~~~~ Up%- oc8 {j?MHL$ P,} P+P *+0$PiS0[ 4S$MhP 44崀S04144 0S @4S 0 0@4,4S $4R#1ѣ1,400 (0Uu `)t \)0S 0+&kp@% P' 0!d|*;]P`E}H+ LuP9+-XQ :$4+041$4+KT4S$ *$"d0|e*))))P)\4$8: H4d<$4: x00@ 0+)pa^_|~P Z +lPsPN  <}p  T< > ;+-0( !O-MIi M0p4,( TpP_8`4pGs04WZ hʢ  ƢYaB 4S<44S $$4R0`\((pP  h*p8  4 SP,0S x$0X t$W0 0N $0LpW$ t1SE $$4P>*` UZU CUʃl7DPEUPPbPEUUPP6 ( '8#80( R&0C Rn ("(T044s04b0|0 0 0 6T0DV0(0 l0,0@E H00 0 , 0500*0 +0 )00*0 +000!0  0{00c 0 |0 o@500!0 L 0b,00 1 1 V40(40STT00;d$ _D0P0D$ITh)p 4S 'PP$p$K`P#X P (@P@4(0(00`V Z<000 p"#7$p = 0۝P0 r04 ߝP ڝP #0S3}p$p4S804Sl 1S !1B0"H 0S8ⷝP (3"$b1p1   $Ĕ!<#BXpX2   S$ "sp; P| c 4 $$s(4ST 0(?W  $tR $4'S  4%ќX0; 4 $$ W  0&0pwSpW㵜X0:S Q4S  0 ᄛ &0S Z &%!p㋜X0⫱ㄜX+(ҙ 0:-&}}(([~~ %ƉŁ|Ng`f|o~}}~ (n ~(~?~ ~~~ UO-GM MP`h l0t@,$p40PEPEUq@@5P3PD0403003C3Q(3 p00,p0T3000D30804@3@#(3 }@ 3 uD2 mH2"e20L02"Yd2p"QDp2P"I{$T2 Ap00V02 7Wi2 /p00X1!%W1 `Op0x0p0d1 &p㸐%  6qp0 S D 0Z  R0SҠ0SPT0 A/ᖐP 0$ 0 0 @x&xD@PQ Gލ ЍZ &0:-xpF g);ܕGXgvo~ECgO-` -M@p L`K@g&TUPQ \&P1%p`A|%%pP `4@@4$ pI 0{0@{{SH{{S \%P{{ZT%P<;SM%Pݻ QU $<U<  AG8 ({:S[d(;t X30P2pGS<+10X2#(30S" )C@4P 09 0$3 PP 3P  Q R Wt̜̕)ۄ )0:-u)p)*&Y)l)))])žЕ))L4%<X)K 0; 000 2 0 0 000 0PH 0 P R  Xp<00 ,D d P 0: 0 l>t|1!.8@ Z12@TȌp Ťpp ňppDPt   P 0@ 1@  0@TcPe 0C Sb0400000,00(00$00 0000000000 000000 00.] 0pR@ @@$̂WA $q8;  00L0 -$p<8; 00L0 $pP.8; 004L0 $p 8; 00lL0 $p pC  |0 x; D0 y;z+30;0; ; '0cy;0z;(0x;+8@ppL0 #Pl;"0#10@00 0`K`QH D `   `0 #PnK0S ``K0 #P(a 0  00D5 #PTTd 3!0d h$``p5x%p#P5%`|#J`!2(1kkkk,a0a4aU0 0P````初1<;SV^#>˟@ 9SzL{ k A::۟SJ#@ (SVz{ k A9I:`"2RgdD' S{ h30S 0 ' D L N@^IN2 X0弅!pV00 Ҏ@+M0@W0 00Dl#@\2 /ppW T p02 "P L4"0:CS0L"`pkL1堋CA{8ZA {'NjG@8țIN8U{X({*!P&U7 0S3 W@f0T0xT000p+t_!pP Ԝ0S BX"t;<000[ W1 0 +|  #d2"SS% 0 " $@-C6?8~A@@؋),)h#&)Е))i)#& ) %< `G1 PS. 2R`2嶐0C(4"<8#8Y``0R?Ld0 0 0 d20 "  |  `b`=0l0hd8?ph8{3{7@{{{{{ {  M 4)4#0à3@0h2 0h22d0@#Wp |0H $#$<0(0"(0@02 0BS; (SC; = 0;["p@0S:0#l2!(0H0C8C8S!* 0 0H 8(#8$"(=" 0 @1币  hh╚;    0;" 0W|)0H $#$<0(00"(@0p0V 0$1 JwP<0[AW 0 0RZW|0H $#$<0(00"(@0v 0 0D lH!p0WpH!@!p ) %ڟU0)h#&l)F " * ܠ7$ 0CS00 P \0Q00p! x|0#!!0ꋟp@0|xt0 PW T0 PN 03Q0G!\ :!0 P0 0$#$0(#"(!&!0 P !0 Pl 0 vP Q Q 40r,p 0 dP  t0 ZP 0 QP 0 HP 0 ?P 0 6Pl 0 -P H0 $P $ 05 10Sl ES` S W|0H $#$<0(00"(@0p8 H\pѡ "<Ns: Ţ.F_uӣݣ(;nMUD)dciSIZ0KWI7LX DDD0J0ZD0 I0) 0K J0KN M QJY0KWD01ʸ+Y uP WD0 $ D0J C 4 ḛ͘W9T pDDJD0I0YD0 0J #1 KJ WO-M`P}0@-S@ἔP-3 @ ̣p# p*30SP a`F0P[:PQ9 KJP9 kD J4剔P@ 3 C d0@S L@p20SyK@HGG 0 0URX `|JY'DB`P6 P`4b 2 R / H0 S # U+ 0 4!}00!0wW\ი〘}zw txp84 npј0S wW1w` \p0S뵘@PJ0p@ 0I Vtgjw`l*> Τ&pŤ|fפu '=zSO-PAM Mʿ@`뼦VP 6P000-S% @P PI0@K p0\Z $`F00S@DDA@D`u%r p ,0S@bLP53 Q  ̑P -00 `@Z-00  D0B5S0  00S DIP?I0 04P 8I0000|4004 0S hI P4  00 8P ~  300S Pl0$0g0(0d0,0a#t0Cp ?o2R0S0$0+P&t#PX x@Da0@T03@00`FrS= RS iS1 KtS xS #묢Բ + 0p 0@00@00S 8  0Y0S  8< Q (0 B/S 唼t8(0S 剼 0@En||0S (0S |s10x 0`S @XdD(0S 4Z 0@+@PH0ST'TH02,0 XS`X `43S`Ổp巔/jaWF cW1 gW0Bp㩔03S\0S^ 0gS$ H0S!Y 0|&  Pp00S_ XZWZV 0S00  ,O0M4K8I<G@EDCWLЍ0000H3p0P xH30`p]D30& 4 004 SSCP 0C00 ,0  4    0R:400,R0t ,00 R B pp y<0S $3S 4p0 00 R B    0y< Q $0Q p0 40 R B    0y< Q $0Q p0 80 R B    0y< Q $0Qn p0 @0 R B    0my< Q $0Q\ p0  <0 R B    0Uy< Q $0QJ p<0pGSz $3S0S  D0S\@ p707S l ,B00'c<sr=: S 5  f /  x )   #     WڀpH0S 00S 0S  Q 0   xtpW  w8 30(#0<   *[ : &I,! n |u7 %h** p*x****`*%  *W# X* *O\jxG-PXMp_'PHh  "DDP b0@SS0p80 6h(pT80U ʖ0$60(60,6006046060860<60@60D60H6$&R 4&<  <&,&R 8&R U4&R <&R 06h'SddGQa]HPA87=CP 呍WP0S f P 0000P6T&0 Nj;P[/P061 q(VUupXH0+SDp(86 000<0 0/015T& P 0p00 :XP00G00Xpᢋl5 @P 00 B00C2#S0d0P0 00 B00C2#d Pv>C 0C0U U0@0 B "00 00A 1#P10C0 00A00C 1#P 0 00A00C 1#P0 00 B 00C2#004qp 0P 0PQT3BGJZp=V Dw`2o`F#^P0 0SU030#:U %5$P岥+P p= \P&T6K/r043PvTS0 0 S5# G@(p SPE>X!EK/r0Pp 0 0<6SR46SR 0&2RRPT2 01io|h6S lcP W0`W  0㖊P o,6S m/`P {0!QPV6%o.<6S:46S: l1Q0@6D&S1 0 00Rt! H& Rd! $&\RX! 8&RL! 0&@RWOJSP1 JRP/0: S2  S)J !P0 JN@n` 054S00`(\?0S phJ s!PJ l!@PJ0@*&pjC-GMM \00xL!p<P<8h h<8X@8DXh}X<`{`XdXhXpXtXXXXXXXXXHhLhPhThXh\hxxxP0D80l8"=C0 8B}PP   vwP:? 0>`lK  -}P t;t <'}@P dP,; T(X卌D@Ї0P+TX8$ }:P  0S:*,Jh8S <PU ThX |P@ 嬇OoB:p q\*:8(p hP 0Z`T`hRPdh0 *PJp`<0 <*pPUI0 K* 0 0C 001W0܌ \:  \8T0PP>0 XPN0P) S%42|0 gpjP9Tv XcP8 h(n8ZP8 T(X(d `2P8 h(b40EDS00d8 (H8 X(T(48 ,8 8P 00S~ `8d )=7, ,, ,q7 ,m7 H(i_8P5_7, \]l7 L(YW+cv PR:?@ 0$7 P(G7W_pˆP|78{#l%Oh8{#XOT2{P$LOH,{D$@O<&{<#0 O, {$# OoZ RRRR|R 0S0SA  >@288S2dC@P |R<S P 0S ] ]D2 |N @+u P:B?\k ,081<Srm+t P*7R-0:%zP 0\P :>@P5|Rt ROX*@PHR@ R0@`yPP0@P`p@+t0(@0000pU@p,`40 U0(P<P8^,(PR00S ,R `0 ,0S o],8SH= h,8S ux +YQgmud} #&h#& &  e 0:-(%- !+#&B U *i  ,:-   + - Yp7  +C zWI |BS 4^ <    l+ x m A-P`EJhl射P03hp2S l P:Uke}PO p 9P/P00@˜7' sd'vP303H$p440pEWQU 4 000`P C,sPE0S34# 3 P㾈㻈㸈iPxh:`pd \iXyT3P04pD/m4S 4SlP  K:` P 4SsRlPn l  PpR|,`p1<01 1> 11bG01/΅01$1kA?=(R#2Rwlp`d Pa Q18C8S ugaqЁ`Jk  lQ00S l P +`P3?o20S R=?o20 P Pl Vl18C8S 0! SS 0Rk  \k=S` 0 0000l /l18C8S _`1mx0+jW1&*&@+ d9 h#&T%`%'<+h+| p*&u@-@` |PLPl1  dqd!OpP10SAF01P> s1) 0P +P0 nPbP 9P0P  c0@ S0VP  00@0T0 D0  40  >rs0SsW+ #&nWmW #&#%A-`4C00P@0$ 0$@sP0 0ЂP00{Y}w|js墛彂P000"SP bU 0+0C0S$P!P $\p<ᙂPEP ݒP 0SՒP10Β P10Q cU 0SڻזPߔ̖RPEl10S `10PiXHQu0S,1,IP#.PTztl%P~qp 000000Sɼ- 㢻㑻yˊꋖPP`0S PPt00S8+#,zW#M>#NE###d+,$,X%8$,@,\$,,O-pPJLDBD``<"p(2 0 qQ %pPpGe-fuP`P GP IP EP 0  v a0@S0000lp:0Pn0C 0 0R080 h嶛0 l10 B1!1pq0 ᄪZPPh0[ = 0ZoR =-00+0 80 =0YSVPMP 6P@ ?P7 4PH@=N@PfP j@P=P=0X1hm<$hVPȼ0V30 [0000z00u0 宔Podl\i0 pYP 0P 啔0$P^ 厔0 Rᅩ0 PP 0 p4  t84'000`1Zp`` 塚͛1SWP 6 ᐬ&ጌ:0P @@ @0 Tp  qp q(  0 R 0P819:\*`1d L \p,< T]P-$ (010S  0ty 0P`Y) Y)  +x)0 |`00` #M =x9x @Зp$T  X o 0S` ( (PO 0S tZo F0080`8"/0  R 0 2s$8"/0 D2sc!"# :p: 0<娙 FP# 劙 F 008 @p 138቙0PXzLw7 @咕p0S h匙 0HX0S<0S 0  Q 8 0 'zp~0S &dbp~0S &0U P q |KutSrl$0 G 0 Sp<7 bp3 P $90$A>0 0T1^6T @ pyXu$0 T1N5T @pp Tbp P 000Rl)埖T0@00 P 0 0 @40 pP F$ $# 43Qp ++p忘4 @嵔p8崘!R`14`11P0d$}!`0P!磘00!R00SRd1p`1Z  R! Q01Y; Mᕙ`1 L1pW4180; X >< 490՗(/(1PU 0S 2 PnP 0S  ͍ 0S -p R080SX R   (001B0 S   0s`VYaZӗ0@0@srbhLdoH00   !w ` & F E !&u  !!0:-  0 !  @  '* ^ ! % 7\   A          ; R   ] 6h   V     - G  n \ h#&  Q/0@-0t h P ^0Jc3g@7 0 0$010t1O-0bM! Mb  [ !1 b0 0 30_bݍ Ѝ"m` t( Hp  0 #G \ $w{` ; 0$ 00G +x(80G( G p x8_S0쀟00 0000 @G P0 wP x8#`@#[*wP0l8 40G PU P0l8 40G PR 딟H\JtPJ0ƒ S$*0@- R P@ 0\ R^ H00"@<0 0 0^ 00"@0/0p@-`hAh1M@0``T!0P1 0H 0 0!  0 qQPp 0SЍp 0 AP000 0 AP 0 0 0 AP 0 0 | |0 AP` `0 0 Ѝpx_ īdd^ h\^ T8 $^ @-M   Ѝ h  Q/X-M  0 p 0 S 0 0 ЍH<6  /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b*/*/*/*/c|*/2y*/v*/s*/9p*/m*/j*/8g*/d*/a*/^*/[*/ X*/U*/R*/0O*/QL*/I*/)F*/{C*/|@*/#=*/):*/=7*/4*/1*/".*/+*/(*/%*/"*/////^*/*/*/<*/ */ */*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/TX */*/ */*/*/*/K}*/Wz*/+/ju*/Or*/ho*/il*/vi*/f*/ c*/`*/]*/Z*/W*/T*/pP/< /!J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*Q/"*/*/*/6*/*///*//7 */>*/4T*/@-@y@*/*/*/*/ps_strings missing %juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeara.m.pmp.m.dstmnnoonmiddayiqvwututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!csp != &blank/usr/src/lib/libcurses/refresh.cunknownbel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangeacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error unknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat1.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON/usr/src/common/lib/libprop/prop_number.c%llirpn == pnintegerarray!((*cp) == '\0')/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNELSIOCS80211hidessidsocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)IEEE80211_IOC_FRAGTHRESHOLDIEEE80211_IOC_RTSTHRESHOLD RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: unknown standard formatCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %u%s: can't write sector %u180320360640720123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctlatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvp%s: unknown mode. TYPE %s %sTYPE %sContinue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20251028NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Can't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! timed out at eol chars transferred in can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular fileusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDtiso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARSLESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadtildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileTag not found%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread commandbranch%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 11.99.4 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.4 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.4 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.4 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.4 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.99.4 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.99.4 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog11.99.4xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv5hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv5hf/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failed executing: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICbase32dtbgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdm/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %u %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartmanlvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorparts->geo_sec != 0t != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interface%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duideloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6vsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %srt != NULL&ctx->froutes != rtsrt->rt_ifp != NULLaddingchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIASepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/etc/group/etc/master.passwd: (malloc) Error in munmap(): JPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSHTVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d oW`sVLxj|Jqp V)JVVԞV(+(+kV@VViضVV1|VVV8 V"\Vh%$W@ W`  W (W  4W @W FW ,X(= ,|pHpHQWLPWLWlTXcYWm@obWHrxzjW DmWDsWDBzWaWPWTW VV// //////////"'+16!**33 $(*,. pushdnepopdne (]]\+`@@]]@@]^]p)  ^^t@@W8t@@^unblock and -DNO_CONV?PTHt 8llll%,l2llllll8lllllllllll l"(/ll5ll;100 0prtstatTTT(IT@TTTI(1TITTT1vHY|#Gp(f#>|UjUsage: %s [-] [-ESsx] [-p string] [name] 49;9?ACEG9 ?/@NI$2Vkks{PATH=G   6:> vtjPED[[[[>abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'D(0(1(1(80(0Ʈ(0(0(0z(0 d>>0>&*->>>7;W[_cccc $/:EN%% 7# >  SYk#$ P ; n 1 u|S1s`vo V!N$*=^                  5^ (0lW @_HM;Lz W@P8T;أأH00PXP}ɰ%̰%C=РH74԰h(xe۰)4_4 8pliI$ %%%%%""%% """"""&"" $$++BBBBB99BB>IKMOQS    2.*0(, 4 EPXO7(N  k   ٵSNڳ:d$ϴ<&ִ$8$۴ $#$ $%%( &#5&%&%(' &$ $9&&&]aein#m3v#u3}2|33#ɶ @Cf@ѶڶNMPXgo` %@,3x9V@G C$CC$C%.4ֵĵ@<@͵ D @  w~ @ ====0==0=9 % /"&),FBXi|~@@@@#@+@4@9@>@E@M@T @R@X@a@i@pu{@@!).5<FLRYaho$)wu1>\xYVZ_glrx~M5%44<~Y)M'6BR1 $).5>FNTX_siry YVZ_glrx~M5%44<~Y)M'6BRCXCXXSXCXXKXXXXCYVZ_glrx~M5%44<~Y)M'6BR8'147:'@*TMP-1  ,u1DZ{ 6 U   {,f !tO#tO$*&tO1tO223tO4tO5N6tO8Y9_9f:;<=@AB.CZDEFGHJLMNOPQ)R>SXTaUiVW\acde'f;gNhNiNpUqtOstOttOukvtOwqx,>_"@Ri?_gXttOtOtOtO $;N[m #+CXu0PktOtO   3MtO`tO)Y 9Z][-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]V4<~Y)M'6BRreturning to single-user after filesystem check readDosDirSectionreturning to single-user after filesystem check `gw*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~? wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_read  4%@ 68 %\8>%=7@%@@0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z- 6#>>>E>X>c>>>>>̲>9dd%KKKEKKqe%@4<BQB_BrBBBBBF^b`dr$c r 8c Lc `c h 0h xi 4o Ho \o po s o o o o r h (   4<~Y)M'6BRDhv$%@u1DZ{ 6 U   {,f !tO#tO$*&tO1tO223tO4tO5N6tO8Y9_9f:;<=@AB.CZDEFGHJLMNOPQ)R>SXTaUiVW\acde'f;gNhNiNpUqtOstOttOukvtOwqx,>_"@Ri?_gXttOtOtOtO $;N[m #+CXu0PktOtO   3MtO`tO)YG{(%@hkT~,%@G4%@I8%@ ;d<%'!#%AZ   KpH%pL%@ X%SFH0eCQMSFU0eCWMHah!IdontNeedEFIaMfM(s*K>;apM|nQn- q+{MM|nQn- q+MM|nQn- q+MM|nQn- q+MM|nQn- q+MR=rGy=iG}MM;Mt?MNmWC 3KOONNyD<#*=(&N0NYbBRuoqr:NIN3Dh&XN`N\ M}-sNN@Mjy֬NN-чHN-чHNZIчHNIчHNIчHNO2IчHOL6 %?a+O0OS'@ )Ѹ=ODO*1@ )Ѹ^O61x )ѸcOmOST.qBHo6֯i}OO8d%@Ql%backupstore_gptstore_tblQWp%@in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercaps*U8UGU[%+-/EYYYYYYYYsetifflagssetifprefixlensetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandsetifmetricsetifmtusetifnetmaskusagestatusY\ printallmaindo_setifpreferencedo_setifcaps\zi0%=7yi%S%3%V %" Ȏ%S@%\h%U%^d%[L%^p%$^%+^%#^%*^%I^T^_^k^w^ ^^^@^^^^ ^0^@^^^ ^ __  _@\ init_current_mediasetmediamodesetmediaoptsetmediasetmediainst`G``Q` Y\` ` ```@``` Q`media_statusmedia_constructor``_%_`_%``T%````p%``_%F`F؏%1+ paddr_matchhsettunnelb%b %print_link_addressessetvlansetvlanifb%,cb%+c,cu(GN^kmoqsuwy{}setifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchansethidessidsetapbridgesetiffragsetifrtshhhhh@%h%i(%ii%eȑ%ee* %'X% i%i\%i0% %e <* %i %cx%%iffXeetctc ,V4invalid major numberinvalid minor numbertoo many fields for format' !ffs@[php tp}ppp? p@ppp p\p npppp q/qBq Qq@]qnq|qq@qVWqqqqpqqM(crmrDOplxrn pp nhpG~n@rrrrrrrr bnorripbgensbextattbnojolietbnocasetransbrrcaseinscrmrDOplxrn pp nhp@Gs*4~n@@ppcrmrDOplxrn pp nhptp }p@Gsp@*4s? ~n@pcrmrDOplxrn pp nhp~n@ & 2crmrDOplxrn pp nhp@G~n@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirror &)<##03CFI !crmrDOplxrn pp nhp*4G~n@w wOi w w@"w)w1w7w(IWlb'aс7^rȂۂ#Kpƒ>c%s: can't read disk label; disk type must be specified%s partition type is not `%s' WTWTbSS /+-$ ")7IKWco| -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinit  #'+3;CKSW_goy@BCFIҐLܐNOSa&b6cAeUfghikƑmԑnorsu%@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:@@@h pp  p$p a` (-@ 2 $1м|^t0 Non-system disk Press any key to reboot bj #'@PSVgmp>Gey  "$&(*,     @=1&)-191J1[^1a      &C]u,95/ fũ©)+S QJNIIII|IxItIpIlI %!%%%#   &8808Yy8QI8y6A8 888ymeq*,y"yyy8y4888882($88.%"DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY !Jt(Z"UPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdef       " % ( +8/& PFPF0* XXX,,x<< vO  " "&bitmask_print5LE,Q[,gm,Z,g,,,,#(>XIJf,v~,v,v,v,,,,%,DH,do,,,,,!,8,PU{,,,,,,bitmask_scanQ  !&ADGINPSV]bg9?LhLLL2hw.disknamesfetch_urlMxsendrequestrecvrequest2B_{ "*.>PTdju      ***************************************************************************************************************************************************************************************************************************************A]9>plEt9Vx'1HBHHHP ,:EMT]eit| NetBSD gzip 20240203 0000000)  " $#!%Z^\`[_]a.CH @j18RnMkkk=kkkk>ddddddd+1YMX]G;btH'2;z?5 'ug PD]o!by9GJ]/6ePQWDbQ0f 0f : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. 2&*.)/35;!#%'+-1]8;2"$&(*, " $ & 1!4]W$F -7=QSd+AHddddddddddddddddddddddddd dDMdVdd_qddvddddd--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataun}}[g}}}}}F}b}}}}}}}}}}}}}}}}K}}Ubn}}s}*}R}}}\  . ' &26: #&/)  #&- ),/ $     "2( &" & .ء,j,uh, u, 0,1/,BJ.,gr,i,-,uK,uJ,u,l,ޔ,,u,,k,+@,7y\l,Dy\h,U",^3,lt,,,u,u,",3,u,,,uϟ,)uΠ,collect'#EsP=====NB4<~Y)M'6BRNAME=Vqmount_disks>    "#$%      "#$%&'()*+. str_arg_substget_available_cds"-4<~Y)M'6BR edit_fs_type_exth& N T  l   # <$ : : 1L e u edit_and_check_label 4<~Y)M'6BRdisklabel_freedisklabel_set_part_infodisklabel_write_to_diskijz0r ~ T H | T hy u Ԁ w y u u $}  t{ x 0q w (q q  v v 0v z v disklabel_change_geom 0 ! %7outer_fill_part_menu_optsedit_outer_partsselect_part_schemerD----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_default " %2RAHXblv%/9#AJPV\bhck;258 7:=@C  %0VPS[^agl"'6;Cir{/=O_o %(5%>>X>>̲ 4<fH M R VU [ W)q` qqd !Mqpqqi .^Or Mgpt_get_part_devicegpt_get_part_alignmentDetails for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - SFH0eCQMSFU0eCWMHah!IdontNeedEFIaMfM(s*K>;apM|nQn- q+{MM|nQn- q+MM|nQn- q+MM|nQn- q+MM|nQn- q+MR=rGy=iG}MM;Mt?MNmWC 3KOONNyD<#*=(&N0NYbBRuoqr:NIN3Dh&XN`N\ M}-sNN@Mjy֬NN-чHN-чHNZIчHNIчHNIчHNO2IчHOL6 %?a+O0OS'@ )Ѹ=ODO*1@ )Ѹ^O61x )ѸcOmOST.qBHo6֯i}OOX u   _N A      mbr_get_generic_part_typembr_init_default_alignmentsmbr_create_new !t!D ܗḌГܓHD DTġ`\P$mbr_get_part_devicembr_read_from_diskwrite_mbrmbr_write_to_diskinside_ext_partadjust_ext_partmbr_add_partmbr_free!***************************************************************************************************************************************************************************************************************************************u      control_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_start7#&))뙙 dhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_reportssiddhcpcd_readdump2 Rddhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2025 Roy Marplesmain duid_geteloop_event_addeloop_event_deleteeloop_q_timeout_addeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_signal_maskeloop_startif_discover qqqqqqqqqqqqqTZ_~2 2-q_222qqqqqqqq.4jn22v2:2?K{23HqjQ22qqq#-v(qv q$M).CXmsplitvadd_environparse_option bcd2e fa g: h` i &jkm lV mw n^o~ p|Oqr s St u  v wW x z|y A B C D E F G H ISJ K LcM N  O P# QS)T+ U5 V? WI XS Z 1b 4k 6- t Z |'g~ }               <         $ 1 ; L J S Q Y f Q l r z     c       default_configread_configrt_compare_proto__x\x\rt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_recvrtT]T]rt_buildrt_deleteX\X\sa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_init[C J T ] Si h script_buftoenvL  S ; make_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_ose! ! ! ! ! ! if_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @CDHDdhcp_openbpfget_leasedhcp_initread_leaselog_dhcp8+ C+ O+ {f^+ dhcp_boundj+ ) s+ {+ E! ) + ^$ + dhcp_informdhcp_start1dhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifa OOOOOOO OOOO'O4O>COHOMOOOOOOOOOOOOO OOOO!O.O;@OEOJT/T/h/h/D/D/VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B / RS/ S/ @S`S/ S=/ SS!/ SrTF/ T'/ @TBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~6/ *&:/ P$!X,!C/ P(!`,! / / / / =/ !/ r@F/ '/ """cs_pathiXL/  bc_base_maxu bc_dim_maxu bc_scale_maxu bc_string_maxu coll_weights_maxu expr_nest_max u line_maxu  re_dup_maxu  posix2_version u  posix2_c_bindu  posix2_c_devu  posix2_char_termu posix2_fort_devu posix2_fort_runu posix2_localedefu posix2_sw_devu posix2_upeu stream_maxu tzname_maxu atexit_maxuaaaaae%JaaaaaaT[ / / (/ ̍p/ =/ \!/ rF/ H'/  B 1 >7iea  m"nQLr_ VB$$s} !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: -o %s: option not supported`]ZWTQNKHEB?<96 0-*'$!c3 d38- sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU HeNKmakech    #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef'++9L.DDϲ;15MS7) |;p%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9,1nny:mWnC!n75VPLHD?;9/-11)15-1$1ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>ca'''''''''''''''''''''''''''gm''aj'''''X'X'''dspbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K| {`ijXFo]H" 64" TB00r | {`ijXFo]H" 64" TB00r " 0C0,8M(*w\m:j kP`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     @@ !1Aa  0@`M #+3;CScs inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_cstringprop_string_create_nocopyprop_string_create_formatprop_string_append_cstring_prop_number_externalize_prop_number_alloc2;85_prop_xml_intern_find_tag_prop_intern_decode_string_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dict_keysym_put_prop_dict_keysym_allocprop_dictionary_set_prop_dictionary_iterator_reset_locked_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equals_prop_dictionary_internalize_continue_prop_dictionary_remove6_prop_data_externalizeABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_equalsprop_data_data_prop_data_internalizetruefalse_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_removeprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_extern_append_char_prop_extern_append_encoded_cstring_prop_extern_append_start_tag_prop_extern_append_end_tag_prop_extern_append_empty_tag _prop_stack_push_prop_stack_pop_tcsetpgrp_tcgetpgrp_tcflush_tcdrain_cfsetspeed_cfsetospeed_cfsetispeed_cfmakeraw_cfgetospeed_cfgetispeedstrmode_unsetenv_int_strtouq_l_int__strtoull_l_int__strtou_l ` F g n t__strsuftollxpermute_args_getopt_longgetopt_internalunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s_getoptatolatofmemstream_seeksetbuffersetlinebufsetbufmkdtempfwidefsetposfpurgefgetposfgetc_regerror__icheckhost__gethostlooprshrcmdrresvport_af_addrrresvportresrcmdorcmd_afrcmd_af__ivaliduser_sairuserok_saruseroklink_addr0123456789abcdef_ether_ntoa_ether_aton_ether_line %x:%x:%x:%x:%x:%x %256s _ether_ntohost_ether_hostton_MD5End0123456789abcdef_MD5File_MD5Data_SHA1End0123456789abcdef_SHA1Data_SHA1Transform_SHA1Init_SHA1Update_SHA1Final_RMD160End0123456789abcdef_RMD160Data_uname_ttyname_r_times   +(&Y > < 9ZZZaddcmd_getmodecompress_mode_sethostname_popenpopenve_pclose_initgroupskMGTPEBKMGTPEKMGTPEBkMGTPEhumanize_numbermatchcompareglobextendg_Ctocg_lstatglob3g_opendirglob2g_statglob0globtildeglobexp2globexp1_glob_globfree%%%%%%%%%%%%%%%%%%%%%%%/_getttyent_getttynam_getpassfd_getmntinfo##: _getfsspec_getfsfilefnmatchxgettype_getdiskbyname/$$$$)$$$-$+creatTLS allocation failed, terminating >R5xh:/|6 "~R5IA5WEnn~;Zx0Nm<[y1OnSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec_tcsetattrwcscmp_stresep_setenv_vdprintf_lsetvbuf_regfree_inet_networkCof\$u0LDD????????J^YaTO|wrmhcGunvisAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~fts_pallocfts_sortfts_statfts_allocfts_build_fts_openfts_maxarglen_fts_close_fts_read_fts_set_fts_children_closedir  khwcschr_strcoll_l_int__strtoumax_l_opendir_initdir_alphasortinsertionsort_mergesort_rsetup_seekdir_unlocked_getdomainname @_strncasecmp_initstate_setstate?getenv_getenv_r__freeenvvar__canoverwriteenvvarauthunix_destroyauthunix_marshalmarshal_new_authauthunix_validate_authunix_create_xdr_authunix_parms_xdr_array_xdr_rejected_reply_xdr_opaque_auth_xdr_accepted_reply_xdr_des_block_xdr_replymsg_xdr_callhdr_seterr_replyacceptedrejected_strtok_rz Q ip6_parsenumeric_filenoØŘstr2numberget_canonnameres_queryNres_querydomainNget_aigetanswergethostby*.getanswer: asked for "%s", got "%s"res_searchNexplore_numericget_portmatch_freeaddrinfo_getaddrinfoaddrconfigip6_str2scopeid)&_yphostent_gethtent_getservbyname_r_MD5Init_MD5Update_MD5Final @_vasprintf_l_getifaddrs"_freeifaddrsNBCDB atoi**!!**!!SPDGJM d'@Bʚ;__dn_count_labelsAtLLB9t+CB'@ջ- #charstraddname0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuv__ns_sprintrrf__ns_skiprr__b64_ntopABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/__b64_pton _inet_nsap_addr_inet_nsap_ntoa__ns_format_ttl=dm54ؗҜ<3#I9=D2[%Cod(h4)$ _posix1e_acl_entry_compare_acl_differs_acl_brand_as_sl_add_sl_find  5_strsep_int_strtoul_l_int__strtoll_lfgetsrewindmap_v4v6_addressmap_v4v6_hostentgethostbyname_internal_yp_hostent_yp_gethtbyaddr_yp_gethtbynamegetanswergethostby*.getanswer: asked for "%s", got "%s"_dns_gethtbyname_dns_gethtbyaddrgethostbyname_rgethostbyaddr_rinet_pton40123456789abcdef0123456789ABCDEF_inet_ptoninet_pton6inet_ntop4_inet_ntopinet_ntop6_fseeko_fparseln__fgetstr_xdr_int_xdr_u_int_xdr_long_xdr_u_long_xdr_int32_t_xdr_u_int32_t_xdr_short_xdr_u_short_xdr_int16_t_xdr_u_int16_t_xdr_char_xdr_u_char_xdr_bool_xdr_enum_xdr_opaque_xdr_bytes_xdr_netobj_xdr_union_xdr_string_xdr_wrapstring_xdr_int64_t_xdr_u_int64_t_xdr_hyper_xdr_u_hyper_xdr_longlong_t_xdr_u_longlong_t__dn_skipname0123456789__ns_name_ntop  __ns_name_ntol__ns_name_unpack2dn_find__ns_name_pack_int_strtol_l_vsprintf_l__getdelim_nsdbtaddsrc_nsdbtdump_nsdbtput_nsdispatch^SOR7vr]kkgI72 X%02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04d-00mnEtc/UTC _strcasecmpbsearch__cxa_atexit_internal__cxa_atexit_vsnprintf_lfreadfopenferror__swbuf333333333JiJJ yYZJjJJJjzZZ [jC-@OOOOOOOOO g.Fp g'ad1PS0123456789abcdef0123456789ABCDEF__vfprintf_unlocked_l__sbprintfexponent^gYce\Q_strndup_strdup_gethostname" !#&(*-/14}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDؗҜ<3#I9=D2[%Cod( 7yACnF?O8M20HwZm1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHGuC?951-)%!}yjfb^CK|EE1In gYWIC<:$$$$$$$$$$$$:::$$$$$$$$$$$$$$$$$$$$$$$$$_getpagesizeqsort_r__sfvwrite__sflush__swsetup*!*!__swhatbuf__smakebuf_tcgetattr_int__strtoi_l__sread__swrite__sseek__sclose_int__strtoimax_lCisalnumisalnum_lisalphaisalpha_lisblankisblank_liscntrliscntrl_lisdigitisdigit_lisgraphisgraph_lislowerislower_lisprintisprint_lispunctispunct_lisspaceisspace_lisupperisupper_lisxdigitisxdigit_ltouppertoupper_ltolowertolower_lc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB _citrus_NONE_stdenc_mbtowc_citrus_NONE_stdenc_mbtocs# dl_iterate_phdr_setup333333333wE<< 0123456789ABCDEF0123456789abcdef_vsnprintf_ss_fwalk__res_nmkquery__res_nopt__res_nopt_rdata/&_hf_gethtbyname2_hf_gethtbyname_hf_gethtbyaddrD!*07 _nsaddsrctomap ]:[=             WEEEdg          DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::clearerrF7Z77<7O__rec_dleafNEXTINDEXNEXTINDEXputpair__delpair__get_page__add_ovflpagesqueeze_key__free_ovflpageugly_split__split_page__big_insert__big_delete__big_splitN??S??E?NEXTINDEXdr\h`H@  (0 < D L X dlpx|lX N`'x?<  `   "   $ , 4 < D L T X ` h p x                 < x@ D? lF ,, h& l   X G $   L D d ( \p     l 0X= H     <5 x   h  ,, hh    XX X X8        $ (, 0 L .4 8 d" < @ \D  L  T \ d  h  l  p t |     0 00 0Lx|  |8Xe!i!9@Di!Hl!Pq!Xdv!UDl?l? l?9 99 9 9 94D4+P\lx4+!T!@!;,u<+&<$&-(&XRX(&&-j[%1-t. :-$&X1-&T`S< 0-jd5-\4'&jn-`&-!-l--4غX-0-0-0kt-vT!$k&-,*&<[%&0-0-8k1-&1-D4:-Dk-,:-4-j k (&(& &-(-0-\[-|`1-&kd~ bjPj\cf†hΆk݆lmo op(ṗp=qGrGu'tNvwVwcxx zsWzkBCԤJ|OPST"VVXZZƇՇ܇   W+(ip'PkDip'm8ididj)(Lq t 3 Vt / t  D t ; t X &t  ;t H /t 1 9t `B t G kt  t  4t \; t ? t P <t = !t  pt ` t 2 t ) t( p, * |Dp $Ut Cw ! +w ! c .| | h% h% s# ?< #(% ;+tExFnPc*aElsh$+ !"$'(+-.03569:0A00001/11111112 2G2P2MNƤ`|0RTfhk`oooopՌ"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp| ( ( ) ) oK_pp0J#%')-Y[ : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----*0-000ooprt} %&,,ĨŨ&-GQ).1256CCLL|| /vz      8 : ? ?   $ ' FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB@4@4G4U4jj0k6kOoOooooo-0Fgi{BD6;luu!#$&*06DJ%%%0%0%0%X%%""0%X%X%X% e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ    l h b  w  i x X       0  $  k  j [<0000 is a directory is not a regular file (use -f to see it)%% ( 4$4 404P<4H4"T4>_4l4q{4;4 B74 4 4 4#42484 44 5( O55!+5459F5P5;Z5&fe5)q5{555e5:57%556(N5445 5+5,5-5.6*6$6?֟46Ek;6/G6/U6'a6F2n6 3M3\q 33 3f3N334 3 3 33WmkRkRkYcWbkCkc kG ky wb YMYrWca%,R>s>>b%@,c >>B%,>?c%,H?s?s?d%,??%A,??D%(d ?e%, @#@7@f%,W@o@F%,@@g% ,@@#Ah%,UAnAi%,c AAAj%] AAJ%!, B*Bk%Hl` %H` K%,BBgBL%,BBm%,BBBnx%",BB Cop%[ *COh%] 5Cp`%HHb PX%b qH% ,@ChCCr@%",CCCs8%!,?DWDS0%!,tDDt(%` DT %a Du%,DDDV%c w%",E$EUEx%(tg EEX%A,EEy%,EEz%,F4F"%h SF~%!,\FF?%j #% _ FF%A,FF%,FG%,'GIG%,eGG%(\i G%x,GH%t,Tj (H;HWH%p,xj }HH%l,HHx%$h,j HIp%$d,j -ICIh%`,cI}I`%!\,IIX%!X,4k IIP%!T,IJH%(k BJ@%!H,QJeJ8%D,JJ0%@,JJ(%l K %8,K82 ?X2 M| [ [   l \# " 4 4 T S(2  d D  # t"  d  TD #^ 2^ T^ M [ [ e^1 ^1 ^1 ^1 !2 (    `1  p L x3 3 L4 T1  X3 3 (4 j2 kH1  p4 4 <1 Vl  2 1 01 \ 1 $1   83 3 4 3 1      \ $ " 8  2 0   t    d H 0    , < L  u 0    1 0   & ' (p )X  8! @ ! ! % |! l! \!  H! ? 4 \     $ L @_a_q__[_I p_______haarcdff#gpg3hCh UhbsLjhmhphhijl[mxmm.?pammmmn nn9nSn|nn$oooo pN0pQpIpppp@W%Wqceqlqqqqqr+rrrrrs.sstMuxuuv5x\yz |V}}s}~=Qrǀ=ցbq["NcŃ׃ BN` 6l׆  qGƊl *R}Eejܑ͑)=KZiwǒӒ#/;I`wՓxԔcߕՖ=QݙO˚ ]*3BZxƛ^0IUbtȜ7RN?ŝ %7PeyΞ4>KTcx;Ɵџܟ$٠0wc 2?ȡCHR^g|Ŧ5T§*ߩ5QiȪ,IMv۫j{-1;Sέۮ !.6Ij~jp9qgðY-8NYa  evJt!=QI.?z͵;܄Ē1;G64b kbcʷ%5KVw Ae Za޺Fng ̽ Ajd6*L\r{,9AKPZcta+18CJQZdu!+.?<F[l~ ,;O[ejoj.?<$,@Xiq| %4ES^kw| &.S< 4o %>Plh g  $*-15N/ ܗ u Rް  ^]S0  %+103&O':(C)J*+O,W.1/ftp8@M?@Rk ii 6>4k #l ?k 7@i Qh ARtf BWtf C\tf D _^Xh E dtf F tf G ,Ntf H tf Ie uYe ue u p  1u 1e u x]LB\| ]B\  ! x0 ^ uuuuuuuuuC/ / / / / / E! / / M/ M  M / / 0 0 GV 0 &0 R)0 -0 10 50 ) 90 =0 A0 .E0 'I0  M0 [QQ0 1U0 d(r Y0 !j0 "y0 #0 $0 %0 &0 '0 (0 )0 *0 +0 ,0 -0 -1 . 1 .T/1 /B0 11 21 31 4#1 5_6(1 7.1 841 9=1 :91 ;C1 <R1 =^1 >p1 ?~1 @1 [T\1 \1 ]1 ^1 ^1 _1 _1 `2 {2 {!2 |/2 };2 }N~O2   -dd-ddTdd:dd:dd  @@ `(0<$,#4#<#D#H#P$\$d$l$p$x%%%%%&&&'''((()))*(*4*<+H+T+\,h,t,x,----...///6;; 00$0,181D<L<X=d=p>|>?222333978:44 4(545@ H! X" d# p$ |% & ' ( ) * . + , - / 0  1 2 $3 44 @5 L6 X7 d8 p9 |: ; < = > ?  @!@"@#@$@%@ &@'@$)@0*@<+@H&`T'`d,@t-@.@/@0@(`1@2@3@)`4@5@6@(7@88@H9@X:@h*`x;@<@=@>@?@ `!`+`,`"`#`(-`8$`H.`X/`h%`xCCDDEEFFccddeDe## &&,0<LPTX\`hpxDHLPT\d   (@,@ 8@HP\h p x @@@@@@`` @Dt t333333334+4+3333DHLPT4UTC33k%l%-.l'\(-'@-'33p-jj k4k339㼥ͤtgQ>PNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[Sž&&&h& m% 33UU33UU33UU#&Dh&h#&Dh@ & #&Dh!&$$&#&8b-)0*8*@*H*)LXX|P*8T*X*d*x   @ (333333333333333333333333333333333333 33 33'& !! 0000000000000000  -3333333333(&(&(& (root)`33`y%Cx"x"x"x"x"x"x"P !v%v%v%w%w%""" "*&ܡTdh̢ȝ4D0lȡXȞService unavailableP$A,aeabi"5TE  ;̨7xܭoAYrV`.T`0 AP:D"MP(onѽ ;o>V^r])eL֠r5NeK'])Ky}툼''r3E3^{<7v2xy Vslv|ܝV-=ޟr/<5χ 7磈|$Yk=u(}vBo3g{^˨ηg5wG ".};73zyV"EL#ޗGG|">">f ͥZ?/^#ȿkF=v jiZZwmǑ_#i䓮~{&u?EQ 1 Dso 747d ̼qpvp-M}qy!p[\+HU h8gl{x 6 j;#!r]x:F|f1ɠɇ&ndDJPj,r!, Ur>vU+?}.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf / BHRP[%!V[%!$b<[%<!g@[%@!tty%9!\y|% Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte Partitionierung (Software-RAID, ...)Partitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen? So knnen Sie 'su' verwenden, um Superuser zu werden.Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden? Wenn Sie von einer Diskette gebootet haben, knnen Sie diese jetzt entfernen. Kann den Bootblock des Filecores nicht lesen Kann die RISCiX Partitionstabelle nicht lesen Keine NetBSD Partition in der RISCiX Partitionstabelle gefunden - erstellen eines Labels nicht mglich. Keine NetBSD Partition gefunden (eine Nur-Filecore Platte?) - erstellen eines Labels nicht mglich. Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm rmdir sh stty sync . .. dhcpcd.confgroup master.passwd netconfig protocolsservicesMSGTXTS627 5032 5070 5087 5102 5105 5108 5113 5121 5129 5137 5140 5143 5152 5164 5176 5185 5194 5220 5231 5766 5793 6359 6659 7300 7347 7460 7553 7587 7606 7624 7632 7641 7666 7670 7674 7677 7680 7802 7987 8215 8735 9086 9115 9128 9141 9146 9166 9185 9206 9265 9282 9296 9318 9363 9389 9430 9508 9626 9740 9794 9823 9855 9894 9900 9933 10056 10063 10067 10075 10099 10181 10187 10194 10206 10220 10229 10262 10281 10293 10403 10465 10484 10603 10654 10706 10718 10737 10789 10993 11201 11392 11452 11501 11767 12225 12890 13312 13634 14059 14191 14223 14235 14413 14610 14771 14905 14925 14958 14972 15041 15154 15326 15461 15481 15593 15685 15708 15731 15790 15805 15826 15841 15862 15882 15907 15921 15945 15957 15975 16185 16435 16456 16472 16525 16593 16666 16703 16729 16805 17300 17326 17348 17455 17562 17763 17836 17920 18020 18515 18753 18904 18938 19073 19117 19256 19297 19342 19389 19633 19766 19828 19922 19927 19961 19995 20010 20038 20071 20078 20103 20121 20147 20154 20169 20184 20204 20244 20261 20281 20302 20324 20339 20359 20381 20396 20409 20423 20435 20447 20461 20484 20507 20525 20568 20619 20656 20841 20904 20940 20989 21080 21210 21263 21523 21570 21931 22081 22250 22390 22510 22642 22682 22729 22739 22747 22757 22765 22776 22787 22801 22826 22867 22900 22933 22968 23022 23047 23066 23088 23093 23099 23128 23145 23172 23190 23211 23233 23252 23262 23292 23318 23345 23394 23422 23449 23502 23512 23522 23528 23538 23547 23567 23571 23576 23582 23586 23621 23630 23661 23678 23705 23726 23746 23765 23791 23804 23812 23828 23859 23890 23911 23937 23950 23958 23969 23975 23999 24009 24021 24039 24050 24070 24086 24112 24134 24150 24162 24182 24208 24214 24244 24258 24272 24295 24314 24333 24351 24369 24592 24898 25316 25517 25757 25941 26019 26074 26141 26181 26204 26238 26249 26257 26280 26283 26286 26292 26303 26315 26328 26358 26402 26415 26428 26465 26479 26490 26501 26512 26529 26540 26587 26610 26659 26900 26933 27188 27209 27242 27295 27321 27348 27504 27510 27553 27573 27592 27621 27628 27635 27642 27647 27696 27734 27768 27825 27853 27898 27915 28016 28021 28098 28112 28122 28146 28269 28350 28460 28488 28493 28509 28538 28546 28587 28594 28608 28621 28629 28648 28681 28701 28721 28937 28968 28973 28980 28987 28991 29005 29017 29032 29065 29078 29133 29191 29227 29245 29263 29281 29318 29324 29332 29336 29357 29374 29385 29407 29585 29629 30331 30355 30389 30408 30453 30460 30467 30471 30495 30506 30511 30574 30695 30818 30831 30965 30967 30969 30971 30981 30990 31003 31030 31034 31040 31045 31054 31059 31086 31088 31101 31113 31128 31156 31200 31247 31263 31285 31296 31329 31349 31398 31498 31500 31565 31614 31663 31767 31865 31906 31997 32004 32065 32129 32134 32140 32249 32308 32559 32700 32827 32895 32932 32939 32966 33012 33015 33036 33081 33132 33191 33260 33307 33412 33555 33580 33584 33618 33635 33659 33711 33762 33834 33900 33998 34015 34046 34082 34116 34140 34164 34197 34217 34227 34235 34243 34253 34264 34278 34304 34352 34375 34395 34436 34735 34738 34752 34764 34771 34790 34804 34811 34818 34827 34837 34854 34870 34918 34926 34934 34944 34955 34973 34990 35009 35029 35036 35053 35070 35077 35090 35125 35142 35161 35181 35191 35207 35220 35238 35258 35279 35289 35309 35329 35342 35361 35374 35398 35421 35434 35445 35450 35457 35475 35494 35513 35521 35540 35560 35585 35603 35610 35617 35630 35639 35660 35673 35681 35701 35729 35746 35752 35763 35794 35802 35815 35837 35859 35868 35889 35907 35914 35937 35956 35983 36001 36021 36034 36049 36070 36084 36091 36105 36120 36139 36684 36717 36745 36774 36782 36819 37131 37308 37385 37402 37420 37435 37457 37507 37517 37534 37556 37615 37773 37797 37927 37952 38078 38096 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-11.99.4. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-11.99.4 ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-11.99.4 ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-11.99.4 completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-11.99.4. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. La instalacin ha sido interrumpida. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-11.99.4Salir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-11.99.4Ejecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si ha iniciado desde disquette, ahora debera retirar el disco. No se puede leer el bloque de arranque filecore No se puede leer la tabla de particiones RISCiX No se ha encontrado ninguna particin NetBSD en la tabla de particiones RISCiX - No se puede etiquetar No se ha encontrado ninguna particion NetBSD (disco solo de filecore?) - No se puede etiquetar Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): NcleoThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located. umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS627 5032 5068 5085 5100 5104 5108 5113 5124 5130 5136 5139 5142 5145 5149 5161 5173 5183 5213 5225 5654 5681 6257 6617 7302 7363 7441 7536 7576 7598 7616 7622 7631 7657 7661 7665 7668 7671 7793 7978 8206 8735 9153 9182 9195 9208 9215 9235 9254 9277 9320 9340 9359 9382 9426 9455 9496 9562 9674 9788 9842 9871 9903 9942 9948 9981 10059 10065 10069 10074 10115 10252 10262 10270 10289 10303 10312 10344 10385 10398 10523 10581 10600 10719 10775 10827 10838 10854 10893 11143 11315 11487 11542 11577 11826 12229 12527 12794 13155 13335 13654 13674 13687 13876 14020 14216 14350 14370 14403 14422 14523 14678 14866 15053 15073 15152 15250 15288 15311 15401 15422 15445 15464 15488 15518 15562 15595 15618 15630 15648 15916 16235 16266 16301 16365 16440 16510 16541 16571 16663 17154 17184 17201 17341 17482 17679 17798 17945 18112 18670 18966 19147 19192 19355 19409 19544 19580 19640 19690 19981 20090 20147 20244 20249 20284 20319 20334 20358 20391 20396 20421 20437 20460 20467 20484 20499 20518 20550 20554 20574 20592 20604 20617 20635 20659 20677 20696 20723 20750 20762 20783 20813 20843 20868 20901 20936 20974 21227 21296 21351 21412 21530 21689 21743 22004 22055 22431 22586 22730 22870 22978 23163 23193 23236 23246 23254 23264 23276 23297 23306 23312 23344 23384 23420 23458 23495 23543 23567 23579 23593 23601 23609 23636 23653 23682 23703 23726 23735 23754 23766 23810 23848 23875 23919 23947 23974 24027 24038 24049 24056 24066 24075 24109 24113 24118 24124 24128 24163 24173 24203 24226 24255 24277 24299 24321 24348 24360 24372 24391 24425 24458 24479 24503 24516 24528 24541 24547 24573 24583 24594 24618 24628 24648 24668 24685 24711 24735 24748 24768 24802 24809 24838 24861 24884 24900 24915 24930 24945 24959 25147 25452 25883 26074 26309 26497 26539 26589 26643 26691 26713 26754 26765 26773 26797 26801 26805 26814 26825 26836 26851 26882 26928 26941 26954 26984 26998 27010 27022 27034 27052 27075 27120 27143 27203 27455 27482 27744 27762 27789 27838 27868 27899 28031 28038 28087 28110 28134 28163 28171 28181 28189 28194 28247 28296 28336 28402 28435 28479 28502 28603 28608 28685 28699 28709 28733 28856 28937 29047 29075 29080 29096 29125 29133 29174 29182 29196 29209 29217 29236 29269 29289 29309 29525 29556 29576 29582 29589 29593 29608 29627 29653 29662 29674 29728 29786 29821 29840 29857 29869 29904 29910 29918 29922 29943 29960 29971 29996 30174 30228 30919 30938 30973 31003 31049 31055 31062 31066 31090 31106 31112 31187 31337 31456 31469 31537 31539 31541 31543 31553 31566 31583 31610 31614 31620 31625 31634 31639 31666 31668 31681 31693 31708 31736 31780 31827 31843 31865 31876 31909 31929 31978 32078 32080 32156 32211 32261 32360 32455 32503 32593 32600 32661 32725 32730 32736 32839 32891 33137 33298 33453 33524 33577 33584 33611 33661 33664 33685 33731 33786 33845 33914 33961 34066 34209 34234 34238 34272 34289 34327 34380 34420 34496 34561 34655 34676 34714 34754 34790 34814 34837 34876 34906 34913 34922 34930 34938 34952 34968 34996 35048 35065 35086 35130 35472 35476 35491 35502 35510 35529 35541 35548 35555 35564 35574 35591 35607 35661 35669 35677 35687 35698 35716 35733 35749 35767 35774 35792 35809 35816 35826 35857 35876 35895 35915 35925 35944 35957 35977 35997 36018 36028 36047 36066 36076 36093 36107 36130 36154 36167 36177 36182 36186 36204 36223 36242 36247 36266 36286 36311 36326 36330 36337 36347 36356 36377 36391 36399 36419 36445 36462 36470 36481 36512 36517 36530 36552 36567 36576 36597 36615 36624 36668 36692 36719 36734 36751 36765 36796 36820 36851 36858 36872 36887 36906 37451 37484 37512 37541 37549 37586 37898 38075 38152 38169 38187 38202 38224 38274 38284 38301 38323 38382 38540 38564 38694 38719 38845 38863 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-11.99.4. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-11.99.4 est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-11.99.4 est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-11.99.4 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-11.99.4 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-11.99.4 Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-11.99.4Excuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si vous avez dmarr sur une disquette, vous pouvez maintenant la retirer. Impossible de lire le contenu du secteur de dmarrage Impossible de lire la table de partitions RISCiX Aucune partition NetBSD trouve dans la table de partitions RISCiX. Impossible de crer un label. Aucune partition NetBSD trouve (disque filecore uniquement ?). Impossible de crer un label. Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationditerGroupeMSGTXTS627 5032 5073 5089 5107 5111 5115 5125 5134 5140 5146 5149 5152 5161 5171 5184 5192 5203 5228 5240 5748 5780 6272 6561 7106 7152 7256 7342 7378 7393 7411 7419 7427 7454 7458 7462 7465 7468 7579 7764 7992 8468 8802 8831 8846 8861 8869 8883 8901 8922 8973 8989 8999 9019 9065 9095 9148 9205 9316 9437 9481 9514 9553 9587 9594 9627 9704 9710 9717 9724 9753 9865 9871 9882 9899 9916 9925 9954 9966 9976 10077 10139 10159 10279 10316 10372 10386 10407 10444 10654 10829 10978 11013 11065 11281 11594 12117 12478 12768 13161 13296 13309 13320 13466 13645 13776 13910 13930 13963 13982 14065 14180 14321 14446 14460 14568 14661 14690 14710 14786 14803 14821 14837 14856 14876 14893 14905 14931 14943 14961 15162 15401 15428 15445 15501 15563 15623 15654 15678 15737 16113 16143 16160 16268 16378 16518 16592 16668 16746 17238 17458 17569 17600 17727 17763 17891 17918 17958 18004 18220 18344 18412 18512 18517 18553 18589 18603 18626 18659 18663 18688 18707 18733 18738 18753 18768 18787 18812 18824 18846 18863 18876 18888 18906 18930 18945 18962 18975 18986 18997 19017 19046 19075 19099 19134 19169 19196 19383 19432 19464 19512 19609 19742 19788 19980 20010 20332 20461 20601 20741 20858 20993 21037 21080 21088 21098 21110 21122 21130 21141 21168 21202 21237 21268 21303 21339 21386 21406 21423 21441 21446 21453 21478 21494 21515 21532 21549 21567 21584 21597 21628 21653 21684 21715 21750 21777 21830 21840 21850 21856 21865 21873 21888 21892 21897 21903 21907 21942 21952 21981 21997 22023 22040 22059 22080 22096 22109 22114 22122 22137 22163 22182 22210 22228 22239 22245 22251 22272 22282 22293 22311 22333 22350 22363 22384 22404 22424 22435 22448 22470 22477 22502 22517 22537 22549 22566 22583 22603 22622 22799 23083 23393 23573 23784 23972 24038 24085 24140 24184 24204 24233 24245 24251 24267 24271 24275 24283 24293 24305 24320 24339 24375 24386 24397 24436 24448 24458 24468 24478 24494 24512 24561 24582 24627 24871 24897 25151 25166 25192 25249 25283 25318 25460 25477 25526 25547 25563 25592 25597 25602 25608 25613 25652 25687 25717 25772 25805 25851 25865 25944 25949 26003 26017 26027 26051 26137 26185 26291 26325 26332 26347 26374 26383 26422 26429 26451 26470 26486 26504 26536 26555 26572 26729 26760 26767 26776 26784 26791 26805 26823 26842 26852 26864 26905 26950 26979 27000 27023 27042 27080 27086 27094 27098 27119 27136 27145 27164 27310 27352 27862 27870 27894 27912 27956 27961 27966 27970 28001 28014 28023 28069 28195 28286 28298 28362 28364 28366 28368 28378 28392 28407 28434 28438 28444 28449 28458 28463 28490 28492 28507 28518 28533 28561 28605 28652 28668 28690 28701 28734 28754 28803 28903 28905 28973 29013 29058 29133 29199 29234 29315 29322 29383 29447 29454 29460 29559 29615 29891 30015 30126 30188 30226 30234 30256 30305 30308 30329 30374 30429 30488 30557 30604 30709 30852 30877 30881 30915 30931 30956 31004 31040 31101 31155 31236 31258 31297 31334 31366 31390 31417 31443 31457 31465 31475 31483 31497 31510 31522 31546 31587 31613 31630 31659 31983 31986 32000 32012 32018 32034 32046 32053 32060 32069 32079 32096 32112 32155 32163 32171 32181 32192 32210 32227 32240 32266 32273 32281 32298 32306 32323 32347 32366 32385 32404 32414 32425 32439 32457 32477 32497 32506 32529 32549 32560 32575 32587 32606 32625 32636 32646 32651 32657 32675 32694 32713 32720 32739 32759 32784 32801 32807 32815 32825 32837 32858 32874 32882 32902 32922 32944 32952 32963 32986 32993 33007 33029 33046 33055 33076 33094 33103 33134 33150 33177 33196 33216 33234 33255 33269 33289 33296 33315 33330 33349 33894 33927 33955 33984 33992 34029 34341 34518 34595 34612 34630 34645 34667 34717 34727 34744 34766 34825 34983 35007 35137 35162 35288 35306 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-11.99.4. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-11.99.4 zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-11.99.4 zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-11.99.4 zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-11.99.4 zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Instalacja zostala przerwana. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-11.99.4Wyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-11.99.4Uruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPHTTPSNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Jesli uruchomiles komputer z dyskietki, mozesz ja teraz wyciagnac. Nie moge przeczytac bootbloku filecore Nie moge przeczytac tablicy partycji RISCiX Nie znalazlem partycji NetBSD w tablicy partycji RISCiX - Nie moge nazwac Nie znalazlem partycji NetBSD (dysk filecore?) - Nie moge nazwac Instalowanie bootblokow na %s.... Partycje NetBSD na dysku %s wygladaja teraz tak (Rozmiary i Przesuniecia w %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766:  . ..zerowd3pwd3owd3nwd3mwd3lwd3kwd3jwd3iwd3hwd3g wd3f!wd3e"wd3d#wd3c$wd3b%wd3a& wd3'wd2p(wd2o)wd2n*wd2m+wd2l,wd2k-wd2j.wd2i/wd2h0wd2g1wd2f2wd2e3wd2d4wd2c5wd2b6wd2a7 wd28wd1p9wd1o:wd1n;wd1m<wd1l=wd1k>wd1j?wd1i@wd1hAwd1gBwd1fCwd1eDwd1dEwd1cFwd1bGwd1aH wd1Iwd0pJwd0oKwd0nLwd0mMwd0lNwd0kOwd0jPwd0iQwd0hRwd0gSwd0fTwd0eUwd0dVwd0cWwd0bXwd0aY wd0Zurandom[ttypf\ttype]ttypd^ttypc_ttypb`ttypaattyp9bttyp8cttyp7dttyp6ettyp5fttyp4gttyp3httyp2ittyp1jttyp0ktty01ltty00m ttynstdoutostdinpstderrq st1r st0ssd3ptsd3ousd3nvsd3mwsd3lxsd3kysd3jzsd3i{sd3h|sd3g}sd3f~sd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2a sd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2krwd2jrwd2irwd2hrwd2grwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1erwd1drwd1crwd1brwd1arwd1rwd0prwd0orwd0nrwd0mrwd0lrwd0krwd0jrwd0irwd0hrwd0grwd0frwd0erwd0drwd0crwd0brwd0arwd0rst1rst0rsd3prsd3orsd3nrsd3mrsd3lrsd3krsd3jrsd3irsd3hrsd3grsd3frsd3e rsd3d rsd3c rsd3b rsd3a rsd3rsd2prsd2orsd2nrsd2mrsd2lrsd2krsd2jrsd2irsd2hrsd2grsd2frsd2ersd2drsd2crsd2brsd2arsd2rsd1p rsd1o!rsd1n"rsd1m#rsd1l$rsd1k%rsd1j&rsd1i'rsd1h(rsd1g)rsd1f*rsd1e+rsd1d,rsd1c-rsd1b.rsd1a/rsd10rsd0p1rsd0o2rsd0n3rsd0m4rsd0l5rsd0k6rsd0j7rsd0i8rsd0h9rsd0g:rsd0f;rsd0e<rsd0d=rsd0c>rsd0b?rsd0a@rsd0Armd1cBrmd1aCrmd1Drmd0cErmd0aFrmd0Grld7pHrld7oIrld7nJrld7mKrld7lLrld7kMrld7jNrld7iOrld7hPrld7gQrld7fRrld7eSrld7dTrld7cUrld7bVrld7aWrld7Xrld6pYrld6oZrld6n[rld6m\rld6l]rld6k^rld6j_rld6i`rld6harld6gbrld6fcrld6edrld6derld6cfrld6bgrld6ahrld6irld5pjrld5okrld5nlrld5mmrld5lnrld5korld5jprld5iqrld5hrrld5gsrld5ftrld5eurld5dvrld5cwrld5bxrld5ayrld5zrld4p{rld4o|rld4n}rld4m~rld4lrld4krld4jrld4irld4hrld4grld4frld4erld4drld4crld4brld4arld4rld3prld3orld3nrld3mrld3lrld3krld3jrld3irld3hrld3grld3frld3erld3drld3crld3brld3arld3rld2prld2orld2nrld2mrld2lrld2krld2jrld2irld2hrld2grld2frld2erld2drld2crld2brld2arld2rld1prld1orld1nrld1mrld1lrld1krld1jrld1irld1hrld1grld1frld1erld1drld1crld1brld1arld1rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rflash7rflash6rflash5rflash4rflash3rflash2rflash1rflash0rfd1prfd1orfd1nrfd1mrfd1lrfd1krfd1jrfd1irfd1hrfd1grfd1frfd1erfd1drfd1crfd1brfd1arfd1rfd0prfd0orfd0nrfd0mrfd0lrfd0krfd0jrfd0irfd0hrfd0grfd0frfd0erfd0drfd0crfd0brfd0arfd0rdk7rdk6rdk5rdk4rdk3rdk2rdk1rdk0rcd1crcd1arcd1rcd0crcd0arcd0randomptypf ptype ptypd ptypc ptypb ptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0 memmd1cmd1a  md1!md0c"md0a# md0$ld7p%ld7o&ld7n'ld7m(ld7l)ld7k*ld7j+ld7i,ld7h-ld7g.ld7f/ld7e0ld7d1ld7c2ld7b3ld7a4 ld75ld6p6ld6o7ld6n8ld6m9ld6l:ld6k;ld6j<ld6i=ld6h>ld6g?ld6f@ld6eAld6dBld6cCld6bDld6aE ld6Fld5pGld5oHld5nIld5mJld5lKld5kLld5jMld5iNld5hOld5gPld5fQld5eRld5dSld5cTld5bUld5aV ld5Wld4pXld4oYld4nZld4m[ld4l\ld4k]ld4j^ld4i_ld4h`ld4gald4fbld4ecld4ddld4celd4bfld4ag ld4hld3pild3ojld3nkld3mlld3lmld3knld3jold3ipld3hqld3grld3fsld3etld3duld3cvld3bwld3ax ld3yld2pzld2o{ld2n|ld2m}ld2l~ld2kld2jld2ild2hld2gld2fld2eld2dld2cld2bld2a ld2ld1pld1old1nld1mld1lld1kld1jld1ild1hld1gld1fld1eld1dld1cld1bld1a ld1ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullflash7flash6flash5flash4flash3flash2flash1flash0fd1pfd1ofd1nfd1mfd1lfd1kfd1jfd1ifd1hfd1gfd1ffd1efd1dfd1cfd1bfd1a fd1fd0pfd0ofd0nfd0mfd0lfd0kfd0jfd0ifd0hfd0gfd0ffd0efd0dfd0cfd0bfd0a fd0est1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drvctldrum dk7 dk6 dk5 dk4 dk3 dk2 dk1 dk0consttyconsolecd1ccd1a cd1cd0ccd0a cd0 bpf0 bpf ...# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin  . .. dhcpcd-hooksdhcpcd-run-hooks# $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use fi done # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  . ..20-resolv.conf 30-hostnamen $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime if [ -n "$rdnsstime" ]; then ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers if [ -n "$rdnss" ]; then new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi fi fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime if [ -n "$dnssltime" ]; then ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search if [ -n "$dnssl" ]; then new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi fi fi # Break when we don't have either [ -z "$rdnsstime" ] && [ -z "$dnssltime" ] && return 1 j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf retur# Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dkctl drvctl fdisk fsck fsck_ffs  fsck_msdos gpt halt ifconfig init mknod mount  mount_cd9660  mount_ext2fs  mount_ffs  mount_kernfs  mount_mfs  mount_msdos  mount_nfs  mount_tmpfs newfs  newfs_ext2fs  newfs_msdos ping reboot restore route rrestore shutdown slattach swapctl sysctl dumount ... ... . .. binmdecsbinshare . .. cu ftp gunzip gzcat gzip less more progress sed tar tip Htset ... . .. chroot . ..misc ... . .. db log  run spool ... ...  ...  . .. lock  . ..