08PqSi'&<  'qSiX`P''`'(. (.qSi'&P@@<@T 08PqSi'&<  'qSiX`P''`'(. (.qSi'&P@@<@TU qSi`'(.yAqSiqSiqSiQ$f qSiqSiqSiRAqSiqSiqSiVAqSiqSiqSiWAqSiqSiqSiAqSiqSiqSiAqSiqSiqSiAqSiqSiqSiAqSiqSiqSiAqSiqSiqSimK9%qSiqSiqSiX`hpx$qSiqSiqSi (08@HPS$cqSiqSiqSiX`hpxP${qSiqSiqSiSQ$qSiqSiqSi (08TJAqSiqSiqSiCqSiqSiqSiAqSiqSiqSiAqSiqSiqSimqSiqSiqSi@HPX`hpx\$qSiqSiqSi$qSiqSiqSi$>qSiqSiqSi$qSiqSiqSi$sqSiqSiqSi$qSiqSiqSiAqSiqSiqSim qSiqSiqSi$qSiqSiqSi $qSiqSiqSiAqSiqSiqSiAqSiqSiqSiAqSiqSiqSiAqSiqSiqSi$QqSiqSiqSi (08@H$qSiqSiqSi $qSiqSiqSi$qSiqSiqSi$qSiqSiqSi$qSiqSiqSi$qSiqSiqSi$qSiqSiqSiAqSiqSiqSiAqSiqSiqSiAqSiqSiqSiAqSiqSiqSiAqSiqSiqSiAqSiqSiqSiXqm7a"7Zeqw+&g= |YiX+JoFo3CeVOn8F@$JU狟] EM &yt&umedٱ 4jTǖ|lKY,(. . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF@46%4 (@@jjp"p"z\z\N$N-N-Dt ,,N$N-N-NetBSDJwGPaXU@SRHffffffffffffUVS( O-9s 9r[^]UWVSZ(]P PL1uQtuYuf9s|1u+z 9suփ 9r}tMtH~t=111t8uqt4#t*v$u}yAK[^_]ËUQȋAE 29scUMM\ E9s<uhv.&tED u|E9rċUM9tu 09bZt*ti]9nUWVS(E@@9s{*i;9r[^_]UWVSW(E u @3.M \b8ME @E p-t/tu<N-9s 9rEt E$<l $< O-9s 9r`h"$<ED$E D$E @$i$6p-PMD$ D$ D$$1ɉL$RD$[$SW(5u1ƃ5$tЃt]$k_[SWâ(4uYƃ4t|$]<$wkt(?t<$ZktЃ_[UWVShp"hp"h*.$C @ &1t:P耀YxOvh*.j /XZ3h*o%h*.B h*.j t/j]5UEU MsMU HE]2hUVS1ۋ"&tVPZYu "&C܍e[^]USPhq"h*.QBh*.hq"5 #& CtsPhq"h*.Bj4UWVSE tuhq"*URhc@53.4o¡3. t Phq"j$uq#~h#]]ܻq#}~h#Uq#~h#WVSuQRPhr"=E tq#~h#RPh/r"= u53.h=r"=1e[^_]U53.<XUjhc 53.an t53.hVr"jS1USRj EPS{ xU:t Shdr"j]UPEU Ph}r" JtPhr")EEEPhc53.m t53.hr"j踖1UWVSSuE H1ۃv>PWZYtC"&uދ"&Ehv"WmZY1tFEEPhc53.4m t53.hr"j&1e[^_]USu Shr"jՕ]UVS1#&tSP~ZYtFShr"j蟕#&e[^]UWVS ]u} Sh}r" } ~Shr"(}1{EFE} t!vr"81UWVS`] u~ uhr"Uȹ1Rhc@53.xiE 53.hq"jcP2.DPEU ЋU Шu>M9Mt65EE1EEEK>tt,uhs"|$1}}}}}E뺉t9Wuhs"j莑U9Uu[}t }uEEEqEeEEVEEċ]9]}}t#}t}uE}uEEEԅu.u9u9E4Š#&53.hs"7 }t*}uuuuM9~VQuhs"j誐1ۉ]Ek]lSXNEYu hs"j脐1}E1҉Uuĉu܋uu}}UUMMPh c53.dg u EX@1}WuGV53.ht"jAEuPE4Š#&h#t"6CE rh+t"YD^ElU9U|`3.<Ea3.]s"rt9U}I}s}u,@)1ɉMMf>h`3.h&$5XZCtCPh$l5_Xj 4^CtCPCPh@t"I5 CtC"PShat"05 Cts؋C4Š#&ht"5 C$Pht"4ZYuTXEw1e[^_]UE5.]UE4.]Uhv"j舎Uh-v"jyUhDv"jjUhZv"j[UE E EE]rwUhjjjuhov"[4.4.Uhjjjuhv"[4.4.Uhjjjuhv"[ 5.5.Ujjjjuhv"m[ 4.$4.Ujjjjuhs$E[4.4.4.4.(4.u(Ujjjjuhv" [4.4.(4.u(Ujjjjuhv"Z4.4.UShjjjuhv"Z04.44.uu j)]Ujjjjuhv"kZ0p-u j(UWVSu4.14.4.14.>WXuWhv"j=S5HY_u Shw"j"xxuSh(w"]hjjh#&EPj)uu뺋(4.#H t uhBw" P(4.WPZ_(4.t(#=t (4.t hrw"AX(4.ƒtuhw"<t?%t4!t$t (4. (4.hw"j.%84.e[^_]UVS4.uX4.4.4.4.4.4.;4.4.rgj4.4.4.4.4.4.X=54.u4.E 4.)EU}t 13A}uke[^]Ë4.4.ut 4.4.Uh$&h&$j:UUh$&h&$jUUSË@4URs(PZYts$h&$jS4K(E%= u(HPhm8@QRƒ t C !jjjQR Bu@ut8uK ]USQ9s S/GZSPEPGƒ 1uE]UWVSx(w-Ë@4jjWP ƃ y hx"jIC4WPs(Xe[^_]UWVS]uVh4.jO,C4uu s(P(躀8jVj-,$覀8؍e[^_]UWVS4.}t 4.4. 4.4.EUEUEU}uH*4. t?11ҋ}9׋M} ytEU 5.$5.E 5.$5.ut(jRP54.4.P Bu@u 54.hx"MuSh4.Ɖ 19|8uu54.h3x"/8t54.h&$jȇ11 5.$5.utTU܉EE܋Ux4.|4.54.54.RPp4.t4.P4.T4.1ɉ 5. $5.5x4.=|4.9}u;9uu6E94.u E94.tX4.\4.|P4.T4.lX4.\4.9}u9utT4.t%=5.u5.54.hEx"SXZ4.t54.hix"j胆)u}4.4.+EUEU4.4.54. 4.9uEr uM}u}tUR4.)P54.r 4.4.4. 4.4.ut54.54.h4. ;4.C;4.7벍e[^_]UVSˋ <5.yQj hq#RPVuV$VSh<$%(e[^]UWVSljӃ=L5.t%tPhy"h V#h PV =p5.wwVPhy"%w$w wwwwhz"$0wxwPhn#h*.hI~"J@V:73^6.6.FV EUVwEU6.6.GZe[^_]UVS1ɉ 6. 9.j?Sh"'[Z`~"tSWZt|/uShf~"Shr~"h6.$ 6.uj蛇h~"|?V NP2Yth~"P16.YZu1S~Z56.h&$Kh~",?V蝀 V荀X1e[^]U塨6.tlP!5Zy6g0M=P56.h&h*.hh~">>16.6.tPP56.51҉6.YX16.6.6.1U塨6.t*P46.ZtP56.H516.ZYul Ujh(9.h@*.PU2 tj6.6.6.6.5.@=uUSUE 6.5.6.M5.Ћ] Ӊ)~5.@[]Ã06$ &&1ølbXND: 0 &    t øUWVSӃu]16.26.6.@ujjh6.h6.Ith~"h&$<Y^6.6.6.6.`6.)6.6.16.26.6.@ujjh6.h6.th~"h&$1<XZSjjh6.*e[^_]UWVSƉ׀:0Btj7.u 9.C1 mCE 7.98.؁}ULQM57.y%ZYMUuXsZ00Phn#h*.9 h&18.H8.t 8./t1 7.7. 8.u8. u 7. KF @t.Y0/Phn#h*. h"1tt7. 6.}7.8=9.t=6.te[^_]UWVSu Vǡ6.E9.E7.E1ɉ 6. 9.[= 9.t57.11҉UuhEYUU8.57.ZUt"?tzD7.PPj@ƒ u- 8.t 8.tjtj 8.u 8.uݨuE\u}}!9u„tt h*.h"#=6.t!9uu E 9.uh*.h"^XZ9.t=6.19u!Ӆu 6.9uu 6.Mu56.} 9.= 9.t؍e[^_]UWVS];!uh!1#CPXZSh!1#P ǃ u$zW0-PSh&h*.? h"Ju WYXyh;!u7WZy4.W0,PSh&h*.h "T.Wp$ǃ=8.uVht"h*. 7.+E e[^_]UWVSu] }9tSC= 9.t VPVP$ZYyV0;,Phn#h*.\h$"-1e[^_]UWVSQu V[= 9.t1ۅtW;uRWZuZW957.u=9.t =6.u BRUPu! uËUF?륃= 9.tuX؍e[^_]UWVSPu]>!uh"FPY_Vu Pƒ u$~U0#+PVh&h*.Ch6"RuSRUǃ Uyl>!u7RZy4*U0*PVh&h*.hN"P,Rl"ǃ=8.uWht"h*. tE)؍X؍e[^_]UWVSW11 D*.yh@*.#^u@*.P@*.s=9.9 9.8.؁}U|WQIZYUu[FT0)Phn#h*. h&m+8.H8.8.tjJ j! =9.9. 8.u 8.uΨu١9.u9.1ۉ߉ u7.9.09.9.uL*.@t?S0&)Phg"h*.Ghr"*f%L*.19.-fL*.9t{t 9.9.9.މe[^_]UWVSW9.C{ u)ÃE9.<TRP Y^tE 7.97.8.ށ}VR_ZuZR04(Phn#h*.Uh&)8.H8.t18.tjtjk 5 7.7. 8.u 8.uҨu١7.59.ljD s} us*Ext9.M| thr")[oE 7.9~V7.8.߁}WRZY= 7.7. 8.u8."%7.259.NjM}t1s2PRd¡7._YtD } )s! 7.9|X 7.8.؁}tVQZYK5 7.7. 8.u8.sv7.Me[^_]UWVSQ]utuh"XZ} 9EueF95t.ˆUPh"3ZYUtF-"" /B000CL 1e[^_]UEH!8.EPhht@j. x$Efv@p-EfvZYtF=9.tj jvPjjjWuwu197.uh"%X؍e[^_]UWVSP]U u h%%XU197.~BPSYX%KM7.uSwPux?]9tWsZu̸1e[^_]UE P2.DBuh"%XP<5.u 7.E@7.1UEP2.DBt5.Eh"$XUWVS7.P2.9.EDJ@t t E@9.޹9.0U?& } $ '&}^@9. P2.8f|y@@t t9.tQL18j h9.59./qǍ vL8"uh"?-t^u1=UDQ@u-t ^u؅uh%#^1L1ۉj h9.59.pÍ vL8"upt@9.7..l7.at$1Ƀ/QPZYt9.M:-@9."FP9.@PX3t(@9.7.;u 7. 7.7.9Et97.}؍e[^_]U17.7.7.7.7. 7.x$B7. 7.7.9. ,t(;t#7.у~ 7. 7.JuJ 9.:;u7.9t 7.t1]UVS 7.11Å t]9@7.u 1ۉ@7.J@։t 7.[^]UVSujZu+J0Phn#h*.h&A!FV CS FC؍e[^]UMU 19tz\u JRQZYUWVS=8.ujEH!8.7.Pjh"hπ"ykhH#g^tZP8[=wJ@ PYt:WP-XZ|3/t 3/D3hπ"S57.jh"S=jUM=8.tI 8.QU=8.ujEH!8.jh@9. UWVSE7.1=9.u-t 9.| t7f%L*.9.;u1SЉ9.Bz u)؃u ;.u{ tՍ<8.SZu# 8.uo8.tj>t[j7.t P&FXPPj/ƃ t9u8. 8.8.u 른e[^_]UWVSSu7.X;7.|1ۋ7.z8.9t9u SEWá7.ZYUSWj / u 8.t$1957.~FPVj. u)ϋ8.tj,jSX957.M~WVVWYXMXABy 7.19~7.)@7.=9.t R3@XZ8. 8.u8.FM1e[^_]UWVS}57.Rơ7.7.)C=7.Y99~ )C)E1ɉM18.VZu' 8.8.tjtzjPE"YtEG7.PPjY-ǃ t8. 8.u 8.uu6l7.@PvX]1҉UH1e[^_]UWVSQ] 8.Suj, u3 8.8.tjj197.~CPNjEpVYZ=9.tW0EmXZE8G+]C)7.57.8. 8.u8.t{1e[^_]UWVSu 1957.~@PXEuM^_1ҋE9USYYUCЋ=9.9 |9.8.=}UWQYZUu[C08Phn#h*.Yh&8.H8.O8.tj7jn=9.|9. 8.u 8.uΨu١|9.ЋKS 9.B9|^5|9.8.Ё}U\SV _ZU*9.|9. 8.u8.OV|9.f u u|Y^uoEH7.8.5|9.5Zu 8.7.PPj9* t8.H8.8.u8.t ؍e[^_]UWVS}5x9.8.V5t9. XZuSA0cPhn#h*.h&8.H8.uh8.tjtTj5x9.t9. 8.t Nt9.1#8.uĨtɊ<\uGGBDtG9D3؍e[^_]UWVS1u8. 8.t hր"fjEP£9.XYu -E 9.959.8.=}U\SV ^_Uu[@02Phn#h*.Sh&8.H8.z8.tjbjh9.9. 8.u 8.uΨu١9.!L<%s=9.9}p 9.9.9.x=9.8\ux=9.@1s 9.< s =9.u5!57. Z 9.뛃=9.u 57.57.WZYu57.릡7.PP_Xu9.Hnt*ptlt 9.8 tK 9.̃=9.uu 57.57.Y[97.;7.@7.=8.t =8.] =7.~ h<" BDA@u hO"I19.Hnt*ptlt 9.8 ts 9.̃57.j_ZsBaK*t7.PRPY[19.Hnt*ptlt 9.8 t 9.̃=9.u7.7.9 RP>_ZB9.Z=7.1Hnt@pt)lt1 9.8 YWiSP+ h 9.뻃7.PP[^C9. Znt1ptlt"9.: 9.ă7.PP6ZY7.U=7.Uƅ=7.Uu h"7.;7.7.=7.9|9}h"pu 9.9.Hnult 9.8 tσʃ=9.uPS?7.PP]^_9. Znt-ptlt9.: t\9.ȃ7.PPY[9. Znt>pt)lt/9.: ^P57.57.1 9.뷃1=7.\Pnt,ptlt9.8 t9.σ1=7.ul7uDp-7.=7.H0V 9.wr 8 t ك=8.=8.u qnBDA@=7.u 7.7.1`9.Hnt*ptlt 9.8 t  9.̃=9.u5=7.u;!t1hSh7.E ;u=7.7.7.7.PS_Z97.8.y1ۊgtR< tF0 w}010j h9.59.T9. vD$ptruD C@9.3/8"uh"1ۉ9.6%9. tB9.8 V=9.uh"Yu8 t 1҉9.x uh"ҋ59.8.tt6]ƅu+ 8.8.tjbrj99.9t'tPt59.(_X59.7. 8.u 8.uut9.ƒ=9.u!h9.h9. ZYy؃1У9.t%9.S<[t<\t.RfZÅu!h$ { uh"*[1C뵉) :.9=:.8.Ё}UtVWZYUu['01Phn#h*.Rh&8.H8.t8.tj\jg5:.:. 8.u 8.uΨu١:.59.lj9.=9.tj jRP9e[^_]US9.< u h" XH< u=:.u$h3"XJ 9.R8tڀ u ӡ:.PKXu1:.t=7.u P7lX9j,:.Yu(>&0Phn#h*.h&eK1҉7.58.S5:.¡:. t+h'h9.PR5:.1:.R]UWVSV9.P9.M1ۀx%u8Huz9.=:.h"[s9}e9.P9.:.9. \P9.:.2< :.9.M8 u:.8.ف}|WRZY=:.:. 8.T8.tj8.H8.j8.U5:.:. 8.u8.:.:.:.e[^_]UVSVu] 19. u 1ۉ:.U9. Uu 1q8u@9.JπwE#1ɉj h9.59.G v"8"uh"'1Zgu@9.됸e[^]UWVS 5:.]:.=:.}+:.;:._&M 9}y;M)9 ڋEE8.}RUu*ZYUu]'"0Phn#h*.h&N8.H8.t %8.tj%tj:.:. 8.U8.uΨDϋ :.M9}}EMELE B19}})É<\GVrω0;UU Mr3)9 ڋEEW8.}RUuZYU:.:. 8.u8.t :.M9u}EMELE B19uu)d9|T8.ځ}tVuaZY65:.:. 8.u8.ad:.Cw9|T8.ځ}tVuZY5:.:. 8.u8.:.؍e[^_]UWVS] SZ=9.tj jsPӸCjPjuHt 1E1 :.}t9U3 98.ށ}V5:.Y_u[0DPhn#h*.eh&8.H8.i8.tjQjz5:.:. 8.u 8.uΨuك=9.tjj ] :.NjEpSP  9~U8.΁}V5:.v_Z5:.:. 8.u8.=9.tjj S舶 :.Nj󤋅  ?u9Ћ)ȉË ؍x:.9<t ttjPjuEo8.=}tV5:.PZY5:.:. 8.u8.~2 u)u thG"HXDžS=9.tjj S, :.Nj󤋅 :.f Qe[^_]UWVS7.7.H7.1ۉ]17.+7.9U7.@7.P藯uu PuƃU7.PP[Z:.3E8.1SȰYu' 8.8.tjtsj7.t PFZPPjƃ t9]u 8.u 8.uuE7.G7.E  Euh"XE tu RR x1e[^_]UWVS7.E7.E=Lp-t =Hp-uhb"FZo=:.t 8.j&8.:.E:.EXUZk EtSu`PR@PNwFH uu^13^@p][sHZPJJ@BE48rE@E܋]Ek ƒ 9]}3:}z}z}׉u0}xupK Ń=9.t谻Lp-7.ELp-Hp-7.EHp- 8.u8.tjt j1e[^_]UWVS:.:.Ht7k X< u'ʣ:.B0Z9tS;SvZY1:.7.Lp-7.Hp-e[^_]US:.9:.}Pk:. :.Eu-Ck:. :.u C:.P:.k :.ZY]d:.j Ph:.g tP4Phn#h*.Uh&5:.1:.:.1]UPhr"h*. j蜻 *.Q*.y ;*.| t*.J *.Uh*.PXZUWVS։˅t9u RPh"VPh" tdt`{tZC<x1ҍ{t2Hs!t ,X< ϊG< ĸ>e[^_])e[^_]UPEEjEP5:.N Uh"Ph"h*.jyUWVSf@8uVu1Q1҉hW3)à 8#)tSWV e[^_]UWVS} 5:.fDž<YP1҉uJhPj u 88th#-ÍjjPm @u8thτ"jf8utSVWڿ y8#Qh%)AjW jfDž=:.t fDž9DžjRjʿ fDž9fDž9:.jSV @u8tfu ftR.@ufDž=:.uK":.@uσfDžftv@u KfDžMe[^_]UWVSQ}u VWR[ZÅuzjjXZu h "jp;s jEPW7ƃ ?tE8thh"j8"u wڍF=wfs؍e[^_]Ë@t@Ë@ t@Ë@tË@htË@ttËtËt8UWVSUE x}pHXz}z9zu};zu 9u{9Mtt9u 9MtiH$z$ ~ U~Nx9zu9t):JR ut'p@ u t19Í\ZY[^_]USEE ZAR9QD[]UWVSƉ׋EEE EME19}9xu90u,]9Xu]9XtyB݋EEEE19}9xu90uU9P uU9PtGA,Ck,QMuZYMu#Tԉ2zur}z uE1e[^_]Êt"tUWRP舕Y_}ËBt1Uj譴L$qUWSQ- ;.v=;.ڞv]=;.]5;.5;.hՅ"j5;.5;.h"j 5$;.5 ;.h"j54;.50;.h"j 5;.5;.h3"j5 ;.5;.hI"jE$h_"j~EPP$hx"jj =8;.tJ=u;.1 ujWeY[_]aÃ=8;.tUE Puj UWVS}u _Ph"j3`;.B9tT`;.e[^_]UWVS$ ]5H;.t(V$V0Y^ugh" j0Pu  -& yWLp4$0ZtWVPy u WhΆ"O5-&jj0։( y0h" jju ։ƃ A Wh V$-&ƒ jjW(-&‰ V,-&h _Xuh"jh[^jh h R(0-&y RY߉RZ=t*w=bt%1=bt" =tu h>"11 Њ Јt u hJ"jYu Vƅ/ t jZV8 jZVP fjjP% d;.2tS SQPR(c%,9kPƉ4W8t t10hb"j ^9s1BFu h"j 1e[^_]UWVS\]ƍ}ZE5,-&(,%%048EPSUe[^_]UWVSĀ]p$tV9V/9Y^㋃p tVf9V9XZ㍅xP/1RPuuGt5p-9ΉЋt}"Q75p-VPh"1e[^_]UWVS] }AƉI1RPuu賩t C|WjVȃRP<tCuPhć"j71RPuu‹N tvkk ыEe[^_]UWVSTERELIu EEE EE؉1 t1҉Ƌ] ڋUӉe ƉߋEE$EȋEt\EU 1 t1҉E܉UEU}9}}}sE܋UẺU1}}t 9u9uEUẺUF uuuE,P# E =D;.E ‹EJu EDEO1 t1M ϋEe ʋ}t}\SQE,#hj#5D;.zÃt#EhSjPVTHt h"^SqY ;.$;.E0;.;.E<1҉UEt E\]̋u)։]uEEIu E E1 t1WVuu09E #E1҉ t1EUWVRP9E EEEEuűE,|"Eԃ Et8"EL0wEԋPatELhaRuuPh"3CPEԃP2‹EԋXX9t"ERQuuPh<"jE؉EEEE̋UЃE܉U1ɉMMMċEE}$tWW}9t }O]K}9:t ] [}19]9Muu܋E,!EujP1Eă1EEËEt@d9s+tNjuE‹Euu}OEJUEMQRPuEPE]tXpXjuL5XZ9u9]EE@]k,PuËEY^k,tԋUEVFF E܋UFVEEtP4@0P,@(FVEƒEt@P@ltȉF Ek,Dԋup(ut H}P$]GVEXE`1 t1u}tE]9tE}?Et\]̋u)։]uE‹EyJu EE1 t1WVuuܡPuuh"j8EtP @@1ҍMQRPuEPE0ju231ۋE;pEE9shI9uEtpp Euu܋E,ujP-EċE1 t1u}C놨u  EE]k,PuXZu E}ȉ81EEE9k,]Kt[ 1ۉX]]u LL\HX M܋]HX]]tK0[4K([,HX]KH B9EutC E@ b]k,D$uu܋E,{ujP`,EċEk,Z(EiB$ t1EUFЋ]EEt  E}U}ԄtOO9M}1ۄt_9]u 9MGEt\ű})׋E?E9Iu EvEEÉ1 t1RPWV蔞PuuSh|"jE]ȉKEԋP9Ut,E:uRuuPh"jE}8E}ȉ8}u}u0;.4;.EE܋UẺUQEe[^_]UWVSuEPF VM]_9EEr )ӉM؉]܋Fƒu]uFt 11ENjE9sPu h"jN͉1+MF@UtR UR)M]E9s )E]1]9؋]sU܋EЋEÍEeM1SQRPFVe[^_]UWVS]E 8w1ɉMM9UMK}HPH EU,hj,RW}EEPhE$-&ƒyERPh"jxhj,3WQ}tE1҉ES1EEE9EE}FN9N u;tEUSE 8}tNEEU,뷍e[^_]ÍL$qUWVSQ8΋QYRPh/"1ɉM؉M܉<EPURvSOE܉EUjEPURSfMM܋E؉Ẽ1҉UЉU19~k,ŰD$EUGm]P<E1Em};.;.;.;.EЋU;.;.ẺEMEPh$-&ǃ yNTQWPh@"0FPh$-&ǃ yN"QWPhf"j1eY[^_]aÍL$qUWVSQ9qd;.X;.,h;.l;.?1<;.@;.1D;.H;.1h"VWI ta#DtNJCl7D;.뷃b$d,&p;.P;.C8;.Ct;.u5l7c@;.e5l7h;.R5l7>d;.@T;./5l7<;.L;.5l7X;.Xl7H;.h*.h"YXp#.)lj80h*.h"XXZ=@;.x8th"5P;.t hQ"jvtjj)h "+h+jj4 [_@u h"jj h "hjC00h"@PQ@ uh"t|j/SZYÅu@V;.׉hjhjj`$8`;.PZ\;.1urh "jj͛\;.؉8hDj803PtP3h("j^W5\;.HOG9=`;.=P;.tf95`;.~W\;.4!F_烽(ta1ۉ(,,9`;. <;.d=T;.tj@;.xrP\;.0jX;.dh1҉ldPh \;.$-&à t$8: ha"jS1 1ۃ=`;.*;,\;.,@XRjPjj(($tLPhI"DXP 28rt)rz rz04z('JJ 04zh P&U;.;.f8ZY9tFS‰Yt"Ph^"j EjPh"9 Phw"j ‰Ju tH‰R840Ph"1 tH89s`u[1 t1+049Ɖы0|9Ɖ4}LV 9Ɖ4|9ء\;.40\;.<0X108014߭0ݝ0y11WVRP ߭ 8-&ܝ0W=t;.pݝta\P>Vz ݅y؉RPh"M\`+EU5X;.9Ɖ# >jVQZY@݅u؉Ph̋"jh;.ܝp -&ܝ0 YLRjP011RPJ$01tZL9rKjQ#^X090Q_|OlaGl막9skQ k4 JHJZH XH J HPW4 |0u|0tGlDhjP88xuxuDPh"Y[, 1҉D<5p;.d;.8Hȉ9r09rÉ014840Ph"840Ph"j04 41119q09Ћ4N8JZ8<<u 8^9 +4i۷m۶R<8SPh_"DPhx;.SW(~JFD\`HP\Phx;.W\DH[, X049Ѹ4}u01480Ph"1ۉ8Y98r;D\`j\Phx;.W\D𙋍09ΉЋ4}88SKut+4i۷m۶QRSPhɌ"kDPhx;.SW$~FJ,TY8$D8tx;.11҉VPh"B98~k,D$Aۉ<014߭0߭;.;.;.;.;.;.1XT011198t)k,ȋ0I9Hu0;0Putvt_|TRXR81RP%؃RP10P @ 9|0,PQpQRPjW'k,Љ1;P}0PTQXQ8)Q t p룋Tșڋቅ}؋ቅ  =L;.t 1Px;.k,80$98p09~Љt$DPSh"pPh$-&ÃF9QSPh'"js#tV:t&PhL"j>,.gPh^"j,G$)08<11ۅt;k8tGpBuE;.p-Xe[^_]ÍL$qUQ ;.;.5;.5p-<-&EM MuQQ$RPh"MɍaUS]CtS P S tSPSCr s gZS` ;.X]USEPsH) ;.;. ;.H1҅u0;.Z[9t ;.u;.u h%"jX4CXtYZ@]UWVSu EEE#p-;.;. ;.M11ɅtJA9~ʳ9M}#t;.h9"h,&hhH"}9x4u }9x(u9p$t버t;.e[^_]UWVS]uuu SO trNj@thj"h,&h1GGWX9w(~6Gth"h,&hhH"@wVw auG [^WY;.p-;;.X=;.u =;.uBGWu;.GWtP;.WGtG4WPZWX;.j@jutVjktG _4E UG$W(G,W0wE #p-G8;.tz8GC GtWP { _ Ge[^_]USEM Puh"h,&h4hH"P ʉPHPPP s E]XPs2H ;.;.;.1ɉH ;.H;..1ۉXt ;.H;. ;.H;.P4JH8;.9t!tXYX tAP]UWVSUu }uWVRcËECUt;.R;.EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMYp-A,y0yq I4 s RPWVQ0-& RPWVQ4-&e[^_]US]C%CSjSZ1]UE UMQ1]UjpUU P;.PYtHJ ;.@ ;.UWVS] ;.C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpd.C ${s  ]e[^_]UWVS uE EEEE%;.1҉Utp9sS0ud{M9O,uDM9O(uPuuu Ë@u7EEU t1C,S0C CC4SPYNS EEUO t jSXZE1u} t1u uE0x1e[^_]UEjjuuu PpUWVSSE E}Eppt^EX EʀtÃttRPDYY Ct1N9u9Eu1ۉ؍e[^_]UWVS u}j8jdËEEC1CC]C&^C 9f1C C$hjrdEhjcdM쉁jhjQdMAdK1AHA 19Et EXEMQjR t1WVEPUBBRUuu uxƃ(Uu7jRE^EpdSuKSEIE싀}@u jR]^_}E UG(W,}x0xdEtFVtRPBYY Fht1҉GW EWW 111E싐Eut"EHdMWV‹EEZYFMu u;.EE %;.S0tK0J4;.;.C4K.C(tS(P,K.C,K.މe[^_]UWVS4E$EE tPPE:D1ƉE̋ENjEvS5uЅyh"h,&h"8}uv0U 1E!ڋE+E 9;EE }tY@]9~Y]̀}tIBEECE܋MЋEEȉEyh"h,&h)h")@륋B 뵋EEP`EԋEvƋEE_UtE EE1 t1u}u}8uEo¸v0E E1u܉uȉuĊME t@@]9%ME tPPEJÍD19EEtP19U9EEtXELMQjRu} t1WVuEE܋P }ԋ]܉TjP}EȋEE ‹EtXE1 t1u}tEE t@@]9} tuuuU 1ۋE؋EE9I9uEEtpp EƋE2EPjVEU t1RPu|EE܋P }ԋM܉TjPc E t1u}CMu  EEE tPPE)ÍD19Esot }_] 19]u 9MPuuuh"L}t/EEtP1uuRPh"]9]tSuuuh"uuk} WY[9t$PRuuhO"̨uۅ1҉U uɅXEЍe[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEgEUu}1ۉ]ԋE9EEIu EEEȉ1ҊM t1҉E؉U܋E芀$EEt \)ډM]uuRPWVe؋M]999u 9u 1ҊM t11ɉMظ 1ҊM t1҉ӋEU؀}t UȉE9E|9}u9uE؃} uE‹EÍMQjR t1RPuEX E芀{atjuXZ}ucVEtK 9u׋S(C,K9puċS C$M9ErU؋EJPCPZYU9닁{at WVh"EtC M苉9t.CM苉p9t$1SQ1RPWVh"֥C(S,C S$]9UrSPWVh"訥nWVh "蔥 Z}t5EtC(S,C S$9Uu9EtPuh0"T EUjuuWVSucE؃uju[X}t$EtC(C PWVhQ"EEEEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋EEIu E1ҊM t1҉EUEU+EUuuRPREuuWVR9EuQEi}lj1ҊM t1҉Ɖ׋EUă+EUuuWVoR9Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMjuXZE9}u }uu}eY[^_]aUWVSu} }t#ӉSQRPhi"ۢ.uH‰?9u*_YӉ9u9u :9r 9r}thz"_h*.~ZYtFpVtFHuRPuWEU}t h"mXtE;Ftu[M;NpNHș9U싆`du<9Mu7t `d)RPh"象K./t `d)RPh"z tFpVtFH9Uu 9Eu1e[^_]UWVS u }Pj8jUE1ɉHEMAYA0ZA WZ1ۉY Y$XZ}thjHUËE쉃PXZu u =p-ƉE} t h"lXp-EPjh WVuhjTËEp }쉻PP P jP^_=t w=bt=btP=EtS Sp-}tURjh  t1RPuhjTEEp }}M쉏PP P jP4ZYutCHSLC419|} tMhS"jX@Et} t#h"jXu uuS9u u|X S|X]tS{_13)t ǃ ǃL tX\1t.1}u}t@EUCHSLX`d1ɉt}u8}t 0}u&}u tCHSLEUC4EE uEC4uuE0jjSWhySXZ؍e[^_]UE Pujp- UWVS]FHE1RPuu Kt C|}WjuȃRPVetPu h"\ u~ 1RPuu _JtDTEU"vkk ׋GEEjVXZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuuJ€}tKt19suu苃0uu SZe[^_]UWVSE@E@0Et E|E2] u t]u}tE1ۉEEƉ׋E t1 9E9ƉM|BEE0Ɖ׋E t19E]WVUEZY‹E9sq~m1}tEPWVE ]EËERPʋEEH[^}t EP4PRY }9},|#] ]Et E!ËEU t19r^Eމ}t(SuuuyE}@,@0E@dpx ECuuUED_Z9|7} EPjRuuuE}1}tEPuuًE }EPEPEPuuuuƃE11 }x}tGu xuƋE|U9|~<u@EE@dpx xt!u |}}uEڋEuu ڋE|5ڋEUƉ׍EpDžlEPpppue‰EpxuZ J1E@,@0;Bu1Z4E, t1r,z0B BRS^pH]{ EGu(u$EtDEƉ׋C4SP[lpl9|}uuUElZYPuuuD‰EEtxB,B0|t |t2EMEEME|KENt|URjPWVutWVhז" LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1tuxue[^_]UWVS(}^4EUEU t1҉E܉U/URPuuVщ‰EЉERPKM܋]t+ +G|)uÉ֋EƉ~vaPJURjujjPZt Ph"TXZMA tP@G(W,@G jQYXtG(W,EЉUԉ_(w,G 1҉EЉUԉ_ vBHMQjPjjRt Ph"XZUB tXpuu1ɉH H$Xu u1ɉHB4RP:XE܉؉E܃EUV‰1 t1҉щ‰8EE̋P tJU؋M9ˉE}#E1ɉHHXpE ϋEMЋ]ԉL\}U؃v8M9ˉE}E1ɉHXEkEuЉt6M9ˉE}E1ɉHXE ku EЉD2BHAMQjPjjRt Ph"Y[uN EUtA Q$}u$}u1҉QQA}u }u1AF4VP:E̋@4uP1e[^_]UWVS]vfBHMQjPjjR\t Ph"VY^EP trzs({,RS jP!XZtC(S,C 1҉EU苳FHE,1RPuu+?t C|}WjuȃRPVtPuh" Ep 1RPuu=tփ~u$~t:7vkk փ~t*uuh" tFVC(S,FC BHMQjPjjRt Ph"_XUB tNvHpuu1ɉH H$NHu1xB4RP:^juYZYtC(S,C 1҅u uSXK.t C0S4C(jjP0uu S5e[^_]UVSUE 9| 19[^]US辛PPhF"h*.Nh*.h}"գp-CtsPh3#h*.NjGAUSSE] t$uhQ#sZY¸tr1EEPhvd5P.{ @u35P.hf5#j跤]UWVSPu }t}~^hx#S莍Y_DžtFh!1#S{_Zt)h"SjZYth"SY[_t뫿}}uhW$v*ZYuUEPhud5P.z @u65P.hf5#je[^_]US}tQ,Shzd@5P.z @u5P.h"j蚣z¡P. Bu Phߗ"j/UuPh"#t Ph"IYXEt5P.h"HXZڗ"Etq#P5P.h9"H ڗ"Etq#P5P.h`"H ڗ"Etq#P5P.h"H ڗ"Etq#P5P.h"aH ڗ"Etq#P5P.hۘ"=H UWVSP]̹ 1uVh}d(@5P. y @u 5P.h "a 1}t}tfV5P.h&G Uj E pSySh~d(5P.xP.Au Ph"j虡U rVPh-"Ge[^_]UVS] }tjs(V vjh;"j Vh{dЀ5P.x @u35P.hf5#j e[^]UWVS] p7p#.11hf"Su~ tet quٿ11ۋE9p#.t%]UEPh|d5P.xw @u5P.hi"jkU;Ut4i9UsRUubYXۋUu5P.hx"ju'u5P.h"FXZj+<u|hhRSSEh#uq#RP5P.hǙ"E1;us:PCPShؙ"EF e[^_]UWV }tEPhd@5P.Hv @u5P.h"j;EEPhd@5P.v @u5P.h"XZEu}P1RPWV;RPWV5P.h""De^_]UWVS}tCE XhB%S诇^_tDžd1ɉhlpdPhwd5P.Tu @^tltDCSx|xP_Pss ss5P.ha"D N 븋lhprh"S݆_Zu+hxd 5P.t[^@5P.h"j觝h$S衆ZYxP5P.m^_@u h"%= th"h"h*.Fjm9tDžd1ۉhlp`dPhwd5P.s @u5P.hM"9tXl%NjX󥋽`8X K`t!Tj 0ZYTujj臜hp`hj]T_Zt̋`1X\11t(X\H X+HXߋWV\X5P.hӚ"Ahxd 5P.r¡P. BuP$Ph"AY[``pp pp5P.h"A`px`@`9q j RP5P.mrыP.Au@uWVRh7"MJWVRhL"!AhT5P.'?=th"hv$EOXh*.:`ZT` e[^_]UWVS] }t9hs4PR v jh^"j sEP3 vjh"j=10j PsO,Ɖ׃ 8t sh"8"u:9shЛ"ryh"g蔑1ɉj Ps =_ 8t s h"=Q8"u!Ѓu h"jJuĉ}ȉM̉UЍ$Vhyd5P.Gp @u35P.hf5#j8Vh6"&?XZe[^_]UWVSlj֋ 1҉p-tUPQMZYtUBMQht"j诘jhhL.p-s 5P.$GP.@u5P.h&$j蝘P.L.VWS5P.= e[^_]U05P.hf5#jaUSS}tE Xho#SEZYthۜ"S4ZYuEEPhwd5P.o @uE ]UQ}tqEPhd@5P.n @uE O5P.hP"=XZUS y.y.t y.ȉ[]UWVSubw.uӍPw.u'B%zBB?R+B%zBB?zzJ}  ;u9tHk?9[^_]1^w.x@uUWVS։ˋ=pu. tu.11~B? ыE[^_]Upu.?tu.jh>RP3=vuxu.UWVSQ5Hu.At t)t%Pσaw <v ;v ir_yGfw$k C E1E)л 19u5y$P2.1TtDSt!@ u 9t1 Z[^_]UMU 9|]UWVSƉ׉Mpu.tu.ÉEE1RPWV1E)Ɖ1UQh%:XZ}Uttu.H9upu.H99stBRWh": e[^_]U塨q-=Du.tvPh"":5u.5u.5u.5u.5u.h+"p: 5lu.5hu.5pu.5tu.5xu.hT"E:5y.h{"5: Ph"":h"mHu.u.5q-5u.5u.QRP5u.h"9,h"+Htu.pu.5lu.5hu.QRP5xu.h2"9 5`u.5du.h"9 UWVSQƉ61ۉjEPV误 >u#ËE8u 8"u w܉1e[^_]US~P,z$q#Phq#Phq#Phq#PShž"h*.<,j/UWVS ÉM衔q-uhU"5q- hk"j莒׉ljEU}jؙ#E#URPQiBuAtVq-q-=PuRq6 3P5PT.R_6 9q-uNE!5PT.}e[^_]UWVSEUσ}u "}tĹ"EU@uSh"XZff=Ut+=u.t fuuSh"+$ff=u%Sthڡ"#fLJ_f=Ut1=$P.u Sh"#Y^$P.tSh7"#XZj(VPB& x0XŃ~X u.t\fLJᵃVe[^_]UWVS9y.uy.5y.V1Xƃbw.e[^_]W|$wUWVSDEUЉMԋEGWEȉŰG WEUEa"E$EtEu"11}=q-Etu.pu.U1҉U܉E1ɉMĹEEUԉӋERPSQq,PE؋UEUuuRPT,RPuuЋE؋UEUuuRP0,RPE؋UEUuuRP,RPuhi"F5,"uuuuuuuh""5 h@*.jdh@y.:" u h"j׎hf}#h@y.h?Y[@y.]슀@y.< <$u { Ћ P2.DQu<-"j EPh@y. Ɖ׋]hT&SE؃}Ph"S tuhPm#S t I =q-Ήʋ du.1WQRP*Ɖuh¢"S菝 u` du.ω%du.ƉuuEt5`u.1Et 5`u.Et +5`u.Et +5`u.EÉ]hf}#S=YZ؉E8 t,h@y.vtZƀ?y.uh@y.hƢ"P3 59uE|E9Ɖ]}.uuuuWVh"3uЋ}u}e[^_]g_USE Purh"2D*.HD*. yh@*.xSY@*.P@*.؃ t7@t( D*.y h@*.FSZ@*.P@*.h"jD1Y]UWVS M q-u h"jƉ׋q-ؙljEU}ؙ#E#UƉjRPQcBu @uq-q-uhuP. mR5PT.P/ 9q-uUjWV5q-bBu@tPT.KE!ÍNju5q-R5q-@. 9q-ue[^_]UWVSRáy.u ƀA Mz΍y. S}8PR5  y. e[^_]UWVSEыEU u1#ˀ Ɖ+5`u.u}};=y.}=y.&"EUEUE9y.y.}=@u.Euyy.KlE9t 5y.tމnʅu+`u.9UE}M1E܋E9E܋U}t+}t}u w{ƆoK"v"ȃ[^_]UWVS EӋEEhy.@Phy.zE 5y.t h"j]E9E|E9u|y.] }) VRPT5y.31fǂU }u@`u.5y.֋M)}CsKSCPKSs FSy.Ee[^_]UWVSEU} u }7M] M]9 u.u.u.19UtWtN}1E9ϋE}79}E }&"=@u.}u1BuEPu.]Ã}!؉˃u=y.u =y.t=@u.Y}ty. }mhjHy.[^u hN"j fǀUEy.EU y.y.EUy.y.y.t_}t E y.Huy.=@u.hk"YS"u.=y.;y.y.EEU EUEUMxa] y.tEV1;uE |9EE}=@u.}tEt뚃}y.E 9y.u;]t~y.Hy.1+]9~ Fu%uF PPR y. *`u.1RPEU y.+Ey.XZEU y.y.EUy.y.>"ɣ" -""e[^_]UWVSË@SuHt+5u.=u.9u9t h"Y^sǹ󥉍1󫍍@u({u "{t"Phޤ"IXZߋe[^_]Ã=1Hu.f}Ut24"J "Phq#Sh1"REPh{"C~uhq#Sh"& =Hu.x@9uHh&jjPR=Rh"hq#Sh"(R>Z)uhq#Sh˨" 6)uhq#Sh"| ƒ< h=y.[ P.Mhq#h"" @ tShq#h3"WVC$u P.vj!4XUhN"jIw "CQhq#Sh1"RhY" =Hu.xx4"붍e[^_]UWVS=Du.ujjju u.B=u.t+5y. $ֿq#uVWh;"} PVWhK"hVWhZ"V EU RPVWhk"6PVWh""$%PVWh"PVWh" ?PVWh"%PVWhƩ" PVWhש"?PVWh"{ e[^_]UWVShEUȉM]t'BuUE$1ɉM $1uuuuE^w.E̋EȉEE q#1҉UUEu.fE9y.~5 y.EE̋E,EUE$1} $&E$1ɉM $1uuuuE=@u.u(}t"uPh"|uuUEtuS&}t.Efu ukE }PEP E8u.}u,E@]̋u}su} { }1҉U}u E@E} u@}u:E̋u}pu} } u}u`u.E1E EU EU}}E̋@ E1E}u.u.+EU EUE}5y.=y.y.E`u.1҉EUġy.19M~O;tAȉM>EUEUM9ȉЋM|"EUCCƉ׋MA묡y.y.)9E]| h"u}ĉu} 1E} lj}`u.1҉EUE9EE |K} u}t?1@bw.t&fw.19M} |jw.9M} |1EEUEU Ubw.t4fw.1ۉΉjw.9u} }9M} |1}E}uu.9EE u.|=Pu.uh:"%^1>E@u.E }uEEjhjjjщ¸H"E Hu.EuE1ۉ]]]] }t#y.y.EUy.y.u.u.EU11ҹuuRPQUM l%FEU+EU ;E}EE}]u)։]u}tq=y.y.E9M9MtB;t=9Eu|CC9EM}{u9ыu}EUE령u.19]tEt<19E}ă|9E}}}9׋u}EUCu EUĉEUu}+u}ąuu hN"}u}tEEM9Ɖ}uM`u.du.1RPuu; ҋMu 9tۃ}u E9uWVjjRUZ+$EUEPuhm"hv"h@*.jdh@y.u h"jnh@y.UYvEHƀ@y.t'?y. t9EEHPh@y.h"} uh@y.EP* EUĉEU EE}tjuuu uUEKjuuu uUEPu.tuk=@u.t Ph&$jSPouN}tjuuu uUEjuuu uUEYt Ph&$jxm}um}u} u }uu }̋EEfukE } 1Eȃ}t }tf}tE y.y. `u.;] u1;MtuuEU G_Z y.UׁǾ}EU}̊EG]؋})}̉Guw OWPE̍HPD3}̍_S[^E}t fǀ fu uEPkE }P( 2=@u.t h" YuEft=Hu.|=@u.h"Z\E̊@EȋE̊XEȍE@‰xu.p1WVjjj" E1ɡtu.p1WVjjj2"Ã(Uȃ?1ɋ5pu.1WVjjjA"}̊MO_U? ˆWGEȊ_EȍG‰xu.p1WVjjjR"xE(1ɡtu.p1WVjjjb"QËUȃ?1ɋ5pu.1WVjjjn"-}̊MO_U? ˆW(}t/=@u.y.t Kx y.u}ˍe[^_]UVSáDu.u h|"^X1ۃ=Du.u ShO#Y^jjڸu.CXZu҃=Du.u=y.th"X1L=y.th"u Sh˫"Y^ y.RP1҉XZ=Du.tCDu.9y.A=Hu.~hѫ"I5y.j5y.5y.RP믅<f=\w.t3h"E^hث"[1w.t=h#2w.Y=uh""k Ph"XZ hv"Xhv%X=Du.nPh#"fY[=Du.Xw.PPh?"F j=,u.t>u Sha")XZ9y.} hz"jX;_ y.RP1҉u Sh" Y^jjڸu.XZe[^]ËU^Ph"h*.OjUWVSĀ|xtz.wSh@"h*.jS%EZuhX"+xƉjRP|Z>9u9thj"0jRSu|/  9t"xthu"h"0Xj1}EfU}EEEEPw!$ EEEE]1E EExER^}t$uE Pu4`5&h"' jz.fEEEy.y.19E~[tP9}u1M;u&}_PaRz.4`5&h"|uu u@렃1}Mt 9sT@E9E~Yt}9Ur߉׋M9}sύPaRz.4`5&h ">  }9sf}wfE@fjz.u4`5&h<" Y[|}tFaP4`5&hh"  ttt111E}tz.}xz.|z.z.z.fz.E]9]E@ƒt<u.E}tхtu|EZE]9]uu*XEe[^_] *.yUh*.j XZá*.P*. UEU 19s f3P]UERPZYUSBHBy;B| X RQ5XZ]UWVSQ]u uh'"S F fw46&h"Ph."S  FPjh8"S FPjhD"S  Sh&aXZFXt ShQ"waY_FXt Sh\"daXZFXt Sha"QaY_Sj v(hj"SF v,h|"S8  v0h"S' v8h"S v4h"S $vS6EXZEE FEe[^_]UVSSPPVu ujVSh b%o,@uLUt"t"U0*Z"t"PSh"j\j?UVS]u VS蹳YZu Sh|"j\;/t"Sh"iXZu E"e[^]Re[^]U SPh"h*.>jUVSPh!1#P[^t,PjPuVVH-t jPZYS!Xe[^]UWVS EEu EE}]EEE1҉t{.&1ɉ x{.{.h"Vu.: NtJb$9&1={.{.{.|{.x{.뗡l7t{.jWh`9&5l7u h"jt[PEYY{.Jp#.4E)Ѓt~S6EXZEE FEe[^_]UWVS4SPPWu uuzjP5XZt1ho$9}PuCZY uċ2jWSh_h%l@uLQt"t"Q0'^"t"PSh"jYt@tx{.Z=x{.HDž"={.tDž"t{.t $P={.t J%={.t "=|{.t 1$1ۉXPQWh"h%jYSh"h'"V u h "jXj/G PZYt|#Sh"h?"V tj/C PcZYt|eXjUVS]u VS YZu Sh|"jDX;/t"Sh"XZu E"e[^]e[^]U]NPhW"h*.j@ UWVS]E1҉ 11ɉtp1h"u u5 athg$:&5l7ECpXDžp5l7CtX5l7=CxXDžt뀃K|wK|njuh;&5l71u h"j WP_:p#.P;UtM |u4uWEp ЋttKxPW覺ZY@u Wh($jGVptECpNtECttt E%Cxe[^_]UWVS SVpPtWu u1hWpShp"fh,@uSVh"jGUr@t@1RPh:&hSSh"(jUSP]jEPSqU :9uySu h"jEU]US]S Zt@ h#SZY]US]S Zt@ h< %SsZY]USP]jEPSDqU 9t :uy Sh"jT]UVS]u VS胫YZu Sh|"jT;/t"Sh"3XZu E"e[^]e[^]UEU 19s f3P]UERPZYË@t@Ë@ t@Ë@tË@htË@ltË@ttË@|tËtËtËttËHUVSӋEU tt RP9Y^CSt RP$Y^CS e[^]UWVSӋEU ΃tt RPY^CSljtȉlj{he[^_]USt)P8X<)P$[]USt)P@XD)P,[]UWVSEUˋuE $EE tH$HD11E ~E}ufCRVڋE E lWVڋE E }t}t#RP_Y`}tDɉ"$XZ"t9t h\"$X9}+uh"$^_ދ9|<t h"q$Yh5{.h"Džx ;rh"$XZu8u t h9"qX 11  ˆK1<1P1HL@DK*#_tM⋅9t Phl"#Y^Ht2{{ @D0{{@Dg"Zt⋅9t Ph"D"_XzG1t{${Q!^t&XZ$t CpStCH\Ɖ)kbƒu 1Ҋ t1҉RP@ȋ+tC@SDC,c)щ‰1v' 1Ҋ t19sC1ҀtSƉ׉1Ɖ׋)׀ts8{<s$BHQjPjjR t Ph".^_@ tFC8S8tGpBuT E8.q-Xe[^_]ÍL$qUQ 0.,.5(.5q-<-&EM MuQQ$RPh"MɍaUS]CtS P S tSPSCr s ZS 4.X]USEPsH) .$. .H1҅u0<.Z[9t T.uT.u h%"jX4CXtYZ@]UWVSu EEE#q-8.(. 4.M11ɅtJA9~ʳ9M}#t(.h9"hB&hhH"!}9x4u }9x(u9p$t버t(.e[^_]UWVS]uuu SO trNj@thj"hB&h1GGWX9w(~6Gth"hB&hhH"wVw 裺G [^WY.q-;4.X=L.u =D.uBGWuP.GWtPH.WGtG4WPZWX4.j@j跹Vj譹G _4E UG$W(G,W0wE #q-G88.tz8GC GtWP { _ Ge[^_]USEM Puh"hB&h4hH"G P ʉPHPPP s E]XPs2H .$..1ɉH @.H@..1ۉXt P.HP. H.HH.P4JH88.9t!tXYX tAP]UWVSUu }uWVRcËECUt0.R,.EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMYq-A,y0yq I4 s RPWVQC& RPWVQC&e[^_]US]C%CSjSZ1]UE UMQ1]Uj"UU Pl.PYtHJ l.@ l.UWVS] h.C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpdp Cb ${sN ]e[^_]< UWVS uE EEEE%.1҉Utp9sS0ud{M9O,uDM9O(uPuuu Ë@u7EEU t1C,S0C CC4SPYNS EEUO t jSXZE1u} t1u uE0x1e[^_]UEjjuuu PpUWVSSE E}Eppt^EX EʀtÃttRPىYY Ct1N9u9Eu1ۉ؍e[^_]UWVS u}j8jËEEC1CCDCC 1C C$hj贩Ehj襩M쉁jhj蓩MAdK1AHA 19Et EXEMQjR t1WVEPUBBRUuu uxƃ(Uu7jRE Epd u S IE싀}@u jR]^_}E UG(W,}x0xdEtFVtRPYY Fht1҉GW EWW 111E싐Eut"EHdMWV‹EEZYFMu uh.EE %.S0tK0J4..C4.C(tS(P,.C,.މe[^_]UWVS4E$EE tPPE:D1ƉE̋ENjEvS5uЅyh"hB&h"8}uv0U 1E!ڋE+E 9;EE }tY@]9~Y]̀}tIBEECE܋MЋEEȉEyh"hB&h)h"k@륋B 뵋EEPͥEԋEvƋEE_UtE EE1 t1u}u}8uEo¸v0E E1u܉uȉuĊME t@@]9%ME tPPEJÍD19EEtP19U9EEtXELMQjRu} t1WVuEE܋P }ԋ]܉TjP}EȋEE ‹EtXE1 t1u}tEE t@@]9} tuuuU 1ۋE؋EE9I9uEEtpp EƋE2EPjVEU t1RPu|EE܋P }ԋM܉TjPc E t1u}CMu  EEE tPPE)ÍD19Esot }_] 19]u 9MPuuuh"/}t/EEtP1uuRPh"]9]tSuuuh"uu } WY[9t$PRuuhO"u 1҉U u XEЍe[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEgEUu}1ۉ]ԋE9EEIu EEEȉ1ҊM t1҉E؉U܋E芀$EEt \)ډM]uuRP虛e؋M]999u 9u 1ҊM t11ɉMظ 1ҊM t1҉ӋEU؀}t UȉE9E|9}u9uE؃} uE‹EÍMQjR t1RPuEX E芀{atjuXZ}ucVEtK 9u׋S(C,K9puċS C$M9ErU؋EJPCPZZYU9닁{at WVh"EtC M苉9t.CM苉p9t$1SQ1RPWVh"C(S,C S$]9UrSPWVh"nWVh "w Z}t5EtC(S,C S$9Uu9EtPuh0"7 EUjuuWVSucE؃uju[X}t$EtC(C PWVhQ"EEEEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋EEIu E1ҊM t1҉EUEU+EUuuRPEuuWV9EuQEi}lj1ҊM t1҉Ɖ׋EUă+EUuuWV豗9Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMjuXZE9}u }uu}eY[^_]aUWVSu} }t#ӉSQRPhi".uH‰?9u*_YӉ9u9u :9r 9r}thz"Τh*.ZYtFpVtFHuRPuWEU}t h"۲XtE;Ftu[M;NpNHș9U싆`du<9Mu7t `d)RPh"./t `d)RPh"] tFpVtFH9Uu 9Eu1e[^_]UWVS u }Pj8j˚E1ɉHEMAAA 1ۉY Y$XZ}thj芚ËE쉃PXZu u =q-ƉE} t h"WXq-EPjh WVuhjËEp }쉻PP P jP^_=t w=bt=btP=EtS Sq-}tURjh  t1RPuhjFEEp }}M쉏PP P jP4ZYutCHSLC419|} tMhS"X@Et} t#h"ͯXu uuS9u uR X SI X]tS4 _13)t ǃ ǃL tX\1t.1}u}t@EUCHSLX`d1ɉt}u8}t 0}u&}u tCHSLEUC4EE uEC4uuE0jjSWh4SXZ؍e[^_]UE Pujq- UWVS]FHE1RPuu At C|}WjuȃRPVetPu h"\ u~ 1RPuu 衏tDTEU"vkk ׋GEEjVXZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuu€}tKt19suu苃0uu SZe[^_]UWVSE@E@0Et E|E2] u t]u}tE1ۉEEƉ׋E t1 9E9ƉM|BEE0Ɖ׋E t19E]WVUEZY‹E9sq~m1}tEPWVE ]EËERPʋEEH[^}t EP4PRY }9},|#] ]Et E!ËEU t19r^Eމ}t(SuuuyE}@,@0E@dpx ECuuUED_Z9|7} EPjRuuuE}1}tEPuuًE }EPEPEPuuuuƃE11 }x}tGu xuƋE|U9|~<u@EE@dpx xt!u |}}uEڋEuu ڋE|5ڋEUƉ׍EpDžlEPpppue‰EpxuZ J1E@,@0;Bu1Z4E, t1r,z0B BRS^pH]{ EGu(u$EtDEƉ׋C4SP[lpl9|}uuUElZYPuuuD‰EEtxB,B0|t |t2EMEEME|KENt|URjPWVutWVhז" LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1tuxue[^_]UWVS(}^4EUEU t1҉E܉U/URPuuVщ‰EЉERPKM܋]t+ +G|)uÉ֋EƉ~vaPJURjujjPZt Ph"TXZMA tP@G(W,@G jQYXtG(W,EЉUԉ_(w,G 1҉EЉUԉ_ vBHMQjPjjRt Ph"XZUB tXpuu1ɉH H$Xu u1ɉHB4RP:XE܉؉E܃EUV‰1 t1҉щ‰8EE̋P tJU؋M9ˉE}#E1ɉHHXpE ϋEMЋ]ԉL\}U؃v8M9ˉE}E1ɉHXEkEuЉt6M9ˉE}E1ɉHXE ku EЉD2BHAMQjPjjRt Ph"Y[uN EUtA Q$}u$}u1҉QQA}u }u1AF4VP:E̋@4uP1e[^_]UWVS]vfBHMQjPjjR\t Ph"VY^EP trzs({,RS jP!XZtC(S,C 1҉EU苳FHE,1RPuumt C|}WjuȃRPVtPuh" Ep 1RPuuЂtփ~u$~t:7vkk փ~t*uuh" tFVC(S,FC BHMQjPjjRt Ph"_XUB tNvHpuu1ɉH H$NHu1xB4RP:^juYZYtC(S,C 1҅u uSX.t C0S4C(jjP0uu S5e[^_]Ë@t@Ë@ t@Ë@tË@htË@ltË@|tËtËtËttËLtËXt Ë\UE P(҉]UVSuE H$X(1y6)tNp1SQRP誄 e[^]UWtBRBR t RPZfY_}ÊtBRtUWRP/fY_}ËBht1UWVSӋEU ΃tt RPeY^CSljtȉlj{he[^_]USt)P@XD)P,[]UStPpXtPH[]UVSuE H$X(1y9)tNp1SQRPc e[^]UVSuE H$X(1y9)tNp1SQRP  e[^]UWVSEEEp@}]8ـu  Ћ}+G4tDžEp 19}5uWSh"f EzBD1H)CNjE_dE@ EDžpq-pp@tVkh1ɉMU9~Ջ]xuxx"2N$9K$s4)xhE1҉UU9]4^`1pthh9`~mptF$V(x|EP4EtӋx|ˉT xAdhpt녉EKED@Hu]ڀt u!@]KtAA G`` E@ EEËEtppxtpHE  t1r,z0Bx}t !! )`hC&h("jEÃd$S\DpTtt RPaY[B^UEMhSQEjXZSbdtuubaY[EUEUDpTtM]19 }9Erp@dxIu EEEQÉ1 t1RPuuu1E3URjW1RPVEEtH`Xd EH@Er)ӉΉߋEEIu EEu1 t1RPWVt1RPh"7E.‹EE@ EEEJEtp`xd @@ƉEӋE‹E5EEAE؋EE)߉ЊM1ҊM t1RPWV"t]K!E؉wEtp`xd @@ƉE2ӋEU‹EE܋EvE)߉1ҊM t1RPWVs1uk]ӃK 1;{E@4uPEBHEMQjPjjRt Ph"[^}w H]]^S}V]t4Sx(u8E@(EȋE@,EċEEE؃}uc}u]E@ tEPPPu E @t2t@ NjuU؋E]KdQE X]C E̋E @$}t d1֋EЉĒt @ }̋uU؋EjMIdQ}u}u E M̉H}tZCr{<u.C .$.C@CC sh'"hC&hCh"jS艮[^E @ ]]؀tf@f@E @$E@M A$t }UJd1uE 1ɉHEP,@(E؉U܋E}ub}u\tPL@HEЉU @4EEԋEUr,z0 t1EtpHxLp4.6AM̃HEEЋE1RPuuaƉ׋EƃEۋMtEPjuރWVQ?tPuh"6 EEЃE̋]s E;1RPuuh_€}trzuЉ}#Evkk BEEԋEMMq,y0 t1}trzrC4SPZ}u }u1QEE]Ћu)։]ЉuԋEX‹ERJu EE1 t1WVuu_EЉUԋ}ЋEFHEËE"1E$URjS1SQV赬tPE1RPh"E‹]s EJu P! 1k}t)ȉ}u"}uC1 rE:1C4SPXe[^_]UWVS$u>E @EED1E؋V,u]9rE;F(~jVFXVWF XVRz(Z,]V ^,xt}x fB fB)É^,E @M AFPV1E܉E]9]FEE@EE]E M܋]H$X(MЉ]Ըt]É؋M9Mrh@"hC&hhe",MЄt]ԋU Љ\] EU`N,t})N,E)F(1e[^_]UWVSS] EC1Ex$tPGEGuha"hC&hh"蕶GuWuUZYtWSZYuF}S1Ce[^_]UWVSu EXE9F(r+V,Et  9s VuZYF,UUet)ЉF,F E}tf@Ef@~E@tE}tfHfH1C(S,}GtW EE@HEEO1ۀ}t_ E1RPSQu[ӋE%E}tEEPjuȉERPu荨tOPQh" EE@ EE1ۋEtGW SQRPY*E?EG1SQRPY}vkk ]GjuheDuVuhwDuVuy(hFuVuehEuVuTFU t+u  F؉F4'F,tȉF,EtfHfHe[^_]UWVS] t@ U f P8dǃ jP^Ɖ <W^FYZuWhx"1=.PE fF81FF ; ȋC AEVp_4Vp^19s~4q FYq Z1e[^_]USRÍEPjhjjj jShsU tShZ"Rj]US蔡Phj"h*.TSh"h*.TSh"h*.T$Sh"h*.TSh"h*.TSh@"h*.sT$Shc"h*.`TSh"h*.PTSh"h*.@T$Sh"h*.-TSh"h*.TSh"h*. T$Sh"h*.SShH"h*.SSh_"h*.S$Shv"h*.SSh"h*.SSh"h*.S$Sh"h*.SSh"h*.SSh"h*.tS$Sh"h*.aSSh8"h*.QSjEUSRhP= u Sh&$jf]Uuu up @uuhO"jfUWVS(`؟ԟha"Rh*rPEܟП119П~7̟hW؟ ̟u ԟ0F`ܟv1ܟȉܟ9}J̟hW؟譐 ̟u ПԟEܟF`벅u؟ht"je[^_]UWVSlj։1EEjhs%Q艷 t(jh"Su tjhQ#Sa u Ejh"SD uEjho#S) t}~Eh"EPhrWh"EPhrW =.t="}t"PVh"(M }uE4LG&Vh" M e[^_]UWVSÉ`dhPzlb1󫋅dhx|h"VhrS`h!"L|xh:"jL0tplhq"KL"u"RPh"#Lh"LDRPh"K0Ph "KXZ"4t"Ph3"K84LG&hF"KhPSVh"h*.CtCu-h*.hd%茘^_t}Dž)uh*.h&"h*.h:"h*.hK"h)‹4PR u1ɉP&h[ Shs%hP9|0h"`d[릃=.u1H .r|Xu=.u*?tۍ_hv%S}ZYth3#S}ZYt|ƄG|=~'hWPh"h*.=nhGPS计 dd!u [Xh%jV`Gkx1ҿ1ɉlx9sUHh9ߋlhsߋhlX 9s1ۀx  1ۀx  롋ы.t ~CL AQw Q1Dpk`9pk<t=.tw7Sh$"h*.;CG t GG \h*.w裐YXt G^G `Njx9rh*.j !(XZG\P 9sX XBtt9+믃9r s|(_h*.j 'Y[VPW gPPxZvPh7$Psy uh*.h*"Phn#Pw_vPh'k#Pw^vPh$Px dPw[vPh-"Px 0=.th*.h5"܎XZ1ɉ .hh*.hG"辎_X.LP$w^ v PhX"PGx j[ PvYvPha"Px u|E3PvZvPhf"Pw uB=.th*.hl"^_1.{h*.h"эY[._Ph"h*.8Ahh'k#P› e[^_]U=.iu=.t jh.h"]Zuj*USh"h .d! .XZth"h .BYXth"h .BXZth"h .AYXth"h .AXZ!.]UWVSu }1ۃ=q-ÍF .s==.t"}u^ #h*.PtXZuWVh"h*.k7؍e[^_]UWVSl]u }1=q-EF .r=.Sh "h*.7Kuu=.iu =.=q-u(WVh""jd]S1}u WVSN VWV YXt%RU!PSv MUufJ"uWVSu"Ã}uPK_XfKEe[^_]US1ۃ=q-ËE H .s(un ZtfPfPxtP#X؋]UWVS=.th*.h("ΊXZjj6_Xt^=.th*.hE"裊Y^ދ[F@H . s .sVm`V #XZu1;5..WVYXt{F .ra=.tS( PhW"h*.5{uSg_S"XZ"S_]s s@.C$@. [uWe[^_]UWVS}E H.4uW[1҉Ut7Mp p[Zuhc"Ã=.th*.h"XZCtSPNfc_X[u릾1;5..WV ZYuыXtCtNPP xu SbjSXjPPiPfc[룍e[^_]UWVS=.th*.h"~XZ1;5..sJWVKYXt3fSЃfC{u ЃfCft h"SPXZ[Ƀ릍e[^_]UVS]S^uSh"h*.w) 1Ouu Y[19Åt 9t@uu hC"$O ~u}t h/"V!PXZ؍e[^]UWVƉjhRP.t9xu9pte^_]UPhX"PvZY8u"h|"h"5Ȑ.h"h*.(j1UVS@fC5d.=~D`.)f.5.jhh.;Ht v-X1d.1CPS.P5`.Cd. e[^]USjjj0oU+CC]UWVSƉӉ9tR)ySh"h*.' j%RP6#U^thF P6"F e[^_]á.t#UPju u:Ht r-kUWVS =.uu 9uEfftcB1=d.tf҉jEPW9WCdYf E1;] }߃=d.tȉGffG=h.t?t=d.uGGG%)ƋOu9rG9=.th*.h"{XZGt=.th*.h%"zYXGW9s=.t+PRh?"h*.%=.th*.j RXZ?te[^_]USjh v-. Y[th [9 Zu S Y11҉P]UWVSX=.th*.hg" z^_5ܐ.5ؐ.5Ȑ.h"hh v- .߃uFh!%P_ZYt1;=..r%=.@ mVZX=.E}tPuPuS" uS6EZY~/9jPuSjSh"h"h*.EPSEPS E=.tPuuuhS%S#E PSY[ff~ u5 Z5.5Xe[^_]UWVS}E U9ÅuWuu h"!?hhWƃ y@Wh!"h*.h*.4"g0< Ph#h*. 1S ѡ..0Nj[Yځ~RQW @u55.5L.5H.h"h*._}f0"< Ph"J=.uURQV| @uG5.5L.5H.h"h*.1f0; Ph-#h*.$j %W~VxXZe[^_]UEU ]U:= r-#tjjh r-h r-蘙= v-#tjjh v-h v-tUWVSƉ׉˅ut;5..rWVh "= D.RPWVH.s{ S$=.t [$t9{ u9suh'"S=XZe[^_]ËHQ 9u BA ÉʅtJ9u@BUh6"P=XZUWVu} u1tC;5..s.D.RPWV7H.t;x u;pt@$e^_]UWVu} ut;5..rWVhW"; D.RPWVH.t H$9x u9pu 1pp P$WVht"; e^_]UWVSujj[_ÅtJNJ/t tF@PW3TZYt [u Ft[ 1ۉ؍e[^_]UWVVj/Pέ_Zu1,VeY/txtEVh":XZEe^_]UVSu>.F@.9s%)P6Skjj&9tC/vKSh":XZ؍e[^]UWVS}u h"j:[uQYƉ<@.uE5А._( Zu h"3:X)А. @.9r @.@.@.uS,؍e[^_]UWVSu@.uE5А.' Xu h"9XА.Lء@.19r _$(uËC$@. 1ECIDžuQ}u} ujjY_t Vh"@9XZVVP_C[ٸ1Xj/Vȫ^Z@PPPC{G C_ Y^Et5uu YZYƅu h"8_E UCS FC^5}u} t)uu ZYt h7"8XًE U7؍e[^_]US]SOZ@.@.]UWVS]f{t hH"SG9XZ{u&{t h["S.9_X{ t hx"S9Y^CS utcRPl_Zuh"S8Y^:9u#s{ WVKXZt-q"ЅtP9uSP h"S8ZY3@.C$@.Xe[^_]UWVS]E 8ƅu h"Sa8_X9stsF C^ j/u ZYx3WƉWNC$19VPPfSЃ߅uЃ fCe[^_]UWVS`=.th*.h"eXZ=.(h"u^_u,^0l4 Ph"h*.uh"g6fc 195..rIMWVZY‹Mt,AEJSBPj2U#UR̓1E1}E9..EuuJZYDžttj$GPEPouGƋG@EG t@EGt@EG t@EċG$t@ESjj(EP"눃EUU1 D.9~(H.1tBESjjEP"G΋E E̡..EUMԉuС..E؉Uܡؐ.ܐ.EU.ESjj(EP0"C @t,\02 Ph "h*.uh"4S)*Xe[^_]UWVS=.th*.hG"]cY[}uXjj5.5.PD.jPA& H._Zu ha"4^jjjhv%fHwjjuƃ y,\01 Ph"h*. uh|"3xPV3Y[y,[0y1 Ph"h*. uh"t3EЍXjS% XZu h"Q3YSWV y.x[01 Ph"h*.> uh"3j(PPV xV.ZYZu MJ tWh.h.4<ƀ. =.tjjh./jjh.S 8z-@u&h.h#h*.r. |..@h.llu?=.t5\.h#h*. h*.h#R1=.XZ.9t!QPh#h*.1ۉ.tx;ܐ.u$;ؐ.u|=.9u;.tRṔPh"#h*.hؐ.賁Ph;#h*.1ɉ .  T.\.=.tV5X.hG#h*.tf=@.t䃽u5X.~ˍN19}X.x9})=.t#q#~h#PWhl#h*.Ocs=.u`h#!ZSKt+@.k = .t81 .jh .Mt̃~Íe[^_]UWVSREh. d.`.9| 5.1H h.h P9~ 1|@u5d. 1ۡ`.؃=.t VP+YXVP58z-ǃ =.u5.9d.}(~$=.th*.h#OXZ.d..tu؅y1މm~W. 9t)P7t=.tPWh#h*.U =d.މh*.h#O@.ZYftCftfHth*.h# h*.h#N_X85.h1#h*. 5L.5H.h?#h*.= .uh"[uj2. =`.1=.t1jS'+ZYy>G03 PhX#h*.TjjؙRS58z-&Bu@t…=.th*.hq#N[_=.u .@1҉.d.PYct. PVh# +hh`.5`.VO h.h5`.u/\.X.@ X.e[^_]UWVS8Ã=.FC=TtP=ltIʁlt=Tt1#=d.u$=.th*.h#L_Xd.t=d.WȉCȉCCȉCC ȉC CȉCCȉCCȉCCȉCC ffC ChRPZYChs,s(^_C(S,C0ȉC0C4ȉC4C8ȉC8C<ȉCXZCth #h.'YXC@th& #h.XZ.]UWVSQMSZt$1tH .r11Sh/ #h*. eY[^_]USuhF #h*.h*.N̐.HQPy PY J t̐.Hy PwZ J: t̐.@ t1yt nw1y]UE Puh*.R = .u(hv""{u$Phd #h*.sht #h*.S8E E #]UVS]s s:Y^1t 9tF@h #SXZs sVh #h #hh..e[^]UVS]C t h #ShXZfK SnPVr3S\PPC$;PV$e[^]UVSu~t h #VXZV X=.u8hS蓑ZYy'fN@$0 PSh #h*.=.tSh #h*. e[^]UWVSuj/VZYDžtDt>Zy"#0 PSh #h*.=.tSh< #h*. ]US]{t hL #SwXZfC߃fCStY=.u-PcWZy"j#0 PSh #h*./=.tShc #h*. ]US]{t hs #SXZfC߃fCSY=.u-P+Zy""0 PSh #h*.=.tSh #h*. ]UVS]u;.u Ct1ʍu1ɉMfEEE'E0VhQ`5. @u h#jE<u 5.h#<u5.h#h*.] ~<tP5.h#h*.>_Pu󥀽_y-`9I&CSh#fh*. j RZ<h#6Xe[^_]USUBBPJ R Ph.# uE7#]4ShN#ԷXZ]USUBBPJ R Ph.#藷 uE7#]ShN#tXZ]UWVS } 11;]}#j4hT# uCPQ1󪍕JƅPƅTJjh'jJRjS5.QjPj!gW,jPjAPjRjVR VRPW5.5.5.5.hX#j oQƅRjh'hVjS5.ffЃf=v1RLhW9 HLRhW LHtmQƅRjh'hVjS5.ffЃf=v1RWhWh#Whm#eLgQƅRjh'hVjS5.fff=v1h#^X1G9 5Ct9C LHD04u5{-Rhp%) u Rh!"XZ .~tj X؍e[^_]u E rM19}V= .tUPh(#踟YXUt.= .uUPh4#蔟XZUBSWh"耟 NuE\4#e[^_]gE e[^_]uNe[^_]UVS]=.t Eh4#SY^uEEY1҉jEPS讹EUE 9u%Suh4#\ =.j۔8u^8u̸]1PSEPuVuu @u1_t =,.1(.  .u}u}tPjUEPj 4#UEmY^tF(.  .u}u}tMjjUEjj 4#UE#XZe[^]UWVS]=.t rEE518jjEPEPuu @uuh5#kjS虈W u%Suh&5# =.xj2jwuV|W`8u|1PSEPxPuuB @u1t =,.|t1p(.  .txpjUE1Y^ExURV訪EPVhC5#jduVɚpPUEf$tk(.  .t|jjUEXZEURt:EPthC5#jd]SVjPًUE$e[^_]UWVS({-8.t f./..SV.ZYuVh.ͨe[^_]É)@E̍EӉljDPh.褨h!%h.蕨uUWVS`Eh.ZES&1]M;>r2jPRU Utj@uVRP,V3hM5#[GjEPjh.RU Uu}u7}u1}u+E9Eu#/tj@uVRPV3h]5#jGM1EEe[^_]UWVSVUu=,.ˋ(. .u'@. .h.hm5#hY[=0.u %tDh*.jSu菰u5{-Php%z u Ph!"eXZ= .~tj oXڋEe[^_]1vs9}E8Ph(#GYXt Vh5#XZE e[^_]N@e[^_]UVS]EjjEPuVuuH @u e}t Sh5#jm . (.tjYY2=0.u Sh!"]XZuuuuuh5#Be[^]UWVS]uEEU E$E@. .=4.J . (.t}jjEPjuVg @tdMt]QM[ XtMMMjjEPWuV2 @tM;Mt W臷 _j.`Y}e[^_]f }tuh.h6# = t)tu*ShT6# uSh6#Sh(6#Sh~6#XZe[^_]UVS]E jjEPuVuur @u} t Sh5#jEUEU . (.tj sXP 0.u EPP5{-Shd%f&IuRPh$R uRPh6#>e[^]UVS ]EjjEPuVuu蝺 @u}t Sh5#j . (.tjC=0.u5{-Shp%誕 =0. h uuq t P֣Xuuh6#n e[^]UWVS,EE̋}uu<=@.t3EjjEPEPh6#E܍Pk((U܉UȉMQM萬 XۋMЋUuwM1Bt(jjURPVWK @uEԋU1Ƀt();Etuh5#jXuދẺE1 1C(9~ڋ0x3{px s{ pxs{pxs{p x$s {$A(뼅t%GPh{-uh6#jUR裒UUС . (.t6j(EYU܃(t Gt9|]e[^_]頳 =0.uuh!"菓XZv$v vvvvv vv6h6#f,똍e[^_]UWVS]EhEpEl}󥃽pu@DžtjjtP|Ph6#z|<Dž|tW[ XuCxjjxPVph @ult9xt Sh5#j2l%EpuEjj_X=@.t=19|Wh{-Sh6#jUR觐 EjjUG ŋ= . =(.t jL=0.u4Sh!"讑Y[%t h%#蜑Zt4Wh.7#艑G9|j 藐Xue[^_]a e[^_]ÍL$qUVSQ$EjjEPuVqq 轵 @u}t Sh5#j . (.tjYd=0.u Sh!"ϐXZEE1҉EЉUm\$E1҉EЉUm\$E1҉EЉUm$h87#肐eY[^]aUWVS@]=.t /Dž S_UXuhTS&h&$j'1hB%R=Y^t{18jPS/tƃ t 9u 8"uShH7#8uv ShY7#j~ hB%jx 1PSPVuu @u1;t =,.1ǡ(.  .tW EZ)P<$PUEIVۮ tR(.  .tj ‹EX+aP$PًUES腮 e[^_]UWVStx|h.cp.$@.FYl@.l)ȉp)ȉt lt|uH1ۋx9t担tq#tv%RPh%PPCC뿃} t~|Pq#xv{-RPhp%PP|Pq#xvv%RPh%PP Dž|{-|{-Ã=4.=0.th@.h!"XZh@.h.ho7#Ό EPZ$w,S&Phy7#詌_X}uC|@0|9hsPh7#yY^P|p4h7#a |p@h7#K|0`.XZpu hhq#h`.hh7#0pt q#6hhq#h`.hh7#h`.uB%ƀt2hWh`.Ohh7#h`.;B%s2hWh`.hh7#h`.B% s2hWh`.hh7#h`.B% s2hWh`.hh7#h`.B% s2hWh`.ohh7#h`.[B% s2hWh`.7hh7#h`.#B% s2hWh`.hh"h`.B%s2hWh`.hh7#h`.B%s2hWh`.hh7#h`.{B%s2hWh`.WhhȦ%h`.CB%t7Vh#j V3hWh`. hVh`.(h`.|h%Ph8#;|@H t Ph8# _X|p(h8# j % } =8.=@.u }y|xXDž1DžtxThj`SPPQt @hu\t|@9uߋ|@(9uΉdQh蟟 ^dtNjh󤋅|@XPwP§ Y|XX=@.uE t|@XhHw9=0.uh.h!"聇XZ|@XPvh$8#P趕X}|@t E iUE/Ã}tP@uj-{ Ph.h58#j+}s u|xtjh@.h.|x@u^jjPjxt8 @u<@. .=4.h.hL8#|@@EHs$@R&|xtv|@8d8. dul-t.s j|xtjh@.h.S @. .=4.h.hg8#襅tx \b|@4h _)jjPRhx@Pt跩 @ht*|h`t5|@4`$R ^K8 ]kЉX1ɉh`9htkh`|G8É֋X9sV9Ct FHt F9C(u:Nu*PQT ZPtރ NjTCXhsR X1.d1ۋ|;X4,F\s@. .t%xQuujPtAC`jjPSxt& @jjjjPSxt @UjjDžjjVSxt谧 @uI8 u3蟚 XjjVSxts @u jٺ.|^_9S蚢 [DžjjPSxt @tgjjٺ.|8uߙ Yuh.hx8#5{- KjjPSxt藦 @u jڸ.Sԡ XZlƀ@.pƀ.e[^_]UWVSƉLH.j=PeY[ƅPt9sx?u @ƅPGh#V蒃[Z.t{-{-8 8V tG=^jhP$Sb T F<=t:{-  ƃ=$.u h8# 41Dž81ۉh 1tpƅY1j,VPZYDžtG1ɉLPDžH1ۉ<1ۅJj=WZYÅu 1l@llh}#WZYDtj,SǕZYDt @Dh%WZYLt68#Lu%PVh8#2 =.8ju118jlPScS$S_ZuDžhDžPmh#SoZYBh9#SZY_uDžhDžP.h8#S0_ZSVh9#qhZ+$WZYuT18jlPS(bhl 9u SVh59#!8uq8h&WZYD18jlPS|i48l 9u SVhS9#8u8u勅48,0,90r48hcH$WZYtVh8# TBlHwR$XR&TЁTāT븁T묁T렁TPVhw9#1H{DžHplWVh9#DžPDžP DžPDߋPDu DžD<t Vh9# D$R&]1҉jlPWg<@l 9u SVh9#8u<@4849Ǹ8r9ufVWPSLP脔 @u%Pu 1 8uSŏ Xwjٺ.TjV.TS荏 =HLjV\`HkIe[^_]UE u@ t]US1]  t=U}tuZv!Zw t Yw 9u@뻃[]US]y...mt =/t=.t-ݛjt@j8(SdUjh8A#jfUu u։ ZYuUVSuV)$@PVPZ؍e[^]U.E]UVSË0>-u F0j PV" x;3ue[^]UVS@Ë5H.=X|-tjtSv蟰ZYuFl6j j5SHFSv$PFSh}%PH.5H.F PhOA#j@]SkSgee[^]USQtPؗ=.uS?Z]UVSÉu=.u VSxZYe[^]UWVS׉΋]Uu E E!UuUG%tq#[^_]USt<0„!1=.uS+Z]UWVSLEӋu>h_A#VL?ZY)ƒ?EljDUh3TSPbEUDEj URPEU:*u%jjWSRPEP{'tEuj>uE E9h3TSV e[^_]9`|-t3UVSRPjuVi`|-e[^]#.t ú.=.u.UWVSƉӊ>uuV.HtB1.hgf5.V,=.1҉.hgf5.S 9=.~؍e[^_]UWVS,E9. .];S5$/ӓY^y#...=.u`. .SvZ=X=&wAKw2iff~7[nRff~7D=,w$==!ff~7=Xff~7=KwJ=w$==` ff~7 =%ff~7 ===ff~7wff~7lff~7aff~7Vff~7Kff~7@ff~7 5ff~7 *ff~7 ff~7ff~7 ff~7Eۣ.Eݣ.Eܣ.eẼEfE1E`. 5$/fSj5$/IE.e[^_]USEPhht@j裘 1ۅu E]u+hgA#_ZtPU.X}%V~.hbA#_YtP%Zy..1ɉ \|-=. .t.0hrA#T_ZtPّ.['#~.hmA#$_YtP詑Zy..=. .P]UPUE .1J$@V&(f . UzA#U}A#g{UA#UA#UA#ۍUA#эUA#ǍUA#뽍UA#u.f .UA#uf . .1UWVSVhA#^PL^_ZX|-h%]YuX&1҉.Ph .Y[Ht .A#t .'#.A#.A#.%.#.A#.q"…y11........t1/E .]ڸj%td~7ڸ#uq#.ڸa#uq#.ڸA#g.ڸA#VuA#.ڸA#u  .e[^_]Ë..}..m=.tg=/t =`.uMU= /t=T/u..(=X/u..1҉.]1.á.t 1=.ú.....US=/t =`.ul=X/u<..u.8t.8t=.u.=T/u..0= /t.=/t9.~j CX]6]Uuj5.z =/u.8t .Ã=/uUjXË...qUWVSu }1+uG}-*u:Vt3st!dt1k1uUE 0e[^]UVS hq#jo hcC#Ch.h.h.h.................h>C#C1[<=:tjhrC#jq FZYu3hC#S-ZYu"hC#SZYuhC#S ZYtC#t&.FtfTq1uhC#@jhC#h-h.P1hC#@jhC#h-h.P0e[^]UE.]UE%t = .uKRuRho%=uhC#h`.4XZ4uу@QuQhC#R5.j h`.YF`.UEtjtUt@t+t%=t]UVSu1ҀtXPeZ;E GtDuw6)u"^t u B9u1e[^]USMP;U sPЉӀuШtx[]UWVSu>WZPÃ$V&%VF%  V?F % V? VuF% V? V  VAF%?@ V? V V  V Ѝe[^_]UWVS EU qu= .tw }8׃?π]w}8J ?΀]wu0J?πw]K]?΀]wUQU?ʀJJJ]JE [^_]UWVSE uU= .u~ 9sSCM9sICKB~Pg_<9r)S{Y"9sC%[tS[Z1Me[^_]US].1u7.u'-zu=/t|-[]_[]US].I1u7.5u'0-%u=/u|-[] []UE= .tE].]USS]uhC#h@./zw2SYt'؃@PZu@ShC#S5.S-YtS5.j h@.4A"E@.ySEPEXZ@.]US].-uH}-[][]UU 1}DuЃ=%" ]UWVSSEIuRP^X[RVZY1uEVLXt S踂Y-h@.jEPNVPguV2Z}tE8} tE 8؍e[^_]UWVSRhH#9hH#9ShH#P&NucjhH#VNǃ u.hH#P9ShH#PMu0ShH#VM ShH#PMEW` Ete[^_]UVShH#8P99ZYu3h#V蟃ZY1t=hW%V芃Y[1t(VCZt ؍e[^]te[^]UWVSlht`ƍxPVY[{%=eh!1#VCV_ GShV, #jhH#V  1҉p1ShW, t t u@hH#WMYZhH#W8YZhH#W#YZt<"u5vptp~HpSPV O tu QMyZYMuGCQV WV _Xu s yZYt,jj*u ;C EC3FC^ Fe[^_]UU Et1ɉME U]6t E]ߗ]á.t);4-t!Ujh@.P.@ UWVS]= .u..uD..Àu.Шu[ШtSS.%uF .A..9~1Ph.ZYu'1.P1.:Y=.1.=.t 15.s-f].9L-  PS.Y[@$W&e21҉.51. 1..t .8 1..=@.vx ugx V.=@.w1..+5.X{1=..8eu15.Q1ۉ.e[^_]1ɉ .e[^_]a1҉.T1..=@.v6x u0.=@.x ߀x z.=@.w1.1..8 u.8 .s.]1. .h-y.@.h-Y[ t9ىM{ RUWh@.t UMuʉY15.zWh@..@._X.8=.t  .tPQ 1ɉ .[V<EPrZE.t.tp@.@.<9s; u Ce-Ed-E11E@.9stub}t6E9s-M܉UuuWs UMuE|1}t8EE18Et < u_ 1EG눅..tPP Xj.)@Pv..)RSP#G.Me-8uCS;XuS%A ._WA .W\P Y[.M .txt/.Ph.-1҉_Z ...9.si.u,15..1ۉ.pu5.CYd.=@.v d-8HuhH#'Zu!%1..e[^_]e[^_]UVSQM1uu@.EQЀ w[jjjj uuuVtjhH#dY[11RjjE0RPuuVuɋE@1҉PU8.uEPjEP EUeY[^]1.9.|@.á.t @@@ Ã=|.uUj11Ҹ$XUWVS|.t`- 0- /1bDž{Po@$j辿WPVoDQ8QuZh"V1XZ$fSftxRP;WZYx,E%=ufSfthP/YXhI#%Zud P9XX~P-1Ƀx tA -x t tlphH#hn#S0|1ɉx =|.u:pl)ыt)Px jjxPohH#SSKWVG-VL WL XZe[^_]ú9.t9 .t 19.‰USR@.t>BE@.RGL XE=@u$.t t7tut g ]UVS=\|-u=/t =`.u$t/..u ujjj5.RP*V P.u =\|-u>5/./1҉.u 4YX5/.e[^]UU]飪UWVSt eYƉׅt‰@.D..=$/u0t;5@.D.}jjjG 1.$/ld2t8e[^_]UWVSVEj)ơ.u.ǁt#tj11u|%.Su5.á.ƒ.. t?x1 rjhI#FY[t j0j1ZtՅtVk1V(Xe[^_]USTá.$N   tw #5x.jCP7tW6%I/f5d.S5h.5l.ߟ1l.?E4x.؋]a..PSy<+u C< u.tPH Z;u 1.Se.X5x.jPCP9=|.S0X]q;!t.tP4H XS5.Y=|.ui.uh.I#hq#ȀXZMh.I#P=|.u>t91ۍ}9tt KtXEC<tθ e[^_]Ujj虶UP1҉@.YYu@. ыuUS]t CPX]UPGPEEUWVS@..@.e=.t1./1x.|.l.=$/t[=.tj3_@.t x@j荭X.\.苝Yu*P:t!u5.BZujǴ_=/t*p:t!ku5.AYuj蔴Z1/=.un1.=p.tjhI#訣[1p.:at h#耣Xt?uhj:Ģ_X WrY.=$/weu:{1d.1`.&\P菕Zze=$/+ej./t.7iCЃ .jSP_Zdteht.x.|.^=.t1ɉ ._=l./uyd.u_uh`.ƒ@+t t;!tA-Ҹu u ‰d.@@d.3=`.l.  =trSZH?E|a<h.1EЍEPEPEPl. tD,EĉE-=h.u Pw P_ E@Ƀ}}uEЅEPhI#x 15`.Y=l.Sl.YuS艒EЍEPhI#6Ch.d.Ht!5d.hq#5h.5l.s 5l.MZt5l.Tj1ɸ/&C$TW&*t@tS; u݃=\|-u ̾J5h-j+Y =.t)S}ZHu]EE1҉UURPAƋEY_tPZXiu0=.i j1ɺGx%i0S{ aFcx $W&j1ɺ#n x.19|.}h/1;x.|.|x.|.=L/t5\.5X.LF^_jx.19|.}h/1;x.|.|莍x.|.j1;x.|.|x.1ɉ |.=L/u+;x.|.}5\.5X.EXZjj5x.1;x.|.|x.1|. jjjj5/Vjj5/v1;x.|.|x.1|.=L/;x.|.}ze1;x.|.|x.1|.|jj5x.1;x.|.|x.|.F=L/u5\.5X.yD_Xjj=L/t5\.5X.TDY^1 x.19|.}.=L/u5\.5X.DXZjj5.6 x.19|.}.jj5.7tköUGA5d/1;x.|.|x.1|.d/5|.5x.E5d/fx.|.y 1x.,d9ѹ|u$du=t.tx.d1|.t.5t.5x.G_Xx.|.19|,fFhmx.|.19| SGFRP0EBx.|.y15x.5|.115d/RPFg8EȍEPh&$=.uEtEP1Z9tP.`.L./H./j(Y{j8//.1;x.|.|x.1|. . ...1;x.|.|x.1|.sx.15.Ѓt+Ѓ$5. t .1;x.|.|x.1|.ex.1.5.C1FP踳X/b"'`.P.15`./L.1=//H.1/h@#맃=|.qj 4-I# =|.M5.6h#PX u jhJ#5.6Ytjh8J#XZj -E%@5d.ѣjPx.19|.|x.1ɉ |.PZ jhJ#45.V1_PrYt VV1jPb1d.`.j1ɺ" =|.u) -#uE%j}=|.jhJ# @j1ɺJ#;_ ƒ 1?PSmp?Zj1ɺJ#>^ ƒ Sp`?lj1ɺJ#5LY ƒp glSp"j1ɺJ#%RZ/ t u.S}o_D.j -E%% j1ɺJ#^x. |.19}H/(H/ .‰x. |.`.EƉ9Љ}5x.=|.E)`x.|.19}H/"H/ .x.|.`..1ɉ `.``.XZ=/tp._UE= .t@]US]SjšZY19} B]UWVSu}t UE  u PZE EE EuEE߉EEM9EEujEPEǃ uG}tAE9s:= .HE9ҀuрtEt>WRXt1E9EsWQMR_ZHMt QtV3_u 3|$Wo XZtu h!%Vhd%WSf}tjSY^y S ZPX؍e[^_]UhH#juPbUWVS}1ۊtAP݀u59}s8Gt+8Gt'.<%t.tRFP-3Y^CGjCSȃXZutKH݀u=9us8Ft38Ft1 .<%t .tQPSS2ÃCFe[^_]UWVS]S臡^u1jjjS"Bu@thVS{ ~ˍ19= .t)RPZYu FSWk_XSjWƒ =p/u9PF4Yt"SWP4P9vR襭Zd1e[^_]UWVSu'X=|.!8u#P^h"N#PEZYUtN#RUB1Ɖ$81YP*1kL$QMWd-Pe-PURh+N#MQV$W XUV0ZUtRhBN#PDhG Sh#P2hV t'iWY>u Vf Z S] X؍e[^_]UWVS}1ۃ=|.u\WG0X$SWhJN#SPVuPǃ VP2ZYu S Y1W V XZ؍e[^_]UVS]h#S1^Zt(h@#S1ZYth+M#S1ZYƉe[^]UVS]SYuVS"YZu]e[^]'V!Ze[^]UWVS u=@/h|.Zj!hZJ#TY_?|uC؉E-uEh#V0_ZEXHtjhNN#s[^Vu.Ɖ<$.T$RUAWuURP)Wl VZ YtsfGftjEPVR Ht-WZKtcu_E18E h+M#~XBEPE8E 0h#~Y^W3Z;u S X1ۉ؍e[^_]UWVS}u =|.j蟒h}N#ZY~1E EN#e[^_]qVWSR-E4$G-E<$<-UMT$RU}EWVSURP$W V E@u t]e[^_]0e[^_]U|EPu迩XY1xE%=@UVS|u=l/u1V[t&V{,$P}VPh-\|PVNZYy VhXG1ۃ=l/uu!jjuuuu,t*E Ue^_]!+t붍e^_]W|$wUWVS4GEȋG EċGE7uui+=/u=.u D/u$Pkd.RPWVWVځƉ׃WVʼnZYuu؉}ܡ$/Eut u EU<uu uuqE؋U܉EU9uE}}$/!nEuuP)&ÃEU ~'=\/t(} t} uEU' t tؙ)]Ur'   E$/Em tuTi'}Ɖׅ}t(`.EtC)1ۉ]uЉ}iLMtN M!E!RPMQ%à M}tDEЉU$/ t uΆƉ1ɉ /E\/Eu襆)ډƉ t u9脆Ɖ视 t t u蓆 AYƉ3uuA)ډƉ1҉UUI=\/t' t u}tƉECuЉ}E}t =L/tƅRPj # j}]!Su%uuwW=D/t&WVuuRPE؋U2=/tH}tBy u$/t t@tqe[^_]g_1EE\e[^_]g_UWVQM1yJ¸u 1=`.jjPWVoeY^_]ÍL$qUWVSQ8QEU1M9ȋ}|&EE%=/ukd.9EE}11S D/uEU)juuRPQEURP[^y=/tL,'83 t u, u$/< u@)$/ u 蝃@u荃EЉUuu耄ZY&uu^_EЋUԉEȉUuuMZY1ۉ]uȋ}EEUE@$/Ey} u#"Å>H `.-CMڂRPu à Hu =`.~1/u}E=\/u~} t} ua蝂 t u u聂 u uE9ƉM0u}EU}u}uؙ)Ճ=\/t!} t} u}tu}EE9ƉM1u}u}ĸ1juP!uust EȋU=D/tWVuuRPEЋU)EȋU̍eY[^_]aUWVu} utYWV.ZYuXKt t uO݉5H|-=L|-4@w Hr5P|-=T|-e^_]UWVSu} uaWV_ xb)ޅ~j^jjjRPV tEj^jjRPM)S=L/Ee[^_] pWV9EZYt1E EN#e[^_]0Zjs^EUjf^EUYXEU!ЃtE9ƉEU!ЃE9]}O9uE|)}t#jjjuuE.)HP6WVƉXZutE21ɉ . .E)SjjWV.HPx.H9~KWV5ƉXZut4WV)xƉCZYE9ƉU|jjuuSMv2=/uts1.WV]jjWV.HP e[^_]UWVEU EURP)ƉYXBut1WVYZu$=L/t WV XZ5d/WV hM9ȸ}|6Du-5d/(~VRP[ 1ɉM EN#e^_]"XEUEUEPh O#XXZe^_]U jEP]\EUYYu ujjjuRP UWVtjh+O#W^_~}Ɖס.HP[Y9u9u e^_]d0o\WV .IuuQjjf *QRPY.HPx[9u9t e^_]e^_]UWVSu} ]WV}YZu t3@u|Ɖ׃=L/t WVmXZ]u} e[^_]|USZtjhFO#VXZ%q|9} .IQRPa ]UWVSSEE] wBu@ujhdO#V~ZYwƉ׃uu1E EO#e[^_]VSuWVO9| 5d/RP e[^_]Ê t u@UWVSƉ58.5,.hO#hS=wWV)RP4.SXe[^_]UPRXZUVSÉt C[^]UWVSƉU<\t <^Ct%x=u`P-Yx=uSP+Lx=uFPAÍP^wƅPhO#jRO#"j PRM 9uq#P#; 0.<=t#; 0.|:j; 0.; 0.9 0. 9 0.҅5-,1 v#u t|\u@r;yj=S.ZY9Ës%x+uQZYg<=t*1@< tҋ1kX8=tq#HP#;8F1< t#uً1V‰8u$q#iP# t tu䋅t3RP YZűPxP#Pd(8u‰2ʀ‰w8t1lߋ1MWt4.Ze[^_]Ë.;.~~. ,. .‰.US.X.0.H.[]É19-t @uUP?kYt.t.t.t.UWVSd.UjS EjS }tUuuP YXtP5 .} ljE5$.5$. 5 . E .E$.d.XZ1e[^_]UWVSÉ։9d.~ .$.< +t[^_]UWVS׉ˋ5,.V,.Љ[^_]M=/tt*ttt t XÃ=p/u[USjm5.ZYA#t:t1ɺNC=.tcS#t1ɺ*C]UhkS#.PUYZt ."h|S#.P0YZt .S#jh9W .jh(W$.d.h.h.h.h. h.1.ZU1}]á..U(.1.1,.9(.~" .,.$.1ɉ ,.@1......|.........h. h.h.~h.~h.~1҉.UWVS=|/uu uqƉ[X11D/ /u=|/u u$ZYt .@;P|- T|-9U] |%!ʃtM9 H|-L|-U | .@=D/t.u a/9.h1Ҹ WVY[u1ۅtj ]SRPlDS:Ã1/)9~1Ҹ F19tD5ݺF1Ҹ ..e[^_]áD/t/=|/u /DUS(.9,.~$$.<u .Ph.}XZCԡ(.,...]UWVS]u }Eu@0tj$zYEe[^_]@= .tWZ= .tw/Py_uS[ۃ,.~K1S ~YuSW_ZV$.t-fZYu,.$.DVe_tW,.uVd^ƒt .V$.teZYt t.t.t.Ӊ؍e[^_]UWVSEUMЃt.} u}u=.tG}EPjEU RPu ueu=/tV.tM E@.D.U#U ;E} „t!؃tEU @.D..]=.tT1ۉ.1.1k .9{~%8u u1ɺZYGFu1ۃ}tO . ,. E1~RjEP{ ,.1҅~ $.TRPuuCÃ=p/u}u9EEEE55.+5.E;5.'EPw_`.9.uY=.u=.uEU ..1=.~+9=.~.81ɺ>Gh.yY19}E81ɋUG`.9.|1}uEPh.yXZ(.9,.~Չ19(.~= .   $.<<@B)5,...9`.}1ɋ(/ Kݸe[^_]UWVSƉ׃=p/tCP[.+.-;.~u u1ɉZYuFu1e[^_]UWV։PuWV ~e^_]UWVSƉ19x.~ .t x.)C1[^_]UWVu} =p/uщu} 1^_]^_]n,.l..h.ál.,.h..UU1wR5.ZYUS]1w%SZ1uS5.ZY]UU1uj jKN1҉PPYZUSU] zt)tuzt \tjc1B4x;&9tu&ـuH &uBS!YuSZ]UVS] uVjSw 93sPuHZYHte[^]UWVS ÉUu} .E=p/u#=.uS.Zt .1.._SPEZYtIWVM^_t R.xt .Sh.%vWVMZYu5. 1.Sh.uh.k. .Pvh.Uu.@}.$ .`.9.}%h.PuX..=`.9=.| ,.,.؉ESjEPuU$ t9r)ډh.t5. 1=.[^/t /uuu} U,.~7;(.  .|t $.D0te[^_]uuu} 1ɸJt1tq .ЉERj]Suƃ  .E9s=)У,.RjStNj$.,.?4WtV).~뫣.z},. .= .u.P8rY,. $. M9u3_u(t M..t EMMb_uM .UL_uGMAt?S~tZt .E*,. .PqSPuE u1ɉ . /t =/uuu} U e[^_]g.+.4- \.~9|0-)ș);`.}sd.)WVGx%U KYZK= .tv =p/tT)PoZtu} UK= .t+SsYtStZu} e[^_]u} MU؍e[^_]e[^_] UWVS]u }.t4 u t`5.5.1ZYt 1. ud/t /uR=|.. 5.=.1^p.t.@x.1ɉ |.4뷃= .t|.ubx..ÀuWV1҉"[^Шu%ШtS'n|.5p.=t.Yf%ul x.Ax..90Ph.Ln5p.=t.[Zth.nWV. x.1ɉ |.uV-SݛXZ1jjVsP u뾍e[^]UEo1҃t -]=/t&/tUSJZ P+JZ HX[]Ã=.y-U=|/u .1|/jhS#3ZYá.xW@d.UWV1ɉ .5.=.+9Ɖ}jhS#=4.XZe^_]ø. @=/u1//../////1҉/////1ɉ /UWVSEEE E}M//t"C 9{}E9Cu E9C֋s/t / .1҉.pxH }xUPC=6/.ub/xHE0u/t,puX9} E}EE}ًEǀ}t E.‹ BA[^_]ÍL$qUWVSQ QEU=|/t E]!؃u 111}9Uй5/FV /t]9؉׋]}69Uu9Eu N^})..1=.~GW /tBN^ M]M])ӉM؉]܋M]+M]MЉ]ԋ]9]؋]܋MRPW[^$O_w E9ƉU}XM]jjWVƉ׃$/M]t u M]M]WVSQM]]9uEM]uu#WZYlN^~ v9uE}RM]jjWVƉ׃$/NM]u M]M]WVSQM]M]1.ȉڍeY[^_]aÍL$qUWVSQQEU}9}/,s{/tE9ƉU}9}u9uu CS K/tEU+AQ+u}9}cq qMU[^Mt qyAQ ]9މM}jjRP$/uʼn!уts sqUZYus{CS 9u]}0jjRP\$/r!уeRPEUWV#EUeY[^_]aUWVSQMSN2ƉOEUXu$ux9.~ CS!2Ɖ܋u}WVY[M9u M9ueY[^_]UWVSjj{T^_uxjhdO#1..ZY1111҉1ۅuuRPEUWV;EUjjRPp$/u uu1.e[^_]UVSEU =/t5/9|)11[^]USZKJy ;J|< t Y RPZY]UWVSuE E>-uF"4KhE%'V'h/#z' Ej5YFR&jhq"~:t>u R^8_UV輱Xt̋URUuÉ<$kL$QM8*WPURhר%MQS W! _usV7YSS j<uTu,jTj;}t&uA&hS#7&*j %% E.uGX1҉Ue[^_]SUWVS]EEEEuu QZYt jhS#h"S0YXujhT#*XZ8IhE%%S%h/#~%oDh$j:jSjj }u}uCPÃtNO@u,E UM;M MM|E UƉ!@tt t OÃuVޠjj fjSj:D.j`Re[^_]UWVSu6EU_}u }tcj-Ɖ[u u11j-Y}.uRP*M9Ή]| RPuuBu @ujjuuWVu 0e[^_]ÍPw k /GPw'k /1/'t'/#tUEEPhT#(YX1ÉUS.w$tX/'^./1/// /tP X1 //Pt jh+O#g.N . ////jh/-./ /Y[뉉txux ujh0T#'XZ1]UVS /1۰#4t'5t C'Ca1ɉNF FFFtP Z1FC6ue[^]UE]UVS E%tYu EP,UEY^u uB2M5.sS CKCtP Z1C/e[^]UEt*xu x u]zB@ @/]U Su]jEP>,UEYYut@ . /$/(/E,/ /tP Z1 //UWVSPEf=/uJ=(/uA=$/u8./1$/(/d/,/ /tPa _15 /{u#j;PsiCs7 1ɉKs {SC;.u RWV UPGZUte[^_]UQMt.9Ptjh=T#.%XZP@ UVS]u .1k9$/u$90/u9,/uPa~#4t P'@5u1҉[^]UU19$/uǀ,/ǀ0/=u]UWVSu`[1(/t:P葰PV  uE$/(/ 1҉(/YS Xue[^_]Ã=/UWVSu hn#uJ / C Suu0/ue[^_]j }WRPsu s蔾Xh#VdZYtVWsPhVT#u֡UWVSUBE:mP8 UuXÅE8 u@Ej URP7 ƃ xuu=.E8 u@Ej URP=Ѓ xCU: uBU1҉SK C9~CCtPr Y1Cu>/CZe[^_]USE] =|.t1E EeT#tS.l.XNt1ۉ] ET#u=@|-x1ɉM ET#^S-ál.ZtPļ XS!P]l.S誼 5l.]B=@|-y1ɉM ET#]!l.EEPhT#!XZ]p.-x$Ujh@BRP.RP?d/USEtzE 8.MU u4@E Qh%R%- }t jhT#}Qh%R }t jhT#kd/-a-yd/EEPhT#>PhU#j ]SSp~P|0uD]EPh#U# XZ]á-x$Ujh@BRP.RP"H/USEtzE 8.MU u4@E Qh#R- }t jhIU#}Qh#R }t jhaU#kH/-a-yH/EEPhwU#>PhU#j ]SSS~P|0uD]EPhU#xXZ]US] }u!jS萏YZt]EPhU#BXZ]US] }u!jSXYZt]EPhU# XZ]UWVSUE t tP]+0/^w=|.t1ۉ] EU#e[^_]P*PzPMRZYt]e[^_]ݠPƉ׃utS;5d/WVe[^_]USEU tXtugR*أ-YYR)áأ-Z=ܣ-t tP贸 XSPMأ-YX]]钸 أ-EEPhV#XZ]US] }uC=/tS3*.Y,@/h!%sSsXZE@]?s]UVSE] ,/E(/*,/#tRRJYEEPhX#XZ]UEtHw1E EX#]x.]U}u= /u]i1]S1]UEu=/ K/]UEu*=/~!EEPhX#/XZUEu*=/~!EEPhX#/XZUEu#=/t=.tL8Bu @u]]UUE t#u?-^u2@t+-!-PHEEPh Y#N US E1ɉ / /E 8,t)EPh$E P }t jh$Y#3/E 8,uf@E EPh$E P }tjh¸T#u1]1=/U/EEPhY#ZYUWVS}]7cY18-u@Q1ɀ wj WP yڋE t1҉t؍e[^_]UWVSM/tFPtu)QjP_XA/ZjPEPH 15/1ۉ]1E8PU-tC $~/Br +tU9 / nP-uEE-1+uEr@/j+UjEEZY];+u$.tP _CP.YSJfh@ fXZEn=/tz1EMu*SdE؍C1҃‰U܉$_U܋Mf9M܍EPjEPËEE1ɉM ߋMu G1<+=u*tStMEPhZ#@EɅu&M}EuPh+Z#}XZPhdZ#1ECtt%tAS Cu҉vC Kut H PE8t,P8 uUUs E_u&IE8u/9{jQEP C]tSjZYPS2 XDe[^_]UWVS ]u }翅u jhZ#Cu@t:EEPhZ#lusEEPhZ#JƒuuU:80tj#XCttHtgtC1҃8‰C1҃{ ‰ft2t<St H~quGS C{C St H TGwLjhZ#5t)u9EPjEP }uSjh[# Y[1StuPXZu@ttCt61uSCu>u9CEEPs!C8yjh)[#X Y^jCtF XZtC t.te[^_]UWVSE0mX^ v1ɋUE C111~Љ w Bk D0Aރk Bu}t}1҉e[^_]á/=/tUShD[#n~P~Y[u /@-;t CtS C t jjSXZ$ۋ]UM@-t9tBt 9t$1҉]UWVSEE1EE111E@->~1EM؉Uu7u/à U܋M~ZEE܃߃A<vG}-tA}u9t%9~-7/Z9Eىu1ۉ] 1ۉ]EFtE@Ep[$G}t}t E1EEȋu} t tE Ee[^_]Uhm#|YtPQZ~-øUS =/u[h/aZtL1/E܉EEEjEPjd E9$/u$/ۃ`[/$/;EMMEEE=/t=.t=8/u-=/ttPjEṔ EufE=.u);P=-9u $/&Pi^Xʃ=/t ƒftըu1/uu u6à 1ɉ /=.tx*It 1҉//@/~+jX!8h8#ZE9$/tt /؋]Ujh/B`UQEPEUUWVS 0ũ u^É4$T|$WVuhf5#WP׀؍e[^_]US]S蔩 ZuShm#h/ /]ÍL$qUWVSQYq AQEU}WRPq1upӉщE؉UM܋EuƉeWuuRP:pu؋}׋EUM!1M]EE9ȉr1EEEUeY[^_]aUuujjdu uUQMjhiA@BA RPq1U EEUiEi@BEjEPXZUS-@/t,-@/Sh@/5-K} 9t .]UE-]Ã=(/t 1(/B$U=-?/r|-P-M1 /E]UVSP$/t .E1$/EPSXZt'u $E$/XuJ$VoYC"e[^]US]t CPJX]ÍL$qUWVSQ8QEȉŰAEċA Euȋ}̉3E3U)E]uMQWVRPqEUKEЊm#EUu҅u΃}yC-YSukXZeY[^_]aPUVS]1)EM}Im#uyA-NQu ;kXZe[^]ÍL$qUWVSQ ȋ1I@E1҉UUUEEPЀ wPPwP PwMP9UU~BMjjuuuu}W9jjEЙRPuuW8 ]F8M뎅t1ƒ}uEUeY[^_]aUWVS1E1EEEEPЀ wPPwP PwLP9UU~AjjuuMSQuV-9jjERPERPV8 E8댃} tE u0uEe[^_]UWVS1E1EEEEPЀ wPPwP PwJP9UU~?jjuuM1SQuV8jjERPE1RPVa7 E8뎃} tE MuEe[^_]UWVS U] 1<%tJMP~XBE؊B<%!hWVSjubu Z D(/e[^_]U4tPw @rP:UXUWVSu} ,/cuWV3XZE e[^_];=4/uldh.WVh-T.\S%g9. .e[^_]WUEU E q#Eq#m#]UVS]u Tuu ]e[^]-P1ZE m#Em#؍e[^]\USQtu u>31YZt[=. .j ZQujA X؋]UWVS]uE %=/u>t>S$PhPj jjjSPh$9t|V輘 Xsuojjk 1=$/1҃=t. PSW t"Wy _}u)jhm#[^tP6J ZY>1e[^_]US]tP3" ZY1]U1}]UWVS|}ue( u ZE E/x9s_E xu Yw 8u 9Et 9t(@B9EuEX8EMEG띋E1ۉE10E]1}1}$1ɉMMuuPuVjWuD ƒ1Eun؍[|yu19E E H]9}/3{yMu$q#[<:N<%<.uFu!1E1ۡ.H9~eSpƉ׍CEXutEuSY9uM|29EM|!Ѓu!WVʉSn E]z Et e[^_]`e[^_]UWVS]3t~v - V' ZY1CCC $/$/$/$/e[^_]Uh$/XUS]$/-t-=$/ujhm#XZ]1=$/$/E]Uh$/'XUVSu] <t1ٸ$/t;pX[^]UWVSEUE|E x.p+l.h5d/ duu8EU =/t4 /ș}9Ћ}|AMMuuZEUXZ}u }es%|x!uE|Ex]EEEE1t$/ixu |t?er8|9EEx|Eu"Et}9|x}}}u} } EUW~MEEUEt*RPuu3Ɖ׃}u}t>EU4RPuuŮƉ׃}u EU}tEUu}u~uyesX}u-&Ɖ׃u#u Ɖ׃u u%11eWVTEUYXu}} E }x=|/t )ؙ1)=~WVuuuu [Zt}뚃=/tEPEP5/轮t $/t ] /t /u=/t =/tu=p/uSuNPEjEURNESEPuuuN$/(Eu0$/$/9EM|!ЃtE;$/E$/|lUsjjEPEPR`us3^$`t2EUEUu}9uEbU$/P[uC<ujj]SMQuu5$/5$/$ EMt%tEUSQuuMM}=/u(tEUSMQuuMwpl)ÅEJU؅?֋M)΋ `.M1ɉ `.M)ȋMEUEU1ۋEUjjjRP~9EM} ߋEEUEU1EUCFjjjRP~9EM}9u|9] E`.`..}$tzM؅tshd)EE)EǾ9KEEUEUu}WVvZZ9MU} 9]~CΉ֋E$0xu{ u{ [^}t}EUW1ɉMu{ u{ XZu$/tWsSz Zjj1CCCj @u]e[^_]y $/C$/.e[^_]U €u1=$/1]UWVS4u}$/$/EU$/$/EԉUt>EU jjRP袧E܉UEE}x8ẺU1bu;]tjjuu蝦ẺUC$/Eȡ$/E@u}t0E9ƉU} !u$/$/]9؉ӋM},#u kd.׋E܋Uuu  9}%kd.]ߋ]9]܋]M}P]9]܋M]ًuȉ}C}kd.9E܋E|E܋U)ډEU 1EE11҃ut6}u}t9ű]}ű}9< E܋UEU $/>MjMQjujuWVY 7$/ $/EUut,9É|}9}}cEԉU؋}9׋]|MEԉU؃RP[^t2jjuu诤Ɖ׃utyEԋUEK$/$/!t 9U}}I1}9}};uuJZYt*jjuutu}EU뒃uEU$/$/EԋUأ$/$/]9]܋]M$e[^_]U jEPWXZ}u}t jjRPuutjU1$/=/u]]USj5L-@'YZt4jٸ$/Zt =/u=$/uW1]U=$/u /$/$/$/]|UWVSU EEt :DM@RtE3$/ s,jhn#E"u jhm#Ht=/=D/=/1ɉ $/E]3Ɖ׃u}5d/P"ÉXZe _=/=D/jh6n#_XE+j,^@=$/@1ۉ$/.EPM$/Z@t/ D/j1$/X=/t =D/U.}Ɖ/u1Ʌt1.H'uM@uu5d/cX]QMƉX}MtMjjRV讠Ɖ׃Mu U111`WA; .| DQMtƉ[Mȃ(KxSXƉYjZVMEPjEPjuujjZY¸tGhun#S&ZY¸t/h#SZY¸tjSIGZYxPHX1]UZu E6 ‹ENt Hujh{n#jhn#XZÍL$qUWVSQ $/"p xutWV ƉY[jj講EUXZ$/uFEPEPWVĕE؉U܃}u}tEU}u}ujhn#QY[=|/tuuuu =p/tEUju{7P7ESjQjEPuuS7(Eueg S_g XZEЅu u؋}eY[^_]aUWVS$/ $/]11~1t2У-t AFKމt $/ $/[^_]UWVS$/ $/]11~1trУ-t IFK݉t $/ $/[^_]á$/á$/Ë$/tUrLZøUjq)Zujh_#DZYyjPDZYxU$/]øUR~jEP5$/U ty jXфuHuUS]} t0tu y.39ӻ˻r1u vH[]UE1҉PP]US]tP^e Z1CC]UE1҉P]USUBt XZL[]UE]UWVS}wSKS Kr{3[^_][^_]UWVS]E EC9C|WƅujjWVRPCPt& HP5-P$^ZtbShV,. NhT&P#^Zu @׀8 uS_Yn#hf}#P#ZYt @׀8 u S_X8t%8,t8 t@Ћ8tH5+/R8%/PY^4%/t S/_Z@8%/P #u|w#e[^]U,/jj覎XZUhj蓎x,/XZU!,/jh`)/ *.Q*.y ;*.| t*.J *.Uh*.PEXZUWVSREƈEj}W5,/ $ f=-tk1x,/5-jW5,/<j=x,/t.VV"Pho#> Ktjh@%/5,/# 럍e[^_]USQh4o#Ljjkjjbu 2%Åt4EPZ9u5 h:o#Ljj jj]jj jj-j/S:څtPjRSWh*.h#gh?o#j՗h*.h#LhKo#j躗USQjhF$5,/x: f=\-t#<-;tS~$S5,/K: jh/#5,/6:jEP5,/e;}nu5<-hVo#0=XZ]USPjP]Shho#4 t=|,/u)-SRZy Shno#<ZYhE tPE X+u}f= -t WVh9p#WVho# jh+/5,/\1h`-/jje[^_]UWVSEhVho#^ 'jh|"5,/0jj jjh,/jjw(jh+/5,/2à yho#'BX11ft#jƉXPQY9tGAj5,/աjƘjj}jjtV# VhPp#l3j)f=|-tj蘤)RPhbp#}jh+/5,/ 0h`-/jj虻jj  jjXZe[^_]UWVSEzhVho# 4jh|"5,//jj襁jj蜁h,/jj(jh+/5,/0Nà yho#@X11st#j衣ƉXPY9tTNj5,/pj5,/cjTjj jj$VVhPp#1j#(f=|-tj&)RPhbp# jh+/5,/.h`-/jj'jj蚀 jj莀XZe[^_]US,]S5,/&[h{"uytUС`-/uUУ`-/Sj5,/谹h`-/jj袹]US,]S5,/Zh{"u tU؃%u ESj5,/L ]UShShlp# S:E-[tE-jhW$5,/S- U-tU-5-t5-5-t5-f=\-tzŨ-t$Ũ-f=̨-th{"hS#qY%-t%-,-D+/5-t5-jZE-t$E-f=L-th{"hS#|X]Ujh{t 5,/`jQjhzt 5,/f`US]e1ujP-XZ]0US]CCtu P$ZYt1]UVSEhsp#PZYtPr^yhT#[Ph~p#hPP-Rƅul-u%-$-X0Z-$-1ɉ $PhN#SSj~u*hk1#/XE-X9-X1&-$h`%/+à ,XPV Y9ut th*.hp#XZ댅yh#蔞xuPhp#uPhp#h*.0 Cƃ`%/_%/8 u =`%/vH@`%/e[^]USEjPh+/hp# uxh+/hhP*+,/yh+/hp#,ZY?hSho# t h+/4X5|-5,/S ]UVSjPh+/hp#q h)/h+/Y[uEp#e[^]m:Hu )/)/5)/hhPL*Ãy5)/hp#+XZ+5)/hq#hVi*hq#SVe[^]UE"jPh ,/hp# uXh ,/fh!1#Pk/ uh ,/hq#R+XZ)j5-P f=-u,/E5UVSjPh+/h.q#) h)/h+/Y[uE5q#e[^]%9)/Hu)/Rh!1#P.à uVhq#*XZ@)/f=-tPhMq#PhUq#hV)Vhrq#S! e[^]Uh*.hr#ʂjf UWVS}<1ۉ+/+/x+/%1u~11Ejh -h0v#u usX=)/uh*.hr#Ijt&`'FtrE96/ kU DЉEx+/뉃a$&nEtPt=l7WQjYvhzu#Z?95l7jh"Vik jh"VQk hx#Vk^Zƅhu#j賂l7h%SkZYkh#SkZYLhx#SkY[Åhu#뫡l7+/l7+/Em=+/t hu#sl7j/RU>YZUt +/5Rh%h+/:6 EPjhjjjj5l7WTx+/U P5l7hu#R@D+/tehv#tMl+/p+/@+/=)/1vldZRp#.E)t8HuR}t hQv#KE hS%RU!jYZUt+/"l+/p+/@+/hjuhjuhjuhju 5x+/hvv#j h)/J%h)/u h{v#@u hv#jh*.kgVXZtKth% h#hx#& Xt 1N11҃=)/1̨-L-=-1ۉ|-=D+/t ,-=l+/t5x+/9 Yu.t hv#j=l+/u"5x+/ Zt5x+/hv#jwe[^_]U)/jh*/U4hѮj\tEXZu5EZt1)/=l+/u!uj-tYX=)/h*/Zu+j CX=@+/tPuK#ZY,/jY,/yuh&$XZ)/V=)/IjP0XY,/tP#Y,/URP#NXZ=@+/uM@EPj5,/̬ jh t 5,/;U jj'sYX1}UWVS]=8*/uhv#ZYu hv#j}hv#=Zt8/t P ^x-|-v#Sht-EP_ ƃ 1҅=+/t7+/+/|+/l+/1ۉp+/=x+/u'x+/%;/u%+/jS)ZYtt+/t t u!h,w#Shv#^_ h w#[j0->uUVQPK U-Euԃ=x+/u hx+/h4$Pk @u x+/%ht+/h|%uI @u t+/=p+/xj:h]w#ua lj=p+/+/uSh`w#!t$=+/u+/=+/u Shxw#j|j:ht%u D+/=l+/u3+/tp+/tR5+/dZYl+/|+/j:h&u t -j:h&u t -j:h;#ue t L-j:h#uE t1L-j:h]Q$u( t \-j:hu#u t l-j:h#u t |-j:hO#u t1|-j:hX%u t ̨-j:h Y%u t1̨-j:h"un t  -j:ht%uN t -j:h#u. t@+/j:h#u t L-=X+/u X+/h-=d+/u d+/`-h+/t Ph"^_`+/t PhD"|Y[T+/t Ph&fXZ\+/t Phm%P_XhP+/h%u0 @u15P+/hL+/hHo#u @u1ۉL+/hH+/h-#u @u H+/ +/4*/8*/4*/tj,S4ZYt@+/4*/؍e[^_]US!S 9X<uY8C L{ t VWXZYtAEPuW4 YVC Zu hx#5#Xc9s ts tC Ke[^_]UWVSƋT//C!wKT//XT//"8*.H*.y;*.|*.P*. h*.j Y[뵋>W_UZÉT//F<w <tj<t<f~ u=CT//*.H*.y;*.|*.P*.!h*.j!Y[6h&$XZ|Why#T//F ^_tbP<T//v Why#>Why#T//F Y[t'PPrTT//$h&$S =T//"~1T//h1#!Ze[^_]UWVSQ} EUZ:EE<\t<^uvrtlZFdZBpЉw0JMqЉw@ y#t38uF*uDr^ЀvZ ZDЋMA\]8t1҉Z[^_]UWVSS]h'g%SXU^_ug@-; CtcE.ƅUB@tj5,/&$j0j5,/jhtz#5,/ zz#<3t<0th}z# hz# XZj/EPhf@5,/j>jhz#5,/8 j/ j5,/jhxt 5,//>5,/d UWVS,]1of=|-t hz# Xh*.>,}W5,/6M@Wj5,/=j5,/ jhz#5,/ 1#1#jhz#5,/Y ؊t =u,@SmM$S5,/. jh1#5,/ 1#2z#؀1uj5,/H[_=//thahTz# YC<w3$&h%hW<#hz# hz#h {# ZSSh{#  hTz# X1e[^_]Ujh1#5,/V KUVSh<{#&X &1tlRPhp%h*.CttHu)h*.hO{#h*.hW{# h*.h]{#cYX%#u8{#Fh*.j XZe[^]UWVSf*.fuURhht@P; Pu fEfthe{# &[ &tIt>UQMeKY9MU~ 8{#QRhp%h*. Ã%#h*.j VXZe[^_]UZZPPPh}{#h*. w//t@th//XjUWVSSt Éֺ &"h}|#h&hh|# Uu :u!USPLZYUu=//e[^_]VSh|#j}UEuh#h&hh|#T@0h#1UEuh#h&hh|#jT@0h#t1UEuh#ht&hh|#4T@0h#>1UMuhx#h&jTh#T11f3A@=uUVSEu ]uh#h&j`uhx#h&jah#St0ffPh#fPĥ# fe[^]Åt$1ɀ8u"UJRPRP 1ɅùUWVSÉ,0hv Dž0hU1׋,03s DEsus 8Es <E41R(4@&*JZYtdG (uh#hj%h%$h*. 4@&h#h*.j C uh*.j _XFD&EsR@8t54Vw @WG$WV VEP MU1e#sj@HEPl susuh#uh#uh#uh#uh(#U$19D&t@ uRh# 4@&h#XZ}tEPh4#[^h0)uuhT#Y,01e[^_]UWVS]uh#h0&h{uh#h0&hh#P11{ u.h#h0&hۋ=߶xtgtEWVhPs:u s h#n=ts h$#'ZY1uh# X䍕uu-WVhPsus h=#Su럸"=thPs hJ#xe[^_]UWVSSljUQ ^t#u uSuWÃu V# ZHW{u uSVW-9uSuV\ u V# XV# BU벉؍e[^_]UWVS@]uh#h &h8C@uh#h &h9h#N{ uh#h &h:߃uh#h &h;ŋuh#h &h<몋1 9Ɖ} PQḧ́#9|(Ɓ tPQh#& 1jjh V= tS h fUtts hj#/_X1jjP9u 9t-uRh#ryPRh6#u to@u h#qmu h̅#S󥍵Ѷx Զx9t PRh#\)P8uDžWhmdsZ/ t h#goZcCjj -1Whmds/ ;Vs h## Dže[^_]U'NPhr#h*.[jUWVS`֍dx1j`StjjjLuh%Sh9iPO. @u hK#jHWVwXe[^_]UWVS։ˍ1ffDžf/[^_]USfx uX1I9~+|uD BPX19}|uD AShX#XZ]UWVS`Ӎdx1j`Vtjjju h%j+VVh:iP- 1@uCPh_#mXZW.e[^_]UWSÍ1Dž7hw#h#h#h؈#y h#fh#Vh:#FhZ#6 h~##GXZދQhX#$XZ뛍e[^_]UWVSfN*.fu5/x$h#Rt4[_~tuN*.fp=5/tTjjRà xTxPSZY@u SX9E%=tIS6h(# !jjRà y6h&$Lb^X5/u5/y hx$=*.f=5/u8=5/t5/=5/u5/5/1/55/55/Sƒ 1Rpȉt5/PWS yuhx"jkJxPWZYjE_=T5/JRt 5/YtYRh?#XZ*tp)R,t55/h&$`5/ZYN*.ft9tSX>e[^_]Ë *.Q*.y ;*.|< t*.J *.Uh*.PZYU?PPh#h*.jc5/W|$wUWSˉ1҉5/M]m <-&h}fU fUm]mURp pSQh-0hx#h*.Z$e[_]g_UWVS]E }܍p(}p4EPSY^tSh#_XZe[^_]UWVSP]} CM% CSCt RPW& RPh-X 1t)?18th-h# _^XcCt2PWZYh-h#^Y^}uzPh-YZu΁}ti=5/u\SlU;?1҉UtRWZY@u\?8-tRh-,ZY@u"{lth-h#N^Y^uSh-l XZ }ye[^_]UWVS5/Xt.h-rh-Epƃ \h-!jjEp\ @Euph&$][^xP=5/t5/ 5/t1=5/ƃ}  =5/h-h̔#h*.D*.HD*. yh@*. Y@*.P@*.؃ t+@t( D*.y h@*. Z@*.P@*.Ѓ߃Yt\^jxt6Ph-'Y[@u8h-h$\\ E *Ph-q[Z@uȋE%=t[jhu GPhh-à uT 55/u"h-h&$!\\8 ih-pGPhh-0ÃtOGXW\`dt;`dE@hDžl-`dpt`d T`9иdT`Pjj\jjPjTjwXP_T `1ɉ`dvRLP)TPSk L9th-h&$ZXZDžX7)`d=5/th`d rPTIY^1`dhh F/\ƃ ~aVh F/S 9th-h&$YXZDžX;`d=5/th`dOtEp뭃=5/t#S\Y?Y^th-h۔#_YXZ\t^Xu SdY55/t SWXZ=5/uh} tbG tY5/9GuOxPSjZYth-h&$XY^$E9Gu5/#G%PSYZuSZth-h&$XY[=5/tWh- XZe[^_]UVS]hVs3 u sh#'Ƅ} t'h-lZth-h#X[^.h-VZYtVh#١5/t jsPeZYe[^]US]} th-PlZt h-h#sh-bZYth-h%#WZY5/t1E ]]]US]} th-kZt h-h#$s$s sh-Rth-h0#WZY5/t1E ]]v]U6PPh:#h*.QjU5PPh#h*.1jUWVS|Ӊ΃=,F0u\p=0F0tR|Y_u%=@u"6|h&$6VXZOt#h|VK =vQZVSmY_u%=@t=8F0u^VSŢ_ZuQ%=@u?VJ^uL6?XPSh,y%hS=΃=,F0=$F0|8/uVP<ZYti|hz#UhSWJWFt=|Ph,y%hWVWt|h#T_XVSFpY^ ,F0uS|&_ZuS|h# j/|Y^|tpj/S_Zxt@xxVD&ZY|)x)؉t=9|u fDž.Nj|ƄPRˠ^_x9Íu fDž.׉ދt󤋅tƄxPRZYu<|9u(;xu 9 u ;p=@F0t=4F0h*.LShƖ#h*.D*.HD*.yh@*.X@*.P@*.0t- t( D*.y h@*.S_@*.P@*.΃߃Yth*.hӖ#9I=ZY#1=0F0 PSj|jtS=(F0u1#| F0PSh#޸e[^_]UE TET]#UE MQTU TE]#UWVS}E E@PX4]p8u_PK4MK8U9U΋U|4uU9u|,S<9P<|"ETE GTE[^_])#[^_]UWVSEE} GPX4]p8uMYPK4MK8U9U΋U|4uU9u|*S<9P<| ETE GTE[^_]"[^_]UWVS}E E@PX(]p,u_PK(MK,U9U΋U|4uU9u|,S09P0|"ETE GTE[^_]""[^_]UWVSEE} GPX(]p,uMYPK(MK,U9U΋U|4uU9u|*S09P0| ETE GTE[^_]![^_]UWVS}E E@PX@]pDu_PK@MKDU9U΋U|4uU9u|,SH9PH|"ETE GTE[^_]![^_]UWVSEE} GPX@]pDuMYPK@MKDU9U΋U|4uU9u|*SH9PH| ETE GTE[^_] [^_]UWVSSEEU JPqXI\XP{X[\9|9| TU ETEY[^_]; Z[^_]UWVSSUE EHPqXI\ZP{X[\9|9|TU ETEY[^_]Z[^_]USU EAHtRSHtG t uF u:] M[]9t=F0uyDutJt] M[]%F01 []UWVS(UF0 F0 dF001d@DHLP4TX\x|hlEE8u F01۹Mh:#u Wl  M1G$4&hF01\F0F01\F0hF0F0F0땃=F0t F0F01\F0hF01F01F0YF015\F05hF05F05F0F0&\F01҉hF01F0F01\F0hF0F0`F01F0F01`F0XF0tF0F0 F0}1F0|F0K15F05|F0xF0JF01҉tF03F0$F01F0 F01F011F0F0F0JHF0F0LF0TF0F0apF0uF0fdF0WlF0HF09PF0*1F01|F015xF0@!Ph#h*.jd5p#.)}䡰F0 F0 \F0t!hrA#hAZMtP-XM=F0u1=F0F0XF0UF0 dF0} =TF0 =F0 u} F0u=PF0tɀt*uMhF0j XZMF0F0F0=pF0tftt&F0F0E=F0t F0`{=`F0t F0gfF0YZttuLF0@F04=F0t F0=`F0t F0 F0V =hF0u/ =F0u! =F0u =\F0u F0}t E E -F0e[^_]UVSƋLF0tp h!% XZTV ؍e[^]UVSƋLF0tp h!% XZTV ؍e[^]UVSxDPTuRh&$hV<R@ph,y%hV hSVU u" 0 PVh^#h*.GƄh\4#^|F0 xF0tS =F0t S< Y Sh&$XZe[^]U=LF0PTtRph,y% Rh&$ZYËzDF0 dF0UWVSHX=F0t>jj hq# SQj]S@u h#jR'Sh#@XZ=5F0FډWVRP轾x#=F0tk#RPQ e[^_]Ë *.Q*.y ;*.| t*.J *.Uh*.PrXZUtAwt&@u=/t'u&%|o@=1ҨIt*ى]UWVSEϋpPF0tvv Rh#Ã=dF0=F0tBjj hq#v\vXjUR@Uu h#j%RWhT$à L F0AF`VdEUQRuuH#=F0t#RPWQoÃ|F0 xF0Et*=F0tU]Ã=XF0u=TF0tF%=@u FaÉ؍e[^_]W|$wUWVSEUEP#SEZuE䭗#EC u=lF0tECu}EUE؉U܋=F0} F0ƉׁE9Ɖ|)E؋U9E|EWCu! EE4Cu $e[^_]g_UVSut({u{ tNV [[^]UWVS(]j;F0F0X=HF0uEԃ}Eԃxu x EԋpP=F0tvv s h#a=dF0F`VdẺUЃ=F0tBjj hq# RPj}W[@u h#j#WshT$ K F0AEUЉMMuuRP莿{#=F0t#RPWQEPvEԋxvs$EPhƗ#=F0u7s,hϗ#n wshϗ#[ =F0twsh#? F%= u9N % 1RPs4%1RPs0h֗#dVXN\=F0t3jj hq#QRj}W @Ws(hT$ "{(#=F0t#QRWP=F0tF(V,=`F0tF@VDF4V8\|F0 xF0Et#=F0tNVF=XF0u=TF0t@u[F%=uEA Eԋ@>e[^_]UWVS]C=F0tS D=dF0t=F0tS(SDXF0 TF0lj?;-(C ;-~:P5F0 ^Zuji7Y]e[^_]1S -F0F01txux tF@-E-}E}E1҉U}9}~j}1EM9M},=F0tK(KS F0k‹E9 E뭋E9}Uܸ UBE랍e[^_]UWVS ]C=F0tS D=dF0t=F0tS(SDXF0 TF0Ɖa -69~] [^_]șEș}E31tZ~u~ tIE9| 1=F0tK(KS c9U~U UBGv뢸 [^_]{UWVSP}F0tG X=dF0t=F0tG(G\=XF071Etn~u~ t]}~9,EEF,;-| 1ɉM =F0tO(OW Ev뎸 Z[^_]UVS RPuV# u1.1ۉF0VR@띉8<=F0tt1ɉ F0߭8 <-&mٽJfJ fH٭H۝4٭J4Puu<8SDhx#h*.$5F05F0V茺ǃ ~ W5F0@1 9#ۏ-whh#h/#躏[50h#詏h#蟏h۠#蕏h#苏h S褏xhv%SZYu5G0(-50h&#>1,0[^|tFu=#0jԇ hl0Zl01UuZ@t;h[#0j蓇 US]S Z@uSho#0jf][UWVS|uu VnY_Z@uSt< tNu38xPVXZY@tE%=@u18؍e[^_]UWV@u x0PHxx0P xj ƉX)l0Pw8URPhG0x0P@ uˋEU|l0l0RPKYXhG0VZhG0[YhG0UZjhG0HWZYuE=G0/u(7uhG0$hG0hG0 h*.WVhG0 2*.@tAh#0j虅 '|l0l0l0l0RPlZYHx0P(jh0jpT 1e^_]UWVS:@u x0PHxx0P xmhxj ƉX=0t-5-蛚[trh#0jʄ =l0tbbyY|1ɉll0PwMpRPhG0x0P@ u!pt|l0l0RPMY[thG0TZt|l0l0l0l0hG0YZu؃=h0txPhG0YVY[tX0 L0tkxPhG05V[ZuTL0=X0t/t/4l09EE8l0|/@l09EEDl0|Wu4l09EE8l0hG0RYjhG0T[Zt0hG0_|l0l0l0l0RP =G0/u(5uhG0$hG0hG0 40 00tgxPhG01UZYuP=40t4=00t4l09EE8l0|+@l09EEDl0|S4l09EE8l0T0t10J~PWVhG0.PhG0G0,0[Xk0t@t=0uPY=x-t1l0 wlPhG0XZ hG0 Ylu_|l0l0l0l0RPXZy hG0;^X=T0"=,001,0=0uSlhG0Y[y;50U|l0l0l0l0RPhG0]pPRhhG0x0P@à =0hu RhG0ZXZ=T0t=,0t0 1,0u!pt|l0l0RPgZYk0 x5-Xx0P(jh0jJcd]O 1e[^_]UWVSx0@t x0t!9t30h#j~]PHxx0P x=X0ux0X t []y!^xT0 <0tW50hڤ#50,0 2hG0TZt.|l0l0l0l0RP0 ^_Ht#t=X0t4hG0ad_y#x0P(Ɖf\WVZYyuthG0]^yơT0 <0t"=,0t50h'#,1,0ZY-u jh0j蠏 e[^_]U=X0u y  \yx0PHx1]]UWVS Džlh 5 0W = w u}/t 5 0h#h4~/t/CFtP5 0OYZy" 0MSh&#0j}C|%=@t5 0hM#j| yX i$`=l0u )؉h&'n[yDžlhG0}RZthG0%ZtX0 L0u#hG0$hG0XZY )P1=G0/G0PV: 9hshG0ho#j{tPWNZYuL0=X0t:t:4l098l0W@l09Dl0u4l098l0jhG02MZYy'jh0j7`J$ 1othG0mXYSPhG0N xס40 00u+=T050hG0r),0XZ}tPhG0MYZu=40t;=00t4l098l0|@l09Dl04l098l0]l0=d0t hG09 hG0"Y+l0 tEt@wpPhG0ZYZ hG0uZhG0"WXjj5_0萌l y8_0ddRh$#0j$zhG0V jhG0oXYy#lPhG0[hG0V RdlhG0a dy RhG0 RhG0@XZlPhG0YX=T0x=,0k01ɉ ,0Te[^_]USr0t0r0u x0@r0=~~ h~Ph#ÁthPh#jwKr0T-5G0Zx&1r0r0r0r0‰r0r0 Dy밉؋]Ur0t0=-u>r0t5=~~ h~Ph#thPh #jYw@5G0XZx%r0r0r0r01r0r01 yr0t0T-~r0~UWVS0t hN#jpr0=r0T-ur0ySr0+r0EU EUT-EEuuuuFu})׋E9ƉM}u}WV!ZY+u}r0T- M19}kr0Ur0;r0s#5r0PY_r0r0+r0RP_Zxk r01r0T-щ r0}=r0r0r0EU)r0r01ɉ r0 r0o-h#j\uXZ؍e[^_]Ã=P-US=-uh#j%uXZyx1ۉr0r015T-5r0ZY~%r0r0‰r0r0r01+P-~C9}Ph#jt Iu뙋]ÃUWVuM r0)ȣr0^_]UWVS$]CDž$$ x$|$x $=@0u15xPu D^_y狳dVh#0jtPuZYud%$h #0jvtۉ15T-5r0u Bƒ r09|Ru -WQQRuk9uUy%=Vh4#0js79|$u9x$t hY#j\rZPu 觰ZYyVh#0jsNjE49}u;0th#뗋9}3t)1;x$|$}Ru ye[^_]Ã=r0t1US5T-5r0ZY~'r0r0‰r0r0r0=u.=x0ur01$x1r0r00]ÍL$qUWVSQ Q1ɉMMu u15r0=r0)9}Ή5r0)څutċr0]؉}܍MQWSRPxƉ׋EUEЉUԉËU֍ ƉύEPWVT yEU)u}r0r0197r0+r0щ9|`tt%u؉}9}M؉]܋Er0+u}럸eY[^_]aUWVS] ~Er0+r0 U )څ~'#9~؋5r0}5r0)É}뷋E [^_]UWVSEx$|$hDžpDžl } xLxPu vY[uEl*Džlhh #0jo֋ltE1҉Pd19} r0+ r0 } yjș9Ή}hlpPtPQ5r0u ƒ2E0x} yE} Gpu5Xr0=0 td@9u r0Й).1];x$|$}Rhu  19x=0t, u&Ed9$thh#jm 1e[^_]UWVSV r0r019|1`; r0r0}h#jAmZY1ۉr0r0T-r0‰r0;E~ 1}}])1u5T-5r0ZY9T-uGr0r0Er0~$5r0lj=r0T-9r0~?Er0r0r0E)։׉=r0x0Jt[tTA1r0r0x,T-r0‰r0;E"])0EEe[^_]Ër09r0s.UWSr0)1r05T-EXe[_]UWVSu] ~;r0+r05T-Zx 9~‹=r0=r0)1e[^_]UWVS1;EE }Pr0+r05T-Zx5É9EE }]u 1=r0=r0)]u 1e[^_]UWVS]x$|$ $=@0Pu _ZyzVh#0jok[r0+r0~b9}P5r0u *} )r019|5T-|^yt7h&#0}94tVhG#ji 1YuxPu ZYySh#0jij;EutSh#֋U Ze[^_]UVS]E xz$usP#}ZyVhs#0ji$tAPgYy$hVh#0ji$艝 1$0Ze[^]UVS|]s|PV;XYxS=h0t1F $M9$$u0;|u(,$U90$u;EuVh#j2h 뻸e[^]US|]EPSo;ZYy1=h0uOE%=@uEhv%S迿ZYu\SYy} tMSh֨#0jh/SZy50踛Sh#0jrh̋]UVS]EUdh1ɉlE Upt1x}=-t =-|PSb:^ZuZ=-u#EUdhEl=-u$u! PVXZ=$0u ($j$0 - -t[j $P3V%A=-u =-t51$PjL$H$X$T$t 1e[^_]UWVSu }GEu EE]9~)])؋ME8tP<9s8u;@u6}jؙRSu~u h##E18}t}t:00E06SVu{ 9.u hA#i00E0ҍCtPR XY PՇ Yuh3#jP[XZ>CPVЉUPEU 0j\̍<+E e[^_]UVSu] }u1NjjjVԠy iShY#jh0Vsl yHShA#0j[e[^]UVS]u x@PnX=\0t*jjL$H$X$T$e[^]UWVS(]} $(v(11ptWPu l ~ pt1@9uNjt9|$up9x$thp#jY xPu ZYySh#OT$9X$u;t h#jjju &y$赿Sh#0j Zp1$1e[^_]US0tP51ۉ00X0um1 D*.yh@*.LYu9@*.P@*.9д-uu%1S 0 t뭅u oډӡ0<0u0 B0tϋxyRZV붉0j50h0跟0 ,1]U=D0u0=H0t0=80t 0@=0u'h  0Yuh#jWXZ1Bt\0t9UVSut>uh#j ă Xuh #j?WY[FVZH~ 8/u3E ؉C1C=0u00X01e[^]á0t@=`0t 0=@0u4=p0t+UE$u0tjP50荨 US=\0t801t6{u+uh1#jVVXZ3hn#h*.n [Ƌ]UWVS]=0u =0<150 @u=\0u950萢0Yu @uЋHHQf $|&@PURURpp p0]9xjjuuuu0p ph^#jfUph|#h#p jDV Qph#p p1҉$$$$ ƃ pP $󥋓($@`w/ @tf%ǃ$ǃ$x$|$$$ǃ$=\0L$H$X$T$0$,$$$ $P6$yǃ$mǃ$aǃ$h RPf y$0p^VhȬ#0jTƄ  ǃ$h 0pCPh 0rP50hX#4 t10@=e[^_]W|$wUWVS<ÉUMMQEPmUu}j 9ƉЍM}Qh#Qh#j@S ue[^_]g_UWVS\]u=T0CEuPhn#Vj ue[^_]领}W($uET$X$(j8$9Ej<$Uuq#uq#PjRj4$Wh#Vwj$ w'@$  R%Ph #|$x$h#V(juEPhR%Vj$Pw Sh#u Sh3"Vi Vj vVZYV胅Xe[^_]UWVST]}T$X$uV($ptSWVh$#Pe[^_]UWVS]u fVfuPZt%t0SRjP}WVWCۉu ]e[^_]e[^_]UWVSUM] Ӊ9ss< uB1uZB1J9s]JqЉ w D$qw Dqw)DB qЉwBD9rt1[^_]UWVSMU 1EU]u tE} E1҉EU]\}ud9ruK~W w~0CEUEU}ũ}t6Ku0CEUEU}t9s}u9rKC01ۉ]]EM1 ۉZY[^_]UWVS]Uu 97 yO@0{?ș9GO1 Ҋ< u C9rt 11{11ҍO9_\$KЀ wD$0L\$Kw D$A%\$Kwo D$aGz L$σ0w9$T$CD$0$T$9r ,11ҍe[^_]UWVS}Mt}uu9E1҉N 9ȸr0WNEU EU } u}t4NM0NEU EU } t9s}u9rNF01EE E E [^_]Ã=P0!u%UP0h-#jLXZ1ø1UWVSSu] E}MM1҉l7=0u)S0:-u0 p#.=0uA 0Q0u 00UWPvZYtAU:uC7tMM}E] ue[^_]lE] ue[^_]W3hh#(x:u9p#.9}l7@p#.W3h#h*."d?e[^_]1UE E EE]aW|$wUWVSjEPSƉ׃EU E9Es 11E9tmt8bt$kuG *wu5 9|@EΉߊ*t xtt*@5Éщ9`Ɖ׉e[^_]g_UWVSRt8uh#Pb$_DžuBh#jPJY[8zx1҉P=0uf00tc߀?t\j,Wt[ZÅtj=WtZYuhխ#Ej Uv YUuh#jIV~ 0B1e[^_]UWVSQÍEPS^^_uC 0%Ƌ]| tC]Su Zu01 KDe[^_]Uh*.h#蔶j0T-9t BtU-Uh*.hs#`h*.h #Qh*.h#Bh*.h#3 jSUWVSPuh!%ShZYh!%S_ZÊEhV(YXuVh#0jeI }t/1e[^_]UWVSlj/E 0M_Z0t@E 0h#P:0[^b0#001҉U11ɉM11Ejh`-h#u uKzX$&l7!r05l7hձ#f r0렸1P-덡l78-uxu1G0EjG0[D0QG0#Bh0380$1-=-u#`@}1 00=0u  0$0-c`0T5l7;_1T0pl0a -HG0%9 0l70$H0Ex9~/pPu]w EZYuh#jEjPEMȋl70P}G0{$10P0<05l7,DG0*#gG0Ե-XG0ȵ-IG0-:G0-+G0-G0- -l7G001=x-1ɉ 05l75CZ4p00p#.E 4-umu}t 0*.0*.Hw49Uu }uj5 CL-x00t Hu01E`h/#jC$hv#P葛[_h#SzZYF0 0}tE8MMYEh#W*ZYE@*.t&h!1#W \EZYuWhy#jC1E1EEYE}tESw [h#u詚ZYu 0uw XEjh#u輙 u@ 0t EtSNw [EPmu7w XZ1ɉMEHjSu E&EE]}t EtSv [h#WߙZYt uu[=0lW5E.j50Ss ^E6~t0C}10ExM}h#S?ZYLFLjP[_}u'hv#P[_u^ h#SۘZYE@*.ur1҉UE5DžUuzuh#S襘ZYt ut_=0tSh#{E@u}jPZYy!h!1#SHYEY_vS6tj.h#W+YZt2jh#WX ujjW_Z*jS1ɉ P-}CG0t 81h"G0Zt 8G0"0q"11jh`-h#u uz$&1д-ă뿃l7r05l7hձ#t0p0xl7G0fl0 TG0#Eh0@3d0΀`0 l7@l7tjMXZF}u}Qt}PU!uX1҉C<]t>j~-u!Ft<]t9}| 9E ^19} 1}!9#A8Qt1e[^_]UWVSSÉ։M:NjU8/u@J)ف ~Puh#j6G։9r KNKNp19r)XӋEuD)Í4}9rHH1e[^_]UWVS 50h#5[_Vh#5h #5hB#5h W5h3#W辍ZYuhK#W請[= u hm#:5Y덊uh##5ZX<.uuh#5X1t3L@NuL@L'H9s tFCC@9u&>t!tWDh#j2|tHL@t<uDh+#h*.J WDhA#h*.Jt@th WDڭ0 1e[^_]UWVS]t K΄u hK#R<\u FFu8uShd#j1 Dž~j@^ Xuh#j1[^GjQPۊ t5hVPِSVh#ji1 W1f YpV֊t\uF8tFWe Shd#yR ZV1u,tWe h#j0GBGtVuh#j\ Xuh#j0[^C31CVZC 1ɉKECE C=0u00X01e[^]US01t6Cu+uhC#j/XZ3hn#h*.H [Ƌ]UWVSu0t$tS=`0u S1u=p0uSu $uoFP Yuhm#j /C_Zt/1s\Ct/1ɉK;WńZC Hǀ?/uC C$l09tP@uh#j.Y[CS_c 1$Z-e[^_]UVSu1ۉ$0u,=`0u1=t0wC |/t[t0CuPFP3? KVPYuɡt0u #$tV^Zt 1$e[^]UWVS]=x-tes{.u{.u Ct:u h#j/VQ[_ÅtCF1ɉMMPtMzЉ v@,u}u@E1҉U'.u}tVh#j% RE@j?R XuhӺ#j%Y[.t;u GM1GtAt+@uVh#%O}tgE8t_W@uuh9#j$WY bGƒWt+G 9OG}VuhU#j$WY 1G=0u=00x=01 hx#e[^_]UWVSM=0tPÉֹ=1:t9pt@9u9U}tjP ZUuh#j$[^1p1ɉH xe[^_]Ã=0u1Ujh UT 0YZt1hλ#j#XZ1UWVS}0$4$E,$E싇0$E E14Et4ËE;CuE;C uC$$9Ku; $trS[ujO YtGGP Zt0 $$$CSEC ECECEC1~SW Yh#j"XZdUh 3 P9 $Uu-$CHCwC3@W S:W [^̍e[^_]UWVSM04$$PvrHto,$0$E 1tL};{Su!;s u{}싹$$9{u }; $tCɉ3V X]e[^_]{V e[^_]UWVSS=0t51ۋ4t#1ɉ v0EEV EPjh虡ZYx鋖$  Ѓh#'e[^_]11UWVS}} ?jh#Vc Åulh#VPdY^¡0 0 u0h$#jE XZjjP虻ƺ- 9tPVht#j ؍e[^_]UWVS]u hV2ZY@u- 1{ǃ4$1E쀾Yt"h YPW-z/@E K<vM E)Vh00Mȉ Rh00  jjFdP芺%($jj F|PEUUEщx$|$@uAjj P;T$X$H$L$`$d$ƆH<$P)PEyjjFtP<$ Ɔ(8$P PZYyjjFlP貹8$ 1$$$$@$D$<6tL<5t_<2Pπ ډe[^]jUWVSu>-u~t2h!1#V_Xu$g05= PVh%#j[@*.1EPS'ZYt/G}vEVWh8#jEUt@*.u1 S4Xe[^_]á0t UU RuP謑504UVS]u F50tRPS, tD3j S*ZYu1e[^]US]}t 0<0 T0t=,0th*.j 1,0ZY50h!"h*.Su h*.h*.j  ]USjh_#Y[xEh"P/0YZt&h!1#Sr/0YZt135063ZS?X=l0th_#hY#j ]UVS] u}t 0<0 T0t=,0th*.j 1ɉ ,0XZ50h!"h*.Vuh*.~S: Ph$h*.h*.j XZe[^]UcPhu#h*.jO 0UfcPh#h*.j) UWVSƋ=0tPh#h*.n =0u ЉˋQtjP8YZtNd8tɍEPs XZ=0tVh#^XjsZjsiGx%} uq#VWPREPh#h*.h*.k1D*.HD*.[yh@*.2Y@*.P@*.؃t- t( D*.y h@*.2Z@*.P@*.΃1Ylje[^_]UWVSAօu"VP_ZtDžF%=t1jh @txP:Y[x^9|u,;u(^9u;F u%=tbWɫnZ<jjjA  ׉NX^\19ȉ}{ 9}Dž 1P  9+{ Zcjjj@G? NX^\19ȉ}{ 9}Dž 1P  9+{  Zjjj@nfNX^\19ȉ}{ 9}Dž 1PC  9+{  Zjjj+?NX^\19ȉ 9}Dž 1W  9PPW) +^  _jjj7>~\vX19}p1҉ u݉19} 1QP  9u#)!  [@ 0h&$m}ZYur Xe[^_]UE @E E@E]OUVSutYS} u C tC0@0R+ s+ S+ 0H0 u0te[^]UVSu0@0 0؃8t VPjZY0u 0u0t e[^]e[^]UVS 01؋tJ9tFjPZY0uԉe[^]UWVS0@0ƍPxY11ɋ 0tx?tBA'u9t ha# 0u0th9 jVS619}Vphs#p-HQP yP-H Z J GSjXe[^_]UMtA'1 0]UWVSu^Nj7t#vuLY[Åu jWXZ ׻؍e[^_]UShY%JZtaujY1"40tP{ Ã0X؋]UWVSP}U UWRW"ơ0@0$TW舩C1҉S URwC0H0u0t e[^_]Le[^_]UVSuV[t#sVKZYu} tC t1ى؍e[^]Uju ZYt@UWVSjY108u&S;u0h}#5-qXZ0P0uj=CPY_uyjS5_ZDžuSh#5- Shs#&w%-xWP yPl -H YlJ ]@PS3XZKe[^_]UWVS50P2.DCtVjEPV$@00] &8KȉMA&uV)PRh#&tK00C&u)BUPg0NjU0Xu,Ƹ^ À~|tH;= ÊVθ(,)%%#$Ƹ Ƹ^0e[^_]U50Ph#UWVSQ5101PIÉ51^=F-t <#uKt;ux&7V1҉jEPSE=ƉV 8uE8t+ V8tM#`& tBUUue[^_]W|$wUWVS ÉUM7Hw$4&q# uu }#!uME5 #tރ uWVuu WVuuM MΉEEUEU)EU t1EU t19uE$1ۋE9Ɖ}$1ۋE9Ɖ}|19uE}11ۉȉIE1U1 E1U1 1"EU!!EU11 EU e[^_]g_W|$wUWVSU?WsƉX=0%1  UUxEU=0&t #2E00MQ  mWUEaYutu]ƉӉڍe[^_]g_UWVS(Ɖӡ00EЉUtUSt@ vUSƉX^MƉׅuGMIt!EnM̍YWVщ‰ Y[ƉWVh"j]SjSuA e[^_]US7=0)u c[]W|$wUWVS4É։MЋ?E1EăH300V]ЉE뭃$" "tCك<E4EȉU̸#=0# wEУ0tV!EȉŰEЃ'wF^0ƒ}'u1EURPh"j}WOjW6 EУ0 00V]U]00VWEnY1 M1ۉ]00VWE7҉EȉUX}t # n0t VEȉUU0Ɖ׃ƒ'u1EȉURPh"juVEjV50 #닋E]؋Eċ}ËEڍe[^_]g_W|$wUWVSEUϋE܋sá00EUUV00Kw\l&8l&}GVQ0YYuRPUMY_Kw#l&9M~߉EUouȅtče[^_]g_UWVS}USƉ׋ 0AZwSjƉYX=0uRE00MQ  SUEZ  !1e[^_]UWVS}USFƉX=0uQBE00MQ  SUE щX 1e[^_]ÍL$qUWVSQ q}W軝50XjLP ZYt5xIu,xNu&1҉Uj PZYUtB@)։50@뽉00k1=0t #EЉUWԝEЋUԍeY[^_]aUWVSRE} q#_--00HO;t(0sx&軞P ωʋ70tx BM菞P M҅xJ sH+ -Q舛X51SƉRPh$ e[^_]Ë0Ѕt /tt@10 @0US]u1Z;/uPhv%lZY@tEPS]ZY@tҋM9u;Eu3E3U ]UWVS}V蚚VP tS[0Y]e[^_] SKZ8"u뺅utK0! Ph# e[^_]UVSu=0uE=-t.1҉-h#iPYZtSΙ0Xue[^]3e[^]UVSu3t =00tP Y0@00010jR0H0Zu0tG =0t,j50h#j50h#jh#m[^1V9@$0VP(--0 >/t[50>t'0H0FxFC蟛XVԀ~/u#0Kh3#V;ZYu$-9r :ƅuh0K;/u>thv%V:ZYt 0x/4)X/ XV>t0H0FxފFC9-u 0x/C ܚX/=0uȚ00@00tP( X005-舗0j50h#@j50h#.0H0u 0u@e[^]UWVS} u0@0udYy 0u0ttj;á0H0Zu0ttt h# Y0t$=-u =V-t50hn#gXZ1ue[^_]UWVSζ-hƅdhE#葮Yt  U=H0u H0E Puj:UEPu u(UEH0jUS]?Su 0uUl?uu 0uUEPu juUuu j}uUS] ?Su0^ ]U>u u0A UE Puj+ Uu uj UM&ft9uPU t@Qh&j h0/0á 0UWVSPG[YuOƋjjPlǃ t 3;ZC jjPFǃ t s{Xe[^_]UShq#Y08tN--_0thB skXZ1XjjSP50"j81]W|$wUWVS ƉӋ 40uj'k< 40X1ƉU1}m T-&M1EmPP$hz#jS;6u{0ujh$S RF SM,ZÀ{0u K{.te[^_]g_1,00(0$0US]tvUUt[F~Xj Rs 1UE@C ?Ct8j RPUjEpSus IVCX C @C[놋]á80USQjj]Sjjh$- @tBEPy80Zt,jjSPjh$- @t80PATH@=580 80-X-]US ]t6;u1Ct*p試Zt1PjEPCp`']UWVS }W1t@0B0PWpE_XZsnEX;t-E@u"xVuX:0 Ph#1Psue uK 0u0te~ jVYX}xuju js_XZxV^uuY1u u zZ unX10 0u0te[^_]UWVS}] -tuu150EnރUR蘉ЃEYE$&VwXZ=-=,0%jwmYX=-0 ,0jw=XZ=-=,0=0=@0tSWSWY_e=@0tSW=@0tsjwXZ=->=,01=0u 10=@0tVW=@0tVW_X=@0tVW8=@0twww*1ɉ 0zjwXZ1=00fjw_X=0tQ0E=@0tgWfY(jSW Rh#:h-V EވE1UR脇ZEPՇXD0t=޶-t0t }tPtje[^_]UWVS} E E܍uV׆51ju\1jY=-tKt>=-u5tUVUt E PuRXZ=,0u V袆X\VZu10tje[^_]UWVSWE} _--00HO;t(0sx&ևP ωʋ70tx BM誇P M҅xJ 莇H+ -Q裄^ 0PS|ZY100e[^_]UVS](01jshXZ=-,0tKu00H00t1,0u00H00W1ۉ,0MwE50=0; ut-t)E Ps50,0ZY[x (050e[^]UWVSu=0=-u1EPiE؉E܋^Yt$hPS.M =,0b[E؋E1҉(0]؅6F1=-P1PP[h"Qv I-xWPyP-H =_ J=s--xWPYyP-H X J 5-W_jsv E Pvk=0=-uJ,0t:u00H00-1ɉ ,0Hu 00H001҉,0 (0=0EPpXe[^_]UWVS]uV趂E؉E܋S 1jPs{K[tt=,0uk{t_G1EpWPZYt@1=,0uA=-u81; u{C1u s ]0ZYt‹띋[10V譂Xe[^_]UWVS]} 3EsdX=-{511P褠Ph#Stj RU5-UR h#Xu h#X-HyP-H X J 5-(Y0@0u"jS*fEPSRUztUt,uveuu 0u0tjsKWs$UuR\e1҉0 Rp0X 0u0tjtJ=-tA{t;511P1Ph#-Ee[^_]e[^_]USD0EE1EEppX=-tlExtc511P赞ZYEP($#[EXtj S5- [h#[5-tXjEPZYtlE00j7XEuKt&:EP$#X5-XԋEt0j50к0@0Eģ0j EppXZ1ɉM 0t5u EpY[0@0E0jX 0t0t뻡0txEt"EP$#X5-LZ]UWVS}] 1CCC =-EP~0@0E^@u h#VjWbjWPwu31ɉ 00tuyju(jWu\E؉s 0H0Zu0tpEP ~Xe[^_]UWVSE ,1@1X1(|1$1`0EP}X1 0E@1ptEXt7u!C1hpPSE 1 sB_tҋ[ŋt1ۉEp ^x|EXtC1sYu|1҉4pjxPS E [븅t4B4닅4P.{_0pt0J0H 䋅010T=-t"=$0u4~0@T40)Љ0=-u 4}fEE 511PAZYP[x1ۅt--HyPd_-H J ~j=WcY[Åt?v{Z-HyPX-H = J={=WAX6 ept@t--HyPX-H J vX6 뼋Ep -tRVPK t vHyPhX-H J 5-_uxsjh`&V u Xԁ} ``041 Huw)4)400toX4t-X`0QRUR0of}Zf}tJXZ:-{z-uzu apu CSu>Eq `tfE=@0u Ext,AEftfwE= t= tgˋE@ft50@0juo][^8t48t*8 uxPW*ZY@t WPiX뀃 h u tCƒv~ H0PSP6hf5#jUWVS]} Cfsftf$ftgS1$jV$PN P|hJyӅtsh|#`XZ Xth#_t h#YVh&$"XZt h#XVh&$Y^tq0@0sP$P`0H0 u0th#3,P'h# PVh#{ t--HyP-H *Z J*-HyP-H X J e[^_]UVSu&t"8u%uCVPZYt؍e[^]UVSu&t8uVPZYuCݍe[^]US,-1ҋ`0tHft fux@ |u[]UWVS}0@0`0t,Pfu9x fu9=,-| P X҉΍^0t 0u0t e[^_]%e[^_]UWVSu1XE'1Ҋ 8tu <:uz:u uz=׉u3׉F<%u }yUVh#qZYUtU~:uBC렡,-U҅y E,- !WE,-Xe[^_]UWVS0@0`0t!f{usS XZٍ݉w0t 0u0t e[^_]e[^_]UWVSutA%<`0`0tCVPBZYtdߋ} tX0@0V$=cÉ1fCC VCP訯0H0 u0tB=@0؍e[^_]US&tjP)f@SPXZߋ]U0@0@0 Ph 0H0Zu0tUWVS] j/u^_t[EtFxPu$ZYy 8t8tffCf1CrƋM19tMEth#QY_tM ju_Zt@HftftfuEu6Eu E u=,-yƀx u1E\tE Dž\u =,-yuGYDž5DžXt,-f~tFXDžTDž`juEP` WaD0Zu?/ugX9`Y@Ph#KnZYtuYDžt5D0h#!nYZuzX9`hxPW=~YZy.8B84T"E%==D0tlEWLȉ`+-$Q`WU_ju+ƃt fx`tWuh#dQWBcXZ0@0d\ujuY_f~udfF`FDžT BtEt$jTPuh&5-"f`z0@0d\uju=XZf~udfF~ 0u0tF FfF CfF fCFCe[^_]UWVS(EE1E11E111Eh#vEZtPE܃bw$h&1Eվ1ɉMǿE뷻EE랃}uutjY1}u+u'}u!uEE0: E؈E1`0tIHft ftfIu1fu'} }t}tuPEvXZEЋ볃|u5-s^-@h#[EjWVZYtY@ft8*fuu<0P08ufHu("fu}}t̓=,-x t1fMfMPu̍EPW EfEփ}t f@ E܃}xf}tjWY_t jPlXZ(OE܍e[^_]UVSu 0@0jucË@ZYft&fHu sXfCFC fFC FC 0u0t e[^]e[^]US ]0@0fEEE-fEu EEPSL0H0 u0t ]]UjuZYtfxup)kX1UWVS(1E11hT#s_t'ptvtV EѾʋE ct ]tPhX#nt hj#^1ۉ]ԋ 09q#cu1#QPh#/uSY`&uwjSbXZh#j w tmh#ſXwhn#0_XuY0P0x 8u SPYZthh#h#XX1딡08t-HyP -H YwJ h}ujSXZtGfEGE<1f}f}U؉UPjEPSEfEEE؃1f}f}t f}f}j/SZYu^1}tEM؉MjSEPEPYMIy߅uq#t?#Ph#蘾[_uljSپZYuuYh$u_Luu 0 Ph <#W %u%h#uh# uh #譽Shn#ZYu h*#舽XEE~Eԍe[^_]UWVSEPY0+-P X -^_}GE܊_tqtg}tb} C<v8u1:t* t/t<EP4Y[=V-t"E u 0xA gZH}낃=0uOZ0-8u(hH#YYu P轷 Z1t p P! EPXXuEE %E1F^t\}tÊ"& <vC< w 00yYH 0 00yYH 0AE@uF9utm&t_U9UčvsՉ‹EĈ@ȉƃEM9MMP YPEP7 EXZ}ׁt }\tE׉΀>-utV]tl\t tVVr M׋MM1ɉM܉E1EURMQ(GZYx>EE1EE׉E1҉UURMQFYZ 8Eu ENE<]L}9}]C}t;uCE8CdEЀ8NC]Ћ}Je[^_]UWVSE t1ۊ*?[V!t ^~t ~u GJxw][u|:u|OpW]onon`/WuOpW/=u4:u ]p늀uGt)/Tt2Jxv$tuF>/u uv~tFuc=0Uqxvtu@r t@;}u50[xP506gZYy9tt1t9s'@ZxvttE]S@ϡ0;EtP9Uu8/t]C v%!%PsX E90t@/Džp>t F1ptJxw@tu@o0tS YpF/S Zt؀x .u o.ux jWtJ tptWu+50@ 놋EG@WPu@/VP_XeM/ у e[^_]UWVS}P v Gu+EHCt5Orxv tpu tAƉ+E[^_]UWVS]{FFu0sk^<*P00+-uuuuSuu%0+-ʉ0)@0uX uuuSuYeuXE)؋1 RhR#u܊N#uNQSHPRhm##u E܃EEPSE)HPRh#ëW0+-Pu }tzM]u EMEtZ|wt00׃uY]Qt@뿃uHus독tEe[^_]UWVS]E %E1ɉME tE-@1u D1E0+-E;~uE t u S=XZE 1Es}B~< O$,&:=J{s{u{y{@u{=uz10E} t 00y;P0e s 00y^;P01 00y8;P0 t=0t"0+-M9~xuH0 uE uE 11 00y:P0҃}u C< w 00y:P0S 0x0H 0Us:H 0U߈ ts1E#E PVu R0p00VvXU 0x0H 0U9H 0U߈E {~=u}1Eu V[X u1 0x0H 0Uu9H 0U߈EE Ru身ZYE 0+-jPHP pމe[^_]UWVSEu ]=&-t1҉0P 0-0-01ɉ 0 0P1Sp0_Zu#u8000H00ys8P00+-P}500XtXZEu EL}tzKyS]P _ P KyS;P|^@P|4M}tVh&G$S荅 iEM0EKySP Y P EEESqEZPe[^_]UVSMt0t"119};ivuC⋉11tJiD} u&ƒu=t uă[^]UWVS utF>%~W,[tW,XY#*Ft~uH<-tB<%t<+u:-#-i0#00E1MxdtS~J~?Hu(UFPQMPYZMUt UQW"+YZUu뗅uV+ZtjV+00XJxRt~i90tM΅x290~*i0t"# ##1ۃ} uVP萎؍e[^_]UVShq#K5X=0tYh#r-HP&-H YwSs0Z8P0xj00Y^u h#BP+0i5rO@Ph #) 9DiPh&G$FXZՋJ ;1e[^]UWVSQ111Uh(#-4ZUt%jtptg Ժ;ƍ7H~h,# 0tyt hT#UjPYXUt 1t+0i5rO@Phr#t"Ph #XZ1tnHi0i0hv#Հ-HQPFY_y/P#X 9~ -x99z 9~ z8 ܉e[^_]Ã=0u!UjuZYu11á0u!0 0Jxu 1øUE=-t@=x0t7uR+0i5rO@Phx#5-UWVS=0t.500NxtSX1000J0B0uh<ViP)Ë00i߉_19~i9uFP記 ^00iƄDŽIu0 0u$0tЉt 0@0=N-1ɉfǃ04؃} ~iE PZ 0u0t:؍e[^_]UWVSu]=x0u1ɉ x00@0SSrwXZu10}=-tpt u =8Wj^X}u-W5-mZY@u0| hPh#SjpSjp*}u$Sj^wSjVwtAt8t$=-tSjpSjpSjpuI0=^ujujhW%t thW%h.#?}uke[^_]US]U M=-ut u1uEM E[]ہUWVS}tE1ɉEPu EPE t!0@00E1fi8D0tt;E܋EEEEi}9r(}i0M9r}9uKP%׃u6t.}@ƃ}ދxt"ҀEہ‰׊U!!1҉U/A9:,1҉tcu tQ=x0t1=-P;u uEt tEu򡴷- 0u20t)h"}upuEe[^_]UWVSjjjà ~ jjj=-tQCtN5-9}J9^9t7@9P5-|ZY@u0軚 hjPh##10950|btPu=0u>SKX5E t t&tt M ڋEsF떍e[^_]US1h#h+Zt$ltptZu⻀ۻԻ͡0u t8t Ph&$HZ^j?ZYV=-u =V-u@t/jP‰١-0P0@YZuS5-DXZ1]UWVS411ɉMh#*EZt+}nt}put h#裃=0E1Eă}u08Eąt2jjW{ uWh#jWMY^t Wh#@0Eȅt}E050 0Nx.}t 9u1҉1ủu؋1MjVE^ZMu u؉}tKE؀u?MjPZYEԅtjM1Wǀ =-uXE؊uẼu؈R0M ƒ}EЃE…tEEËEȉEԡ00U1Mx3t#t uE܉kuñȄ]܅u@1E܍EPjj @u q耉E]܅i\9]t}tLjSPY^Eԋu5}t/1҅tHi4ho#juVmuS#Z}u}Mt7}t1jVW~ #}SXEԍe[^_]UVSupá0@0ujVjQ 耾t-S5-wZY@u0蕕 hPh#u%+0i5rO;-t ,jVY[=‰tut čt ujȽZuVX 0u0t~؍e[^]UVS=0th#jPXZu h#Ph&$rsY^9~iPh&G$IsFXZ١-HyPq-H Y J u5-u^Z@uh0 hPh#u~0@0SSË0J0XYu0t}؍e[^]Uhq#$X0US] hq#$X]0 0uPUS009|:t%uh#q0X A1Ë]UWVS fE 0E졄0E11}uEE@<}%<a~<w=$T&) &F<=Pހ<'<\"FEF1FEv t!#< t#E0 wE#< u#փ8t "B&u11}~ uxFEp"ntj@-t ɉ1:QS@-<}t!~u9SCE\U'$#"# $#1E]CMt]BBuPt}t E"M@EE裄0E죈0 [^_]UWVS]} =03v$x&$jsZYu h#XhGx%[_jsh#jssh #f[ h%#T^h%#I[Y1벋st7jv3XZ>t h(#X6jsjs u7{t1h#Xh$jsh &1~[(h,#js u h#_h@X#js { t&u h#f^h0#[js T u h#@[h7#h#h;#$XjsZYu h# XhC#js u h#XhZ%h"s ho#jswhB#js hH#Cpho#zs t=jvihM#\jv U; uhN#hS#9_vhX#s!h]#s#1#%1`A#1#1#  #S9tRho#j}WlWVC [w*yh#:Pho#j]SlSvjPiZYhh#hZ$NXe[^_]UVS]u t3u hGx%XjSZYt{t hGx%X[ɍe[^]UVSEX0=-u=-u250ju XZ=0 D3...0e[^]UWVS}]5x0t/1}t3=-tޅttVS^YX}u-t?Hi@@} t u P XZ؍e[^_]UWVSP]u }`Ktu,EjWVSE#,0ы Phn#>vPWVSe[^_]UWVS]t 0 =0dPX1u 1 01`[1\\90~jh&`PΙà u\0dP_NP^؀;18t@x/t@xPSm!ZYy1EЉEԋ\0\u940E[ D0u#e1:tt@u=0h#Skp^_19-T!T-5D0߉Sh-xWPYyP@g-H X J EЋUԋ\00\ke[^_]UWVS}WY}E1D0tb=-u5}t/j5-4jhз-Xf-1PaHZ=-u;1u{=-uru=-t`=-tWh#qgXF+t'=-u1҃=0‰0jPyY^1WZ*u@WTXe[^_]UVSU:0@0jRj_Y^x jPXZ 0u0t\rx=f-t01=-t -1ۀ=-t-11jjVj =f-tt-t-e[^]he[^]US]0@0jS^ZYxjP0H0ZYt Sh.#q0t~qjX]Uu}~E p P:ca1Uu\w Zu h#qUu uS| ZYu h#rqUVSuV荠@$VP+L؍e[^]UVSEX9-}]ށ}0@0FPb-P-5--0H0Zu0tip0@05--)- 0u0t4pe[^]UEuj h#jy[>-)--UE--P-P0P 0P0]US]0@0-9t-P~ XC-C-C 0 0u0t ]bo]UU0@0B0R~0H0Zu0toUWVSW -\ k0@0=-5-0thG9ua-CPW¡--J -+-0-0^^t5;8u1H+pp X@MSNjM󤣐--X 0u0t e[^_]Ine[^_]UE0B0-)- 0u0t]n]US--0-[]US-+0-)أ0-[]UU-)---+U У0]UWVS,ME 11˅t MPZMwDGƋ܃}tE0v h#mFPKE0u _E1t0wLG V藜YMVu8HMM̋3XZ̋EЍe[^_]UWVSD 011EE h#E_t/}pt}rt}duܡ0EЋ0E뿡0E؃8u h#lj#E^tt S`c[Ejh<"nEZYuET&EP5--0X1EEԉEĿEÉEjMQjX HMt EU߉Ӏ\uA}\}u:jQjNX HuE߉< uO}tj/P_[X9UtltRUuoZYt%URhT&oZYR}] 0xF $p+-E1!=0u 0}NE-9r,>Wu#Y 띃URE@ PAZY@Uu0z PhD#G}t]u]u ]uuRE@ P:[^yФ0uz Ph]#dE؀x u_j)$0*tEUEUuu hv# YY$}O 1SQRPHDRPh$X 5-WZ-@th#[XXEEЍe[^_]USME UJ~A@YXu[]USM1t@] 8Tt1[]UWVSP]1҉U0 w9j EPSΊM 9t#t9uƉׁvSh#Sh#ce[^_]UE0 w @8u1]UVS]1tS艒Z1tpVh4%S ¸tVVho#S ¸t<uh{"S|u Y^¸t0 vS{Ze[^]Åt2USŶ-t1:Ŷ-uƶ-Auƶ-[]Èƶ-U-PPR-PXZ= 0tM=6-uD腺P_芺PP 0hXY%u#jPh#9a UWVS}] Fh#U_Fn%1ۃ<-u,Ķ-Rƶ-U#RPh#8V%#Cuġ-HyPT-H ^ J 1ۋ-t#S#<ƶ-t{"RPh&#U Cuh0#:U[1ƶ-:Ƕ-t2-U#t RPhM#Ķ-RPhf#uU Cu-HyPS-H YJ vu&hX%W^ZuǶ-@uK1-tPW賑ZYuډe[^_]FuWU#Ph?#Y`e[^_]USMU 1Ķ-9u ]R@uQU#PhX#`UVS]Ct&st Pn XCEe[^]m e[^]UWVSP]1ƍ@uPXtUP0UBX1h0r050=01҉0Ye[^_]UWVS }t150EE509N 0BE-uB<-uzu+t 501ۉ؃EEE@tcu}t00ӃouUE8t E!Pu"Ft50U!RPuSjGY[+U#Phl#W^ru"}th#`Ph#Rjf^SPXZDu)--u~uMe[^_]e[^_]UVS] C}أ0V-1ƶ-@uV-jMX08u=0un-=-u*=n-u:jt^tjtYt - =-u=n-u-=-u --0=-ut :-u-1 ƶ-u Ƕ- ƶ- Ƕ-@uـ=n-uC=0t 0u<@00P00jPV00XZ=0t6뻋u h#\H 00Pt0000001ۉB9tt 50 0e[^]~U}ujjjjVE0@0jL0Z8tPX 0u 0u1U[UU0 wj jR Hu100UWVS}uEt ]uQ t9-u Ayu+UB1ۉ1ۿE?5Y]-uyt͉:UtKu5?:u$EEEjEPh#Yà EPh#cQy:u벉뮍Py:xuWڅuU?<:u!EEEjEPh#Yà tEPh#hз-Njh#Z^1H9ujRh#LYà 1Ujhq#h#/Yà U+E@1?1ɉE11ҋMPho#j URgNhURh#X ÊEEEjURu X( t1E1҉PjXe[^_]UME  h#pYP u0=0u01ɉ 00h0h0RppUVSM0tuA0u1:-uztC0B<-uztBu 0˅tǍr8tuPh #9Yy:u܀y:u.zu 0J 02u Ph#{X50150e[^]UWVSj*0^Qzth2#:8-0E 010j0Yt8zt hC#W8-u @P50P)Xu n09\x9}hU#벍EPYá0@00 0)<}_߉ƋM9sω9s x19r )ЍpkME)9s 150 0u0tVSo[PY09} hl#0B0)أ00ljNx=0tE7d ZEy1ۍ0)‰ Lu10 0u0tU1e[^_]Ë-z8U 0x@ @-J8-z8]ÃxuUSt Pd XK]HÃ8uU1҉P8u]UVSƋXCF~h 1A1Z1f@ fZfXfZfXZfXZXRfPȍe[^]Uj1҉P-JHR P UPUSUJtXxv-u~u C $t h@#-B0+B8PCXe[^_]UWVS4-EX=uE8t h(&35--0} t u Eu P9!E@EŠt 9u u4--PP GӁt uu ljE)WPk 0H}t 0R\uG0x\F p\Sà u! 0x F dp 4-> 0xF Dp u"4-@4-==O A94--PP 0xV P-)Rx-X4-M)ȍe[^_]UWVS@} -B ]urVY wVhN#Vhf# 4&h#j"S?FS܀Z؅tWh#}xM4&h#jP FSUWVS]S5-M EZY9-ulPh_H= 09s<wDu 9rMW50[ ZYt%0= 0M܋=050 ##S e[^_]øq#-ztLUS 0tt#u*q##1154-P 0ZY]UE 0jZEODU謳\uH袳 u"4--@8xtjjXEjjh"D _UVS-Xt 1ۉXX8x tjb-1҉P Y1p84-P0 0xx0Px00ƃ)c t,~tŁF $& 4--PP @\ |td;Z=t g u,?&u-@1-@d|u-@Ǯ-@)&t;u,-@ -@ q-@-@r-@_a=t0 u74-@4--B0ztjj`Y-1҉Pjhb&Vtà ؍e[^]UWVSSá-@tuy =-,uyGEt7`&t,O8uQP\~ZYu`&^_8Et2jwV2Y_t XS|4$PS- Rt -1҉P؍e[^_]UVS-p$ t jj-ubX(x,u{ upVDZuh#P: uBPVg-BC1ɉ ^t‹(wjpV P0+P8RF Xe[^]Um-B]US]V9tjS]UWVS3t u%j _8XpZʡ-@؍e[^_]UWVSS-@}%11EuCPw C u j X1҉PYt8uj 1~^Xj 1҉VPXFYƉ}t'}ugEwRu D}twu}um-@-@}t_&t<}t jjG-@#61ۀ& r؍e[^_]UWVShEӉM-@E1E0E誰E+-]jEPZYtxcTd*"t~L tgF=.H#"$$& Džd't+pЃPЃv;4--Yt藧PЃw tPd@d_ƍ@;w`u hc#<\u<\uhz#ރ?PDžd Džd11\PЃ \w t0)Pw t0Pw t0脣 Ad9ud(=w h#0=0 á0HCw6 0?ʀJ R 0CC@wj 0 ?ʀJ w 0CC 0?ʀJ vH 0H@ 0Ywj 0 ?ʀJ w 0CC 0?ʀJ vH 0H@ 0;wj 0?ʀJ w 0CC 0 ?ɀQ vP 0P@ 0 ?{ 0?ʀJ w 0CC 0?ʀJ vH 0H@ 0 ?ȀP vQ 0QA 0?ȀH vJ 0JB 0?ʀB< vA 0AA 0Xh#}€ u 0 e a]tW t)蔣'~ \u聣=uh@#%4--xtjjX븲Š"& <w 0C 0fxt @ 0C=u 0s\谟k u%4--@8xtjj^GJtujaY>uVZ0VXs;5$0};5(0~5(0}>uIy>u |u &u y1tm&ups1ɉK-djdB(-@(X4-Pj¡-@(Y-u @ 1҉P  躚s-X$-@ 荚-`H,hP S-p9-@ Y (\u: 050VXO"D8 .lhjډU0H\^{t &0\+-X 0d\@{1#Tþ}Tty&uh P2.DYu[tJ}Tu@T$0%0jjh$0 T1Tۘھ &tJ 0xd@d\Xd\ &uJЃ wK 0xd@d\Hd\ƒt:@Ѓ v0t' 0\d\P 0xdX=d6X=d%:t #u&¾Rdh &V;YZ&d0H0tx:C X:xCdXdt\dd9‹\uADdd1 u#}t 0x#C $X#踖1Gfxufxt΀Aw@ ȋ-X2dVNj@f@f@dr@b&1҉Pa'uAW|b&u10\Nj@@"&f@0\$ו0HNj@@&@f@e[^_]UWVSS-1ۅtXC1-0x tj-1҉P YF8Pv vS‹FP U8tSj-p蘚7jhB&P-HUJ@ B Κ]e[^_]UHu+]UWhPT0ld-`0\}1󫡨-X1pjEP-ZYE00E-Tjh螙 :jhB&P -B t$Pt=^- hppDžt1ɉxR|T}E-jjtP‹ -pnX-`-dڙZl0\00u jlSDžpq#u^j2Džp#X-`-dlXl0\0pu hpp}UWVS -@1ۉ]}¡- u@$xm@4$&jj}CjjlCQu;jF Ej@UBjj,UB뻡-xu j F Y1҉V @jaj 3^ -zu jCjUjCjD-@C u-x,u p [u h#Zj诿 -PS @0C>-Yx ubx,u\h %pa^ZuIu¡- up0-pY1҉US@PvjjfHu? 8j@-1҉P P-J0HCBHYvB-@ttjjjtCV-@^Xj蓾 -B0+B8C j -p0EC 5- ~ uh %v`ZYt h %CEF-xj ƋE0FEY-xu-x  jj p0‰EEU表-@^Zu UBE밡-xt jj@0Fj:F -@Yt-Pv jj u -@FEM1҉@{j jC1҉SY^tNjjX=V-tt3j"-@X&}t-@uWf^_VjjJ¡- u@$x@1ɉutt;tj aXZÉs؍e[^_]UWVSP} uE E1E1}𡨷-X- u+p0ƉxXtӡ-p^[뼋H up$E0FEE럋]K9u}} uwj- 4-H4^SZYuh+#Ssj/v0 t hJ# -4-+A8FF-1x4M@u} u jj\1E1҉j 1ɉHEFE F -@0F[e[^_]UWVSS-@1tu=V-tt h\#LGܡ-@nAuWj 腺1BUjnËUBpXYUjU$C^Ut1ɉ ֡-@tj")pZƉe[^_]UU-1ɉHHPtjjX-1҉P t/Ht3-@jy-Ytrrho#*-1U11ҋE]DUU Et 9Pt]UM40tPt9JuB]US]jθSCU PUPUP X]UWVSEP[y h#9*u;5-~5-ExWGYZ=w PWVI `jjjr uNuFjjfjjfjjfjjf$jj fSEpuj0huEe[^_]1=00UWVS}u ~}th@VW蝅à VW诅ZY}t9u9t:WX19t-yi0> PVWhC#SpSVWh]#)9-}-؍e[^_]UWVS]{tN7Gu 00} t} t&Wxjw PR+GxPYW6 Z1Ce[^_]US400@0uSw40St6 0H0 u0t ]']UVS40t/}u jS$ZYstFxPWX6͍e[^]UWVSu] -9}5-9~-9t7SjjSV+9tg8VW= PShy#'؍e[^_]US - A - ~.CPjjL x9-}-PX͹ؙ } ,0]UVSu,0 ~;$0|p5,0j Và x9-}-9tdYVvhh vhh V+ǃ "N xtQqZuQtYttj :   <t?j}WSQy"d09 PSv h##$SxZ 00#VX:9=-}=-~~EuxV-9t1jPSW0yc0*9 PSh##rjjW `H0Icj0~$PVh#X#19u1e[^_]UWVSƉׅu#P[u VtYt ukj jVXZutb0{8 PVh#"jVXYutb0N8 PVh#щ؃p Ѝe[^_]UWVSƉ1LÃ}tVhO#5- Eq#$EtE"&-td#NtRuhp%PFЃ!t)t7RhY#Pe t u1~ t1hB%5-<YX 둅t}tSh3#P h/#5- XZe[^_]US]5,0j S uc,0CPj Sv tCPj Sa u0j j SM ujj S; u h9#.!9-}-]UVS]t4,09C|sKƋCZ9tVPSs=s e[^]UWVSuU 1E E1E Et{j1ۉX40=40X]^9$0[vaSYES:$6Y}u00u EPV* vu9(0}(09^ uSYu SIZtj jjS  y_0]5 PSh#SUZ9US XISwYZOjS !‰U0@0XZ=,0 ,0(09}@PjSG ƒ uyE_Ht Ut_E5,0jS ƒ yA^8ujjS ƒ y$ ^8t^0]4 PSh#9-}-xjjRU  UuRSW0H0<0/%}t --}t --e[^_]UWVS }1EEp7p#.1EEh#u WYD t0tVKYwN9$0~>}u}1ɺ<ƒu,EEptVl_9(0}Vh#0sssru>[1UPjS  @Uu[0y1 PSh#> !9t'VjS @u[091 PSh #}!ju܋MZh(#rXe[^_]UVS]u M1P1<&t#KyS PMX P<&<uFtPho#S+ S4<&VZYt vVuQSh3#MSh<#EF y)KyS] P-Y P-Pho#S Sv XZۍe[^]UVS]Z0@0u!u 0u0tX=0uOTuZ0tO08tCt>1D0@D0=-tu0uO 0Y0[^]US]SYt ]]鋵hz%S+ YZtSiZu]US]x#t%SYZuSho#j h00]UVS]} tKyS P ^(P ?u3Sh/#q ZY?tH!VmPh&$S  uKvyS~ P XɋP 뽍e[^]US0@00t8t P{& 1҉Y1u1@0 0u0t ]]Ë@0u0t9u=1u 1UWVS]u =@0u0t8t=x0…teu`tM t$tAW؃u>=-3=-u,=0u#=n-t=-u`0uYEPjSV @}t tD1:=-tt!Sv=-<uu9ujPSSZY@t^u`0u jSZY1E܉EEEK>v cV DjEPj e[^_]UWVS] }uh6%scG^_t}sh|$V@GZYuhx# j5- xh#VG^_Eur0tF0@00P# 1ɉ 0[t jVXZ 0u0tF@u1@01Eq}sh$VFY_th&{"VsF_Zt CE1#~puM} CEh6%E01FZYƅFMEu}}(th1ۍF~u0u6u h}#XV?Ph*o% C ~ h/#oX1ۉ@ut h/#WX110tB08u6u h#-_VPh*o%C ~ h/#[1F@ut h/#Y1ۋ0t708t+h#0PE SlPh#-C@u91tLu==@0tE0Zu)E0>-u~u1}tE1 111ECh#RXECu\0t0Phn#Y[E PaÃEX?vEph'#5-6 h#0Zu h# 0P XSCPh# zCuui0@0t VX0t0Po Y40t jSJXZ 00EO111Ee[^_]UWVSuu @01ǻ0tB8t;0@0W-0P0H0ZYu0t1uu e[^_]e[^_]UVS]u `0u VSQYX`0<vjSDNXZuƃ`0e[^]á1=@0u t8u1UWVS01ɉ D01u@@u 0e[^_]1҉1=@0u‹0t0}W150S!jP+S d1t }wWk150Xe?1uHuUS]90t$jj1jj(jj0]US\1ɉM=0u'=0t0t EE0000D0tjEP[Zu Eģ0jEPZYt0@0jEPY[uO8Eģ0=@0uы0tǀ;tH10jSXZ몍Eģ0bjcwX] Cvv1ɉMMMMEPjhXZjSKYX1EEEEK>v N DjEPj zSPC XZ50MU0E0YUWVSh`&PZYj'V=_Zu <)ș19e[^_]á0@0-t,UP 1--Z 0u 0t 0u0tW UWVS]~;1Wu u ~ )Dž~E u F ~) ]M8t̃؍e[^_]US]S t0 9t*Cfx!)QRP yfKC CC]UVS]Cfu1CfKS u>0@0s>C CC0H0^uV0tMV Ffu9s0@06CPRC S)S0H0ZYS XKe[^]UVSu] >t/CHCFyS!VH XڊVH 9-u]e[^]e[^]U5-uXZU5-u~XZUPuu EPE u hA# uPJu UEPu u UE Pu5- UWVSu] Eu]EPu}Wf EHyEWfEUZ fEUtDe[^_]UWVS u] j'V_Ztt~tnhl#V^ZY<u[KySP"X P"SVGCHC^_ySwP"[P">t%h`&VZY<tBEt7KyS#P'XEP'1҉U1FVKI't/KyUES AU y;뼅t$KySP'X P'KySP\X P\KyS^P'_ P'1}D>;,KyESJ 'YE J 't"KySP'X P'9-u]e[^_]se[^_]U5-uXZUh-Ihз-?XZU8ruPhq#Ph#UWVSSEPE X85--0j=RUN ZYj=SB ZYU))9~߉Ӊ 0I 0<=t$t xFU蘙p UCɅxUzU] Ue[^_]8UE1@u,1+1Rpp h#jhT1mT1UWVSu} ]t t9u t1141&Ft9t&!@t)[^_]UWVSS11ɋ1tZuA=u܍P訕EY11t5Nȃu$Ft sVЉZt F6ǃu1Ee[^_]UVS];uE#e[^]h#SYZYS5Z9u;Sh&$j'S@ Y^ƅu+Shw%XZ/<'uh#sXuS)Ph#o e[^]UWVS]} sSt"CtS҉XuEs1Et Wh~T$Y_}t5uh~T$XZ$-Jy R[ -z9 _F>=u y:Cu}th)Z#FPZY-HyP-H X J e[^_]UWVS=l1uh1 h;l1Y111tJG} tE t8tEt.h19P5l1l1%h1XZl11tfzuh jjh &1zuHh jj h&BR.uh jjh0&h4#P&ZY¸(&t1UWVS|ƉӀ8!uxu :~[tfxipftft!f u&Pq _7;";f xuWS蓡[^1WSZYuNf$`&)E%=E%=@E%= E%=`pE%=aE%=RE%=CE EE6M;MUԉ!]˴]n9>(u;)u V Sue[^_]UWVSƉ׉ˉ&fx@f$&SV$Y[SVy$_ZYSVl$[^SV[$ZYlj։11 lj։11 ylj։91lj։9ylj։n9([lj։P9PV虞^_xPS肞ZY04]E9uc9u_E98PV@^_uWxPS-ZYuD04MU9u9uE98f9]PV^_t1oxPSҝZYu鋅|9u;xu͋3E 3U $)~t08u9ut1u uq# 9uM+-8Mt#y޸#uPhy# ECSW YZ@u';"}*#RPhR% E}t jW XZMuUVS@#\0@0X0@0W5\b8t j=SYZt hSXZA Pho#j@]S6jSh#j h-h<"(j hT-$h# ƒ %u#j Ph#mj,h#h#\j hT-$h#K$e[^]U=0t 10|0R-01000=40t jY---з-ȷ-tP1ȷ-ZUj1ɉ 0~>R-10-Zxt@~j0@0jXZ1`0uƀ`0@@u 0u0tj UEt]UVS]u tVs XZe[^]UVS]u &$&Vs [u CEe[^]s jVDF4$VsJVs Vs[Vs Gs*VDF[ ]VsVs C[XZD[*uFEEhFv#V&Y[EEE8.u(px*u EhFv#V_ZEEu uh#EffEƋE@xWBtG,%A[A< $,&CCA<2hIEܡ1tP^u $Uǣ1YE܋E܊@<<~8Hw0$&b~<'tz<\tv<"trflnhrdt`v\ru P2.DqtN\y ruBMuЃ<u^?MЈAu-<@^ae\ruЈBU?Es}ttWWtWWEС1tPZ111tPX1111ɺ E51FP£1XLx׉2Es}t"tRSuuh1;0RutRSuh1Ruh1  @11 Ek51h&$`11t11҉ƹlcE}tuVuP VSvtVSVP3}tt PSuuSPutPSPub_XMƉUйjEV}t uWVuP(hWVStWVSWVN1th؉EM܀"t'uEЉUmЊM<:1҉EP10e }С1P1UY^MmЃ=1t^}ѹLE}mt(t <$SuPX <$u t <$SP( <$]EЃ}t%tPP$Suu LPP$rt PP$SeWW$u%}Nu 1Buh#C[^E@EEf}f815--fBYt*fBh #jK1}9tǃ8뼡1h#XPeY[^_]aUE E EE] UWVS}0uh j jh`&MQÅu$Mh j jh &QӾÃHxu Vh##Eh*.h#Ea6Wh#h*.赯vWh$#h*.袯F (twu1h- &SY_ujhX&V  &t"VP_Zu&f(1&uhP11҉zY[th?#vVh#Ǐ f(1hcH$S%_Z1ɉ>ÉhR"V(_Zu h]"V ZYu6hb"VY_u Vh#  e(1h#S]_ZDžum>jP11҉(Y[th#蔎XZ (1G}Ɖ듍Wh#S3 HuEt9$1s(h#1$1f*)1Y[f*)1uƅh$Si^Zujh(1h5%SIZYujh(1衷 h#SY^uAjW11҉_Z(1Ph5#SY^u.jW11҉_Z(1hC#SY^u.jW11҉t_ZL(1hT#SNY^u.jW11҉5_Z (1h"SY^u.jW11҉_Z(1Thd#SZYthr#SY^u.jW11҉_Z~(1h#SY^u2hW11҉d_Z<f(1h"S=Y^u2hW11҉!_Zf(1~h#SY^u2hW11҉_Zf(1;h#SY^u.hW11҉_Zuwf(1h#SxY^u*jW11҉__Zu;(1h#S=ZYu9jW11҉$Y_tVSh!#u(1wPw{tSh# F;$1rSh#>~!jSh#‰$#1H(1f‹8)1H(1hf}#V苧_ZƉ>uh'#Y[ &;twWZt ucPVWx[ uT- &Ë@)1WYƀ>thf}#V_ZƉ>1&tP2.DPt7hP11҉,ZYt$h?#蘈[_ Dž"!y v5Vh#_hD#U1ɉƇ(1(1$ &0)1<)1<)1H(1WH(116C-fC0)1<)1<)1H(1te@H(1t>16C‹<)1H(1h(1Ze[^_]UWVSP1۾ &< &tCtg1}jSEP< ths#}Y1@E hX jSP1E4FZ9uu誹Xe[^_]UEU M= -tMU E]y5]USÃ=(1=`(1u1҉Dt%Ph(1XZ/ u=`(1t =(1t/ ux=x(1u=l(1u7jh(1hedAS/ tHh(1hrdAS u/h#jh(1hedAP y h#j]USQ(1WEV$)1WEVf()1h(1:f()1X=(1=(1u2h(1hfdS y8t8t#rE=(1u2EPhmdS? y h#蕻Z$-h = 莓X=(1t1&h(1hgdS y#W]UWVEu (1t (1e^_]Uh@(1hmd5$- UEU 19s f3P]UERPZYUS]EPu h@*.hSƒt$t< tj S2ZYt1]US@-tsPh #臖 `E E'#]dU"=8*1u"PhF#P: Hu9Y[u uVh#YI][<1M9Y<}Ph#輈Y[1jPWG t5(1uh*.=4*1~E1]9^~ t)t;FtF5(1Wuh*.+FGVh # XZe[^_]USBHBy;B| X RQ蒎XZ]UWVSQ]u uh'"SNF fw4`&h"Ph."S' FPjh8"SFPjhD"S Sh&XZFXt ShQ"Y_FXt Sh\"XZFXt Sha"Y_Sj Wwv(hj"S裊v,h|"S蕊 v0h"S脊v8h"Svv4h"Sh$vu8t/j} tu Sh#$ Sh%_X뿃} tu /Ph# 벍/Ph%[^띋$t $P觛YP蚛Z}t E1_jPSU y hw#X7ƒu*t=tR΢$u hf5#g e[^_]UE/1E /1]á/1á/1UE Puh*.eh*.j 'kjqUWVS]8ށu=/1t5/1h!"zYX=@+1t"=/1u5/1h#z1@+1XZuu ( ZYyWҡPh$^z t7=/1t.j hyX=/1tP5/1h#'zjPpe[^_]UE Puj' UE Puj UE Puh UE PujjoUWVSt1ۉ/1Ph!%7^_y h#YKhVukw }t Ƅ1ۍPWW7YZyWh-#NXZ]%=`uz 9u;u/1Whh+1C à uWh=#뜍xPS6^_yS끋%= ShW#e= u0t,WhV舅 à t ߻Whu#+W袹Y#0hVBf à uh+1h&$BXZ멉؍e[^_]UEPSZtPRPh# u uh#hh`+1v`+1UD+1tjXj 0USxj0h&jt H+1jjP]US=j赙jjbjjY]UWVSÉ֋x CPww wwփt=01~j ^X01e[^_]UWVS1=/1/1/11/1/1/11 Dž޸u/h#h#?c[^Dž SUYu{Åu@3hVid ǃ uVh&$sXZPXEtVh#2v Eu {u{wu"Wh#h*.y DžQCC jhPjV*~ Ãt'$Phzd@S藦 @uSt [W茶YD P2.9rDYt)PH/1t4KRWQ膷 u <tPȉjl Wgk C1ɉK C C1{;/1C/1/1XZ{ t%VwͷYZuVh#?aXZ?jk Vj Gj G j GG1CG8{Dž*Ed@DžT/1Eu/1} u:E 5j sYtsh#ss _Xtvh*o%s6M 9~=/1 1ۋ9}IU: tE 9}?C9Ft16uPh#_XZPQZy5/1ы1Ҩuԉ ^ EtPs ssh(#sȃƒt.t&Ps sshA#h*.WvDž StPVS t"1/1C/1 sbsZST 1ɉN01H01~ X /19;/1/1?uǃ tuU E 9|q/1q#:tF$he#Ph#h*.u/1t`/#;t%#Ps ssh#h*.tͅjsVsUE u 藳 )9 _ TU e[^_]UWVS]fU ffCffBCffBfCffBs snGY^} GW CȉGCȉGCȉGCȉGC ȉG C$ȉG$(s( ЃXsXCdȉBdChȉBhClȉBlCpȉBpCtȉBte[^_]UWVS]fU ffCffBCȉBCȉBC ȉB ssFY^} GWssFY^GWs$s rFY^G W$CDȉGDs,s(WFY^G(W,C@ȉG@s4s0Y^S~fCe[^_]US31tcQRP$31]Ƀ=d21tf‰Ã=d21tUWVS$ƉӉMС821EF,E؋BEfE졠21KMK d21Et EEM MEE1;=@21D21>f}3EE܋Eؙ}E)9EE у}uUuG=21=x21 }t Ct C{tfC[9UF(9V$}1uD 9~ txƋCSM$C,AE8211}fG18f@@XZtA 1521821C,)C$S("s${(19sC,EM9bE@EUЉE@EMK,E)ƃs${(ș=8219E9UʋMou{5821C,)֋C,C,)s$S(;h#SNjCSMEAE@ufFZ[tA 121Ee[^_]UWVSu^8C@Pvu uu uhPu u21 )P@1ɉ531NP t1҉ 91CtCS OtNCSWVJ +QCSLCS >WVJ +CS yP @1t|u!<|uxuxx u xv8|^u |tx31=21XT؋tllωT|߉TWGs0GWWG zCSlTblp@QPDt{D|~DS Cq0CS Ch> 4BhD"l1ۉp@W dhOPdh t19| H0#8@#OLlpPxp 82131H0|Ãx} 821x5821f-s31B0C9sjh-VE5821 C =21t@Y @[ JPdh t19}#8@#BLlp>Ãxjh-p.EPh)#j=21t h=# dYhI#OZtWC jj31@0 RPJ P^_D31@0Ɖ =21tL‰ˉы Љ\1ۉЉ\P@)GWWG)GWdtLL1ɉLS Cs)jCS Ch)Bhp8|2121 ]e[^_]ÍL$qUWVSQQEUA@Pq q{$ƃ 9jj31@4 RPjjWVv f-821Hɉf- f-f-f-f-E-=21tE-]E]C WV XZ=21t CpSt C(T1ҋ 31I4 xtWV`([^11tjupEA 821f-UJ 31@4B9s$Ujh-QMAM 821 UB fCgu5u0C‰UjjLUfPjjSuu(ZY8tuuZY8WVSWVQUMPHPH QREWVٺU$WVȺZY8u(CWV诺fXuu蠺f@uu @Z[@fAjeY[^_]aÍL$qUWVSQpQAQ A1 %Cff^_"f@tl#PhP#$\=21t+=21tC CC C u#hZ#^Yhi#ڰZu1211nu t3f@^_ 01$01jj ¡,-ƅDžs Dž1 21X[tBBp tBBtPR^_t 01$01hs#Ӄ[=21t/5(-jjjj 01$01uh#蘯Yu5,-RPjjt21=21toh#!]b5 01=$01ut(jjX@[ZHfAWV$1 01$01XZ=21tj M_ 01$01ut!jjRP! 01$01uu h#RPof%[^f=@h#sh#臮ZY5 01=$015(-jjjj 01$01utRP5,-jjEhjj5$015 01YƅDž WV}@@PP WVaf@5$015 015$015 016^_8th#x1ɉ 21[@21D21tCjj RPs> u{C9s#Qjj RP[; N0ӍS19r)#u 5$015 01iu"h$蠀h/#xZ121XZ$fH^_f@t !5$015 01h3#fu8!t%h3#5$015 015$015 01#@Z[@fAs5$015 01gf@5$015 01h;$$u thR$J =21j IXeY[^_]aUWVS}u w wN@fEEZY9ucp21t=21t =21tj jjjw wup21jhe$W[ w wNYXG $019O u,-; 01tOf%l#f=@u"Rhk$d~w wE)Puhy$I=21us=21tRyNj Hh$~XZ=21t2h$W_=21tfE)fCe[^_]q h$ݩZHt1ɉ 21x밍e[^_]UWSá31p8ѻSYu1ۅt$ 31q0RPká31H01{ ؍e[_]Ƀ=d21tf‰Ã=d21tÃ=d21tUWRPY_}UWVS,u} }P21T219]KM])9ȉЋU31H8UUE9|"A!!EUM]9]}=21tuI!QWVh$G31MȉẺMuuWVu> EMEЉUԉE؉U܁\TtCЋU!CEUԉE؉U܋CEU܉EUEUEUE9ƉUCEU܋]9؉Ћ]ظ=21tduuWVh$G 31EƉ׃\TtAЋ]!A׋ARPuuh$FZEȋUEUԋ]9؉Ћ]ظ};=21tuuWVh$$|F31uuh=$aF$럍e[^_]ÍL$qUWVSQ8QEU}9Es9=@21D21Esuuhb$yh01l0131sx1u؉}܉Ɖ׃uЉ}ԋ}9}Ћ}}sEU9E}(\1ҍMQRPuuS4 EЉUԋEUEUċ}ϋUEȉUḾTtYh$ZH=21u؃(21,21{@tjjjjsHsDs s Su[^_=21t 01@ 11 }s sZYe[^_]121e[^_]UWVu} WVuuuh$"dj .WV$t uB<v Rh$be^_]ÍL$qUWVSQ81yAE 31EЅutWVTZY8t 1u؉}1ۉ]̋E;@21ED21suuEZY8t EU͋E9D21uE9@21311ҍMQRWuuj EĉEE21Eȋ19]E s 9sjVJYXu!Rh$bXZ1E؉ESEpWgEȋ 9s@t EpNXE21x0uu EY[ 31EƉׁ\TtAЋU!ASA RPh`31薔5|3131}d21=h21ttt531u5|31 EЁxU tU tuh)$aXZ=h21th`3131_EЍxU uEЋX\á311RPuuM EH 31ELHh R531531531Z=d21t31PP"[^531d41E%Y=t =t)=@EE@E31p8 Eh`31Ȕ31uuà =21V脞 EЉUԋUЋEԉщSpCtZuEf1{XEPӜEUC S$C0S4C(S,31HT t1CS yCSVܝWC(Yu EE'f1҉SdEP9E"CC C31HT t1CS  ChX(21,21=21tE }̈GE؋U܍eY[^_]aUWVSX 31E311RPu u EEƉׁ\TtCЋU!CQC RPh`315|3131}d21=h21ttt531u5|31 ExU t U tuhL$^_X1EU1E EU EURPË21Y^t@@psEtCCt_EtCXCdK EEPS9XZ=21t 01@ 11 u u^_}tjjjjuuuun (21,21}ExU uEX\á311RPu u  E@ 31EL@h R531>531531ѕ=d21t31PP虹Y[531 `41h`31芐31XZe[^_]ÍL$qUWVSQ0AQEȉŰA Eċ531FPE21Ef%ǃ}tCSCS V0UE}tEU1ɉ ft1 uމ#u#}̉u؉}܉9E؋E}ԋuȋ}̊M t 9|P}tFTFD1҅u{uRP}ĉ31@0 E1uE1Ẽ9Ή|[+u}̉EUE9ƉU|R+u}EEEUEEE9ƉU|.uuhn$YEȋỦEUEEEE؃}t DT1҅uuRP à uuuu? EU䡐21EԋKMЍEPuuWV u}}MtT j1҅uc 31q0RP肌à MoEĉ31@0eY[^_]aÍL$qUWVSQH921EątGWGW EU531F0E}tE1ɉMԋGWEUEE1EԋGhE1҉UNPEU t1҉E؉Uܸ u9]|bEƅu1*31X0EU=21t@M؃ωT ‹E؃T ؙ]UE؋U܃EȉŰE9EȋE̋u|uMЋ])M]̋EE؉U܋E9EȋE̋]|c]؋u)]űMЋEȋEԋueЉE؉UM܋E9EȋE̋]|.uuh$VEЋUԉE؉UEEEEHËE}t1 DTtVEEą31p0EU=21t! uUADX}t DX1uRPÉEă uuuu E؉U܋ 21MEċpEPuuuu ËEUEȉŰMtT- 1҅uiueEƅ31@0 EUEU=21tMċIىTUċRE@ `uuăf 31q0RPˈEă 1Mu h$T31@0EUj=21tGWEUPGWGW E.Gh eY[^_]aU1qPh$h*.e$jUWVSSƉ׉uEPQU 9t:tWVhX$jize[^_]UWVS É521PSXZ=21t=21t ho$TXVSa^_t u=21u1hy$T[p21=21u631Ph$ToSZYt h$jTXh$_TXr=31t8=21t h$'TX=21t h$TXh$$T_=21u hH$T^'=21u hf$S[/=21u h$SYr6=21u h$SZ8=21t=21u h$SXP31 $( @8 $(RP542150215,215(21h$S31@Di($ʉ1WVRP jj RP# RPk(dd$WVRP RP ($h$@=21(21,21+@21D21 31(21,21531NF)ڋ~,f,021421Ӌ~4DӋF8׉֋ $(+ P21T21 021421u't2!RPh>$ =21FSQhR$ =31t4hg$31Xtssh$ j X=21t4h$a21Xtssh$F j YX1=21=31=31=21tm31jL04h 531531" 531531赉=d21t31PP}[^531S41Y=t21t1҉21jBX1ۡ2131;Z,sDtPj;XCP`;121X=p21t =t21th$O41X=21=21u h$O_=t21t h $O^zN0Ph!%+Y[u70t-1҉,j,R Ph!%h(m% t=21u h@$OX) e[^_]UWVS]s{{@u(EUE9E1s WVE܃ WVh<$s sGX41\41EUX41\41 E9U}Xs shL$TN =21thf$ (^Ehr$/z[u1ɉ 21j<jC EE}d}uJЃ1H21r8021421jWVp tEWVh?$s sP41T41EUP41T41 E9M}s sh{$j 80Zu#1ɉ 21h$Lhr$ y[^px 31u31311҉319t9zu9rt9zu9rt31C0S4MEEe[^_]Ƀ=d21tf‰Ã=d21tÃ=d21tUWRPY_}UWVS0RPM詀21xf%ftGWGW sft3j`h11GpP umjhp11P uS3j0h11G(P u:j h11GXP u#C uu utkh$ Kh$wHu=#ZY=21t 01@ 11 h1=21 H41L41 31t04A09rAA09rf@u79s#=21 h$=21ufuth$u^Hufǡ31@4EY[=21tGWGW f531N0ASQRPm y%=21 RPh$ f`t f ufp=21:9=21h21G(RNd1RPS5|21Awt h $DG=21t1Sh $!PG(P=21t 1GG1GhX531(21xgș9rT=X21t;9ظs1ttht)t 9sw Dž1H~A^tڋNtftH붋 521 9ظC tIDp Dtt=21u0D(PSh; $nd|(븋DpTtuRPSha $9/ 31119ЋAtz C띋RPh $ t uC~3|X=21JuDXVPh $4[^+W-pY(21,21G fFf[j 'Zu01ɉ 21h $MDhr$ap[^u-ju~jXp2121f@u;u tW$21  F=21=21tzGf@t`@ GpfGGGtfGXZ Gf@u1P41T41X41\41FV 21tGGp}FDtGGtcFHtGXGdI F@VWR[^=21=21t =21G\u&G`WduuGhWlutlh $Bh $1nu 1ɉ 21&'1G\G`GdGhGlaf!qXZ=21u]31P4 @0ȋ^4É΋X0p4=21GW 31W\t@@I0D11531uFu=G\#8t-@DNL!!ڋNT tF8F D`Tdu#u@DžVCSSS[tGh19u9VSRPh $:@=21t hM $Yh$lZ Ë@0V4^_=21t sCSZChVx@jjp4p0pHpDӁ hZ $_?h$jkH6aZY=21t 01@ 11 #he[^_]UWVSĀ 31E1E 31E;A,}EEU}\TtAЋ}!AEUAEUEU11}tAu}׋E9ƉU}4Ѓ1H21E>HLY4DEUE9ƉU}4Ѓ1H21뾍U1E 1021421(21,21E31];X,W}}1Euu 31U׉e^_\Ttq֋}!qSI SQh`31To5|3131}d21=h21ttt531u5|31脜 =21tE@x 31E1E= 21t731p,kEd1E;SVuPhs $h*.R 1= 21=21=21ExU t1U u E#uh $;[^ExU uۋ}G\M]ȃ}tgu EUHu}u}11ۉΉ!!u6u2EU}9}u܋}9}uԋEUEU}uE|21ËE}uu 1ɉK<}%?}u}9t uuuEZuuh $:j~1}MECEUEUtxu}9r WV[X M89xu9tuËEUtx5H41=L41 H41L41311҉EUtxEUtxt1x1 E9EEEEe9׾r 1)ӉΉߋ|21E]3u us%21|1҉TYm9}u9utc%?u9tWVh $;9jSuj!YXu Suh $9uEsE)Éٍ1EPE 1`21e[^_]UWVSEP@EUE@ E}juu艻 t`41t`}9xuPu9puHEuuh?$Ep p `41qyEpxu}qy `41931u 31u덋=`4198tEUMK؍e[^_]UWVSTU1EE 31`41111E31H,9M= 21t5kEd1M6SMQuPh $h*.1ۉ 211ɉM31U;9soWVtXZt`u} 21tCCpd21tEtCCttEWVkZY8tEPSZYuE_Ee[^_]UEU @,+B,]Ƀ=d21tf‰Ã=d21tÃ=d21tUWRPY_}UWVS Ep8=21t 1Q=21tt1;@21D21slj}1RPj@F[_DžEx48x0.Fhv%PXDZY"}O_ u9ttFPh $s4Y_R $Pn`ZFfSPV whD $>`_tr<Fo)efFYPVWGfSPVE@0P4p pihfH DžU;B0B4wr r@Y[=21ƅhh3#Pe 21 d21ufEx4x0^N<9")f fFE@01x41RP4gfH1󪋅fFXZtwFh3#P@ZYucA1A =21 ~h $Ep pFh$^H121EHX P@uuȉh $SQRPVFD9c $>tFPh* $y1_Xr $P][tguE@0P4=21t hQ $" YP1҉P FfPhc $#]_u@@ uE@0P4=21t hQ $ [H1ɉH F>ufWVR C+fFPVS/fWVuDž}G0W41RPdfHXZ֋>^EP4@0wP~.uJ9}:uh` $ ~ .u)hp $Ep p֝1>h$[EH0P4 19@21D21s h $=21tuHu<~t6h $1RPEp p蔜=d21uHt%~u븉Fh$&[[H1f1RPcXY,t#B<v^uM;A0A4o h $1RPEp pЛh $ZW1ɉ 21?M;A0A4t!=21=21 $ $R1RPEp pPh $ZǃS1RP,f%ZZf=@AfC1RP蚻ZYxu xU;B0B4ЋR @RPRPhPqb‰1RP1RQhPBb0Ph $Ph $-=21t h $Xh $XYU;B0B4}R AAQ=21tTVC9tHh $1RPEp p™CFh$~XHt 1҉21 DžfKPRh $>+u Dž 1 e[^_]UWVS\jj`_ZP$&h $+h#W[^u 1ɉ 21}hjjjj8hD $+h#W_Zt5jjhjjjjآu h) $X*1ۉ21hr$SW^urjhejh[ $+h#,WZYuh$W_>jj%[^@%@3fs Pht $)=21tjjY_fXZh" j5215211ƅDžs 521219T= 21tD+21=21k#)WSPh $h*.*1 21C$w0h $ss 821A 1C$h$ 821QC SRPRPhW^ 821C$1҃=21tQRPWh $h $a)QRPWh $h $b)=21t h$_ 821C$D1C$=21t/ss CNjC$1~YY=21u$GW 萷h$TZHt121GWڍ@1=21@fC$1 S( v Dž 19}L,@ HLPxfC$1C( v Dž 19}T,L0`d@݃ vHC SCS1u`tdPPĹ[_=\21u21_5211ɉ \219s؋{$@1=21@ukfC$1S(19tL,@C SCS1uV`NfC$1C(19tT,L0`d@Ktd.PPiXZ0N^uu9r~$tF~ 1‰1 t!tSQYNjN ^FV~ uH~uBFV =21th $SQRPOh3#vvvv 蜓fOWh$SQRPh$Pu 121,v vOYf@fOFVFV RPh3#vv 訒212149s$;ww Y1҉WWY_8u؋=219s3CSut{u{ tRPPSXY[jj蠍XZe[^_]Ã=d21tUWVSX2121D219= 21tA=21))Kkd"VWSPh!$h*.1ۉ 21ss WZY{u { <{u{t t&521tC=p21t8=21t/u*CS 9RPWf@1C SCSut+RPWW¡$21Y_:u9|Css菰FXZ95$21|)js s賜Y=hC$E"hi#YN /ss^1ƅs{Dž  21^_tBBptBBtVRPZYu hj$x!_Pss觛tQDž ssvVPtUf@Y[5$015 01UfHXZ4e[^_]UWVS EP@EU 31E31RVuu EEƉׁ\TtCЋU!CQC RPh`31R5|3131}d21=h21ttt531u5|31 ExU t U tuh$ [^1}E@ EE}juu跢 pEUЃ1EUH210M;31Ӆt3}9{u}9{trzs{31R Y!}tdExU uEp`ơ31RPuu E؉U܉Ѓ1EU܉M؃3021421Ex@t+jj31@4 ؙRPEpHpDp p` 31Ez89x t2}t,E@$ EL@ EEUMW}tu}to31E{89x u^E@EL@jRPEppn K` tPuSzch 531531s531531W=d21t31PPzXZ531A!41h`31Q31Ee[^_]Ã=d21tUWVS\U1E 1u31X,9]$= 21t/kEd1VSuPh$h*. 1ۉ 2131u1EE1ɉM21MU;9WVġWV/QEu}21tCCpEtCCtEtCXCd EEH$&EXftbWVgYZt=21WVh$!WV]YZt!=21WVh$E SEPwXZ21Ѕ9xu39pu.JZHX21Rjhe$EPTjhe$,t {u{ { u{u jh/$jh;$EP迵XWVPhC$E;Ee[^_]UWVS31 31|jjgO1󪋅h^_=21xX$=21uhg$nF[uh~$RY=21t؋1҉$21h 531531531531`S=d21t31PP(w_X53141^HXI$~97I#)a$~$tl<hNjH`ltW,Ћ9G0sVh$$Y[n=21tVh$XZh$D_C=21uՋB,t|Cl$1~H`C|@ltË#XLS5 315|Y^u h$| 3121h 531531r531531Q=d21t31PPtXZ531@41X21ttDžPLDžHLPƉPX1󪋅lT0TGLÉX$~@=X21u\\`H`GÉXDžU )\tu{xlLtuQ+HhVL\DžU 1DžTDžhDž`TPh$1hDž`L1 21׍G@tu tL9u⍕1󫋅8<@8ؙ!!Ӊtxt9Ɖx}4Ѓ1H211tX,9tQ= 21t5ktd1VStPh$h*.15 21tl1ۉpttڋ\Tt$dӋt!_؃QO SQh`31}F5|31|d21=h21ttt531|5|31s =21u-|xU tU tth>$rXZ=h21th`31G31X=21t =41uh21 21 21d 31AhdlߋplƉ߁\TtAЋt!AƃdAId t1RP5315x21B 31lߋplځ\TtYӋt!Y؃qhISQh31D=31tth^$ ^_]31ph531531 =d21t531531oY[31\8 uǀ\TDžd531531KXZ=31th$PDE^_u/531531Y[u͋d921u 31AhdlߋplƉ߁\TtAЋt!AƃdAId t1RP5315x21Aj531GXZΉlߋpËlቅlpplp8X<HX9ƉH} XH521uy|||@tXl)É@,dPfdt9u6xfdșD1ddff1h$~lj1w8d1 |@(9r1|@,9r1 |@09r1$1t|@x9sЉl(1󫍕HU uH1׋h󪍕U u P1׋\u"xLu DžU t11ۋ;WVpBZY< <<tt<<tM U u Pdك⋍d9s WVPh$O CVtuPU u PU u P1dX9lpHH21Dlp1ۉP1Y8P9ك1DrNU u T dPщ@ы@ @P\9(hIdd1HU u HPU t  L1~\Hdd11ы1Ƌ1f$H`d`ktgU u Tjj(Rdd)ٺ!P~MH8șlpd]$\`pd11;dsTd!Ӊlt @lt$9~ҨudFAl뤅t$9~șdl tLjS PB =21dt'W3VslsQs th$H(h$Po<ZYtej PS[h 531531E531531A =d21t31PPe_X531 41^1ۉ21=21tP|p`|PD uT|PTxU u |PTHU u HhRP h($\PW;ZYtw`S|: HU uHڋ|xU tT |GThRPh`31z;31121=21u)|xU |P\1ۋ9TU u P|~U t |V\ !8uC<1sY|yU u |Q\r0t‰lRh@$-YXl@u1ۋ|@L9=U t | |G`U u T !8uC<1sY|yU u |Q\r0t‰lRh`$UXZl@u닍U u P\RPL txh$P8Y[taU u P|xU t |G\\RPah`31831tj SV譎  =21ts h$mDh$P7_Zts󥋅ƀƀh 531531\531531<=d21t31PP`Y[531*41Z121e[^_]UVS1;] s8ShR&^X1E0Ph$FZYuj XÍe[^]á31!UVS1ۡ31srؔu <=21t40-h$'YX"$u$P.Zty=21uɡ31t4肣311ɉ Lh P531 531531;=d21t31PPh_XZ53141X1521C 31=21t h1$[hO$-Yti=21uۡ31 h P531T531531:=d21t31PP^XZ531"41X121j-Wj$WYXuj\Zuj\Xe[^]UE(91E 91]á(91á$91UE Puh*.Hh*.j 蜼jUWVS]8ށu= 91t5(91h!""YX=41t"= 91u5(91h#141XZuu ZYyWGPh$ t7= 91t.j X= 91tP5(91h#je[^_]UE Puj' UE Puj UE Puh UE Pujj`UWVSt1ۉ$91Ph!%^_y h#YKhVu }t Ƅ1ۍPẄYZyWh-#NXZ]%=`uz 9u;u$91Whh 51à uWh=#뜍xPSO^_yS끋%= ShW#e= u0t,WhVà t ߻Whu#+W Y#0hV跷à uh 51h&$BXZ멉؍e[^_]UEPQZtPRPh# u uh#hh41 41U塄41tjXj USj0h&j 41jj]USj*jjjj]Åt3USӃ=21t+Ph!"YXShv$XZ]Áu=T=Tu =Tt=Tt=8 u[^5314131Y 318<qH։9u9RPhc$31BHЉ8< =21uh$ ZHuqh{$裺X=21th 531531j531531=d21t31PP=_X53184131^ 31@DqL։9u9RPh$>31BLЉ@D =21uh$ [Huqh{$ʹY=21th 531531葚531531$=d21t31PPhSP5<315|21ƃ (31,31031<31=LBALt[=X21h$`h$tY_jjjjjSW;=<31fGWW:fG@31CJtejPh/$ =21uh$ Zu9hM $辱X=21tC=<31fGW9fG@31_fCff=v]hd$Y=21uh$Zu8h$RX=21tfC=<31fGW{9fG@31_fCffuih$AY=21uh$5ZuDh{$_=21tjjjjjS:=<31fGW9fG@31f{f9}zD3<:uZYx=1%= j/SY^_txrt1PRS)Ph$h0W~jP Ƌ 19}Y WPZY u$PS=^_yvA =@uG} tE 1҉ RP(=Y[uk%=@u4h$h0W}WÉF= j} ^_1!hh | à 1}PSZYftS} YylR9u 9tԍ0Po]^ZT8P8RPS̚ yt 1ۉ h$j$Vk|jjV | ÃPhFS茮 yA8u|S| Y랃}tVBUZt8PhF|@SD yhF S2_X1-tP^}tIMQ3tPYt Zy S| X؍e[^_]Ƀ=d21tf‰Ã=d21tÍL$qUWVSQ(E̋AEqy AEȡ31X0]؉E܍EPuuWVk UMUЉMԉE9މEs 21p1MЋ])jj`SQm ǡT;1U4ڃr h$c_W!ʈEȋxlEHX21!9tPRPh$T;1u< =21t h{$‰^h$[u 1ɉ 211!EPT@P}̉WE1҉PPPTeY[^_]aÃ=d21tUWRPQY_}UWVS$EԉUMQƉ׋EE31H0ș9Ή} EE9EPWVuS31J09u EÃxth$XșRQWVuo CuWVPuU tUB EPE܉UM9ME9u9t)MЋE@ E܋UM9Mt7}t1a+E9Et }tE`M؃PESTCPƉE9Eu1E`e[^_]UWVS,E @XEȍ]ܹ1juȋEpG ޅtPEp[_E P@"EԉU؋VẺUЋE P<@8N^ }9}u}9}u9u9tQSQuuRPuuuȋE0h $n,=21t h{$$Yh$SZu 1211)V] CSFV rC8S<e[^_]UWVSPhjjIƉRP 2ÃfCd;EPjjSP31;B0u UztWVM_X5d21u  21QrRP E@ `31M ȐȔh P531g$531531[^=d21t31PP] ZY531Я41Xe[^_]UWVSE XChSlDEU}}E=21tP@P @ Ɖu5REXuhJ $耫1҉21YX5d2131@0RPWVqSx E@ `ChSlEU}u}u hk $231@09EUs } }AEPuuuN¡31@09u u~th $XRPuuf FEPT@PChSls}EbUBXEU}GWEU G8W<521#uTGPWTEUTE@ U B 9t`1e[^_]UWVS<]uE< %Ek$E#Ep$531f 21EԋސޔuRPAE31ؔؐY^uNw9$d&1RPuh $jRPuh $V1MQRPh $%jjRPP.f%^Zf=t-31ڔڐuPh(!$EPjjQL531;F0u Ext%{rt4I5311DXZ@F^=d21u^F9t'ޔސuhN!$iE`'P9uъ218PufHEf9ue=21t h$Yh$Zu 121t31ؔؐH^_5311ɉސޔ{rޔuL<uFuhl!$豧XZ=21t h#h^h#YuS531pXZ31t4,EEPjju!K31Z09u Extuh~!$jh@EE=21tP@P @}ԍu6G뭉Eu輀Ee[^_]UWVS}]O,uh#$h&h` ؙt,h($$h&ha h"$ݫU Msu)u؍e[^_]UWVS}]O,uh#$h|&hq ؙt7h($$h|&hs h"$cUMuu )EUu#P@EUEPU Zt̉É؍e[^_]UWVS] u}Y;1t5x21WVSh>$$q_SWVu5x2101e[^_]UWVS] u}Y;1t5|21WVSho$$(_SWVu5|211e[^_]US=21t h$$|?j5\;1{[Zt!h$$Ghr$[ZYujT5\;1xX1ۡ\;19XL~$Y;1t@Pp0h$$^ Cҋ]á\;1t%Ux,tP*Y5\;11\;1ZË\;11t z,tUu uuuRUWVu} WVZY=21t@X@d=d21t1s&31f`u131 ȍe^_]UWVS21tH X;1 X;131!`t'Rh!%$ۑhr$ "j|Satuhlpx1RhW%$脑hr$蘽 th<%$31 ǀdƀah P531L531531=d21t31PP\^_531ϔ41[1111 31!PRWVjh\;1hs%$赐hr$ɼZYh<%$谐31 ǀdh P5319K531531=d21t31PP_X53141^1ۡ31dJatP PhW%$ݏhr$ h%$ԏ311ۉdƀah P531bJ531531=d21t31PPZY531041X Rh%$g؍e[^_]Ujh&Px UWVS] 1LPTX\`DH&d󥍵dh%$uS| < @ Xh+$SS^ 1 $ ؍e[^_]USQ]tdҀBuCu'EPhd@so @u%h+$SDXZuSh,$SU E]v= ]US]jSzYZuh[,$jS_ YZuh,$SXZ11;VF|~$u~,u;VV | F)8tZu#[tuY8{&CV$9t N~19};{; N~ 19};{ ;KHEPu,_ZNjF,uVЉ|l|t2@|jmURj$O8QUR|P|tijWR, uYjuWUu"@uuZYjuPUu@v0shV-$u[1e[^_]UWVS]u}SZuBjWPS@tjW p S@tϋE p0hf-$S 1e[^_]ÍL$qUWVSQ ȋqyQIUMx uhp-$SZY<$E܉E1EuuWV7- utuWVh-$SLEPuuuu* Ɖ׋EUutuuuh-$뵋M9ȉËM}eY[^_]aUWVSu 1ۉ^hB%5l7E _X1td1SщU&MzYZMt/UBuSh-$u hB%j{E XZ뫋&&  Vۉe[^_]US1&&uh .$7`u܋]UWVS ]} Whq#S葝 1&&EԉU#E#Uut7q#;t%#WPS7W&S*EԋU!E!U`u}u}t;uuh.$juV5q#;t%#WPSӝWVS˝؍e[^_]UWVS]u tEU E Uuuh".$SY[ SZu E@P9sPVh1.$SۍFEPS Y__EtVhP.$SZ 뭋EU҉EU#G0#W4 E UG0W4S2Z@tuSZYEU#A0#Q4 E UA0Q4S_@NVhl.$S+ Ee[^_]USP] ;u:j EP5l7D U:u1҅u5l7hZ"u Ћ]UEUitstau+u Pb uPZYU @Rh.$PU UE t*u 5l74ZYt5l7h.$u US] ;u#5l7AY1҅uh.$uXZЋ]USEU MitWat&bt?L,RP@st?ttMr:~h.$PY[E1eRPN $RPn[Z@8Zu%S5l73ZYQh.$P ֋]UWVSu }jj hq#WVj]SH2 yEWVuh /$2}t Sh$2ZYj 1Xe[^_]UWVSQ]M tu E𿥤"E𿵖"Qh/$SN'M $jNXZM uWh0/$S> 9jVQjjuuSU 1ɅuWhO/$SVR‰ȍe[^_]ÍL$qUWVSQ AQEUA E܋AEjS3_Zthj/$6jSY^ujjjjSTEU}u&}u h/$S[XZEE$EƋEUuE9Ƌ}s 11҅tEUEU9E}| EUS~Zxt h/$PP @9E}}EUuu h/$'EUjjjS@ $u1LY_u h/$jPjuujjS8 uVTPh0$S p EFI FPARTFF \PFVEUF V$UMHV(N,EU+EUEЉUԃF0V4F8PS,2_Z@)QFHVL$}$e9}s}܉~PFTy 1;VPsUWS1ZY@UB߃}uujSr@jp juuuuS u h20$b @ r $󤋃 H PAQPA Q$PAHQLEUeY[^_]aUVSĀ]E 9p#.tE @&1҉Ue[^] ,(hY1$&$hd1$G.$1RP,($ RPhu1$ h1$e<jS\ uh1$L<XrX CRPh1$-s,s(h1$s4s0h1$$C8Pho#hxV-Vh1$-sPh 2$- 1e[^]UU E$E8E U]UWVSQEUAQ E܉UEUEUEUE9E E]|!I뾋Eu^h2$PWE UEԉU؋E9EE]}5Eu"WVuu uuuuh2$P8(1 AU1]1 u`U3U ]3] uPt3}ut(EuMWVuu h43$PMEAE A E$A$tMu}t=2$}w } &2$w&QRhP3$uy<1ۉYMuWVE Uà  E C E$C$E;EMu7E;E u/ACKtX EYEUQ#E9Eu0E9Eu(ACKtXYE܋U)AQ qMԋE U+EURPEU?E t]s{ px EUMԉQE܋U)AQ A}G{YK_Gtx)E}䉸hl3$uEXZ؍e[^_]ÍL$qUWVSQ8EAQE؉U܋A QEUqy19WVuu ut-E؋UWVRP ΉE؉UMWVuu ut-EUWVRP] ΉEUMEEă}Eăx}PEЉU1M9ˉËMY}u}tE9E؋E܋]DE؋U^9E؋U܉EU}XWVuu EU}u}t6EЋUEȉUWVRP Mȋ])Ӊȉ+EUԉEUEċP @+EUEȉŨ}u}tE9EȋE̋]9uȋE}uH}uB19}FEPWVuu ыU}ut#ΉEȉUM EUEȉUjjjuuȋEЋUEURPuEă Eċ@^1EċEčeY[^_]aÍL$qUWVSQȋ]yIX P@E؉U܋w yh}3$uh3$u0XZ~th3$GW EUN^ }u}u O_ uuSQM؉] M؋])9]u 9M@E9؋U}SQuuh3$uO_ ȉ+EUEUVFV +EUFV FGFtxM]M]SQM]uuX ҋM]ut&M]uuSQM]. M])ӋGW EUE9؋UO_ t~tfȉWE؉UjEU)ډM]RPE؋U# M]uhl3$ut tN-}uA1h 1hڳ RXYS}uMQh6$S jHJ8QRUPUr 1B$E1r(z,ꀃEE}S^_@tPSn^@tFUȁ¾1uuuRauS@uh6$S'ZY1EEe[^_]UWVSSÉЋt񾥤""""Ujq Pq qu uSU uWh7$S &PSZY@uWh17$VWhM7$S1e[^_]UWVSÉu uRP@ }}t}ME䥤"E쵖" UMEE䵖"E쥤"@ Ur $Ep PFVEPF V$EPFHVL1Fv VFE0S@uuhl7$S] uuh7$S1e[^_]UWVS]} tE h&1ue[^_]SEUjS th7$SjSrjSd jSVjSH u uh7$SY[z uh7$݅t)I }9y$uu9q thPh%8$SM 븅t*t u5Xu}+rz WV tjj _Z@ultjSY^+uu tjjr_Z@u)jjjjSuu h($jjjStƃu h($1fdžUjuu썆PjVjjjjjSC0PSY^@uh($S;hX8$SSXZ1e[^_]UWVS4u ] 1E6#h8$uVFO tPSu @u95p#.th|&jZYjh Sue[^_]UWV&}^_]UWVSH]u }1ɉM܉MMMMMMEh8$WVN Eԃ @t=}buEPSXZ׃}qtuԍEPEPEPSv@uE95p#.th&jE1;EE}1SuMu_t xuPt9pu 9uU@uuuuuS-ẺUЃ}u }E܋UEĉUȋE؉ES\ZEHEPSEjh&P&uuhP.$S g$1RPuu EUSXt E;AtIh8$S_Xqy 1U9ЋU}`9u\9uuW}u}t,1U9ЋU}=MuuWV ҋMu#u}t 1uh 9$SXY[uuuuQMSẺUЃ}Mu}t{9}u9utű}1yMăEp(x,SZ@tJu`p(x,S@t$uűMq1uh.9$S>Eԍe[^_]UWVSH]u }(,EUEh9$WVK t(qtsu&jsEPjjS@uzE95p#.th&j_ZuujjjSE܉U}u}t2E܋UEU}u"}uuuh9$SZ$1RP,( Ɖ׃uԉ}؋M9ȉЋU}WVuuh9$SqjSEY^tPE܉U}u}t h9$Eċ@ EjS_Zu h[,$pjSY^u h9$Rx G EG$EjSg jSY tu h:$SXZE9Eu"E9Eu}u h/:$S_X1E̋p GPGTEE܉EME9s3Mjh&V< MtV(F,9U}UƋE̋P @ẺUЋEU+EU9E|uuhT:$EԋU+EU9E| h:$.}9}E}} EUE܉UEU;EU}9}}M„tE9EԋE|EUE܉U1}9}}R tIt@}u h:$S}Y^ U܋MHE܋U+EUЉQ}u h:$S=XZ1M9ȋ}| EԋU؉EUuujSA@jp juűEU+EURPS uh:$S @ r $󤋃p PF V$1~PF0V4j\VFS H PAQPA Q$PƉ׃q0y4AHQLS@Eu}UԋEh;$S[^MffuSZY@h/;$Íe[^_]UWVS]1uuuuu11hM;$uu F btENtoat%itClh &Y1EPSZ&EPSEPSZY@kq`1;EE}=S;UU܋UUZt&xuPtM9Hu M9uU@օtE 9p#.uEU t th&jZYWVRPuS1e[^_]UWVS Eu} jj hq#RPj]SL yEWVuh;$ }t Sh$ ZYj Xe[^_]UWVStƉP)Zt 9St[Rh;$VX ,{ Rh;$z $1s3щ¸;$$1s sщ¸_1$Wh&$hV (Who#htS{ SVOuhhX&Vr SVh;$ GPho#hS: Sh%=$ $jmSj$G8PShx=$ h=$ G0W4uuh;$X1RPhPwPލe[^_]UWVSˋM} $&E;$u t h;$ Xh($ X  ׋󫋃Vh <$ _8Sho#htS Sh<$x h<$E)<$>E7<$2{u;t h;$< YhE<$1 C KZ1҉9u9BuEi<$hO<$ _tjmWj$8S1tttSho#ShY<$hWWh<$_ ZYwh($Q XucuZE;$E E]<$e[^_] e[^_] Ⱥ;$uRPhVk% q#e[^_]Ë *.Q*.y ;*.| t*.J *.Uh*.PXXZUWVSxhl% h<$ohZ+$x h<$Th<$xà Džp<$Džp<$s3x ps sx p CtPh<$K Cs31F { Wh&$hP Who#htVVP[JuhhX&Pm Ph<$XZ{h;1ho#hVfVh<$Vh=$ h/=$jj hq#CK x$$RPjV CK x$$RPhv"t jmVj$G8P跺VhW=$Hh=$>G0W4u[uWh;$xX[tVh<$GPho#hVVVh&$ZYeRPhPPh#K Cs31H C tYC 8P)s t󫋆Rho#hVVh=$(e[^_]UWVS}u 1ۉ]]]1h=$uV"= tYl`~Wa wO$&ut6xu>ƒ뽃븍EPW EPW[ZY@u떃95p#.th &jY[ujW^Zu h=$Y؃tډE;EE}1WMuZt xuPt9pu 9uU@܋Ut -hl% h<$hZ+$ h<$h<$W1ƃ E<$E<$v6 uv v uv FtLPh=$MXZ e [N Fv6 ?vXZq h#Y1e[^_]UWVSD] }1&}E>$uh>$uu : tfitJTt,Lt$uV9 tfitLat%bt0lh &dY1txEPSthEPStXEPS6_Z@uG1;EE}1SM}Zt xuPt9xu 9uU@܅t95p#.thH&jZYuujjuSe[^_]USЋQfPfQfPQPQ P 1Ҋ\ \ Bu[]UWVSE8}fHfMfMfXf]f]X]߈]X ]P Uf@fEExstExlK1MjQk`&RUھ U؍Muu ruf Fu1MjQk`&RU菾 U؍MuZu rutf uPEPEPEPEPEPEPSEPEPEPWh>$u u#8 Fz밍e[^_]UWVS}]t?u 1TEPEPEPEPEPEPEPEPEPEPSh>$WÐ 4 uEyƒt$j@}W8ssWփ &ue[^_]US1t&p&uh?$uً]UWVS}uk]`&U tu} CE[^_][^_]UWVS] t}04S؃ƹ9iʀʋ8q8ȃEfUf%fEfEU1h@h\?$M XZUuh?$S賴^_hWRUV Uyh9?$uhS?$S膴Y[49sWPhi?$SX)uV fEf%@fEZ V XE࿃ȀEEU |1e[^_]UWVST]E EEEuE &1Ee[^_]魿u 1EA$]1}hA$uu4 tKUtLuJ-Pw@ r4}W5l7QZY@t }PVS @u E9p#.th&jZY.}Wh[ VSuEtWh& VSKe[^_]UWV}uh<1E 0XZ<1Ex8e^_]UWVE }u#pt;1h;10@XZ;1Exe^_]UWVSE] uDž#h"VS2 @toul79p#.tE D&1Ee[^_]覨 ?$yhB$h<&hPhOB$: a_@@ǃu‹p vhB$Pq= F8Pho#htWWhB$S@ `FPchC$h0&hh4B$Dz X hSh%A þ11{# ƅxh>$P8 u Vq [TPh:"Vx< tCPh[B$Va< tCPhfB$VJ< tCPhsB$V3< tCPh- &V< tCPhB$V< gCPhB$V; LCPhB$V; 1CPhB$V; C PhB$V; C PhB$V~; CPhB$Vc; u DžVW\ ZYuhB$[^%Buh($AWhB$A uS Ph#&$S/9 tSh*C$  p Dž@$A 9Y貤 Åu Ykuh2C$h$&hh>$P"6 tVho#htWVWh- &SF= tFPho#hW/WhB$S= bv$v hl%SE< Fv,v(hr$S)< *v4v0hG"S < jmWj$F8P諩u$S _ZWh$Sp< uh?C$? hIC$ [? - YY h#7 t9h"`XZu&h'$S4.*.VSL_X*.tVD^S Z1ɉ Xe[^_]UWVS]} U#1,hiC$R$W+  @$t&Ftiu5l7Dž,9=p#.tE X&1ۉ]e[^_](,$($jSZYt,uhmC$*jSpZYujSbZYt,uh7$S蹪 1ɉHh#V5YZu^C$V} ZuhC$hOB$  Y^uhB$륋$1QRPKu uhC$SB G 1 h*C$ 迣 XZthB$V謣 ZYtjhPu u$hC$SV  4Ph#&$V/ F41$1$8PhB$V8 TP8;Y^!1RW($. $( ,10$(+hIC$ d _ZOh?C$PO ZY4P _u"jh&Rw umV Y8Ph- &W7 dR8ZYdt8hC$S 1ۉ,DPhl%W- LPhr$W, g,9DH0|;LPhD$S荧1V $@PK , uhD$SsXZ:jjj Bu @u hGD$1$ 9sP,Q! ;$u9FjRPQ8 Bu @u hmD$-h_D$r$, ;$uF9$sh($ ! _X h%R Y^P\ ƹ,hB$Rԟ P Z X+tPh>$W+ t,0Ph:"W_, ,0Ph[B$W;, ,0PhfB$W, ,0PhsB$W+ a,0Ph- &W+ =,0PhB$W+ ,0PhB$W+ ,0PhB$Wc+ ,0PhB$Wx+ ,0PhB$WT+ ,u/(~ǁ#,$ ,0PhB$W* ,0PhB$W*  ,fǀUjjjBu@uhD$S譣$, ;$u ^u&H$,ȍt 6 _Y4t 1󫍽@Wh- &V02 tuhB$SԢR@ZYu(WhB$V1 tˍEP@~ZYt@hC$S脢 fEPhl%V) tEPhr$V) mEPhG"V) SWh$Vj1 tj$EP@貟 $V' <9PhD$Sʡ $ȉj1RPBu @u hD$2,$Pu 9uj$$RP~Bu @u hD$,$P 9u͋$,1,EFI GPARTGG \G1w$(q y$ϋ O(1҉W,q0y4σ8T󥋽,GH1ɉOL4WPGTP覜,AXj\Q蕜,Gj$1RPZ Bu @u hD$$, ;$uԋ,$(AQA 1y$AHQL1҉Qj\Q,Bj$($$RPBu@uhE$S][^*$,@ ;$u1ɉ,A  XZe[^_]Uh*.hGE$?XZUWVS(ƉjzEZuh&hE$j@ H1jvS>v ShIi R@u hE$j@ #e[^_]U E]PUE]?UW1HfDžDžDž\ƅƅƅƅƅƅƅƅƅƅDžDž18<Dž\DžDžlDžDž DžDž Dž$(Dž, Dž0-Dž4Dž@kiDžDE$DžHi DžLE$DžP!i DžTE$DžX Pu u# }UWVS, Ơ<1^ jS!1 CjjhWPS$$thhq#WJ WhE$jS,1 ^11|u @u!|(AJu@#Qh"XZFtY~jWp0 ƅjjhSPWu$thhq#S"J ShE$X_XF1RPhF$hSOShLF$.thVF$Y[jLJZsjyAXu48/Vh%j< H1jvS2v Shji R@uE481hdF$S ujSÉhyF$9Y_ut 9ÉѺ})؉Rh%XZ hF$XhF$_ut9ֺ})؉Rh%ZY.hF$X!rJu|1e[^_]UWVSVu{ _uh&hF$jg; ƍEP[t hV$jK; juVENj] t>sV0$ZYu+C xu"t s srEYXj ZuoXe[^_]UWV։P Zt hF$j: jQMQE 0Xe^_]UWVSuE @80ƅ77Ph#V t 7u2HVH ,Z3V _t hF$0x jWhm(Ğ Ttg81ƅ9m(@󥍅8PhF$jPSr0PhF$jPuVr VShG$jp9 S[t hV$j9 T˅tdS zuW$(,sZ"ZY(u1$zu%B Nj] t>sVZYu+C xu"t s s>YXj ZuXe[^_]UWVS@J9sr[^_]UWVS]u$ZuP7E_@u h &hE$u+^uh &hF$j3 sP3?s Ws?hf$uO t.P誘 Eh$u2 E tZu舘 EYLEPh#u }Chs@Put  @qh H$u XZt V YhH$u裉 XZt Q XMEPh#uB E Mu {hE EEEM؍CU`EPu u @Muh &hH$fEftft5fu6t2C t Wh-H$jg1 }tC(UhMH$C0ut3hiH$j61 t C0sHtS4KL9sщ}t:s@shu us@s`u @u;4(81t/sl`}t$CU[s@s`u @uEsd6CptSuZY@u s\hH$s8sXu @u s\h&$te[^_]UWVSPu軅 Zu1du ܆ _tLV' Yt4WA EWu tPMQS; uS [1V ZtS苅 X؍e[^_]UPEPhB$u ƒ 1tEUWVSu\Ph%H$V t\Mfnj4Zu\VXtd$1jRVVhiSU@tt}f1RPh%H$u  1e[^_]US]uu S? @t ]]1]UWVSu uP [^u &Pu Y9Es&?V Ƌ}M)1Ze[^_]UWVSu u [^u 6&P Y;Er&?V Ƌ}M)1Ze[^_]UEPh` #u ƒ Eu%UWVS8uEPhH$V uhm%h0&hhH$6hH$V _ZtPv ƹ}[E]ShiV4}ĉjS葑 PhH$u { ƃ S1 Yt:EUu؅y1ӉM]! EjEP= XZuVhH$u  Vխ He[^_]UWVS1Rhiu54 @t|j7RPhH$hS3ހ>tVhI$Vt j7RPhH$hS;tSh%I$ESK\ e[^_]UWVS]hH$S| Y^tVP讑 Zth5I$h &jVhH$cV贑 ƍUܹRhiS<3@u hWI$j+ e[^_]UWh%1󫍅hPhiR2 t|}UWVS\PhI$u1 uhm%h&h0hI$dShiu2 tT\`ty1׉\`! ftShiu>2 @؍e[^_]UVSuV|ZtÍEPhg$Vl uhm%hL&hhI$uS#1^Xu hI$jX* CPS] ZYu hL&hI$Ph H$u 7 uhL&hI$j* S1e[^]UVSSu] EPSV @uh&hH$j) hJ$V( ZYuh&h&hhI$ H$Eu$PRS蠁 He[^]UVSSu] EPSV @uh,&hH$jZ) Eu h3H$j) hH$V蛀 ZYuh&h,&hhI$PhH$S He[^]UWVS}h!R$WK [^u Pl pY@vhJ$VMZu h4J$j( VPh!R$W@u hMJ$j[( xtdPhiW/ thdJ$뮉`SBX`e[^_]UWVS}hO$W ZYurP認 pVYXuhqJ$DVShO$WK@u hJ$j' 1҉Uu]EPhiW#/ @u hJ$j' SX1e[^_]USÉЉʅu q#th#QuRPShJ$c]UWVSu1j+Vhxi P+@uhJ$ UЉUPXۋUu hJ$j' U]Vhxi W @uhJ$ڋE9E~E19u~tj YWh&$FXZj SjUVSPuVZt"ÍEPu V @u ShK$jf& @PxUWVS$ƉUЉhN$P} [ZtP ƹY1@]Shvi Vs-j S PhN$u} à V警 HZe[^_]UWVS(uEPh K$V uhm%h&hfhI$MԋU ;@udE̋UЋu}y1ӉM̉]Ѓ!! ׉u}j EPV XZtVhN$u :} V He[^_]UVSuV[thf$VN| ZYuh&h &hhI$@P葊 ^fx PSr+ZYu hI$j$ PX1e[^]US]EPh&K$SW u *&juS-,ƒ 1Buh&h&$[;XZ]Uh/K$1US]dPh%S uhm%hh&hhI$]d|lPhiS8+ @u hfK$:X1]US]dPh%Sp uhm%h\&hhI$d|lPhiS* @u htK$^:X1]U1EEpPhiu* t hdJ$j # 1UhJ$uUz ZYuh&h<&hhI$GPh H$u z HɃ0 v+BwBÍBwBUP]UWU1ERhiu) @u hJ$jR" 1}W|$wUWSÉЄtGjj hq#QPj]SO S> zq#th#PShK$ hO#¸%#@Xe[_]g_UWVSv uh&hK$j! jLh-l_Zq#tK$jmh-PZY¸K$uq#WPShK$h*.=h-t VW?Xjmh- ZY¸K$uq#SSSSSPShZL$h*.$Vҡ j&UEU P]UEU P]UEU P]UEU P]UE1҉T-T-1]UE1҉\-\-1]UE1҉d-d-1]UE1҉l-l-1]UE1҉Pt-t-1]US]Sh-YZt =CЃ v؃߃Av h-Z>u -1]UE1҃t`<1]UUp-t H9t@]UWVS41ۉ]܉]E䀖B1EԅƉB1EPjrZY@u hM$EU׉ủ}ЋMMāɚ;~EU6eĉ}ċ=B1}11}t4މ׉Mԁɚ;~mʚ;1uĉủu11EP#[@u hV$j }‰  ˆUË]؅C tw@PYEȅtePu Eȋ@uLRCt}tME9u9u E9E|9}SZtjEP Y[=B1tSZusuj%EPjfqZY@UEM9u]9uE9E-9ŰMh#j UWVSÉHP]ZtP_D 1D1V!LY@u h&hE$&RPHSƃ uh&hM$j( R1RPhM$hWWVhzN$ jVW_WhiL@u WhN$3t PhN$XZjVWWh~iL@tt PhN$lY_j pHZ@uh&hN$uu =`-j:RPhN$hW蠿?tWh?O$W| j:hN$hWZ?tWhQO$W| tHSW?YXjVWDž@WhiLNuh^O$;XZjS9#jVTW蟶Džd1hlWhiL @t|hXu hrO$l@1dWhiL @@u hO$@lhO$@Ru =<1t%͑"w&RhO$KY_HS XZ=<1u0=<1u'DjHSDP jV`VpV<1-{k?PL@uET$=<1tM$Pj h/%O$  B1BXuthU$%#Xuth͑"%#XuthO$%#XutRPhO$ h/%O$J B1_uthU$%#^uth͑"%#YuthO$%#Zj p5X-XSV65p-tjHSVv e[^_]UWVS]S^t EPu S @u WhK$j u /l Sm Yl Etuh &hP$j~ EPEZt hV$j u1EVtRUWpZYU}tRUuQZYURhB$S tFE= B1tFtj= B1tFu[= B1tFtL= B1uE=<1u+!Hu)}tj Xh*.vAZY U6"=<1tj 谻XS] uU uj衲UWVS,ÉUPb^uhF$@hS$Sm ZYucU̹ Rh8i(S @u 8t hS$j jhS$u| uh,&h&S$j Eܣ B1 B1u VhCS$j e[^_]UVS։PVSPhUS$j{ UWVS]U hmS$Sl ^_uh%h@&h2hwS$‹ B1ށ؃E u %ERUz NjURz WPtDPEV\ZYUu c#9ERE ËE É B1X1e[^_]UVSP]U ChS$Sl ZYu [ WP3z SSz VP~Ãt7EPS5 B1脣ƣB1ST1FuE#U B1e[^]UVSP]U hT$S|k ZYuh%h &hhwS$nPy Sy VPM~Ãt7EPS5 B1ƣB1S1FuE#U B1e[^]UWVSS]U he%Sj ^_uh%h&hhwS$Ƌ B1%EVx Vy WP}ƃt1PuסZYuS$EM É B11e[^_]UU EkEPhS$u uhm%h&hhwS$! B1%у uсE ȣ B11Uh*.hS$XZUWVS]he%Si ^_u3hT$Si ZYu"hS$Si ^_uhmS$Sui ZYtP B1 B1B1!‰ B1d$1󫉕tVh7iS; @u hT$j e[^_]US] u=Ph&$蘷E tP躞Yt Ph+T$uXZEPYtPShp%Y B%܋Et Ph4T$<XZ]UWVSuV%[u hF$/VYu1P{4Z@u h&hE$p 81jS8PD8Ph8i(4@`%1󫍅`PhiV @uh&hAT$ju tWphQT$PX&Ht#8tuP9u QXVh[T$XuShbT$荢_XjPY^u h "j \8Ph8i(4 @uhS$HPhvT$蛵hGx%HH9Tt$h߬$phGx%Tj)zj pP4Z,H%(hQT$&_1ҋ0t` &xtO(9u 09t4#HɋL q#t%#QPhp%貴 ,딅u hX&薴^j 诳YjmZti 119X~M%9u>uW覚PhT$O hT$BhT$4j OF뫃 u]e[^_]e[^_]UWVSӉϋuuJb 0Tb Zt2tVWPe u3薎 1ɉ [u1V聎 ZVx [ Xe[^_]UVSu]}t 3jx NPڋE XZY@uEC s1C1e[^]UWVSu]Et,DžpVRpRtWjPuBpWp Y_u  ܋NPڋE Z@tʋEC sF C1e[^_]UWVSW]EtJs$URPVƉ׉‰ 9иr E8t8"uo;sC| C 9s} "WV+ Y^u  볋K(PUE Z@tE}G _C G1e[^_]UWSËtP艌 X1e[_]UWVSÉUMU1}E;E t[ztMUj8 ^t`NjUx4uup4x u}x xuup1ɉK(C(E81 S$uS$S(PXC$ue[^_]UWVS1ۉ@}u 'E@u E@ u*PE 0b ZYu6PE 0a ^_u獅LPh` #E 0Z u 10 L0t 1󫃽0 00_0nu8u[[HhB%HPkH,ZYu Dž,x&EXtj/VK[_ÅtC`1DžT0XDž\@PTP,VQǃu@xuPqbTt/0u#xPVZYHufDžtt,Ttt T]1Dž,tN(j DPS%,D (t8t1ҁ,v H"1҉(VrX(0tDž,1ۍX$讹_Zu?Dž1ɉDžDžDžDžjShFX$ u ؉8 P2.DytRx:uL҃0jWVhB%Pt;9u8tMhOX$jg jRVjP\ƒu#;t 1҉Ŕ@|Phi8uƒ 1Bu hoX$j' e[^_]UVS0]juVh]$Sg@u hh&hX$V% Zu VhX$j Uf@fEލEPhiS% @u hX$j 1e[^]Uh*.hX$XZUWVS] }1EPh8i(S @t&E1r r r1ʹ|󫍕[!RhiS @[< v PheY$j hY$[P\P <fDžLVhiS @t%fNthY$=<1t hY$\XfDžLVhiS @t%fNthY$=<1t hY$XfDžL VhiSu @t0Nf=) PhY$_X=<1t hY$ёYfDžLIVhiS* @t0Nf=) PhY$蝑XZ=<1t hY$膑X|1󫍅|Phi8S @t}u(j r$PhiS@GhY$&EEEEĉEEEԉEEEEE|Phi8SO@uh $АXr}uMu u uuBEH~HEP2.DJtx:t~&jPh>X$ uWhY$j^_1Dy h>X$OY Pt`XZGj,HXhY$Y4t8hY$XZ hS#Xj _PhiSF @PhiS* @jh`&PZN u ftePhZ$[^Vf"fP PhZ$J ft PhZ$/ZYj GXe[^_]U81EE1҉UUUUUUUUEPhi8uO @u hoX$j 1UWU1Rhiu @u hX$j 1}UVS]EPh%]$S uhm%h&hNhW$uVhiS @u h!Z$j: 1e[^]UWVSSÉ׉Ph&$S)Í6 9})j<X)ЉU~&Ph(#ύGZYUJuj>e[^_]j-ьXUWVS Eԉ։ˍUع1fuf]1ɉMRhiu uEh3Z$yXE1e[^_]UPEPh>Z$uc uhm%h&hhW$ME\UPEPhY$u uhm%h&hhW$HMEUVSjjj"R y hGZ$\1ɺuBhPS芊 y haZ$wZuufiuSt Xe[^]UPEPhY$u uhm%h&hAhW$qMIE=@u hpZ$j 1UPEPhw%u. uhm%h&h4hW$M E@u hZ$j 1UWVSƍt1fDžfDžRhiV y hl[$j h'v 1l)ƍJ(R!R _9l}l' Džl h[$h%h[$h[$h,[$hX$h[$llh[$胊(pp(dp@!Pd!pP Y`B1t `B1EaB1tI@tc@tC@tP@ tS@@tB@yA@pXx@`1ҋpv9}pL9}B\pfP@u uw%k pfx p@tp d#!= = w-g 1u=w_f?v-k 11u?1p%:=$v1"- 1p1p P h`B1SW`\VPPllh[$rp@"Xp@!dǃ0X*w'Owt4tov2tW0 Z=<1OGPySPh[$h[$踇=<1Z$uZ$WZdPh&$}XZ`A#d9s ΃q#yW$VRPh6#DCB%Ȁ=<1XGPGPGPh\$h\$G1d_19d&j>^=<1GPh[$RKStRTRPh\$衆RPh"\$萆 F뗀=<1GPh)\$kY[Gd<G=PuZh4\$h&$:XZ=<1WGPh9\$GPh>\$ _ f`WֹZ$d5t-\PQhp%K "\`f\TddTZ$tHZ$PtZ$PtdW$Pt"PQhp%7K "봊`\d<"\TL=PuEGu:hQ\$h&$ׄ^X=<1GPGPhV\$贄 t#=<1d\$hQ\$h&$vY[=<1GPho\$XXZ1t D ҃L dd`q#dtZ$VRP`Q4&h}\$Cu_h\$h&$ك^X=<1GPh9\$軃GPh>\$訃wW ÉTӹZ$\t-dPQhp%kN "dϋ\fd`T T`Z$tHZ$tZ$tdW$t"PQhp%K "d\kT`PhE\$蝂ZY=<1)w '$&Z$X[$txZ$un][$gZ$`Z$YZ$R[$K[$D[$=[$6'[$/1[$(6[$!?[$H[$O[$ Z$c[$OG)Xsj ڀpp)hXh'"e[^_]UpPhiu ulh\$sXl$Eu h\$j EwE11 -USE UUXt=EEEE1҃UjURP 뺋]UE Puj`T US]S$PhF]$jʢ SB1PB1~ UuUE Pujj舢 UE Pujߧӧ Ã=B1tMUEE EjjEPEPjEP聤ƒEBuhW]$XÃUSP@ jh&4~ jS ~ uSh|]$6jPVeZ@uSh]$j]UWVSd@u~Q1}=B1tC&;Et7EE jEPjjjV軣@uuSh]$O 1ۉ]]]]]E}W]SjVSjeÃjh]$`ZYu]$]$1uuuujEPj{ Eq"1}jh^$h# EPh% h%h`^$j茠 ju6h^$r[jjj jWjjVj\1ɉ -jEPj̉ u8tgh^$Z(9uV,Ph^$jWjyjVjo T EҀu+=t$h^$DjS| = -m = -tjWjjVj -RÄ = LEEEEEPz Xe[^_]UVS]E pt&I>v ![^]USQjj]Sjjh -'th4#uB1Zu h "jp jjSPjh -u‹EB1]USPh_$h*.h*.h_$Sh`$h*. j,rUE E ]UWVSSE u}up8@$1%1ҋ $1 1 $1 ډ9t&'  9$tl& P&11Y[^_]UWVSE u}us8@D$%T$ T$ Љ$$1҉9t&/ $ 9L$tl& P&11Y[[^_]UWVSSE }uJ8p0 Љ$$1҉9t ]& $09tul& EP&11Y[^_]UWVSE u}uG8@D$T$ Љ$$1҉9t& $9L$tl& P&11Y[[^_]UWVSSE }uK8p% ‰$$1҉9t ]& $9tul& EP&11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]& $9tul& EP&11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]& $9tul& EP&11Y[^_]UWVS UM EuT9|$y|$T$ ʉ1щ9L$t&9T$l&uwy|$y|$L$ ˋL$ ˉ$4$19t&9L$ta$$9T$ta$ P&11 [^_]UhhX jjh@-un1҅tPUWVS jEP~ Eu_X1E9}2uSPJZYt!SP7ZY tG1EEe[^_]UVSQË0tRVhb$EPoVER9mZe[^]UWVSQ1:nuzouP mX1҉UhB%PЄ ZYt98nuxouSPȚZYu}SP趚ZYuE1VMEe[^_]UPPPhb$h*.yjVlUWVSÉ} u,PQ & ZY u Qhb$1t V/lXt*hk"WHZY1u"su4h!%,Pp^_uE"~u M }jPH ZYt1iho$Kjhb$W< uU jZP,P t% 9|\ 뭋QRSö uC1 C1u17hb$Wj Vhb$=tEtQ#Et#Et"Et6s%&u0P,P S ZY@tjj@j^_,t#jhb$Sص uhb$V6`Y[0Z"tShb$Shz$hVq0 ,Dž@hB%,PzSXZ9 PWxjNjXZڄtVB L<-u.1j=VsY^t$S@]#S4Q ,t1|=C1t}t=C1u}uD]hb$qY19~4h*o%qGXZj pY=C1tc$PV Z@u hT#XtXt t6hk1#X t nXPa=C1tj}t0$|p jup j(h @u hb$6_-,W3h,y%h,RoP,R 8tV,Rh# ;ur8uWVWhc$j t 耐[PsY}u, Ex](~o jj - WS$En ~)t}u2h*.,PXZj P$m ~j,P{ @uhw#X,Ѓu ƀt&qttP PVhf5#\H}C1 C10SVN Y_@uVhc$TXZ e[^_]UWVSj Ph!c$n;11to&tZ&t =C1t>&F%#u߬$QPhp%cn !ǃ 끍Gq#th#F%#u߬$WRPh4c$ntG%#u߬$PhIc$mn t 0h&$ ho#mXZF=C1KtSp%#u߬$QRPhWc$m=C1h%#h&$jmsds`sTsPhic$Tmslshs\sXhc$>m0=C1~chSjjhk"ju.t%j SȂ^_tShc$l h &{Y/#t $Ph&$lXZe[^_]US] 1t-tPu華ZYuC11=C1]UWVSEt48nuxou C1P\1X1uh#:X1Y,u@B uP蝃_uh " S[^ljxj,S赁ZYt X1e[^_]UPhe$h*.:ojaUWVS]!11҉tE1ɉp7p#.111plhf$u un 0r=dhWlSh0q" ,@uSVh"j n@t(RPhx&hSnSvj^USP]jEPSU :9uySu h"j ]US]ScZt@ h#SZY]US]ShZt@ h< %SsZY]USP]jEPSU 9t :uy Sh"j ]UVS]u VSQ YZu Sh|"j ;/t"Sh"TXZu E"e[^]Se[^]U袷Ph"h*.jje]UWVS EEu EE}]EEE1҉p7p#.h"Vu t4ouBjWh`&5l7Ru h"j PRY붋p#.4E)Ѓt>S6EXZEE FEe[^_]UVSSPPVu ujVSh(m% ,@uL׷t"t"0fZ"t"PSh"j诿 j[UVS]u VSv YZu Sh|"j访 ;/t"Sh"&RXZu E"e[^]Re[^]UǵPhVf$h*.hj[UWVS]E1҉#11ɉd111lhhf$u uC HuLf$M,9tQG.C|g$@'UC| C|C|C|5l7CpXDžlL5l7CtXDžh.5l7CxX5l7Xjuh'5l7Pu h"j POX5l7豎YDždC|p#.P;Ut0ttSxt SxߋM |u4AuW8Elh ЉtQxPW?!YZ@u Wh($j( ltECphtECtNtE%CxdupVVO@$XZK|ǃe[^_]UWVS SVdPhWu u&hWdShb% ,@uSVh"j\ f@tKRPh|'hSChShf$b0j*XUSP]jEPS,U :9uySu h"j虻 ]US]S;]Zt@ h#SZY]US]S bZt@ h< %SsZY]USP]jEPSU 9t :uy Sh"j ]UVS]u VS YZu Sh|"j ;/t"Sh"MXZu E"e[^]pMe[^]Uh g$j觺 Uh&g$h7g$hTg$hg$hg$Phg$h*.4d jVUVSQÉj EPS U:uVSh h$j9 e[^]UWVSuEE@t"C1 1VFe[^_]PC%_u h#j VP ZYuj%V]e[^_]UWVSQ]E10u1-hih$u uݗ 2F$@'=HD1tDD1뷃=DD1uHD1c뛁K뒺al7C8K t LD1hK\cPDl7jC@K@2K&gl7@P s4K Il7C(KK@KEPuh@'5l7Jƃu h"jd Et LD1tctKtK@tK t=HD1DD1 s=DD1tHD1c@tKt1҉,-sc sKsC  sC sh#VkH@D1Y_EthԈ%VSHC$KXZEth-h$V9HC KY_Eth3h$VHC$KXZEthHxUWVS]u uu uQ fMA1CCS1CC D1@ D1ȉC1҉SCE ȉCЋEȉCԋEȉC؍~E$PWh{ E$ ' t9131Ƀ 1Ƀ 1Ƀ 1ɅtuRh"j 1ɋuЋ} t1Mݓ8"t$M tM9uM9t Suh4"맋E9ƉU}7=|I1tuuWVSuhU"N.uuWVSuhU"?9u؋E}<=|I1tuuWVSuh" .uuWVSuh"j= e[^_]g_UVS蝑=I1tPhl$h*.D hl$Phl$h*.Dh*.h"菙XZ=I1t 'ttshm#h*.fD j6=|I1u UP6UWV=L-uHH׉=4I1t&ɉ HffJ=L-u f@ffB^_]UWVSƉ˃=I1t/=xI1t 1}oQdI18I1PuO/ RסdI1ΉRPSu5I1_C 9t 蔑09gPWVh v$?j"5e[^_]ÅtUWRPY_}Ã=xI1UWVSƉˡdI1=I1tQu8I1P. M׉ΉRPSu5I1oB 9t 0fPWVhFv$?j$C5e[^_]Ã=xI12W|$wUWVS#Å=I1uI1BB4I1I1 dI1 ;hI1lI1ؙ=I1;|*9I1_1)։ؙ5I1pؙQ Y 'JtRz!9t !9t ҋ1҉ؙ=dI1Q ;Xe[^_]g_W|$wUWVS4EU؉M܋ I1A Id t15I1/X=4I1tI15I1PPW I1xU thmv$KXI1H xU t@\U؋M܉M؃=4I1tI15I1PP I1A Id t15I1I1I1JH,1_9M؋}ruuhv$w< I1\Eȋ1ҍMQRPuu+ Ɖ׋EUEUċΉEЉUMԁ}Tt2CЙ!!EȉŰ{MKEcEUԋCx1RPuu_- K` t1Ɖ׋Cu}ԋKd t1uЉ}ԋK05I1#5I1Fx1҉$Puu+ 4I1I1\TuoÅtKSuY^1}|(}؉ʉT(@ uE@XȉCXE@\EȉC\E@`ȉC` ߋu%ClÅt]SuOXZ1EtttpY_DpTtF u1EnY_Fu @ߋub%CPI1H05I1EЋUXe[^_]g_UWVSQEӾ=$I1t1}=L-tCCfCU.C)f UZ[^_]USÉЃt't7uFɃu0 ='Shv$h*.< ]W|$wUWVSC s(H1 I1t ǃ^F=pI1s0Kd t1RP߭ڍ@-&VV$hy$] I1 ؙy8PۅI4-&WW$q,hy$ I1A0= @ I1I1=I1u\Tu k‰I1jjjhjRj` £I1 I1uI19uhz$(j&1=xI1LhI1lI19|RPh+z$T hI1lI15I1 dI1H '[t?  Lș)Ou뺸=$I1t?jj5(I1S=dI1Sb dI1uPؙV jVuؙ=dI1VYI1I1Xlj=4I1t PRCXZI1xI1\=pI1DžhCz$ 'X=pI1~݋ I1A,XƉ׋ǁ\TtA!AƃAId t1RPh;$jjf*.ftRhht@PI DžPu ftpI1=xI1tu 11=I11w,1I1;x,t h*.6 I11҉牅8^9؉<}Ë\TtAЋ!AAA)uhy4D1ҁTtqփq9Ћ|hoz$$(u^I11=I15I1FU F )É^=I1$~O`^p=L-u*VtGx9sЉFx^fFxG,H9ufVNfFFTVXЉF\KN`ȃ$~:=$I1uFh$\^lO`؉Fd9shz$#%[5I1=I1F t/)؋É1ɉ~U uF\I1H xU u@\€ 5I1N J~U uv`G`YI1$~%I1Bl5I1F=I1=L-~&_89rOd1VT~U uVTP~U t FX1~JOd1111f# I1A8P!tm)D4A8)Љ9s?~U tv`у >5I1F$B1ҋ9r)=I1O`艅FW897~U uv`G`aI1$~%I1Bl5I1F=I1=L-Od1VT~U uVTP~U t FX1~JOd1111f_89s\)D4;~s@~U tv` 5I1F$뵋I1$Nh񉍸Flx1Dž1҉;Npst!ʉt @t$9~‹ШtGDž끅t$9~‹I1BI1;I1u^=4I1tI1s4PPF I1@I1I1Z4Jd15I1I1I1I1H41[I1Z0 } I1؋5I1=4I1t5I1I1P5I1 I1X05I1ދvxx I1\t4Tu衩%Fl菩%CPO붡I1I1𙋝ڋËƉ߁TtAЋ!AƃAId t1JI1Y\Tt=pI1Ys8I1){0ƉK`Cx1񉅰69s)9sI1O%Cl뀡I1I19rߋ I1A01q8ߋƉ߁\TtAЋ!AƃAId t1Z~==xI1j.V X܋ I1ߋƉ߁\TtAЋ!AƃA׋Id t1q#tGx%WVRhz$ 9|]=pI1DI1P,t,=xI1t h3#G X1j H X1x~j $ X=xI1tj;_u=I1thz$v5I104=L-0FF4+=_w hz$jd I1X󥋅`1=4I1tR5I1K[^I1=tI1t ǃ\8 5I1x\dI1RPm SY=4I1tI1I1r4PPG I1X4HdLH t15I1I1Z;I1sE=4I1tI1r4PP I1@I1I1Z4Jd15I1aX5I15I1I1@4P5I1eY[^_]aÃUWVSu]tVc _uVh"jdb `1ɉPhd@u PA tGRhedAu ,9 @u!Y8tuh"'yXZ9B<1CB(CB,C B0CB4CB8CB4CB@C BBC$BDC(hr4% ƹ ߋSh"VgD CPhN"VYF C Ph "VGF CPh"V8F CPh2"V)F CC,$C,PhE"VF C0PhZ"VF tP X}!uhzd@u 7 @RhedAu 7 @uuhi"j` 4}1󫍅Pu^_@4ȋ99t(Ћ}1ۉ1E1ɉ [Eƀ*Pj PEPl 1e[^_]UVS4]jhPjSuIjPjVSV u؋E ʉʋMQ؍e[^]UVS]u VS YZu Sh|"j!_ ;/t"Sh"XZu E"e[^]e[^]ÅtUWRPY_}UWVSuuuu. É֋EU)jj`RP? Nju 1ۃ`9}1EPl@hFVk`EUȃM ~MAhQlCȍe[^_]UWVSP]UpEM1^F}tF^ECS}tffCCCCC 1 :}u: 1҉C(S,C8C£DT2u hz$ @T21=I1up5I1=I19| WVh~$R I1m'XSt1޸ =I1 DžCh$+X=I1~$H N1N11RPh;$jjXf*.ft0Rhht@Pt" DžPu2ftI1=I1tu 111$1( (9$h*.CX=LN1tdN1t(N1(fZN1( N11N1 DT2T1 T150T15@T2)֋( N1N1ȋ T115I11Sr_T1 @T11T1H9(u^ N1N1+N1()ȍX9s@T1@)‰э@T11ۋ(9s ƃ@T1C(9sك@T1C׋(0T18 T11h@T1 n(N1@T11T1)Ѱ^(t90T1D8 T11h@T1 T11@T1[1T1@T1@ u뢡0T1| T11h@T1 T1FY;5(T1s"1;=$T1s-bT1G=I1'(=LN1tdN1t(3~==I13 j. Z܋( N1N11ҹq# tGx%RPQhz$ 9[=I1B(T1t,=I1t h3#DX1j EX1 ( ~j !X=I18=LN1\N1u `N1'-/-V1fDžTYfV8\`d%y flfDžnT11 ׉ؙωʃvdN1uh'h1$uXU| 11EETEuh'h$/ T1T1SS_uh'h$S7([t T11h'h$9s>1ɉ C T1 1( T1CXN1=T1$ T19$9rPh'h$vN1D 1;T1sidN1tЉtF$9rh'hS$ N1‹ ȋ( T1GB돋$9(1҉G䋅$9s1 4}1󫍅Pu艢^_@4ȋ99t(Ћ}1ۉ1E1ɉ [Eƀ*Pj PEPJ 1e[^_]UVS4]jhPjS uIjPjVSV u؋E ʉʋMQ؍e[^]USXu t%؋@+B\-&$<$+ Z $\$,$]USW3W3U219~i-@=B'W2BtU2[]U3Ph$h*.4jUWVSSEӉ΍Q1f~WS_ ZYt(}t{=X3ujjW tu SNSZu5x7w, PSh$j; xtuh$j; PV}tu 0uH e[^_]UVS=X3t!3&~ Ph&$hh`T2_4jjPƃ t3} P6hց$hh`T2)`T2e[^]UQPȉEށ$tEnPh%$<XZUWVSÉU܍Esu{h$] EPEPEPVEPh$$fERf Ph?$(EPEPEPhK$u} Ph]$u| Ph}T${XZvNE9sGGPh(#Wݍe[^_]UWVS0ÍEčs1ɉ U2\-h*.dh*.ZU2 V2/XZe[^_]W|$wUWSøthV3h$XZ5XV2h$5PV2h$HX3t Ph2$x_XXV2t?PV29} hC$Y[()<-&MMEuQQ$hf$1 j HPV2Z0$m X=c3tuhb$[_}H1E92=c3tC҅U% Ec3t Sy9=tc3C{PS5c3[ u/87t%)Phw$ 9~Ph$ַZY=c3u=c3t GaSx5c3jRU Ph$CxUtHH5c3RB Ph$hZ% VX1e[^_]UEt Phȑ$XZh$'Phܑ$h*. jUWVSDE։ϋEEc3uc30-E c3t<t"t(E}u+E@E'E@EE@E@ E@EX0-UZhX%V ZYu=Et'}c3u1ɉ[cEXt""}uVeT [^1ۃ}uj/V~e ZYÅtUԹ1}EEE}WRhx&V t-1EԅۍUt/WRhx&VǠ 1ۅtVh$t/Exuxt Vh$j" p}P ju }~tCUj1}^Exux uxuxu xE@E< u2]Ĺ1jEPEPĆ ¸{&EE耉E 1}E@1}11FQЀ w0 QwWMQw7u&w$']@ }@11 @]M9ru)u}1ۉj/VZYÅurEEPV Y[Vb XVYVZHuNp @0u }u=c3uV Yt- V"b ZtMUCUe[^_]/;}u =c3BEXS c Z{ X ?}u MUs1x& c3Uf1E e[^_]US-tuPZYtC]UPu*fxu#@Ph$hhf3Sf3 Htu DPV PT ZU}uE u  'h$h$RRh%PPh$3 UEt#t#"$,$tPh2$$$Rh#XZUVS$`'E׉Íu 9stMtJ@ShH$XZe[^]UVSX%}tJE t1@jjEPà tj.0BY^ƅthe3@P\YZuUuR` ZhPhf3* f3e[^]UUE Pjjhhf3PRi thhT%hf3O f3UVSE UZ1t@ȅt  )ˉ t Eu7t3jSsZYt%uX%hPhf3!* VRhY$hhf3mVPRhV$hhf3DσVQPRhS$hhf3VSQPRhP$hhf3 f3e[^]UWVS$u} 5E ~y111119FtM |1t 1} L7tMw tLxw tHuGC@u?6ttxtu#  @@1u "5ω5KtB uhX%hf3:[^vth_$YEPjjhVPP)g t hT%VۭXZSVhA%hhf3蹿f3e[^_]UVSMQd3Qd3يۊ@'BZ@'XÃ@.)օ~=d3uCd3[^]UWVS uE Eԃ=4-tL1ۉ4-hhe3_Zu(j.he3.ZYth@Phe3& e3uhhX%hf3& F<tX<t<u^EԉE FEe[^_]G]ع1}ʉfEu jS ^_uSZY6e[^_]VPFPhq$hhf32f3e[^_]US]U MC<t,<t<u/MU ]]yMU ]]q؋]YS(PCPhy$hhf3跽f3]UWVS(uE MMԋ]U~u'ẺUЍ}عjuV _XUЅҋEtt SVZY SPV" }yE E&$e[^_]stEEԉE E#e[^_]REEԉEE E{"e[^_]3UWVSXEEE EEEEEEE"1EEEE1EjjuVjj]Sjyh$Et}tSyM9)sxEt  Cy;8-t8-PuCyP C E1ҍEЋMs4tHH1ɉ B uЋuЅ~u'EuuPsuV~uEuuPjjumE#CPth#h#h$E*.H*.$yh*.j XZ*.P*. }e[^_]e[^_]UUMzu'uQPuu RUU} uuRPjjuUWVS u} EE11һ$~kMUD8-u^@PXZMt$Ut:u?DX,t*DX\}uCNv tL}tEEEe[^_]UjjEPEPu u-h?uuuo(US Ph$h*.Sh$h*. Sh$h*.$Sh&$h*.ShE$h*.ٽSh`$h*.ɽ$Shs$h*.趽Sh$h*.覽Sh$h*.薽$j"UVSƃ=g3udPSs^Zy Sh&$&밋l%=`Ƌg3t:h#$RPZY h$PRZYu\t_X/tXRPh$CRPhۘ$h*.ĸ\`\tRPh$ RPh $h*.tDž`t0P _tPhH$/ZYDž`9t S}X`tjtj莪jUWVS TPjhPjT蘼11ۉ`d`Ph|dV @ h;lu\1ɉXSi9dsW`gXZuh"\PY_t X\X;lrt\h"hp%hWEPtg3t{WPhZ$tbWPh$ lSZh`PhedAV 1ۅ9usCaPTh"hG%hW4EPtg3.t-WPhZ$tWPh$7 CiVd Xe[^_]UWVSV1}jj}Wjh' uTEEPjjWPh'Y t S[!hGx%S ZYtQhGx%je[^_]ÍL$qUWVSQhqAdA EAEAEjjj h$薿 Y1iPEZuh "Suj  E y h$j E9tSPhʚ$w tCtQt_}uEPEP _XE#t[OEEq#_1$:E$z"$@E$z"E$y"ESiYE܃}ƒ}E ˆotRExurW2Z9EsEh$h$h{"h{"Suh $uh$$EE1EЉEԉEȉẺEM}dtEh9xE@EE@EEEEEEEou E]u]ű]u]usM] }EݝxEݝpEؙRPSQץ Puuuh+$u؉Ep݅xܵp -&PP$E])ؙ WVRP肥 PEU WVRPh Ph6$jj hq#SQj}Wƭ @u h#xjj hq#EU RPj]S蓭 @tjj hq#EM)ș RPjuVg @tWuuuhO$Ep݅xܵp -&WW$VShY$,mE}MЋ] }tajj hq#SQj]Sݬ @jj hq#EȋU RPjuV谬 @VShp$^ MЉ]ԋu؉uEȋU WVRP PWVMЋ]SQ֣ Ph$}"Mȋ] }jj hq#SQj]S @Ijj hq#EЋU RPjuV @jj hq#EȋU+EU RPj}W賫 @WVSh$`M]u؉uEȋU+EU WVRP PuEЋU WVRPȢ PuWVM]SQ貢 Phƛ$W}MMȋ] }m]m]jj hq#SQj]S۪ @jj hq#EЋU RPjuV讪 @jj hq#EȋU+EU RPj}W{ @Eu -&QQ$WVSuh$uh$|M]u؉Eu -&RR$EȋU+EU WVRP莡 PEЋU WVRPt PWVM]SQa Puh$uh$莪$u~XeY[^_]aUPh;$h*.j肠UWVSljU΃=Dk3u'jhDk3L @k3ZYuho$2[@k3Xi Dk3}u-WUPZYUujtdWUPZYUu=tRhh@g3脗ƒ @g3uPh&$jt K c1e[^_]UVSƻ@-tPVJZYt"Vh$5084輬X74MC St8tPRh$x Rh$txZYuj 3h/4 C.4.4 e[^]Uj=X=84t%084fPftjh/#Pe jhl3ƅ UWVS=74574ÉDžu¿$RWhœ$5084ƫ5084vPhPh@*.$y'1=3ShӜ$5084rL2.fDHfn,f?trfauH74Sh$5084& (fptfqt#1҉745084h$ Y[C13Sh $5084ڪ &SSh$5084轪e[^_]Ã=3tO=84tFUVS57474741ɉ 741U57474u1҉3[^]13U3jZ=74uj̃X74t|74j豃jh`l3諃 UWVStEUtj1]ut=tP2.TS!@u$EE%@ P2.t L2.fBuӃ}tgh 74[ƋE]tC1ۊ474t8u9s&H 74 CuݍHȋ])=~ E봉EE} Uй 1u1 34tltf$t\uDS8uOCDC<0~2S8u0x tF8tutt 8FtC1DЋEǸ /4:[tL\t$HWыu)@,-x$uvXP2.DZtep0u&E@GOu)~ˍYσ ttD9])ف~mP<,<]B<\t<$uj2P2.DstX0u"Et@GOu)~ɍAσ ttD9t])ف~Oȋu)=ZJ ]]\tBJuztBX5P2.D^tS@0uU tZBGO])ف~LӍJσ t4tT9t(])ف~Wы})ׁ@E8uhuP3 EE 5084h$ EZYFbEe[^_]USEU uM衠Gx%@-084tRQhp%P补(#PhE$| X74ZY2t!h/4h$5084a1X74 B]X]UVS]u9.4t}584E 74u184@-8t 9XtSh $j4 @u=.4th.4Ph$p Ph$pZYu.4584e[^]U}uwX74]ø<$]U}uRX74]ø/%]lU}u-X74]øC$]GU}th@.4hI$5084 X74U}tԞh.4hj$5084ߣ X74U}t蠞h.4h$5084諣 X74UWVSEuEE PPu FHt 1}6hž$E PEP uh͞$E PEP t}E p;_E څuP$8at$=p74t$1Ʌt1Ƀ=`741=d74ƍQV1M Z^9Yu19ARPSWS X74e[^_]UWVS0 Eu5X74Huhٞ$E PEP t3h+j?^_jhl3d{ ZYu=74E 9E ;u"1ۉ3jju à u=74tՃ=3tԉڋƅtō5`745d74 h74yZY9u1Ƀ=74κ$=p74t$VPSRƃE =3c=84V74741ҋt374(=74t=74=3u"C9]j[^1=3E ƅtˋE 5`745d741ZYU 9u1҃=74‰ֺ$=p74t$VPQRς=3f=84Y574741ҋE t3574( 14RjhE 4M u uE 40h$览^_=74=3E [Dž5`745d741ɋQZY9u1҃=74‰׺$=p74t$WPQR蜁=3u5=84t,=74741ҋE t3=742P Xe[^_]UWVSEuEE PPu_`Ht 1}6h͞$E PEP* uhž$E PEP t}E xpTtYuX741St&1ۃ=`741҃=d741Ƀ=h74111ɍSRtXZ}=-4u5084h$ [^닍xPSXZY}uIy,8tSh-# [^1ɉ 84 84O84846u2jE pĻZZutL9¸}9U 9zu19ZVPuWSh1$蝇1҉84841pt#Xpe[^_]U=84uY%=84t6$Pju uU=84u"=84t6$Pju uUWVSEuX74:Huh9$E PEP t31=84=84thF$E 0QZYu*=-4u5084h$ [^Džth+j̣p^_jhl3t XYE t ;u&1ۉ3j574u 腶à uK=74tу=3th)4SZYuShM$5084 멉ڋE ƅt5`745d74 h74YXtt9xPW=UYZu8484 Wh-#!XZ9u1=74ƃ=84u"=84t6$jVPSWh1$1ۉ8484=3=8474741ҋE t374pj!XZ1ɉ 3e[^_]UWVS u }t 誔h!1#v#ZYuvhr$5084蟙 zj hI$W > =84u"=84t!6$tVWjVjjhRS;yS赴X X74e[^_]U帥{"}uS#]U}u ɓh$h$h$5084̘1X74UWVSE]uu1҅‰uTpuCE xh{"W7ZYu u0HhS#WZYu1t/S#, u븥{"PVh$5084.e[^_]Uh$h74u uIX74U}uϒX74=84t084E Eß$] ]Uh$h74u uX74UVSE] u1=7474u{{"yt Msh{"V ZYtBhS#VZYu 1744V裻^sh$5084 맣7474노S#Ph'$5084 =74t574h=$5084͖ 5084hd$ 74Y[t1҉,84X74e[^]UhS$h84u uX74Uh`$h74u uX74Uhv$h,84u uX74=,84t174Uh$h74u uMX74UVSE] u Ȑ1=x74bu.sh{"VnZYuBhS#VVZYt1sl%4^hsh`k3 t74`k3 뷣x74t74t$t:u5084h$8 1x74ZY4l%4:u|#S#t{"SRQhˠ$5084 x74X74e[^]Uh$h74u uX74Uh$h\74u uX74UVSE] u vuHsh{"V/YZtBhS#VYZt6VиZy+sh$5084H 1=7474 3t {"S# 3PQh-$50841=74X74e[^]UEt~覎X74HuhG$E PEPn tЋE ph$|_YZu9=X74uJ=84t5084hX$T XZE ph$>_ZYu-4%41%4USUE X74u 3Pt ]ڍpYt`P Z@u Sh$X;084=)4th)4h$P賒1ɉ X74 Ph$ XZ]]]UEuRX74=Huh͞$E PEP tӋE ph١$+^ZYu -4USSEuX74Huh9$E PEP込 t3h+jE[Xjhl3(k XYE tE ;u1ɉ 3jju 转à uu=3tڋetSh١$Y][Zu -4=3u=84t74741ҋE t374tuj5XZ1ɉ 3]UEűX74}Ht}6h$E PEP菻 uh$E PEPt t}E ph$|\ZYu!E ph$e\ZYu -4UWVS}M 1ME1=84t574741ҋE ¡3t@3574uj:ZY1ۉ3EM9t EPUXe[^_]UWVS}u 貇.jjoƉXZSE CYujj輔h#K à u%j/S% _ZڅtPhRWx =74t65084S1 084HQPY^y Pj DY^ J }~j5H74hN#WS`  jWS` Sh`$^X74jc~~Pf Z9uWjۓZYFu hs$#X1ۉX74e[^_]UWVSPEEuWX74Hh$E PEP EwɋE ph$&W_X}h$ ^u ]E XSh$VSg1 uY}h$ɻ Yu ]E X ShȢ$VS"1 tA5084hТ$ XZ<u}u"E X ShȢ$_VS1 74ʡe[^_]UX74}t =%4t =%4u#V=%4u084E Eߢ$ h%4h$50841X74 UX74}t鞄=)4u#Ϫ084=)4uE E$ h)4h$50841X74 UEt~=X74{Huh0$E PEP tӋE phj$UYZu9=X74u<=84t5084h?$ XZE phi$TZYu -4UEt~蠃X74{Huh0$E PEPk tӋE ph$yTYZu9=X74u<=84t5084hq$Q XZE ph$;TZYu -4UWVSu huS8 9}1hE4S F 9~hhGx%S GSh&$SY[Hu j%NZ-4e[^_]UEu|X74/Huh$E PEPG tu uhq#- UEu0X74/Huh$E PEP tu uhң$ UEuX74[Ht}6hc#E PEP觱 uh͞$E PEP茱 t}E pphأ$R USEukX7488484Hu h$SRYE ph$@RXZ84]USEPvX7488484Hu h$QYE ph $QXZ84]USEu赀X7488484Hu h$QYE ph$QXZ84]UE} tuWX74=74th&$IQX骞U} t}uX74Ã=74t jjXZj^Y=74t jjuXZjwUjjj}wUWSREEuX74=uE Xh+$蝵 Xu]ShȢ$PS1 e[_]UVSEuF0Huhg$WrZYt.h %WaZYthn$WPY[t뷻vZt084u6hv$Rgv t3t35353h$R7v1X74e[^_]UWVSPU} uRUxwZUuUE $084Ee[^_]uË@t P81ɉKXWVCZ=84ttP3hӧ$5084ue[^_]USEU X74t tt<]Op-t8Cuq#PRj h$5084Fujrr 1X74]UVSu X74}t e[^]ovcvXuvh$5084t,Ct P/1҉SY3h$5084t1X74 e[^]US}utoX74B=-4u084E E$]\ 8484h1$>@84X]USEU Hv oX74V=-4u084E E6$] 8484Hu hc$?Yrhh$?XZ84]USMU AvnX74_=-4u084E Ep$]t 8484BuPh$M?XZrPh$;? 84]UWVS @Eu} tmX74AHh$E PEPƝ tЋ53} 19~j k3Pw腱 t*Cu%wh$5084rX74 h@h`3P 1ؿk3X 9XrP2.DP@tC`3<$t<\CFC P2.K߿DJtm1KԿK߿DJtk ߿DЋԿʋMQ9~mP`%4)PE 4V E 43߿iu6CDžؿ9}~)`%4)PE 4V E 4ƮƃF;p30mXu 5084h4$u!5084hI$ X74^X~ t=74u 5084hu$΃=84t:5084h`3 084HQPYYy Pj sYX J j 6R 3P53V =74t3~t-084HQPy;P| J PjLsXZh@Ph`34 io3E3E 9XCؿt G9}ce[^_]USËt P1XCt P1ɉKXCt P1CZ]USd3j\wX=84t>Ph$jd]Sfj~!084fJftPSRkh jhn3H USdjvX=84t>蹻Ph$jd]Sj~!084fJftPSR h jhn3jH UWVSÉ֋:j:WYZuWh+$SA :WP$YZtj%W賀YZtWh4$S W跊F u FfP HuFf=tPh$Sأ h#SʣXZe[^_]UWVSQljURq[Ë7 <wsBSuRU u8Uӊu <wrs C <v1e[^_]UWVSË@t P։1s_stVԪY1Ct P證1CZe[^_]UWVSljӋu74u<MPuEPMQSW>jt>y8E8 u@EPh?$UXZ H< ws 1e[^_]Å8UWVSH%Pty=P2.UfTWfUtbPt[ftwftL0Eu7EtW})߉0u7tWӉ)Ӄ@YAbAXZ[^_]UWVSljUu }uu hX$j jh$W uW1ɉK fCPjh$W uWC fCjh$WY u WC _t36Úv蹚Cv讚CF C FfC (Wuh$S Ei$:j/RU}^ZEUu RI8)ЉUHQMϙƋMQURP { uEuCYj@V|ZYt_{ u1҉-4Mq@Pj:Ep| t@PMAYE@yE@tj>[urVj]RUC|YZEtH:UttWuVh$)PERVoUMVeu WuVhƪ$fEPx:t1j:V{YZtP>t3tJj EPRU J U:tM9u HvWuRh$7R?fC*C ttp%4tt%4tq#R菘CZ{u"%{ t!%PoCX1e[^_]USZKJy ;J| t Y RPkXZ]UWVS\fDž1jh$Py _1Dž1jP"$AZY@t(t 8tt 8uSh$P7(8j;P ZYƅh$PY_t>h!$V_Zt4h)$VZYuh1$'P_SVh^$S葖j@P:y t%1ۉ-4@Pd^j:xZYt+@P.XDž11Dž8ta8tVj/P [^9u*u+pjh!%S+ ts11ۃu t*741ɉtf1҉uPt ;th~$S5dZY1ɉt >th~$V dYZ-4=74tjjXZ-4hPR8 u11ɉ741҉74QP7474YZuu*"#Hu9! uPh$BM Ou Pj貿Pj胿_Xu1t ;t1j/S8vZYDžtG9hh&R 1-4Pj=-4u,;u=X74uh*.h$g ^_W4t3hSSL hh!%S hVS $hhI$R 1ۉ=`%4 tS741ɉ 74t hhF$ hhJ$R Pj(74Gd%4uj/V [ZtP1ɉt PjPjXZX74-cNj5e[^_]UWVSh<1@DžDžDžDž1048Dž1 ($ Dž1DžfDž1DžfDžE11,jhn39 ZY u P"$Y[@Sڏ^ȏ<$贏Zffu/t+;h$S藀ZYh$*t?u+$u =d%4uh$HWY,,d%4t <,j/P _Zt@,PَZ PƎYd%4 t 8uh9$c1=84=848484DžtDžx=`%4t0 tRP'ZYu8484O74x$,h!1#P轕^_44u ,H4PSt$P.Y[u/tx8484584=84ut84P1҉$WVP\y,Ph$B_XC=84u=33 ,Ph$5084] 8484 084uu5084j I[^RPh$QE]hShm3R -4m31$[=84t5084h $艨 XZjy[X<415-苂`h$ -Xj ce^_u 1DžDžl@`j lRP lt P2.DB@tU`6[DžDžDžDžDžDž1DžDžDžDžDžDž1ɉ1 DžDž11]\dd$tej `Pd: 8484`8\P -!Zpj$4ƅ#d8*u@zj pVPx9 cp8-T@dj VPB9 -9Ћp8/Pdx*u,j pPR8 pd8=84=84h$-$tXH ׉dRp^_oDžh8HVR<Ytx><$td+*F$tN<$othY$g8X$Ou jh$@$!td˰$ ƅuѰ$utPOkXVr~_^t:\-,r)=84'=84h$t;u h$8n3P8n3~ h3$841u>u$PڋWY^'ShS$5084M ƅu  Shf$5084M ҃thx$6XZ h$6X (DžDžDžDžiXu tSiYi_uRh$DžDžDžDžDžDž 9d%4u h#P$_Zu Dž8*.\ 8|uQjj TZY h"@P@ [^88u @Ph`$Dž08<8484u!t9Nj}5uPuG84 84!΃9=8465084hб$虠 ^_u t=84=849u 9t Phޱ$?4 hY% h"PKY[88u Ph'$=Dž0hjS[^hxhjS_Z3h$h'hh$茒9l3s&l3tPfY3l3PyZl31 84$8474@tPjtR^_DžjR[4P5l35l36 u h4$1ɉjP5l3菼ƃ l39u hV$8"ty-ח"l3R)Phi$  u @;u‰Њ Bt th#P_Zt h{$=-4u -4șul31jP+Y[؉|tL𙋍|9Ή| ||=74F|19=l3|19||Nj4PWj5l3aǃu4PKZ1 84$84|)ډ|8l3@DžftS@ u˕tڃ#u)uË9 Ph=#=,840849 84$84|#]74RbXb)f=-4tYjP[_++y @B19|@B)RT Y맋c[1u9V4P5l35l3{ uj6N$$h#5l3衅_Zt h²$/|ft=74u4P}^tch$tQ=,84uڋ 84$8419}Nj749|084 뤋084#[#jM8$AaY0=xu tjSrXZtx1ɉ08R18 $Pʫ _Z@u*tP.$fe$h$5084D 1; 84$84|84 84y )jFX8484 84$849؉|1= 84=$841@u @u"PjLY[㋅Pj mLXZ@tPjTL^_@tPj;LY[4t4P{@t P? Z0t8t08RX ;d%4t t P_1 X,t,P_1,XtP_1_$t$Pr_1ɉ$[(t.(PS_1(Z| !e[^_]UWVSÉjh$P讨 jh$S薨 tsh$S3ZYDžt$jh$So tS)Wh$j藘 uh$C_u?F t u8t,jh$S# uVj11҉VZYe[^_]É؍e[^_]QUS1EEjh74: ZYt-=74uEE@EjjY[hjI[Xhj IXZEE;EEj:M 4SZYtw1ۉ8n3=-4u -4EU 1oEd%4t%h#S苀ZYt;|tSi]1ɉ d%4[E~E@EE@E\=74uE]ËE@tjj7XZUWVS$} j h\$uVǣ uE1ۉ]]upÉEP}DZY53 " 3X1e[^_]UWVSu1ɉ |3hޘj].E74[_tp@r3{3W{3@r35747474-4thPBUP UBC-4 Ԇ3Ԇ3 󥍺33󥡌3<<33@@3.4DD.4.4HH.43LL3p74PPp74l74TTl74h74XXh74d74\\d74jh474`UP趇 j`Ph474裇 jh 74U썂qP荇 $jqPh 74w `74U쉂`74hh 34PH hPh 342 $hh /4UˆR hÈSh /4 uj+|3 t1|3EEe[^_]e[^_]UWVSQ}j/W6 [^Ƹv%t9u!%jPs&XZt/y Wh$אohWh@n3g An3ƀ@n3. d1/F09tBEjh@n3&XZۊUx"0t$uOu5084h-$w Y[1@n3F<.u1F@Fɍe[^_]UWVSu3u/hT$ X=$3t X741Ee[^_]<fDžƅfPftjjWPt hv$贏Xhh$53"53= 򡌋3SÃ(t hv$mX=$3t X74j;Xt(t#fVfthWP. jYu=X74(ujZjXe[^_]US E1ۉ]h1$u`ZYt E1$$=l74t$E.4u!=-4t=-4u9.4u%hY$Yt!5084h$u TjS{XZjpX=74u)5084hη$u [XjMXX749.4uh 3h$iZYtjS%{[Xjh@3 ZY%hjl(Y[E8484uuuuhR% Hu.RPh$ tԋEPj(XZjXdj> $~XE@E8484uyuuEu PhR% Huv 3j1$51$E$j'XZjY1ۉ 3uu h$5084JRPh$% sjh3 Y[hWj1'XZ1ɉ 3h1$uc^[Z¡74tt =3tSjtjrXEt1=74PVX=3t(MEu PhR%| Hu\j[뼋Eu(Eu PhR%O Hu/=3tjY1=74PZ=3tCjX=3tqjUg 1ҡ3Q~jX1$NX=74u06u=$3tX74 h$>Xj7XjVYjN[=$3t X74EPj%XZ]UWVS74pt74`"1`= 84=$848484,84P=84t}u=74tTuu u E 8-u}tuh$5084 u h+$5084 ʡ.49.4u:1ɉdDžhDžlDžT"jh3 [^u#jP"wXZ뺃=3jXhjh$XZhjZ$Y[hh#u [^_uDž\@*.1,84E 8|u]jj $Y[lE Xh!1#S! ^_\\uSh`$9XZ>1=,84Dždh!1#u [^\\u u h'$Džd\fzt \@xRP3AZYxE%=tu h6$5084 EЋUԣ8484jh3I ^_D584=84uh$u(ZZYth$uZZY.4twC\fxu \jWVPdF\@jWVPGyu h$跇_X+584584h$  DžT6$}tEuuhR% H-4T^``u"uh&$ZY뽡3hM$h'h+h]$ba9t3s&p3tP5X3t3PH_p3j!^l@ujj g!ZYl=74t=,84t =84y 741ۡ.4`fxt `P\fyt \@S5-45t3 p3 uu h#_Xf8  84$84\Pu5XY@X t0`X 84$84\J뭅u`@ @tc[pt95 84$84|׋084#50843^pt74pt륅u@i` n 84$84:\H Xpt9 84$84|084 \@ @t#084#u h#胄XZ`@ @tjhx$fXhj@Xdtd\R^1\`P<21ɉ` $[zhPjXZDžh=3u X74c3xP X3`t`P1^1`j[X741; 84$84}jYh@u l@u"hPj XZ㋅lPj ^_3xPb [3du `u)\tꋅd\RY؋`P 1XP,841҉8484 84$84e[^_]UWVS1ۉ0474PT74$15 845$84L8484,84(\74$h1$u:T_ZDDu =74uVu=84t}t}u&E 8-u}tuh$5084m 뺋E Ph+$5084T ɋDtE uPu 1ɉ8Dž<Dž@1=T74uDHjh3I _Zt=3tzj4^hjXZhjY[<}tWE jPY[E j/P( _Za8tNa8 tDE Ph$[^X74. E h#PR^_E 8|utU !%9t v%tE jPY^t/x=l74t a8 uW@`8 u"E hP _ZyE Ph$P=l74t 뽃=l74tE PYE .D.4uJu6tY jjmXZ.49u&ju/^_8484X74ujPlY[=ujh3m ,_ZzDu}u/m8484utRPh$ ˋE8t8PuhR% H{h!1#^44uuh&$^Y[ȃ}E h#PP_ZuDž0*.15,845\74E 8|uXjj H_Z@E h"@PS Y[00u E @Ph`$A15,845\74Dž8=E uP-Y[00uE Ph'$$~XZDž80fzt 0@xRP^6^_@tE%=t1ۉ,84\743h$h'h3h]$X9l3s&h3tPr,Y3l3P&?Zh3jZX=74t=,84t =84y74,1,.4DtB8484ut/0f{t 0IjRPQ<5-4l3 h30fxt 0P4ft 4@,VS! u0]8 u 84$84h$T|^ڃD+=84u =840jjjP:11y=E Ph${Y[L0Jy/0Px+Zt΃ t*;58484|0H уԋ0jjjP :yy| B, 84$844J4P*_ 0@ @u[0 |u4J4P*^t `L@L,PT95 84$843084#5084(XPT74ډPT롋4H  H 0 84$84 4H PT95 84$84|084 84@ @tA084#QZ8 u 84$84 h$yY݋0@ @tE Ph=#lyXZjJX8t80R^104PF'1ɉ4 $[Lu 84$84y3dLPh$5084n  5084h$N` XZ뾋D(uu=\74uj# _苅8=ju)[^X\Bu@j`S ^_X\lp1tE SP~q ZY@XP1$+‹E $Ph$5084 `jh3 ZYt$X741; 84$84}4jE Y*hWjh^_=34Pf[벋<@u @@u"hک$WBZYEue[^_];2ø#=74tL$PhT$5084 -t$=74t~ tP32PS2 S#%YE ]e[^_] QMZƒMuQWh$5084QKSu QWh$ދ}u#Uj PMQEe MMEPjUR rPj h$5084릍e[^_]á@3 3!t$uCd@4tJu6d@4H74%d@4P@3-8!u-UVS t t @d@4tJt d@41&d@4H74 tGtBB@"u\uXu@!@B؀"@tՈBut B1 3@3u/d@4tHt d@41d@41H74[^]US@3`3 3@31ɉ d@431ۉX13P53/XZt3@ڋ]UVS =84t2084SPU 0^Z8tPh~T$5084  5084jh@h`3h@*.)y}uB5084h$t.=84t 084Hy Pj Y[ J z=3?30ZÃu 5084h4$+u 5084hI$x t =74u5084hu$$T [^1ɉ 74j 3uV7b 30P53S =74t3{t-084HQPy;P| J PjXZ{ qhjhj e[^]UEt]1]US]u h߾$jT SZu Sh$jT @]U=-u : -084fPftP2 Z9-ÍL$qUWVSQ084 ,84 XjP+ |@4@4Z^+@4y @BL-&ڽ߭ݕ 84$847419}l؞vK߭ٽf f٭߽٭؉Ή߅uq#t 11h#RPSQh7$hPٽf f݅٭۝٭Q~DQh#uq#RPhJ$)PPTÃt Ph#)PPÃ<RPhT$)PP؉19}t  @~4('%y)DžkddʉӉف1 Q%1 RPh_$)PP8 84$8419݅8484584=849Z)߭߭ٽf f٭۝٭׉hs$)PPà t!Vh#)PPÃ<RPh{$)PPiË+p@4t@4x@49}9}&h$)PVà h/#)PP؃ u084fJftPVR eY[^_]aUSF1; 84$84}6=84t%084fPftjh/#Pk jXji >X]áA4@ `t1USA4HyP Yu1ZJ ƒ,uɍPv"u|@4A4HyP ZuJ"\u%A4HyPy ZuJCCA4uh:$! Y@4@4A4HyP+ Zu ZJ ,„t@Pv8\u"A4HyP Yu JCCA4uq-=@4th@4P-ZYuC ߸ ]UWVSQƉUh@4P[_tHj.V[_1ۅt6uPZYÅu#)Wh@4VT u1ۀ@41ۉ؍e[^_]À=3tUWVSh!1#h34A4^_u";8th3hS$'[Y[1$hS覰_ZyƅEj.S[^pu Džpq#1btH uuzG uҋp-4uSpEƅt1;4 3*%u_3uGE uh@4#} h@4P+ZYtE th$P+[_tBA4fPfttRP0ZYx|?thc$ h$w$xAE85h@4}}X A4fPfttRP[_x"|?thc$ h$ E8h@4}z=74t5A4PqYt u A4Hy t u5084h$Jɋ3u5084hV$Xk33ɣ3A4HyPZu@JP2.DB@uGG9u u3u3̣33=A4HyPYuJkPkУ3Ḅ3ḳ33A4HyPKZuJ< u63k39̣3u@3 {u@3KZCh@4h>$ _XA4@tRB[5084hZ$> XZ5A4Y 5084h$ۍe[^_]1US]P2.uh$S ZYu-4DB@tCjhc$S*O u -4Uh$S ZYu -48h%S ZYu -4h$S ZYu -4]USZKJy ;J| t Y RPXZ]UWVS84=74u 84hQ$L^tIh$h3"J ZYƺ9¸} 3.uh3Vh$5084 jh$h3M 574tjha$h3M uSt -4 -41.4j h<$h/4J t\h/4h$5084 Bt 1-41-4t*j h$h3& u5084h$0< ^_-4-4-4-4-4-43h1$ڲY1u<-4u 1҉-4@u-41384e[^_]U塈3tP)X1374-4-4=-4u1-431-4-4|%4tPY1҉|%4=74u13U3j X=84t%084fPftjh/#P2 jh74蓿 UVS]30jX=74tf3t-fPftjPB 53'13 3x jP 53 3 174jX=74t>3t-fPftjP 5313 1ɉ 741|74j誾PZt Sh$j); 30e[^]UWVS ]u74=3t =74u$u 1ۉdE4`E4Pu+dE4tÍCdE4C1ɉ dE4`E4h5-4W[G /thh!%WH hh0$W H W5fyWh>$qQXZ1qP =84Xأ8474,84174,84} t1=74P7X"t!jjRPPh$Y%֡X74-cvt3} t1=74PѼX=8474,84h!1#S``E4Sd`E4 uuhc$ ^c$Phh`A4C u5`E411ۉ`E4j h`A4ZYu`A4e[^_]UVSQQMq84=74u 84=-4ut95084h$7 Ph$ YZuBj h3I^Zuj UR@P[ M te5P2.DN@tVu=X74u=-4u1ɉ -4t=74u5084h36 084 XZz84eY[^]UWVSQ4MY=84}=X74}=74u 84=-4u}5084h$6 fPh$^_j h30ZYtj.h3^_th38Y3uKjh$V` u7Vh$5084f320h3h%$5084x3 }1VZtVh8$5084G EPhP$Vb tEEPH_uu 74u\]84gu=X74u=-4u1ɉ -4t+=74u"5084h34 084 XZE84EX74eY[^_]Uuh]$j2h A4~u hw$j5 A4UWVSP}u jjh#jWh$V` ƒu&Wh$V` ƒ uWh$V` ƒ USjfEe[^_]Uhh)4- ZYu)4UVS%4584X74=74u 84h#yZuQj h3ZYt?8t:x"u41Ɋt t"u P"u @%4A@Ɓ%4%4584X74e[^]UWVSu huSA S= hv%PUu]WS YZuSh$7KXZ19/uVÉ$VWH uڊ/ e[^_]UWVS}GE119ut4Z9sFSU(849r1uÍD1EkE1Eu9uE1E9]tzMt5084RU1 YXU;wr084 t:"~ r\u ]9s@\Au;E XZ[^_]UWVS}M1ۊ4t <%tU J9rSMAEQЉUct?&/-3%TcMUmn>=74u Eq#$=%4uM=74MtE%4E}.t }cE1҉Ut @/uE1҉Uy0u MEMIQψUߺ}wQEM)щMr9Es8/H8/uM9€}}M Q9vI}.u29S.49cS.49R.m9pS/491S<4} ~!9S949 S+9S]049Z>)؋u ^ 9BL湅#=74t -4u#}mډ)Ӌu N ty.uup9swBL帅#=74t|%4)؋u ^ tA9sHBLE H9cS%"M I9OS%49sSڋMA[^_]ÃUWS$]؍U1EEEEPShx&uh ƒ1uu Xe[_]UWVSu] }VuSt u1N tu$t$fN lSZHˀ; uLUJ9uD D*.y h@*.Y@*.H @*. t@u҅t$ff t1҉e[^_]UVSQuh`3[á084?vPh$) juh $PCƃ`3 1҉UUR@)Ra3Ph@*.yh$uh$5084jq3193 U e[^]UWVSD]} SMj j VhRuWv t&hh"RF7 j h"V97 h%4tzW9Vt vuvvSb @uT"8jjjhSvvv thh"S6 !8Sh-$AY[4jjS ƃ u(PPhW$h@$@PjS @uPPhm$fDž=74~"jP'Z74XZuWSi @ 8$}u 8A^PPh$#@ >jPY+‹Y_+y@Biy1fDžRjP uYO 8u=74~{4 8#tLVjS@ ƒ 1BPPhp"nu< tQDžPPhhSj @u e[^_]UVS]u S-Xu ]e[^]QZ US] hT-$SYZ¸t,hx&SrYZt;uEuh$c>XZ]US]SZu Sh$j(' ]U蚨 u h$j ' US] Su ZY@u Sh$j& ]UEu h7$j& PZu h]$j& UWVShuE ]E1҉UUUt PEXt SE_=-4tIEt PT1ɉM[h$nEEZt P31EXh$BPGE[_EPEPEPVy$X7453 ZEU3084t\RVh$PS1ɉMEPjP]Sh@*.<yhy0#uh$5084X741 Vh$P Sj=x74tVRUM É4$C |<$WURP1 WhOd$S2 WVS2 E(tPX]Rh$r^_}u-h$Z Yu]SES 1XZuh$%ËuV 1 uq}u-h$ _u]SESd 1[^E8uh$˶ YPhȢ$贙ËuV, 1 uŋEtPhȢ$肙_Zuu|%474^ux74539~Lk3Phɍ$ ZYu0h@h$h`3P0 3053YC'%41%4Et PK1EX]tSI _1Et P"1ɉM[]tS Z1EtPXe[^_]UEu\X74=74t%5-4h$5084PX74fHhD$E PEP UBw x74t l%4u t%4u)E @tt74t:u h$j" PRPE pZY=x74t"=84t5t74h$5084 74j h/%h/4. .4.4j h$h.4v. `.4j h($h@.4[.  .4$j hV"h.4=. .4j h%h.4". -4=74tjjE p UWVS0u=74uue[^_]=]ȹ 1SjhV u}uVh$s S 1E0ESs XZEče[^_]UWVS,EPu EP[ Uȃ uL ỦEЋE0ufEjEPQ74EUXZ1ۃ=74~yjEPPE+E‹E__+Ey@Biy1RjEPm u8t8#tu<_1҉jEPVw u l y]8EO8#7ËU9} )‰UEudX؍e[^_]UE]UE@(]UPEx$tEjURjj0 a 1USjuk [Zxj0jZYu S. Y11҉P$]UVSPuEj0jfZYt,0@$jjV jEPhhV` ؍e[^]US]t&S13 sfs^SX1]UWVS(]=74~jEPN74EU_XEE E̋C t 9EsẺEЋ}s)C C)E0}1u&uW3 t}R)EEЃ}umq8c8#twYC(O8uE9Cr">uC,'+8#us ZYCEЉC{uMEЉC 1{UԺufU؃=74~;jEPME+E‹EY^+Ey@Biy1~1҉VjEP u a8tW8#tMC(9574Ph$5084<C(<1EЍe[^_]UWVSQ} ]{uhCZC{({,C;C C1s sSjjEPu{(uT{,t Cu`EZKSBCEC9Cu3pVs>ZYu> C(1E2Cs} z뙋s )9|Gs}UC Ee[^_]UWVSSu] }VuS u-~,tu$t$1ɉN(YSZHˀ; u9UJ9u1VjjEPat} ut/$1ɉN(t1҉e[^_]UE Pu<XZ=hE4u hE4UE Pu<jtUE Pu XZ=hE4u hE4UWVSSƉ׉ˉʁv )…tRUWVɼ tUu؍e[^_]W|$wUWVS||xˋ7GEGEh1E_u h[$)hEYtU 1u]EEEĉu1EEEEE11E11҉UUU}t }}uetWuu9 EE)PEW| u hi$IXC1Ʌ}lj}EU1EMu9}uh~$A^_EEu1ɉMCw$D'E8tJ1M9ȋM}uh$XZFh$hE4XEE@EO}jjjE 1}Ett h$O@EO}E8t h$+@EO}oEU@EO}O=E.E0@EO}E @EO}jEu E8u$ Eu E8u @E"u  NEO}~j8h$jEPIu [h $1RjEP&KEZYwP$'}tR}uL1Eh!$XEE'h3$hE$h[$uhs${_X+}t?:Xȱ?v.X?v"?tH?uH ?uHɉ[]UWVSƉUʋCtىM1Cr 2<]t, [u#z[u[tt:Zt :Zu[1ۋUJM1ۋE@\EuuVW t VP^P5W45W4hE$j F9X`4sX`4e[^_]UWVS1ɉ /t,$Xtt+i9~d\@1ɉÅu5W45W4h[$k1Ҁ8IuC1tOFH@>uj RP? F 5W45W4h$j ؍e[^_]UWVS ÉUE9C$"u5W45W4h$HhÅtP2.5W45W4h$DB@tCujjPj趿ƃu jj jjPj腿t9t5W45W4h$A=/.u?1@=utnԍ1 󫍕h 1VľYBu17Fuދ8u P2.0Rj P蓾 v jjUjO hPj f wӋuu@kHPA JkHЋ8Nj󤋅B$(׉XZDJ@t Cu<;t<}65W45W4h$BC e[^_]UWVSt1ۉ1ҡE4v1U4t2;{ uCp5W45W4hK$蘇 SYFu\`4tk P``4ZX`4@PT`4Xe[^_]UVSƉj pX1҉--Ye[^]USjx1҉P|-|-Y]UVS5H`4vtQh!1#6IYXtKySZt# PSP薗 S@  S0X1e[^]UWVSu]8X4Bt1L`4u t1ɉ 1҉W4PtJtHh!1#p薝4X4L`4RY_u Rh&$jy W48X4qphP#jhX4vhH$h,X4 XZW4X4L`4@X454X4u V* ƒ tCW4@W4Hu>#u~nu W44X4@ L`4L`454X4Ƿ_1,X4=W4u8#uxnu W4M 1M I tX4W4t]Ut @uKf X4-tX41ɉ 8X4=L`49G L`4W4t1BJM pЍe[^_]UX4@ t=PP5W4hf5#jB 1p`4h`4e[^_]UVSud`4uh$j d`45T`41ۉ^] ^1ۉ^ 1ۃ}uX`4CQVSRP t 1҃t5d`4P_PhN$j Ѝe[^]UWVSE`4`4z %&\u.rEP2.Dpt zu0y_<\t<&uG`45`4V9r0M`4P5`4Uã`4`4`4XZM `4C1T`4xutyPx utk`4)ʋ `4L 9r2U`4P5`4ã`4`4`4YXURUT`4M 0QS~U`4 `4=`4W9r*`4P5`4oã`4`4`4XZe[^_]UVS]uCP9SsCPs'CZY}u1CVu CP'~ss0 e[^]UWVS15W44jh`4BZY91ۉ`4E41ɉ l`4CSuu xK u W4)9BmuB5`4j1ɋ`4_Zu W49B Ht1s l`4C8u W49Hs1ɉK 1tu*@5`4j1ɋ`4a_ZtЋCu,u W49Hu׋@9W4pu x_W4C \u@5`4j1ɋ`4Y^u W49HNCt t P H C=<>: $'\`49p`4r\`4kP5``4``4XZ=p`4k 5``41h`415`4{u5W4s Y[ =l`4uu =`4 `4t5`4CPj Vy u`4p @))Ӊ`4SPVN{ mj5`45`4h`4;jjh/#h`4j5`45`4h`4Fj5`45`4h`4 jjh/#h`4ej5`45`4h`4M 5W4s `4@`4D=W4*.uY-u[hrA# Zt8tP -_9TPhht@j uVft--<u -t 11@tR@DPPLt%tv$DP 1DžLP u?F;5-r5W4hw% Y^5W4j$dz 5W4j Wz 1WZtHW6X;5-r5W4hw%l ^X5W4LjD躠tdWeYtXPh'{_ZDžtE;5-r5W4hw% Y^'9$Ph $5W4 _L<;5-r5W4hw% XZDL<Ph$5W4虌G 9tE8t1:"u#C؍e[^]USPyYt@Ut‹EBu Sh$j ]UWVSÉk<`-AfEE19E~6Q@94:u9E~֍~@kt~UCuBEs[@})EKʋEC _9~M{fufSf9} z)f{)MS9|M9~fK)y1fsf9|MS9~/E9}(CPuyRuFYXCuE9}ys(ulXZ1C9uf{th!$uQs%Cujjs7 uCuS)PssԌe[^_]UE @]UE @]UE @]UE 1҉P]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE 1҉]UE 1҉]UE 1҉]UE 1҉]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]"U1 a4jA1U1 a4jA1UE uU]U4 -1]U4 1]U4 1]U`4 1]U`4 1]U`4 1]U41]U4p1]U4U1]U`4:1]U`41]Uh袧41Uh茧41U 4 1]U`4 1]UX4e1]U4q1]U4l1]US] @4)thkj<XZ*ƀxj3P?jj35@4Y]UWVS ]u t/{u)P.vP= t6vWKC 1ɉMCU9~Y}C48Zt>vPZYt/{u&MVU7MQURPGE뜍e[^_]FUS]Ct>P:|C ZtsP[Rs 1C sXbs1CZY]UWVS`-1AfEE1}9}FQF @tf~uߋ}9}֍~@ksCf;ssfF t4cC,t{uu S_XC0tu SY^{hC E{CE܋Cut 1EEuECutiPEZt[8tVU1ɉMj RUmYZNMUt)9M}MԍPuR ZEM9}MtFE1ɉ u1uE#CЃEЅy 9}NjC fsfufu EfC  `4M)U)9~(f~CDuEԋ}))y1E+E)fC M΋U9|C@tSf)Juu5`4WuCPC Ph$"EU)E)9~fS }}E}t'E܉E;USBu2ZuEC9E|PÖ^9E}EEM4`49~*u5`4uuh$h*.YjK}u)MUʋM9})EK u`4}))ȿuWVEQLCu3uuWuuuC Ph$h*.X$jKjPkbZYths輘hsCtuuWVC }PKC _C tOP5}77LXZ?S{B99fSs C9|)BfSU sV_#@$l'2=.=9=R@Kщȃ$'C*h*.jC Y^\sF "HSB ufCf;CfCs$uh*.jzC 5}725}71jjWPJEti^u5}7J5}7V ƃ11Et9}} < uEF5}7BthW$jj5}7Vjj5}7$jj5}705}75}7Y=5L2.DBxqz>tKdtF<-u(=t5=t,-v3=Rt=Su%t!+=`4S>t`4|@h*.jB XZV&]CfS K)y1fK)y1fC\{f}}S׍ MQ9UK fMU)y1s9~fSUʋMM9ULfKsrXxut fCfCjz `~x~Ja (EC99C@ 'fS?u ? =St=VYvt1ҡP2.DPIh*.j@ V| oesqC Zt sPG_XsWY tF t!u S_Zt Cs~ft^F uMsFqC ^tsPgGs 1ɉK sdWs 1C`4XZu W_XF spC Yt sPGXZsWXCt2P*o1s_$uCD0tP oC1҉T0YEC9E|ӋC4tu S_Xs1ɉKC ^tTP1C ZFuuVu5}7/peE9s$[ Xe[^_]UU`4U fP]UU1x9`4~`4]UWVSP.5`49B  MP5`4jY_Mu11`46`4`44uj-t.t)9`4r!DPo Zt;`4s --؋]U5a4Wf1a4`4ZU5a4XU5a4XUS]uTu PmSPjh]US]u+u PemSPj?]UE Puj& UGuPh&$ UuPh&$ US ]uuPlSuuu jPQ$]Uhq#uuu uUWVSu5a4w"5a4T"XZugu,u4u(PnlVPjjAƃE}t'E8tE$9}u.YtEE$t9}=2}Et,~(E8t PZU$DE9rE} u)@E }y$u{[Ej PvXZYtE@M}})ȻEE9~)ω}u uVQM5a46ÃMu$u uVQh$5a4SQ11MvMSq8XMtW5}79ZYMM5a4PSӅ5a4mPSjjSc$S?nE @PE@PVMQ5a45P0S詆 P5a4qSP5a48u'u(PajU,Ru$u uuP$t6SbXtSW8W$ SHVPS e[^_]Uhq#u$u uuuuu u3$US]uuPiSuuu jP/$]Uhq#uuu uUS]u5uPoiSuuu jP$]Uhq#uuu uUS]uu PiSPj]Uhq#uXZUS5a4]5a4|؋]Uj5US]S hH# P }荄k =D4t7S诇Ph]Q%5D4B5D4^5D4x^1D4=4t8SoPhoQ%54B54l^548^1ɉ 4=a4uh*.hQ%v XZ]UWVS h!1#PB_ZuohRjP譋Phn#h*.*BS^ j4hf}#SH _Z؉Ph#9TY['tCVhSl+ uW:$W t ;u뵋Ct{ tዅhf}#RPH ZY€:=uZhf}#S3H ZYhQ%S$ ZYWSQ ;V\Xe[^_]UEPE 4UWVS 1ɉJ P肈 ^. Zp j hQ%V uՃ{ uC W) h!%WkJ VWdJ WujƋ;7P yC9C u=CPWHY_Zu{ YaCPs#Y_ZtۉC{ CPtGC VXY^e[^_]Ã=4u U塤4t uP蘣 XZj 2UhH#> YtP3 Zt h!%$ Ygjhn}YZ hZjXUWVS$1ɉM܍}1T4j5j袆[_ ]߉j jPM =T4u:S<ZxEPj w_X}`jhz[^1T4\,hj@4PgZY~>jh8j@4Pfyjh_X=49SE^ujhY[SZu@41$Hu[g@4Ph&$jXjc@4)t]SU^/}EEjPtUY[{EE119EtMЋ 1҅t9t; tB C@܋Ekl9tH41҅t9t; tB Cl19t4EPYZu EG19tPZtGEP.e_1;}s7klE@0 t(Pdt!ztHhr2p8p4jG19t4EPZYvGVX_}kSlY^u`S[Ohj]jYju8j]SZYu'lڋS踕Sjj^ڌEP蹚Xe[^_]UWVShPVٞ hhU%V詟 hVW跞 $hhy%W脟 Vu1EWZt/SSSSSSSSSSSh"h4jj.Y[ WVXZ뷍e[^_]UVShPV) hhU%V hVS $hhy%SԞ SBt VSXZe[^]UWVS}11u܉5T4jj7_ZyjVPHI e]@4$*u u^)uYjhbY[,u>tPZt@4$PX@4$SX^_ES9bSZYS^]_U%U%S^5}7cbjj5}7x5}7IW5}7>bEPj  }tChj_jZj u,jSZYuU%U%Ј贒SʗXe[^_]UWVS}11EܣT4jjfZY=wjSPyG xpu@4*u$tPV_XEV[[u4EPj ZY}t!hj`jju ޑVXe[^_]UWVS1HH;E E8u EH1LEL0< t tLEL8PuY$}1ۉ889E StZ9$PuSv O]1<%rA <%t)P2.< u"DB@C8Cuj PPS@ P 9T1ۉFADЋ(DB@ulD:AtaD\t?@@4D@P0ډ,Du,:t0@먍TFX4,!< uP2.DP@tC8u$C<lRpS9BËE YXۋplt 3F늅t 3}uW{DW! Xu#D4tRh@!'hbW%P(e[^_]8 UWVS0u 1EEEPVEP2 ] 1EԉE܅ukVhuW%E܍t0SE)Ph"V2 hW%S ƒE؀8'uE؋E؀x*hGx%u. ^_]EԊk<'uMCj'S6:^_E؃}u SUeY؉E؋Eԍ4Vu@E_ZRShW%j~ j 벋E؍J9d<%u<@Q)IB*B6j/V ZYDžtVo EXuЅt GE/}!ud_HEu虅 M܋}ԍYtqUĀx .tx uuWe uˋU;2tEԋEԍRUu?EZYUWVE)PhW%E܍DP;1 y;2tVCXuDb XtE܋M1ۉ}Whht@jS f}ufEf}ufEPEt|e s+}7EjP5}7Bv5}7O6Et55}7Dj5}75}7sO}7EEKEfmEURuuUjh@*.h ]u uAE@ uEÉESiESvXZ9}7thPjj}7t-9ut h/#_uQY 9th?P+XZNtE@tEEug9}7tSjPPt t h/#,_hPTND*.HD*.ZYy h@*.A@*.*NjC +_ #L9}7tS[}ter+5}7B5}7j5}7Mua@Y]܃Ct PM@ZuB@Xt EtVfe[^_]UVShV[ZuYtPEj.V5ZYÅuhVhh4虆 'hVhh4聆 hCShi4p e[^]UWVS֍y9sjʅta}t7E t/t,P2.DHuUQMu=5ZYMUtC)؃~QhW%PSF1E ؍e[^_]UWVSƉUMjjjà @t5$1UVjhj4V虅 VuSOS ؍e[^_]USPhj4hW%EPjh/#u, [Xh/#j, ZYttjhW%S` u؃hW%S ZYuhW%S ZYujhW%Sz` t؊t t@hSh`b4迄 u=X]UVShh4^$i4^$hh4h@a4y =i4tR)~h4.uh4Phi4AZYt+hhv%h@a4 hhi4h@a4 @a4e[^]UWVSd1ɺ!iu$xtx jPhh4ʃ 1ɺ%iu$xtxI jPhh4蔃 jjjà < 1jhj4VZ Vh8i(SMS ugL8P hPhf4 T$8PXt*hVhf4҃ hShf4ƒ B%Íe[^_]ÍL$qUWVSQ-T a4LCh X%(Pj y,D4t Ph>X%At [^h*.haX%0t jh.3Ƌ(Y1ۋ(?RXx\ZX9h[4%Ẁ YZPWVB h[4%W贀 |P2.PDžX@.XtIQD\$HDQV:] uHPDAu&XhViPj C iƄV:({:_Xujrjn[^TDž$Hjj$V(WhyX%b @u"Dž$ jjVWhX%b @u/ ;TshX%jPZYt,뱸 ;x|s:hX%jPY^u(hdZt a4DžLh jS&5P^_u54[DžL9 P‰f@ @ 9uhujjjjjjjjjSPjuH41ɉXTDžhjthPH;h uHiP8XZ{  a4hiPhj48 jhX%hj4Zt(jhW%hj4Z W%X%1DžPhX%j@$VjjPpPV` $@t puh4X!'hj4hp%h->jbt8DžpjpPjj$S*` @tShX%]^_1@1ۉX=j4su%=j4luj4P2.DPX(Ph!% ZYu7h$P6Z^_Džu\DžTX/1jv$X󫍽p!1󪍍pi[@u 1ɉ$NhhX%U_Zthhe4he4j=e4thhd4hd4hhY%hY%<ÃtϽPhY%j[h6Y%S[h:Y%S[h7Y%S[$hUY%S[he4h`Y%S[=d4thd4hlY%S[ hwY%S[Y^hY%S{[hY%Sp[S4hY%j^[hj4hY%he(hj4hY%h$SS4.hX%hf4>X_ZhY%hf4%X[^hZ%hf4 XZYh6W$hf4W^_hx#hf4WY[hGx%hf4W_Z=f4hf4hj4h Z%jxtnhj4h%Z%$Pj~ $-^$F4[hhf4hf4j~hX%hf41Wf41`c4hhZ%qSZYt/h"__t hj4hZ%hZ%ht1i `c4hZ%\Pj ~h\hg48z \i3j hg4>) th[%\Pj ~h\h4y \3j h4( t=4t `c4h[%\Sj( ~h\hi4y \2^=i4u8h\%Sj ~h\hi4Ay \r2[j hi4F(ZYt=i4t `c4hhh4^_u =h4u `c4,hP$Sx hhh4hh4jx`hhi4hi4jwJ,PSTY[t%`c4Tujhh4hh4jyXtjhh4hh4jz_hh4N< Z=h4u=w jh\%"P?w jh\%-wjh\%hh4w jhh4hh4j{hhg4hg4j}m`c4u:1ۉllPjI^Xluhh4h4j|*g4XDžDg4u DžD6W$h4=h4u6W$h4=h4u6W$h4=h4u6W$f4=f4uX%4=4u6W$DVSQRhj4Phh4hi4h"h,g4u6W$h4=h4u6W$h4=h4u6W$f4=f4uX%4=4u6W$VSQRhj4Phh4hi4h"h^(jjjO X%x P Y`b4Rh&$h( heZZ?HP/h\%jtjZ. a4_V=4h"h\%Y^u>=D4th5D4P?g hvh*.P'g jh\%j\TpV VVPh ]%h)]%S9T =i4thi4hF]%ST =4th4hQ]%ST hY%jSjk-S<-=h4"Xhh4hh4hj4h`]%jh]%hc4 hhc4hc4jjFj jhMh $V3M=f4thf4h^%VM hY%jMYX`c4Ltd迮SPh^%jL=f4thf4hh4hh4h^%VLhh4hh4h^%VLhY%jLXZhY%h_%YX@Ph_%jdLh7Y%SYLh:Y%SNLh7Y%SCL$=i4thi4h)_%S'L hh4hA_%SL =i4t_ZExN1jSEp` S}WS}Wttg`PR][^tEPPR跟ZYtU6K8t,K8u"E@t$RP]^_uh(m%EP<Y[tEXt p$l(h,`d04t:$VS\_Zt'EPV4Ph`%hS EpFjh`%:Y[@)"h`%h`%Sq@Vh`%We@Wh`%S譪$WePh}DS22SE?Ph a%v4‹ t ?tPha%P肩_Zu[h)a%P`ZYtލRh- &P> tjj hq#04,,RPj$W S8P2. tHLDJ@tSPWVh3a%hFP % k41󫍝DžƅDžk4DžDžShQVZ  k4f=tfyfl4f=NE1f=FX!ʉ׃11Ɋl4l4t 'w4$@'w'$@'wt$@(u$@| uu1Ƅ$jj hq#04,,RPjS% $PSVhAa%hFP 4J1󪍕)󪍕$R2ƅ(ƅ,J(,,f0ƅ<@DžDJDž('Dž$ƅ|0RhQ`VLX j!?jAm.jUjj hq#04,,RPj#W (S?PWVhMa%hFP/ Ljj hq#04,,RPj$S SVhց$hFP 0E@8@ue[^_]UVSPjjuVjjh!'|@tbux XtSjjVSjh!'U@u SY2hGx%S ZYt PuU ^Zu S[ hGx%j1e[^]U EEE EEhuEPOZYtEU 1ɉMEUhEP%ZYtE1UWVS`NjEw1hGc%w6 Y[uF h!%w 5[ZÅt#h "'65ZYG辟t똀\t @BJu Xt@w4@4$t)tVP҉[Xt@4$1҉9@4PS5YZtXP,40Sƒt/t#VRЉXZuTRY8puo$uVP҉XZtً$HjjjjhSQRPx jjjjhSQRPx ۍh~%S h@4PS^X h"Pm h@4PP3X W(R1^pT`~a9fhGPSW hwVPW ;h~%S hwSW h"S hwSW (uYh\a%V hVdW hwSpV PhB%Sk à ƅG1ɋÅth"St2ZYu!PhB%j à uhZ#SB2ZYth#S12ZYthR$S 2ZYthc%S2ZYthٸ"S1ZYtt hh`a% hhB%VcV hSVTV ƅGw PV謙à wh&$jj9k؍e[^_]UE1҉UMU ].UEEMU ]UWVSQ]} E10$hmj6Su Eea%4jRHDjjSRǃu E18‰uE@WZڈEV$XEe[^_]UWVSE 1ɉ1D󫍕D1҃=T45}7.nh@*.3 5}7=T4 GuujjRAXZ1Ҁt,DžfDžDžDž=v Dž1ۉ11119tD5fDŽ5DŽ5H5=fDŽ=DŽ=BC8[ty1t1DŽZfDŽDŽDŽBt1DŽXfDŽDŽDŽBhjjjjjjjjjRPj轜Ã4uDžRuh&$j@DžPS(tuiu5hjjjjjjjjjPj1ƃ4t@DžPV轑ZY^Hy VXSڜ_u?t6hޤhPh.P @4.DžM=T4yuT4Dž&1ۉT49i8511ɉ9=T4t9i854t(~SWQ,YZ[ڋ4@4ƀy1҉LPTXjSPO hCP@4"PO jShX4O 5@4,, 0$4(804DH$u"u $1҉DHQ,RPFP$@4()n,, 0$4(804DHu u $D1H$ T4HpuDH9jj hq#RPjVb jj hq#@4$P@ RPjP/ D48t$@4VHDPha%R_ @4$p~ơ@4$0hRRVP@4Pjj:5Dž1ɉ$Pj躍^_u65@4h_1Z7$P1$Xu@PT4P5@4 Pz^@4$HXDH-1ۉ,048DHƂ(48<=T454\44Ytu 4h£4a1X@_yuƆy$tP,40Wg$͋e[^_]UMw1vB ]UWVSDž1ɉ@4*)PhTb%hS (m%#t+hf)/ZSh^b%h豾 ju藟h!%֋@4Ph%hS= h!%Shb%ҍǃ(h!%ShbjlE0p11R ZYtsE;klEX{41 Ctʅtƃ{,tjjjRhRs8WPx {jjjRhQs8WPx jjjRhRs8WPxƅ,CP 1҃CLPQhR%hǃYcLu۝XZ=T4CLSSRVǃSRjj\0jj!6?$!'v=IC`,tPhwb%hV Vh}b%PL C`,tPhb%hV CXtPhb%jW WVoC\tPhb%jWw WVJST"t)%tT-$VPhb%P CH@(m%b%CX,tS\tPhb%hV Vhb%PQ _h%,b%hb%P. _Xb%2b%hb%P Y^b%:b%hb%P XZc%Db%ha%{Tua%PP ^_ b%Kb%:13(m%b%$tt1=161e[^_]UWVS @4*PƅhSc%>h"h#;蠆PhXc%j$=D4t"@4XzSPhqc%5D4^ u6h艚D4Yt Phc%+7 XZjj3_Xhc%WQ$@4Y[1D)SP-B^ZmPdR P,V dRhc%W#TPVAL$TH\@H1ɉD@9DtUh"

tm4]US]m42 9r ][]b[]À=m4tUjhm4jO> m4 UWVS jjj.> 1iPYSPj = E uYZEi]M}Ejh"Pّ uuuP tAEP2.DPtE쀼u؍F} tjuj\= ukWXe[^_]UWVS}19t2klwFLt#UFh!%PmZYUu NPy#C19tklGx,uHPC171u0kl_Uf%{Twbf%Ph"h,y%EP Ee[^_]US]1EPu V5YXt$UtthghRP^E]UWVS\}1󫍕E41҅ ƅjP_Z1} tE pS(ZYtbP,40S辴t;JP.2YtJG89wtjE@ aBujR_ZC411Ʌt $;] t t A܉t1ɋEWÄ hjjhh+jjAjjjjh.蘁4VP;w ExtSx u^~1;s}O19t }?;tBx(u PYFËEx uPZ&1ۋ;sx(u PXC1ۉ؍e[^_]UWVSu1ۀ~ tB~9s*ًx(u1;tB9uPXC͉Me[^_]e[^_]UWVSQ8ME111ۋE;Xs-E؋MMQrPEPL tu}CˉeY[^_]UEPE P0]UWVS}EjjjjhSuPRx u1=jjjjhVu WPx tVShof%hըe[^_]UE8b]UE$|4Ƃ@|4{4fP {4fP1]UEPE ]UE E EE]sUS]$|4)PCC0@|4R3 C{4C {41C1]UWVSÉM1u1sNуtX4tJ}0u%1Ƀs1t0uAqtJ EE띃}tB nBBXEEZY[^_]UWVS1󫍵HEPE jhjjh jh54jj jPSj}Ã8VPisS~1e[^_]UWVSZEZURuh`4PVSuhi%j¸$KEtVS艞 Và E)ËE9th?i%h"'h hVi%Ee[^_]UWVS EUϋMMjW Y[tK1MU9t FRlSVPNƃtPEV)XZ]e[^_]e[^_]USj$uZYtD1ۉ]XEPjhjjj EPSU Vt;M rj$S뱋]UEPM U:XUEPM UZXUWVS Ɖ1uP$kƅ vPhi%W( tPkYi%ti%Phi%kXZi%ti%Ph4薜 Vj&4W Hv|= a4uj{^1 .Dž.Džjhh^$ kPj(Vu1h4h.V q#= .u3h .hCN%ZYq#uV^%= .tq#VWRhi%h谉WSs = a4uj膒XDžjhh^$3jVj'U(= 4+=`4=4h j%Vߚ V h4Vh,y%S& Vh`4h 4hj%jڈ$WSho%jVhp%j讈V WSj Y^DžVj)TXZS=X4tZ=4tQ=4tHh j%V V h4Vh,y%S% VhX4h4h7j%2;e[^_]USڸxtjS艳 ZYuShQj%jʇ ]US18tjSI ZYuSh^j%j芇 ]USSJ=tsg1EEPj%SEZYtt`Huȃul"hv%hX t&jS hv%hYXKuhvj%jTXZ1]Ã=q4uiUq4p"K4j%<4j%-4]@$4%4rp"4]USE] tP:gYSjR{fXZ4E]UWVS18Z1Dž@DžDDž<jjl% h]l%P^_thgl%j}h]l%hl%`Lɲ辚}uuhvj%jT}Y[ju=XZ1e[^_]UWVS .{t0u1#W3OYZtWh&$h] ك1ujhXZe[^_]UWVS1hg%6JPh&$P) ytQPXHhl%JPh&$P xhl%IPh&$PЯ y6륋tPXuh&$h3\jj6'_xP蛠h6$R à t'^ySZh"PoXZ1ɉu|S7WAuh&$h3\\jjrRhf}#WP ZYu$u t*Wh&$Vm ShW词 u<=uDžS肿V|_XtqР[^u蹠ZYtCh0[jN^_u2脠Y[tjh2^XZ1 jh3h%]%衿薿苿؍e[^_]UWS]S 1E CM [_]iUu uUWVSW]S 1EE @u1ou tkl1ɋ}9x4uAl9ut؉KjlQ茺CY^t11҉Uu ;s'klM q}9~4ukUlSE@Ұe[^_]1UVS@]xu1EEEEu1EURURSЃ t1;EE}juuS:URVSPL uF;s rEtEȋỦEUEЋUԉEU؍e[^]UWVS]u 1V,ZtCڍe[^_]US]s 衽s$虽XZCE]鈽UWVS]1;3s8klCxdF@0 ttWD X9sklS9zduBd@1;3s>klCx4uFtWXF 9sklS9z4uB4@sXCEe[^_]UVSjhPju5t)uu P @u`0SכS0Z1 SśXe[^]UWS] 1Sh|duw t#S;S t%iSR3ZYt3(X1e[_]Uu hzd@u)UVSujhPjV[t(ju jPV)Sy y01e[^]Uu hedAuUU EHJ Ju BM+KQsPR` u&y q"Lu xtfa EfxNA t @fFFf9ߍe[^_]UWVS] u@(D=4u jP4XklhNA0 y8P41RPq1l'Ɖ׋lAdP9QhslhPPlRWVhm%EpUEXfC u> 4ufC ;^Q8tWRPQL }E8 4u.XfC uVhD 0 tfC txPTP41҉`dRPTPHL|]d`SQX\ˊlppX\uX\lt4PTd`SQsX\tj2 t j3ZNXtj4uu赗Y_FhD8L`}Du/E t)E8u!4uhM4ZE}`thMXGFhD0 thMYG@PtэL)QWNht18RЃSZ49sL}uFEt8u:Spl\XLHhm%Ep葡$fq#`tEt8uq#PEP4PSRRpl\XLHhm%Ep)8e[^_]UWVSXu} ]=4hL4PZY94}4hsL4PZY94}4hOL 4PZY94}4h+L4P[ZY94}4hL4P7ZY94}4jGK4PZY94}4jHK4PZY94}4jIK4PZY94}4jJK4PZY94}4h_K4PZY94}4h;K4PkZY94}4hK4PGZY94}41ҋ;Q$s+k UA(0JPZY94U}4Bʃ4F@ t_u {4 H H"LE#U qEUt(xt hq#54hn%v跞 t85ļ4P41RPs$s RP5 4S4C8u%uh u hI_hPR>Y[P545ļ4P41RPss苅RP54.5ļ4C S$CS P41SQRP[RP5454h+n%v貝P 9u1C( P/IP549u!SH1BLPIP54#9uSH1BLPHP54l^u'CHpX5454h9n%v  ^uCHp\54ρrJCHP`u&hoHP5454h"n%v賜OEERh&jP h5HURjPcà P5454h"n%vhS.cfx5454hBn%v6CH@HthIn%vXZCH@HthPn%vY_CH@HthYn%vXZCH@Hth`n%v՛Y_CH@Hthln%v轛XZCH@H thtn%v襛Y_CH@H@th|n%v荛XZCH@HE n%FEe[^_]eIuCHP5454h"n%-+{jPMQKQWsPRdk B(0F}WP54h"n%v0e[^_]UWVS] Ep+sk H(L9t[Iw`hWKQVsRPdhWWjjjj@(4WJ8WVsPRp VsRPh 1e[^_]UVSu hSP t*hSSjjjjhI SPXZ1e[^]UWVSu jFHP}W\ jWWjjjjj IP2.E܃,11ۉt}DW@uu@tA~Ht҈Uth#SIZYUu GFH`L+/tG/jSFHPjSW FHHL1e[^_]UVS u vDh&j ]S膈 j SSjjjjhH0SFDVHB`1e[^]UWVS jj%/[^8hLDC %:h9DCC%:h%DC C,%: E1҃t^tZ %'tOE4F %:}Ou/UDEjh3}EZYUMB"t}$vuhCF %:X}$thn%h#'hhn% jjjjh9hjj jjj%SjM+:ƃ4xu P/V ;SMe[^_]UWVSQE @4tt3t.t)=t" u E x8uu u\XZjj 荣^_x 1҉j4$'UG y;UBXYu؍{sheBhYBChLBC h?BǃJjjjjh;hjjjjj SjM8ƃDxu P.V9S1e[^_]UWVS] B({119tuklKI0΃@jj hq#BJJbRPj!W jj hq#CKJbRPj'P躅 8uth9AjPPV E@ tPAjPPV q#u h@Xp@0@'QWMQVRPpjjA)ļ4,jB@SPhց$j -Pk ļ4jC}@SPhց$j :PI ļ40j-X@SPhց$j GP$ jD<@h,@ SYÃs45Z£4Tٰ-LƄT 19~-@Vhn%jPh4蔃 j.?h4P5454GP:P-Pho%hh 4F Dh^$DXe[^_]UWVS] @4$DV跲Y_(V胵0(C<@8jPŸ@ x 189}gGu CP@@<2<9s SklLT<R+A<Q@+QP$@ 09ȉЋ(}fF돋<@} Ehujjh>jjjAjjj8@h4E4URP*u5@}j8H襞<_Zj 茚$^DPRH04EZ1ɉ(,~!klSLQA<Q@(,1@8048;HHD88`VpWRLV7uVP 9jj,(40EU+04RPjPPQ,PTEUjVP @V PRLk@8< 󥋽 x08x4@u}u} 40WVv)׉(,8E@@PEp蕝_Xs$Ep@f E@fx@CklPsQZYVCU<8kl4@0E@)Ћ@)P880PyoCUk@l( 9s)klPVPNo 180(󪋅<18@98tNH0N8HV@8 QPWRL B r0󥋅PHDž 1jjjjRPRPjPQ0Hug $(,Dž<Dž@jjjP84P@L PT} j jjhuBh'=jj7jjjjF,ƃ4PVH"КV-E)PB89B4<PZufLW WPF8PP8 WRPQLP $AhUMhrjJjjjuPh 4"C(4ys$1ɉK$[1\E<M@C,Ss(,XZ{, 3CE11}}9}tLk}l{G0u:8t4GLt.MUGh!%P}ZYUMuBy GD tO@E묅u}u4V%_ti[Jtyp*Nj0*WPjhp*Nj0*WPjh<VUYu(VGZuujV^_ƃu1s$蟏1C$s(K"C(ZY1e[^_]US]t*h!%SuZYtj/S ZYt xu]UWVS]u}Ht1҉t1E U EU`#'E<4=Tu=8 =T=T=4Xh4 WtLWlEURPh h4uq= <W91EuPE!UMjho%h4, MUttq#+="4)uUMjhβ"h24v, MUuQ4 u ƀ4HFu24tt 34'4= 8t4=T;̈4u4; Ȉ41;̈4u; Ȉ4utt4Uh 4É$h 4UR+ UuӊtY)׋89Ɖ<}&8<)489Ɖ<|@98<}0+8<09ȉЋ } 8<9}$ uj8oY (,Lz4oXZeY[^_]aUWVSu vv0N ^$ ut"N^9ȉ} )ӉN ^$1ɉN N$FV1e[^_]ÍL$qUWVSQLqyA Q04AQ@DLP@LCS $WVSP|+04׉PTP4 uPT1ۋ04@DSQ8 jQX t7@DžtG<%'tWZ맀tjVW| VWZYt{t1h c%Xe[^_]UVS19tklqFLu@u19t$klq~,t@9sklA[^]_[^]UWVS<Ɖ@4t/)t&jh!%hxp% DžjjPPjh0.Iu@tDu/u'@.Pj)z[_@t .h.j*@4Ph&$h =.41h!%hxp%UZY@4t )uVo}_uǀtPPSo tҋNA4jjjjhVq8PSx 5..4%'hp%hS0N WVShp%j_*(W[oYhp%jXZe[^_]UWVS|jPuM_Zx1ǍxPWxY^xu t WNZdhVWL =uWMXf}uйfu󤉃EfǃU1e[^_]UP- XUShEdjjEP]Shp%軖 @t2h$S0ZYu L4hp%SZYuL4]UE]|UWVS41ɉMԉM؉Mܡ@4f(S$}ЅjjjPOÃu1@4jjHDjjPEЃt̡@4}Љ$KS19};DH} DHEȃ=H4uajj]Sjjh(.qy1udH4Zuh*.hp%c ^_jjSPjh(.Oq1ۉ]5H4Eā 19U~UVu藏ZYËUBTtUكup@4840hak%hEPEPEPuCxtuuuhak%h15P4EPEPEPuCC~H4wL3Mhh CSEȉUjheRP:=Pusss shq%hX (hdMĉ P4hP4j, P4u/EEԋEE؋EE܅t+EPEPEPu&APUԋPU؋@ Eܡ@4$tuuuR@4,jhPa@4$tIytCf(u9PG[Ht'@4$P@41҉$Yh.hT ^X]9_~GL H4AEȾe1Puqqq qShq%h EX$뱍EPj-ZEZYDH4DP4se[^_]MUWVS5L4t/uwjP,P SithjXZe[^_]UVSE X(uNpƋ0VPsjh{Sà uhjjs ؍e[^]ðUE1Ҁ=L4t]f]UE} t=L4tA1]U Dhq%茎h)q%j#EjjEPEPjh0.m$@t"EUu=thjq%j?#XZøøUWVS,]EE15H45L4uCSEUCSEUURURSЃ tԡP4@EU @4;\`|.}t1hkjؒZYuEP@sKut9։}ȉH4L4 5H4 L4EEЋEE̋E E11E܃}E,1}ԊEZuVh&$hq%dSbe[^_]UWS0]}ȹ 1E1EEE =L4ujjS)@ jP4E܍EPjS@e[_]UWVSM 1@4f(uD11uFu@uGN t Ƅ[^_]1US0]U t/MQRSPL tsuuhq%j]UWVS4}=L4PklUVE 0U`ZYE UlVSClP211CC,C0CLCPCT @4$p( u1;~ sJURWVPL t5E؋K,9u+C0 C0E̋UЉSEċUȉC hf}#VK ZYS蟁$Sʂ t hV- uE<=uVKƄ<$SVhr%hP> 11_Xu5WShr%D4 tYWShr%PuC 5D4%_ W{<$mZYv .8..="FtPVZt F9F:Ch4h4h4. 1@.Ct@t!1C F z~uʃ5}7(fjj5}7=5}7[5}7fhKjjhxhAj&jFjjjPjÃLPSS e[^_]UWVSQƉht%)h"P= uA=D4tht%Pht%5D4t< ht%Pht%ܩ /OuPh u%Ph;u%2 _XVhdu%S1< SW]tht%hu%Sj ht%Phu%Sjht%_PD4ZYtuVhu%P; 5D4pWujh"VTz VWX1e[^_]U1ҋE]UE]UE@d]UWVS$E}Ѝu1ɉM] u]u]܉uu9u]{ u ;}}w1] 1ۉMԉ]M]x(Ã}t*M 1]1 uM ]M]U9uU9u {;u U| 9u܋U} U;U UU|WU9U܋U]|G9u9uǀǀH vIH uԋ}p x$]C 1҉EE$[^_]á4"UWVSXE؉UȉM]E EUE} }}$}}؋wu}9UM}։lj]19؋]| E1ۉ];EE}LuuWV*ut4EUuuWV*);uE}u}]؋EUCSE܉U1ɉM̋EUEUE9ƉM ]9]E؋P@MAQEUEM])M]EE1҉UЋM9M+}EԀx EEԋ@1҉MM]]1Éً]1Ӊ]ˋM 9u]9ƉE9Ɖ]E9E܋Eu};EEEUuuWVA));uE}u}E9ƉM1EEO)]9؉ӋM}EUEЃEE9EE]|Eȉ0xUMPH EE̋EU׸;EEu}uuWV();uEu}E̍e[^_]UWVSEU }}u}M] M]M$](M]M,]0M ]$M]M]M]M]u} M[^_]UVSQMAQuRPRPjjjjO IuEU11ҍeY[^]UE]US]shu%ji ]]eRUWVS]} j/W ZYƃth)PCDPWt ƒuMV`~Dr9s6t'19ty u9t@e[^_]Uju EDPCHUEvPEDPu _ UWVS]=4u $4K$9C |b549s sW}jjjjRPRP t39r,1tu{(u t @9|1e[^_]UWVSU}119y u 9;] u}t uz(tt}h~t[nЃu"9uǂǂ1J Z$1ɉƀJ C@]tu%1e[^_]UWVSU@11B z(tBBB B fǂ[^_]UVS41ۃ<`''t,jS3FFXZw%'C "uʍe[^]Ã=4uU4]ø4UWVS Uu}E EE9E saE11ۋMy u9t 9] tC9] r;@EM9|ۃ}tMa}w}uWrV衕 0}t.1HR}t PRhv%PRhv%WVe- R}t PRhf%PRhf%ԍe[^_]US]uh%hP&'hh v%ysUNX]]HNUWVSÃ=4un419t/@ "u 4419tp4x(9uB1[^_]UWVSu =4u U!4E1҉U19~\UE]FPv(,uutu Ex(u}t!C;4GUfˉ}FFN(1tF$1Ft 8tjPkMP蟓 kMƄF uF }th{UXEEe[^_]UE>U U]UWVS]u=4u1҉U1ҋM9bx u 8D;U +}ߋE싃E苃E}t }u{(u1+FV C S$FFlN(1tF$1F,MPFtk9t jPR( F tV"}uM9MuǃǃFt$9thVv%h&'hdh v%yvF t'uBK 9M sM 9rE1e[^_]US]=4u!w k 4"1;4s k44C([]US]=4uS1w%'E[]UWVSSÉU=4uv!v=4 41k 4B9tp4;u(}u1BRQFZYt44k44B4V 1Sh&jRUc( F hst~ SPh%jWC( F'F(UV,~0F((e[^_]UWVSPu]=4u1E1M9z u :;E  1}1ɉKC1C CkEt CCEC S(‰C$EPC,}u uK9Su;u tK }u0~(t*u!K @N 9M sM 9rE1Z[^_]U1ҋE ]USR] j EPu9 U:tt htX1 k]UWVS0]{Tuhv%h &'h{Xuhv%h &'hh v%r{\uhv%h &'h߃{`uhv%h &'hȃ{duhw%h &'h뱋CjCDPV֍ u h w%V XZ{4uD1ttʋ5P2.DNuT4@׀{4ujhf"C4P6= ؊LD tB:u JND Ph)w%W h"W^* ƃiWh;w%jlPhJw%VlsXs\s`hnw%Vk,Psdhw%VksThw%Vk19aW 4`''PwP7Phw%VqkG P u"OQPW RPhw%VDkH9~hw%h/#VkZYZhY%jkVRDPPVhw%hw%jÃ(V蛪Xe[^_]UWVS@E PẺUЋE @EE @ EE @EE @EȋE p@ E1ɉMMMMUjjuujjjjE u}zhM]EUEԉU؋EP@9ȉ|YtTtOM܉]}ىΉ߃SQWV)׉M܋]))EU؉EԋU؉E܉UU9UEU} EE܋EEE̋UЉEU9M̋E}M]ċEԋUڋM̋]M]9ȉ} +EUĉE܉U=4u 4E1҉U19~W}]Exv(*uutu Ex(uthujjhjjjAjjjRVhE4URP腵uV .}51Dž<Dž@;us<`RVSPL t$hl`d<@FjH7)4A Y^s1҉8,0$(8;HD8ȋ0`WpVRLW6uVS jj@<0,EU+,0RPjPPS,PTEUjVS4Q 8 tIVPSRL$(u}u} 0,WVV)׉<@8ڋE"C t @]fCEf@ DPU1]1EEPVJXZ}y1Q1҉Tu1Hùxt%| q1@ 4SG0|GEE;xrB;Us E11ۃ}t E;]sP7/C_PHYV5p46XZ}e[^_]UWVS0EDž}uEl4jSuZYt jSa^_uY13jS:_Zuu[^ƅ1;44} tE 9duE(u)tURYu0;$s{ЉuE, EDEHʋ9Ɖ}fjj hq# WVjWhpƃ 3WVPhy%Vt VO Nj8ƅ3ܶP, Nj8XZЉ8@ ӻVw؉1=uRhnFjj hq#EDUH,,RPjWuE$hoRjPHV <$;Y;L9  $eVP| V;pf $Vc $S;[f VC wW;Ã9r$hy%h('hh}x%EuZ1hjjjjjjjjjPӫÃ4tPSi^X19s 419t4@Y؅ttWZ{ tS&Xe[^_]UWVSljfDžv/ƅujhv%Y^yhhv%S_ z躠t&豠8t觠WPh,y%hS hWS_ =Džp!j/S _Zt.xv9tH9s8/tQf YyߍxPW YZ%=pu J>hQW/ iƄ/u%谟QPhp%hS $hQS^ =@uW'f ZuhWPf^ =hS臭 Y_1Ҁ;/u 1Ҁ{‰hSj8p<$V8ZlhЃpDl=w4uhh!%S^ =whWS^ =v H?V9 _y HVYwHV8 ZVcHX1e[^_]USÍEPS菴YZy1]EtjSXZxj `PSm t SYSv`Z=vf u]UWVSEUP?A ^ƃ}t11ɉMVW Zt{fx vX jhy%S8 uSuh,y%EP @u h3#f 3Et}tESWuh#y%jcuc[zV4 XEEe[^_]Ujh*Ija UWVS h2y%411tY+ڸ;y%xuڸFy%tu#WSڲXZuWSƲY^1yahFy%hPSX[ WS!1u hLy%蛜PShVy%jdShby%j4:hS蠲hAy%ShPPZ WP賲u'hly%SӛPPhVy%jhuy%hPSZ Sho%jtPhuy%hy%juh3y%S^hPWJZ hy%SAPWhVy%je,hy%S%hPWZ hy%SPWhVy%j2,h3y%SPhy%jMhTc%SϚPhy%j*hy%hPWY hy%S薚PWhVy%j(h2y%ΚhPWeY h3y%S\ythy%S= Phy%j_ hy%shPW Y hy%Sp14.Ph,y%hW ttpWhVy%jC utjh+bFXZte[^_]UEt4fP]USE@k `('t!`('ShWE 0"Cx4 ]UWVS$h.ƍPhW@jD"@1jhz%}_ZRhW@P! 1ڹ`('1!tT9u Dž0AVP3ZYu=t4B G jjjjhjjjjjj!ShÃ4tj"PS觗SgXe[^_]U辗x4tPPRRRhz%jUE 1҉P1]UE @1]UE @1]UE @1]UE @1]UWVS$pxЉ11)ӡP41RPSQ+RPh;$j]S ]Сļ4Eԃ7x6P URjP91ɋu ;Nsklu ^c0AO0}u}u ]u]uutu9]}UEG0uW+EUu FV}t ]U]EUWE `1e[^_]UWVSd} E@9E Ek] lEpF0t }G؋0xxPuAyރWVh }%j&EP Kj#PWVh1n%j&EP ,EPP41RPWVRPh}%j&EP }G؃x,u hg迣Ph}%j(EP 3P0t0pTpP P}G؃Phց$j(EPZ E-xt.@Lth[P}G؃Ph}%,1 t-h.PE@Ddph}%j(EP 1҉UH4Rtu}GpTpP[E^_@8tPQ҉EZYtыE@DLt$h财Puh}%j(uV uh萢URjP4EMYK0+u@u={8u PREPh"}%Ept uOX} uEe[^_]UWVS] j){X1119tklKA0u y8 B݉t+ut8j,跡j+计SPh%jPV 'tCj+菡jPPEP j,jPPVaM h/#Xj*bURjP5h^$8ļ4j-0 tfA A VB}lj@*'fG G5GG G,G01G8@Ep x$+s{ 1ɉMM;H s%MQuPRL t Euu}EыK19tklSB0u+2z@s{~S(xE+C$PR蔖XZE+C$e[^_]UWVSEU΋}EE1ɉME;E k]l_C,EFU;uFt8tKQP'YZuk{8ueEC8EC4FV SVCt~8uklHCBVPDXHXXe[^_]US]5}75}7YX{$ujCPC$XZC($h4jjhgh'hRjFj jjPs$h4yC(4ys$1҉S$Y1-C,SP]os(zs$C(1C$C,]UWVSuV[t$V"Yt&jPA S uue[^_]}hjXZ1e[^_]UWVS@4$)t uiVu`j(PjRƃu1O@4jjHDjjPÃt͡@4$3t j@4PLSЉƃu11P;^ s-URSVPL tEuEt 8uPC΋@4@u <@TXuuDHTX=T4pjj hq#,1ۉHL,ËHRPjXPjj hq#jhj^W8jj hq#jh0jdSpfH 0T@4DP&$WXRHQDjP p H0SWXWHRP@4Pjj'm(h^$0lppltDžxDž|}1 EPt!EfEEjEDžPf@ @ @f@@@ f@*@,PW=4v~(u@0f@:@119~.u2FN<uF EuPEXZC΅juɋEtY_1}z 9u}Wڹ[fB EB h;jjujjj(jjjuSjsjƃ4uP`VXkSEEEe[^_]hj XZe[^_]UVSuE ]wi$,'hDs A[4hE2[8P@xu!h#P衞 XZ+jjjjhQWRЃ tQWRPLt tt 8thhIl_詵‹ Y^tASRPh.~%hS @jى$P҉t5hh߬$W hRW hh &Wo $@j1S"@1uDHM] 1ɍe[^_]];ƅsh%W( S0pƃ 1z t 31묃u1돃ty  ?VI$$@c)((A6,,B 1ɉ Pho#jSi jSSjjjjWd0St ZSe Xe[^_]UWVS(]}h#uV 4XYu81ɉU.'M`PDZYU9‹M}ƒ$uӃ4} E $-'h4_ Wtjj__h5ku2P41RP hRPh;$jEPK h6&tjjI_Yh7u)tjj_ZPh&$jEP h8t"u ho#jEP蹢 h9t"u$ho#jEP脢 h:bt"u(ho#jEPR h;0t"u,ho#jEP h<2^VP4Phn%sye[^_]UWVSX1ɉt @@44t=$txuP1$Xytƃyjho~%:_X=44|uÐ Dž814ktƒ8C1;8 8/T0 RPh,y%hW٠ 541҅t4҉uFWPZYu Ɔyȅ4ƀy1LPTXƀ);44ǀ,ǀ<jWP/ hW4"P =4u/41҉4hӸ4aljY t^4tByu/49u4ы9u􋐀뺃:54'xk<ǹ1󫋅PB JsC )t C8$tC81$u19;x sۍRPPL tO@j$xustj_CBk<y׹󫋅PB J$CsC C8RPL u;x ruكtЋQ__k<y׹󫋅PB JCsC C8ci1fD @9s=4t1.'󥍍P{_.'󥍝PًH^=4t_Dž DžDž41҉0.'󥍅PًY=4t1D.'󥍍PXX31B 8T3B ?G4y @HfFe[^_]UU J E] =42UWVS11ɉ4PYZN418t=suB89J4ƅƅ{@14k8|<teD@Phw~%jPv4Ph~%hvhh~%R  h4PR F8y4D(~&Ph~%hW˙ hWV 4D,~&Ph~%hW蘙 hWVv 4D0~&Ph~%hWe hWVC P4؃PVh~%hru1Dž884kt1;8 8tuÃuT4B1LR) Mh4jsjh:h}C,. VSXh4jsjh'hM(w&hp4ssjh'h G+we[^]UWVS]}11=4t}jh"CPu ufK04|tF9Lu@‰4p u*Vh%hV P@?jh"V u3Vhρ%hV 0|1jh1@$V蹽 u$Vh߁%hFV uetV1҉POjh%V聽 u$t9VRh%hUVh%hU u ƃy1e[^]UWVSt1=$.t=4u hpj2l4ZYu14=4th8j 04^_u1ɉ 4=4u jHjߕ4_Zu154=4uX hj谕4ZYu14l41҉X4P4T4p\4`4Pd4h4041ɉ 4448 4$4P(4,4415<44484H@4D4PH4L44414444B 481=4p4t4tx4|484414$.1󫍵MVhjhh!hgjRjKjjj@PVh#*ƃ4u 4w1=4芙蚥SVV* =4uL@4$t>4t5xt$h`3jY^tjjXZǃ=4؍e[^_]U=4tuh%jPR UVSuu1r$ugjjjVcyÃtjjHDjjFPt$@4KS;DH} DHe[^]UEx8th#h.'hm h-%a@UWVSQ} E@E19u~aEX=su8u?G8.=ru8u/Gx=muWsZ$tfc fK F뚍e[^_]UWVS0uA_Í}Ĺ 1S^uċ$br$zuubPCsYtWWPZtNjE@ u WVX_XWPV tjVSnE@ t VPZYVXjjS;ƃx4 e[^_]UWVSuXYƍ}Ĺ 1uVZt틞$S_xt,jjjSǃtSYt$SPHLPd 1Z} w#jM .'RjP8x u0h#h.'h h-%R1t4Q,1t9E t @11tt:[]UVSQMp@19|h%h/'hho%9ù|@89¹}@1ۉȉڍeY[^]UVS]1C49C s8SrY;C K$}'ujjjjRPRP Ɖe[^]Ã=4uUhlXUS]=4u1;4s k<4[]Ã=4uU4]á4UWVSSÃ=4ut=;t645419t$USF PWZYF<ɋUuG1ۉ؍e[^_]UWVSSÉ։M}h%RZYuj juyC,S0h%VY_uj juyC4S8h %V_Zu0j(utY^ƅj)Pmt_ZFh%V耡ZYuEh%V`Y_u j(uh%VE_Zuj`u@S Oh&%V!Y^u>h%#EP}> XZt(2'>ttVPYZuG C<e[^_]USPQRh2%EPj6~-h/#ukEjh/'Pןt2uw}[1Ehf}#EP= XY:tjME+[h/#jkEZYuu0}X]UWVS1jhPjEpoeqÍPhd@Sۍ @SS \EP,[1Dž Džƅ ƅ tpÃuMtGutЃ ) u DžuЃ A댋Ex@uP@4tPhU%P ƅEpPh\%j6\E@@Ep0Et(pv0v,hm%j6V{1ɉH0X,H{09L;C,P{89T;C4 PCPH ^_;s@\PV5ZY{tރuVtjYj jVki uj jV"iTuj jVi u7thhGx%P裵 hVP莵  sh)<$V跐ZYuDG8PW<G4h7<$VbZYu)+h<$V(ZYu)j h/'V thjPh^Xۋu0lY19ȋWul[j`RC@P$ C,S0C4S8 u+t)CQ RPYZuƅu_, G 1%E u G1ɉOOO_O _$UWG@jhRjPSƋG,ÅtjP4tKRPPs0s,Vt'8t"P? PXZ@8u ǃC4S8)G W$q1ɉSh|dV{ iR&bZu]jYSh|dVL{ u܋1;s̋tpH,9H0u0;u"H49H8u;t밉jSP脰 BrVHZ1e[^_]U覝1=4t =4]UWVSE8}fHfMfMfXf]f]X]߈]X ]P Uf@fEExstExlK1MjQk2'RU U؍Muu ru袯 Fu1MjQk2'RUr U؍MuZu ruW uPEPEPEPEPEPEPSEPEPEPWh>$u uG 8 Fz밍e[^_]UWVSu] t>u1}ZEPEPEPEPEPEPEPEPEPEPEPh>$V4 uAEyƒt ƒu&UUSCEC EC fEfC1J1Vk2'U荊ZYUu$2'}EECEfCGue[^_]UWVS@utc2'CPCPC PC PC PC PC PCPCPCP3h>$j@}WE 8ssWփ 5'ue[^_]UWVSEUM܋}EEۋM );} GEE1EEƒ< ‹E䋀,uF;E9r+F9s,t }P;U u)9sE䋘0 }t%0tt13t]ƒt<tՋ,E39Et:ƒ}u9r&39s#P;U sxU9sډ)9sу@uEE}t(}tE8}tE܉1 )1[^_]USMU Zyu t tR9Qr[]UWVSHXH X$1ۉX p0uu]9]E}u1ɉMUtj}t}tуtat\@ uуt=t8v1]9]t UrH X$9} 1҉P P$ )H X$EE}u}0]Q[^_]ú=tUwB=tGwH w8RXs.'-v=uUWVSUM119}uP0uQjVRjGуtux`ڃuV]0]}tT1ɉ]Ut4u9}u*uu}7SjQWuPEЃuGAuFA1e[^_]UU 1tEMh]UEUUU ]USMEX؃< uʄt E0‰[]UE1҉UU ]U EEEEEEEP&U EjUWVSÉЉʋuˀ{u,C { K?H} K.C { K?H} K KI1ۋ}_ik?19Ή[^_]UWVS u]}1u܉]EPU Zu tXQ%PEUEԉU؋}uM9u džN,t1uuuuQt1e[^_]ÍL$qUWVSQhy}y}y }E1EMȍEPEPEPUE_E @/EЙ]u)։]u]uEEMԍEPEPEPUE @Eܙ]u)։]u]uẺEuE}ƉeE؉U׉֋Ue)ӉM]]ȋEԉMϋUeƉωؙMʋEE)׋EU t2 t,EPWVuu3.EE}u u}tE}}4E؋EؙRPuu5EU@4DH~1ERPWV5uuRP5EE]ÉUӉыUe9E1MȍEPEPEPEi @tKE=A}Ẻ}UeʋMЉ;U;EFuE=~]E}8E]1 9[YeY[^_]aUE]ÍL$qUWVSQ1A1҉U1҉EUF0E؉E1Ɋ t,}uÃt$<t ,}u9]t@u0Eu1M]ƒ< RWvWڋEy11AtE1ҍeY[^_]aUWVS,M$](u,}01EEEEEE1U9ЋU| E1E܋EE19M}M9Eyu1EEU ẺUЋEH9M}GE;E]UE0juQu@M]E@E1;EE }Vű}΃Mu uWV 1);uE M}uu)9s ])] 1҉U111*1҉19]]܃}MM 1yAQ Eù19Ee[^_]UVSEP$9p |$1jjjjSQSQjURP),1҉Ѝe[^]UVS]U M1k N( u4؄tfEB 19EtJ @u,1u.R E@M,9du 1dd[^]UEUUUUUUEUUURU UEUUE1҉UP0UUR1U }UEUUEUUP0UURѣU LUE1]UVS]MU2U k V(u؄t=&ukE U1uQЃ<![^]UEUUE1҉UUURiU UWVSÉ΃8t2$41jVR $Rh{dЀ3jjhPjRxA@ue[^_]UEP0RPfUWVS]E EC0E1xp@u@4Lu䋀PE19uuE1tr}t[P,}u]9UuX}ts1t@t 逌}WuS yуtu G{0Ea;hhZYohS*ZYa }U׍e[^_]UWVSEX01҉U1Eߊt]t}ttR<tNwtw A,<vxP6W/=u7sE@,9uQVP3 &=t1skE P3迗 e[^_]UVSuE =4uh4X>y 4CFU,U9u 4@Ce[^]USE PMk K( : uBu'@ ;Et0j RkU PF 1]UVSUEu Nt+t6uXE@VvpSFFD.4t(vtvPS艖 e[^]USR] = 4u0j EPu ƒ =w uE8tt hCX1kD44u]U U1vEEUEPnU E_ZÅt*UVS14NFZuSNXe[^]UWVSQu>xp19|hƅ%h$6'hxh%+z]9|@89@|ue[^_]UWVS0uU=@4]ډ@E =~Mȉ\1ɉ`}ډ1@8;FF| FP1RP|~ tlURjVPL tYEċUȉḾ1ۅuBu>dž9|Ӄ!!ut9ȉ׃}vjhve[^_]UWVS]`t0`󫍓0 Se[^_]UWVS4E }uthф%h6'hh%8xhjTH^_6'u CEUY~11ɉKKCSƉ׃s {$Cǃ?ǃjh>RP"@ǃEPu^_t!ẺEЉEԉEȉC1҉؍e[^_]US]= 4u]1Ҹ; 4s)=w9t kD4B1=w kD4[]Ã=4u ^,4UWVSƉ $41󫋅 EU RPVhÂ%h4P) E jhPjVU3xShydP[ @u V)X1V)jSui e[^_]UWVSlu] E EE$EEPSV EPډXE8t%E8hޅ%h5'h h%u1~,u3FuuuUM uxMQWPRL u GF,;x rËEċU9Uu;EuE̋M9Mu;EuՋF,MQMQuuuuWPRxà Y}w}u }t#1A}tPh%%uPu "}tPh~%PhZb%uu' ؍e[^_]UWVSHÉ1jhPjSZ1J1Dž11҉1ɉډ1ۉ؉!!ׁuO1 RPh+=fU?XqWVSK+9u)9u!V!ʍ4󥉅SsGX99;ƒ<<„t <uh0101ff=Uuf=u#(,D1ɉKu1󫋽{w%RXuX tHtt7tqiEt,EPFPVC,1RP4P P~ 돋t6t%C,dDž $t tx9,sbthjW@^Zt31ۉ Dž1ɉ1҉Jx #Xu&1󫋅fǀUe[^_]US0E }uthф%h6'hh%^ohjz?XZE u CEUY~11ɉKKCSǃ?ǃjh>RP:@ECǃ1҉oK0SUE Z@u S?CX1d3{ uUC$9K }DURjSPL t1Mt*419t @D=u=u S뙉؋]UWVSUMtQ0t),0Ut,]))111҉XZ[^_]UWVS}UM] A<t <t11É1uvB? ڈ49'fDžU1 WV)Ӊ1!!ډuAWVhP_ x30 14^uPF ƙ9uK9uCH!؍SƃSf<Y9k9_'{X؍e[^_]UWVS]Euh5%h5'h .1uEE}lj1Ʌuh%h5'hh%Hgs{u}Ɖ 9uE}QRuuYK0S[Puu e[^_]UWVSÉЋ{419tBDu3{u}s{ u}u}u}v}t 4M1;})ωxMH PC u h"kE UP XZ܍e[^_]UWVSE }Ĺ HUMx}}t}1҉H41ۅuhI%h5'hh%e9tCDuu}E`%}}1uuuuE1} u}w2t tu'}\JM1ɉMr1u}}}E}u}0}}u}t7}u }|ڀtu(}E}u }E}9}}u1UMUMUM}9}}u P @|UEUEUE9E}}}pEbE`Mt:EUu9֋}|}9֋}}ً0‰EU,Ɖt1xtx}9ЋU99uE|{}EE,EujSUr }4u9P7u 4XZm1hj63E_Z EfǀUƀEEl1ɉpplxt }9}u|H1+EUẺUЋ,E,EEujuUs }t'4}9ttP6u 4XZE0qEHEUȃƉplRP )׉E9Ɖ}ME,uȋU)Ћu}ƃu}|U9E}}EU+EUẺUЋEEEUEĉUȍEujuUx }t'4u9ttP5u 4^_E9uh0u_E,9EE}Khj+1ZYuEb4}uu,fǀUƀ0Ë0}00UMыE`M]}v*}}u }t}iuM9ʹu}UUpx u}EEMEjR}wR‹E@vM1ҋu9Ћ}_EEE1}$tuVME]1uCu}ƃuuWV2 )׉u}9]EM} EUEUE1ҋM]M]9ȉ} +EUẺUЋE\EUEĉUȋE}EuuW< }t2EED4u9ttP3u }D4ZYEu0h'jjP!1}?t;_u}E@Eu1EE1}EE1Vt_}9ti@уtuH}0t;1Ɋ_]ttt}t9}t#@AuՋ0U9u1e[^_]UWVSP]E EuEE}t:C,u)C0E1҉UĉUȉỦUЍMċUPX{,4}u1( 1}jjjj1RP1ҋ};}ERPjEPS,tEؤ 5EUEĉUȋEUẺUjuVSUEaUċMȋű}Ѓ uEYUċMȋű}Ѐ}u.h`&'sWVQRUMs''C,UMtX(C,u 9}8SjWVQRs ''C,tPC,e[^_]UWVS}Ĺ uE0xE0EEH419t@D=u€t E1ɉM1Mtكtu‹]9] uEE@uȃwE9t}h=E]1ECƃuuWV)9މ}u}1E1҉EtqE9E E˃tuSE`tF1EM t}tȃ<ttE9E tw̋E0ho#jP]S@ jPSSj SR4 ƍ@[=wʡ@4EHDEU}~ E1ɉMRWuuSVRPމؙ9Uu9]tAˁ~ƉЋM\1҉`@EWVSuE E0E8e[^_]UWVS]E EEEEEܡ@404}81HDEU}~ E1E}u?9}/jh>uu=~?EEEUE܉0t}܉}UU}} ]e[^_]e[^_]UWVS ]@4480hak%h}WuVEPS$xuuuhak%hWVEPS>tuuuSЃS\e[^_]Ujj Uj j PUS7WPG$q#PSh܇%h*.[ j U=(.u E(.$5fPftP=Z9(.UWVEE왉U1E}ujEPjq e^_]U0E E1EԉE؉E܉EEEPEPuVƒ xEÍL$qUWVSQ@@u5jh%5菐 $5%5$5$5$5$5XZjPX $5$5$5$5+$5$5_X%59}9$5$5s7$5󥋅$5$51=$5uh[jjE.t!jjjP =$5uih1#P) $5Y[tPh&$hP x$5$519߭yP-&ݝ݅ <-&߭ٽf f٭۝٭y1d~dVhǿ$)P=PF Nj$5~-$5t PvDZ)Å~:ùdhq#)Sh8'Phο$)P=P ǃ119ʉst  @~4h9'SQhؿ$)P=P +%5%5+ %5y @BL-&ڽ߭ $5$519ظw ȉ߭l-&s9ٽf f٭߽٭=ٽf f٭߽٭1 9ljst ȉݝ4h9'%Ƹd PSQh$)PP á$5$519‹$5$5)ލ 19‹݅99}h$VQ à +$5$5߭߭ٽf f٭۝٭?~~h$rtPh#VQb ÃhEx%VQO à <ЙRPh$)PP Ãuh/#)PP à $5fPftSVP eY[^_]aUSPjPX]UWVSPu ]Ett v9sP71;uuߋuE9s$;ut:GFFPh͗%jW= ؍e[^_]UWVSuE E1tpH-td:t_ tZUx}HM=P2.DWtDOt uxuO1!tjjEP@t  FCE덉뉉؍e[^_]UWVSuju)ZYt&Vu PW9ucO7؍e[^_]UVSu huà @tuuSFS؍e[^]U|EPuN ZYtM EUQ1UWVSEE 0Vj SD DžuVjS2 ƅtu)@))։NjE 0E8 uC t  Ȁ# Ȁ;uڊ t%\uB"u#u uB1ۉ؍e[^_]U <v UD&0Ep Vx1Yw{t)1 E@ȉC,ub Ex txj(Zu h<'3XYǃ,f@S(P1.1;,s$k(рyus1(D@1u e[^_]UWVSSƉM׋ttZ9t<{ t6 1ɅuufujuP t[뷃 S VhƉ%2 e[^_]UVSËHt2L~tHHHZR1ɉL^Pt2T~tPHPZR1ɉT^`t2d~th`H`ZRR1dXt/tVfG,X1҉Yt/tV-G,X 1Xt/tVF,X 1Xht/ltVF,lYhn 1hZe[^]UVSNjjjVnD@PjV%l8@t@4%1҅ut 4%1҅ut 8t48SVlXZe[^]US]E ftPh$;'h%0 jP| t(@t >h$;'/YE u1҉U E](ShjP#@uE $;'E%]i/]US]E ftPh;'h%W/ j|P t@I=v|y 3=7`x^ |xYZt>1҉Shj"@u;E ;'E%].h;'.XE E]d']UVSĀptQPhhxV辟@u h;'8.XV Sh%- e[^]USË4%1҅uau]h%SXZ{PtS 1Ytk%1҅utSLt%Juz#PS誔XZ]UWVSÉ׸r#u2-%+1u%%PSbS_jSBCt PSXZe[^_]UWVSÉ֋8 Ph<%,1ɺhXZu4%VSSjjN%1ɉK 4%1҃uuj%XZe[^_]UWVSUM8ttY@@0tM~ tBEU  1ۅut1҉FXZ[^_]USËltu;RSlZYt&hvRpPaPhS%+]Ãx tpUSË%1҅u:u6SE% Y u=uSnZ S.YuSDX]US]S蟔Yuj$XZIpQpcvPh[%+j#Shjdj#]UVS]E ftPh:'h%* |)RxP# uh:'*X;|t xD8t|xӐh*.H 1tf *.yh*.j 3 Y^*.P*. Shj @uDE :'E%e[^])jTXZu Ee[^]y"e[^]UVSjhW%AZYuhW%h4#-)[^"VPSZY@u Vhq%)ZYSXe[^]UWVSMy t %1 EU}u%1҅ut6`u,QMY}Mtu1ۉ1@EU}u#%1҅uZ`LQ-X}t u 8 ى%1҅u1` 1e[^_]UWVSM48%`uu %t%ti utSYt %@utS-Zt %`ut[1҅u%u! u@uM1ɉȍe[^_]US]'%P'jjQjjQ4]UWVSQ]4Ɓ@1utg%@1҅u\uXt0t(VwZ%t4:' Vhy%&NvSq_%t4:'h}%%[^8th%&j( ShWj4Ɓ1uguc%@1҅utTS,1ɉMjEP,@u hD<'%Z,\ǃ,Xe[^_]UVSuh#%48ӁYt:tt{ u h4%SUYX[j+XZe[^] @48ue[^]-UWVSD]u Ctt,PCQPhj@EP^@uh,<'$E_E{ VEPW3bƒuVWh%:$ st#Ej@VCxPG VWh%?$UCxU3`UXYu"D@RWP_׍e[^_]UWVSÉMt0x11UjSZYUu 1{ K uRPQM3=_UM  {Mut';xu;0tQh؊%n#11҉Y^{ tFEU   t3x"Z@uh;'3#Xe[^_]UWV։ϋD@WVXZe^_]UWVSu%1҅ut V%ZuF Ph%z"Y[Ӂ u% 1҅VGEj EPju^ ]PSh%"M1҉-1;,sYk(jQMuL Mt5j EPjQPMAPuh%%! MQC럋 V4Z@uF Ph<%![X ~ u#V3%1YutVdX~ tV [ӁtK~ uEӁEuEuEuV腢ZY@uF PhK% !Y[t ~ uV$Ztue[^_]?e[^_]UWVS(]} uS#ESfẺ{Ls$S# { }u }s uJSYt?Vh[% S SdS訥j3ZoE v%]e[^_]*Vh%h%S11҉fs$t jjSa" S.#Z@u-8t h;'X1}E A]e[^_]"}{ tC uPh%Ph%(Y^{PtRStCQEЍ}ԉƉщUSCtZU9uPEPua t{ t11҉s{ t411ɉhz#SSFS8]e[^_]e[^_]US]C Pt$ZYts$sLP ]] UWVS];1{Ly)tC$tjjS 14%1҅ututEC$u?tSp!Y@u h;'ZjjAS @u h;'X]e[^_]US]][].UWVS׉΋;M EU K 9}!E4UQM YZMUtBu }{ t~EUhϋ%SCjjMtuuS, tSƟZSOSX+9t'C jjMS [e[^_]UWVSP] 48%@1҅utjZE1t6HjEP, @hd;'h%!_tm@h`%h%h%@t+XRDLtzhۋ%h%h%I Ehۋ%h%h%& 1Eh%h %h% 1u1h%h%%h%t C[h-%h;%h%<@uuhC%Yhjjj TPhK%E%5u>%54%1҅uu u_%5XZe[^_]USS]E uPh8;'h%R jEP, uh8;'jYuZ8t$h8;'h%j,,jǃ, _w$jPh8;'h%ju6M8tu h%YuESQXZ]US]E U{ u)C щ‰{ t][]t[]UWVS ]]} utSEtXZu 'w{ tC PhՌ%K%p^_CStP }tQSS[1pEPjEPu] Euh;'WYASuMXZuk&~ WEt YXt3{ tC Ph%XZF$C$N>K>tmC**aFVtPMQV1FEtPV2VP~ u!Wh %$11ɉddY[ۃ} ~EPuu { tSZPHtJHPXEu}OuEPu^ ؍e[^_]UWVS]DžPPhhYo @uh;'h%1XZh.%Y^1hPF1׃ u Vhp%AXZuz$87tp$8 tt Vhp%^_\XPSǃuh;'[ttlHp VWZYu VjS ϋFVt=PVF PtZYt%Vh jj 7u7W1FtPV2VP~ t11ɉ#VhWtSPtSttPSP e[^_]US]E ftPhH;'h% S聡Z@uD"87u ]]"8 t"8Vt"8tEH;']]UWVSD]} uMMtFMPVZYt3Mv/u"7S UE x;'Ef5#e[^_]EC(f9t { tQPC Ph%f{(K>:Mu#M}tyEPVC*P Mt_{ tEj<}WQC*P9K PQMh%Yjt S*ȉe[^_]UWVS0EEE EȋEEԋEEЋh%S_ZuEE %+h%SY^u,Eȋ@0SwZ@E] EȉEe[^_]uh%SR^_E܅h %S:Y[u EȃHg1E9}E4Z\FSX}1ҋE9}?EЋ UQMƉ$MQuw5 K)Eƍ@E UB 뺋E@Wh)%W1p#.E 1E111E܉EEPh?'h>%uuttktA(NtR4tU6uE뾃UuM@밃ptxtn 뙃M듁M늁M끾wEkp#.E%@1҅uE䁈4@EԉE1}11uE䋀t0tR~ tGߍV }9}~E4RUrZYGUu9]uuVjv EvjEPEp  uoE䋀t0tL~ t-ߍV E4RUZYGUt}9}9]tvuVuu @uE䁠41E䁠4E@tKE܋Uu9]u)}u#U܋MEtNf}fC(ffGfJuj; ȋuFZK>s*S>+Ee[^_]UWVSu} lh%hPV*à t1=whlh%hh% <8th%h&$_ XZheh[u h<'> huPY1l>uZG Ph% tXZt{>u[C Ph=% _Xhhd% YhuPWhQhnRPhnR  =nwHƄn ƄoPRhh%Vr@u-h<'h%, XZhtjWhà ppe[^_]á%5tU%5P%5U%5]UE@]UWVS]u }uh%h<='hG}t}uh%h<='hHh%jtu :t 9ptUC tHtJKHjAYu<tBCXCpf@up MH1҉PfxCM1e[^_]UEM uh%h(='hh%u t 9JtBH@MUWVSM Ep}y1yy9s)}_+Yyutʚ;1Ƀ}t}[^_]UWVS$Ǎ]Sjs EPGPSfEUЋG uʚ;)U܃tHPU1ɉM؋]9ڋ]]s 1҉P1 ])ډPX )9s tJPMىH 봃ue[^_]UWVSU} uh%h='huh%h='hh% }ʚ;vh%h='h܉É΋P t9zuM9Ju JuK$݋S(tJtHK,JjYtcUUrEB zEBEBC t&H9r 9ux 9}sHJP1C$BS$1e[^_]UWVS]U Eu}xx xʚ;vI[^_]É}u M[^_]USEU M]]]] 1ۉ][]nUVS]u E1MMMM i@BU[^]4UWVSUuuh%h<'h|h%XB 1ۅtI} t} 9xu5}9xu-t9pu$xtyz$x18z,xB,C볉؍e[^_]UEuh%h<'hh%U PH@LUEuh%h<'hh%@L11UEuh%h<'hh%{U P0UP4UP8UP<1UWVS(]}1E E@uh%h<'hYh%1҉ỦUЉUԉU1;s4s,C0 I>v = DFu EPj蓿 @u11EEEE1;s4sjEPC04 @tF1e[^_]USjPj[ZtÍ@Pjoo ZY@u SX1/1[1҉S C C1ɉK C C$1C(C(C,CH؋]UWVS]3tP>E t9VuFt9t,NtJKNt PKXVFXs@91s@sDCMYC t6HtJKHP ڋHtJHPZC uK$HtJHPXC(uK,CNe[^_]US]jSXZ]]UWVS ]uCh%h<'hh% %5t,%5H%5%5C8tst Ӌ`!ft1f9thWhi6b@؍e[^_]UU1B$t&zLu1t]UWVS\u~>u Vv 7EEEE1]MuS EMQUE UJHOuԊEEjPS蝹PF Ph)%F>PSV.}(u V*N>׉e[^_]USEtSjS>[ ]UE t E] ]USEtSS/[XZ]UVSEu Ʋ9t t !ʉ11@u1[^]UWVS}] ?jWSD s jWV, wmj:V< ZYDžt?EPjhjjj jGP C8 }tUC8jVCP P2. DJu <:tFu}Wjhjjj EPV C0E t/it.u#Wjhjjj j@P C4 }tC41e[^_]UWVS<}u tAu}*EPV[Z1@u0tC WP; ZYt[u{1ۉ؍e[^_]UWVSSE{ su lZYSs F<t <t3KCtjRPQVsu ju$R{C~uN ufF tUPRjURWPVsu ju("ux"MFGVj趬XZt7t9}s 7VS耬ZY1}u>t tCEM9tHM9MsuN\?~Vnt>0bt!# tt:xtBrt#   C  E P2.MNMߋUDJt!U߈U~MDyu~~U}EjjEP  tE1ҊM΃0wGMLBu}t?jjEP t.S=~ttCEE}u$@t9E,1}XFe[^_]Åu À t t @ u1Ått u@ t1UVSQÉ֍EPjjjjjjR }uȉjDZ~~1CtCHuCЍe[^]UWVSE։M؋ERm EYuh?'j=u _ZEu Vh?'h%u?E}u [E܋EE1CEE8j=W貽 ZY)9EuuuW uʃ}t'Vl ^tOWE[uXuFW É4$ EBU$WZYUMuh?'u[} DED1uVAl _XjCPu5 uh?'yVY[41҉TMe[^_]UWVS]s {X1;s s WF,Xs1s s{$X1;s(s WF,Ys$q1C(C$Ze[^_]UWVS,ljU؋E1=b$$`='E*@1$} $t uh%$;@.tPXjM 11rXu 1#u1ۉh?'6Y#V9ZtjM !^@t;thW%Sx ZYw#SW1ۉ^c#@PYO#} 1# U -#} u#jM Zuh?'hN%t.u h[%u%" "} t% jM _u hx%1 a"} C"H"<;"u @i <P[^""} !h#u ZYudž!EPjjjjjju  }!u h%!} !EPjhjjjju F }v!u h%]!} K!8M!jh%u u u/E܋HL@ư`ijhŘ%u 0 u/E܋PTư$E܋@DFNPpMju PWSuRUSu=ju MQWSu܋URSuju VWSu܋URjSD u h̘%+ }  8 jh%u C u2E܋HL E؍`ojhŘ%u u2E܋PTE؍'E܋@DNF0E؍FpMju PWSuRUhRju MQWSu܋URFRju uWSu M 1'1} tjE 8tbj/P聶 Y[Džt@j/Pn _ZDžtM @t/O1!t1ۉ/ } EPjjjjjju  }u hߘ% )jM EYu h%  T } luh%} Uj,u & _ZDžtxu u h)%89E u=E H j[u h|@#Q 1ۅut%Ɔ EPjhjjjju , }t hC%ZO )ǍEPQMZ ZYHMu- 7: U艔) jY  T } E <4t E x4u  E 86tx6u @E @E 묃} zEPjjjjjju e }cu hw%} 8=LHM *L} j,u 賲 _Zt u P $UR[Uu h%RPK 1ɉW}}} u Ƈhkhs%u U ZYu ƇhLh%u 6 [^u Ƈh-h8~$u  ZYu Ƈhu jy[^Pl苸ZYuh?'iXlu P>p^_} u Ɔ 1hx#u Y[u Ɔ |hg&u f _Zu Ɔ  ]h%u G Y[th%u 4 _Zu Ɔ +u h%} t% jM n[u hə%1   ~o} Q8Sjh%u { u/E܋HL ư@ijhŘ%u 6 u/E܋PTư$E܋@DFN0PMju PWSuRUJ?ju MQWSu܋URJj} <8>jh%u f u8E؋HE܋L @ư`xjhŘ%u  u8E؋PE܋Tư*E؋@E܋DNF0^PpMju PWuuRUzIju MQWuu؋URVIju SWuu؋UR5Iju VWuu؋U} j=u 譭 ZYu hҙ% @Ej h%u ud}u11҃uM6Sj h%u { u}u<1ۉ$jh%u L u0}u 1ɉM1jh-%u  tFjh&%u t0jh%u tjh%u }u(jP%U XZTEÅu h5% @E؋M܍UE@u WM1ҍE@t WY#X3EPRU1EPU܍BP1EPU܍B8P1WURP)%$1ɋU jhO%u }u(jP$U ^_MM1ҍE@yW"[h1ɉMEPRU 1EPU܍BP0EPU܍B8P0WURPY$$1ɋU 9jhX%u tjhb%u uB}EPjjjjDjjuf }duhg%Kj hv%u  }uߋE j/uݩ _ZDžtGSuj HuNt>EPjhjjjjW˵ }u Guh%ƆtGuh%!11Ƀ}U jUEM j/u  ZYuEjP! PJM JM UEM j/u 荨 [_uEj P{!  J M J M b} DITPM 6T*߃  % Ɓ QR󪍖 fFPfFSfFVfF^fdžƆ2Ɓ&E DžtGEM 1?j@P   JM E } u} 8jh%u uHLHjhŘ%u uPT@Dju ƐVWQRP!A 8u h% }  $豯u T $ZY h?'m}  4%1҅utu h%9FU m@u u h%N K < - ! @   uh%F EEӋ4%1҅utu} t h %\ڀE Lt @Z} t6j/u ) [_DžtGEU N@uu h;%/ 1,E؊EE19MtIk(P} u*t,]f9Xu#U8uU8PuU8Pu U8P AjE@P( (,P,k4EfF} FEt'EEFEFEFF}t uF1~FH j/W ZYÅtCuWj HtWh%1~_X f~ EPjjxjjjjSЮF } Sh%QF[^  }    @EԍD1HEԍL PEԍTXEԍ\E؋E1҉E1ɉ} u^ }t EX]ԃ E؃}  hL%}  EX$]ԍX(]؅uhr%}tlE ƅu u h% EPjjjjjju } }t u h%j FVE tMh%1E̋E ƅtFj:u [_t8URjhjjjj@PEЃ 1ɉM܃}t)h›%j=u 趠 [_E1҉UЅt@Ehݯ$u ZYu'E uhۛ%qp3hZ%u ʮ[_1ulE Itčph%u 藮ZYu. 5E uh%qph>$u VY[u&E uh%뽍ph$"u [Zu&E uh+%넍ph%u ZYu πsh%u ƭY[u @Uh#u 設[Zu QhC%u 芭ZYu hO#u lY[t1h%u Y[Zu hܤ%u ;ZYuh%u Y[uh%u [Zuh%u ZYu|h%u ϬY[u ah%u 贬[Zu@Fh:"u 虬ZYu (h6%u {Y[u $h/%u ][Zu h2$u ?ZYu @h(%u !Y[u @h;%u [Zu hդ%u ZYuwhl%u ʫY[u\hH%u 诫[Zu[hQ%u 蔫ZYu@hE#u yY[ t u hA%}tu hR%uXZ1E s!t@uho%NXs"}uh%1[uu h%urBsthA$S˪ZYtSK Xu 1E؋Eȋ]ԋ }t&1ҋE9tE9S{IB,j,E@PQ uh?'V]ԉ]؋J k,1CC C$C(Ẻ{EЉCs }t"u _S׋u܉)1S׋E}t5E-}t }pEfE\} >hƜ% `<"- } u i^udu h%@d} E aDžt @kh%u k Y[M܉]t&h{%u F [ZthU%u 3 ZYu E܋U  E܋U%h1%u Y[uGu h%Åt @Í0PWj跨 Ht h%|h&S _Zth7%S ZY@yj[B 3}  jM _u hA%> @} EPjjjjjju 袤 }u hH%} tyEPjjjjjju d }tfu ha%P} tBEPjjjjjju - }t/u h{%WPT[uh%ZY@1 S Xe[^_]UWVSEu} EEEE1ۉE싀?'tM܉UVP ZYUMtCnuFE샸?'uu u E##EEEEE} ?'EEe[^_]E8uu E̘%e[^_]e[^_]UWVS }]u1p#.} t[%`EU%몺} t* u }쉳UNUЍe[^_]UWVSQEE] 1 t 8t RٟZPПX1t 8t R讟XP襟XEtu7jVuB {p$e@%8tjjV txTuxTjP僻DtV\,DX@HXLtV/,LHP_TtV,TP跞XY\tV,\X苞(耞XZ]e[^_]oe[^_]UWVS,hdj^_uh?'['Áǀǀǀǀǀ@ `hHG'P^E48XYt%1҅ut 1ut =4%5uy=0%5up0%5@4%5jjjr tP| 0%5 4%5_jjjD tPR| 0%5 4%5!D^ 0%5 4%5hE+P P~ =v1 E1ɉ} ,84j,j @_Zu h?'^ ǃDj,jHZYu h?'趿X ǃLj,j贗P^_u h?'芿Y ǃThhI'V =vh?'h%^XZPPu~ZYhf}#P[ ƋY_tglju1.P` ZD9t t u x\tH@ݍPPRV1ҋEDW@MD1@DHLPT1HLPTXh\l1X\hPE0P7M0uRh?'hf5#跽 =Ht=w HƄ SRu71 1} }111PPu|YZOhf}#PY ZYtcut:gPV YD9tۊ t uπx\tH@߅t+%柃1h$ YZ} u,jE`@PEdƃ u2ju P lEd`= Zu h?'^wGE`kh%F ZYu/}tOtEuP' ^_ƿTh# ZYuD}t uuPӺ ^_ƅuDžuthΝ%蕺 ZYt7PPًU E1ɉu#tSu XZ1+u؍e[^_]UE E9r9]UU19U t]UWVSlj΃E ˍMEEBGUV ZUMu8]s]u9usFr}9 89s "  @G19r)SEЉ‹E9s )1e[^_]UWVSSU uJTuhb%hG'h~Tuh%hG'hhv%+ YLGL9t)cCu)U QM;W;ZY8ËMU t u7F|B|u t  tAH+GHu9r9e[^_]UVSjjVà tSV S ۍe[^]UWVS8}1}عEX}ى‰0E pE؉U EPW*_ZuUBtt U Btu VS ZYe[^_]UE UU E]rUS]hXG'Ph(G'ØS]US]S Zt]] 1]UWVSƉ׉j<|QS CPtS8jhv%t jjSrǃ t:jWS`ƃ }tG9Et G99EuWSW* e[^_]US]t"jjS tu S@T06 ]US] UHSu<ZY9tS X1ۉ؋]UE PTuh{%hF'hhv%~ 2PuUWVSSlj։MBTx t41҅utVWcYXu'VZtFP[1t&FT9CTunCt ;FtucVSZYuVCttFttF8PC8PZYt5FPCPZYu"֋Cx9Fxuٺ%%}u&tNCuu&VjK6XYBuc 8t h%TXSj%6ZY@ut 8t h%2XVj6ZY@tN 8th% X1tESWvS Ee[^_]UWVSP}tDjjSƃ t)jVSE 9~TuVSV uӍe[^_]UVS E uh%hF'hPTuh{%hF'hhv%9 2uh̡%hF'h߃}uFƈPVBXZt1SVuh%j uV)l ىGSe[^]UWVS8uh8G']ShXG'EPhXG'}Wu WV8$thF'h%荰_X14SV莞ZYujEP1jEP&e[^_]SVPZYt1xjjS&à jSEP ECT x t8jSYtC8PsT<_Z@u h%ǯYS;U t2C9t ;E !SEP_Z CTESPNjC|ZYtwG|tEuEGT9CTuG8PC8PZYuЀ{Yu Cx9GxuCXPGXPZYuWu}W M /1z'1zuz uzu 1z1U幀U E]UWVSu] }uh%hG'h{uhb%hG'h|h7%t Fu#<u;FuFPh$WSe @u612WSPFDPgÃVWSPFP Ã؍e[^_]UWVS}] uhj%hG'huhv%hG'hh7%DZ GS8t)R78s<t<t1&vvRS Q$ e[^_]UWVS(uuh,%hG'hFE<t<FVU1QF1 G!)JO9tx dB@t8tM9r1=8}1ɿ}tAut]@}9s8蹶 /`1ۀ=8%5uU}ع1E׈E8%5S}W<WV-th%hG'h'h7% 8%51ۉ؍e[^_]UVS]C<t<t, /g S'؉U Y=8%5t158%5S>Z;E th%hG'hnh7%| 8%5Ǎe[^]UEU uh,%htG'huh%htG'hh7%1 fPUWVEu uh,%hhG'huh%hhG'hh7% fe^_]USH'tPh%@c XZ]UWVSD1}]SIWZ@j0SgX1uuuu}WSX1;5`<'s/d<'H>v 葴  DF1;5X<'s/\<'H>v X  DFWSX1 1҉u uSjE0EPEƃ S WYEt 0e[^_]UVSuEPu V uVjHR ZY@t؍e[^]Åt3UWVSƉ׉ˋtPWh%Vu 1Íe[^_]UWVSU} u19s$@u9s8uh¢%h\H'hC؀xth%h\H'hh֢%Ҭ u1W9s*jCPU& tًUGJ:N9s@u1Ѝe[^_]UWVS`։ϊB _`u1P`PCXZ `SFQ X4%@1҅ut _t^Fh#Yu%Ph7%S @& Ph?%S @uWhK%S @ydhlhF%W YZu@ltDžplxDjVYZuGDžphU%W蚢 YZW芠 Z|6h]%Ws ZYuDžph%WS ZYhz#W> ZYh%W) ZYhv%W ZYyh"W ZYdh%W ZYOh4%Wա ZYpDžp Džp_t@F Phj%SU @plH'tPhw%S. @7@t pOdTX4%u#Qh%S @hVLX&t 6$Ju%Ph%S @9vHh%S @!FPPh%Sr @v$h%SZ @V螨Phƣ%S>@~Pt?vtFQPhhtRE@ttRhϣ%S @~xuF4%@1҅ 1h8G'tPltXY#FxPh٣%S @u(z u RuARPXQTtPVZYT9Pth%S_ ZY@jjtPƒ ttqTjjP T9u-BTT Ph&$S_ @T`jR뛉ThGx%h&$St_ @Tu4jPSjK @h4%W谞 ZYu>dTX1҅u4%#hF%Wa ZYh%WL ZYhz#W7 ZYh"W" ZYh%W ZYthv%W Y_twpuhehxOpu VZ;pul/lxDpjV{Y_#4%#Ph%S @Wh%S @VtZ%u6u_%u*Ph %S @umt:u%u6@t>(W%Wb uu Ee[^_]E1҉UWPE PhC%EPƃuuh0H'hf5#- jEPV\` @u 9 8th0H'hs#1ɉM^_Euƒut$#Q XCt h#"Q XCt hۤ%t h%t h%t h% t h%@t h%t h%sh%ssh9"fsh%Y sh1$Lsh'%?sh.%2sh5%%sh:%sh# s hB%'P XCt hG%P ^Ct hP%P YCt hܯ$O ZCt hY%O X nE*.e[^]o UVSM] X\19t 9t&B,hl19t 9tB,1[^]UWVSu} S.Z@uh%h%hd%WVM `PPSh%h%hj%WVM u.P9r)ǍGPCP$ZYtۍP9r:)e[^_]UWVS EP EE[tF  >SP螑 ZY} -];уM I+ѻ}h%#EP. ZY;tjhŘ%SY ujh%SB uu1;}1u1;} uJum脟 [EPjjjjjjSo }tG,9uSv 荐 ZYEPjjjjjjSeo }u9G,nFu0m d!u mX1e[^_]UWVSM 1҃}twE8to1tA1]\t.u#]<uu'7t)Kt/@ t @B뼉)It tB[^_]UWVSEEEUE E܋]1ɉME9 1E؉EErE,@x ۝ VuQ9uuĝ "E%?B ȃ}uz}E؁}E‹E9r봋E9UrE}DEt.O9Ms T 7뎉ߋM_.MIE)M܋E9,}v M}}t ;]tC }uUUt;]tC } t}E[^_]UWVSu EEE}1ۋE9EeEEHes2H'H'Gesy4EuyP2.DBtes P2.DB@t E\t-x)P2.DBte/t M轛 M\u/t#w衛 7f\\t0v\0G0G0OttNGCt*tesUEu EZY[^_]UWVSÉ׉U7(ƍPS螐YZ@Wh&$SL @}uSj=9 _Z@u$p h7#SUL @u@ s=Vu hV wXPj sVu Sl> Y s Vu Sq=ҁ uޙ V( t.Vu PhV@Vh&$SshT-$SZYsC1D0t<0u FuM  )sSP7 Y_@u|u } 9K;} u@tPh&Sj ~7 ^Z@u3tPho#SJ @G루tffPh&t&ffPho#SJ @c t Ph&@tPho#SJJ t%7Ph&$S.J @sWj.VWjp tcVh&$SI @tQ?tGuUWVC*P U[҃VSo_Zu VSo[^tRXZR蹏YtPtrVS?_Zu VS谎ZYtX蝐 /1 莐 ؍e[^_]UWVS,E̋A tӉ΀ytuV x1}ԍVx}W}ԉ}Z@$1FCt}ЉF tCUfCF t&EȀxu xtK|@Ft C8UF t CXUF0CxFftPEt诈_ZF tU tUȋECTt14~t ` hI`%EtCTZYuՃe[^_]UWVS8t܌ F1Dž@jB UPP蟡fDž ˉhPhiUpk UJ>r*hPhipVk ,؍e[^_]UVS1ƅ@ CtDžC8P.^CP~ƋƒYu9Zu)CT@fCXP_u tЃtЀC| t Cxt(1ɉ,uCTƅƅfDž1󫋅@p׉މ;tHH t2fDž f󥃅 ZupV耆XZtHHt'CstHHt0fDž f󥃅  t'CXsXtHH)fPR1 @؍eY[^_]aUWVSDžLDžP"1ۉTEXDž\1`1jjHVjjLP4Y@OHuWTY1CPW+QXZ$jjVSjLPX@u 8 넋H؉@D@9DDx9@s… DD9@r׉F u]dEuGuXu hR'1wX?$RuhnPmpPC(PS[뼋F1,1t zuB01$t$uG4h1 jSV\fDžx,|Vhi@(p\ @u6&} 8t} 81thR'h%nY^<< 4R0R,RSjP(e$4󥍽hr󥃽$t$j4PSƃ u6`| 8tV| 81thR'hΦ%nXZ31 "4u5uSU ^_u1C YuCtP%ZSFX1ۉ؍e[^_]UWVS(]c{u'ss s$@ S1sSC ЉEԍENjuEEEE؋E܋uЃ9CrHuԋEƋM9MsMM̉MV3ZY{MԅUЉu}ԋEԉC} E܋}؍D8CC;Cr 1CCK%Ѝe[^_]UEEE EEPhgBuV UWVS`fy(u}S'`S'Xҍ4uV S'DžLDžPDžPhBSU ;v .8S'DžLDžPjRS e[^_]UVS ]E fy(u/UEfEq*ufI.fMffEк11҉EUEEEEjEPs!e[^]US]sn#s %DXZ]]DUE@u(1ҋEp@th~B EpT ZY@UWVSM}]utDw wu .E C[UU +29sGu "1.1U 1ۉ19t9u} A,[^_]UWVSSÉ1҅tލ<}})v ~tCf…t‰Z[^_]UWVSEӁcSctrt V1E E1}}1EEEtHe{l}܍}u܋U9NQUt9Mu&s Ee{,}܍{l믍~}~MNM9Mr}ʀ}t}4u NɀMU;Uf}}tcuU9s;1t)ЉuRT>ZY}艇} u E苀MNjuu؉uUU} t] u3tMNjuE苀E}u r Ee[^_]USSӉʍMQM QMZYt }u1҉Ћ]USSӉʍMQM QMZYt }v1҉Ћ]USSӉʍMQM QMZYt}uȉ1҉Ћ]USS\t rXs\1C\ ]USS`t RXs`AC` ]US]$ST>XZ]]]@UWVSRË1utOC><vGD&BTtt_9t;t1zT9yTu)1uuUW U밋@븀{>v P Shr%b e[^_]UWVSÉ։h,j:ZYt:PǀcScufǀ,1e[^_]UWVS@ÉRiY@u Ph%aXZ.Gw*hH Ph%a th, Pj9_Xt@dtVWv<u?(9x u1Wt cScuGhu @G @(GH>A<wOw*󤋅% 1҅ut&x utmtdf@ tStJSj:jPSU9Ѻrf‹fP@TȋG,D8ǀcSc_$tZDcScuQtu?Odt Ghu;Yt-fǀ2@$)f5XH~$t>~DcScu5tt,~<t )ڃf@6Vt4L7Pu"uJƃv9nC,m@1ɉ;D9s 8 ttBxrhуuL>t4L7Pu"uJƃv9C,VP)HFGWu*)؃qf9 ffC tHGY u<)9(CM A 󤋽 \ tC)9C= A󤋽 \wr sb@WuM tB)9iC< A 󤋵 \ttWH4%1҅u/u+@t@Zu)؃fPhPKƃ tjt jVE_ZP)9}QC t  CfCtKSVY^>t/t+VV Z@)9  CKttdt[%1҅ut)@^u)؃ftC t@)9rhC A 󤋽 \S)‰)=+wD@1,w,)Ѝ4? Phۧ%CX4 hAe[^_]UVS~\jhHPF\ uFe 8u!5l.h%WY[ ShT'hf5#W 1ShjpK@uhT'h%WWXZ1e[^]UWVSMuh%hT'hh%_ Ӌ}S OuO 0u싐1utXt Ctw qjSPC u3BC C^PP S@BSjuME"ZY@u 3~BCXSjuME^_@u C CS j3uMEZYtC Sj:uME^_t1ɉKSj;uME_Zt1sSj6uMEZYt1Ce[^_]UWVSu/h4j-ËXZ1C`CH%1CPsijhV%1҃utV0u^_ p11 % 1Y t/@P( ^ A %1҅u1utfpFPg( Y?V @ QP lpS@>p@P' Z W(P O>w*󤋅Ɓ1uTuP%1҅ut3 t)hRR@PP Ph<%>@>u1DhRP*PP PhR%Rh,T'RXe[^_]UWVS$Ɖ1iu1hf%ORfN*.Xfth$SP/ à 1GiPV Rh}%Rh$SP6Ãu` 8t8iW Vhf5#DR!w h T' Vh%7R 1d4@1u$u j5SWY^@uƅS%Zu h T'QX랍lj󤋅e[^_]UWVSS]Sj8_Zt,]t#8tCP%Zulj1e[^_]UWVS$ϋEE Eh%RP ZYu}WƅPkN $$XۋuhTT'PYuQVhRSV-<@t-PPP XZuETT'e[^_]UP1ۍj6j4@uƅx,w "j@,Ph@hW2u脨WPh"mWPh"SVh%sN$v"tm%u)PWVhӨ%%N(PWSVh%M ]e[^_][+UWVS] T'tPh#A XZE1E;s31;Et k, 9t@v 6h% PV~G,1;uts 3h% PSXF,܍e[^_]UWVSEvpE E] P1}tEuSPhA%u @tBE^PϦPh*o%u @t E9sT;] us< v![ Juj h ZY@u؍CT9Ub[ "uj2 ZY@te[^_]UWVSuE ]xKt t4SWhS$@u{Sh&$VQ Xt3[ S7ƥPh&$V @tuuVj{ ZYVj o ZY@u@uZ 1e[^_]USS]uEtBSuHPEPjZYu1}ufffDsD]UWVS4E 1҉U@hHMЋ@E؋E E@_tE@oE'EPjyMЋU؋E X^XtEq#,EPhMЋU؋E .Y[E%E4u1҉UMUu X1E1tENjM U)уȉEU~@uCtEPS蒣EPCP腣EPC8PxSu7  EE9w< v X #ЍzD9E7X "E@Tt 1ɉMEPj!MЋU؋E XZt؋]u1E9EFEtu ޔXu EEU9t M;At;A u1EEIʸy,%=t%=t 1tȉE@uGtEPW)EPGPEPG8PWuΕ ]E@PEPjMЋU؋E Y^E41҉UU9u œXEEPW腡EPGPxEPG8PkWu* ]뤋EԋE؉U%1҅u7u3E @hu$űE Ph%!HEԁ Ee[^_]UWVS$]ƅj4uM^_@uƅExux uExl!WPu h%u9@u1juMqZY@t+W3ƉP腠Pu h!%uܡ@tV)3Pu h3%u趡@yjuMZY@t,E#pVPu hE%uu@ 3 PPu hZ%uC@ut Ex,u@GhElPhhV6Vu hr%u$@ut 1;j@E,Ph@hVVu h%u衠$@uc;s WF,X鋃@1;Ds WF,Xh1;ls W̿F,X鋀13;⋍T9Pu{@D19t ;t_B,RPMUXZtu-Vdt&F$;BuFhuPΘSPG Ph%v?v$贘SPG Ph%?E苐84EЉU%1҅ut*FHF%hF%W藦jEq8~HuJFt.Fhu(VJ9Hu~<t>t FH%FH%>u FHĪ%FH˪%~0uF8F4eWh/v4jE7Whv8jE6(Whv0jE6v8v4G PhѪ%C>$~@u\EEЉU%1҅uY[^hEtGW4ZueE苐84EUt]h%=jE6 >vHW7juW#*tFdFhӉe[^_]g__e[^_]g_UWVS EEE EEt uujjE5ZEE싀ƃ1ut{%1҅upul ! CiPE0yu+@ t@{t:{<t4s$ǕPE Ph(%_EHTB%uU'rt E:tQVC PhH%;1uEPLt @v@}GLihP ESJ>ZYEE1}m5`-&EHTB%uU'zt E:tVV$QWC Phe%U:MElE@eEEE@ht 1ɉMExdtj$PS& tڋE@$Et͋E@4%1҅uu h&SY^Sjj01҉UuX}tSuujX0e[^_]g_UE]UWVS ]ESjj30Ghu/E$t#tShnPj/E1u}}{ u}tE0PWh˫%7!B%u%QWh%6 ]e[^_]UVSuF Ph%6s b1C CCL ue[^]UE]UVS]tVwLSh/j.v$`PC Ph1% 6 1FL]e[^]낍e[^]U幠E]=UWVS]{ WhJ%6F0+F8PWhn%5ShjY.1F @tEi@Eu Ph[%0EPjE1pLp d E1x xE܋ƃ1 utEe[^_]Ɓ1EP E}GG @EjEPuUJ cSc}܋]ԉu؉t t@tQDcScXEp$pEE@@[xYE@ cSctP@ E1p p_!E܋EԉU؁E@ uEEe[^_]cScuE܋% 1҅u΅uʋE;E1{L%1҅ut%u81^uE Ph%-ZYE䋀ƃ1%1҅ut/s$蛆PE Ph%m-EEe[^_]E䃸C cScs$APE Ph%-E1C<wPh*PBP uhx  XTTu ~P1ҋPX#\ًP9 tW9r7&Ph Pht%s TX#\PˋP9 / 9r̍oj5`hUZY@u ƅoATX\th Ph%0(Y[ oX< uBHvW`Vh%%W`Vh<% duW`VhX%%uW`Vhh%d1҉PLDžPPPTDpt;jP`h:Y[tW`Vhz%PPuDžPXT@6@t:tj6`h[Z@uW`Vh%W`Vh%`hKƃ tPh Ph%&V:d8 h4%1҅u.u*h%hdiPh0ܠhhdpPjhSd@Pud@Pi<wPC*PEP u%C PF Ph˯%cuMUd[뚍e[^_]UWVS8EE] }uP8Yt99s&}E EE pT'E%e[^_]z)WPS nЃ<@_{ UfCfEf9>Eȃ(9E؉EċEEċPЉUfffM9f}DC E1ɋUȉʵfuwEċEԋEċ@Ef}tuC E܋CEEfEfEfE}uܹ1҉UЍMЍE eUfҋESftutPE Ph %!(fEfu)T3EPE+Xe[^_]UWVS$}E ^\ftPhT'h% cCubh$RSU u#>t=G PhT'hf5#]W*sPRWt^\ue[^_]UWVSE 0xjPu( uEDT'e[^_]ËOwvsPw Sh*%<uu؍e[^_]hx\uu؍e[^_]e[^_]UWVS`(É։ʍDž( 11DžDžDž,ftRhT'h% t @`jVP u hT'YVSzXZe[^_]UEM ‹]UM 1ҋE]UVSuV4Xt,sss Stttt:uj@苃t$Pǃ tP|ǃY%1Ze[^]W|$wUWVS }7tu PdYF><vu#%1҅uuF(fu  Ӂt1ۅu uuE0e[^_]g_hp ÉE1Em5`-&RR$F PhM%VhSj(e[^_]g_UVS]Shjt~ht j30fXZe[^]UWVS E} w]~tuE9{dfG PuF Phq%xVE1҉Pdh-%VV *!GuE@ @;Gu}P8oPF Ph%%1҃ut V[AV%1YuمtӨtW1~E84%u!uG]9C$uSh{dChTE胸,1ۅutEVZ1҅uEpE@]CO W؃~]CX{F$E}uEUҊM]脄tI_E@Ѐ8t HD)у@v " M@X@E}uE@H%j6cEpHVr{e[^_]UU1t )]UWUBvd" 0E 1ɉJI} ډу¸)Ј1_]UE1҅t3Ⱥy(t%=t1҉]USU MEttt9Xut9X []UEttPf1ҁ]USEttju S u[1]USEtt$ttP] 3#P uI1[]USEtt$ttP] 3#P uI1[]UE1tzhu 1zd]UVSEE t u wm^Qt u ]uTIhFhu t ?t61t0t,cScu=cSc =cSc[^]UWVSdEtE}?Ex 'Eu1E@$ h8G'EPHjju yKÃ{E8uǀxhtxduh %hU'h*h%: h8G'uV=HE@dZYx tWu[Xu1RK|EPdB#B E}WSiE@d@ EWCPiiC9SV&]jjEEPJ jjEPJE }E8P^d_uqE0XZ^D$NjuuPZC| SEP\juEPJEuEPZY@E@$tvtguZX1uuVSQhVCPGhE@dEPC8P1hE@dEPCXPh SEP[_Xu[jj}WgIà SWIsxC|ZY uC|E@dEPCXPgSu G9tS ZSEWX떀{tjSu Hà uhSb_tߍC8EPb^ujju Hƃ t9tEuVdZYtF ~$1ɊT <2P@A"Puu9tjV븋E@EE\E1u}}G$tN}u>}Ghu5j}Ghu5jRP*RuM UuU]UWS]U vG 119t@u1 'V'[_]UWVSUyv u1΃y tËAdr@t$tt @$u@hy%\X؋UÅtF PSXFP}WWCPXFd@t Kthm( u} WC8PWY_C9@VCXPWXZ؍e[^_]UWVSSƉMtGu[x|tGd} u@t1҉t H|PVJXZ?ˍe[^_]UWVSQEp1҃t<t19sAM1ɻ BAt }ut1ۅ}u@9s 8t1щZ[^_]UWVSE Eu}]Cfw EHfv) f9]u1Ʌtd@w 1 w w w ?w xIÉEU)ЉE9} "uu}u1EEftff@~jVC@P2v ‹u#StPWS]e[^_]뾍e[^_]UEttIt:t4x@u HAtx@uxDuxHu xLt@`uR1]US]jjS'ƒ ujjS]m ]UWVS} uEtCt=u{@uCAEPVTZYt$@u NtHUJNV^C‰؍e[^_]UWVS} 1EEEE3CdEu u%StVMQS2uCE䋀%u=tuuStPMQSjC@PE0 tK9Ht ESXESut URP'ZYSXu e[^_]UWVS} Et0tYuvtCPEPZY@t+C@3#Eu!CD3G#EuCH3G#Eu CL3G #Et뺉މe[^_]UVSEt0t.ttju CPPn t v1ۉ؍e[^]UWVSu ]ENj@t9pu9X t5j]ZuhU'Pu<{*VhHV'Wg tVh@V'Wug u j  Z VvEU1Ejj@EPSƃ@$@ 1ɉM䋃%1҅ut6EPSFPF PF@P@u VE䉆F F@FFDf{(uXC><u,C*FHC+FIC,FJfFKC-FMC.FNC/FO%<uC*FHC.FLVF VFHtVo, eFHE8V@?jG@PRUe UuG`t7%1҅uuV 1ZiEGhPG Ph%VV oj.FhPRj 1E@F0EpjVt8;Cdt,of PjCPPCP@SF PtjR$če[^_]UWVSEtt?u[0tFdЩu1҉t Pu /Y_6ҋEt^tTCƅtDGPEPp8WRV ^t @H KUQjsZYtUJ>t/@}wFH r*NjM;rC 1CUe[^_]&W|$wUWVS ue[^_]g_h1 ƉE1Em5`-&RR$C Ph<%$Sh>Vj(e[^_]g_UU t,t9PuƀRhcDjj>UUу1t.w 1#tRh W'ht% UWVS 1ۉ]]] stqpCuCN@H9AHrot t]t tK{du~du?u~hu0C`P EF`PZY9E~FC3^R6t1EC7UtHJUPe[^_]UWVS81ۉ]]]E1u1EEE9CEׄCdt\URSTRPŖ t t0u5CPE Ph%C1ɉKd EEt9sEsxF URV4RPS t tlVdtRNh%tf$QPF Ph%Vj_@u 81t 8t hV'Z1F$F fdEt9sE6NEtXMPF$Pv裕 t t1F0PC Ph%*V tPVujSTRPEċCPEЋCL }ffMM9Ms KMɉMMԃщu2@uj}t}u^}vXU؋PU}vEUPUt6ut#9Usu)t9s M EEu)u(}uƃEȃ}v1ɺ>]4tuh@WjE}t?E Ph̵%EEZjE0"h]%u:e[^_]UUt&t9PutƀU]a]UWVS}u1-0t9~t6^xtuu S u؍e[^_]UVSEu1(0t^xtuu S^ u6ډ؍e[^]UWVSu}t9suCxU u1[^_]UWVSSu10EɮEP1ZYtU9pu 1ɺ]GEttu4@t$P 葍ǃ e[^_]US]t9XuPxtJd8t 1[]UMU t t9Huut xdt1]USMU t3t-9Huu쀸uX`ty @tѲ1҉[]UWVS@EPj:E _X1EE 9CEuh%j uVƋ CPVh%u* @uosXsTVh%u*@tuuVh%u*@tCtPVh%%uy*@tC`PC`^Eq#tEg%"t q#Au}$q# t=#q#@t+1$q#y#uRWVQuVh4%u) @&sdVhH%u)@ C1C;s WCIF,Z拀H1C;Ls WIF,XCPECLE}EfE9Es< SM@ukHL1}9t 98t(A, 1M9t39tF,}čOQ}OQh6PB PEPu2E UU)U0sx1t8Fd%u'~ t!GFhPWEPhW%uk(@6ċ?e[^_]UVSu Ft%tF9CuuVCxPuݍe[^]UVS]Sjj1҅t#09XuƀلtKj3p%Y^u=t h]%S 4XZe[^]UWVS} 71ۉS]É]]jUWVSPu} UUjWC Pe7 Utۀ8&tݹ%UPCPC Ph%蝻C{jV UuDt&9tH9Kut倸u܃xdtCEe[^_]e[^_]US]Sh>jSh>j謳 Sh<j蔳]ú`Y'Jt f9tUWVSEU MftEv0f9s 1&f9u}tMf9) [^_]UWVSEu} tRU w 'fɋ] ] +39s~ "1?fҋu1҉]19tu692uA,t[^_]UWVS8Eċ}ċ]ȅt Ⱥ\кeMQj uP҉ƃuEfǀ< GfEfwEă Ph%螹Y[f>ff}fuEfǀ< 1҉1ЉЃEu.Ef}w X'Ph%j ]SKt 1:BUP XۋUuhX'XߋMDغuf}f9<t >tuă PVh#%R護SEf]f< 18f}uVh8%}ȃlm(Y[Eċ4%1҅utj1XZE΍e[^_]UWVSSƋ1;,k(Kfu{u#{u{ u {u{t]fuCUhPCPVUt1ǀp Kf1ɉHG[e[^_]UWVShEw E@EEEE@|tXdÀuXdBEAE1ɉMM}Ef9UrZ9]s# E PhU%ڶXZu<}])Ӊ]ff}ftftfu f9s# E Phi%q_XLʍ]ĉu)fEE,19t.kM(Mf9HuUjSPA1 UtLF΅uE4%@1҅u/u+j EPjEP_sPE Ph%Sf}tHuΉuȋ]ˉ]̅t<9s8j EPjEPsuSVPE Ph%\(b1ủuEEPM1ҋEPE[tE-Eƀ>f}uEȅEEEPjuWƃiUЍ M))Ufw# E Phƺ%ȴZY%EܹEȉEUʉU9s* uuE Ph%iEX|ۍEtjPS׷ u`jhPuhǀpEfEĉ{(u 1ECECdu%Cd{4u EC$U9S tKdS t};sC t u9FhsFhE}{}uuE Ph %N Tf}t21u~`}W9rF`E̅t}OdMQ9rGdE}uE؉EEe[^_]UWVSljUMu w@ Ph3% 1҉u1ɋUYt E1ɉKhKdK`ǃu uVjtXZƃ>VuMUZYuC;u}tG PhN%_[^덋SDtKHtƃ>VuZYtȍe[^_]USUE M]v]ɉME BE[] 1[]UWVS ÉUM苰EPjRQRtBf}u;8ύG=DQK wWF(1RPQho%~(WQh%肱 EPjSuuAtBf}u;8ύG=DQK wWF,1RPQh%踰~,WQh%( e[^_]W|$wUWVS4E؉UЋuC|t @du'E!Eu@)ЉEEƃ@׻%}tQuЋE؃ Ph%uz18ujjE؋ĨEPj@$ W'8u ǃ8%EPj s@s<Qtf}uʁXsXS`1CdChǃF8u ǃ8%8u ǃ8%8u ǃ8%8u ǃ8%{`tps|t8Fdu.S`F !AtH9sFhPE؃ Ph%/ 16ċC`tPE؃ Ph@% 1CdC` u9t.E1Em 8-&}fEހ fEm}mދEȉC`{duEt:E1Em -&}fEހ fEm}mދEȉCd ǃ8i%}Eǃ;uCTt>}t8sLъCDCLCHCPCFd rFV t#tFhPF Ph߸%( 1F$upFhPF Phr%1 Vd s"1F$F VjjF赤-NtHN rV裰XVBYHC`;}؍w u PVh%MuVh%,KdSh tRQPVh%uϪ)uVh%u踪 RVhn%u褪jE0XZ}uA}t;WVh%sHsDhWE0% @u Wh%O^_E؋^|tFCdҀ t ujC@Ps tKd Cd uًE؃ Ph%苪w8uE0 E؋041ۅu2u.}؋1ۅut$%1҅uujtY[XZ렍e[^_]g_W|$wUWVS,h1Džh#fDžBDž<"#K8Qff@,u1siS0,G$u u iSS0S ti;S0sS0udR Yd{u1ɋS0)`-& ڽ 1$߭ ٽ2f2 f0٭0߽ ٭2 Љ ,褪Z{ 1߭5`-&u +t q#u¹Gx%ݝC4HH H¸A%݅u6%+t)%WW$VQ RP, Php%;,{t 1s,让Y6Pjs8s4Wf6t聴 ,TVjXZGu 1a8RPV莛ljփ 9иr781kddȃ9ƾsff+tST1󫋅,@EUUE E)E.E d}TjEP"_ @u, PhX'h% C@Cto ?9sS0S9su,S$t%,R jݜP, Ph%| e[^_]g_UksE]U|sE]U庍sE]U庞sE]U庯sE]UsE]UsE]UEsyuӁ]zUtE]i twUWVS 1tx 4 u1ۋM9s3ru2u\tffW׋uUuƅtfC [^_]1UWVS@D@H@4tPH1҉P4YH8 w$8W'ƅ< dƅ<;  ƅ< Bƅ<ƅ<0ƅ<ƅ<D 4u:ƅ<D8%1҅ut,Dž41DhP  14H,X@(fDž11,,9(DPDT19tk,<>98tB9rIpr@uDtDu f,,ht1(4tj(\ZYDu" t\1(fDžD,0% 1҅ut#j@wPZ$t @pt1$Dx@1ƋH8G 5bu`(uHX<@D&v P Phr% HP4BbCD_Zu hW'Y#Nj󤋅CH_1҉tjhj|PtP6/sD/j1CDCH| e[^_]UWVS] E1E;s31;Et k,9 t@v 6h%I PV?G,1;uts 3h%I PSF,܍e[^_]UE@|tPd(t1]USEu1X|tuu SC u؋]UVSEt0t-uvX|tuu S u1ۉ؍e[^]1UWVS} G@4j.DVCPjr 4wVh%$~}tE@<"jWu褙< u hX'G8@Pj48Ƌ<% 1҃utjtHuƅ0eDP< PhP%uXEjVjj)S.@tډ؍e[^]UWVS u jh0j)à @uhX'聂^Uع1}E"tEuR)ZYUjRS$ @tEjuVj$j)S@tEjVh@hSg@u_S=Xg؍e[^_]UWVS}748%ud=u]uTjjYZuEX'e[^_]qVhjPu@uhX'h%HXZ8uu@tE1@= uE Y'Et?Tt$TPuEfHfE븀 u%1҅utE8u}e[^_]6Fhdž,E11EU9tk(fzuE@ދ4%1҅WOEA4u: 8 8 ƈVhW'hf5# % 1҅P|tFB`tfftft Bduz uԍG Ph8%JY[e[^_]21҉P@@@ 1ɉH_ Shb%~^Z@uShW'hf5#~ 0WXWhj jve[^_] e[^_]UWVS]u t~wtFuu SHt1ujS߬ZYuNjt w1rh묋0t_1[tt1thDjUY_@(@,1҉P|P|0fǀ<fǀ?SjhPjjS8u"C Ph%|ShSƉSaXЍe[^_]UEtQw]UM E]UWVS É׉M苐t 48UMtSjjP u u E SZt~8 1pp@1x xx$@u ShW'hf5#{:SjY(h%SXZP3!YXt jjW|P;t j3XZvLWFDFLVHVP1҉VDVHYt=t8EU%u=t}uE%uS6ZYvLWv4WvPhe%2 YX؃t w t u F19tAE9uuUM7Ph&2 XZUM΃^Ѝe[^_]Uh*.hi%ۊjw( )5)5t9W|$wUWVS)51B)515x.% @*7f@J7 s f)5/sf)5 s/f)5fp)5f)5)5*7 erI)5)5ff)5f)5=)5tijEP Eȣ)5Eȣ)5ZYF)5)5)5 )5)5 )5)5f)51ۉ..pT)5 *7X)5U1E)5uE\)5`)5jhT)55)7.à x9u h%藡 XSV5)5h>%j0 @J7Hujh.j*- )5)5󥸤)5=)5u=)5u)5󥺼)5)55|.=.u؉}mrq.E؉ )5)5 )5)5E)5)5=ɚ;~ )5)5-ʚ;)5)5)5$-&we[^_]g_UWVS4ƉU)'h`%K/ Y>F hd%{=FfVRVRPWSPh~%. j.]SFPj/Y uj.h"S苕 Sh%. j.SFPjX uj.h"S[ S<F^(ZU)ڃ<,wJ<w1tR<CSPSPh%<+h%"<:tI<I VT@4['h % T@f4fftfkfqh%)Txh%y XAJ7tKT@th %h%R X+81%8P4fPH9\H)T@uF=wtyhZ$#f9f4f4P=v 141P 9ȋ8"8ԋTp_AJ7t3t uh,%h\& XT@t hC% X  h:%'+Y1H1ۃHu ˃j.RVjF uj.h"R4 Ph)o%d XZHuu hG%J Y ShS%< XZ geTP\w닅T@P9TX\H9s&$ P2.DQto%RP CYXʻ\J9H4sb4Phq#hp%y 4H9scTH\SHZuhZ$6 [0:utS+\ YƄ4\n1AJ7:h߬$ T@Z<t <uh,%h\& XDž8)T@Hʃ8tHj, XHT@uRh\%yRho%Rh~%M YXtj,a h%6 XZ)P\uj,; h% _XRT@9@8j,  VT@Ph% AJ7P!PWha$ T <x2<w><tG<T@8Ph:%P $Y'<rT@<w*$Y'h%Bh%;h%4h$-h܉$&Ph%,T@t <uh7$hS%+'^ Phi% Y[THFh% T@Z<t%w uh%<uh%h%r _h%Ph%] [^T@8Ph%? THjh%h'%h2%hA%hQ%h%h_%}ht%sh%ih%&j.STPjA uj.h"SP~ Sh% j.STPjA uj.h"S~ Sh%h%F h%#< T@f8fZYfw2$Z'h%h%h%h%h,%h%zuh$%nh1%h;% S1ɋHQ t Sh$hH%&uj.VSj@ hR%^ [h\%N h%#D T@fHfZYfw-$Z'h%!h%h%h% h%h,% XAJ7t-T@<m4Z'h#Ph$ ^_@J7 AJ7uh*.4 [g v狝t݃{)!C2t!#t1 hs%3th%: C Yh%" C HC SRRPC Ph% HhǃxPh% XZ h% XCPh% Y^19~gVHhYZuVh% XZCj.RPj> uj.h"R#{ PVh%R F땋L 9؋)5)5t9~~BJ7 qm)50t 90P UWVS]u#pJ7tP3^1ۉpJ7tJ7ST tJ7@$#+pJ7Yu5e U1҉lJ75P2.t:C@;:uS tD~@tB\u JDN@uǀ:u‰1e[^_]UWVSU}tIB<:u1ɍ4 E  8uAu t<@t:u <:tu9uF~@u1[^_]UE.]USE] u|À:u%u@C8t9EsH:tt @|u1[]UWVS4}!}u[=pJ7tQu Wn[^u<5tJ7P)YtHWPD3XZhY)^1u?Zc Dž)Etw}xjjju[B !jh@PE xDž1ɉ1ދ9rqhQuƒ ?tuZ\b 0S0Ob 0HЀ u%V1Iu8:ut+<Dž\t-Dž t t11:uΉ1҉V9r)ډ)ށVSv,ZYu"S/^u[Ɖ‰.1<#kcu SZYPFS7/XDž.M1j=h&S ƊtV:t֍HX)ىMAQPuVË tF}t u XWi.^KtF:^Dž@DžtB<:uЋ))ˍ x:t:C؋)ȉ)9))))QW_*ZYu:W-Xt u Xr-/_ _<ljljƉlj )PVQO SR< ,Ymt u ^)؍P9s&PSD)ZYuS,>^ XË Dže[^_]UPUjujM EUhJ7tPP+ 1҉hJ7Y1`J7lJ7dJ71UWVS1=`J7uE `J7=hJ7uYh{N%`J70 hJ7^_u=`P5hJ7" Y[t?Duz1=dJ7pJ7t=lJ7ulJ7hJ7u@ @uPm* 1hJ7`J7P`J7@Zu 1Sh{N%PAًP2.TZ:u#t =dJ7t|0\NdJ7G|0\u dJ7P1ɍt:uf:Y\tAߍP5hJ7 Y^u'hJ7tB @Rv) 1hJ7ZD돁NJÀ|u :t@PFjWjM EÍ@ wCe[^_]UVS]u wu ][^]UWVS j=u uy ljd![Edu![ l8]EdUru<:<^uFG<:wMu})ߍGdPS%ZYuS([w<\ůG<:HЀw+1ɉMF0MȉE9t HЀvE농w1e[^_]UPEPhhQ7hU7uƒ1uEUWVS} uLu7uuW1ɋU à =U7u u1Ɖ>1e[^_]UPEPhhQ7hU7uƒ1uEÍP Љ ‰ Љ ‰ @UWVSQBJ MؙFv#߉1I wEZ[^_]UE @ U+B ]UM UA+Bu)]UE +E]UWVS(ƉыXB1x}É)M1ENjEE׍9rסV7EС\V7E=vEiẺMԋEA1PUÉ)‰UM1E‹EЉE܋E؉E]؋U܍9r9Mr(}v k=9s}E܉EEE놋EԉFEFEF ~$Eԃ([^_]UWVSU} u]R > $URjW= $WjV= $Vj$S= ZE] Ee[^_]UVS@ÉjjjQjRP2 tNtL9tHVP蛺 ZY@u:"N j@]S0eL h/#Sh^%P.=V7t$ 1e[^]UWVSSÃ=DV7tO1t lV7<!jơlV7!pV7)Y9sRUDV7Z9Uu)@uÅu,V7!1ɉ1ƅtÉ5,V7(V71e[^_]USX?,V79(V7r,V7É,V7 4t1[]À=V7UVShq#hq#hq#h%.hq#h/#hv"h%.. "=V7t=#%=V7t%Y%=V7tj%QRPh%Ӌ5.t$=V7t}%G$=V7tU%`2#=V7tt"%=V7t[%SQRP֋5.]ڡV7hq#h/#Ph%֋5. ڸhq#h/#Ph%֋5.ڡxV7mhq#h/#Ph%֋5. ڡ|V7Fhq#h/#Ph%֋5.ڡpV7"hq#hq#Ph%֋5. ڡ.hq#h $Ph %hq#hq#hq#h%. e[^]UWVSQË@xtt*BEB$؉‹E¸1DD@J 9s:tt/Ήz}z$߉}1|C@1҉Z[^_]UWVS V7V7V7k(0.h]'@Ps1ۉ^,V7~0XY1ۡV7E9s6U1h]'GPrKGU!C(XYk(|0V7EM9sCU1h]'GPrV7E؋M)@xV7GUC(XYk(|0EMV79U1h]'GP5rV7EV7EEM)ȍH|V7GUWC(YXG hq#hq#h0%P.=V7t V70e[^_]UVS V7;V7s4>uDC[^]á V7uÀ=V74UWVSH DžDžDžjjPhV7jP-@u V7 V7PV71 @HV71t3tShPhU%? t!Ƅ9hf%}fXu ƅ{ t5V7u V7FtB<97$['V7V7V7V7V7볡. V7Q9}H .@.V7V7w.iH. V7Q9P@.E.7H. V7Q9@.V7V7V7V7V7V7V7V7ƅD h9#Rhu%P.G"F =V7t h Y=..9}.׸É|V7 V7 V7r5V7V7V7)I V7xV7PtV7tPV7 .pV7BlV7 hV7ЉdV74`V7#5V7t@`V7)‰\V7=V7t*1҉j Ph " h]'hLV7mjHV7DV7@V7h]'h0V7m11$V7V7lã V7u&V7 1tV71e[^_]1À=V7u1á$V7u $V7UWVS@É;HV7;@V7jF¡@V7_9u739u0P)Y;@V7u;DV7)DV7@V7jVS\ 19Z;P pV7PPh0V7m=pV7XZVS Y_@u:|C j@}W0\ZB h/#Wh^%P.=V7t0 95pV7u"tX pV7PPh0V7OmXZe[^_]UWVSEЉʋlV7!Ë V7)){ MA L>D=V7tMjRP[ M95`V7sxu@)lj|| >;dV7Fs"J| u| | DT>| T 9Ss$EExSWnED CSWjl;sss{uISC PdnXZ=V7uE@,t pV7EX,pV7؍e[^_]e[^_]UWVSƉȋ} 1ۃ9t yYC V7‰ى[^_]UWVS¡lV7!9t> V7)su܋tu 9t)D @!u܋D UEPhLV7"j@ZYe[^_]UWVSQӋlV7!‹ V7)tu)ߍ41Ƀ9t ^NAt#\| DuD0| DJX[^_]UWVS EܡlV7Ћu!9`x }؋ V7)‰WtV7]ׅu9])Ës V}t Z}܉E)+F$Iׅu0w \'w\'"1wt\'1;SsS |C@C;Fu ;u1ɉHt SFPkXZNZH9t9sxt PFPiY_SViXZxT }t Z}܉ыU܋E؍e[^_]%E܉EEPhLV7hPhLV7ak=V7t KZ{ SC $V7$V7e[^_]UWVS9pV7tpV79kjjh0V7rjǃ t؋_ jWh0V7YjEWh0V7j$V7=$V7;HV7r;@V7rw1ɉÅuj}먋 hV71ÅuP=DV7@u1jTNjlV7!‰)[9tP4DV7Y9uō3@V7t]EPh0V7&gXZt>G 9r7 39s0jWh0V7|iEWh0V7i$V7=$V7}뾉؍e[^_]UWVSÉU V7EC1t}9xts@ƋuzơdV7EF}}1U9s1k`;k't @u-$k'k' sjtt* 0@p00uHP@$u1S$0t9(s* *\p0믋H@9(s(0띍e[^_]UU.%;|(sD2.]UUC%;|(s4$.]øUS] uSh*.T h"S聫t) 0Ph$h*. h*.j CXZE*.]F UEPu u UEPuus UEUUE ]YUEPuuG UEUUE ]-øUEPuu UEEEE ]UEPuu UEEEE ]UEPuu UEEEE ]11UUE t]USPEtPt ( )wu PEPà Et Q( 1]UWVS ‹@EP2.E11 =E}9s%9]D{t}tk Y DFɅt}uzuB V7BV7 [^_]Ã-UWVSQэX011`xwG0w(XtVWh.t0tyw HutY9}1OM‰"tZM3`tt t$@t39}ǍÃZ[^_]UQEEUEEPEPbÃxuUSˋ@ ى[]ÃxuPV7@V79Ps=UVSÉjRpCc u 1 Cse[^]øÃxu;UWVSÉ׉΋P9PsSCHK 4BRu[^_]US]E xtK1ɺ C H @([]US];Cs 8^u@1ɺlC H @$[]UWVSuxu^ËxFS<L$9rAL$LL9rALL@ u CP PD P] C< e[^_]UWVSË@E)щMt2֋Sʉ|t SC} 4ECEZY[^_]UWVSWÉ։ϋEEK{~uU~}uЃK$r'sOA)VxVukK)K)a1ɺCPAY^y)Vx>K)K)1ɺpCPMVWMZA)VHXK)P؍e[^_]M Od؍e[^_]ue[^_]UWVSSlj=/.t9s?MjC,@Ps(_ Mu e[^_]C(S,z{,f P{<tgFL2.0=/.u9sH2.0=/.u9se[^_]UWVSfU0H9s*P9rfzf;}ux]u)E .HuVQM t uMQ ZM9ufG}uf 1e[^_]UVSËK9s P9r"G{uCCV7V7V7'8[u"x.u.K9r !f3r9s:.u z]u{uCV7CV7[^]èu'B P2.fAf`f' ЃðUWVS É։1E!ЈECE1EEt URSYXS9sYKu{tt/t$H9rEPSS|EEр8\u!x|u(8|u!u9H9s9u@9ut URSXZ{ u"E9Cu{uCV7CV7{tCuE׋S1ɉM؋}t 9s(H9s!8\ux|uE9s8|u@}}u }t9rm}u$Eܹ)KPxE܉EEXK+MKAEU)щ>CE1ɺE`}~!UK)щ K+M|e[^_]US1u4`s' ZYuCC u1]UUE ft҉U\s']1]UWVSSɾ=/.t9rC,E5L2.=H2.113C8wC(H{<t@f;t9f;t3AE9uf9s419tK0 f;|f;Q~ @1 1{8C pPW&ZYuF;s$rC8e[^_]UWVS Ë0F;CsGjhY%V u 1ɺjh`%V u1ɺ,S j@B@Pr Y u ؍e[^_]oK A QrqЉE1}C @t E@<S9sQ8^u@}G89s;]u @]r-u%@-c-u:~] 3C9]xN9rƀ-tЀ[t+K9ȉ}PM؋U 9sъV:t =|뾃39r{uCV7CV7V7<-t<]u{uCV7CV7V7CE؋ P2.Ћ}9sB8Dyt)w"U׉DR^1Efu+`9}8uQMZYMt U=Fθ=/.u˸jE@$E@PEp W u fMA Q$JuN$f8-P9x]x-t A -f9k=/.vNf9~;{uC V7CV7ff9UPF΃=/.uމEa~{uC V7CV71E7* UFup>-uF3-U;Cr{uC P8]u V7CV7{Ex8tC @tEHfE1/.u9}~Ju9sE8}3G8GEx<t4t fEfu-GL2.8EuޡH2.8EuFff}t)Ex,x4u|x$uvx<up@(ffEf}t^U܉C P U܋pEp(gEp0\Ep Q1}U܍D2 9EuGC H?C M+H 0؍e[^_]x]%x]Xe[^_]UWVS$@ @tbF P2.f tNt L2. t< H2.ff9t-;sEщUfE]EӉC;s$[^_]É؃$[^_]8UWVS ]CEx;0\t [uE;{r{uCCV7V7GƁ)ul*.C @t,SUEECE^ ]7;US1ɺ(?>+9<u31ɺ1`E xt{uC V7CV7{xtCxNt  pS9UMH}*ua CHE)PH;KE)PCHE)PXKE)`Z[^9}\x{ƋK9sI:,uDz;9s6JP2.DJt%9~{uC V7CV7PU4SY9s3H9s8\ux}u3@9r9r x\u8}u {uC 1U$J(t8I08 {]"1ɺS B@xz@ wML(hS9s#H9s 8\ux)t)\b wCDLpS9sH9s8\ux)u {uCV7CV7<t60E8UOdBZM@5 C @DIe[^_]UWVS ]x;s?SB< $0s'^[m\p{|;{r{uCV7CV7S B@xz@ wt(hW;Cs8)t~) wCDLp ;Cr{uC P8)uV7CV7 1E 1ɺC H @$E1ɺ C H @(븺 몋C @t,SUEECE^ ];US|1ɺ(Kg;{r{uCCV7V7Gu1ɺ1ɺCxVu{] {}9Az։vM?tH{'xM9sxM P2.Dyu},t{uC CV7V7@}t{uC V7CV7?tx*KuNA)VHK)P CH)VXK)`_X"A)VHpK)P^CH)VxOK)K)1ɺCP^^Nj;SsE:,u@BJP2.DJt%9~{uC V7CV7PaSY9s8}u@&@x}t9r{uC ^{9s9r։v!?t{u#P9sPP2.DPt 1e[^_]UWVS} UҀcE tEp9J) W^ ZjLXt3SUUw$@@EjP|1ɉMZYuS Z ]lp1tEEU1}EEuDžh1.1DžhDžxEEMU싅hE1C C{1҉S S$S(S,C01ɉK4K8K ދG9 P2.fTQffUu<_p9wu G9w s^DYu _< u ]Cuf}<_9wNP2.DJ_bP2.9wuDJu _FfDB9wufu _bDZÀ>_ f_ 89a;wXP2.DJu _?9wu G9w 'NDJ_ G9uG9< u ]CЋ P2.DQEED%EEMulMAMMAM=X=Xw=H =P =8t5!=p=x0=h%qERGPx u )MuMA}dM)ыU9uG PVRm @ڋE]E9uEƋEEEEuuu uM%EEG]4븋GM90t.0uuu E)PMB^Mu%]\uuSuM '@ SUT\%=uK똁G؋HUM+W Puuu uM{Wu}4|G؋PH UM+W PP uuu uMu;Wu}t| (9uE9< e[^_]UWVSEUM} MƋ]U9UE@EEM %=p=8pwL= 3w$==Sf=|=(4=05*=Xw =H =P<=@=`=h=wE=w=xE=D==fzk=tlw=t#=t1z=ofwWf98f=|TEsf>E]fy%Nf<f%fUB CE!! ؉ʁU! ˅EHU)ЉEM~! d!EtkEȋUt %AE8! ؁UUÁt!! E=؃[^_]UWVS0ƉUMȋEE܊E܈EF(E؋F0EиMjPh{PM U}tEؿ]9^ t9^u Ft}]Љ]̀}t]؉]1ɉM]9^tf]E fE1҉Uԋ]9u }t]]f uRUufuFuJ$M~1ۉ]1f} uBu"1҉U1f}Ff~u|}R(U1ɉMfu1҉UFu EEf}u FuME}t#ˉMuPuPM UkMuf~t#fWҋ P2.Qu?f_t9f}fMQҋ P2.Qu f}_zftQ P2.WQu f_kf}t)f}xfUBQVf}_KyuPSPM UftOf}tgP2.OJf_ f}_Zf_ 8u_CfCU P2.DQuf}_f}u2ы P2.DQu f_tuPhwPM UŠM t }u@}}]9]t:}9t3uuURPM U]]f} EF}toEF1ۉ]t`E@EWfzfzfz+f1ɉMf} /1Ee[^_]UWVSljM]U;] HEXtxt/Ht suFƁލNMXu.ދt %FEAXw80tYwE@E(t<5MH$pxhEE@EMjuSUEju uM‰9EtMICjVSMU WVSjuSUEju uM‰q9EtMICEEjVSMUK tMM9tEVSMUMjuSUEju uM‰9EtMIˍs@M%\jSVMU 9Et(Ss@Ӌ%=uKSVMUXZ=%GU+W Pb%GU+W PP CEE]FEe[^_]UWVSlj։ME 9EE@EEE]%=wF=(w"== =tf=0t}=`&=w"=,=tn===;k9uu1<Ff99utF9utFMA g9wuGG9wuG99wu Gi9w s;ws~ uE@eG9t9l> ދG9 P2.fTQffUu<_p9wu G9w s^DYu _< u ]Cuf}<_9wNP2.DJ_bP2.9wuDJu _FfDB9wufu _bDZÀ>_ f_ 89b;wYP2.DJu _@9wu G9w (NDJ_ G9uG9< u ]CЋ P2.DQEED%EEMulMAMMAM=X=Xw=H =P =8t5!=p=x0=h%qESGPx u )MuMA}dM)ыU9uG PVb] @ڋE]E9uEƋEEEEuuu uM%EEG]4븋GM90t.0uuu E)PMC^Mu%]\uuSuM '@ SUT\%=uK똁G؋HUM+W Puuu uM|Wu}4|G؋PH UM+W PP uuu uMu;Wu}t| (9uE9< e[^_]UWVSEUM܋}uE fEӋU9UE@EME%=p=8wN= Bw&==fEf=|*=(F=0Hg=XSw =H=PM=@=`=h=wF=w=xW=q==f}zw=txw=t(=t8=f}wdUf9U?fEf=|E~fEffnEffEff}yRTfEff>@/1f}&(f}UEMA @ MMًU)M ЋUEHU)ЉETMڊEtwMMсt ڍDU7DE%EMȋMI tE؊DEC[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹}ƒ}t H}܉E9C t9CuCtEx1EE9CtffEE fE1EԀ}t!puRURW UuEEf u@Eu<fuCu p$fE~1fEf} u@u#1fEf}Cf}~ufE|fE}p(1Efu1ɉMCuFEf}u CuMFt$EEuRuRM UƒNuf}~t#f P2.DAu;f_t5f}E P2.DAu f}_fEzftOP2.DHu f_f}}t&f}MDHf}_fEyuREPRM UPƒftWf}toɡP2.DHf_ uP2.Dpf}_Ɖ 8uaCf7E P2.DAuf}_f}u4 P2.DAu"f_tuRhwRM Uƒu ր>t}EEHQMuRUT U9UtUtQ}̋U֋MH׀}tuuuREPűM U‹uuf}}twEC1҉U>tgE@E^f}zsf}zbf}zQfI1Eef} fEEe[^_]UWVSljM]U;] HEXtxt/Ht suFƁލNMXu.ދt %FEAXw80tYwE@E(t<5MH$pxhEE@EMjuSUEju uM‰n9EtMICjVSMUN WVSjuSU,Eju uM‰9EtMICEEjVSMU tMM9tEVSMUMjuSUEju uM‰9EtMIˍs@M%\jSVMUl 9Et(Ss@Ӌ%=uKSVMUXZ=%GU+W Pb%GU+W PP CEE]FEe[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹Pƒ}t H}܉E9C t9CuCtEx1EE9CtfEE fE1EԀ}t!puRU&P UuEEf u@Eu4fuCu p$fE~1fEf} u@u#1fEf}Cf}~ufE|fE}p(1Efu1ɉMCuFEf}u CuMFt$EEuRuRM UƒNuf}~t!fG P2.AuE P2.DAuf}_f}u4 P2.DAu"f_tuRhwRM Uzƒu ր>t}EEHQMuRUM U9UtUtQ}̋U֋MH׀}tuuuREPűM U‹uuf}}twEC1҉U>tgE@E^f}zzf}zif}zXfQ1Emf} fEEe[^_]UWVSljM]U;] HEXtxt/Ht suFƁލNMXu.ދt %FEAXw80tYwE@E(t<5MH$pxhEE@EMjuSUEju uM‰w9EtMICjVSMUW WVSjuSU5Eju uM‰9EtMICEEjVSMU tMM9tEVSMUMjuSUEju uM‰9EtMIˍs@M%\jSVMUu 9Et(Ss@Ӌ%=uKSVMUXZ=%GU+W Pb%GU+W PP CEE]FEe[^_]UWVSlj։ME 9EE@EEE]%=wF=(w"== =tf=0t}=`&=w"=,=tn===;k9uu1<Ff99utF9utFMA 9wuGG9wuG99wu Gi9w s;ws~ uE@eG9t9l> ދG9 P2.fTQffUu<_p9wu G9w s^DYu _< u ]Cuf}<_9wNP2.DJ_bP2.9wuDJu _FfDB9wufu _bDZÀ>_ f_ 89b;wYP2.DJu _@9wu G9w (NDJ_ G9uG9< u ]CЋ P2.DQEED%EEMulMAMMAM=X=Xw=H =P =8t5!=p=x0=h%qESGPx u )MuMA}dM)ыU9uG PVE @ڋE]E9uEƋEEEEuuu uM%EEG]4븋GM90t.0uuu E)PMC^Mu%]\uuSuM '@ SUT\%=uK똁G؋HUM+W Puuu uM|Wu}4|G؋PH UM+W PP uuu uMu;Wu}t| (9uE9< e[^_]UWVSlE} UE8e p >E F E ЃEF@EFEF=/.lt1ۉ]tMEAEW_ YE}M9MP F,EF4EtpF8EtfF UtC1ۉuEE1ɉMMԉ}ĉUȋEE1}܉}}}tF0x)9sڍEjuuM }u ~DEjuuMUà uE܃}u ~DEu$E@@@P迖EZu E lUJ@9r!@@ @BۋE% FDuEuuًU&Y_yFHuEjjuuًUV}uP&EZubU9s=K}juuËUЃ tjjuut EЍP}EEEċU)‹}W)É__ }tWEX@E9r}@@@ B;UrEEtP葝_EԅP^t1ۉ]tMEAEWb YE}M9MSF,EF4EtpF8EtfF⋅D$ ~D$D$$Ne &.&.&V9sNuE@D$ D$D$$d Pf.&.&V9sNu;&N9sVu PgN&.&.&N9sVuR ZPgN&.&.&N9sVu;rEPgNf.&V9sFuEx6ogUT$ D$D$$]Zf.&.&.&V9sNu;t94PgN.&N9sVuPgN&.&.&N9sVu{Ex̊ @ ?ውVPgN.t&.&V9sFu鋽Džȉ&.&.&N9sVu#1xgggD$D$D$D$ D$L$M $.&.&N9sVuD$D$ L$D$ D$D$E$ҋȉ.&.&N9sVu鋽BD$BD$BD$D$ D$D$ $_ Ȅ.t&N9sVuAD$D$hAD$D$ mAD$\AD$XAD$TAD$PAD$LAD$HAD$DAD$@AD$<AD$8AD$4A D$0A D$,A D$(A D$$A D$ AD$AD$AD$AD$D$ DD$D$ $] AD$TAD$PAD$LAD$HAD$DAD$@A D$<A D$8A D$4A D$0A D$,AD$(AD$$AD$ AD$AD$AD$AD$D$ D$D$ $ ] B D$(B D$$BD$ BD$BD$BD$BD$D$ D$D$ $\ snit&.&.&.&N9sVu̥l.t&.&N9sVuTga.t&.&N9sVu{ i.t&.&N9sVu;Qu.t&.&N9sVuv.&N9sVuv.&N9sVu{EDžDžDždgoug~@D$ D$D$ $EZ .&N9sVu@D$ D$D$ $Y N.&.&N9sVu;A D$A D$AD$ gD$D$ $6Y .t&.&.&.&N9sVuD$ D$D$ $X 1v.&.&N9sVuUE@D$ gD$D$$&X EDžDžDžDž DžU1})` UWVSt ÉU11 DrEEEEEEEEEH>U DEED$ED$$UU}ĉ|$T$E$ ƃtdE$X ƃt'D$ED$$HU1҃ډ踩 MD$|$E$蛨 藩 M荩 8D$ED$$Tk 8t[^_]Z UWVSP Z Dž/devDž/XtyDžyXXD$g$Ut-ƍD$D$FtH4$ 4$OVD$D$ D$D$p$R@Džgp0ƅpD$D$<$TƅtFL$D$<$XuD$<$Xtg$BUnC蜧 P [^_]聧 8u)΃wΉ<$VuD$D$<$S`TEE ut|$E$AUt#ED$D$ ${EtED$D$gt $ۅ 1P [^_]پDžUVS ;ED$ED$ E D$ED$E$tKB; ƃt?uE$SE$:[^]ËEUE$sS[^]þUVS êH H;l D$D$$p t@l $q ǃl H$RǃHƃl 1 [^]K 0ǃl H$RǃHƃl t 0ǃl ${RǃHƃl ߤ UWVS< ÔuD$/4$h D$@4$'Qƃ%D$T$$PV 4$QƄ=D$D$D$D$ D$D$ D$$~ tVuw: ul<[^_]Àl uMQ Ɖt$)XD$ gD$D$4$}P =x ?l ` UVS_ uL 3D$/4$2g "Ht$l $;  l D$D$H$m cD$ D$D$H$ !Ѓ2l D$D$H$軙1[^]_HRD$D$%@4$NHD$t$l $ 脠 Ɖt$)XD$ gD$D$4$N =諡 ?GV$K tƃL Qw 8#u͉4$ƃ Z J 0_> 0UE$]UWVS$1 E@ E։υU };EE EU D$T$ $""""D$"""@9rlMϋE eʉ)M]E@}UPp]uXhpl$[^_]ø""""9"""s1$[^_]É1ʉEUE };EE EU D$T$ $""""D$"""?]u9rM΋E eʉ)Ήރ߉u}U1M E#E }T$L$ $""""D$"""?UM]9ȋEE9EE },EU D$T$ $D$>9MϋE eEUM\U1M UME#E }nEUD$T$ $""""D$"""\>9BMϋEE}19}E UM T$L$ $D$>]u9M΋E eƉi`T$L$ $D$=9MϋEEƉ]u덁݉a)u}T$L$ $D$+=UM]9ȋEM""""9""")Ɖm݉]u UWVSH áD$T$|$|$D$$8 D$$H*)R)L$L$ |$M $?8 tkM] +L$\$T$$z)ƍv)ljD$T$ )Ɖ)ڍe[^_]øUWVS8 ǵ}܉EԉŰP2.ljEtGJ@t@-+RӋ}tWAʉ@uk-t͸+t@(1ۍJAt"<(5<)uf~ʍJAu18[^_]BË}tG)1}GY1}Dw11Eȉ][5̉ ‰Et^EЙ׃ЃEԉ0xE܃Hʋ]DKtMEܸ9 }Ã0)Ӹ9ȸ|땋Eȋ]܃t*}̉u2 8[^_]ÃGEPXẺ 8[^_]É믍EEЉÍ}v9s MtQBHuހ.tẺEt,}L2.UЋu؍LDFt uf}am}a.m.f}pm}p.m.@EЉ$]M E܍ g D$EЉ$] u݋FV }ԉWFẺẺ}J1}ԉ|}<}<Ԁ}.XEE܍ g t#D$D$EЉ$]蛈 uKE܍,g t+D$EЉ$]$ u}g]܍#D$EЉ$ t2,g t%D$EЉ$]ƈ u uE܍L]̉ލg tD$EЉ$]肈 uruЉ4$]k T:sE܍LD$EЉ$]A 2u݀}u<E]DCt.E܍D$EЉ$] u1ۋEЉ tC.uu#ỦD$EЉ$]诇 Uus5uD$EЉ$]x tu#GW ]ԉSG UWVS Ƌ'<'wwEVN)щȉMEED$$`t_FMȉFD$F$i`t:F]؉F>FDF 1[^_]ÿ'E {UWVS5 D$`D$dD$hD$lD$pL$|L$011DrD$0$|$H$L$4$T$8T$PD$\1D$TD$DD$`LD$@|$X\$LD$\D$`M|$Txq|$X\$LtL$T=qwT$`9@-D$@tT$T=qw L$`9@tL|$D|$X\$L\$TD$lU D$TwD$T|$X\$Lj|$XlFD$\D$`t$\PT$Lk)ЋT$P ‹QD$dT$hD$t ] 1uUT$$]t M1uU T$$;tFu̿[^_]UWVS ˲pt:l>t M1uU T$$K;tFu̿[^_]UWVS 诪 dE $ ƋE%EENgUuUT$$$…plU>t M1uUT$$:t1FűuUEEu54$6E [^_]ËUt }1]uЋu9t!$UV D$UT$4$ E0E렃}tE1҉UWVSw ,u Ex}u 4t+D$4$9uE)E@ [^_]Ëp t 1[^_]Ét$HRD$$nUWVS âE D$E$Pf D$ED$4$NjE8tB|f 8"tn@.p uOt$ E D$~rD$$҉[^_]:f 8"u썇vk.뱋p t[^_]ÍvҋE D$jrD$$mUVS åuF$3F $34$3[^]UWVS$货 i}E 1t u$I+E[<$ E܋MAnD$4$/EMA  EU P8E܍NgMUT$${!ƅ>nED$=4$( HE } M D$4$(7uM+E U W tMWu9wt!Љ1RMWu9wu ~oVEN1ɋE jp t(E܉$M2E$B2EE$[^_]Ét$HRD$$k $2ffffffUWVS8Υ Ãuc D$rD$4$`{uD$:4$' DžD$D$4$({hF$xR $(D$$D$D$|$ D$D$dR4$5$(6D$D$|$ D$D$4$B5S|$$ƅ>d~kD$E D$ ED$D$4$tWD$D$zd@ $ A  $2D$$R |$$ƅOD$E D$ ED$D$$$D$E$tPT$$}$>/$0/` 8[^_]À>/uEt$D$<$St'D$<$D S` 8E D$t$E$wu}뎋E D$cD$E$VuE D$D$D$ ED$D$lR$2BE D$t$E$ur_ E D$rD$E$tDž1D$ rD$E D$E$ Dž1kt_ E D$rD$E$Ot1;$ 5_ t$ 'D$E D$E$ <$ 1rD$E$xD$/4$S^ E D$D$E$sDžDžv^ E D$gW`^ E D$gWUS(X EEED$D$ED$ ED$D$E$0x E([]øUS( áEE>ED$D$ED$ ED$D$E$W0x E([]øUS(耟 5D$ D$$?D$D$D$D$D$ D$D$D$D$ $/x D$([]øUS ÿED$D$ ED$ED$r$|Sx E[]øfffffffUS裞 XE$ U膞 ?U\t \]ÍY\]UWVSP }|$E D$E$q9s [^_][ ?|$ t$D$$\[^_]UWVSߝ Ô}|$E D$E$q9s [^_][ ?|$ t$(D$$\[^_]US p %E$ t []ÉErT$$\EUS * ߤE D$E$ t []ÉErT$$\EUVSܜ Ñu4$ t[^]ÅtEt$rT$$\EUWVS苜 @u} |$4$6$t[^_]ÅttE|$ t$`T$$\EUVS+ u t$E$$t[^]ÅtEt$sT$$\EUWVSӛ È}|$E D$E$ u[^_]ÉY 0|$ E D$D$$\[^_]UVSh uE D$4$x t[^]ÉEt$+sT$$\E[^]US ƢED$E D$E$uE<$ ~F [^_]D$$ UWVS ֋PË@(K${ )9C {}9s>C K$S{})9sT S M9rNC M9s C C C$C(C,KC S$T$ʉs [^_]Ë#C KMUWVS\- E}7<W11\Dr׋EEċE EȋEUEЉUԋEE؍WÙ  ,E%#jo}čE܉ÉEEU$T$ډ}}ً]ẼljE w  f1#E#U tEUȋM_E9s U,EEE̍PUP vSE(.&.&.&.&.&;Es MĈEEU̍JMR wډ~}4]EMȅ9s U>EMȃE1ۋU؅u)9s!2T2U9sE#EMȉE9s UMȋEE9s UEMȃE9v ED#MȃEDMO9s UruGt$|$ D$ED$E$뺉}UE$[^_]e{F UWVS~ 3D$ED$$t{NjE88/tbD$/4$蝐…tL)JBU=wsG|wdD$}|$M$] Es(uuE[^_]É[^_]äftUuu%1[^_]MyfUWVSs (}UtlƍxD$4$u tD%=`u'-$U ytĄ[^_]D O1Ą[^_]D 1UWVS̆ Á}U)tlƍxD$4$ΰ tD%= u''$U tĄ[^_]t}EE u[^_][^_]UWVS4K~ }78ủt$E$ϣE D$t$<$4[^_]UWVS~ ÷EE}}70E D$ED$4$=t}EE u[^_]p[^_]UWVS4} RuED$E D$4$Q=t%}̉|$E$ ED$|$4$ 4[^_]UWVS4>} }70E D$ED$4$<t%}̉|$E$觢ED$|$4$4[^_]UVS | ÐEM thP8t P8}7@:t1 [^]ÁP8S&D$D$7@<$)OH8붸 [^]UEt @:]ø]UVS 0| }7t^d".@*.T$XT$$p4}7tE$/2}7$$}7 [^]Í $3Xu뎍s$ $fUWVS({ 6}tG{E{EOEEME EM<$bƃ t tu#E([^_]ËE1([^_]ËUGD$ D$GD$<$CE9E9G?@UP2. DqEEmUT$D$<$4:E;E :E+m}EE;E tu}MMD$ GD$GD$<$vhD$ GD$GD$<$UhMAE9O~D$GD$<$9iGU9ut$GD$<$^9u7D$ D$GD$<$gD$ ut$D$<$gt$GD$<$9E;E v}D$ ED$GD$<$}gEHU9_E9G5MzUG;U D$ u4UT$D$<$gED$GD$<$P8E E&OL$D$<$f}D$ FD$FD$4$fFD$FD$4$7}tE9} uD$ FD$FD$4$lfFD$FD$4$77D$ UT$D$<$3fG3L$MGD$<$d7MD$ L$M܋GD$<$eM{D$ UT$D$<$eGU D$E D$E$]U w ~D$UT$}7$^]UWVS v Ð~u}ED$E D$4$6tE} u [^_] [^_]UMU E~tEU M]]UWVS Rv ~u}78E D$ED$<$5tEu } [^_]~ [^_]U u ª}E }7~"tD$ED$$9]ËEUWVSu ^}}EEuED$E D$<$T5t'~#tuEE }[^_]E[^_]UWVS:u |EEu}78E D$ED$<$4t)~%ftuEE }[^_]VE[^_]UWVS0t y|E}GDEE}798GH%EW,_]ԋG1ɋ];_]]؋R_]܍49;EM}u5W,M؋ +JMIʉʉʋMUMfF%] ؉Ft$G|$]fFuE9sMF^U9jbځM9OV Df~9E9rMutPG,]؋ˉM+XÍ@‰ЉЍD$ t$EԉD$<$]cMEE9G~0W,10[^_]Ã]1^E:<$]~1Ur dz}7$]UVSr >z}7p t4$ u N8@[^]ø[^]UVSDr yut4$ u N8@[^]ø[^]US$r ýyE UD$ D$D$D$T$T$ D$D$E$$[]US$q dyE UD$ D$D$D$T$T$ D$D$E$ $[]fUWVSNq y} uUM=tUG$Ur\7tUF$U5\7tBU$KU\7,048<@DHLPEtE@$\7  $(EtE@$\7TX\`dhlptxE tE @$w}\7|UUUUUUUUEE$tE$@$^\7U UUUUU U$U(Uċ,EȋE(tE(@$z?\7ŰUЋUԋU؋U܋UU䋐U苐U싀EE@@t ʋ}wHt ʉt ʉt ʉ,t ʉt ʉ,t ʉt ʉTt ʉt ʉdT|t ʉt ʉ`|Mt ʉt ʉ\UUt%  XŰE@|E@hDž$ */ E@,p1҉,MI, qfL>9<ffNv tv$6uMI,4vD> qxf~g$bO HG 9u͋9 <>f|>y_u$F,HfD99f|9y.NDfHD$F|$NuĴ[^_]Éщ$*E@,R|)ƍTxDlx9qf+fG9R)fL29R4 ʋ fbJr tv$uE@,RD 9YMQ, rfVAtωp$0V PF 9u͋tp9l9h\T$ xy DžxEP$ty DžtEL$y DžEԉH$y Dž4$uy Džx|Ƌ)΋)ȉpl9^p9dE@,H1҉tvf~94>ff~~ t‰ljv$fu}O, I4F uf~0r$4W PG 9u͋9 Ƌ9l9|)ȉ9~ht|Ƌ)΋)ȉpNj9p9 E@,H1҉lht}f~94>ff~~ t‰ljv$nu}O, 9I4F uf~k$ W PG 9u͋9lhwDž?lxE@,@xMT6MA,@ƋQHVfF94QDfHD$A|M$uDžGGG GGGGG G$FFF FFFFF F$,B0B4B 8Bǃ< <ǃ@ ^ǃD vǃL #ǃ :ǃ$ 'ǃ( #ǃ, #ǃ0 #ǃP -ǃH -ǃX _ǃl |ǃ oǃL -ǃT -ǃp <ǃt >ǃx *ǃ| !ǃ f2E@tgt.Ex tAu[^_]ËE싀t(VT$¸&T$ D$D$E$o1.t&.&.& Tp=u[^_]USA NIM1&.&Tp =u[]UWVS,YA I EƍME$+FF(9u݋uD$$78Cuxu'D$$$3/T$$2ǃL !ǃ8 +ǃt !ǃ< ,ǃ !ǃ@ -ǃ !ǃD .ǃ %ǃL 0ǃ %ǃ  `ǃ %ǃ aǃ ǃ$ fǃ ǃ( gǃ %ǃ, hǃ &ǃ0 iǃ$ %ǃ4 jǃL %ǃ8 kǃt %ǃ< lǃ %ǃ@ mǃ <%ǃD nǃ< %ǃP qǃ #ǃH oǃ #ǃX sǃ %ǃ\ tǃ $%ǃ` uǃ 4%ǃd vǃ, ,%ǃh wǃT %ǃl xǃD ǃ ~ǃ #ǃL pǃd #ǃT rǃ| d"ǃp yǃ e"ǃt zǃ ǃx {ǃ `"ǃ| |ǃ ǃ }E2xU U}tPE}Uu(x<uD>E tAuЃ,[^_]ËE}܋u苗t(MIL$&L$ D$T$$%Ep }Wp}^X^X^ X ^X^X^X^X^ X ^$X$((9u,[^_]$>L $<t $^ $v $# $: $' $# $#m $#[ $-I< $-7 $_% $|T $oD $p $rd $y| $z ${ $| $} UUS; :C ]p JHJHJ H JHJHJHJHJ H J$H$((9u[]ffUWVS0; BEU܉M}772EE4E fEE$Hƒ=4M4%y 4 44fǃ EDPfvM䋑f8;@E fWf^fqf$MdU܅}7Q)ʉ$ 2E$N‹E@ @M M4 'UfB 49}} 4% 44;4tf  r7f1҉Ѓ0[^_]ËE44%y 4f y4D$ D$D$$I 4449)‹4L$ T$U؋MȉD$E$!4;4U}dž4…f 4xp4fǃ 3E$>0t3E$=E0U,)4fǃ E܅U0tE@ U؋4 E44B%y 44D$ D$E‰T$E$~v4%y 4 494114M%y 4;4)fǃ Mԋ4D$ T$U؋ED$E$U؋M~4y 4 49411x4Wy 4 494r7ff @}AEE܅U$-E$‹E@ N@FM MtUB.jE@ U؋4  UfB 9 4,fǃ !E܅{}7Q)NUm~ 4}} 4Hx6 44m4%x4뿃ߋ 4}} 4%y  449}fG Ef` @*.D$ D$!D$L$ض $U3 \;Efǂ ǀ4ǀ4ǀ4ǀ4ǀ 4]UWVSXS3 ;u}7MV8у$33`".EEt}7 E)V8N<t=%G*tE11zE}uAX[^_]Ãt $*tًE$E@EFF$گ Ut p@뮃$<UVS- a5ƍ D$4$ sD$4$ 4$ 11t)0tGB<1;NVt~΅u׀>u|F[usVmt2t00uVFtJeNVu1UWVS04, 3Uu :uH2tU$1YUF@fu2ML$ MD$T$<$#2M EPJ(N$JN 3s$D$D$$ FTs$zD$D$$ FXV  ~$}79}7NT}7 }72P3PB0zp12džp2E싂E苂TEtU܉Udžp2ELɉMEEEUtwD$Eԉ$UiE܋U؉$!Mԉ $E܅IH 1$µt2džx2EE-EED$E$ u džx2EPED$E$[ u x2t|$E$: u x2dž|2UtE)dž|2E؃0[^_]Ë@@Dǀ@l@hǀǀǀ<HHpF$B(EU܋ED$<$~ UEU܋ED$<$V Uu p2MU܋ED$<$( Up22@@,EF@fL$ D$ZD$<$2XE1ydžt2džx2Edžx2;Et ED$E$N u dž|2EtD$E$* u |2|$E$ |2LMFEidžt2džx2dž|2Mdžp2EEdžt2džx2dž|2E@tg|$E$ uTx2dž|2EJt|$E$ u x2dž|2dž|2E8ENdžt2džx2dž|2ExOAOU % ,}7D$E$]US$ Ø,E}7H$ }7H }7HT }7HX }7Hl }72 p2 t2 x2 |2 2$4P[]UD$ +M}7tJX}71]ø]fffffffffffffffUWVSLjMEE_9tBfxft0fu9PuԀ}tMHE 9u[^_]M@EE D$E$UElUUWVS \# +}ƉDHfx 4 [^_]Ëf=tyfDN4f>tX$]輦TP.t&ffB9uǀFF [^_]ËEFf\Nu]ED$$]YMME$ ]UMtZf@f@@ f@@f@@]\]X ]]9Eu]$ұ$0]@*.D$ D$D$p$Ȥ $]$y$׃UWVS t! ))Ɖ׉M$ ttLMt5$LVp9uϋ}E$TF [^_]É}UWVS (Eu^.&9t)fxf8u@$9u׋~1$]艬9> $]q4$i[^_]UWVS Xt&.&9t0fx4ftfu9VuF9uЃ [^_]ÉMFUFҋUMuUM$MUUWVS Q'}fǃ $?P.&ffB9uǀ2ǃ ǃ ǃ S2@tL$ =w4D$T$$N2!9u[^_]Í$h$ƀUS m &E E}7t+2UT$$U(E []ø []U %UM ~*}7t2t _1]É1]UWVS  r%}7te3339}}<31 [^_]à D$$?‹3t333뱸빋3L$PT$$x 33]\33u-U  $E}7t%2UT$$1ɋUE]ø]U T$M}7tJT}71]ø]UWVSg $}<$ƃuOG @tI& 8u?}73t-}7D$}7$Htǀ3[^_]UWVS  Ý#EU}72E EE$3= %y   fǃ LNfu f9q fmffjMUU$) E$mE@ @ME@ M  %y   LNf   yt鋓  9f y [^_]ËE$Ot3E$8=DEMR [^_]ÃUfB   9| <  9f [^_]Ë %y  ; fǃ Eu-E$E@ @aσufF }7Q)=  Ef` [^_]ÿ@*.D$ D$ D$$蝛 $zUWVSf  u}7MqV8у$2c33`".M MEt}7E%F8V<t|‹F EHEP,UD$U T$PT$ PT$UT$$WB[]ÐUS Ø}73t`3$貇[]1[]UWVS  Xudž243@fu|$$> t%F@f|$$ 43`3<3h3@3l3D3p3H3t3L3x3P3|3T33X33\3383d3Fl83Fm4322<32D32H32L32P32T3222@3%2fdž2432<32D32H32L32P32222324832@3%g2`33@fuT$D$$  [^_]dž3}7}71 [^_]ø|$$ UVS }7$LtHl}7 Pm}71[^]UVS }}73ug}7~7ǀ2233t9@fuT$D$$ [^]V1 [^]UVS * }73ug}7~7ǀ23tE`33@fuT$D$$S [^]1 [^]UVS A}73uc}73tW2u<23@fuT$D$$ [^]Í21 [^]UVS ƪ]C=w"Dt}7X }73u`".1[]mUSP  }73u`".1[]4UVS  }7332222`3d3ǀ2223@fuT$D$$ [^]x 3m1 [^]UVS A }7332222`3d3ǀ2~73@fuT$D$$A [^] 3m1 [^]UWVSn # } M}73322l3UujU22l3~73@fuT$D$$[[^_]ÁU 3P1[^_]ø[^_]Ua  D$}7$]U5  D$}7$]UWVS  ÿ u$q 33|$ D$D$F$2VT$Ǹ&|$ D$PT$$-2VT$|$ D$PT$$F@:udž3[^_]Ë2VT$|$ D$P<T$$}78}78 w+3<$賄31҉31 US z[] g}73US B}7$K1[]USa }73t-3@fuT$$ []1[]US þ}73t53@fuT$D$$d []1 [] e}73ts31 ?}73tu31` }73tUs3E1]ø, }73tUu3E1]1U }7U31]UVS Ê}7@@fuUT$D$ht@$进 t Efu5  PwtU$Ѓ[^]Ëǀ3[^]Uft}7}7UWVS,2 , ( f}}7@@fu|$D$ht@$ }7 t }f}7}7;Pu9HtL$MԉT$U؉$6QMԋU}7;Pu9HtL$T$$Q43@fuT$$ 3@fuT$D$$$$觕,[^_]EfEf}7;8t8>LJ3}9t:ǂ3iEEEEEE  D$}܉|$$B ǃ( ED$$U $ ǃ,  US , t[]ÍD$$ $ ǃ, []US Â, u[]Ë$ D$$躶 ǃ, []US$ :( t$[]ÍiEEEEEE  D$ED$$ ǃ( $[]US$ ÿ( $[]ÍED$D$$躷  9Et( $[]D$  D$$耷 1UWVS4 B}73;3@fT$$ , ( y}7B$,oD$D$ HQT$PT$@$詧 7@|US&E؉D$D$ $cUԋ@t A:zUԋ}؉|$D$$+|$D$Uԋ@X$ @$軄 D$ D$D$@$nǀ343@fuT$D$$4[^_] 7@|S&M"E܉D$D$$x  9E( }7R뒸$ D$$d ǃ, ( |14[^_]S&MvUԋM؉L$D$8$Uԋ@YD$  D$$謴 CUWVS, cEEEE uԉt$}|$$`EEEED$|$$`D$$a}73tD$t$$W`,[^_] }73tUS u}73u-3@fuT$$V []øUS h }73@fuT$D$$ []US }743@fuT$$蹋 []>US ÂE U 7RtI|t7S&T$D$$A}7ǀ3@$ 1 []ËxtS&T$D$$}7ǀ3@$蚀 뵸 []UWVS  ùE}72tQun7@@tt\ǂ2S&T$D$$`@$ [^_]7@t ǂ2뮿 [^_]7@tǂ2{U+ }72$]ffffffffUS]E  }t J;}R ;~[]ÃUWVS p}tG8 u^@u[^_]ÍtG~W,EO(G\p;}@ ;~9Uu׋u멉<$G8UEU t9P| @,]1]ø]UWVSu] UtSx]F9}VxR)9H t7~,}߉ˋF(D$NQT$$U91[^_]É봸UWVSu] UtSx]F9}VxR)9H t7~,}߉ˋF(D$NQT$$U091[^_]É봸USEt=H~6X,1".&.&.&9t t[]1[]UWVSu~~?F,E1ۋF(D$NQT$$ًU9u1[^_]øUWVSu~~?F,E1ۋF(D$NQT$$ًU-9u1[^_]øUWVS}] UG9)9i4utU}t]G,E] Eu pW(9|_9}W(p 9 _9} E E;E 1[^_]É듋uW,G(D$OL$$D9UED$ PT$D$$]UWVS}G~EW,EH;}@ ;0~09Ut_(Gt} u̓1[^_]USEP(]U@,M H;}@ ;~1[]UWVS}t@G~2W,EO(G\p;}@ ;~9Uu׋u[^_]UWVS]ta{tZO~[w,1 t&9tItC~2S,EK(Ctx;}@ ;0~09Uu׃[^_]Ëu[^_]ffffffffUWVSn #ЍR4ր33V,U39VG8 L4U;W81҅ZE1EEEEẺEUMD>EED$D$ E3@@D$UT$M $mV,UD>Mȉ$|UV,E3EEE;4ML$ T$D$E$7ED>$}|EENjE94~-D>D$E$dEE94ӋUЁĄ[^_]Ã4$ D$t$ ED$D$<$‰ЁĄ[^_]ËED$ T$D$E$ED2Mt$ D$BD$$D$M2$P‰ЁĄ[^_]úsUWVS8 üƉEЉU̍R4Eԋ4}8<$ ƀ?EEE4E؍EE'E$zM9Er;UU)ր?Et)E؉D$ t$|$E܉$xEy8[^_]Ë}ԋGu܍WMtFȉ׋uԋ6tftE‹u)uƋ@tQuEt}|$D$ $Uv UEЀ4SŨ8[^_] EԍPMtыujuE)ƋEԍPCt$D$ $Uqv U)u}E)9s뷋E9r7EԍPEt3t$`V[]øUWVSO u3t$e3~#14$2n;3|ߋ4$nd3ǃddž3D$0$vi4t`2PtD@@X~:Ɔ3E$02@PX3@$41[^_]Ɔ3UWVS4 u3t$J3~#14$m93ߋ4$l[^_]UWVS]33E 4~443ujUz11"v.&.&΃39}+0p49uu΋u )΃39|1~O39~5114uPu;3|ى[^_]1[^_]@,4WP\4T U U 4O)Ή4W )ʋ} T4T L4T |3 XUVS îutKFX32@@Tt,D$4$ E D$FX$1[^]øҸUWVS AEExD$D$<$mƅt,)‹M tEt|Etuu)1 [^_]ËE tmEtYutREM`~7 u)1MfT$|$E $mE 01f%и [^_]øzUWVS TEEME $l}E(EyEƉE1҉9s& u EDE9ru EtEfEtE䪅i1[^_]ÉEE $lu 9}$ktu EEE uuF9s6tGE9su DE9ru Et1fEt1ыE%U`~7tUft ЋUEH1u ]9rMu EEE EuuF1҉9s"uTu EDE9ru Eu_EE1GE91GE9r뷸[^_]EE'vEfEfmkEfm2EE1E 1fm EEdUVSb UE ӁttH@[^]Í €\7ʋ JHJHJ H JHJHJHJHJ H R$P$ [^]UWVS vutv4$wVȉ‹9u F0$eF,$e}79pt]9p tJ9pt2t$d $fe4$^e1[^_]@u@ 9pu@9p uUF4$e>9UtU?$9Uu~X24H90t…#ȋH90utJ$d2UWVS 8lj֋@X2BTttO@ ttO@ ttO@@t tO@@ttO@ttO@ttO@t4tO@ ttO@ @ttO@@ttO@t@tO@t"(ttU<$,UtB8tt<$u 1[^_]ËGX2G@%G@RR8t Ɖw@Ѹ[^_]UWVS OƉ׋@X2@Ttf@ tf@tf@@tf@tf@tf@tf@tf@ tf@@tf@tf@u;u?uGt7@@8tf@1[^_]Ãf@t4$t4$미[^_]USU MU }7t%t X@t @@f%f1[]ø[]U U}7M u]_]U U}7M u]]UVS hE }72Uu0ÁE% úډ1[^]ø[^]USU U}7M u8tHX2H@H@[[8u1[] ʉP@[]U }7U]SU }7U]UVS n}70tFFX2@Ttf@4$4$7@@8tf@U1[^]USEM Ut%t X@t @@f%f1[]ø[]UEU Mu]i]UEU Mu]5]USEUu2U Á ӺEڋE 1[]ø[]USEU Mu8tHX2H@H@[[8u1[] ʉP@[]UEt@@]ø]UU E]UU E]aUVS ñutFFX2@Ttf@4$+4$7@@8tf@U 1[^] F7PT1 t t t@t̀t(t t8t ttLt 1 7PT1 t t t@t̀tt4tt t@t@t(t t8t ttLt 1ffffUVS gu4$| D$t$}7$H [^]UVS u *u 4$| D$t$E$ [^]UWVS < uE }7:x<ut&.&9t<uЉD$t$<$ [^_]É4$| UWVS Å}}70E D$ED$4$|t<${ D$|$4$K [^_]UWVS v +u}ED$E D$4$'t<$x{ D$|$4$ [^_]UWVS! }u}7E D$ED$$UǍt/Ux0u 9t<uƉt$|$$ [^_]ÉU<$z ƋUt$|$$W UWVS =}uED$E D$E$6tAxEut&.&9t<uƉt$|$E$ [^_]É<$>z UVS óu Ex8u9t<uЉD$t$E$| [^]É4$y ffffffUWVSH F}EUċEG,4@4E@U {}X E EG@E̋GXpXș)։uȋE;GTEȅ~E1ẺE9ut3EĉD$<$藼uH[^_]à zE1H[^_]É$ ['EEFEȅE@$ZEyEGM+M9E O(U @9~F t$vhF E@ffO@EE %WHUUȁ ‰ЋM ȉFEfFE@EȃvA}${NMLO HG E9uЉ}FMăU U~g։}NjUG tUMȉ$gG UMȋE@A%GGfGfwu}G9uOT9pO(LE @ 9}Gpt$ EĉD$ED$<$EEGT9tBuW,u P GG(<$FEP1Ʌt=Uȉ}$MjMTO HG E9uЋ}E  G(MJ9~R 9}ED$ D$ED$<$B%UčJ‰Uĉy19uĉ)UBHFBLfFMEy19E0B,4v4BDfFt$B|U$du 4M$WE u E;GTuO,u u6uč @4PA!EE;GTG8 <$<$2 EE EOT9E M MO(ʋH98OU9U+GHFGLfFfFUO9{UGDt$G|$jcu2 ȅM cUuUȋu6O, 4I49~X}uEFDfG|$F|$bFHGFLfGEȃ9FEfxmMO(E @ 9}EȉD$ EĉD$ED$<$M MG8 @}78u E<$GG8 <$gEuĉ׉EċE MO(@9/(E w(t@ 90}0OL$ EĉD$ED$<$EEGT9tAuO,pM EG8 3E RW9)ʍBE <$9ENG8 <$n[tUWVS 8uE0E,EP@,Dt@ 1H48~xfHf@fuEfx~OE@uFE@#h2u `~7:tx}$K t$KutE1[^_]f~E@tfx~݋E@u}7{uGm뱅t}$K u%D$}7$G}$J QiUEPT$ PT$P T$P$11^]UWVSEu ]MU}}} }uyE]yE˅y1ۉׅy1pu؋M)ًP)utu9nP Uu)H)ыUt29OM)ىʋM) xHMUщMUMʉUuu܉uUU UMU[^_]z뭉U델[^_]UWVSՊ Ê}7@@MtǠ7J y S&ED$D$Ǡ7@$,]A@„r7#A@t2ED$D$@$\B@r7#B@~ED$D$@T$\A@Œr7#A@`~7t $E[^_]uX~tǠ7S&ETtS&D$D$BL$-\`@Ǡ7S&EfED$D$@L$[`@`~77[^_]Ǡ7S&EUWVS ƘuEӉ΋}$EP, 9u;u t5 D$E D$ |$t$$]K6[^_]èuUWVSĀc E}7Eԋ3 ]}7]JxV HJHUE@8@u B8@U B@ ]S&t$D$7E@@D$ZEԋ@@H D$u4$]蕗f8E@PhtzEԋs]sE}78 S,11.&.&.&ȋ ˃9|u 9> Eԋs/E@ Eԋsu EH| P,CEfEE}\~7}]qM I, 9quV2xH uV p92fEuu؋sU;z)R,M<} :MMUQыP,UMUhyEE EuFD]䉃 FH fǃ  ED$F|$#"iFLf FHEċEԋM؅~E@,}D8uF,}8E̋@E;F\E̋@ EЅI}9|GEЋCEE@,]] R]܋]̋[UЍ.&A@uUEPrLuȅ]URu`~72@ x]9]ΉMEu FuE܉D$4$]u (]ԋHP}|$E؉$E[E؉C{9}(UEH}ȅt}9}E}89^y1ۋE<9|"E@EčPE9E9U܉bƋUԋSuE܋U9}|:}EcUċE܉D$4$]UCEԋ}U9{tSEM9Hb{E}79UR zsC}]9]EԋEP:xE@EH u;F}F(9~E 3tEu;Cw|MȉE3Fu)F)Ǎ)ƅ~ED$4$]utʋMȉ}yEE@@LEEԋHE@8ZZE8tE]D9FEP]9ډUMUȉ$]/ EMЉÉ؉؍][ )؋])9EUr8^y1ۋE<9U܉[^_]ËE`~7E}G}WX@#h2t $0]S&D$D$Eȉ$SEԋ}uW PEw P,u2 R4UE9x]DFfFt$D U$!UDfF4E9u]䍃sD$ WD$D$r $7 E@ xkE}G}WX@#h2Et @@D$$];[E}7EE@9SD$$]EԋCB[EEEE܋E;E^]9]#}E܉D$4$]$FNj]ԋSuEƋE9~@9M9CSD$$EEԋKiSKD$B$EEԋCCEfED$D$E$]JEԋCEYEԋsSE@9 EPSP$#]\~7Eԋ@$a ؃[^_]Ëx}HJHw1 ;G}7ƋW,tGD$BU$]UB;G|ɋELME@8k 79FEЋEP z@tP N][]̅  MċEËM)ˉ]D$\$ ]؉\$D$$]o*U܉M2D$E)ȉD$ u؉t$EȉD$4$]-*EE@ ẺD$$]tS&t$D$$N1ҋEeE܋E@vE}E;xEԋuFECFCEԋXE7E@PhE@E$]SK}GD$G$Y3]OEԋE`8@@$]Z$$ ]9E}7E̋QY,E1ލ4}R,z9~uLIR~1ME܉]9uT$U<$]MUuՋE܉EűQpY,ЃE u؋E<}܋4;aUR,:z9~_y}R~}419uT$U<$]UuՋu؋E̋Y,QB}9~E@@%E9u~_})E1U܉M0E؋@D%EU׍FUM9ƋPB%M9uU}}E)Dž]9E̋EًU)E9EEE}ӉʋuEEȋE}EЉ]uċ]9]MEȉE܋ZE@,u܋xB,p1҉]M؉M9}L$M4$]DuՋM؋E̋]9]EEEȃE]9\]EE90}уAy9E@uԋsEEzE̋Y,E܋4mEpuE܋]؋}̋q,"XQ9M$mE@8MEԋPuFD$FE܃$M&:U܉\EK]CD$C$ESPSPM؋E̋EuЉ9}9}}z}ӋBM!EuȉuȉM}ӋB9E܋u9~EEBDu9 tT #FfFEBLfF9t!BDt$B|$]Hu E̋sE; [?1ɍ UL$D$ <$]U€w֍V)ƉL$D$<$]mljEЋE̋@  EȉEu9~uE})E؋u])؃EEH,E9w]]]E})uu]9}u܉1}9| u9}9}9}E؅,9E܋u9pwE䍐 E̋@=vm EĉEE܋Hىωָ tftEĀEā =wEဃ)ȋ}܋OωփtftE܋uЉpE̋BD$ D$ED$$]AE؉uE\U܉uk|nd`t$D$$]EDd]S&t$D$$Ed ~Mċ]CED$D$ E؉D$\$$]w U܉M:D$E)ȉD$ u؉t$EȉD$4$]5 EE@/]S&L$MD$$DU܉tE܋M؉L$D$E@$DBE}̋R, }9}uE]E@,E]EE9E|EH,EE}؅'E@}ԋsE؋}9Ef r uv'E܋HE̋@1Et$qt$ $] W9}u܋]䍓 T$UċE܋@$ U(fv[1ɋE䍸 E䋀 EEpu@E܋}ȋE)NjE@X0ppuChG}uNű;JHED$ut$$]gS&t$D$$eBD$D$ D$M܉L$M $Ht$D$M@@p$BD$D$ ED$D$$M@l|$$ft$1|$$AE̋@D$D$}@@0$]ft$D$$|AD$D$ D$D$E$^t$D$@@p$5AD$E܉D$ ED$D$$tuv`D$1D$ ED$E܉D$E$]1S&U؉t$D$E@$]~@U؃9u1҉Ut$D$E@H$]E@U9uyD$1ۉ\$ ED$E܉D$E$]|$E@$eS&t$D$$?E)ED$D$ D$D$E$]E@|$$dt$D$$m?D$E܉D$ ED$D$E؉$]1Hz }p D$1D$ ED$E܉D$E$] 1S&U؉t$D$E@H$]>U؃9u 1E@Ut$D$$]>U9u HH_ppu;t#t}uNű;JXLJED$ED$$]bS&t$D$$=D$D$ D$M܉L$M $t$D$M@@p$=D$D$ ED$D$$aM@}؉|$$]ED$D$ D$E܉D$E$]E@t ]̋ ;qtE؉D$$]RaS&t$D$$(<D$D$ ED$D$EЉ$]E@E؉D$$`S&T$D$$;D$E܉D$ ED$D$E$]SES&Ủt$D$E@$]H;Ũut fhES&t$D$E@$]:u0L% E̋u;p ES&Ủt$D$E@L$]:Ũu^D$D$ ED$E܉D$E$]g|$E@I!t$D$E@L$]:uUWVSGg n]}719X‰PtFC:uk11ɋCD$ CD$C D$C$rtB[^_]]C9u}7 Q+SxSQ+S x SċKxSt1҉S1҉SQ+S y[^_]Urf +n}7$]UWVSSf nu] EM ^\UV`UVdUVhFlNpL$D$T$ED$ ED$\$4$u>vF9u+}7 Y+]^y1ۉ^IM+MNy1ɉN[^_]ø[^_]UVSe Mmut$W$vu[^]UWVSee m}GDE}798GH%E1ɋwG,pGE9M}DMfFE ‰Vt$E@|$&tAfFE9s>FVM9utс}9uN uf~xŸ[^_]ËM}9OGD$<$XtD$D$<$$1EU(d k}7$]ffffffffffUEU 9u5J9Hu-Hf3Ju @ R u 9u@Rtu1]1]UWVSc UkU} w ty1 f.&t6~RutF$qu1[^_]ÉU$t8U F@RuDžtÉv$#uG 멃UEU  HJHfJHfJU @ E]UVSb gjutv$u[^]UWVS b 4jMq~X1Q,zQ~>1҉EM׋q tMv$ZuME9xԋEM9A [^_]ffffffffUS] t[UӋE+v.&.&.&.&.& ȉt %1ȃ9u[]ËE[]UWVS]} 1115.t&.&.&.&.&.&.& ȉt %1ȃu1&.&.&Lȉt %1ȃuڋK tBu1ҍ.&4Ɓt %1uۋIuċu9 [^_]1[^_]USd` hEL t$D$, $]x)P 1[]É$91[]øUWVS4` ýgU܉L P ` E苃\ E7E@E@pE؅}7EE싳X tRyF%y }93}Ѕy}Ћ})щ})9uM)9IBljыT U)y<93}}Ѕ}}A}7L9+~ EЅۗD$D$E$m1ǃ` \ EE1ҋX u}u}7E8\ ;T |~)EЋEHAE̅q}؃E9|9;ۗT$D$Ẻ$0E@p\ ǃ` ;T QuJ, ~7lۗT$D$$i0P E8uuE@@l8 }\ ;T MJ\ AluL  D$ <$L…yP )ЉP mL t}艻` u䉳\ 4[^_]ËE1}7EEU苳X u}4y yFȉE}7E8~7)}ЋEHAE̅\ ;T }tM؃99RL D$ , $*)P ǃ` \ ;T yX E` 9U, Ǎۗ"t$D$$\.` ;X ~aP x` E@@xuL XD$<$my)P ` ;X \ ۗ?\ t$D$E@$-P \ ;T ` uԀ>X u)ʃ}7E, EԍۗEișǍry )ƋE9E@M؉L$D$$,` X EE89~1$ &P _$U\ ;T \ }7uR,r@ۗE؍, E0L P P }` [9X EP,\ 4v4~}}܅uE@}؉|$D$$+` P y}9ۗD$D$E؉$+ǃ\ ǃ` UN;H@uRFuLf~-$^` D$\ D$F $VP fI` E@$ =` P L tD$ Eԉ$…yP )ЉP 늋@lۗT$D$$v*\ \ E9T ȉljM$ gfL t'D$ Eԉ$ky)P $ AǃP L D$ , $y)P !P E)ȃ9E@ۗD$D$$F)` 9X , Ǎۗ"t$D$$ )` ;X ~b` E@@xuƋL t2D$<$/y)P $ 4$됉Ƌ\ L t*D$ , $y)P $ X E1UWVS oU $]E苃X }7M19|T X ` \ 9T }7EǠ79T 9~7ES&E)$ Eu ǃ` E98.@@ltˋM t‹UT$D$$J'뵉T \ PBh9}dX T$t$$ LƅtDE;` t4$h U S&D$D$4$&uU1T \ X ` [^_]ËX ~7Eu@@h9ME4M䉋X E;0 GE\ ` Ǡ7p >u~x~7US&t$D$$%mtGUt @@tut$D$$%@@lu$ mu\ ǃ` }7ET 9P))ΉT \ $ 둋T xǃX UhR !ZUX UT U ` U\ 11]U,R YUX UT U ` U\ E1]ffffffffffffffUWVSQ Y%}72}7E}7]19u9uVF,E1҉MEF~`CH1U.&.&9F~59uuS9~S 9}͉9FˋU9VMIS[^_]Ë]S~Cs, 9tɅ~UMڋXCӉu.t&.&.&.&΁9u9uu9u_FP W7BH8~NHD~GBlthtËuu拐tt 1O W7@ xUWVS$O lWƉEY7EBH8ˁ=u}7}@D-=}}7LJd }7Y\A`fAdBt%]S&D$D$ $!EBt8]S&D$D$ $!}7p2!P@EBlhzǁl2ǁh2BxT2@@Tth2t h2t h2t h2 t h2 @t h2@t h2t h2E[A\sfǁrǁt5Wfǁ~ǁ;fǁǁfǁǁfǁǁfǁǁ|fǁǁt[tfǁǁ~>Rr&.&ff@f@@ 9uǁp"ǁt"~@p"p".&.&.&ff@@9u}싇d %ȋtp"xt"LJl LJh 2}7E}7E ItiE9tE9tE싘d ZHB~&zr,EEz9uuMD$$]R[MIu1$[^_]ø}7ˋtiǁl2w}UM܋HQf.&% ؉9u9ut͋UMD}7놋tǁl2]tOǁl2[UWVSJ QEM ]fMf]f_}7;7Nftv}7969+}7l2tot"уt>]f9p"t"]fp"]fr"1[^_]Ét"ufp"ufr"ft|WfffufEftoEft\fYfEN}f9r"at"yfufEffEfEfEfEfEu%UVSH -PEM ]f}7;B`N4f1Dfl2t1[^]ft_/ftMfufft2#ftEfuffuffufffff끸yUWVSG OOEM MMUUf}76;F\<@<UfrftMfvǠ7? tV2vtCL$҉T$ UT$D$4$>S&T$D$$1[^_]øUF NEfx?}7;B\}1@rU f tUf vEf1]ø]oF (N}7ǀtǀx}7 t%d ǂp"ǂt"l u1U勀d %1]UWVSE M}M }7l2t^ftfvǀx}7 t)d fp"fr"ǂt"l uI1[^_]fPfftifuft_Bfthfj`d %=1[^_]fuf/%뛻늻D L}7h2UVS D aL}7l2tt f@d [^] 7RtS&D$D$$ r7M!A@f@d [^]UWVS'D Kh t}7} 3x@tOu f}7f9pdt6l2t3}7fpdQ@E % ЉA@[^_]΍N} f_f|S}7UL$2@l$,;S&L$D$$UUULf`L$2@h΍N} ff|}7UL$2@$:S&L$D$$nUUULfL$2@t$J:S&L$D$$ UU}7$UM fxGU}7$fUM fA I}7f@dUWVSA ÓIU}7pFFy ;F|# tH4$ [^_]Ét$$lUWVSyA .IUu FFy ;F|# tH4$ [^_]Ét$$UWVSA H}7x|$E$Ɖ<$l [^_]UWVS@ ÏH} |$E$GƉ<$2 [^_]UWVS@ XHU}7tX } xQH9M IX9}Bxp,9!39M t' u pP1[^_]Ë#39M uك׸[^_]UWVSEM UtY xSpu9|Ip9~BXx,9!4>9Ut'PH1[^_]Ë4&4>9Uuك׸[^_]UWVS UztzB EBE wGGtXNjEB_ ])؉ƋEBWU)Љ xыOM9NjO9}_W,9~ ! U9u뗃 [^_]ffffffffffUWVS@> FE}E E EE E @$] ÅGE؋E @ uWUXts E}7E_E))9~ىL$ED$<$]؃@[^_]à u:G1@[^_]ûkEGy1Gڸ@[^_]ËG,M؋E̋pU ʉMDEEЋGU)9|M̃ W(I9~Gt)A$fE9rTU).&.&.&.&.&AFAFA F AF9sڋUB E H %BfZE @E܃vKMȉ]ĉ}}$]M \_ XG 9uuϋMȋ]ċ}EԃUt3uމr}ߐ)fX@ fH9u}WBO(T M̋I 9}GD$ EЉD$E؉D$<$]{L<$OH<$]7E9GTG8 <$]h~E D$<$], MԋUЉE E9-]ȉMĉ:BD|$B|U$]|UBHGfG9}s*w tUv$]auUG 뜋]ȉMĉU; BUT$}7$]UWVS : ÞBu}ED$E D$4$t} u [^_] [^_]UWVS : JBu}78E D$ED$<$Atu } [^_]X [^_]fffffUWVS|-: AEMu ME $]_EMqM$]蕽EEÉEMAEȋQUċE @U zދ]}7]t_ @ U$ ]ÅyEEę)EEĉEċuMqQ)փE9yUċAEȋE uEE}7EEkEĉEE U rUUEσ tu[ $ ]yEEę)E]É]EE E  uFE EĉEY,]Eȋ}4{U]tyu4Ur }y([9;~;EȋY}U9wU@t)G$fE9rFUv.&.&.&GFGFG F GF9sڋEȋUUċuV}ỦUUĉUUȉUUUu΋^,EEEF@ED$ED$ED$ ED$ED$4$]v]D{u܋]4.tH<*t*Ѓ}v‰ DOu뀉1pUWVS(/ ê7EUM؋ufUވM݋U 1ɋU EEԋ}P2.Et$$UEx}P$u܀G$R Ut}EMU E‹E Et~MލAf qCWЙDžNE݉Et$E$Uu0Eu([^_]À}. I}ԅ~Mȃf wCWDž~]؉t$$UuUVSUE tWJ9A tX9tPZ {$uZZ[pۋt> R(ut$ ut$ut$$1[^]ûu11UVS- Ɔ5UE t\J;A t];tUZ {$u_Z[pۋtC R(D$ ƅt$D$$b1[^]ûu11U6- 4p r D$ ED$E D$E$1]U, 4p r D$ D$D$E$1]fffffffUWVS, F4ÉU:GEG<\<^ЍtP2.z;%2<:<&Hٺ!fЍ R )f )эQ0 )ȍH0p3{3F3FP}[^_]ÍGuGr3%PP2. Q8ȍэf ҉)у0r3{3< tzfȍI)f )ʈU ɉ)ʉ֍N03~;{3~G=E}uf%puN0H%}dUH]XAEdE*UUX]PGEG=E%p0%@p0%?uV0PPEUMU؉ȉM&ËE%>%tEU؋E | E%+%;E׋UEzG=E}]f%puN0HHMf%c|E$G =B}Ef%pPUuV0PUE]|EHM%+%c׋UEG=E%p0%@p0%{@2}%*f@ %-uN0HHEEG=E%p0%@{10}@%/%{@ 16}%@*%p0@%{10@}%m%@+uN0HHEE3MQ\11HCES{D8E<\G=EPU\EUVS$ U,Ơ7t| t~9t $Q| EED$D$E $!uI| tG@t  d~7 x @xt [^]É댋E[^]É| @uUWVS(# Ê+UEtBEEǠ7u4$ UT$ D$D$4$bM踵N)‰)_EีNe)‹E)_Egҍ)mUD$4$6 ɋUt\H tKx$1҉u܉.&9t-fuUE܉D$$ UuG([^_]1([^_]ËH m([^_]UWVS(z" /*UEtBEE7Eu4$o UT$ D$D$4$}kLЍB)L_E܉eЍBE)L_E>)<;llD$4$ ‹EtaH tMx$1҉u܉&.&9t(nuME܉D$$ MuՋGy([^_]Ë;pl@x([^_]UWVS(! (UEtBEE7E܋{u4$ UT$ D$D$4$裴}-?L) RЍ)Ѝ YGEeE)  IȍE) GE*SRЍ)<; `D$4$X E܋;`AQ tUy$E܉uv.&9t(~suED$$ uދF E܃9u؋E܅tЉ)43llD$E$ jEOMEuu4$ UĉT$ D$D$u4$TuĹ-?L) @)Ѝ YFUeȋE) @E)4FU։*SRЍ)43 `D$E$ }tux}cur}ulGEEt}fOMrBEER3m$AE'u땋3pl$B3`$pCk}t EE$"UWVS æ E1ҍpNt-%upHptKst!ltpNuӉЃ[^_]Å~;}~8E tىUi Uƍp@Hπwx9}몋E D뛉U) UUWVS9 084@08G4<11TD $rD$ \$4$,1t9,1.&Q9tU<u9u荕P)1󫋅4p84'Y8_4w%uwW%8H4X0@,y9r4|$$0萟t,8C,{0K44y0q 1[^_]Ë0 8a$08 t@0@4$08G,tG0ƅ`%0P2. 1Dž$Dž(Dža`,4:~Jwɋ0nʋ DK,<ʍ\yЉ,'~QaDž4>B<=B<=0 oV4)?6,4(t94s4zEEP~.(&,Dž,Dž(T$`-;Dž$,] CEP4 ]P,&Vw ҋ0pው,4O&4PD]Em PUT$,0 49؋,s؍X(8K44K0,$[,4D,9pT$ `D$(D$4؉$0}F8C4B<ƒ1ŤŠEOPTEV~pUUJP,4$0q 4,OPDŽPBE5MMP!PCW(ȁs,$L$4$0DÅ8X,4H0@44,-0 1s0 ,40 ,1!4e0 1,40 14c,0_ 14,,09 ,&Gwҋtq1m94s4@40 4y1441144141411ۉ411441UE $U1]UE$U E]UE $U1]U U|]UWVS ã}u >}0D$$v+D$t$$`‹U$4UtUuE2 $ƅ_EE[^_]Ë}ut$ D$$M$E2@ x tbMut$sD$$EQ| D$$$ Ex tUE9ED$D$ht@E$_ tEftUft IA(Q|uEt E1s$ot!D$D$$=RB(~$<tD$D$$ RB끍( D$$}L D$$_t$sD$$EsD$$/UVS! EtD$ E D$ED$E$ƋEt$0[^]ffffUWVS v ƉEωD$$ٳ tB4$ű ƀ?u1)9tXzzt"D$|<$m …uۉ<$菱 9t 1[^_]Ét$ED$<$/ [^_]ÉUt$ED$<$. Uu[^_]UWVS$ ƪ uEUt E<t] $[^_]É΋Ex thE%1p]S9sbD9rEtfEt(%D$$%]]C \ExtftEx(1ba?0Vu~9Vt"VT$<$]PljFVEptft]CPSD  Ћ]P|‹]Kf:`JBftKɍD$E@$qUu$tEE܃@[^_]ËMAOMփ_EtfEtǤ$tE܉$tEP p,@ @(@$@,ׅU5My tpL$ T$D$E $2tq}tWytYWytDWxMy ufqUE$sEp@@LEMA@AHADALucfx@1ED$ T$UT$t$D$D$ ED$D$E$Ktwm7GED7ntsuPUP|1늃}tXpx11EnMxn 11EMIuE4$rE܃@[^_]px11Eu؉4$SrѨu2u>Mt$IEUw r}fm밍t$ E0UUWVS `UJEtB9swt$U$OnUt]rJ] fBB ]fBxzE:us<u.u'EBB [^_]Ëu1[^_]äftfu%u0tى4$hU[EfUWVS SuVzF9sHtT|$$Mmt8~VM f FHNMLF [^_]Ëu1[^_]É<$gUWVST ED$,E$6 D$|$]A: xD$|4$]e HM4$]Ԑ =M t<$轐 = E$]褐 =n D$$P]kÉE@ t$$Ut E t E D$,E$*E, EEEP2.EȋEE u<.tk)ύ)ȍD$4$ t [^_]U cE=w ̚]1]UWVS 5u4$蠂 UT$ D$D$4$5i}-?L) RЍ)Ѝ̓GEeE)  IȍE) GE*S)ύɍ̚D$4$ t [^_]fffUWVS4 FufF(}ȉ|$$Bj t4[^_]É<$PM1".&.&.&t9ufV(4[^_]UWVS u  f~7fV Ed~7 4$&V(EfD$FD$ $U|=UwDE |)ʉM싆t7T$UD$E$;U9sUJM|M))‹FtIT$UD$u4$U9r4[^_]1$d~7[^_]ËUыU|UVS utgF$^F$^F$^F $^F$$^F,$^4$^9 t 1[^]ǃ F  @>  @tÍ'ffffffffffffffUWVS ælj$U D$$ Et$UT$U$:9UuED$$ 行 1[^_]ÉUED$$ 职 $<UD$<UD UWVSd  T8EEEEƍEE> tqE9D$t$U$:Utˋ$ <$;UDŽa 8Euu>vt1< tHv0FFU$;$;UDŽUWVS<r ' T8U1ҍ Ӭt"u Džguԉ@!&.&O@6ƒ:uƅ/nFu$7>$i %!`ut$L$$'1U+uW`[^_]+ U$_3ED$P3UED跅 CUWVS` jEU T87t$\pwbtNT$E UD$ T$uD$D$@T$$T$.2T$Mt>$uT$ U MT$L$$Zd L$\+u`[^_]ø{UWVS âExw|Mt_ƃtAƍU$1ED$1UED [^_]Ãu$1Ɖ [^_]UWVSpB }EU T8u]]p3MmLm8@E Eߺ81tEI}E )|$t$ʉUM$]~/MUЉ΋ʉU$]0}D$r0UD܂ !\$T$$]a ]U+p[^_]ê0f%CD$D$ ]D$D$@}<$L/mo8뎉f>~%E~LSC9u1Yf7k]  ]uUS ÞEPw*Ӑt諁 -[]ÃӬu$'2[]US IEPw*ӐtV -[]ÃӬuU T$$X []UVS 7 uD$:4$E t!D$cT$$nq tE D$4$ [^] - [^]UVS tuD$:4$D t!D$cT$$p tE D$D$4$, [^]ËE D$D$4$ [^]US 9 EMPw*Ӑt - []ÃӬuL$U T$$, []US ËUBwÐt1[]Ãìu$W []UVS CuD$:4$vC t!D$cT$$o tE D$4$ [^] - [^]ffffffffffffffffffUWVS  ƦuE1ҋE xtGEljу1Uvt 2uU@u [^_]UWVSĀp !}E| T8xƋE, p@ E0 E|1E]EH Eƒx  EB A ǁE9uʋE%uL P \ EpxEPMHx }1E]u=.t&.&.&.&.&.&.&.&J˃4x MN K u9uʋ]uE%BzBE9:xE+1[^_]ËU 1ۍ U @tBEtʍЉʍI$ wu1묋}@ E@1ۍE0 EEEu1}}}8tDAuEƃ@E}t,ى%I$))9D E9u }C\uEL^@]񍘌1҃DD  u̓E9uE, :*.&@t$ELDu۸@u܋} Ƈ }8LT 8 0u} ] ]E M }~Et M  ЋU 1ҋMDŽ DŽ  r1ɉ]].&.& u]U1 L ȉу9uMՉʉ EMU1.& L ȃ9uMՉʉ MEE@twM Љʃ Љ Ѝ Љ ЋU‹Elt a1v`,tEUEEt @Eǀ, -]UWVS`F uE EM T8ENjE1ȉ܉ %Ev㪪UUUUUUUU ]% ȉE1EE, EE$t&.&.&.&.&Eƃ4x  EF A Eu1E1EE܉}ԉ..&.&.&.&.&EEƃ4x  NjF A E؃uĉ}EEpEEEL E<}Ǎ)Eˉ]܋E؋}}؉EE}}EEu]EË}1u!u܋11ًF11}݉]Љۉ]Mɉ]ċEԋ ]3 ]3 ]3 3 3! 3" ]3# 1EEԋ$ ]3% ]3& ]3' 3( 3) 3* ]3+ 1E؋M؋}1ȋ]!؋u܋]3<1Ë}3L>1}u u3 u1E䋼$ u3% E1ljE3 3& 3 3' 3 3( 3! 3) 3" 3* 3# E3+ }m1u]E؋}}8E%MɁ ȉEE%MɁ ȉE1E1 E&.&.&EE0Ãx  NjC A EuċE8upuE+u(1`[^_]ËuEE UWVSPm &EЋ}] ] T8EƋE1;$]܍ut&.&.&.&9u$E<_tpuEЍu]U+%P[^_]< t<:tًEPt΀ tɀ:tĉEĸEE]Ѝ }}̍?tLD$ D$\$$.t&Ҁ09u$?uE]Ј E؃  }EủEԋE؀`SŃ?49E ЉEȃm9Muċu̅E؍X]PE]Ѝ ]1ۉ}u6NŃ?}t}<9Lü ˃gu`€@DN뺀@~SGS҃?E؀8*)x0EЍuN҃?pڋ}uE̋MȉËEȉD$ T$t$EЍ ${EfU Ѓ?S?S ?SEfU Ѓ?S?S ?SCEfƒ?S ?S CC E};E؉D$<$AE؉D$<$vE؉D$<$U ]/UWVS蝰 VE T8EEXUэuUS1M䍶J 9uMZ9uԋU$E+u 1[^_]Ë]UWVS, ԷE؋U T8E]Z}uU܍S1MJ 9uMZ9uًU܋E tjUD$ D$|$<$[U8uB.&˃9uPF9tӋ}E+u1,[^_]ø딋]UWVSD9 U uU T8‹E1DžDžDžvJ88E+1D[^_]D$D$D$ D$D$$ ? @D$$  @D $9sӉ t׉D$@BD$ <$L$  $?29:?!~95?J901?߲9,?+59*?x}9*DžTDžJD$$譴D$$葴(D$$dP4?9ȉ)ډщ‹09<Ѓ D$0ED$,D$(D$$D$ D$D$D$D$D$ D$D$<$$D$$VtD(,481Ɖ 1 09<DžuDž@fDž WDžHDž9Dž*|UWVS ǠEu T8E1D$D$H $iDžDž4$8$u vt$4$Ɖ$YW DžD$$8vu[x=uUT$$l D$$: DžDžDž DžDžNg|$4$-pt5tmuIT$$x'멍T$$ye뇋$41U+Ĭ[^_]ÍT$$.x+t$u$W uDž't$u$[W DžOD$$ƉDžDž|Dž[<Hv2CȍyYz) ӍQ!ӺZ) ! ڍYп9) Ӄ! ҉+у>Ã/Ӄ? щ҃A! =ЅD$$t*D$ 27D$D$p$$I2[4$>S |$0|$,D$(|$$D$ T$|$||$D$t$ D$D$$@D$ D$$D$D$4$D$D$|4$D$D$p$)$&D$uD$@*.$w(UVS蛤 Puv$H‰)Ѓ[^]øh`UWVS4U ÉED$uut$u 4$R u3D$ ED$$EE8$E $]豬h`)‰UE E h`9t$u+E E܋E$]P NjED$ut$u t$u܉t$ uD$D$b K E$1J t$|$ ML$D$E$}v/lj|$t$ ED$D$<$g9]uىE D$E܉D$ED$ED$ ]䍃vD$D$b}<$ U^D$O O ȉD$$EPU9uD$]J J  J ȉD$$dEPU@D$D$4$E4[^_]14[^_]+M MXELfffffffffffUWVSˉU23]333 13Ή 3 13 43 1343 1343 1343 1343 13 43 13$43 13(43 13,43 13043 13443 13843 1΋<1щ3 13@ 3 13DE] [^_]UWVSljEfM}܍H1ۉu1f;]ƃ6 u1M9uΉEE}EE]܉UEEEC9uE荈Eu䍙uΉUEEEC9uuE9uă[^_]ÉƻHUWVSc 9ЍPH USD̮f`TE\Ƌ@1f;` ؀u19Hu111ۍhXdLH1`f Ѐuዕ`1Љd1fN Ȁu1hXLTd\hx\9YTP0`HP1\f? uዽ\1Љd1fN Ȁuዕ`1ЉhXLTdh`GP9SP09->1ۋT@*H98uԋX1ɋT1`f\؃ ؀uዝ`9uŻ@`TXO9uu⋽`E؉`]BbJ9uߋDfǂK $2?ƂK aDK ƄK $,T$ vT$D$$%7H4$dB `D$HD$T$Կ14U+[^_]Íxƅ?n)nOPEȉHTDUWVSI u(}  T8E14$EA $?$u 1H t $t9u틽)x  @4$$D$(|$4$ D$vD$4$T$|$4$}<$T$D$(L$<$T$T$<$$D$(L$<$v|$0, $}$lj~T$,D$4$&Dž0Dž4Dž8Dž<$D$#,D$<$u։fǃLL $1ƃNL $ D$D$OL $ dD$xvD$ B$et$,$m1<$ʉ)Ѹ%I$))Љ)‰ ;$D$(D$<$ ɋoD$,D$<$|$,$:LL ,L D$06 < ȉD$$,L ,L D$17 = ȉD$$,L ,L D$28 > ȉD$$T,L ,L D$39 ? ȉD$$,L ,L D$4: 5 ȉD$$,L ,L D$;T$$,L P,L @D$D$,$(E+[^_]D$,D$<$ ɋ$D$(D$<$l|$,$y$D$(D$<$6p D$D$<$ ;$D$(D$<$[ D$D$<$ &(D$<$$Dž0Dž4Dž8Dž<Dž Dž Dž+ffffffUWVS芍 CMMUu T8ƋE1@6Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\Ey1ۍTt&.&.&.&009u$ͯD$@|$<$0E D$D$<$|$$,<$耯D$@t$<$D$t$<$ϯ|$4$E+[^_]Éu4$ UT$L$4$qt$4$膱Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\TfffffffffffUWVSQ utJD$ED$4$NjE9t58u0F 8"tE 81[^_]ÃuE F UVS EU ]~<Ílt&.&.&.&у? H9u[^]UVS臈 0EU ]~Í у? H9u[^]fffUWVS81 ƉUċH0<@,9s1V8UEV(U}ԉEE܉MF4}ĉ}9sMt$}ȉ<$et8[^_]É<$uEĉ|$4$2Eă8[^_]U萇 =Et'tu-E t:.v]ËE t#v]ËM t &v]1]Íu]Íu]Íu]UWVS ώu} 4$uw[^_][^_]UWVSd҆ Çu}$}(E($r EEE(EEEEEEEE EEEEEEEԋE E؉u܉uEEEE8Euu4$…u?}4U4…u%tE(usKu?u8M,tE0uVUE(D$}<$<<$UЃd[^_]äftumt׉UE4D$ ED$E0D$E,$5UtE(D$}<$ E0D$E,$ <$]jfvE(d9%U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$9]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$`]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$]UVSV u4$u1҉[^][^]UVS Ӊu4$u[^][^]UVS Øu4$Zu[^]}[^]UWVS见 \}u <$…uL}wPU>…u6t-11U.&2 у9uUɃtЃ[^_]úUWVSX ЈM $3. ƉEE$ljE4$ƉEE EEEED$ML$}<$/t.1EM $ M $ 4$ EX[^_]ËuE$,EtED$t$<$몸Ǹ1UD$ ED$E D$E$]UD$ ED$E D$E$]UD$ ED$E D$E$]UWVS ^}u <$ …u>I…u1t(11Uv2 у9uUɃt Ѓ[^_]úUWVS2 }u <$ …uG…u5t,11U&2 у9uUɃt Ѓ[^_]úUWVS~ g}u <$& …uGM…u5t,11U&2 у9uUɃt Ѓ[^_]úU@~ E##+ፂ6v]Í#]ÍT ]Í ]ÍMv]Íw]Íw]Íw]Íw]Í( ]ÍX ]Í ]Íw]Í ]Í ]Í ]Í0 ]Íav]Ítv]Ív]Ív]Ív]Ív]Ív]Ív]Íw]Í"w]Í9w]ÍPw]Íiw]Íw]Íw]Í ]Íx]Íx]Í%x]Í7x]UWVS | ×EwrE$2NjE $2ƋE$2E|7E$e2EU׋E$P2ƋE$j2 [^_]Ãu${) tffUS /| U T$D$U$ []UWS] }Èĉ Ⱥu?u0t 1t 9s\9r[_]fɪUWV}u uu.tft^_]tfUVS]u 1ɍt&.&.&΋T11Tu[^]UVSz êu Ee…t5҅u.URG0D$D$4$?GD$D$4$>G,D$D$4$>G(D$D$4$>G8D$D$4$>D$D$4$l>G D$D$4$I>GtO L$D$4$/>GD GD$D$4$>GtOL$D$4$=GD$D$4$=GtOL$D$4$=GDuoG$D$D$4$=G tW$T$D$4$h=D$@D$4$AE+uG[^_]ËGD$G$GsG D$G$jG Uw EUM ̲tt M U],]UWVS4Tw  MU T8ËE1Z? 4z v2z101x9u싵9uߋD$ t$AD$$&D̲ɋtxD$$̲ҋtFD$4$2Z ̲tt\$4$d2Z @@t!\$4$ЋE+u&4[^_]É4$}؍ťUWVS 3u |E}u E_N VUu}A1)փE}Eu[؋})@1)փE<tȃE΃\$D$ 4$|$]' [^_]ÍC)<}D1E)փEGut|}D1E)փ딃@1)փwUWVS0t {}wt1ҋGtl1ɉE܅tDM1M؉EEE܉D$|$ML$ D$4$f;~rϋM؉tw뫋E܃;Gsw10[^_]øUSE{x-P XPPHPXJP$H )P,JH09P(P4P@@B "f.&.&.&.&^_X9uۋ;Hu̲tD$$]E+u <[^_]ËUEU Mt t]%]UWVSXOo wuU T8E1V(F =?Bу+?҃/ [^]UWVS É։ϋMER)ЃEE9DE11փE? كCwʋE9EuljUt)?UZE [^_]9us vE܃EE9^EE [^_]UWVSEUEEECM]}Ov&}Wu;>}}UMڍ{sz) ֍K!ιZ) ! sп9) փ! Ӄ+Ӄ>փ/փ? уA! ځ$}w ҅UuU}:[^_]1[^_]UWVSƉU0 w'1r0 wv1ۉ؃[^_]9t}0t ؃[^_]Ã9u׉UWVS Q AYu} FEFED$E$?$ug$EwD$EUT$<$u?MF8?$u#vu=uGUDžtEF8?$umt [^_]À=uG}t܋UV,8,uрxtuˀx=uŃtUV(8,uxpux=uztUV0V48$uHEEFiUV8$ZHEEDž>EFFFF F$F<F@FD4$t? [^_]øUWVSXO pW}EE T8UE1D$E$ƋẺ$E]} Kf$OME Eĉ4$tU9$PMMȃ1MU)ƒ$v=yM}BEŰB8D$XUĉT$ D$D$u҉uȉ4$i4$‹E9BPBMыE)Ѓ]$m=yM}x}E̋@,D$EĉD$ D$D$uȉ4$qi4$Y9M@}uȃqMыE)Ѓ,t=yM}EŰB(D$UĉT$ D$D$uȉ4$h4$‹E9|BceMыE)ЃK,p=yM}EŰB0D$UĉT$ D$D$uȉ4$_h4$G‹E9BEЋM)уf$xqE̋H@$x)Ɖf$E̋0QG}̋O $@c}E+1EX[^_]Ë}ȤA}f}ȃ0fv.ft& ff vE}}oM\pEM)M&E}f}ȃW}ȃE҈AyuӉ fE҈AyuӉfE҈AyuӉf E҈AyuӉfzUMR)уt t]Ã]UVSU v$̍.&щcw[^]ffffUWVSI `QЍ$$0$.t&.&8$>x~$0$42z9$u͋$0A$4A$8A $<A$@A$DA$HA$LA $PA$$TA($XA,$\A0$`A4$dA8$hA<$lA@QD5т歁RQD$XT$\AHQL5l>+hD$HT$LAPQT5kAكD$`T$dAXQ\5y!~[D$T$ $0$4D$0T$4$P$T$8$<D$(T$,$X$\$$$@$DD$8T$<$`$d$$$H$LD$T$$h$l$$L$D$6_D$:OD$ +D$$rn+C,hC0kAC4كC8y!~C<[ڍ~@M]u v01pq]u11r9u]u 1[^_]ê@f5fUWVSL; _CuE T8U1҅P?EEfEEEEfEEEEEfEEEEEEEEED$4$U+uDL[^_]D$4$<tFXF\FPFT#kUWVS]Eo&U SP ST M|`)ЉEu t_QC@SDC@SD1EUU19EsH{L{`$ǃEUU =M ȉE}ωދF@VDEUF@VD1۸U9иEs11NH^LE)=w}E䍐​M u -)Љ‹u s,uu1[^_]äftuduKt11fuKu2ufPfE pE럸9UWVS?8 ?lj(UE u T8, M1ɉ$H?sM?d0E1fDž2Dž4Dž8Dž<fDž@0DžBDžFDžJfDžNDžPDžTDžXDž\Dž`DždDžhDžlD$$ " p ߋ$߃}rMEuQEuHD$\$$#D$$(1,U+[^_]äfEtD$$$(Ѿ$tBXB\BPBTD$$$臾$t봋(fUWVSd5 ç=ML$U T$ T8D$ƋD$`1D$ D$$D$(D$,D$0D$4D$8D$<D$@D$DD$HD$LD$PD$TD$XD$\9EAP ATD$111A@QDL$A@QDqHyL)|$GPGTT$)ЍT`D$D$$W`T$D$ GD$$GD$(G D$,GD$0GD$4GD$8GD$~!D$0 "D$0 r!D$06 T"D$06!D$0f !D$0H!D$0* !D$0 6!D$06@ !D$0I!D$0 d"D$0qF!D$0v, (!D$0Xa "D$0:b!D$0!D$0|!D$0g!D$0Nt"D$0V!D$08!D$0h6!D$0J!D$0,!D$0!D$0!D$0,!D$0mf!D$0H"D$0x *!D$0Z !D$0g@*.D$ D$D$Gy$ a@*.D$ D$D$y$ڒ@*.t$D$$Nt$ D$D$z$藒 @*.D$ D$D$oy$e@*.D$ D$D$y$3@*.D$ D$ D$ $@*.D$ D$D$Lz$ϑ4@*.D$ D$D$uz$蝑l@*.D$ D$D$z$k@*.t$D$$t$ D$D$z$(o@*.D$ D$D$y$!D$0@*.D$ D$D$`z$谐5@*.D$ D$D$z$~@*.D$ D$D$y$L@*.D$ D$D$2z$@*.D$ D$D$y$]@*.t$D$$\t$ D$D$z$襏@*.D$ D$D$y$s@*.D$ D$D$z$A@*.D$ D$D$z$@*.D$ D$D$y$ݎ@*.t$D$$Qt$ D$D$z$蚎@*.t$D$$t$ D$D$z$W@*.D$ D$D$y$%ffD$1ffffffffffffffffffffffffffft+H t$P$tPt;uB-4?øUWVSUʋX{8C,uK(C,C4C09svK4)ȉE9sUEϋu)փ=tftЋu))щ‹{8u΃C4C,C01[^_]Ëu)ƃtftC4C,C0ΉMD$K(t$H( $P ljC8U 뗋EC4S,9t[C4C09z}C0mC4C,C0^fJ1u0u\%u5ufEff_P@US]SB CCCJ u^B4?BBBBB$B<B@4JpJTJPǂǂ[]ÃK0뚸UEtH tP$t Pt;t]ËJ4?wB,B0B4E]UWVS u] NjFxr/|ug1ۋP8t9X(tET$V($V$E@8x X(5u6F@,@0@4u [^_]h| ۍSv [^_]UVS  U]E81}8tmCC tvS(s$taD$D$$ЉƅtoC@8@4?E D$$tt$C($S$C [^]K$]C C(1vиUED$ E D$D$E$]UVSEM t]X tVP$tOPtH;uDB-4?w7t-x:t&(r@1 w#EB?EEE@D$D$$]@UBu܉F0B??E E@}EmEE@N?EP B M}]؋u.t&.&.&Fǃu}M]؉uKwE*]ЍuFPFX lFTF\FG?} mmUԋE@H?}؃ U E܋]ȉX PUԉxu}~<}~@ỦT$lj$]\/ }ȋPU]ԋ@E؋Fߋuԃ(tftE@t E@ >)UUԋExD})щHDE@uFDF:?E@}W$tB}GDG;?uV$tB$uFЍt&(M9}U؋u.t&Fǃ9u}MU؉uffB " f= fuN9}U؉MuԋE).&.&s9u}EEUȋ]4EuFD]FH?.)W,WUUMЉ‰EE!MUЍ D89U\ uuUԉ}}|;v.&.&.&.&.&.&.&BEME!MMȍ MDM9 uu}؉U)11]؋uvFǃuu)ƋE@DCE@ E@ : t$EԉD$UB$]gUB)uuԅRuU؉]ԋE@$t]XE@t @ E@7?11U؋] MU؉]ԋUvm)E]艃{DE@M?UuMU؉]ԋ}EG<0EЍWu܉FE@Q?EuMU؉]ԋ}uVdFh ^`}mw EЍ E@ E@  t$EԉD$UB$]DfUB)uuԅRAE@G?} EEuFHUVLFK?fM9}]؋u7t&.&.&.&Fǃ9u'm)EU艂zD Eǀ@??N}MU؉uԸЋU!Ћ}GDGDU)]$}}M]؋u)&.&Fǃtu[}wr}M]؋u}M]؉uԋ]̉؋u)}G}G E@O?EpEE11]؋uh}]؉uԋu]^DF$tXVt ]C }G9?EEG}M]؉uԸЋu!]CHu)U[EЍ{EPD@B?} EESz@EЍ{]܉CE@Q?EL}M]؉ut }1uF$t @0V EB))9EEЍW>tBO)ڋ]ڋ_ۉD$T$ $]b]CU܉B0S 1 EH];XEЍ#|U܉BE@Q?EEE)N9'}U؉MuԋE4.&.&.&s9u{EЍX{]܉CE@Q?mmUE}ȉU؋uԋ}Q })EM9MBMql}ԍ qUu4V)ʃtUfQt9tUfytfyv9uU؋u}~lbuu}؉UԋU}]Zf]m)uUT$UEԉD$uF$]`FUUQfU_EȋU;B4EE1}}!EED$ED$uF$]w`FEЍ{ ։u!މ Mt M9M]]}}؉EEF&puMu!MM΍ MtM9ou]}؉EKEXL@I?E@l@E?1N9{}U؉MuԋE6v.&.&.&s9'uv}ȉU؋uԋ}Q})E_]MU؋uԋUwHEЍQ&].&.&.&fDSt9uE@l}荇4GpGPGXD$GXD$GpD$ D$GtD$$]r{U܉BGQ?uE u5UEP$t EE@t @ E@6?11ɋU؋]E@ TfvPEfED$ED$uF$]p]FF7MM؉]}؉EԋEQ}M)ȉ})EuE‰FD}ȉU؋uԉmU)u}twruԉփRu=E@l@F?XdPhUuEcE@ y%E܋]ȉX ]XUԉ]؉XEUP<]X@E-UUEEyYEX(u@(D$D$$][uFfED$UT$$[FF5?11U؋]]]EEx@O?]Yf]^}荇4GpGPGX WpwtL$MGXD$T$ U\$t$$] UM{]܉CGQ?pmEUB(uJJ(vLmEЍ0{-EfED$ED$uF$]ZFw9ȐruF1ɉNL$L$ $]aFU܉B0eF??1҉UAE]ԋEЍO|]}GpGTG\L$G\D$T$ GhD$GdƉt$$]V {U܉BGQ?;f tURGmm1EĉUeE@=?11ɋU؋]E@O?UVS]iu9ƋCP8tT$C($S$CD$C($S$C[^]þUWVSuËVB0t?t*U UMu[F [^_]=>?u>D$D$$^ML$M L$$t^9Ft본FR?UEM t:P t3P$t,Pt%;u!B-4?wB tJ$A01]ø]UWVS$ oEԋMM T8E܉ËE1ˉECEKKExS?D@l];1҉΃ك)É؃9u͉ϋuFlE)H8xωx~l&v@ E؃]C EXu#MA,A0A4E$IExXEp@??u܋E+E$[^_]Åt-.&.&9j1u9׉@@eu~S?-FS?^<]؉}L59uEP<@@11كu`t/uG)É؃9rً}Gl]K;.m9sۃtٸ뭃9sr1t(Ѓ9s_<uP9r1O9[뀋}G@GS?_<]؉WH t7P$t0Pt);u%B-4?wB M ttB 1]ø]ÃB 1UEtKH tDP$t=Pt6;u2Jw$C?tL?u +BD]ø]BD]UEt6H t/P$t(Pt!;uB-4?w4Bp)]ø]ffffffUWVSr #uMx11D rt"E pt&.&fDU9ux.t&fG0UofxZUWVS4 >}̉ÉEЋ@,E܋{t-Ek@^S,sutftߤEw uEH,@lu6^};s9sӅz}G8‰ىuFl؉Flv,)9_ʋ}?EE؋})EE@,u~89Edž3)ƃj'E@,uFl‹uF\l] Lus<9S} 5E19믺}O\)ȉ9ۋuVlv}4M9~(u\9tDJBBF|EE[^_]D$E$E@FtFl9F\`^t]FDVLfDPTT$D$$"dž% @9E,E UWVS]ƋCxPtT$C($S$CPDtT$C($S$CP@tT$C($S$CP8tT$C($S$CD$C($S$Cqt[^_]þUWVS q *EuE E]E}}}}U M$:18FV ~$h}uEMQ~HHtk_} U}KB/&} } M}W} }؉1MD$D$F($V ÅMF0@*x@H0x,GC4EHKPЉSLCTESXD$|$F($V C8D$C,D$F($V C@D$CLD$F($V CDǃEHD$D$F($V C K K8{@KDЉDRE쉃E艃C$u [^_]M„V$M]V F(d V [^_]øCE`[-@F4$U ED$ED$D$D$D$ D$E D$E$j]UWVS] EUCECBCBC B CBCBCBCBC B K$J$K(J(s,r,s0r0[4Z4D$D$ $ЉÅUBNjuD$C,D$B($UR C8D$C,D$UB($R C@D$CLD$UB($R CDD$D$UB($R C{8Us@KDC,uv8 C,{@uv@ CL{DMqD-{uvueu^CMQ+QS $ | 0 E[^_]älfbft.t&eft&W(f.t&fu5AfY{8f3f+0f(-f%*$E1E%ffffffff薍 OLUWVS<| 5EċM uS}׃L]f.&.&2A3Ѓu߉׉MEEEE]čLUȉEuϋ1EԋM3OMЋU3WŰu3w u܋u3wu؃4E‹EE܋EE؋EU} U E34}Nj<1}}Nj<1}}Nj<1}Uȋ1EEUu} m Eu] 1}3؃uU3Q1к}3؃uU3Q1к}3؃uU3Q 1к}3؃uU3Q1ڸ}3ڃu߃ȋ]čL1UM 1ω32P3<H1ω32P3<H1ω32P3<H1ω32P3ÉEԋuu]]M ډӹ΋U)։u9fWrwwWrww)ы]uL2uȋUtrUu+ øU)9fGHOWGHOW)ULuuJE0LuTUU ھ])9 fOY_wWJOw)ًUML fu苜]u'ME;uMU]u+LƉ кu)f9OWrwWGpw )щfEDE\uΉ.EuLE]؉E$]ˉ]ERD$U_NjFD$U$藇tE 8 [^_]1 [^_]UWVS ] d}GtUD$UN_ƋGD$U$1t+4$艦=yarauE 0 [^_]É4$諣1 [^_]UWVS \ Nd}GtUD$U^ƋGD$U$贆t+4$ =tciduE 0( [^_]É4$.1 [^_]UWVS\ cED$E D$E$tSEt4}D<$;^ƋED$<$!tE01[^_][^_][^_]UWVS[ =cED$E D$E$tJEtZ}D<$]ƋED$<$荅t54$=yarauE01[^_][^_]É4$[^_]UWVSZ ÒbED$E D$E$tJEtZ}D<$\ƋED$<$t54$:=tciduE01[^_]L[^_]É4$R5[^_]UEU E MMM]GUEU E tcidMMM](UVSY êaE D$E$gwƉ$舣=tciduE0[^]1[^]UVSY ZaE D$E$wƉ$8=loobt 1[^]É4$mU[^]UWVS LY aE$肊t,ƉD$E D$E$Wwlj4$ [^_]1 [^_]USX ç`E D$E$dvUT$$c@[]USX n`E D$E$+vUT$$@[]USX 5`E D$E$uUT$$A[]USGX _E D$E$uUT$$;A[]USX _E D$E$uUT$$oA[]USW Ê_E D$E$GuUT$$xA[]USW Q_E D$E$uUT$$A[]UScW _E D$E$tUT$$A[]US*W ^E D$E$tUT$$PB[]USV æ^E D$E$ctUT$$B[]USV m^E D$E$*tUT$$B[]USV 4^E D$E$sUT$$B[]USFV ]E D$E$sUT$$B[]US V ]E D$E$sUT$$B[]USU É]E D$E$FsUT$$B[]USU P]E D$E$ sUT$$B[]USbU ]E D$E$rUT$$B[]US)U \E D$E$rUT$$B[]UST å\E D$E$brUT$$B[]UST l\E D$E$)rUT$$B[]UWVS |T 1\E$D$9t,ƉD$E D$E$rlj4$7 [^_]1 [^_]UWVS T [E$D$09t,ƉD$E D$E$rlj4$Ԛ [^_]1 [^_]UWVS S k[E$D$8t,ƉD$E D$E$qlj4$r [^_]1 [^_]UWVS TS [E$D$l8t,ƉD$E D$E$Yqlj4$ [^_]1 [^_]UWVS R çZEU$T$ 8t,ƉD$E D$E$plj4$讙 [^_]1 [^_]UWVS R EZE$D$7t,ƉD$E D$E$plj4$L [^_]1 [^_]UWVS .R YE$D$E7t,ƉD$E D$E$2plj4$ [^_]1 [^_]UWVS Q ÀYE$D$6t,ƉD$E D$E$olj4$膘 [^_]1 [^_]UWVS hQ YE$D$6t,ƉD$E D$E$molj4$$ [^_]1 [^_]UWVS Q ûXEU$T$6t,ƉD$E D$E$ olj4$— [^_]1 [^_]UWVS P YXE$D$6t,ƉD$E D$E$nlj4$^ [^_]1 [^_]UWVS @P WE$D$5t,ƉD$E D$E$Cnlj4$ [^_]1 [^_]UWVS O ÑWE$D$=5t,ƉD$E D$E$mlj4$藖 [^_]1 [^_]UWVS yO .WE$D$4t,ƉD$E D$E$}mlj4$4 [^_]1 [^_]UWVS O VEU$T$x4t,ƉD$E D$E$mlj4$ҕ [^_]1 [^_]UWVS N iVE$D$4t,ƉD$E D$E$llj4$o [^_]1 [^_]UWVS QN VE$D$3t,ƉD$E D$E$Tllj4$ [^_]1 [^_]UWVS M âUE$D$M3t,ƉD$E D$E$klj4$觔 [^_]1 [^_]UWVS M >UE$D$2t,ƉD$E D$E$klj4$D [^_]1 [^_]UWVS &M TEU$T$2t,ƉD$E D$E$+klj4$ [^_]1 [^_]UVSL zTE D$E$7jƉ$X=gntst 1[^]É4$'tU[^]UWVS hL TE$%%t,ƉD$E D$E$tjlj4$+ [^_]1 [^_]UWVS L SE$$t,ƉD$E D$E$jlj4$В [^_]1 [^_]UVSK hSE D$E$%iƉ$F=atadt 1[^]É4$kwtUEt 4$+wM[^]UWVS BK RED$E$iut,ƉD$E D$E$Gilj4$ [^_]1 [^_]UWVS J ÕRED$E$ut,ƉD$E D$E$hlj4$蜑 [^_]1 [^_]UWVS~J 3RE D$E$gƉ$=gntst 1[^_]É4$$P$UDžtڋUT$D$4$$t U:[^_]É<$#1UVSI çQE D$E$dgƉ$腓=gntst 1[^]É4$=$tU[^]UWVS I JQE$R"t,ƉD$E D$E$glj4$X [^_]1 [^_]UWVS :I PE$ "t,ƉD$E D$E$Fglj4$ [^_]1 [^_]UWVS H ÔPut*t$E D$E$flj4$謏 [^_]1 [^_]UVSH DPE D$E${Ɖ$"=loobt 1[^]É4$WzU[^]UWVS 6H OE$lyt,ƉD$E D$E$蝊lj4$ [^_]1 [^_]UWVSG ÏOE $yt%ƉD$E$Plj4$裎[^_]1[^_]USG ïFE $D$$t%ƉD$E$jlj4$轅[^_]1[^_]UWVS > TFE$D$#t,ƉD$E D$E$lj4$Z [^_]1 [^_]UWVS<> EE $D$S#t%ƉD$E$諁lj4$[^_]1[^_]UWVS = ÕEE$D$"t,ƉD$E D$E$@lj4$蛄 [^_]1 [^_]UWVS}= 2EE $D$"t%ƉD$E$lj4$?[^_]1[^_]UWVS != DE$D$9"t,ƉD$E D$E$lj4$݃ [^_]1 [^_]UWVS< tDE $D$!t%ƉD$E$/lj4$肃[^_]1[^_]UWVS d< DEU$T$|!t,ƉD$E D$E$~lj4$ [^_]1 [^_]UWVS< ÷CE U$T$!t%ƉD$E$rlj4$ł[^_]1[^_]UWVS ; \CE$D$!t,ƉD$E D$E$~lj4$a [^_]1 [^_]UWVSC; BE $D$ t%ƉD$E$~lj4$[^_]1[^_]UWVS : ÛBE$D$F t,ƉD$E D$E$E}lj4$蠁 [^_]1 [^_]UWVS: 7BE $D$t%ƉD$E$}lj4$C[^_]1[^_]UWVS %: AE$D$t,ƉD$E D$E$|lj4$ [^_]1 [^_]UWVS9 wAE $D$#t%ƉD$E$1}lj4$脀[^_]1[^_]UWVS f9 AE$D$t,ƉD$E D$E${lj4$! [^_]1 [^_]UWVS9 ø@E $D$dt%ƉD$E$r|lj4$[^_]1[^_]UWVS 8 \@EU$T$ t,ƉD$E D$E${lj4$c [^_]1 [^_]UWVSE8 ?E U$T$t%ƉD$E${lj4$[^_]1[^_]UWVS 7 ß?E$D$Kt,ƉD$E D$E$Jzlj4$~ [^_]1 [^_]UWVS7 E$D$t,ƉD$E D$E$ylj4$} [^_]1 [^_]UWVS6 |>E $D$'t%ƉD$E$5zlj4$}[^_]1[^_]UWVS j6 >E$D$t,ƉD$E D$E$xlj4$$} [^_]1 [^_]UWVS6 û=E $D$ft%ƉD$E$tylj4$|[^_]1[^_]UWVS 5 ^=E$D$ t,ƉD$E D$E$ xlj4$d| [^_]1 [^_]UWVSF5 <E $D$t%ƉD$E$xlj4$|[^_]1[^_]UWVS 4 ß<EU$T$Lt,ƉD$E D$E$Kwlj4${ [^_]1 [^_]UWVS4 =<E U$T$t%ƉD$E$wlj4$K{[^_]1[^_]UVS.4 ;E D$E$vƉ$}=gntst 1[^]É4$ytU[^]UWVS 3 Æ;E$ t,ƉD$E D$E$9vlj4$z [^_]1 [^_]UWVSv3 +;E $3 t%ƉD$E$vlj4$@z[^_]1[^_]UWVS "3 :E$ t,ƉD$E D$E$ulj4$y [^_]1 [^_]UWVS2 |:E $ t%ƉD$E$>vlj4$y[^_]1[^_]UVSt2 ):E D$E$`tƉ$|=atadt 1[^]É4$,^tUEt 4$]M[^]UWVS 2 ø9ED$E$*\t,ƉD$E D$E$dtlj4$x [^_]1 [^_]UWVS 1 V9ED$E$\t,ƉD$E D$E$tlj4$]x [^_]1 [^_]UWVS?1 8ED$E $f[t%ƉD$E$tlj4$x[^_]1[^_]UWVS0 Ù8ED$E $[t%ƉD$E$Ttlj4$w[^_]1[^_]UWVS0 >8E D$E$urƉ$z=gntst 1[^_]É4$ P$UDžtڋUT$D$4$ t U:[^_]É<$.1UVS/ ò7E D$E$qƉ$y=gntst 1[^]É4$H tU[^]UWVS / U7E$]t,ƉD$E D$E$rlj4$cv [^_]1 [^_]UWVSE/ 6E $t%ƉD$E$rlj4$v[^_]1[^_]UWVS . æ6E$t,ƉD$E D$E$Yqlj4$u [^_]1 [^_]UWVS. K6E $|t%ƉD$E$ rlj4$`u[^_]1[^_]UWVSB. 5u t#t$E$qlj4$u[^_]1[^_]UWVS - í5ut*t$E D$E$jplj4$t [^_]1 [^_]fffUWVS- V5E 0Ft%uFt$蜹4$蔹1[^_]ÍL <$fFt<$W1[^_]Ét$L $[<$3FUS- 4D$L $̝D$L $1[]US, Å4EU 9t8J 9H u(Rt<@t-T$$[]1[]ø[]Í'ˍ'USa, 4E @tUT$$s[]Í, D$ D$D$tT $US, û3E @tURtFtAD$$U5U [^_]K4$l [^_]1 [^_]Í'UWVS & -utJ 9u@~ G$訩…t,Ft/D$$U~U [^_]1 [^_]Í'U% P-Et 9t1]Ë@ ]U% (-Et 9uP@tt ]1҉]Í']US/% ,Et 9t1[]ËU tH Q9Ur@tD$E $}[]Í'U$ ‚,Et 9t1]@]UWVS$ N,}t; 9u1G $5ƅtGt"D$4$<}[^_]1[^_]Í'U=$ +Et 9u @t ]1]vÍ']UWVS# í+ut 9t 1[^_]ËU tM 9uFtA F EP$UmDžtŋE HɋUtOFt@L$D$ D$T$<$KF~}~ t$|s'븍'UWVS4# *ut 9t 1[^_]ËE FtE $(F EH $M褦…tFMtI} |$D$ D$L$$U膍FUV}~ t$贮o'믍|D$ D$D$;T $USL" *Et 9t1[]ËM tM 9uL$$mUS" ú)Et 9t1[]Ë@tU T$$[]Í'US! f)Et 9t1[]Ë@tU T$$[]Í'US]! )EU tG 9u=t99 u5Rt@tT$$R[]Í'@uፃ'ٸfUS è(Et. 9u$@tU T$$[]Í'fUWVS X(u~(Ft  [^_]D$ED$ D$D$4$tȋUBU$DžtFD$ED$ UT$|$4$dt}M9Muu>uyF8"udF1M Z$ 蘣ƅt' D$4$PfFF FE 0 [^_]É<$谫D$eD$4$tՋMofffUSEU 9t5X2Zt$X@xJxJ13B []1[]ø[]US ý&D$ $L $[]US &L $[]UWVS4 W&M EpAQAtp }D$ T$L$D$ uԉ4$'D$|$E$Bqt2t$E$"nt|$E$7r4[^_]Í14[^_]ÉD$ T$ D$D$ uԉ4$襈y D$ lD$D$ $:UVS G%E 0t$ M $4$荩1[^]USX %D$L $ LD$ M $1[]UVSM UBAt%tOYI2B9r39[^]Äu!YI2B9|9[^]ø[^]ø[^]UWVS O$ƍD$ $覐L <$vt$ M E$%t $Eb<$JUЃ[^_]ÉE<$2$ ݟUt֍lD$ $MbMAFAFA<$t$E$Mt+$Egb<$ÌM $ΧUЃ[^_]ÉL$ME$M9uE<$臌UЃ[^_]Í}D$ D$D$M $UVSM UBAt&tQYIrB9r49[^]Äu"YIrB9|9[^]ø[^]ø[^]U EEUM UM]U EEUM UM]U EEUM UME]U EEUM UME]UVS' !utl9u4$`[^]1[^]UE@]UWVS ‘!Et l9t1[^_]@t5H@w}1һ9ˉrx9[^_]ËP@Ӂw;19ωr-9[^_]ø@c YU Et l9t11]ËP@]U œ Et l9t11]ËP@]U o Et l9t11]ËP@]U B Et l9t11]ËP@]UVSc  Et l9t 1[^]@u:HXȉEUU19ErȋE [^]ËPH9иrE UVS †Et l9t 1[^]@u;HXȉEUU19ErȋE f[^]ËPH9иrE fUSQ Et l9t1[]@u%P@Ӂw݋] []ËPH9иrE US ‘Et l9t1[]@u%P@Ӂw݋] []ËPH9иrE Ux %Et l9t1]ËHP@txE P]US5 Et l9t1[]@u%P@Ӂw݋] []ËPH9иrE UVS qEt l9t 1[^]@u:HXȉEUU19ErȋE [^]ËPH9иrE UVS: Et l9t 1[^]@u;HXȉEUU19ErȋE f[^]ËPH9иrE fUS _Et l9t1[]@u%P@Ӂw݋] []ËPH9иrE UF Et l9t1]ËHP@txE P]U ±Et l9t1]ËPH9иrE ]U lEt l9t1]ËPH9иrE f]Uy &Et l9t1]ËP@uE ]U@ Et l9t1]ËP@uE ]U ´Et l9t1]@uP@xM A]ËP@M QU bEt l9t1]ËP@uE ]U| )Et l9t1]ËPH9иrE ]U7 Et l9t1]ËPH9иrE f]U žEt l9t1]ËP@uE ]U eEt l9t1]@uP@xM A]ËP@M QUSZ Et l9t1[]ËM tM 9uL$$\US EU Mt l9t1[]@t Xxx3P3H []US ÁEU Mt l9t1[]@t Xxx3P3H []UVS 6Eu ]t l9t1[^]ËPH@uxx11 [^]UVS9 Eu ]t l9t1[^]ËPH@uxx11 [^]UWVS$ ÒuEEEEVt $[^_]À~(u~-+0u xZIE܉D$}|$F$ugEUщ¸9иeEF>t"D$ooD$4$VJE@U $[^_]E E܉D$ED$F$fEUE܉U}9EXV8"J&<8"0f,E܉D$|$F$ΙEU!Ѓt4MEFcD$ED$8"ut&4fffffffffffffUWVSP c<$Wf0vH@Ή9w u)D$D$ D$t$<$D$D$ D$t$<$fuP[^_]Ét$D$$c7_DžD$D$<$R?D$D$ D$t$<$D$D$ D$t$<$euP[^_]UWVS։ʻ1ɍ<0ufPw 7 uuf F[^_]ÍPwW ֍PЀ w0 1UWVS<7 4$cB BBB$BBB(B8OwuBfn'"H[v*BDžT$T$4$ЄI?D$D$ D$|$4$D$D$ D$|$4$cut9Bt&уtJv狕B8G<[^_]Àttt{B"JHJx"t_Gxaucxlu]xsuWxeuQHBzB(Jxru+xuu%xeuH̃BB(GP)D$D$ |$D$4$D$D$ D$D$4$;bu1<[^_]Ã+w{TX<$O1USEt&.&.& w u[]US  ÎE ;Et1 []ÉD$ED$E$2 []UWVS I]u}E E $蠴VEvHwu1[^_]<tPVt1ZE/V}h}~,V &E t w@t)щN] t&9D$T$E $]%1?/F(<>$ tHv~ " ~ t =t u)Vx"\xRPV HЀ"u"ufzEEF(>FFF F$GF]}D$ D$D$H $f)щN$x>qUWVS, \ EUu :Z^1ɋ}t9s_;<&uCGt1EE}}"U\Et;U)‰].&.&.&9L9u]0M돋UtEEtE,[^_]À{p{;CEtA.&.&<>tuE$prvvxEpD$:}t$$t}(u GtLt51E$蓊[^_]ÀÉ8versuÁxsionuE tE E D$E D$}<$ot}DDžyD$t$E$@\<$DvJ~iEp[~QUD$E$]UWVSx -$@hp$tD$D$E$gǃxD$<$輒aEЋUԉlp h!ыtJ911#l#pD$D$|$D$ D$lplp hȉdD$$1WƋt0<$gd3D$L$d4$ollp ȋdE D$4$aNjtPD$T$l4$llT$4$&t$ՇĬ[^_]1)<$ft$談1Ĭ[^_]D$D$D$D$ D$hD$l$ VlthȋtGL$4$]%t$1nUD$E$U]fffffUE 9E]UWVS eƅtBD$$PEt E$@8~DžMu% $膆1\$@~DžtED$<$@D$G$lEG,w0G4G8G<[^_]US åM $j[]US D$,$mM $j[]US AD$M $@jD$8M $1[]USD ED$E $Z[]US ED$E $*[]US ÜE$kE $k[]UWVS( fUM܋p4@,EEGEt@E<E tDMUD$E$UMtLօuE܅tE܉1([^_]ÍJ}D$ \D$D$ $蓯ϋE܅t([^_]1UVS ÅPt@9 u6p 9ry}D$ D$D$ $KUWVS WuFt09u&x<$WeƉ<$Fe[^_]Í D$ D$D$ $өUWVS* Ƅt1XƅtptC[^_]ÉUx<$d1ɋU'ƅtpt<$d[^_]ÍD$ pD$D$ $8US FE xt"D$ D$E$r[]Í}D$ D$D$  $ѨUS* UB4tB4R,…t8$7[]Í}D$ D$D$ $mf}D$ D$D$ $CUWVS4 OUM@8t 14[^_]ÉƉ׍PU$DcMDžt6pE$6EG4$67E$c4[^_]ÍD$,$6dM <$aED$8M E؉$E܅$w6<$`V09V4E$X6N4~,UEE؋UЉMԃD$E$衞MԋUvA)D$E؉D$D$JEF,}܉8}xF4F<<$`E$8E܃,n}<}ܜ$rEMD$ $F5UT$MA$GEM܉H<$_UT$U؉$KE܅$5<$l_E@,vu1<$/^0[^_]D$4$=t؋E EtɃF E䍃E؉}} ED$4$=;EZM9U9PU}E܉4$(=E܅UT$ D$4$~D$4$=4$<U܋T$4$P tEO49H1NgEq<$\D$4$ ?Ɖ0[^_]Ë}4$Z<E$5mRD$4$9n}э D$ 4D$D$ $}E$5n 4$;EԉD$4$|=}D$ 4D$D$ $輠UVS E 0t$8M $!F,v u0u&Ɖ[^_]Åu2[^_]1[^_]äftt鍃D$ D$D$x$ D$ D$D$x$U[ Et,9u@]1]US' Et ,9t1[]ËM tM 9uL$$US ÕEt ,9t1 []ËM9H uU tL$M L$@$} []UWVS 8u>t=~(u7Ft=D$ fT$VT$$bt F$ [^_]ËFD$U$11tՋ}O $MTEtFVT$U$MUs9}D$mD$4$ $TTƅ,D$4$FEF~ E 0%:D$ED$F $ ljEt\UF$F 9:" 7~D$ D$D$x$腇E$[ [^_]词8"uE$[$mSƅtEE$[1!1U 2Et l9t1]ËM tM 9u9]UVS= lt$TM $ƃ\M t$HM $ƃPM 1[^]US ßE xtD$E$#[]ÍUVS `u)D$L$BtTM 4$[^]ÍHM UVSX utl9u4$[^]1[^]U' Et l9t1]@]U «Et l9t1]@]US ~Et l9t1[]ËM tM 9uL$$fUVS 6uFt [^]À~(tD$ PD$FD$F$Vu_D$ HD$FD$F$.tW)D$L$#AHM 4$E 0[^]Í)D$L$@TM Ǎ@D$ 0D$D$$)fffffffUWVSq &ƅtBD$$TEt E$@ODžMu% $GX1d$@ODžtED$E<$ED$G$}>EG,w0G4G8G<[^_]US ^E$o>E $a>[]UVSt )Pt@9 u6p 9rt 9t%$c$Y [^_]ÉUMGE$4UNjE$3Ut$ M9t;E [^_]~D$ lD$D$$hxA$衸MA8,uA1)UE]UWVS C}9GE$;3G4…tQG4tA1щM<B,U8$EMQ,E:UB49rɉ׉ʉB4G8B8UE$2UЃ[^_]1҉Ѓ[^_]UE$.t`8]UWVS谿 eut 9t 1[^_]Í~<$\2v0<$Q2[^_]UWVS_ ut 9t 1[^_]Í~<$ 2v4<$2[^_]UWVS ut 9t 1[^_]Í~<$1E 9F0r<$1[^_]ɉUWVS覾 [u~<$l1Ɖ<$[1[^_]UWVSi u~<$/1F8uF8<$1[^_]UWVS* u~<$0v8փ<$0[^_]UWVS ãut<9u2~<$0F49E s+F,U 4t"<$0[^_]1[^_]1ލ~D$ D$D$a$uUWVS] ut 9t 1[^_]Í~<$ 0F8u`F4;E t\9E seE V,tUEE$N,UEF<U$<$/[^_]1UA܍~D$ D$D$$(t~D$ D$D$$sUWVSU ut 9t 1[^_]Í~<$/U Ɖ<$.[^_]UWVS ðut 9t[^_]ÍFE$.~49} F8V,E E EE 9sQEDE 9s>uv.&.&.&UJ,4t9uu~4F<E$.E$[^_]ËE$-%~D$ D$D$$zr~D$ D$D$$PrUS詺 ^Et 9t1[]ËM tM 9uL$$FUSb D$E$[]UWVSu} ]Ct [^_]1t{(uى[^_]US êD$E$A[]US ȹ }D$E D$E$ []US薹 KD$E$[]fffUEU @]USN E$;t[]Í~D$ lD$D$p$pUWVS0 ê$}`HtыpG$萍`tBtD$D$ D$ED$$Gu0[^_]ËUT$$PDžtօt$ Ku}DžPtҋ@w4$躌)T$$PtЉ4$~taNjPu냍~D$ XD$D$$n~D$ XD$D$$n~D$ 8D$D$$n~D$ 8D$D$$cn~D$ 8D$D$$9ntыt$P~D$ 8D$D$$mUEt]1]UWVSD& ۽$UtEDžDžEU ; u @|$t$ D$ED$$OEU t$t$|$ t$T$$Quu EM L$$RD$D$ t$ED$<$u1D[^_]ÃuvD$D$ E D$ED$$ tlEU DžDž; 눸D[^_]ÍD$ D$D$#$kEEU D$E D$E$]UE]UE@]UVS Ɨ]C$$?[^]fffffffffffffffUWVS莳 Cƀ8$`D9?.&P9b/t9rw/u9t 9t8/t)ȃ=4׋!ƄfDž.$_P /.pl@istX@XXXXf@ X $;ƃtb|$D$4$(9o84$q$ӣ1o8[^_]o?1[^_]PƄ$fى4$g^$lj$ׁ|$4$+D$$ o84${UWVS ǯuM ^t^F9tX^ [^_]ÉMD$${9…FFM빍~D$ PD$D$9@$g~D$ PD$D$:@$glD$ PD$D$;@$g1<&M䍙%D$4$Bu1 [^_]<\<#ED$4$t҃Et?D$$Vuύ T$ T$D$#@$ct][^_]UVSū ~]u {u/vuD$$t,u[^]D$<$ku 1[^]D$/$Nt6u Ht>D$$)u뼍 T$ T$D$D@$bE >][^]UWVSت ]u {uW~uDD$$t4u~ tmu dtZD$$tu1[^_]D$<$Vt6uftwD$$,u붋vt%u tD$$u늸[^_]Í T$ T$D$c@$daD$/$9E >][^_]UWVS 荩 BUyEx i} _$-ƅI$-+FFF E Ft.ED$4$ׄuG$514$5 [^_]Í,< t~D$4$uD$ 4$tFu.D$4$tD$ 4$wpD$4$_DŽ^O2D$D$4$G)D$ 4$Ex 4$#41 UWVS ãED$E$;t>Ɖ$TE eU4$3eU [^_]1 [^_]U D$E D$E$l]cUD$E$]UEǀǀ]UVS ɮutFwyM MJ]ZMJ [^]$o*t|] X]XMH ]X뼍@D$ |D$D$A$]D$ |D$D$B$]1fUWVS έUu }t`t`tAtA}tA uutA} $1[^_]1[^_]Ãt  t L ]tL ] MtD ]뙍D$ lD$D$Z$\UWVSED$] u}څu59D$Ë}t E@؋T$[^_]9s+ut E|$8XD$1ۉ؋T$[^_]σL$uT9r9ڋD$)Mt}W닉u 11҉ËD$\$N D$)‰$L$ L$t$ ؉։L$T$ ӋT$L$T$Ɖ؉։d$ D$T$9rFt>Et*T$+T$D$ $|$ }GD$9D$sY+D$ T$D$1UWVSu] }Eڅu9sL1҃[^_]Ét$9s [^_]ȃL$ u;9r9r )‰t$D$[^_]Éu 11뛺 L$ )L$ D$T$L$‹D$ ‰T$D$ L$L$ L$ L$ 4$t$Ɖ9r-t&$)ˉL$|$ ڃ[^_]9$s)T$щUWVS }|$u ]Eu9sA1 [^_]9s11 [^_]u@9r 9\$ىمu 11҉ƋD$ [^_]ú )D$؉D$ L$$\$ ؉t$щ$$9rt 1RT$9sC1<15UWVS(} D$ UAuЋ]u`D$ D$9؉ÉD$$1҉މ\$$|$tكۋt$ t؃ڋuVȉڍe[^_]9:҃T$$L$ L$ L$$)L$$D$T$L$D$ L$T$$L$L$$L$ L$$\$Ét$ӉD$ T$9D$+D$ \$L$L$$ ƉL$$ډD$$D$ ЉD$UMڃىЉʉD$L$Ɖȋ]M9r>҃T$$9r9+\$|$پȉًD$ D$ȉD$$1i]U ] } D$ u 11҉ljÉ|$$!9D$y)T$T$D$ 1qUWVSu gD$E]‹}u+9щ1ҋL$t؃ڍe[^_]91D$ L$)L$T$ډD$L$ЋL$ ȉD$D$$T$L$ L$t$$$9)L$|$ ƉF$[^]fffffffSL$D$ t9tEAf.&€tuuuu˃t@Au<.t&€tAt9AtAt9Au΋D$[US 薅 KtP D$E D$E$e []fffffffUWVSQ u} %=PwM=@/=O= ctGrGƀtGwE===lu-Gƀu-G@GAEGx --PP@x-uX-tXrx BZf [^_]øpwwurT뺹ryw2r@s?@Gs@-!GS@SG--Drt7=`ubCs9d/?%uQtSa PD$ D$D$9$:MGA-fffffffUWVS Q E(D$E$aE=fAD$ED$E$cǃ\b8uE$aOEtMEMED$UT$4$0Mu E<=tX4E8E4uϋM9|>) ‰L$D$$O f1 [^_]ÉM4$`M랹č,D$ D$D$>($U9넍>UWVS輀 qEh"lB}ptDžxAEEEEEE|(D$ut$$ =]E$D$t$$<Dž<Dž@DžDDž8H|$8D$$Dž\Dž`Džd1|X}t Xuĉ4$XD$4$ |$4$%D$04$lc\b8D$hD$t$ D$ܤD$0$U,c4$,4<8D$t$0$tD$(D$$^;D$$D$$@;D$|$$4[^_]D$ܤ$[^_]Dž4c;,Dž4GD$(D$$:yD$(D$$}:D$$D$$_:UWVS@{} t$(D$T$L$,D$,t "|$GD$8UT$$\$('uL$8ǀ-<+>D$D$,D0OD$D$$D$ D$0 D$4D$, 11҉D$8T$<09L$,tfD$$|$89T$ |$<O\$81؉ËD$<1 -\$0|$<ߋT$4|$8Ӊd$0ډډD$8T$<NyЉ< tA< W9L$,iߋD$8T$e[^_]D$rD$,D$,FL$8D$0T$4D$T$ $D$\$($D$$T$ D$0T$4D$T$ $D$D$L$8D$9\$(8"D$8D$D$D$,D0OD$D$$D$ D$0 D$4D$, 11҉D$8T$<09L$,tfD$$|$89T$ |$<O\$81؉ËD$<1 -\$0|$<ߋT$4|$8Ӊd$0ډډD$8T$<NyЉ< tA< W9L$,iߋD$8T$e[^_]D$rD$,D$,FL$8D$0T$4D$T$ $D$\$(wD$$T$ D$0T$4D$T$ $D$D$L$8D$9\$(H4"D$8D$D$8HL$L@L$8t$@|$D<*tXD$=E$/EԅBƋU)։uEԋEREEE,U‹MD9F EEtJED$T$UM $u֋U$U9t5EuEEEuU܅/EEUUыr/Eԅ0t#.t*E8:t"UED$ED$L$轹MAt70E<-<+<::[B9FB 9F  E;u~#9E'xt#.0tE8:tD$W$t7WE<-OEx:R?8[^_]ÍVNQq t21UE}88[^_]ËE$ Ett p1pu-x/8ED$ t$D$`(<$EED$ t$D$<$*t#.t$E8:tED$ED$t$t7?3D$ D$D$a($4Eԅd}؉:t0Ex pq yMMMyM؋E'xEEEЉpE $MЋtp+t)kExut#.8tE8:tt$4$ut70t#.E8:ED$$7qx:#EE9E:E MM؉:ŨE uЋE؉t#.t+E8:t#MED$$谵EЋMq1t7EЉE<-WK8ED$ T$UD$`<$EUu3D$ T$D$a<$t$ t$D$<$3D$ T$D$a<$ 'xt#.E8:t$$袴A 3D$ t$D$a<$*[u x;UWVS[ Nc} u*|P uǃ|P |E ;M!8-pxP -'D$-E$ǃP --|$E$tAx:ǃxP >u|[^_]ÍrP :u>u|t2E8:t*|$ D$UD$@*.$?[^_]ÀxF|'_|>uTx:tL|9M'E8:t=|$ D$T1xP '|[^_]Í%D$ D$D$RP$uHD$ D$D$SP$E 4l:bUVSY ÷`utD$ D$4$H;[^]ÍD$ D$D$/$UVSX O`utD$4$%e[^]ÍoD$ D$D$/$fffffUS3X _E$B1[]UWVS X _EtVu;U E} Uz BD$E@t$9s0E@ 1҃[^_]ËE@D$Mxe);u EE UD$9sNj]C 넋E EuGE@D$Ex gE UybE E%D$ (D$D$$g}D$ (D$D$$=TUWVSV <^UB Eu1ƃu}9}EE}B269r|])9ErGË}u sJu(u J J ZR9r [^_]ÉfftEË}u rucuk띉UGD$4$ƅt[UB)ǍD|$D$$U0MJB E2Xf넃@UWVS7U \u} D$$$…0x@@  D$D$1D$ D$D$$UDžt1D$$[^_]R1[^_];8U$l$b818US T [E D$ED$@*.X$< []USS Ú[ED$ E D$ED$@*.X$<[]UWVSS Z[u} t(ED$ 1D$|$4$Q[^_]Íw0D$ DD$D$4$ UVS4S Zut'D$ D$D$4$YQ[^]Íw0D$ 8D$D$A$= UWVSR {Zu} t)D$ 1D$|$4$P[^_]Íw0D$ PD$D$6@$ UVSTR Zut>D$D$ D$D$4$Dt [^]1[^]ÍD$ XD$D$0d$F USQ ÆYED$ D$ E D$E$ 9[]UWVSQ KYuttE D$4$~7 F0u D$4$ [^_]tF0uҿF0뻍w0D$ `D$D$/$R ]UUM E=vEM EB]UWVS u] Et?})t6vD$\$$Vu9}tE) [^_]ËE [^_]UEU@ ]UWVS>P WE0x$Htu[^_]1[^_]UWVSP öWu tLEt>{?t+fx f@UPp$MH,UP(UPDUP [^_]ÿUuy 1UWVS O 4W}u$(‹EE Bzr EBttpE tZeE EU>UtnMfH f@PM H$x,p(@DP [^_]ÍE뭋M teE E딉U U$1UWVSN 9VUE trB0~4r,txM q J$tE D$ E 0xt$|$$[^_]ÉUD$ hD$D$<$4UYw0D$ hD$D$;$U US M 9؃[^_]ÍKD$ @D$D$-$<몸UEu E D]1]UWVSB YJ}utQEu@D69E r4E D$D$<${6GfGG[^_]1[^_]Í"D$ 0D$D$.-$UWVS B þIu} t;~uaVL\WQWQW Q F1[^_]Í"D$ D$D$M-$뙸UWVS4yA 2IƉEԋE} T8uЋU1҅x%PލT$D$<$]wGt_T7<}؋x}p uX]HM܉M HJH JHJ H:rZ}܉z ]9u1}ЋU+4[^_]ÉE܋]ԍXT$ T$D$h-$E܅ E܋]ԍcT$ T$D$i-$Em]pUVS? ôGut~uEFu=:Fr6[^]Í"D$ D$D$-$뵸UWVS? GGu} t9~u)Fu!:Frx9sD>[^_]1[^_]Í"D$ D$D$-$fffffffUWVS? öFƉׅtat1>t F9rF9s1[^_]ú䍃D$ D$D$P$뾍oD$ D$D$P$pUWVSU> Ft4ljփt3Rw0FGT$D$<$([^_][^_]ÉU{D$ $D$D$P$>UUS= {EE x[]ÉET$ dT$D$TP$E[]UWVSh= Eu} Et,tYPσF)F 71[^_]Í"T$ PT$D$bP$fEuET$ PT$D$cP$2ErUWVS< cDEu MUOEà E} u EX؋U)1|!})1׉E8>tiF‰߃sgtftËM؋})p)ƉwE0)F=^EX 1[^_]ø‰߃rxM]썃D$ 8D$D$P$MÍKD$ 8D$D$P$M}]썃pD$ 8D$D$P$L {P7f/UWVS: VBEuM} F lj؉})1|!})1UU<] M ؋M)ȍP)‰UUM)Pw^F [^_]Í^l1[^_]ÉÍKD$ D$D$P$ME]荓pT$ T$D$P$EjUWVSA9 @u} ~)u>F1w3v,V J 9rT tI9u9s![^_]ÍA9rA9r߉9sx[^_]ÍF㍃KD$ D$D$P$LȃD$ D$D$P$VUWVS)8 ?U} uz)u>B1w3v,J Y 9rL ti8u9s![^_]ÍP9rP9r߉9s#9t0t P9rP9r9r뮺BÉ1[^_]ÍKD$ D$D$WP$UUȃD$ D$D$XP$aUUUE ttuB]ø]UWVS$6 m>EEEM<}ulٸZ9]QEu|0օuD] t 9} $MtUUEEBE $[^_])ӉމxpU t 9} EtՋUUu뭅tA=wmM^ZZUD$D$$]UMi1ɉM]썃D$ D$D$P$MXMUEE썘\$ \$D$P$MUEMUWSE]~OSt<)9U rww؃t6t YXYx1s5u'u[_]Åt:1[_]ê[_]ftu'u1҉[_]úf᪍YUWVS] UЋ}ߋustft[^_]uuBfUWVSu} ]tquit?9sTtH<t3t<MHU SM)[^_]Í^뾉vt 뭃먋EUWVS] U}t>u9]t?U9s"] tLB9Err9EsE[^_]ËEP뼉8tu9sՉ u빃M1}+E[^_]UWVS] UЋ}uރstft[^_]uuBfUSM2 :D$D$ED$ ED$E D$E$[]fUWVSP1 ó9ƉЉ T8U1҅[ƅD$D$D$D$ T$D$4$Ct1U+<P[^_]Í1ɉ D rFDžDžD$ T$D$<$%uutjƅD$D$D$D$ t$GD$G$But$$tu<$6t$#tփT$ xT$D$$j`UWVST+0 7Ɖ T8E1 ƃP ƅD$D$D$D$ P D$|$4$AD$D$D$D$ L$|$4$A;DžDžDžDžDžVDžDžDžT$ D$D$$rtjƅD$D$D$D$ t$GD$G$@ut$$thuGtLD$ D$D$$u$q1U+uXT[^_]Ë묋$qʍփD$ D$D$$8G^UWVS- k5ϋEE uE T8E1,VD$D$ D$D$<$\B4D$ D$D$$7t6D$ D$D$$zw $ɗD$$D$${$聗D$I$cG$M$?~~f$N$ t$D$D$$mU+Ą[^_]Í @$0/<$6!D$t$$豅 tD$t$<$ԆtƋtt$ɇ뉍$$$談hD$27$j뛍D$t$;rLUWVSl Ù#uEEEEEEEE T8E1MGUqEE fD$ D$D$ UЉ$U5EEEEEEM MEEML$ D$UT$$_=EPt%D$T$T $UUEML$ML$M $MƋE$C^E+l[^_]Í D$ D$D$$MD$ D$D$$U)D$ D$D$$dEe9D$ D$D$$/6$1]D$D$r$WrJUD$ED$ED$ED$ ED$E D$E$f]UWVSlF uEEEEEEEE T8E1xMUEE fD$ D$D$ UЉ$U藃EEEEEEM MEEML$ D$UT$$v\E@t"D$D$U $UU3D$e$tM 9HtCED$ED$E$MEƋE$[E+9l[^_]Íu$BD$ ED$ED$E$ME 멍 D$ D$D$i$M^D$ D$D$j$U4)D$ D$D$k$kE 9D$ D$D$l$6$8ZD$D$r$^oGUD$ED$ED$ED$ ED$E D$E$ ]UWVSJ }lE \EXE` T8@E1D$pH$FXp`DžLDžPpP2.dL2.DlD$ D$D$<$mD$ <$`bdh< Q< t< L .&< t< t t ~ u9P>uXp<+%<-q<@nL'PHD$ D$PD$r$}؉DžL<+<-w҉ht$`$Zhyp1@U+[^_]ÉtЍLThDQtDTcq'<@L#PHD$ D$PD$r$h|DžL<+F<@[hU\l K4$  u9F<@t$`$qU\l<+<-t$`$>qU\؉<+N<- t$`$1_Z<+<-DžLDžP.hHD$ `D$D$4$zhQ7F<@uhHD$ `D$D$4$z؋h]PFF'<@hHD$ `D$D$4$yhU\1PU\PF]<@UHD$ `D$D$4$)y)F<@ DžLDžP1:D$ D$D$$ D$ D$D$$X,D$ D$D$$a?UWVS$ M(E<} T88ƋE1f<!ǃP U@D$D$ D$DD$<$z@D$@ D$4$AD$YD$4$"M40@@ $@@P T$$w@@$D$4$ ~,t$D$4$p8,|%=wP $Ә4$u0$8E+[^_]þ뿍D$H$Q}…tE|[^_]1䍃gD$ D$D$NJ$ (UWVStdEUU T8M1ɅtBE}<$EhM L$ED$<$hED$<$RU+u:t[^_]ÉEuL$ |L$D$hJ $<EK(UStE D$E$[]USJE D$E$[]UVSjD$D$0W 4$%D$ t$ED$$薍[^]UEȅyt ]%]]ffffffffffffffffffffffffUWVS0fE؋}u T8EԉËE1|$}܉<$]&1&.&.&.&.& F TFuF(}ԋE+uW0[^_]$)]yƅgы]؍AD$ D$D$FT$ +],&UWVSPEE u} T8U1ҍ$iD$@$_E E19xu}_D$D$$'_D$D$$L)׉ 9|KD$D$$^D$ D$$19 })׉ q0$d_0D$$%U+[^_]É裱0$_莱0t1D$ t$|$$Őb$^1농D$$tыptEU##UD$D$D$D$ E D$E$H]UWVSx×EUU T8M1ɅtBE}<$M L$ED$<$.ED$<$U+u:x[^_]ÉEuL$ L$D$T $躪E"fffffUWVS*8]du T8<ËE1dENMVU^ ]]~}}^]]ċ~}}ȋ^]]̋^ ]]Ћ~$|}ԋ^(x]؋~,t}܋^0p]^4H]~8D}v<@u식d3`s\s{ l{LȉEl1؋\!1؋`LyZ؋u\ɉT1`!1l yZTىˋ`MʉX1!1ыXP:yZω}ω}E1ȉ!ߋE1NjE0yZEȉ1!׉M1ωEMyZω9EEȉ1щ!1߉EMyZNjMu}ω}1ϋu!1׋MyZ߉Mɋ}u1!Nju1hyZ׉}ωM1!ߋM1ωuu1yZ]|ɉ1!1lj|]yZωxωxU1ډ!U1׋xyZljutʉ1!ω1߉t]yZ߉pʉU}1!NjU1׋Up2yZ׉4:u‹Hω1Љ!1ωuu0yZE]Dω1ߋ]!1׉EyZωE@ω}]1!]1߉EyZlj}X1u1u1Ƌ}1!ϋ]1߉u]yZ߉MT}1|1u1lj1!ljT1׉uUyZ׉ :X}1׋x1u1lj}1!ߋu1UT2yZUu1֋t1֋U1։‰1މX!1ƉUM yZΉTXMu1΋p1΋M1Ή11MnTƉXEh1NjE1NjM1ω׋X1ϋT1ωEn߉TE}1NjE1NjM1ωXT11En׉h|1NjE1NjM1ωT11߉MXnljh}x1ϋM1ϋM1lj11׉MTnω|t1׋U1׋U1ljh11lj|2n>Xxp1u1u1ljT11ωxhn߉Љt}1U1׋U1ljX11ljtT2n׉p}1u1|1Ɖωh11߉pXnlj}u1u1x1ljh11׉unωX}u1U1׋t1ljߋX11ljUh2n}U1׋U1׋p1ljX11ωUn߉h}U1׋M1ϋM1ljNjh11MXn׉}M1ϋ|1ϋM1ljh11߉MnljX}M1ϋx1ϋM1lj11׉Mhnω}U1׋t1׋U1ljX11ljU2nh}U1׋p1NjE1ljTߋh11ωEXn߉}U1׋E1NjE1ljh11ETn׉XuE1ƋE1ƋE1Ɖ11މEh8nƉߋu|1މu1u1É]X11ӋunىMx1ً]1ً]1M щˉh!! ً]X;ܼى|t1}1}1| !׉! X|hܼXωhxp1}1}1Ɖxh !! xܼ։׋t]1ڋ]1ڋ]1‰t Ӌh!Ӊ! ڋtܼЉˋpM1ȋM1ȋ|1p !! ȉXphܼXhMu1u1x1Mh !! u>ܼΉ׋Uu1u1t1‰U ֋h!։! uܼӉƋE]1؋]1؋p1E !! ؉XEhܼXÉhM]1ً]1ً]1Mh !! ً];ܼˉىU]1ڋ|1ڋ]1‰U Ӌh!Ӊ! ڋ]3ܼӉƋE]1؋x1؋]1E !! ؉XEhܼXÉhM]1ًt1ً]1Mh !! ً];ܼˉىU]1ڋp1ڋ]1‰U Ӌh!Ӊ! ڋ]3ܼӉƋE]1؋]1؋]1E !! ؉XEhܼXÉhM]1ً]1ً]1Mh !! ً];ܼˉىU|1ڋ]1ڋ]1‰U Ӌh!Ӊ! ڋ]3ܼӉƋEx1؋]1؋]1E !! ؉XEhܼXÉh|t1ً]1ً]1|h !! ً|;ܼˉxp1}1}1ljx ׋h!߉! x7ܼމt}1}1}1Ɖt Ɖ!׉! Xth>ܼXXhpu1u1|1Ɖ11߉pbXUu1u1x1‰֋h11ʉub‰Uu1u1t1‰։ډX11uhbщMu1u1p1΋X11ubˉhEu1M1ȋM1h11ЉMX1bƉ֋UM1ʋ|1ʋM1‰ыh11ډM9bUM1ʋx1ʋM1‰щX11‰MhbӉhEM1ȋt1ȋM1EX؋h11M1bEM1ȋp1ȋM1h11ЉMbӋUM1ʋM1ʋM1‰щX11MhbډUM1ʋM1ʋM1‰ыX11‰M9b׉ :TE|1ȋU1ЋU1‰11؉UX bȋThEx1ЋU1ЋU1‰1؋T1؉X2bƉ|t1֋U1֋U1Ɖh11Ή|:bMxp1׋U1׋U1ljىߋ]11ljxhb߉tU1ЋU1ЋX1‹E11U bЉ‰pu1u1|1ƉM11؉uMbȉEu1u1x1bʋE11UEu1U1Ћu1ubʉ؋U11EU1ЋU1ЋU1`bËE11؉Ћd\2މCPlj{l F LEFyZ<3 d Ӊ 1ΉTud3nT  1Ӊd]nd  d׉ ؋d1x9n ׉ 1}:nd T 1ڋ}d;n ҉ 1Njtn T P҉։d 1΋}T;n <P dӉT 1Ӌu0nˋd NjT 1u1nЋT T1u2nd 1ڋu7n T4 d҉׉ 1Nju1nߋd d҉ 1΋|nƋd T1ӋUn  d ҉Ћd 1UnT d 1Und 1!1‰dUܼd  ωd1!1ω}>ܼ<2  d1!΋d1֋UܼƋd 1T!1Uܼ d1!1UܼT 1!1ًUܼd 1!1‰TUܼT  1׉d!1ω}>ܼ<0 1!1֋|ܼ d 1!1d]ܼd 1!1dEܼd 1!1ىdt ܼd d1ˉڋd!1‹xܼ 1Ӊ!1ȉËEܼ3d 1É!1։Tud3ܼT 1!1Éd]ܼd  1߉d}9NSd  T։ 1u2NSd ։ 1ʋu0NST ։d 1‹u1NS ڋd Ɖd1֋UNS> Ћd 1؋UNSȋd T׉ 1‹}9NS 2 d׉ 1ʋ}>NS Tډ ׉ 1Ћx;NSdlj ׉ ЉT1؋}d;NS  ӋT 1Ë}>NS ˋT Ɖd1u1NS4  Ӊًd 1]NS d TӉ 1ʋ]NS< H։ ʉP1t0NSTӉD @pӉڋX h1\]拢Plʋ` 1։ˋx 拢P pƋL 1NjE拢P ` d҉ 1ߋU拢P  1U拢P d `1ȋUd拢P щʋ` 1‹M拢Pڋ` dщ 1֋M 拢P 1|拢Pd ; Ӊ `1ϋMd 拢P Ӊً` 1t拢Pы` ` 1ȋ]拢P  d 1‹]拢P` 1֋]拢Pd LЉ 1E拢P  `Љ 1ߋE拢PL 1!1ًE$M\ ` d1!1M` $M\  d1!1ʋM$M\ڋd 1։d!1ƋM $M\ 1!1ӋM$M\ d `1ډ׋`!1|$M\ d1!1ًU$M\ ` 1!1U$M\ d 1!1ʉ`x$M\` 1!1Ɖdt3$M\d 1!1Ӊd]$M\d  1!1d}9$M\d 1!1ىdM$M\d 1ȉd!1]$M\ 1!1ʋ]$M\ d `1!1Ƌ]d$M\  ։ 1Ët7>pm ` L։d 1׋]`>pmNjL dӉ 1]>pmыd 1؉dE>pmd‰ 0 1dE>pmd 1Ήdx3>pmdd ։d 1Ӌu7>pm d 1Nju1>pm׋d 1dM >pmd  1ډdU>pmd  1dE>pmd 1Ήdu3>pmd `҉ `1ӋU>pm  d 1NjU>pm ` ׉ 1U>pmd `׉ 1ڋ|8>pm` 1!1dEvmzd 1!1Ήdu3vmzd 1!1Ӊd]vmzd 1ljd!1Nj]vmz  d1!1]vmzd d1߉!1ڋ}8vmzd d1!1tvmz؋d Ήщd1!Ƌd1΋M vmz 1щ!1ӋMvmzd `1!1NjMdvmz  1!1ϋM vmz  ` d1!1ڋ|`8vmz d 1!1dEvmzd  1!1Ήdu3vmzd 1!1Ӊd]vmzd 1!1ljdx9vmzd 11dMʋd 1ډM1ʋt M1ωt1׋U ߋM t1ʉ1U Ƌt ]11]؍  E 1Ћ]1؋U] U11U] 11ʉUU׋U ljȉ}11׋E M1ȉ1E M 11|E 11؉ExME 1M1ȋM U11‹M UM 1ʉ׋U1׋U U P ׋XUzp4 @UrU1ЋU1Ћu lH؋uF ЋP ȋD1T|NS\ыUȋUBU hDEĴ[^_]UWVSE}wʃ?@)Ӎ ΃Mqy9rfup@?v6}EЋ]E D$<$Uv@9s]ËE19s-)] }|u sutft[^_]19rӃ[^_]Ë}OM]|u seEuUEuLEUED$E$U)֋E9rqFuRu9ofEtuRu8MEtf1/fmM qKMUWVS%ʿ]} T8EEGWEU?@)ƒw)ƒT$LD$<$D$ED$<$t(OSSs9uݺ\1u.u4tftME+u[^_]ê[tfʼnUE]UU ft1]ÁE ]fffL$$Yai qyD$A(tQS[hRjj [1Ít&.&T$D$ Zbj rz $z(t RPS[jRj [Xt@fffD$$X`h px1.t&T$D$ Zbj rzu@ $fffffffL$$Yai qyQS[ÃRjj [1Í&T$D$ Zbj rz $RPS[>jRj [Xt@US `ED$E D$E$ []US/D$ D$ED$$'[]USéD$ E D$ED$$-[]US躴oD$ E D$ED$$[]ffffffUWVS,q&uEEED$D$}|$ t$D$EE$DEE ED$D$|$ D$D$E$DEEED$D$|$ D$D$E$3D6EEED$D$|$ T$UD$E$CUEt9E& <wE)Ѓ9uEEED$D$|$ t$D$E$OC؃,[^_]bp8 u>ƆUN,D$ D$D$<Æ$jfffUWVSӹ} T8E1}D$D$HtHE$Ot=ED$D$<$褄;Es1U+[^_]ø"㍅D$E$[Gtt@D$E$!Gu[ED$cD$<$4;EsED$|$ H%D$`d$T$UnID$ D$D$B$BiQUWVS ǰxD$LW \$E$qƉ؅u [^_]Ékn01UWVSpu*UL[ ut$$L[ @B1NjEEE1UЋUME1EHt$$xxL[ @B1Ƌ}E1NjExME1EH D$E$~u(L[ ]ٸ@B1E1؃p[^_]øp[^_]$'L[ 8D$ D$D$H$gfffffffffffffffUWVSæD$zrD$E$萄uE0$.".&.&.&@t&tD$E$u܉[^_]D$D$E$t 1[^_]ËEpD$D$4$E@<-u?EPP2.DPtEPD$ ED$$U9MU9p9g^My+th)ƍF߃1BD$+D$4$8E@t<+ !M?!fffffU/ܴE?w0$.t u]Ë u@u1]UEP>w 0$.]1]UWVS(贬iu}܉|$D$4$uixINE uG>wl_8EظE! EED$|$4$(i([^_]Ã>w2_8EظE EiiUWVSáuYhD$ to-D$D$[ <$y)l[ @3.t@l[ [^_]ÍU T$ t$)‰T$$뵍27D$D$[ <$fffUWVS1ƉЉυV=~vVotXftNgu5] ^}+}-}=uFЃ[^_]Ã+t-ut} E #EFЃ[^_]-t~F+։} RE #EFF F+֍RE #EF뺉  E Iu1aUT$ <T$D$t$^bEF!FUWVS˩Àu] "<-EEEE}|$EԉD$$$~$E~D$|$$TEeD$D$Ẻ$eMẺE0EUP2.DPщMEE1EƋMt|$ $mƃt|\[^_]D$ $MU…t݋ED$ T$UE D$E$UMtNMT$U $0mƃUt$]!\[^_]ÉU S8UtB9udM밍FD$ xD$D$>H$KMU$U~9E~T$$lƋUfffffffffUWVST荔FEu}]E E bEEE;E܅~ 0MU tEEGz;EGEEUEUEUEUEEEE ESE؋E$]@ 8MЍD9E  0^EUM]L$\$ $T$]9tu׉EUuM΋EEeщٸ9и| E rED$E܍xD$E؉D$2ˉщցЉ%ƉƸQ))i)\i(\ø)\ƋEԉE]ʋUʉD$ T$]_D$E D$E$9} T[^_]ÍEEEE2EE'E7E U)Љpd1҉v.&.&.&Ɖ҃s΃EȉU9E}|T1MċEUM]L$\$ $T$]Mȋ]9ȉ|u͋MĉEU,E} uuMEU%E%EQ)EU)ȃi)\i(\Ѹ)\EUED$E܉D$E؉D$]ԉؙMʋEe}SEQM]EU)+EUEUEEE;E'EbEdEE Eg]U]EdEEUM]$<UЍD9E ỦUM܍_׉F u ,[^_]Ë]Uv]uGՃmu$],[^_]ÉUE$] UtÅT$D$ $M]<MD$ D$D$w$`An]D$ D$D$w$+AD$ D$D$E $>艶UWVSíTdhl}X} uUpUP T8@E1dVhXphfT:C9rf.&9f>*uf~*u1f~*f?f[uZp!!f90f[ʃfu‹ffP u&O f?ʃFW Ӏ_ Y9t fx*Df*ʉك |$|$<$7U+D[^_]ÍJfzuf[Qy+.t&.&.&.&f,2f]u답f[!B0.&.&.&.&.&.&Wf]tI׉΍Nf%ff-uGf]fF-Nf%fF_Wf]uH Af]O9CD$D$ D$D$$ P f 99sWfPfu9t.P9fx*P9fx*ʉW 9 mT$ D$)L$pP$gf[!~ʉW-0$P…ZJD$D$ D$D$$T@7pf@!fH9"|$ 4t$D$w $+|$ D$D$ $+T$ 4D$D$w $i+ T$ D$D$ $9+T$ t$D$ $ +|$ D$D$ $*r͢UWVS4{t7 t&ft5f{uL$M $щ.E[^_]f~}uf~u[^_]MU썃D$ HD$D$w$%MUQMU썃D$ HD$D$w$M%MU*NUWVS(ljtu} UDžDžDžDž uBB EBB]u^} UfP9~ʅ\uVtU@ɐ.&fH9uft([^_]É\@p([^_]B} U맍D$ TD$D$w$#U} UhUWVSkrEtXEPtF@u=@=~Ӊƍ'=[== >tD$x$ɱu@D$x$螱=@sD$x$s'@@HD$x$H>@UWVS8nX#` T8U1ǃg g DŽg r捃c r h D$ D$D$$Kh T$$<D$\|$4$rNA8t߉g 8#mD$\|$4$BNt8t㉃g D$\|$4$Nt8t㉃g D$\|$4$M8t߉g ǃh ǃh D$\|$4$Mt>8t$h D$\|$4$Mt8t$h D$g D$4$_)NgD$\D$$!Mƅ8tщ4$Zuċܳtܳ >t|$$ uቻg ?x{U+8[^_]Í@D$\|$4$|LK8t߉g 8#wD$\|$4$LLt8t㉃g D$\|$4$)L%8t߉g 8xuxxu xg 8sxwxLg D$\|$4$KtQ8t$h D$\|$4$Kt&8t$h g ~h D$D$$Yx{Elǃg 171Pǃg ǃg 芄HT$$)hUVSSÓ[ h tJtKg [^]ǃh D$4$ h ut$+s$01UWVShS[uǃh h t3$t$g $XtIu1[^_]ÍD$<$  h uˉ|$+s$0g [^_]Í,D$ 0D$D$Ԉ$ FUWVSRDZuǃh h t7$@t$g $tMt&u1[^_]ÍD$<$C h ulj|$+s$>/g [^_]Í,D$ $D$D$Ԉ$, BUVSQhYǃh h t$o[^]ÍD$4$ h u҉t$+s$.1USAQX h t$zǃ h []fffffffffffffUWVSPPǦX}ƉUԉMEԅ}@EP2.EEEÃ]}ԃEȍFE]|ЍL]DStEL2.Eԉh EȉD$qD$Ẻ$`sEԉh EȉD$PD$Ẻ$2sEԉh fEpxEfEbxEfEfxEfEoxEfEtxEE`ah E؉EEEčEEE4$ T9u}v9tq:/t9r.&9tS:/u9uF.&:/u9r)vi 9u(Ƅi [^_]Éր>/tJ(i ǃs$utǤƄi [^_]ftt鍳-#fffffffUWVS/æ7E$}LtP2.DBt;L2.0fkfbfgfE@ E1ɉMQD$ ED$E$|Ɖ׋E8t~EM9t8uo8"tEʋM Q1[^_]ÉEUU9ѸEs)fmuEZENE0US.P6D$ E$胙[]ffffffUWVSa.6}?t<$tD9uzf.&9ti8/t9t`sc~/t9u)=vm ׃rtftƄm Ѓ[^_]ø(€8/t Ƹ봸-#US<-M5EEEEEEEED$ẺD$$tEMt<[]ø<[]ffffffUWVS -4t4ƅu"t$Ut,E t: [^_]$^ [^_]Í-#$1E uD$D$$ ǃtD$$D$<$D$<$h<$褗[US2,3Et=tU T$؉$͖[]UVS+Ü3utE D$D$4$D[^]ÍD$ tD$D$1@$붐T$D$Ít&T$D$Í&.&T$D$!Ít&T$#L$ u.&T$ .&T$HÐT$.&T$@ÐT$D$ Ít&T$ L$ u.&T$D$.t&T$D$L$  Í&.&T$D$L$  Í&.&Í&.&D$ffff̀rS[1& [Ḯ̀rS[1& [ḭ̀rS[ô1& [̀ffff̀ffff/̀ffff^̀rS[d1& [̀rS[D1& [Ḥ̀rS[$1& [<̀rS[1& [̀rS[0& [ḇ̀rS[0& [̀rS[ä0& [ḓ̀rS[Ä0& [̀rS[d0& [`̀rS[D0& [R̀rS[$0& [2̀rS[0& [ḩ̀rS[/& [P̀rS[/& [ḷ̀rS[ä/& [Ḷ̀rS[Ä/& [ḉ̀rS[d/& [̀rS[D/& [Ḛ̀rS[$/& [̀rS[/& [Ḩ̀rS[.& [1̀rS[.& [Ḍ̀rS[ä.& [òrS[Ä.& [ìrS[d.& [l̀rS[D.& [t̀rS[$.& [s̀rS[.& [r̀rS[-& [p̀rS[-& [j̀rS[ä-& [m̀rS[Ä-& [̀rS[d-& [Z̀rS[D-& [ ̀rS[$-& [S[-& [f.&*̀r׋L$Q1fffffỲrJ!QS[þ,& [UWVS$Ơ,q q D$$q q +q q s$uu[^_]ä[^_]ft뻋q Pq D$D$D$D$ D$ D$$~q 11q D$$D$$ƌ$JCf;US#;+q E)9q t$腯[]à T$$M[]US>#*D$$q u $m[]fffUSúQ)‰э)y )ȍ BЅyBut*$I )Ѝ)‰)[]i)\P ףwƒUWVS ÉUB< we΋EE11u v4B< w-ύLzЋuU<9EsNju9r9MrE؃ [^_]1 [^_]UWVS!Á)EU1UE $MƉD$ED$M $Rt9} uˋUtE붋E8E[^_]1[^_]UWVS$K!(Ɖ T8E16P2.ʄt/}9tBt DK@t⋍t0DCu1U+u]$[^_]É $yDžtҋ0F D$<$wF$F(<$?y떋PUWVSX 'E؋}E }EEEE]P2.]wu8EX]E]܋DJ@u2<%uEUMYC\}IED$ED$4$ NjUEtjM 9UE}uf~ E FUxSMN7FE؉Fy$U"E UπUE댉E䍋L$ M܍,T$UD$E؉$rEFEFQ8VD$4$蘔E,[^_]ËF$ߋ\}Ef~ FFCFFD$4$>E,[^_]ÃUML$ T$D$E؉$護EFHUE$E UtRπMw0D$ ,D$D$?$UZE(E9Ut'$腂E UtπUEEUVS>uD$4$ V(4$F u|D$ D$D$F$V(D$T$!ЃF tRF)D$T$F0t F<)D$T$D$4$誒D$T$e[^]ËVPNTT$L$utˋt+FD$T$D$4$a{D$D$D$4$4UVSbuD$4$V(4$F D$ D$D$F$V(EU!ЃF tZF)EUF0t F<)EUD$4$腑EUw0E[^]ËVPNTUMutt+FEU\TD$4$ :D$4$UWVS0}?ew t>Et[^_]Ft$V tQFtB1ɉωMT:0$݇V T:($·V D: $过MV ;Nr$詇F,t$蚇F4t -$膇F8t$w4$o[^_]ÍʼnD$ 4D$D$M$脳?e[^_]ÍD$ 4D$D$K$FUVSÂ4$kLr D$E$6y4$k[^]UVS=4$~kLr $y4$hk[^]UWVSI<$?kLr D$$}Ɖ<$ k[^_]UWVSóuED$@$fED$E $g…t?t$U$Ut'zu Ńtt$$輨uUEHutU$躄EUЃ[^_]Í,D$ @D$D$<$萱7UVS 4$ jr D$E$e4$i[^]UVSÇ 4$ir $ f4$i[^]UWVSH <$ir D$$.fƉ<$ji[^_]fffUWVS0AUP2.E܍uu<0 E1]ȋ]\Kt|u 8<|Euȋ]؋uԍE9;K)11v ؃9ruvu~]؋utgu9t`wX<.u;{<0B߀Xt[EuԄYEDH@K0[^_] uA)BaߍމD$ TD$D$F$ULuԍE9s11UWVS YɲD$-D$@*.<$eE tED$E D$<$D$$ ^RE$CXUS×蹳UT$ U T$D$E$mffffffffffffUWVS FuEEt.\u* [^_]M %l t. [^_]E } t=Q tME  [^_]ÍމD$ t D$D$$+GD$ t D$D$$E TP2. } } U P2.DPwM QɨE E nE 0<rMЈE} #EEE} ;c‹}Ǎ EEJEu}&dW09uuӓ E} ?U  ЋM ME U P2.DPE PEE ЋM}ljE_ EE TP2.DE 0M EEu } \Et } %Et } &Et } =2ME E 0<cMЈdE TP2.0+E P} ;U P2.DPtOEE DЍPE} -} ^u!P2.M DHE 0ME\ErEEEE E E pE _E NE =E,}MEu}9tedtH9tud1ɀcFdE P ZE PMuU{L2.W0EEL2.W E UWVS(E܋uU }EE3O}}}}u΍ MNjED$ ED$\$E$tuU)u|ZGUڃ^uuM~EJUʃ)-E9EGO]Ϋ([^_]ÉxÍn6D$ h D$D$$ U U ]܍36D$ h D$D$$ҥU ]=j  %UED$ E D$D$E$]UD$ E D$D$E$]UD$ ED$E D$E$]ÐUWVSfur n/>3)Ѝ)Ѝ:~ 9w$r ugP U$Ѓr DU4$Ѕt9w$D$ D$w4$[^_]É4$Duljw$t$ XD$D$ w4$VE t1붋r t9U$(ZoNjU4$DY[^_]ËPǃr 뭋U tuGEǃr Dr hD$$=rr `ǃr 11UWVSÁur o))Љ):~ 9w$r ug` U$Ѓr TU4$Ѕt9w$D$ D$w4$[^_]É4$Tuljw$t$ XD$D$ w4$TE t1붋r t9U$(tmNjU4$TY[^_]Ë`ǃr 뭋U tuGEǃr Tr hD$$pr _ǃr 11UWVSÛu4$Džr ED1.t&.&P9u/>3)Ѝ)E:WɉM~4T$U4$~UuMG$U 1[^_]Ër u$PU$Ѓr UD$ t$$Ǻ4$H@G$됋r u$PU$Ѓr UU$(KkNjUthP뀃r tr u/D$$=oEr ǃr ǃr 4$HtՋ@UWVSéu4$ Džr EC1ɍv.&P9u𸿿)))E:WɉM~4T$U4$荕UuMG$U 1[^_]Ër u$`U$Ѓr UD$ t$$ָ4$X@G$됋r u$`U$Ѓr UU$(ZiNjUthP뀃r tr u/D$$"mEr ǃr ǃr 4$XtՋ@UWVSøUELtЋr t'Ǎt$p9uǃr ǃr r t'Ǎt$p9uǃr ǃr ǃr EPE LEHED1[^_]øUWVSUE\tЋr t'Ǎt$o9uǃr ǃr r t'Ǎt$o9uǃr ǃr ǃr E`E \EXET1[^_]øffffffffffffffUWVS pUE  DžXEK/tBD$E $p-E $Տuv E t E tDž`Dždxhً]/]DU.&Ѓ/u.&t+M L +M]t/+]utftl+EthD$E $pZ !%=l /u=@^_Ot/t.!+M,u~.׉ڋt9E щ`p\l`d 5lD$D$E $pJDž`D$`p蔍D=`/=A߉փsWtftdl /tU\`Ut+M׋tu -닋u \`l=p?t9E DtX$pk1Ĩ[^_]tN~uPf/tp ?pxқzUWVSÌ}E ttrD$<$(xX[^_]Et$<$}cfDžMtAt$$h(ymt J8"tƉ<${i1[^_].1fffffffffffffffUWVS}<$)r $`r ǃr 7tyP2.E1<:uPyAu-<\u.JDK@ttDK@tBuE<:u1<:tEu51[^_]Ër t$Nhǃr ǃr ΍yU UWVSçu} u<:tu1[^_]8ut#8tu<@t΃}:t% u}:t;UuF~@t[^_]Ät<:u[^_]ÍoD$ D$D$ $菓[D$ D$D$ $`UUd]UWVSÃu} to.&.&8u$ u|:9s :t|tu[^_]Í,D$ D$D$ $脒bD$ D$D$ $S-1UWVSpLJƉE T8E1=m}! Mu0r t |$$U$\ UD$ D$D$E$uDžDžƉDž9^Ѐ A:sDž\7Dž t t Džy9r)Nj)T$$` lj99D$D$E$A^Ѐ txE<#=D$ $,#dDžD$=D$$yS<:uA)ljED$L$E$:=w!C:SDžDD$ |$D$$v@D$D$ D$D$@$dD$D$@$?qDž9y^VЀ : ރ\DžVDž.&<:tu))lj>|>:t :)Љ‰)9)؉D$\$$/L$t$<$u/ $`OދDžމ:DžD))))T$<$#\o<ljljÉtE$4>)ȍP9rH8E+p[^_]ÉEDžD$$+[됋r $U!r D$<$*|70dƋY葏0$]|0DžƋ|$]Dž>{D$ D$D$ $zD$ D$D$  $<c,D$ D$D$  $.oD$ D$D$ $͈tp@a$B\DžmE$c;;E$M;n땉Ƌ$[>$|D$ \$|$4$V Pu Dž$P|H $RDž L$T$$=*4$V18Dž4$VDž鋝,D$ D$D$ $跆"0<$VZ0$6ZtE$\9ҋ M4$V趋 1ϋ$Yu%$Y됋E$8UVScEM ut.t^UD$t$$F[^]ÍT$ T$D$ $_M EuM ET$ T$D$ $%M ElM E,T$ T$D$ $M E1USir t$Wǃr ǃr ǃr ǃr 1[]UWVS0ME T8ƋE1Dž]r r P2.r tr uD$r $ 8D0Dq@:#r ux|\u ǃr ׍:\tWut$r $I7lDҀ|\tǃr ǃr r $;Ƌr u$Uǃr r Pr @&L$$/:r dǃr ǃr ǃr f:wu<:tAt<|uD$t$$}ƍ@E+0[^_]Ër $k:uhr $ZTǃr +r r 0D$r $8r 5r t$Sǃr ǃr ǃr ǃr D$ D$D$ $裀t"D$ D$D$ $t7ǃr ǃr ǃr ǃr $Sǃr ,UWVSSu} tPtzr t$Rǃr ǃr ǃr ǃr } u[^_]D$ D$D$ ${uD$ D$D$ $MWUWVS$Eu} (TED$=|$4$ƅl$d]>JDž<:9}d]V<\ֈmt>}<:tkOML<^uF<:mu‹M])ىύAdD$$]NljEEd<:u]WF<:XЀvP2MҋM FE1]MVD9ut 0v]M :]U})rtT$<$]MEEM$[^_]Ë]뽸 y]䍃D$ D$D$ $}ÍD$ D$D$ $|]䍃oD$ D$D$ $|z1*E$](P<$]P]ˁ UWVSEu} uE0D$=|$4$Dž$d]>Gƅ<:d <:tCZtsu)Cd]D$4$]LUn‰ƹd<:uЉƍX)Ӎst4\$$U]KU@Љ)ӍsűE[^_]Ë]썃oD$ D$D$# $zE]썃D$ D$D$$ $zÍD$ D$D$" $zZ]썃D$ D$D$` $Qz)D$4$]Jt-M14$]M։4$]M]k UWVSs(}E u1D$#D$<$8H80txE 11.t&.&.&.&0]9~)ƒxЉ vxwW]9׉1[^_]Íxw7@tftƄ/@DžDž)S$K9>:hf,{ 81Ƀ4uA )čD$ܤpxr󥋵t$D$$'D$D$$%|$t$$%D$ȏD$$z%,D$ XD$D$El$tudurP(1򍳂(rBvBDžqfz$U 蕻N\b8D$E D$E$]UWVS_}U T8E1EtqMyu )čD$UPtMP}y:u}\b8T$D$<$%U+ue[^_]øBfUS賺hD$ُ$Kw D$ $I w []UWVSHa}}ԋE E؋uu T8EЉƋE=D$l$M.w }M؉MufuUT$U܉T$ D$ UT$$$Luu vU܋9El} u w tUԉ%9w t1MЋE+H[^_]Á} u w uD$D$ $4XƅtdEĉ4$"]AfxHuHPU3Q }3y$ u֋U3QuˋPD$EĉD$$UQgDžuED$UȃT$Ẻ$蟋;Es4$O[f % ЉD$D$ 5D$ED$Ẻ$H#x ;Es1"B9EBf9EzJ Uȍ~|$D$ $M~DNMMčD19C9}rỦ׉΃s$tft1V4$rZDUuuB r EfUS8D$ s \$ ED$EU $T$u؃[]1[]UVS<2M uEEEQEUAEt:EȉD$ED$E$suEȋỦVE܃F1<[^]D$ED$E$~s<[^]ÅtEȉD$D$D$D$E$GsUS,X EEEEE܍ED$E܉D$$~uE,[]US,ùEEEEE܍ED$E܉D$$*uE,[]US谵eEEEEEE$[]fffffff=̀rS[& [ḽ̀rS[& [̀rS[Լ& [(̀rS[ô& [L$S[Ú€$.[t'L$̀rS[q€$.[ S[X& [US 致<D$E D$E$xb []US U D$E D$E$r []US#ػD$ ED$E D$E$-b[]1UWVS×}E 4ME0 T8E1E(,hEED$E$>$D$h8$ %hdžPdžTdžXfDžD8H<$C`ht$DkD$X^|$dGt$\t$`(D$hD$$ZtGGԉ<$=tȉt$`t$\_D$ D$D$$AhOw0D$ D$D$$hL$L DHЉD$LT$TD$dP|$dT$hT$$ Z#D$`GGƉT$TL$<D$dPD$H떋D$<@D$<$T$TD$dpD$HYD$d$<EED$<vQD$*7T$\T$`l$LL$8uD$<D$,D$dP~Kt$LtO1D$h$*9D$d@ fD$h@T$dfB vtCD$<V$)t|$,L$8/D$<D$XD$d@tt$\wt$@T$l)vD$T@D$\FD$Tt$@D$8T$TyD$0|$$<]T$L$ w D$TD$0w D$4w D$8w D$hD$w |$w D$\$8JT$L$ 1L$ tyT$TD$4L$8D$hD$|$D$\$IyċT$TL$8D$0D$hD$|$D$\$IT$,D$(2녉L$TL$ t$$D$d$'x|$\1D$pD$9|$(ucJT$`@9T$(kBD$lD$dD$B$Kt$< -UWVSў}D$<$+ED$ ED$E D$<$D$<$+[^_]UWVS輖q}D$<$=+ED$ E D$@1.D$<$D$<$4+[^_]ffffUWVS QU J}7D$$U *U z0u LJB uqsfB EEJw9mJ@U 9v<6}|$$vU  0Muωƃ}EEu2J0B0upH MHBD$$)E [^_]ÉU U fb ߋrEt9spE9-JUT$ U T$UT$V$Љƅu E[^]L0E[^]Í D$ |D$D$8L $ G@U 莎G@1.D$E D$E$2]UVS`E$ tRtL@$tEUT$UT$ U T$UT$V$Љƅu E[^]K0E[^]Ít D$ dD$D$pL $2F@$U赍n@1.D$ ED$E D$E$$]UVS耍5E$ tRtL@(tEUT$UT$ U T$UT$V$Љƅu E[^]K0E[^]Í D$ LD$D$yL $RE@(UՌ@1.D$ ED$E D$E$$]UVS蠌UE$ tRtL@4tEUT$UT$ U T$UT$V$Љƅu E[^]#J0E[^]Í D$ 4D$D$L $rD@4U@1.D$ ED$E D$E$$]UWVS(迋tuEvt U>V$  I}|$T$UD$ D$D$@$ыU,$ tvtp@Hti|$T$UT$UT$ U T$ML$4$ЉƅuE([^_]ÍV}H0E([^_]Ë$ 1ҍ}uU썃p!D$ D$D$L $B@HU]EU썋D!L$ L$D$JL $BEIU$T$ (T$D$}!$lBEX/D$ D$D$[!$:BUU躉s@1.D$ED$ED$ ED$E D$E$]UVSw,E$ tKtE@8t>UT$ U T$UT$V$Љƅu E[^]G0E[^]Í!D$ D$D$L $PA@8U ӈ@1.D$E D$E$2]UWVS褈YED$-D$@*.<$6Et8ED$ED$<$p|$ D$D$R$U E $D$zxD$$E$[USïD$ ED$E D$E$[]fffffffUWVS0豇f}u t$E$6E̅uu}EEEEEЋE 1 t1E؉U E UEUu}!!׉ uEtE밋u؋}#u#} t1u؋MЅtUMx*E؃Mw"Nwq\E@VP2.PE̅uE؃ tEtRM\0҉Q0Au؃0q AEԃmEEԃ0[^_]E@u}\}E؀t}ME؍GEԋ}؉<$tU@}ظ^DE@uS4$uV tQFvIE %Fv7 ,-}ԉ}؉xE7P2.DptGEԉ7Eԃ0[^_]ËU̅EE@>EE\@sEE\@bEE\@tEE\@nEE\@vEg}\G0E0<v\}AE\@aE&E\@fE E\@rEE@0@ 0EE؉$rF<gE\}؉xE^E?5Dž+xD$ D$D$\$4$ 0S 1󫋽BDžDžDžDžٸ1 t1 !! u~늋;ut 117D$ D$D$\$q2ˋ񋵤9## t1ҋtH򋵤9_9Džދtt$$$wtR9D$ D$D$\$0"D$ D$D$\$0# 1!D$ D$D$\$1xD$ D$D$\$0=/.ڋ)ы9t$D$4$~c9V9ËϋtftRuh9%Dži$~‹9xfu@u'D4 MfqX1҉1ɉUVSv?~EE T8EE EEEMED$ UT$UT$$1xEU+u [^]1蝦UWVSv}EE T8EEEEEMU ED$ }|$}|$$YxEU+u [^_]1 UVSuH}u t44$"D$ UT$UT$$1ҍE[^]1UVSAu|ut54$]"U D$ ML$ML$$E[^]1UD$ ED$ED$E$M 1ҍEd]UU D$ ED$ED$E$ME0]UU E D$ ED$ED$E$ME]UVSTt |EE T8EE EEEMED$ 'T$UT$$1xEU+u [^]1fUWVSsÍ{EE T8EEEEEMU ED$ '|$}|$$xEU+u [^_]1UVS[s{u t74$w D$ 'T$UT$$1ҍE[^]1UVSsûzut84$" U D$ 'L$ML$$E`[^]1UWVSrdz}u t74$D$ 'T$UT$$1҉[^_]1UOrzD$ 'D$ED$E$M 1ҍE]UryU D$ 'D$ED$E$MEy]UqyU ML$ 'D$ED$E$ME9]US qFyEEEEED$E$E []UWVS$KqyDžE = t /7ƍD$D$ |$t$$~%tm1 9BD$E$uċR} u9rcJ8.8 uK9t4$Y$ƅ(-9t4$Ё$[^_]UE D$E$a]ffffffffffffUWVSoFwƉЅtK Љ Љ Љ Љ Ѝx|$F$#tBF~1[^_]ÉUT$ xT$D$y$r'E냸UWVSnævƅ9N rd~PRuF$D$ D$L$M<${VMf.&2Z^uC[^_]ÉUy(MD,ED$|$F$u|M ,ҋMUu~ VЃ[^_]ÉMUD$ `D$D$$W&MU M͐D$ `D$D$$&M9N r~y(M|+ED$|$F${UX+Mu~ 1UWVSPmuƉυF(JJrPfJtt$ $ uL赗t4F%=@=(=Ĕ[^_]tt*8t$tB$Ct5z |1tft Ĕ[^_]fxt~B8z<~ ^z0Z4FB@zT.BpDpf@PDP01H41 u䋕t3P8H<1 uҋpx9t<|1tftF,) rĔ[^_]ÉtD$ lD$D$$a#tzUtBT%=.(8t, f({f'{UWVSnj#rE։ʅE@(u+U$UxTLYHP#BXU$U@PxTZrtftP,}WP@ @J@ @@[^_]ÉM썃D$ TD$D$$!U!1UWVSeiqljօxlxD$$tE3G0U3W4 ux3G8|3W< &xGЁČ[^_]D$@ $\ttRxD$ $mƒ{p&0t$s&0pЁČ[^_]úЁČ[^_]Ët$YUWVSXKho}ljU ]1G(D$C$]E܅}-G(҃EEE܋1ɋENE̅n]؅EfHJ]%EEEċX(]S@|/EEG(EGU)ЉEԋEċ@DEEEEEE?U؅F fFHEċ@FFEEpEuE܉$]5Å(G( u { .PK S M2ƅMpE9EȉFDEN(F{ ufNJE̅GE؅tEC G(YFFfFH FE5u3ҋMċI@M)щM7EEċX(]S@|/EELGEԋETMM/GU9tG(UЉEEGU)ЉE{~f{.n 8G(tkFFF,D$FTD$E$]1ɉfFHU؅&؃)‰UFTE[FTF벋EEUEEEGX]/IE܉$]EG(E9GEUЅE}G(UċRD#] "EMtuv$]*uE܉$]_!UEf@HO(EEX[^_]EEEE@]uaMЅW$tEЃtUX[^_]t]M!E4$~5EEUE}MЅuW(EċpDuG$]Y}Ef@H }0] UĉB }EEEOGt8f.&.&.&PXT9t+PʉPH@uUЋrDyЋXDPXT9t+PʉPHPu׋@ԋ]D$ 0D$D$$^} }fGH]G @E}G(UċrDuG$]EЅEċ@hUZG(UċZDuu떅uEċ@뽅?~t&UWVS$`ôh} EdD$,$ƅEF$~(EEt=}1҉Eu׉ $ 9sǃuEuw1ɍ'E‰EM@DEwE1}EBUE$U UQ…U@DEBBTBN(U?fUufBHEuBMEPUEo}}Ut E1ɋUt9xf@H F(EuNE$)A} $ uE$F$4$1$[^_]Ã}uω$ 9sǃuu0UU~X릋}|\1ɋUYxf@H F(hD$D$@($FN(&D$ D$D$$8&D$ D$D$$ 1ɋU@f@H F(ZE4UWVST] e}tH@JHDy$?VDxpup$$VDy4$wtv$uGt$G$G(t&<$1[^_]Ë@$$dG$ ƃtCG$뻍D$ HD$D$ $EvEG$<$BEbUUUWVS[ïc}57KW(?FLfFL;NHtlfv$NDFLf;7tȍڐD$ <D$D$$Affu@F83G N<3O FJ"Gt uƉv$uuGfFHPp$~DWF(VD{G(G$O(1[^_]ËGt+tEW(uƉv$uuGGIG)t룃8N?wGGENQ(BI|/u‹E/N,QT$VTT$$/7[^_]ÃD$ <D$D$U$1ɉfFHG(uG$F,F(NTD$ML$G$藴D$/M $at;9EP$U9@MD$UT$E$KMN,GFFF8V}F)uGHf fű~t$u} EHDu@8/tF(tF[^_]ÉUD$D$@($访ǃUttF<$b<$ugfF)E@[^_]ÁN(fD$ D$D$1$ FUWVST@\utpd7u4E4$u(4$qE$觿[^_]ËF$$=뿋F$$0F$$%F$$0뵍D$ D$D$B,"$K aUS SÅ[@1.D$ D$D$E D$E$l$]]US SA[ED$ D$D$E D$E$l$]]UWVS8LS[Ɖ׉t,M=U= =T$E؉D$E܉D$ L$|$4$ =ƒu܍M؁ ʨtUEԃ8[^_]úڋUոEEkEhEEMN1$"ك8[^_]1URY@1.U E]UMU E]fffff̀rS[ÔY& [̀rS[tY& [ ̀rS[TY& [UWVSQ6Yu} u !t9u[^_]1[^_]ÍD$ D$D$*P"$ UWVSQXu} ttB|$4$%[^_]Í`D$ D$D$Bt"$) ukD$ D$D$Ct"$UWVSP9Xu} ttB|$4$[^_]Í`D$ D$D$Bt"$ukD$ D$D$Ct"$kUWVS@PƦWt$(D$T$L$,D$,t "|$GD$8UT$$\$(IuL$8ǀ-<+>D$D$,D0OD$D$$D$ D$0 D$4D$, 11҉D$8T$<09L$,tfD$$|$89T$ |$<O\$81؉ËD$<1 -\$0|$<ߋT$4|$8Ӊd$0ډډD$8T$<NyЉ< tA< W9L$,iߋD$8T$e[^_]D$rD$,D$,FL$8D$0T$4D$T$ $D$\$(誫D$$T$ D$0T$4D$T$ $D$QD$L$8D$9\$({ "D$8D$E܍ 0MU‰T$UE$]U})ljEuUD$ D$D$E $] MAQt$|$E $@t~")Ɓwf]o8}}؅WMEA Etk}9z1ҍOMu1&F])9! ^t t49st҅=$]…uuEEMHE+A AE@M MԉH $]18[^_]ËMЅ$E$]D$ D$D$E $m$뫉EX@$]MA }E@@eBE $]rD$@E$E |EMH ]ωu]$D$ D$|$$UU2txzuEԃEU܉ƀ t9~tMG M L$$]uDG uNjUtG~uU܉$]>}닋]썃D$ D$D$"$N$]‹EE1]UWVSCTK}G $wt6$uG[^_]UWVSWC Ku} t"tL D$ $^[^_]ÍD$ D$D$:"$buD$ D$D$;"$4UVS8BsJut&g== =@ED$E܉D$E؉D$ T$E D$E$}|=t3w $Ef>@fFE܋UVtfNȃ8[^]FfF׸E@EÿE?EEUOFfFFfFw1a1뚸̀rS[4I& [ffffffffUE]UWVS$HAHE։ME}E؉Eut\E9UsI߉։]EƋE D$\$4$U~# HS9uE)9ur]ڃmu$[^_]ÍEԋu؉0EȉEċEEȋE9E^Eĉ$]1X[^_]Éȉ}} 9sOuƍW+}Mω:}u݋uƉ]䍶 HZ9u]E9r}}E؉EU܉}Љ؋]<].&.&XJ9u]ދ}9rU܋}.U߉ËuދM9U]3]M9lËED$\$<$UM9Ӊދ]19ME9Ms?u}}9us'<3ED$|$E$UM9~؉9urًu}E9u̅U؋Ev.& 9rUB9)ӍCu؍LuDEEu0f9uM؉E UE8}؋uf9rEH9)ÃE؍4TЍ< }}\>M).&ƃT9uUU؋uuދU+]9rEUED$\$<$UU9ЋUԋM9s͉}܉ߋ]M ֍E9}s8)1ÍED$T$UE܉$UM9ȋU‰9}rȉ}Es11}؋uv9rEp9rR)ÍKE؍|Ήuu\2M)щ.t&.&ƒ\9u}}؋UUs11(M]U9UE̅U؋E}Ѝ.&029rEЃ})}؍DE؋EԉEvp9UEЉEԉ}؋uEԐ9ruFU9rMB)U؍DE؋EԉE#}؋uEЍv9uE؋UЋ})E؋EԉE11봋U9UsEЉEUUE}؉8E‰+EuEuY}^؋uƋE؉EЉȍ8].t&.&.&XJM9uU9rED$}ȉ|$Eĉ$][}~]WD$ lD$D$y"$,ÍcD$ lD$D$x"$k]WD$ dD$D$&"$]D$ dD$D$'"$h]U5<UT$D$ ED$E D$E$]fffffffffffUWVS 4f<EuVtG~^ЉUv.&.&tP1H1 uN9H u [^_]ËUU$]t"N^HXNH UF [^_]ÃUWVS 4;ud7uu[^_]*F$$4$NjF$$Ӥ[^_]UWVS3f;}E wu v.t&6tk9uFVO9N uO1MO1 MtGD$ D$T$$GWG1D$<$KtG9F [^_]ÍT$ |T$D$i #$SE GffUWVS2Æ:u8F}9FiF FD$ D$D$$FVFD$F D$$FtotfxWFvthV uAzN)91F Ju M ]z u F MЃ[^_]1}81F u1UWVS1}9}d7t2G$$貢D$<$ƋG$$蕢[^_]D$<$Ɖ[^_]UWVS W1 9.E$d70E@$$(D$E$,ƅ@ ‹} 6@E@$$轡tiEM 1D$E$ƅt[P } uWuY'u}8닋E@$$/t= [^_]äDf9ft8}8E1E xIE xfff̀rS[7& [ḃ̀rS[6& [UWVS$!/6utqEEE E8D$D$ED$ t$D$E$肿ƃt 1$[^_]8 u81ፃ,D$ D$D$<@#$`ffffffffffUWVS0M.6E̋]} T8E1u9 &t8u)؋U+0[^_]ÍM1D rE̍.&TЃutS؉].t&.&.&t\="t]W$]~I1B]]fffffffffffffUWVS-4}U utMЅt1.&HOtu&xu)Ѓ[^_]ÉU n6D$ D$D$=h#$U 끍36D$ D$D$<h#$U KfffUWVS1,3M} Utut[4t&.&9t8u)Ή)t4ttu)[^_]1<$Ɖ[^_]ÉUMn6D$ D$D$A#$UMP36D$ D$D$@#$UMUS%+2Ey |(9~)ML$D2.D$E $1[]ÉD$ D$ED$E $1[]UVS*e2Ey |(;}.D$@D2.D$,w 4$U[^]ÉD$ D$D$@,w 4$k[^]UWVS0*1u} taEtHL2.EEt/E9t(TSOLKf9t)ȃ[^_]1[^_]Í`D$ D$D$?#$ukD$ D$D$@#$FfffffffK̀rS[0& [UVS%)0ulimNA90%[^]Ëtph9rltp[^]9r싋lUWVS(Z0]l^Uu}E_ N)BЍ4))Ѝ<)Ǎ)ʉȍA )) E9uu}E]싓tp4819u[^_]Ë]싃tpu޸UVS'@/L4$聘ulU4$d[^]ËE4$M[^]UWVS .'.} lE[LE$ lttp)ЉȉB}H}wQǃǃǃGlhEG1E$著E [^_]1뜍Gƃ}?v8}}E?EG EElE艃hE=p)ЋM@G@EE띍/D$ D$D$Y $$vE$膖EEE3UWVS >%,lEEẺEыE)ȉE䍃LE$lUp)ȉAEplt)̋Ep1thE$^E [^_]1끍/D$ D$D$ $$UWVS$ý+L<$Ɖ<$[^_]US #Ä+ED$E D$E$t []US#S+E$[]ffffUWVSq#&+}tHD$<$ƅt&tt$<$[^_]1[^_]Í,D$ D$D$AX$$YUWVS"×*uD$4$?Dž|$4$t>UT$D$E $d;Es1>[^_]J"8썃,D$ D$D$VX$$NfffUE U9r 9]ø]UU E9r 9]ø]UWVS!o)lw lw ulw \b8E1ɍt-ωD$4$>t lw PEu׉MD$D$4$ MtMljMuD$|$E$ lw 8Ftt$E$ 4$ uMEtw 9t$$ǃtw ǃpw [^_]Épw TD$D$$蛬[^_]UWVSt )(u} t%5D$4$tt=t1[^_]À=t[^_]UWVS 'ut4t$<$ƅtD$<$ 4$[^_]ÍAD$ <D$D$|$$UWVST'}G$Lƅtx @D$$~[^_]UVSR'ut/t$$tU 9P [^]1[^]ÍAD$ $D$D$|$$SUWVS Ñ&U\b8E8s7i1}ƉUE D$ED$<$u E <=,E19MƃU;\CEVE [^_]UE [^_]L닋 EyyEeu>EcLt9er ]6M υt&MyEҋuLMyfffffffUWVS!ƍt$<$褲u[^_]D$ FD$t$<$襴[^_]ÍpD$ D$D$X$$떍]D$ D$D$W$$ŵcUWVSK}u t$<$u 1[^_]ÍF D$<$ıtF t6u$FD$<$tăt$<$ 뵸[^_]ËFE }F[^_]]D$ D$D$w$$OD$ D$D$x$$軴 UWVSAu} t tJD$|$4$豱[^_]Í]D$ D$D$g$$NuD$ D$D$h$$ UWVS^}u tet$<$轩u 1[^_]ÍFD$<$&t~uD$D$ F D$t$<$u뵍]D$ xD$D$$$qqD$ xD$D$$$?BUWVSz}u FFt 1[^_]Ét$<$跨tFD$<$*tӍFD$<$葨tF D$<$~tt$<$k랍]D$ hD$D$$$nVKD$ hD$D$$$<'UWVSw}u -t8GunG toFF[^_]Í̑L$ M썃XD$D$%$$U話GUMt]F[^_]GF[^_]ËGuS[^_]GFGF[^_]ËGtщEL$ LL$D$$E( GFG F[^_]ÍLD$ XD$D$$$$辰G EL$ @L$D$ $蕰E   FFfffìrS[Ä& [v̀rS[d& [VWST$L$1t8uЄt`B͉ .t&ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUWVSöuM EtqF> .t&9tQZut\M xU &.&t%J9utE8[^_]É똉1E0u1ދE1эD$ D$D$: %$萮M E9M ڑD$ D$D$; %$UM fffUWVS(ÃƉЉ T8U1҅OD$ |$D$$<$蔢@9Er*ED$|$$Fu%1U+I([^_]E @(N sD$ D$D$ $_4t9um΃tft%D012 ( T$ PT$D$0%$}v82T$ PT$D$0%$B-D$ D$D$ $w^uoN }L$$ te$Nff^N mF.t&:#UWVS^ƉE T8E1t5Vt1U+gĈ[^_]ø݃FEDžF;Fu&F uF=hu ~Wt{}ttMED$ t$D$$4$蠞9E{ED$t$$+1F5EDž*FfEMfD$ D$D$<$[<$9EED$|$$sF<<p EED$D$D$D$ T$pD$$v~0wDžFȉсI<<9fE;|$ L$D$$U8<$m9Er8ED$|$$$mj$m~3LED$E$NDF <Džytt Eut2ED$ D$D$$蓄t1ED$E$1cUWVS<ÊuU EEMEE܋EE؋E E T8E8}1w~wF}U+A<[^_]ËE}+8+EԉEE؉EE܉E MM<[^_]xvE܅t U؅Et(1댃vE܅t }؅cFu f~#V~CΉD8T DND$ D$L$M܋E$^WM܅x9lEE܅t E؅aFfVT$D$ D$L$M܋E$VDžMn9fFfF fV ffuu҉T$D$ D$ȉM)D$4$VMx 9EtEc҉Uԋ}^UT1'E܍ E؍xE̋E܉M܉u ET8ẺT$D$ E؉D$t$ $MU9M)ƃ9}u1hȃiviD$t$E$製1?FD$  EEEDEԋ}1'E܍ E؍xEЋE܉M܉u E8EЉT$D$ E؉D$t$ $MTM9)ƃu1yMFD$ D$D$}<$T<$M9L$|$E܉$腼MFUU܉D$ D$ȉM)D$$JTM9\D$T$ D$L$M܋E$ TMUWVS@lj΋E T8EG uY$fto|$$gt9wuҋtD$G $輗u1ffh$荕@=v1U+|@[^_]ÉЍJƅffЍtftD$D$ |$D$@$yO9Aff9't0G9T$D$G$&t$ |$D$$hu8u Dž11fB<UVS dut$F $&eE $MUYF t [^]ÉE4$dE [^]ø̀rS[& [UWVS1}E$jxyUtR֐.&6t;F txu@9uD$FD$E $諸Uu 11$^q莣8[^_]1[^_]UWVS;ut7D$4$zFftID$4$z[^_]Íw0D$ D$D$@T%$띿ffffffffUEu]É.߃A.t0.tvPЃ w-t1]ÀvPЃ v1UWVS UE Hzu;9]苰uυ0qD9sD{]Y}^D9_D$υt'v@9w@|uxb9wxT9}P [^_]Ät^};tm9tЋ'밋II[:K [^_]Ë9u9tЋ}^D9_D<]][D9^DυYDM9YDt&I}>0^D9_D$명ff9߅unP=UWVS(EEdE1ۍUԋEЋxMЅuO.&Bxy‰t%xux#l;htӉ@udEϋEЋxE9zEuЉF([^_]ÍUԋEЋxUS`PtSt)/[]PtfHuX uHuxuπt[]Pt#u[]@ tOEyD$ ED$4$0UuEt8u x[^]ø[^]ÍD$ lD$D$x%$腘qUWVS(tƋ@tt 1([^_]ËFOx]M܉ЉUUMtR=w1fuVtztufLJ8 8 f럃u ([^_]ø ([^_]uEFtOtB1M]\$ ]\$D$$DGt@MzV뒸.;븍3UWVSõƉׅt5tet&u 1[^_]É $GuMT$ DT$D$x%$MuMT$ DT$D$x%$ÖMkMT$ DT$D$x%$苖M6UWVST ։ T8E1|DžDž%F F`FD$$D$ D$D$D$F D$FD$ D$D$<$u G @u}D$D$ L$D$<$O @,1ƒ $WD$D$ D$L$<$4~QG KD$D$D$D$D$ T$L$<$ҠE+ȁT[^_]ËQu7Iffft#fFPЃ6tRr,D$ D$D$ x%$蛓U +t't܃t&uҟş踟UWVS(zƉЉ} T8U1҅t\D$t$ >D$D$4$BE=1U+([^_]É4$`PwstP|.ut$T$ D$D$4$D댉,T$ T$D$ x%$#膞O UWVS4>}ĉÉ T8EЉNjE1C<<EԋCE؋CE܋C ECECECE1E}EȍXH,P<9ѺsZu܉E 9tBKt:": =t׃v.t&.&w9uE̋u9~UȉEuE1uЋU+4[^_]Í}1fE9s/tG9sD9rEufEfECEEb1fۋ]oUWVSÖƉ׉MEOD$A M$k_…tKX MH FBF B FBFBZJBB!G_ ߋus%uu Ѓ[^_]äЃ[^_]ftug׃D$ dD$D$x%$]0D$ dD$D$x%$.f mUWVS&B@DϋE$E, T8ƋE1* $ , 11D r} !W.} ft/} t)1E+" &[^_]Á} u*(Dpf@fPff[PD 8Hx LD$ |$ T$L$$躖…P @@ u+!<$诖f$V讏t,$ډL<$ی LwdmPu .8tX<9 u拽4t t҉tH9Y PP1= UWVSpYƉ T8NjE1>$.M$M`11D r틅FFtGGFUCF趆裍1ɐ.&.&.уu9s x.:d9 @ *HDPDDžDžDžDž<$迅8=.t&褌G au$1ҋybK#;d97$1ҋ0ND$F D$F$5Ƌ@ut2OD$G D$G$tF$R$RU+cp[^_]Ã){$R$R1녃1(@<tcE D$ D$D$$u|d@=1$1ҋ_/@ P$1ҋ蜉膉8,D$ D$D$ x%$|$1ҋR%@uu*$HDPDEψe$O謈1gUWVSihEdpPt%=~h΁Dž1E1 Dr]`1 DrV]pdMEE`]MEE$E]1 DrFdd<$hdU[^_]É<$hh .[^_]ÉЉ`6`fXh.\G]1}`X D r틅h HOT`@pP9DXLHHX9HHD$ PD$D$L$h)dL$P T$ D$DD$l$ ;xq]1EDr틅lEEE!$\Xl$hqL9TX\d\$h~EE؉E؉d<$hi~dS|dMEEdMEE‹`MH@A‹@u@<$h}UWVS`*ljUMMME EEE T8E‹E1EE$Uu\WtUL&t89uML$MML$$OMt u܋E01}U+`[^_]ËG;t?OƅE$1ɋU "D@u듍ML$ME$ 2rDD$E$t4M<MMG;tƅE$1ɋUv.t&@uD$ TD$D$x%4$uEED$ xD$D$4$tu%uܸEvWt$I<$HuEaME뺋M# U芼7Ew ]Í^]UWVSU ut(vGt$TH<$LHu[^_]ÍD$ D$D$rx%$]tUWVSØEdE tEpMh T8lNjE1x1󫍵1҉D r퍍T11D r틽dpPu x x$9Dž hlE+[^_]ÍD$ D$D$x%$s t]DžDžDžDž|wHt;u Džx$tT+ l`XtGt`u\W9tCu+w9 t  | t1҃1҉ TL9G9}Gw9 uuttdx$tTLf.&9u`q@D$%d$9gd$…^ d)xD$L$4$tPTP `pLH@D.t&.&vZ~u~ x G<_$S98JD$ 4D$D$ux%$]e>x$+Džx$}+DžX`A{$ 1"DžDžt?G t,Gt&H?wB11  ?uNj<$7lD$ D$D$cx%$7dG H닋Dž(D$7Dž{vGt$q7<$i7u DžDžvXx.fǃ8 4$1ɋt.GtuŋG@fuXHS$o.D$D$D$ L$D$ $!;ȉQH9rs$P- xrHH9s $5GDžP`tp;X@XAƜ9qXGGPPP PP PPHxPFF|!DžDžDž 1D$ |$T$$xx$1ɋD$D$ $y|$L$$,~D$|$$/FF|HF<w<FDž|19sMd9]2Bt⋵d|9s 9r $WctpD$ D$t$<$ )ʍ0&J9uB<$2Xt;1AtF0 $t2Ft4$U2X@FXVDž|1dH1׉D$ D$D$$贛T$D$Ii $BwjNxa 7 $s1x$#5x$#DžFB0$0t2Buቅ߉UWVSp褤MMEׅ M11D rEMEr EED$ E$]2&HMt$E$]ooX@t\}}< < ߉ډt$$](t!P@t< t< u׍ZBu}}GE؋GE܋G EGEGEGEGEEED$ EԉD$D$E$VtFEEEEڍZB&q6EEtÉE v[ttMډ[uEMA.t&‹@uUEtEЉEEp[^_]ËUuˍD$ (D$D$h x%$Z]D$ (D$D$i x%$ZUWVSpϩuE$Δ>FEu11D rE@tmEEEE<$NML$ML$D$ |$D$E$ʔtwEЅUp[^_]øp[^_]É<$NMML$UUT$D$ |$D$E$ct2E$;-RUEetFE$-gMEԋAE܋A EAEAEAEAEEUԋEtEЉƋ@u{ve!UWVS\ {0 T8NjE1aCr D$ D$ D$ $Sƅ?8#D$4$$D$4$x1҉< tv< tr׉ʋD$$ ƅtbHT$$GFt < t< uσxzT$$RuЋAAA AAAADžD$ D$D$4$fU׉&.&t틍tڋ$D$$ k1ҋE+Ё\ [^_]ËډD$ D$D$ x%$U,D$ D$D$ x%$sU|UWVS4EȋE8Hu11D rM̋]ȍD$$ EЉuЋM̉t(Ct&.&Ë@uM̉u؋EЅt $]'EUt 4[^_]ø4[^_]UVS!֣uD$F $#tP PH p[^]UWVSD՛ÊljE T8EG ut$t$$tӋD$$|JtD$F $[Jue$AH@=wI$H‰@=wЋЉ=@1U+D[^_]Ë~D$<$Itu狵1DžЍtftȍtftD$D$ GD$D$@$+9qt89FD$D$A$$z<FL19\9PB 9=0t9$9uۉD$D$ $uD$ D$D$$i(u9u Xu3fvfvB{UWVSâ}utHt$F $]E $UF t[^_]ÉE4$9E[^_]Í,D$ $D$D$'$OfffffffffffffffffffffUVSÉ13v.&.&.&.&.&.&   lLLLL9r[^]UWVSTNjEGEGEG EM],t&.&.&.&.&.&Br 2 r 9u֋]Exj׋]؋M1ȋu!1U V1!1 ‹Mp $1!1ы]3ν1!1 ˋuč|1!1؋uȍ*ƇG1!1 ‹u̍F01!1ыuЍF1!1 ˋuԍؘi1!1؋u؍D1!1 ‹u܍[1!1ыu\1!1 ˋu䍴"k1!1؋u荴q1!1 ‹u썴Cy1!1ыu!I1!1 ˋub%1!1؋u̍@@1!1 ‹uQZ^&1!1ыuǶ1!1 ˋuȍ]/։1!1؋u܍SD1!1 ‹u؉1!1ыuč1!1 ˋu؍!1!1؋u썴7É1!1 ‹u 1!1ыuԍZE1!1 ΋]荜㩉1!1]1!1 ‹]Ѝ og1!1Ӊ]ӉыU1ыU䍔2L*!1 U֋UȍB91UԍqU11 ‹M]"am11ы]썴3 811 ˋuD꾤11؋učK11 ƋUЍ `K11U܍p11 ʋ]荄~(11ӋE0'11 ދE0ԉ11M̍11 U؍9ى11ˋU䍴211 ڋu|11֋EeVĉ11 ED") 1ȋ]Ѝ*C 1 ËU썔2# 1ދUȍ 9 1 M䍄Y[e 1ыE 1 ˋE܍0} 1؋u] 1 ƋUԍ O~o 1U, 1 ʋ]̍C 1ӋE荄0N 1 ދEč~S 1M5: 1 ‹M* 1ы]؍3ӆ 1u uÉ_] GMG T[^_]UVSÙut0FF#EgFFܺF vT2[^]ÍD$ dD$D$@'$GUWVSm"EBU oP?ωMM1ÉPHUʉP@)|89]riڋu uwuoxEE);UEމ}E} ]7E@9r})uu Eu sItft[^_]äftX] E]DEvT$ XT$D$@'$WFEU ET$ XT$D$@'$FE\f7u S,f$UWVS$NEE} T8E1WEEG?78)‰T$D$<$cD$ED$<$LEyX1tftE+$[^_]úx)rD$ LD$D$@'$DD$ LD$D$@'$qDWZfPdUWVS$ڋNj}ЋME E T8EƋE1P2.ljEDGtXEE؉ƀ0xC1E 1҉uËutFt9}t`}׍Ty1ME+$[^_]Ã}u1ft* ta) 봻A8w믋u܀.u{E9twVË}DGt03Y؃,THt$^D B螶UȍUT$ U T$@1.D$E$]UED$ ED$E D$E$y]U讅gUT$ U T$@1.D$E$B]UWVS$x-u4$2uE荓UEEEEED$@*.xX<$E؉D$<$ D$<$u $[^_]fffffffUWVS΄ÃEX T8TM1ɉPD$D$$苶ƍ`$׋PD$XD$$P+WPT$D$i4$Q!4$t'pTU+İ[^_]]\$\։P&.&6tN~ tu틅XD$F$2uԋPGX$(XPP$ :A1.$踳ffffUVS"׊uF tF 1[^]ËF0$F0F($F(F,F$FFN D$$FtN 댍D$$t N e]UVSZuF uu,F [^]ËF$FF F tԋ$a F F [^]UVSßuF uetaF0$ F0F u9D$D$ D$D$$$F0[^]Ë$Yf 뷸US] $-1U C []UVS<u4$F$@ FFF0$' F0F($ F(F,[^]UWVSҀÇE@0} r ML$$rp.t&< t< tRD$4$=x4$VfM Ay EpE pED$<$tfP1tN< td< t`E@H9tXE xFE7ED$$>PuuE @4E [^_]Ã댉U }OD$G$_DžUtf.&.&:|y@uEu1].t&.&.&\X:Dyuu]؋]<.pDAEu@uDA@tv:Dy@uEuEx<2wE苴L1EE<2w]EBRDQ@uf.&DQ@tvDQ@u}[^_]EEfE랸}))ߋ]4)}؍)؉B)ߋE4)E؍E1ۃ@EEEzDAuE~EzDAt/}GEzDAu( }DЉEBDAUWVScjljE T8E`M!t8\$wD$0$AD$AD$A D$ AD$AD$AD$AD$A D$ A$D$$A(D$(A,D$,hhDžD$ D$D$$]j uit_atP%xrt& r; ut$D$$0u f})\D$|$D$ D$D$$ g:t$$%t$$ H88$HD$D$$]t$E+Č[^_]}vP.& p;8u}vvgl.t& P;8udt$T$ D$D$$8<$\=!\$\uD$ D$D$ɓ$|$D$ D$D$ $uz|$ D$ D$D$ 4$Iz|$D$ D$D$  $z|$D$ D$D$ <$y( D$D$ D$D$4$y}艽EЉT$UT$ D$'D$$0XP2.9D$ND$$)U frffXftD$D$$41HD7D$D$$9|҉ƋD$ D$D$<$1D8 DAu.L$$*9|ȋD$ D$D$$aD$$ 5 D$ D$D$7 $0fuAD$ D$D$@$lD$ D$D$ $1HD7D$D$$9|҉ƋD$ D$D$<$91P2.D8DBu.L$$<9|$DD$cD$$YUWVSZ4bEĉED$ED$E $a>D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,`D$0 Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,1`ẺEEfEEEfEEEfEEEfEEE`t3 u'^"lUowUt& x;uED$|$ `+.D$(D$E$E`t eED$$;E`AED$ D$D$$~D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,^;D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,7^D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,]D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,g]D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,\D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,\aD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,/\D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,[=E`ek‹wt& puED$ t$D$E$zk‹w p8uED$ t$Ɣt$E$+jWc& PJ8uED$ T$t$E$jWuf Wz?uED$ T$t$E$E`t tED$$ ED$$1ɋuEzED$$ E]ED$$@E@ED$$E#Ef Ef Ef EĈ[^_]Í T$D$ D$D$<$=n D$D$ D$D$$UnU D$D$ D$D$4$m D$D$ D$D$$UmUP D$D$ D$D$4$]m<$D$D$E$Ĉ[^_]ËED$ D$D$$ED$ D$D$$ED$ D$D$$uED$ D$D$$^ED$ D$D$$4QED$ D$D$$ ED$ D$D$$-ED$ D$D$$ED$$ jIUWVS$kP XuE } T8U1D$L$ t$U‰T$$}xVD$t# $U+u#$[^_]$.19UED$ D$E D$E$]UWVSO5W}ED$|$ ED$ED$E $x8Ɖ<$vuH;M}"f.E[^_]À|.tH;M|1[^_]UWVS$NñVE T8E1D$|$ D$E D$E$&…tD$<$HE+u Ё$[^_]~UWVSiNV}u Gu 4 Gt*D$4$迯uUt E[^_]ËEtE[^_]UWVSMíUuSd~M u7&.& ~t9uUt E[^_]Í L$D$ D$D$<$hEtËE[^_]UWVSSMUu} cVu5f.& Vt!9>uMt Ev[^_]Í|$D$ D$D$4$hEtËE[^_]UVSLfTu cvglt& Bt ;2u[^]Ét$D$ D$D$ $gv ϔ[^]Ét$D$ D$D$ 4$Ng[^]UWVSKëSU} tfUBb~U f ~t;u[^_]Í T$D$ D$D$<$f[^_]ÍlUVSlK!SuaP&.& Bt ;2u[^]Ét$D$ D$D$ $?fv ה[^]Ét$ D$ D$D$ 4$e[^]UWVSJ[R}auwX w t& @Bw- wi ue;@w, u845\u( Lud<uK,1|$oD$ D$(D$4$d[^_]ÍnE捳ލ֍΍ƍ뾍붍뮍P릍'랍W떍 뎍1UWVSHÞP}D_YD$t$<$_x [^_]É|$D$ D$(D$4$c[^_]UWVSuH*P}^wf.& rt;:u[^_]Í |$D$ D$D$4$Lc[^_]UWVSLGèO T8E1E <tmD$wD$ D$.D$M‰ $MbMt#PT$UL$<$U0E+u4L[^_]D$ .M‰L$ME D$$MwUWVS4(GNEEEE$7E܍U}}؉HEU;EEU t 14[^_]ÃuuU<-1E<+u JMBP2.DK+r1&.&.& LH>vD{uU 4u<.m}DCuuUЋMэMܨ@1ҋM..&.&DK@[9rM̄WȉMDS@793EEԋ}DC@1ɋU1&.&.&DS@J9rUȄЉUDS@&9ENjUDC@.1ɉUЋU/&.&.&DS@9rUċUЄEĉEDS@9Ef1.&DS@9rEu ]Ԉ^^FEȉFEȉFEȉF RGEuuESt&.&9sDS@uE&DS@tx9rhEz}BDCz}4BDCu;u[JMBEEEz}DEBDC yUWVS CǾJEU UHMHMHMXˁHɁ@ ='-E썇'E)ENMb֍)É]ԉл))ƉuЉމػ))Ɖủ]ȅEEMbӍ)MĹ))Ӊ))MUQEM)U܍)MEC$rEE-$rEE$rEÅU܋MXE^}d\$DD$@ED$<]\$8T$4]\$0]\$,]ĉ\$(t$$L$ ut$ut$uԉt$uЉt$ủt$ uȉt$8(D$u4${%E$Et $Et $EČ[^_]ú)‰U썇iEESEW-L uVE; er@ror:@ unk@ nown@ LOC@ RR @vers@ionEČ[^_]ÍsEs}\$DD$@sD$*t<.tȅx%[^_]Åt<.1[^_]ÉM~T$ h T$D$|($E[^_]UWVS0>CFTE荰EEEE$ΘPlPHH8|$ x|$x|$@ D$L$T$ D$D$4$~ Eƀ0[^_]UWVS=ÞEuP Gt-D$4$=u?E tE [^_]Ë?D$ڔD$4$AukVP2.DPtM@D$ ED$4$讍ҋMyE8m1Ɂ]1VUWVS<îDulvg Gt-D$4$Mu?E tE [^_]Ë?D$9D$4$QukVP2.DPtMPD$ ED$4$辌)ҋMyE8m1Ɂ]1VUWVS <þCu D$4$FFy ;F|/} t)P}D$4$~[^_]Ét$E$胮US;GCEM QQy ;Q|< tZ[]ÉL$$5[]UWVS@;BEu E$ZEEEEED$4$F0u ǀED$4$D$4$[^_]UWVS:kBPP_8uV@ttuF*V@uuOFuuFuFf~@t8D$4$Mlj4$kP[^_]ÉFu뺋F몉4$JfF@UVS9ìA_8Fu t$@*.XD$ D$ED$4$'[^]UVS9XA_8Fu tE D$ D$ED$4$[^]UVSU9 A_8Fu ztED$ E D$ED$4$[^]UVS,9ý@_8Fu -tNE(D$$E$D$ E D$ED$ED$ED$ED$ E D$ED$4$=,[^]ÉED$4${EUVSy8.@_8Fu t2ED$ED$ED$ E D$ED$4$30[^]ÉED$4$EU8?_8U]U7?_8U]US7À?ED$_8$? []UVS7R?_8Fu t$ED$ED$ E D$ED$4$[^]USJ7>_8$mH[]UVS#7>_8Fu Ht2ED$ED$ED$ E D$ED$4$6[^]ÉED$4$EUVS 6e>_8Fu t9ED$ED$ED$ED$ E D$ED$4$2 [^]ÉED$4$8EUS76=ED$ED$ E D$ED$_8$=[]UVS5é=_8Fu t4$lF[^]D$$US5V=D$ ̕ D$ED$_8$2[]fffffffffffffffffffffffUWVS 15<E8tj׉ƅt|$4$Ot@u(<.tqAtN<\u~u~t(뺉U)Ѓ [^_]ËU9Ѓ [^_]1ȋU)UWVS4S<}};ƉӉȋ9uwufu9rى)ڋE1[^_]ÉED$ET$ D$D$)$ ,.EE룤u9sftuu_SfӋ]KUWVS03F;E׉΋UU܋U؋U$!EM9L9MyE荃EEuuE9D$E$t4$ME*t4$MuuE$EtE؉Eu܉00[^_]ËuE$Etu)y9uΉE)T$ $T$D$)$E0[^_]1UWVS$1ó9]Uϋu M MUL$T$ L$U‰T$$"EaËUk‹E9uC6@@EJ}B$[^_]Ë]t*]t .]{<|.Z9Z.EM9s;D$U썂D$ D$D$)$ ,.Eډ)؋ux$[^_]ÿ뛉댋]썃D$ $D$D$)$뷋]/EE}8UWVS(%07]}u ӍR9M)ÃM ,.E썁EЉU u2D$ED$ D$D$E)$EJBs1([^_]É4$ERt+([^_]ËUU]UE([^_]UWVS+ /þ6E}E(M,u M0p T8tU1҉u$t|$$I:ƀ?YE4$k\DžU4T$|$E$-Eƅ9s9D$D$ D$D$)$ ,.7)U4E$NjE$|$D$]4D$ D$dD$$HNj $‹>|$ $}wyEt}wvM 򋽤(t#t<.z<7|0.}u$.U$'D$T$t$(D$ D$dD$4$nG‹$i9HxP2.|f @)~ DžƋD$D$<$9u׋)lj4$}O<$xJ|$4$1ɺ0f; @|01x DNu.9uՋʋ)‹4$9gƋp)p9 D$ $D$D$E)$J}+R"}$4$VD$t$ D$dD$<$D‹$$D$t$ D$dD$$nD‹ $eGD$t$ D$dD$4$D‹$9z9[D$|$ D$dD$$C$utE+-Ĥ+[^_]ÍE4$(5tD$$1ɺ~l<8E4$3+D$D$$U &Ƌp)9 D$ $D$D$%)$I}$ 4$VD$D$ D$dD$4$A‹<$4|$D$ $Dž- Ɖ$SH}u ;}$$|u$),D$t$ D$dD$$@‹ $ GGD$t$ D$dD$$R@‹ $IG$D$t$ D$dD$4$?‹$_wGo"D$|$ D$dD$$? $9u}3$S;x$ nG GGDž====Dž$`lj96w\&79&&Gt1Gta$D$D$ D$dD$$~=‹ $uuO}$<$fOwG$$T$t$L$D$ΜD$ D$dD$$<‹ $$9 E$p}$4$V~NL$T$D$D$ D$dD$4$;‹$TD$ *@D$E$pt$<$C-Dž##?#S1>)0~0 $a09"$‹ $#u|$D$ $U R<$S0|$T$ $ S9$sƉ9$)u}$@<}$D$t$ D$dD$$9‹ $GGD$t$ D$dD$$K9‹ $BGD$t$ D$dD$4$8‹$bGG<o"q"}4|$ t$D$$軳4$s9s?D$D$ D$D$)$ ,.։)׉}49)= $S@u$D$D$ D$dD$<$y7‹$t6c'92@Dž@DžDDžHDžL@)‰t19rE4D$ |$L$$賱<$k9s3D$D$ D$D$)$ ,.)U494$SPt$|$,ED$JD$ D$dD$4$5‹$@t$$4$1븃}$u$f}$v}4|$ t$D$$.4$9s?D$D$ D$D$)$ ,.։)׉}4FD$D$ D$dD$<$n4‹$iF9|Dž1pƀu2$BDž |$D$ D$dD$$3‹ $|OP9w|$D$ $U v<$ST|$T$$U Y%<$a)‰Ѓƍ@t$D$E$$+4$D$D$$U r)j16K:f.&.&.&.&.&.&.&9t؉4$QD$D$ D$dD$$$1‹ $u}$4$F$$D$t$|$D$ D$2D$@4$x0}$<$.G$ D$t$D$ D$2D$@4$ 0‹$q4$Mlj4$S$zlj$H$0lj<$]|$D$$U ^8%<$cG$UOWT$D$t$ܜD$ D$(D$4$8.‹$3E$p VUUU)ȃ= $[Ht$|$$U C4$Sz4$2~$bD$D$ D$dD$$ -‹ $o<$~$D$T$ D$dD$$,‹ $<$IfF $7 4$)D$|$D$D$ D$dD$4$,t$|$$U a4$SCF$~t 4$o4$dD$D$4$4$Z9E4s3D$D$ D$D$)$ ,.>D$D$$U v9p6F9Gt1Gta$bD$D$ D$dD$$5*‹ $,uOE$ VUUU)ȃ=F$>+}$e}4|$ t$D$$裤4$[9s?D$D$ D$D$)$ ,.$}~F$B= g$}$+4$%VD$D$ D$dD$4$(‹<$}$ )ƍG GGG GG GGƅ=t9yG GGG Gƅ=fDž==fDž==Dž====W GGW GW GGW G$g<|$D$ D$dD$<$$‹$eD9D$|$ D$dD$$w$ $kuD$ @D$t$$Dž  S1F)0~0 $K09 <$蝵‹$uD$ @D$E$D$$ S1F)0~0 $09Y <$մ‹$uJ}$4$lj$}|$XD$ D$dD$<$5"Nj$‹*T$ $1ɺyk$ eC4$Nj$u4t$D$<$9Dž9s3D$D$ D$D$)$ ,.)u4t$$1ɺm_4$ o=$Nj 4$u4t$D$<$3Dž9s3D$D$ D$D$)$ ,.)u4t$$1ɺgY4$z7$Nj4$u4t$D$<$-Dž9s3D$D$ D$D$)$ ,.)u4t$$1ɺaS4$ /$|4$u4t$|$$+9s3D$D$ D$D$)$ ,.lj)Ɖu44$Mt$$1ɺ7)4$ }4|$ t$D$$$iH)$qT$ @t$L$$X…$ЉPzD$D$$U 9ȋ$r s}$ f<tu$>)0~0 $097$n‹ $uu$(5<u덍D$D$$U R$'*$<|UWVS8ǭE  U8u(E}?ED$,ED$(ED$$ED$ t$\$L$ED$T$ ED$E@)D$<$P8[^_]UbM8E#ʬʰ]UWVS-u}'|EtG9E r'Gf|t+E D$<$պy躶([^_]9} r+Ey;}uE5T$ 0%T$D$l)$E뵋E9E r1UWVSdEE}U ‰WH9ffOX9@ffG 19rvKffLG u1Dw fu11ɉLu9uCG$G(G,1[^_]ÉD$ t$T$U$vxËU뭋]~(UWVS}6Eu} ]9~$t~$F(DF,u^(D~ 9V(9F,9~,)щL$ |$VT$$oF,F,^(D$ML$ D$FD$$]07F,F,H^]9:f]fPV,PffN,ujǃfǃ ǃF(F(V 9~F$F(DF,1[^_]É~$F(DF,1P 9UHɋ]HN,@ff V,9ErgMF,F(F(T~ 9~~$gF(F,bxM]`]P(UWVS T Eu} ]9~$t~$F(DF,u^(D~ 9V(9F,9~,)щL$ |$VT$$}F,F,^(MT$D$L$ D$FD$$];F,F,H^]9>fҋ]PV,Pf҉N,ukǃ ǃǃF(F(V 9~F$F(DF,1 [^_]É~$F(DF,1P 9UHɋ] HN,@fV,9Erg]F,F(F(T~ 9~~$hF(F,cAN])](ffffffffUWVS E}]} 1E䍘l%;M EL0T0EUD2ED2} v[Gm M0<OȈEO?Mu9uw [^_]ËE Ep} W׃0u F(*${zMUWVSî}u QUEHf0x}~E1wL0ڈ wL0YQƒ}u79}7YA.v7ڈ v79|E[^_]à EFE[^_]ÉEѝT$ %T$D$g(*$EE UWVpu o^_]ø1G fffUWVS\q&ϋMM T8uM1t$D$ED$ D$2D$M $MaƃM9r,ML$$A7M)11}U+u\[^_]ø\UWVS EE E컉e)})ljӉ))эR)É]%I$)‰))ˁ}: E E+Ju}: w) ]u$M EÉ$SrKE}~=Ut3}P2.L2.w\DAtu܋E Ƌ})x [^_]9u]䍃D$ %D$D$eL*$ [^_]ÍM U$WEM E$DtiEEM E$HEbt?EM EÉ$MM7tEMffUWVS6u4$術H9MX} sjuWuOt{} T р:.utZz\ut\z\tڋU ƒ.} 1[^_]äft.t&u?u&zU 벋E Pf} q(yUWVSn#E T8E1D$|$E$tGD$T$${tT$<$tFU+u [^_]MfffffffUVSgEuUMx#L$ T$t$$!Ox9s[^]ÉL$T$$[^]fffffffUWVS AutcEt\E $)ljD$4$*u?|$4$Q&u%džt$|$E$# [^_]É4$%f謡UWVS dutcEt\E $(ljD$4$)*u?|$4$%u%džt$|$E$" [^_]É4$O%UWVS u t\E$'ljD$4$)u?|$4$6%u%džt$|$E$! [^_]É4$$蓠UVS LuD$4$o!tD$E D$4$5 [^]D$E D$4$ [^]UWVS/u} tAv-u3D$4$'tD$4$3(F1[^_]軟USxEU tttu P1[]vUWVSy.}u t' td@t/tZv{Nw u6(D$<$&tD$<$R'71[^_]D$<$&tD$<$"'΅uʍ&UWVStu} tPD$4$a&tw== D=D$Xݜ$D$ht$pÉ$-wʋ|$|%\$`t$pD$P0D$@/M\$`D$xD$p1/t$pDPЉD$pK$C‰ƃ/˃9y~ǃыt$xDPЉD$x?D$X!D$XD$8D$HD$@ \$pD$dt|$h8D$pe[^_]ËL$T8pet Et$D$h|$8D$HD$TD$0t$hF$F<+<-D$,NЃ S$0` P.&.&.&Љ$2R0tVσ D$49D$@ D$T \$H' ݄$\$pD$T:@q t$8t$T0.t&.&.&.&18tt$8|$8D$HD$TD$0߃E<b$D$h|$`GD$pߍO͹)ٻ\$8D$@D$8D$<?ܬ$ݜ$@D$|؈D\$8؉ȃD$xtD$xj݄$D$|&tru|$T݄$L$PtT$0D$4)‹D$|(Ћ|$dt $\$pDŽ$5DŽ$DŽ$DŽ$D$X$t$D$PD$$D$ $D$$D$$$\$|4ƃD$d|$h8݄$\$pD$XkDŽ$DŽ$YT$8T$8 DŽ$DŽ$\$ ݄$\$P$$$\$|L$8܄$T$@ݜ$D$D|D$ ؋D$=u D$jDŽ$DŽ$$RD$D$5$<$\$|TA$$Et$ $D$|$$$\$|݄$\$p4ټ$$ f$D$@٬$|$ ٬$T$ D$$l$ T$ z1L$X9uT$@D$Dl$@\$ D$ T$$D$8T$D$pc؋D$|ـ\$8ـDRD$xAD$xD$HJ$%{=D$8D$@#$$T$x܄$ݜ$yD$01ҋD$|(S1|$XD$\𿃼$uk$u]|$xt%=D$D$`$\$|SFD$`U|$p|$$G1t$XD$\࿋\$x $$\$|2L$X܄$ݜ$$D$\$|&D$4$'$ $$$݄$\$p $2$ %=D$`xu xD$D$`$\$|9ED$`Z|$p|$$rF$%|$x==p$$\$|=D$h$=D$p$=D$H$=D$`$=$y|$8$T$x6ܬ$ݔ$ݜ$V1D$8D$H1!$1D$XD$\?$%=|$\)‰T$\K)!؉$UD$8Jf%|$`GD$H$WӉ1|$p|$xq- $DŽ$$|$xt%=w k)9t-D$8ut$@ D$@#$r%$1$c|$8L$0D$0L$H$D$`PӉ1t$pt$xD$@D$@ݜ$zgT$TaUL@1.U E]XUMU E]Fffff̀ffff̀rS[ô& [̀rS[Ô& [̀rS[t& [̀rS[T& [UWVS6u Et"4$mEExu4EE[^_]ËED$t$<$ntGt8Eu׍GEE[^_]ffffUWVSæu} 4$juT<$]uq9r9r tt1[^_]ø[^_]ËFW9r9[^_]Íp*D$ x'D$D$e*$v*D$ x'D$D$f*$vUWVS"u} 4$E<$9E4$q<$aGE9FuK12\9\u0\9\u&T9Tu9M9tƸ[^_]Í*D$ 'D$D$C*$u+D$ 'D$D$D*$u$+D$ 'D$D$E*$u1sUSÛEL8T$ D$PT$$7[]US觽\E$uE []1[]UWVS$fEpEEEEEE1ҹEEuxw88 w38&E u9u҃}u }$[^_]ÃEƃދMt};xsϋHME롃E둃Hut9MsEMluEY}l}b1`US!EU} ~\wEBu - t wJt Bx1[]ùr u-JuB-yy UU1Ʉtt'4$gD9t t u 9u[^]UE]UE%]UEt ;E ]ø]UE%t 9E ]ø]US Ut/9E t*D$ 'D$D$pH+$dqE []US讹cM E%t.9t*D$ 'D$D$pH+$q[]UEtt]1} ]ËE ]USE ~>uTEtKD$ 'D$D$pH+$`p~Ewǀ[]ËEǀ[]US舸=EU tt 1[]DvUWVSG$ ;Etc@@uD$D$4$&uu E[^_]u84$Cu81EUWVS趷kuthF~O9tHNM 1[^_]ÉU^uED$|$E$U7uu=FUF맍D$ 'D$D$Zt+$~oi|UWVSï}t;t-M tWt1$B;wr$B<$B[^_]UWVS蜶Q}tJWt7E1U9}t#E4E D$4$eu߉[^_]1[^_]ÍD$ 'D$D$t+$nUWVS E@EEE19ut|Ee[^_]ÉЃD$8D$,txUL$$D$,D$0T$4D$T$ $D$\$(2D$D$0T$4D$T$ $D$D$ T$t$8L$$}t$80 E Uwx9rUT$D$E$ []US@E D$E$[]fSL$D$ &t@AuD.t&.&€tAt9AtAt9Au΋D$[fUWVS 衦VuMD$E$ ;E@0u ǀE EEEbDUT$UD$ $M2MU)֋Ep}Ћ}΃s-tftU)UttEp~)EE9u6u뺉$3u)EpfB뺋E;EED$E$:E [^_]ÍP))Ƌ}w‹}΃s_u$u}D$E$9벤fvtbEfH @D$$91|뀍w0D$ (D$D$C ,$\D$ (D$D$B ,$\D$E$91fkPLUWVS øs`D$-D$@*.<$EtE D$ED$<$PD$$  [^_]UWVS荣Bu D$4$8FFy ;F|/} t)P}D$4$8[^_]Ét$E$UVSʪutDD$4$7D$D$4$Hff D$4$7[^]Íw0D$ ((D$D$6,,$[US茢AED$ E D$D$E$$>[]ffffffffffffffffUWS2Džt)tYBfBfB B [_]ÉUn6D$ (D$D$MP,$7ZUuU36D$ (D$D$NP,$ZUrUWVS膡;lj։MEu` uZGG _ tC‰t")ʿ)ϋM)9|[^_]Í%D$ (D$D$`P,$-YU0D$ (D$D$aP,$XE+ïD$ (D$D$bP,$XUWVS\MÉEEE T8E1fjDž9E]qA D$.$!zP2.8tGt3\_u<.uuy.u}fD$:$!tOfu:t .uـx.}G~GUFw Uz@9t$D$$]/@0@Ɖ $#K@)9x‰ ȉ@ M<[/1U+\[^_]À:>E4$JL$D$t$LD$z2D$4$tpu׋)ʉ׃ (D$ $I8f cFt$$MD'9Dž1Ct$$Cz90CD$ \(D$D$^P,$LwP$\ f0x0k$Gtxf\>0N7L1UWVS`ŚE‰Eu T8E1FE D$ .u‰t$L$E$')}WEE4$?ML$ML$D$ t$ED$ $蚅‹Et]$pE@ U+`[^_]ÉM $M<ʍJE`MUƋE$u눍 D$ h(D$D$P,$J$UWVS(薑KuE>FE苳 }tgUE<$>ML$ML$D$ |$UT$4$b‹Et)$8E@ ([^_]Í뗋MUƋE$t([^_]Í $舃t: E D$ L(D$D$ P,$HqUWVShg։} }}U T8E1} o*$( 1qfQffQ 9fED$|$ T$D$ $P@ u+<$Ѕ[D 9EMHHPPDžPf}Ɖ9DžDž )D$t$ D$D$$uODž@ u4$Ѕ8D8 9<$oRf$[RfG$IRЋщ9ft9|dRE};d 1DžЍ 81&9l!9hufyuh }9Z 9tcP fz )u fzfBfzG9u拕@ m‰))9^W׋$L<))9yrtft1'$1U+ h[^_]9,z 7t$$*D$t$ D$D$$BK@ 9N04$6=3׉T9E>f t$$9P }u,04$6tp9J90Љtftפ9P'$1;NjE$$;$[<|$t$D$ D$%D$$%6<$4=9D$ (D$D$P,$?.+D$ (D$D$P,$q?D$D$ D$D$$&Hg@ 399x04$3=1Ɖ$m3P)9| At$ D$ )D$$%r<$2p)9L$L$<$qX8f&($ЅwDž$$B1Ht$ D$D$ D$D$$EDž8@ ?9$1x9D$D$4$V>9fw99 E Ƌȉ2f.&.&.&.&.&.&H0f9~fpfJ2r 9uً9n.@  G,)σ (D$ $F Ulj$ FfDž 1DžD$D$4$T0։9^f 19s<04$CJ})σ (D$ $ ljUWVS$賀hu}6EGBEB $&E+>DžD$ED$ED$ D$ED$<$R…F D$FD$FD$ D$|$E$MElEE$ <$l>Et $[^_]ËF t:$[^_]øEE$ <$>$[^_]Í D$ (D$D$P,$7E$O F 뮸xUWVS@Mu T8‹E1kFB FBPƋ}ۉ\$D$ D$)D$<$ ~HNj9s4$@ D$ x(D$D$P,$3`4$G$9@ -$9@ t҃$S92fJz UWVSoz$8ƋEtvF u>ED$ ED$ED$E $Elj4$8[^_]ËED$ ED$ED$E $EDžt뼍,D$ (D$D$P,$2[E1UWVSyH7t@ËED$ ED$ED$E$ًU EƉ$7[^_]ËE1[^_]UWVS0yԀE}u  t6/10[^_]Ã} uyMMUUUUu|$M L$D$LD$D$ D$ D$E$skuE0[^_]Ã} t=6a8t{bPWPtD@ 7 E #׃T$ (T$D$P,$90Ex{UWVSXw\}E EЋEEEE T8E‹E1$('1r E؍EEȉMԉ}܉<$[D$D$ D$D$E܉$qDž E؉D$<$XƅtEȉD$|$$MЋIt9pMЋI t9^}UEċMԃ< t< tM܋E؉D$4$MPE tN<  < E}9yE؉D$$zPu}ЋEĉG UW}lUWU؋EU)щM9GU؉W)ȋ}92t1ɉE؋} E9rE؋}ЋO U)ljEA4$"@9‹}؃tftUЋu؉2ƉuԋU)‰ŰEEE6tftuЋV}ȋMԉ :M)ẼEE؋u9AE؍4uȋU܋4u4$!@9Er7‹}ԃrsSt}MԉM܋E$E܉$D2E1uU+X[^_]ÃỦϋU)׃E (D$$t 8E܋UEȉD$|$$72P@ EĉỦ $R2ŰEMEЋPEEE$E܉$Eaf{E̋EM8Mԉ $EE0ufiK1E܉EUSr9zS7D$D$@̟ D$ D$ ED$E D$E$[]US.ry6D$D$ @̟ D$ D$E${[]UWVSqǙy6'0tDÉt$ D$@̟ D$ $ًU EDƉ$00[^_]1[^_]UVSiqy tpǃ ǃ ǃ ǃ ǃ 5D$D$ @̟ D$ D$ $?Ɖ[^]Í $ t5ΐUWVS0pfxƅAqP2.8DG]]ԉ]]]܉U؀0|\G1t&.&.&0 w 4H\Gu./E]9tEprBDGu10[^_]NȃE@ fu+-dt ufF E$gED$ E UD$T$E@$t!Ѓ6E@0tM@9t$E@0E@}Gfg D$<$o1İ[^_]vQ}Wf9xD$$#‹E@ UdUuVLfF E E UdhE@ f` EPPHTE@X\+X\lpuN09FEE}D$<$OU֋}U}܉U].t&.&.&.&Jtf8uU]H:Mu:M8}u]uHp_]HcE$]E؋E E }؉8E@[^_]ÃEE܋U)Ѓ9EPWEt#E9r 9\E}E؍]܍DD$E$]M}ωr8tmt fmMEtfEtޤ}8E}:ƉEĉЉWE#E\E\]8]tAuU8Ut}jU8UtYM܋uFuU8Ut2Íw0D$ )D$D$h,$&?EM܃9u؍ 0Ms)uuEU}}f}܃u4Eu}}뽋U}f}}}fffffUWVSWö^}u tAtkG0|$ UT$T$$;tpG0[^_]Íw0D$ )D$D$6-$uܞD$ )D$D$7-$fG @u1 8Tu1offffU EE D$E$U]øUWVSUß]u} tVt&t9uBEFUT$4$P[^_]ËFUT$4$tE[^_]1ύD$ (+D$D$(-$ {]D$ (+D$D$(-$ HUWVSU\u} tVt&t9uBEFUT$4$P[^_]ËFUT$4$tE[^_]1ύD$ +D$D$(-$ {]D$ +D$D$(-$ HUWVS6T[u} tPt+tu6F} u@[^_][^_]ËF} u[^_]1[^_]ÍD$ +D$D$(-$ 넍]D$ +D$D$(-$ QUWVSeS[u} tPt+tu6F} u@[^_][^_]ËF} u[^_]1[^_]ÍD$ +D$D$(-$: 넍]D$ +D$D$(-$ QUWVSRIZu} tVt&t9uBEFUT$4$P[^_]ËFUT$4$tE[^_]1ύ D$ *D$D$(-$c {]D$ *D$D$(-$4 HUWVSQoYu} tVt&t9uBEFUT$4$P[^_]ËFUT$4$tE[^_]1ύ D$ *D$D$&(-$ {]D$ *D$D$%(-$Z HUWVSPÕXu} tXt't;uDEFUT$4$P[^_]ËFUT$4$tEf[^_]1΍D$ *D$D$F(-$y]D$ *D$D$E(-$~FUWVSPùWu} tXt't;uDEFUT$4$P[^_]ËFUT$4$tEf[^_]1΍D$ *D$D$e(-$y]D$ *D$D$d(-$FUWVS(OVu} tXt't;uDEFUT$4$P[^_]ËFUT$4$tEf[^_]1΍+D$ *D$D$(-$y]D$ *D$D$(-$FUWVSLNVu} tXt't;uDEFUT$4$P[^_]ËFUT$4$tEf[^_]1΍)D$ *D$D$(-$y]D$ *D$D$(-$FUWVSpM%U}u t/tYEED$<$Ot E[^_]Í]D$ *D$D$(-$nuމD$ *D$D$(-$@xUWVSL{T}u t/tYEED$<$t E[^_]Í]D$ *D$D$(-$uމD$ *D$D$(-$xUWVSLSu} tdt-tGuP1EFUT$4$P[^_]ËFUT$4$t1U[^_]1ȍ"D$ *D$D$(-$m]D$ *D$D$(-$:UWVS4KRu} tVt&t9uBEFUT$4$P[^_]ËFUT$4$tE[^_]1ύïD$ x*D$D$ (-${]D$ x*D$D$(-$HUWVSZJRuE }t )щʋUt7uzN|$D$4$Q tuUtQFU4+U u@ 1N|$D$4$QUt?tFU U u@[^_][^_]1[^_]1[^_]ÉE]T$ l*T$D$*(-$E EމT$ l*T$D$0(-$EUWVS IþPu}U >E E|$4$tQ9UrRtqtMu:1T$ED$4$6>u"uvuE$E 1[^_]ÃuEt${E ԅtEuT$U$EM U_GD$ `*D$D$`(-$M]D$ `*D$D$^(-$U ;D$ `*D$D$_(-$`*D$$$UWVSRGO}u t'tQD$ t$t$<$ [^_]Í]D$ T*D$D$(-$XuޞD$ T*D$D$(-$*UWVSFhN}U EEuEEEt[T$U<$(t>UFu).&Ft9uMM }[^_]Eu1[^_]ÉU썃oD$ H*D$D$(-$XUpU썃UD$ H*D$D$(-$#UE1U썃cD$ H*D$D$(-$UU썃]D$ H*D$D$(-$UUWVS6ELuEE E 8tutlED$4$tOU9UrGtstVu7ET$|$4$Y>uu}u<$E 1[^_]Åt<$E냉<$E ωЃttkE녍;D$ <*D$D$(-$]D$ <*D$D$(-$dUD$$NjE 8Ut Eo<*D$$ UWVSCUKu} t tJD$(#|$4$4[^_]Í]D$ ,*D$D$?(-$u;D$ ,*D$D$@(-$UWVSCýJu} tJtvt 1[^_]ËWUEFUT$4$Pt׋FUT$4$P[^_]ËFUT$4$tFUT$4$tEMG[^_]ÍD$ *D$D$X(-$B]D$ *D$D$W(-$k UWVSAæIu} tJtvt 1[^_]ËWUEFUT$4$Pt׋FUT$4$P[^_]ËFUT$4$tFUT$4$tEMG[^_]ÍD$ *D$D$|(-$B]D$ *D$D${(-$T UWVS@ÏHu} tt@} u[^_]]D$ *D$D$(-$uD$ *D$D$(-$UWVSL@Hu} tt@} u[^_]']D$ )D$D$(-$cuD$ )D$D$(-$5UWVS?sGu} tt@} u[^_]]D$ )D$D$(-$uD$ )D$D$(-$UWVS0?Fu} tt@} u[^_] ]D$ )D$D$(-$GuD$ )D$D$(-$ffffffffUVS>GFuED$t$ ED$E D$E$E~>.t[^][^]US?>EED$ED$ ED$E D$E$[]UWVS=óE}E D$E$St u)x[^_]9u\-D$ 8+D$D$|-$E)[^_]USEP@.tsˉ؉Ã߃Av 0 B.t@.tuKȃ߃Av`01 []Éȃ߃Av0 w`Bt2J.u˃߃AwˉB.uW[]ÍYЃ v-uBg1UE8*u P.tt E]]ÃE]USUtA1.tF1Ƀ\BÅtX߃]w"t1ɃBÅu[]û[]1ۉ[]ÉU[]tUU'.t&.&.&.&!]wBu]1]US;jCE D$E$[]US;@CE D$E$[]US`;CE$r[]US=;BE$@[];B_8U;½BE Mx7]UEf]UE]UEfU f]UEȋU ]UWVS$:VBEE EEE0PE }썿l,}Uuu9E }9sux.tb@tx U9sS@}AnVUBc} 980]($[^_]UE EEE E::rE El,E)M9MuNr:M\tf.u͋EM)ȃM9M}R.EHF>uuG뒍V>[U|$M $jU:M)ȍ<FtOD$ $=t?M)ȍDOt M}:S}9uɋM܋Uʋ}\]iM Z)ȅC9u?1;Au#@t6Hȋ]؋]9\] ( [^_]ø!!"UWVS(/7EEEE܋E9ErME 9EsEEH0}}]EEƒ@dt(]n(EE([^_];M sۋ}?[ E +E9~]E}9~K3uEUt +E}Ey+EEy9Mu]D$ T+D$D$-$=EKuV]ڋ]9 }9;] }|>}uE~΃s/uuUED$D$<$tE+uЁ$[^_]úWUWVS$n'/E MU T8E1D$ D$|$E$t-T$L$ ED$D$<$VU+u $[^_]É@WUS]E M9r 9s9su[][]UWVS~&7.EU} E9sKUP0ك@tHt-t]([^_]Í29rUUX9r͉1[^_]9sAu@u!E!뾋E뷃E막ӋUUWVS%m-uE t*X?w#9r6 )ЍXt9Aхu)[^_]ÉT[^_]É=()[^_]UWVS8%,EEUu Ɖu]Ӊ]8]}Y ?w` 0}9sq }9sg9u>zPt$|$$U]uU270:ۅt9u1[^_]Ë]s[^_]Ë]X(1[^_]UWVS Q$,u}E9E |2&6D$D$$umtF;Gt1 [^_]ø [^_]UWVS#Ǜ+U2E uuX1[^_]É?w[9rCZML$ ML$)D$D2$t(9E~9}ljr[^_]ÉO(;,?UWVS;#*EU t_Z1?w%9r8D)ӍV[t9хuލF[^_]É[^_]É(F[^_]øUS"j*E D$E$( []UVS"?*uD$D$$NtD$T$ tV[^]øffffUVSuU ]tE>t&8ut&.&.&9t Ju[^]fUWVS(!dž)}EU܉΅lt F"}uFEUT$$]0uMËu-+31UEE1709}It$EUZ9t)ˋUOA< vA<@W9|E܅ttGEE܋}8؃([^_]ÉЃEt j1UE}S}0UWVSG }D$<$|$ ED$E D$E$ND$<$ [^_]US4_D$ $*[]UVSød7u [^]Í D$L$ $訋ƅu$kƅtD$ $\FFF US i@U T$UT$$ []UWVS2D$-D$@*.<$ĆE t8ED$E D$<$|$ D$D$R$E$ID$zxD$$^[^_]ffffUS8E D$E$w[]USU E D$E$w[]UWVS%E։ϋUt%T$ML$$Xq[^_]ÉD$4$诞ƅtU1UWVSnu} GD$F$uD$$w[^_]UWVSn# l$^xD$4$m?E9  ELh$D$4$,b8d$ ( Džt`t\Os1Wp΋ t $謠pP9uዽp$莠Gt$ytt ;( r`t4$Oǃ( ǃ$  t\1tt:$Ft)NtF D$F$ыF9pt$g; rtt$ßǃ ǃ Dd$˞( uAEU  h$*l$LĤ[^_]ËWT$ D$ D$$ $UWVS,í T8U1DžDžDžDžDž$Ct3D$D$ ˟D$D$<$>}=~h$   T$ D$ T$$1U+;,[^_]D$<$z؟T$$rT$T$$Љt6t,$L$ D$T$$=;pt$Dž$Dž$1t5tD$$ҋ;pt$vCAUWVS(ju} tmNV$VFED$D$  D$ D$E$s1ti([^_]ÍD$ ,D$D$~ .$uin6D$ ,D$D$ .$C:델UWVS m}SG<tmL$ D$D$${GE6E썃gE荃jE+E$T{EE;GE4G0D$E$%{GD0t‹E$ {GD0tQt$zGD0x,$zGD0c=$zP $zGD0$ y [^_]Í'D$ ,D$D$ .$~UWVSU1( u;( v$ <D$E$Hou΋Ot5GEt1 t $O9uu $讙GD$ ED$<$h1[^_]$ ( $ Et7$ ύD$ ,D$D$ .$| UWVSl ðU EIEjd7EV P LE$sEEčD$D$ ( D$$ D$Eĉ$o"HM@EEEEEU<ЋM E u D$<$omuNVZED$L$E$ҋUBuM}#TuEMU9sE$l~E  ul[^_] E(4$_| U .9PuMEA  E4$|a}ED$D$  D$ D$E$QntMPtFMMЋMMԋUT$D$ P T$@D$EЉ$ntH P1EUM9E\$pt$t)i)\i(\Ƹ)\yÉL$p\$tΉ)׉t$H|$Li)\i(\Ƹ)\Q֣p=9Ƹ ף@L$`\$hT$hT$Pt$H|$L tD09}L)à u\$hT$P)׋T$h#.t&.&.&)à 9L$`\$4L$p\$tƉșL$pT$t|$p1ωT$t1 qL$@t$<;t$T$EŃD$T$D$<;D$pD$t1$D$PD$xD$Ht$x|$|D$PD$ ED$D$HD$D$X$D$\Љ$9\$@D$xT$|D$hT$lɍL D$h1ÉT$l1 D$p\$h1؋\$tT$l1 D$pT$t9#D$xT$|D$hT$lD$hT$lD$pT$t1ӋD$pT$t1D$pT$t9D$pT$t9ȉL$x\$|\$h|$PD$pT$tD$`;D$D$eЉ t$x|$|KD$pT$tD$xT$|D$pT$t D$pT$tD$pT$tD$xT$|É։D$hT$lD$xT$|D$pT$t9؉D$xT$|D$T$D$xT$|D$D$ ED$D$HD$D$X$D$\ЅtE D$xT$|e[^_]Ë\$8TD$<=9Ћ|$$)D$xT$|$$$D$ ED$$D$D$X$D$\Ѕ$;$D$$9$;$$D$pt$0)$t$h|$() ‹$|$@D$`) $Ƌ|$4) 5T$<;$$$$t$x|$|$t$h$|$p$$|$@$$$$$$$D$$$$$w\$hL$piF\$p9hFdN-00dFD$xT$|L$hdF)ډ$$D$PD$ ED$D$@D$<$D$\ЅtcD$,;$uV$T$0)Ћ$L$() ‹$L$`) Ћ$L$4) uD$<;$u \$p9$t\$hL$p$$UWVSD6\$ljT$( T8D$Ë$@1΃ ~G \$ьD$D$D$?D$$D$E$T$(Gщ€|$?t>T$4L$8\$舌\$T$4L$8\$$@+NЉʍe[^_]D$D$$D$E$T$(щ€|$?uG D$4xF~T$@D$D$$\$&Z1ۋF|$0>|@u$hFdN-00tD@<@sȉ|$0X$@L$ @D$ D$4,f.&.&.&9t$ G  ӉL$,iF9uڋL$ t$Ή\$4L$4щ\$0iF9dF\$,+dFG D$D$$D$E$T$(tщ€|$?)D$D$$D$E$L$4T$(@щ€|$?D$0dF\$,+dF)1W G 9t$ tG -t$\$49t$ \$<T\$!\$UWVSDE؋}E p]܉u]u&GWEЉUԋ]܋u9 EЋU+EUD$Y`D$ $T$].ÉփEȺEEUĉ؉ىEȉu)ȉ)]ȋu))ډÉ)EUY`EU]Ћu9؉|_K\9D%]踈1rWL \u9ދEGWEЉUԋuЋE܋U9֋EE܋U)ڃD$Y`D$ $T$].-ÉփEȺEEUĉ؉ىEȉu)ȉ)]ȋu))ډÉ)M܋])ӉȉuWEdF1dFEu4$2ƅt&iFV hFdNN(]D[^_]ËM܋];OG|\5.t&.&.&.&.&.&.& Hu;tut9|>dFEED$ ED$ED$<$nƅ@M܋];O_+EUĉәE܉]}1lj}1 ыE‰F1Xe]؉E܋؉0 }<$11ƅE؍H/F(EUnUWVSHƅt$tljD$pT$hL$D T8D$T$D1fBM<:|$l|$X40>D$71t$p&:t|$ht$p7>~|$p9yt$@9|ɿ=G|$pkfaHD$xD$pD$tD$pD$DD$D$p$\$t4`\$t8D$07L$8L$@bD$,% \$X))D$4t$4D$ t$|$$\$t3|$#t |$D$D|$4|$x |$4G|Ft>8t$|$hG$D$\t$hD$`k XPD$P1$D$H\$dD$X$(T$PD$`t$p ;J ryt$p1pYD$pT$lFP~L\$p9\\$l}3=H\$p\\$l\\$H ;N>VD$\9U\$dD$hP~7|$hdF$  tft|$hGD$h@1=1D$dp ؃ux f\$P9؉ӋL$H\$l#?\$t{8t$p|$hw|$hdFT$|$@u)D$lJD$ht$t|$hwÍT$xD$`tD$lD$XGtt$TDD$Pt$p@dPdPltftߤ1ۅqD@|$p`Pp@D$HD$pf@D$`<EPHЅut&.&>u)׉|$LT$`.u<*t <-~0< wȋt$t)D$lD$hD$TD$P\$pCCD$x؉dFǃhFǃlFǃpFD$XC dN\$lډNjt$tVtftt$l0e[^_]r1D$HD$`*t -~0 wNjT$`)׉|$LL$Ly|$8v|$X|9|$@ ,;T$|9<D$d$|$$8,$|$ 8|$pGD$xD$؉dFLJhFD$|D$؉lFD$lpFƇqFfLJrFD$XD$\D$d.D$Dt$<uVQ9L$X\$\{9L$TT$PL$XD$\tD$XT$\p9D$Tt$PC7D$XT$\_1ɋt$pD$dt9D$TD$P11D$H4D$x-D$|D$pD$TD$PD$px|$dt$xt$Tƍ>>>!.&.&9iFuD$pD؉D$X1T$p>4iF>kFuL$T\$X)ىL\u dFىL$X|$d9uD$T؋|$pdFLJhFD$|؉lFD$lpFƇqFfLJrFGD$pt$@p dN\$lډNjt$tsctftt$l 0D0\$LډNjt$`stftt$L0{ɨr뀋|$xT$|:,1;(1vIi)\= ףt$D4)L$X\$\9L$Tt$P|$t$CD$<D$DșD$XT$\D$D$0T$4T$4T$ D$pT$0TT$ Tp-\$T$T9Ӌ\$PT$ |9t$dt$<0>FD$<șt$9Ћt$H}D$(D$Dt$,D$XT$\D$XT$\poD$DD$(9}\L$T$$JD$dL$T$ 7D$,3QL$dlD$,9Pt$pD$dN$]X=v޿T[^_]ËE~dNE荄dNNjE0. 9kUD$4$]!-Uu_ɉ1$DžJUWVSƠNjx U$W=EU~|$ $Y4 +} 4 L/dž0 GXx2>Pu, Ex [^_]ËWZىt̅yƅxE4 9$Rw-É4 H/dž0 1l1ɍ'"@/dN}D$|$ $UVS04$8 uƃ8 4$[^]UWVSEuM V~BhFhF1t&.&P9u dN9ut [^_]Ë]rf1[^_]UWVSw(UM Z~>dFdF&.&P9u09ut[^_]Ée[^_]UVSñ4$3$[4$[^]UVS蹧n4$14$p[^]US胧83$[]lUWVSg $R+t6ÉǹUu [^_]ÉE$33dU1USîE$3[]UED$ D$E D$E$]UWVS試^<$o3$L D$ D$ED$4 $-Ɖ<$+[^_]UWVS9<$x u3$莂E D$ D$ED$4 $Ɖ<$[^_]USĥy|E $11ҋEVt H/P([]US舥=@L $11ҋEt H/P([]UVSHu L $1ɉEԺt tL/P([^]ÍH/UVSƭ] E$1ɉڋE臺t tL/P([^]ÍH/UWVS誤_D$$l3$4 t1$,EƉ׋D$$*[^_]$1ɍEƉUS˫ME tE,[]$E1ɍ$[]US迣tME t@ tE,[]C$HE1ɍ$[]UEt@ E]UWVST]} tC }1ɍ[^_]UVS0ƺ]D$CD$CD$ C D$CD$CD$C$D$(D$D$$zD$$1ɍUL$xLL$ L$KL$ KL$K L$KL$KL$KL$ KL$$K L$(K$L$,K(0[^]UWVS]u } IXP.& ;r B}y[^_]ÍIlP)׉[^_]UWVS ޡÓu} D$$x tv4 t?RXPL$(.&.&.& ;p H}yD$$; [^_]ËL$RlP)Ӎ3$}4rUWVSET$RuXP$M ]0.t&.&.&.& ;H p|yE U $\$,.&.&.& ;A yyƉ;u ]9u ] $\$,.&.&.& ;A qyƉ9u ]|M 1]1 ȃ[^_]ÉƉ;u ]}# $\$ ;A y}&yϋM 1]1 )ȃ[^_]Í [ulPƉ)똍 [ulPƉ)L [ulPƉ)RUlPE UvUWVS+D$ $x t<4 tOUM T$L$$Ɖ׋D$ $[^_]Í3$@{4 uu} ffffffffffffffffffffUWVSq&}u tSL2..&.&t(TSNLKf9t)ȃ[^_]1[^_]ÍkD$ P/D$D$Bx.$CV끍`D$ P/D$D$Ax.$VNUS蟝T u#$ tЋE$YUWVSX e=t:F$V FtD$$]4$1)uƃ[^_]UWVSæ}ƃ $ tCƉxtD$<$}]E FEF e1[^_]ÃUWVS{0uE} t\Et1UӋ} ׉|$E$Ut!~}} u1ۉ؃[^_]É뻉؃[^_]ÅMuՍD$ \/D$D$H.$2T멍ŠD$ \/D$D$F.$T3D$ \/D$D$H.$SѠD$ \/L$MD$G.$ESUҋEMT$ L$D$H$sSffffUWVSæƉUM <$ EtC${pupMH  <$ 1[^_]Í 1#.&.&#txu8u돍D$ d/D$D$.$~R7<$ uUVSèEU Mt [^]MUEt$ |/t$D$.4$ RMUE[^]UWVS萙5 E$q  1 E0E}M D { uZMUCЋMU 9u` tgߋt}Ct9K ttFߋteC9K ut2 MUCS$ЋUM 9tV uE9rRE9sKu}샮 E$c ut?$]$u[^_]ËE]1 tߋtCU11ҋE]ffffffUWVSޗÓUE0}E, T8E1M zhEED$E$CD$h8$ hǀPǀTǀX71DžD8H@L,D$ |$0D$8$n#8U+d[^_]ÅE ((hEED$E$FD$h8$hǀPǀTǀXE (D$ /D$D$Q.$cNW(D$ /D$D$P.$.N((D$ /D$D$Q.$M(^STUXUT$UT$ @1.D$E D$E$>]UӜUT$UT$ @1.D$E D$E$]UED$ED$ ED$E D$E$]UWVS謔aD$@*.FX$')F`F`y ;Fp|4} t.FXPVX}D$FX$)[^_]ÍFXD$E$US'ܛE@*.Q`Q`y ;Qp|< tQXZYX[]ÍQXT$$[]US ϓÄE D$ED$@*.X$A| []US蘓MED$ E D$ED$@*.X$f|[]UWVSX M} }E EEEeD$E$'E@ E@U~5M19E}EtfEtME)‰UE$z UE@몋U tE eMWPTEfH @1[^_]ËUulj7wWU<$ UG)uًECMAAAD$ $&E[^_]ÉЋ}tftE@9)ЋMAD$ $y&E[^_]ÍD$ /D$D$Q /$Ilw0D$ /D$D$= /$IE)1u E MOuo U@/D$ /D$D$ /$0IE@UUD$E$h%EU)1u .fBefm7MyHMUS 5ED$E D$E$x []USùED$ ED$E D$E$x[]UWVSʏEED$E $ƅ0Džt}D$ED$E$xY=?fGfw  G$ G, G( G Eu/[^_]É$MfG 1[^_]D$ D$D$<$*[^_]ÍD$ /D$D$>`/$GUWVS袎W}t6D$<$#G ƃD$<$,#[^_]Íw0D$ /D$D$;/$FffUWVS%֕u 4$?;9EUr9s 9rt׃s$u8u:Ѓ[^_]Í9rT9tՉ׃ru$u+tftƤЃ[^_]zfĉUS o$E9ErD$E D$E$ []訽!̀rS[& [UWVSƔu F0u ǀFFF tLNtE})xX9VnHM9VF t t[^_]É4$N})y9u/D$ /D$D$W/$D+V9Vs4$u^4$qgw0D$ /D$D$</$?DI fffUWVSӋ} UU u=މ&.&.& u[^_]Ívރƒ0uEt0tC0[^_]Éމ[^_]Í{} 1ugfff)ygfff)҉)Ѓ0CUtE9ut 4{ECExtEgfff)s҉)Ѓ0GE9E땸)0KыEÿE0C[^_]UWVS ìUM9 ?p9s΃ttUUGED$t$E$ޗMGU)UD$D$$E}E01 [^_]ÉUE5GED$t$E$fMGuUEU JHJHJ H JHJHJHRPVUF0U$F0`UWVSL蹈nljT$ L$L$,11D rL$$D$(D$D$L$uEt@GЃ%uD$t$ wPZw /t$ uL$t$$T$9T$ |$<D$D$F|$| t$|$L$80811ҍTPЃFHЃ v$WT$ Ft$ D$UUU;t$( 9t$st$D$$D$t$ D$UUU;t$(9t$st$D$$D$t$ L$뭍~*D PЉ FPЃ vsD$@M࿀ D$Pt$ D$u>UUU;t$(; 9t$st$D$$D$t$ UUU.;t$(9t$D$$D$t$ UUU ;t$(9t$D$$D$dt$ D$D$eUUU;t$(rL$(T$$9t$st$D$$ D$D$ D$L$HЃ  1t$v.&.&.&|PЃpЃ vt$L$<$|$ UUU9D$ ;D$(rL$(T$$D$ D$ 9D$sD$D$$L$ D$AD$ :t$ L$D$ UUU ;t$(O9t$D$$D$t$ L$D$UUU ;t$(L$(T$$L$L$L$st$ D$u>UUU ;t$(9t$st$D$$D$t$ UUU4 ;t$(9t$D$$D$L$ L$1L$ 9<qt$  t$94t$L$9t4$1e[^_]ËL$1L$ 9<IL$ 븋L$1L$ 9<y|$ 렋|$7L$ 9<L$ 눋t$6L$ t$6L$ eL$ )|$7< L$ Jt$|$ 74|L$ L$ $L$ t$ ~64|L$ y|$ L$ |$ 74|t$ NL$ L$ t$ ~64||$ wt$ L$D$D@$hL$L$i D$D$UUU ;t$(L$(T$$Du}cD$UUU ;t$(9t$st$D$$ D$D$D$4UUU ;t$(9t$st$D$$ D$L$D$$9.$"!L$D$$9$L$D$$9$L$D$$9$L$D$$9$UUUw@;t$(rL$(T$$g9t$st$D$$D$L$D$$9U$IHL$D$$98$,+L$D$$9$L$D$$9$L$D$$9$L$D$$9$L$D$$9$UWVSH^s{$M$} |$8}|$<]\$@ T8D$,Ƌ$D1\,\$<,$@0u ǀƄ$D$8$$MD$($G Wf DŽ$D$@D$ $$$DŽ$DŽ$L$<$D$dD$l$D$4D$$D$hDŽ$$D$0$D$T$8$%t >u$)؅D$&,$$ C$$$$ $$R~Ƅ$Ƅ$FDŽ$D$tDŽ$FZ$1⋼$<$$"SG f A$fx/D$<M$$DŽ$DŽ$D$$$$SD$$8$$ǁPǁTǁXy 1LLtft$C f$f$Cf$C$C,$CD$$D$$DŽ$DŽ$DŽ$D$@D$ D$$F$e$$$D$ 3 󥋔$\$l{$ [L$8L$ D$T$$4$$MFD$p$y DŽ$|$lƄ$1$D$`D$\D$DD$HD$[$$Ƅ$ $t$84$$I@$4$4$RT$h:$IЃ01 =v.& 4Jу0 vꋔ$$5t$lN9vT$tL$lL$tىL$t$Ƅ$+ލW7*\EFЉ1҃ -=f.&PwFЃ v뉔$n$U$$t$lV$ O!, v$0pT$l9$D$lD$x$ R$$D$xD$`$N,D$l@TƄ$$$1$ 3$8$$D$[$%D$pD$xD$lDŽ$11ɾD$\$HT$hT$T$[T$ |$p|$L$L$\ $Q$)Ɖt$pD$p*t$pdM$$$9}$$\$`D$\D$DD$HD$[5$T$lBD$x$$)R$$u$0$$|$D$$4$$oH2)$9~$Ƅ$D$xD$l$D$p1$$T$lrt$`2R1Ƅ$xƄ$$ !$ω$ 5$+$$D$lD$x$ $$D$xD$`$b(D$l@T $ $$$D$lD$xD$dt$$$$D$l@$3$"$T$p$$$ÉD$d4T$p$$D 3 t$8t$$DD$ $D$$D$$7<t$d$$h$$$ $$$3$\$l{|$`$ $ $8#$c<T$lR D$$Ƅ$$71$$3/Ƅ$D$hFtO$$$F$$$$tMƄ$0$$A$$$ $|$Pt$t$)ƅ$6$$&.&T$xƒG$B$vƅtM$$D$$$$DŽ$DŽ$$D$x11ۋ$n$ϋL$x$8p$$$t$`D$p)ƅ$<-$$8.&.&.&T$xƒG$B$vƅtJ$D$TD$$$$DŽ$DŽ$$D$x11ۋ$q$ϋL$x$8p$$G $$|$[$PD$dt$4D$xƋ$)ƋD$H9~ƅ~@$$r$$$$y1t$H)ƅT$H$$D$h{ $ $ D$($$$1A$$$s,$t$x$)Ƌ$9~ƅ~@$$r$$$$y1$)ƅ?$6$$).&$ƒG$B$vÅtM$$D$$$$DŽ$DŽ$$DŽ$11ۋ$f$D$$$$DŽ$DŽ$S$ϋ$$8p$$DŽ$$,$$$$y$$$V$$t$($$$2BS$$$V|$4WV T$$t?$D$$$$NDŽ$DŽ$%DŽ$11ҋ$$\$4)ޅ$L$$H$$$v$N$+$ȿ$5v.&.&.&T$xƒG$B$vƅtJ$D$TD$$$$DŽ$DŽ$$D$x11ۋ$q$ϋL$x$8p$$$$$aDŽ$$$$$$ϋ$$8p$$yD$L$$*$ȿ$4&.&.&$ƒWG$B$vÅtM$$D$$$$WDŽ$DŽ$$'DŽ$11ۋ$fDŽ$$$t?$D$$$$DŽ$DŽ$$$D$4P$$y$Z$D$$$$SDŽ$DŽ$%$!$$2BS$$ q$$$9A$$$ $$ $tB$D$(A$$$$$=#$D$dL$4ȉD$xI|$lݔ$|$[$D$$D$$D$$D$ T$$$@ǁ$'DŽ$t$Hu$9t$psD$4L$H)ȉ$n$D$l$DŽ$eDŽ$1ۋ$$.DŽ$$9$$DŽ$DŽ$$$E$D$$$$xDŽ$DŽ$O$1ۋ$$$D$$$$DŽ$DŽ$1ۋ$$D$d8N$`$\x$$$|$lDŽ$D$pD$`D$\D$DD$H<$+$$$L/&.&.&.&.&.&$ك8@$Y$uÅt?$D$$$$DŽ$DŽ$uDŽ$11ҋ$y8p$$$$"$ae|$l<p3$$Ƅ$$11ҁ$$&- $ D$`D$l$DŽ$$H$$y DŽ$$T$`$D$pD$\D$DD$HD$[$t$D|$\l$\|$08@$$N$|$h|$x)9~υ~2x$$$L$h y1)@ʋt$DVL$\V$$D$x9$$I!$$"&$у8@$Q$vÅtDŽ$1ۋ$$L$H\$ht$D|$\>T$pT$p$T$d$D$`D$[$$ %D$`D$l$$3DŽ$$$D$$$$DŽ$DŽ$1ۋ$t$h$[ DŽ$1ۋ$$\$Ƅ$0$$DŽ$DŽ$$$$$N$D$$$$DŽ$DŽ$|$[\$4$L$hDŽ$f$t$l$D$p"|$[|$4D$HD$pt$4F$|$l$$DŽ$$$S$D$ 3 1$T$p$9$rC$ƍC$D$8D$ |$D$$$$wPvT$p$W$D$$$$wDŽ$DŽ$HI$$$ RD$l@1Ҿ 3$D$$$$DŽ$DŽ$|$@OL$@ML$lIƉT$lR$Hى$t&.&.&.&σÃ0 u䋜$D$\ub)ȉD$p$?$D$H=J$$D$lD$[$+L$HG$A0)Ɖt$p$1ɾ Ƅ$-$$xΉƒ$$$1ɾ ZD$[t$@T$xT$l־DŽ$$$$L$@1ҍy|$@D$@8D$@D$xD$l|$@1ҍOL$@ D$@8D$@D$xD$l ؼT$@B:D$@Yf% $D$ 3D$D$/$sBL$HD$[$$D$l+$D$l$DŽ$D$HD$pL$HD$[$$D$lD$4$+H$]_L$l I$8T$lG$\$[$\$p7 D$xD$lD$`$H$$ $$T$ D$<$9D$@8|$tD$@-$H$D$lJ$J$$D$$$$KDŽ$DŽ$"$1ۋ$$t$@~|$@D$@83L$@Ǎqt$@T$xT$l頻$$D$d$$լ$$$D$@x|$@D$@8\$@Ɖ׍KL$@ƶT$@:rt$@T$xT$lL$@1yL$@鐶\$@KL$@.D$$L$`L$l$$!D$@pPƄ$$O$$$$$ۉt$@D$xD$l17L$@Y\$@ mT$@B:D$@5D$@8L$`L$l$$ GD$@pPƄ$$$$g$$$҉t$@D$xD$l$$;$$$1ɾ 2D$@8$|$l$D$pD$xD$`$$$@\$l [$f8T$lګ$fH @Ȱ$ DŽ$֋$mB\$l\D$\D$DOȃ0 1ƍuD>[^_]ËEtD>t(.t&.&.&ud9uE[^_]ËUuD>t:.&u$9u뾐.&9tt[^_]ÍD>UWVS;}ED$E D$EE$$©3E܋<\$D$D$D$D$%-uM(U$T$ 5Aƅ?T$ DV 9‰T$ s )HFL$D$$̠D$ V9oL$&˃9O9uD$%Ur]} ;tL$E$UE tE C9N.&9ue[^_]ËD$%-uMEED$E D$X$B@Ɖe[^_]ËED$E D$O$@Ɖe[^_]ËED$E D$$?Ɖe[^_]ɋD$%9v.& %9uU~ t^E|tE_UWVS,c}m|$D$%U <$Y!3m܋<|$D$$%-BuM>U($T$m>ƅUT$DV9‰T$s )HFL$D$$D$V9L$4.t&.&.&.&˃9M9uD$ Ur]} ;tL$%ɋE$UE$tE$C9~N.&9ue[^_]D$$%-@uMEED$E$D$X$d=Ɖe[^_]ËED$E$D$O$2=Ɖe[^_]ËED$E$D$$=Ɖe[^_]ɋD$ 9f.&.& 9uU~t^E|tE_UWVS`ÈE(|$PD$YUt$X|$0D$0D$H|$ D$$D$L<$X¿3፾ÿD$DED$ED$ED$E D$D$DD$ D$HD$|$ 4$U:ue[^_]ø랸뗸1fffffUWVSpÃ9v==  =D$DEU D$HT$Lu 1ҋEЩD$HT$XzD$D~eD$DD$hD$ D$lD$D$X$>D$<D$hD$@cD$\% ?D$X\$Pt$PD$4t$PD$TD$Pأ܋D܃L݃TT$PL$P|$fD$f fD$dl$dT$`l$fu؋L$@)эyT$`(\$X׉T$,D$(D$8D$0} }1|$DD$ }y}}}1MD$`L$$MDD$@$8D$PT$@{D$DD$Dm} }R}D$ 1EUT$$o8D$PED$$D$@T$|$D T$l|$`(D$D$PD$ D$`|$Nj} t$@ ;؋\$H*t$ D$P1D$`$[؋D$<$ID$P9+D$`M} 3E 0D$Pe[^_]ÃD$lx |$`/WD$8 D$0C D$0D$D$<$މD$<$D$XD$8T$,҉D$0 D$41w )ƒ p<)Zt$LEЩE'E D$E D$X$6D$PD$Pe[^_]E$36D$PD$lx t$` D$$D$@EL$4 3L$84$臆D$4~T$8 D$0 D$0D$D$4$UD$4FL$uDžFD$4ڞ.(ɋL$PAD$H0كDڞ(xD$XT$\D$HT$LD$l|$`D$`|$NjD$PU҉D$ t$<|$8t$(L$$D$4D$HD$8D$4r D$`(D$X (.&t u)D$@L$$~YD$`D$؋tT$HL$H؃\$HD$HT$LD$H-@D$L"D$`|$P0V-؋D$XT$\D$HT$Lut$PD$,D$0t}||$\D$D$D$h$I[D$hD$D$d$MbjD$lPT$`1D$XD$h$YT$DҋT$`D$` F}EL$\yD$<9)ƅD$@|$\)D$hD$x$p\D$DD$H~ |$HL$h9~ȉD$x)D$@)D$h)D$HD$D$D$D$(D$<$?L$,T$ T$$D$,Eh"GD$,1T$$1T$D$<$$>D$D$(D$<$?T$1L$D$L$,T$؉D$<$HDžL$,D$D$T$Pt$t$#LɉU )ȉCD$T$$#DƋD$D$<$>ET$$t1T$$<$NjD$,`T$$L$,D$ D$,PbT$L$L$$<$<D$T$L$$UUBJL.t&.&@9s t]UWVSku} G9F}uuFV|9s]B9EE)ׄtdD$D$$UXREt}Ut\T: E)j[^_]ÃFV|9rָ롉E4$?E$>ƅD11UWVSx$}<$%RD$t$rD$dDŽ$ݜ$DŽ$E$E}É$-wʋ$5牜$}D$p0E@D$0D$h/$D$xDŽ$15$DPЉ$K$C‰ǃ/ ˃9?~ыL$xDPЉD$xU tE u0e[^_]ÃL$t8et ED$PD$TL$hA$Et$LD$t1|$F$ߍN L$P9L$()$D$TD$h$$04$0$ $$t$89( ؋D$h!$$$;0D$t$/0D$x$#0<$0D$$$$ 7$9D$h$@DŽ$$s"E@u$|$h‹t$0 1ҋXҋ$ ʃ0$4t&.&.&.&.&.&.& LOЃ${/~Ӄ9~)ƒD$XNT$`\$X݄$CD$`$QӃ0 T$T3t$PD$tD$`|$$$$}5$r$}D$pH$P$}D$pыD$pD$Lt$tD$TD$XD$`߀EDŽ$E@ D$tD$`D$`|$p)랃i  n$£D$$4$(DŽ$E@$}$8(xE@$u$% ?$݄$$(1/X$(D$hp$$ÍpT ~!9r@@DŽ$$t$PD0$DŽ$!$$)Ɖt$h$D$hD$$$3$$t$h)$D$hu$$$+D$t$+D$x$+D$<$+<$+E$9p@ $'z$$$?+DŽ$DŽ$E@}EPu9us#T$D$E$$=E8 )n)T$T$T4$$$HY9^T$TL$h$$$9D$hb B cT$TD$D$x$$:/D$x%$L$$<-D$@$ $)D$@$T$TL$H)L$Tt$d |$D$t$$0D$t$؈DT$@$L݀Bټ$$ f$٬$T$4٬$D$4T$X\$@|$L(|$LD$$D$T$ـDD$@DŽ$D$HD$D$t$$-D$t$D$$$$r/$g$l$($$8(4$0($$$&$D$hȃ195 DŽ$t$P9t$(tQ$$q $).&.&.& j\t鉔$\$h7$$Ɖt$8D$4T$X\$@D$$D$TD$4$D$X܈lD$@ؠDTD$$ $D$h$D$h؉D$$T$ $$T$ zD$$$-…]f$)Ɖt$$$$e-$Z)$$$$)ЉD$$$$l#Q؋$D$@݀ټ$$ f$٬$T$4٬$D$4T$X\$@|$L|$LD$$ D$TT$DL$ $$'D$TL$ D$'9D$TT$|$X $$D$8D$hD$TT$XD$4\$@D$$$EjT$TD$$$$""$D$(D$4T$T|$D$pD$$D$ ED$ED$$$$$E$E tE }8$D$hD$@\$XD$4D$$ D$T`D$@\$XD$4D$$DŽ$D$T.|$p)D$LD$pD$LA$ب\$@)T$KDL$$$%D$ L$D$%9D$ T$t$PYDŽ$!$T$XD$4\$@D$$ D$T\|$tt$L$BBE8BDŽ$P$f"$$]xD$$4$$$D$4$}u$DŽ$E@}$mD$@؞=D$$D$TD$40t$$)D$$D$4\$XD$t8P$1D$xDŽ$I$(݄$4ݔ$D$Tt$tD$XD$L~߀EED$PD$T1D$L$$T$ L$LL$D$:ft$tV ~ t$< D$TD$$fJ $N ~ r IN|$`T$TD$X)‹$(݄$4T@$$3d"$~4T$T$D$$ 9T$Te$T$($$$t$$$D$@؞D$TD$$ D$TD$$ D$LY$\$xL$X\$LD$tDp$T$P)ʉT$$$wR$L$`l6D$h$$$ $$D$x$$G)‹$(݄$L$` ݜ$$$L$ L$LL$L$hу5҉T$M $MU  D$`Et$PD$tD$TD$L@$.D$t:D$tP$1D$xD$hDŽ$c1W߀EmD$h]D$tD$`$DŽ$!|$Xo|$hDŽ$P |$XDŽ$!t$X9$J$@w${DŽ$_D$paD$pP$)D$$$lD$xAD$xD$`$D$x$$d5)ED$ED$4$$$d$% ?$݄$$(fD$T($&DŽ$t$X9$$C$$$ډփPD$$s9t$DŽ$!t=$$@D$P$DŽ$P DŽ$L$X9$1@c$1ۉ\$P\$T |$h$@.DŽ$t$P9t$(tT$)$$D$$$GD$`$WӉ1D$x$!$DŽ$!xxD$0t$PL$TD$T L$`$$PӉ1D$xD$h1$T$t fffffff|$L$ -fffUWVS(E܋u} G9F|ƋG$]EnOMEH}ЍV@^LM1]؉uUEԋuuEډډ]fQfE9r]؋uEԋMQ}9)ʃTM)ً}9s4})f.& :fJf9rۅtE};xt#}GMADE([^_]1뇉Nj@E$]S…t>Gz q s7u/u(UE$];UBEUE뎤fuu밋]K J z s fUWVS<E@T8Ex0'E }Ux}؉EԋE@EA…u&t&.&.&A…t v0uA߀PEEiE)4u؉EEEUWVS豌fuEH98)ʃ} 1ɍt&9 $/tTUP@} K}|> 9u~2U)49t$W0T$D$ $Eu1[^_]Í~ u u M9t$O0L$D$ $u}{1.t&DUWVS0詋^}u D$(D$<$\$ D$ T$$D$T$D$,D$4$`\$D$T$D$T$ G+FD$(+D$,~%T$$ЉD$D$\$ D$ t$e[^_]T$)‰T$ D$\$D$ t$e[^_]UWVS}M 2A<w 9uYu߉[^_]1[^_]UWVS蠊YEM]E TsCD9sf9r)؃L9s&)D$D$ $]M[^_]UVSEPXM 9} .&u#9r1[^]Í~M t09tݸ[^]fffffffffffffUVS轉jR0)ˉf.&.&.&L u썊\a)ˉ.&.&L u썊A)ˉ.&.&L u[^]ffffffffffffffffffffUWVSU} EZ]9BB[^_]ÍBEu\]uttk )E^M9uU.&M ЉFCU9rߋUM})}Lt*%9YE.t&9rE})} ȋ})J.[^_]ÉBMUVS蠇UUBJT19r, 9st9sEE$Ɖ[^]ffffffffUWVS 1d7} w.l U4tfMt@/.$0E $ ƅEFEFuFF [^_]øMEPUуl ‰)U= w|/.$It/.$0xUWVSȍut"F w"d7u&l 4[^_]É4$[^_]/.$UN?l 4tU$[^_]USMtuPtv[]fu*t9ut7u[]ÄtuO1҉[]úºt؉[]u u똃UWVS]CEEEEE 1ɉE}ˋM!.&.&.&.&D}|eEUƉ׉1u}D9]ωˉ t"E9C~$EUTC؃[^_]É؃[^_]ËC$tKSx s stftE$]u2uʉE$EfK H x s UE=w1=w=v=?wD uA]1Ӄ?v ]x@u̺ ]Éڃ]U$t UP@]UWVS8ւË} EHMW9|ЉʉE}EGM4 9w}U$SE؅kHD9Us2UU)ЃD$D$ $M^MUGEԍDEEU]TU9W]9)UЉʉM̉u).&.&.&}9HtMEӋM11EU-.t&.&.&.&.&.&AeƉ׉1CE9rًEU܋]Љt}9lM̋uȅ ftDtE؉pE؃8[^_]EUWVSìu L /.Eut?t|$E$EE$`EtsEud7Eu?|$<$r‰EtUE$7Uu/.$u먋E[^_]D$6D$E$ E1[^_]d7EuO$rDžt@q@L E/.$}/.$gL u딋En/.$=1XǃL Eu1>UWVS$ùu EHNj@EPG9~&.&9U $|ExUtt$D$<$ UEp@]L] ] )؉E1}U܉ʍ.&.&>M CFM9r}ыU܋]9rJ+MDtUE]XE$E$[^_]Ív.&9sѥ9r1fUWVS}u FO)u2_DTt&9s290tɍL [^_]UWVS0] E@ECu)uAUJEDT9:98t x؋]E1C$‰E؅p CEԍ{}E̍DEEH@]DEBE܉É}11+v.&.&.&.&.&EE@1+A)EU1҉ƃ1USE9rƋEM9+EM܍]ȍ\]MЍ\]E)ȉEE9]܋]5.t&.&.&.&.&.&.&E ؃1)EU1҉ƃ1UE9rЋ]܉ǃ)߃EDžuE)NjEftEԋE؋}ԉxE؃0[^_]$E؅t@@E؃0[^_]1؋]E }UWVSEx|$Pt~^$T )‹M  P9|$s`F )׉\$ Éً\$ D$ ?\$V9T$sZV ЉD$ D$ e[^_]à t(D$ ?\$1D$ D$ e[^_]1D$ ?\$D$ D$ e[^_]ù )D$ ?T$9|$r1ҍH ЉD$ D$ e[^_]ËVUWVS$sÅE %tT$ED$ twD$ $T$|$ |$t ) |$T$L$KStL{uL-2uD$)NjE8؍e[^_]ÍD$$hT$S {tM5)‹E؍e[^_]UEM Q t.t&.&Ju]UWVS|x1utD$E $zDžD$D$4$(ptt ʃ9t*xD$4$ t|E%=_gt`fx ttpu ffx fp@ƒ P$‡ P, P( P Ĕ[^_]K51Ĕ[^_]ÍD$ 8D$D$E81$/514O1USvò~E UD$T$ D$E$[]UWVSvw~utFD$4$? nx$P8D$4$H [^_]É4$Tڍw0D$ ,8D$D$=\1$.UVS6v}ut&nxP[^]É4$[^]Íw0D$ 8D$D$I\1$@.ffffUWVSuv}u|1$'- ffffffUWVStV|uf~ *D$4$ F0ǀǀ F 1F tV$ЅF F0tN@9t $9F0F0$F0ǀǀD$4$FFF [^_]ÿF yF$i4$Lǐ8w0D$ @8D$D$81$+81 fffff̀rS[z& [UVSszut8F0u ǀ4$uAnP[^]Íw0D$ H8D$D$;1$ +뜸fffffUVSr7zut#1V ҃ t[^]É4$[^]Íw0D$ P8D$D$;1$*UWVSryu!7FF 6uaDfF FF uuFVT$D$F$V$FV fV 1[^_]ËF0tN@9t $F0FωVʉNɉ~ ωVʉNɉ~ωVʉ N ɉ~$ωV(ʉN,ɉ~0ω V4ʉ$N8ɉ(~<ω,0123FG4VF5NE6FD7UMFK8VJ9NI:FH;UM<\GLFJ\EZLDJFGFGXLGJLFJLEJLDJ^_^_XLGJLFJ LEJ LDJ ^_^_XLGJ LFJ LEJLDJ^_^_XLGJLFJLEJLDJ^_^_ D$ D$D$T$$ e=<1ɋ8tBD$D$ N|$\$4$ y8t6D$D$ ~D$L$4$W8t6D$D$ VL$\$4$QW8t6D$D$ V\$D$4$ ?O8t6D$D$ NT$D$4$_8t6D$D$ ^D$L$4$W8t2D$D$ VL$\$4$AuwW8t2D$D$ V\$D$4$u7O1$[^_]Ë8'O-'8,$[^_]UVS &ipEU uMtTp4u 1 [^]D$D$4$.u"udž0&UWVSh^pƋ4D$D$4$-EtE$nGu͋$MtMtf~ 18t$9⋎t $?4$uu&E[^_]%U9%8}%]EUWVSg=o]tCƉ$[^_]þUWVSHgnljUD$@$:ƋUu 1[^_]ËOD$M$…1]~˃Mt|tatOt=t+tt9EGX<^?^@V@FA~B^CFDXhH *JHXXhHJjJHXX h H JjJH X X hHJjJ9Zu5>au-Fw"D$ p$ ;F@tNO$4$h%81[^_]Ë0.NF(șdž‰DžuN V DDTNꉖD$ T$D$8$]EP ~D$4$0}z4dž$$$pXPx H XPp[^_]Ë8f8F8FF F FFFF40. ~D1 󫍾$F~ 818t181D$4${dž0M8?8UWVS$HSZuF(x~(V0!UN9F9MUD$N $MUF($N 9} TDTDF F,9sF0 F,|$}|$4$$[^_]ÉUUE$.EEtlE܋UT$ML$E$袭ME)UЉL$D$$1M $5EUVU(_US]ED$U $ #C,9C(}#C0[]fUVS QgYEpFtD$D$$F u  [^]IUWVSIQXEPwhHtwSuNP L~8xpXpTPtYtQ1[^_]1DžLDžPX2DžTHDD$$$ƅtǀHXdž$$ljFHDt dž w:&GOGG CG =G 4G %GE UtAtCf\ Ft$t$賺4$j XxD$ ED$E D$E$XE EUuM, Pdždž QXTtt!ЋTDTT9QX1XA1L=f+fdžXD$ L$D$$T PD$D$$fxuu fxD$D$$E t @E@t E DžLxpX]2pTPO AfXmxD$|$s XD$`D$$` =b1уX`abcddefghhijkllmnoppqrsttuvw `b1d}h=f]t_LX Љ lp&D$$ 88D$\T$X$TD$XT$$…\@@f@fBB PD$D$T $XD$XL$$D$PT$$O,t$ "T$€ T$$X +ǎXFTT$ p8T$D$)(2${TfUWVS$HãPEpFtD$D$$FUED$E D$4$kDžEtuD$D$ED$D$ D$|$4$踜‹!@u FЃ$[^_]ÉUD$D$$LUЃ$[^_]D$D$$'Ѓ$[^_]fffffffffffffffUWVSGfOuE U VfFFVVfFFVV f F F V V fFFfFFfFF=6F t<[^_]ȉFȉFFȉFF ȉF FȉFFȉF[^_]ft~ɍDNE* EtEЉ‹ȉBȉBE9t'GʉHɉHHttX ˉX X ]X ˉX f9Vɍ\Nt&.&"BɉHɉH@tH ɉH H ɉH 9uȃ[^_]ÍD$ |8D$D$bP2$F lUWVShEMuE E F=F ƒ<NvVVNNvVVNN v V ȉF FfFFfF[^_]ËȉFȉFFȉFF ȉF FȉFFȉF[^_]fN~ɍDNE4 EtEЉ‹ȉBȉB'G9}ɉHɉHHttX ˉX X ]X ˉX fVɍ\Nf.&ɉHɉH@tH ɉH H ɉH "B9uȋF mD$ |8D$D$bP2$F ƒl'UWVS(&CJEpFtD$D$$%FE  D$D$$kEb1E}䋎M苖U؉U싖 PUb1@xH M؉HD$D$$f$u ([^_]1([^_]UWVSAìI}wFtD$D$$FD$<$tr$tcFt$t$t$E4$<$wE$譬[^_]øUS -AHE9ErD$E D$E$ []fqUEtu]11ɍT9r]1]fffUVS@zHUE X81rVȉȉȉrȉVȉrȉVȉȃu[^]11ɍv1É11f1놉1_UWVS4?ÖGEE@Et } 9x 1}EEEEE*EP}GA у@3=0fuftpfuE@E܃!‹EH}<}0}}Gu kUzu@G GGBPWxG8GBW}O ME9kOft DAfEtD$D$ E܉D$L$4$蔨V1ۉ]E@Ex#} EHU ꋀEEƒUƒUuXM01ɅMuFBEFEEF0E4[^_]ED$$E0E@ D$$MAt MM} y AUtiUJAUQ}Q D$ML$D$ M L$D$<$耣E4[^_]Ë}GMWW:D$UT$D$ M L$D$E$!E ]}؉0fuft tpfuu^/Ex }OE@D$ 8D$D$t2$D$щT$ |$D$E$lE@E܉dU܍D$ 8D$D$t2$U/B $1fUSEP M TH}[]UWVS:vBuE9G Ut OuhM Gt"V T$D$$fG$jGB<$X9}thG tkMtOtD$L$ D$GD$4$wn"?9}tG tUE?9}u1[^_]1G!,USUE @@ @HKYXBP[]fffUWVS Q9A}ED$E @D$E$諣t7ƅt|$$t [^_]84$V8UWVSD8Ë@uE T8‹E1k*lt$D$ D$D$<$K=5DžDžDžDžD$D$$|<$*ƃtI<$)D$D$4$tntD$4$ytSD$D$$E+uqD[^_]Íӆ$L8D$D$$諠4$裢8?gUWVS,7>]ƉUM܋ED$T$4$YNjE  &ЉUUD$L$$]̷EGfEf}UBM (9tD$T$$]肷UBD$D$$]cXMfG|$ED$4$]<M9$GfEf}BEGIf9trWu܉V1,[^_]ÉE؉ME\$ 8\$D$bP2$E؋M7UE:98uDE܉ufp뛋PUD$D$$];UuT,[^_]ÉUD$D$$] UE܉ufp5UE:98to!D$T$$ZtfGUE]L$ 8L$D$bP2 $UED$T$$]bsUWVS<'4;}EpFtD$D$$#F w8t<Jut(F( 8GvЃ<[^_]F(ǀF,}Qf3G !DGDE䋆fHD$|$$DD$ED$$軱DžUPuED$ 8E܉D$D$bP2E؉$GG 9=7EED$ M܉L$D$bU؉$WUMԋEDGDE䋆}MԋED$ M܉L$D$bU؉$uMtUMVE$Mƒ7MɋMEVUfVD$D$$ϲD$FD$$F[FV(VfxD$D$$ZD$|$$̯hP OfMEMfMMF,PfG fGTU䋆f@D$|$$覱UD$T$$Dž@=zD$ 8D$D$bP2$TEfEEM8FtM$F FMF(~UfVF(D$D$ED$D$ E D$L$4$‹E!@uxFЃ<[^_]ËE @ME$MU *‹MEfEE'D$|$$ApUD$D$$UOV(UVfeEfEN,MKOD$D$$ίD$GD$$EWfPM9uD$D$$}7}fEfEM/}fMfMMV(NfMHUUf9UǀxD$D$$D$|$$WfEV(ENfMfMMgJfMuljȉEMED$ E܉D$D$bE؉$EME܍L$ 8L$D$bP2 $WEEMfMN,MaOD$D$$D$GD$$WHwf9M9uE܉UL$ 8L$D$bP2 $E܋U뫃fU@ ) G OfPDWTUD$|$$D$UT$$iDž@=vU䍃D$ 8D$D$bP2$UMT9fQTP|D$D$$OD$|$$ɩ1҅c8@ tfUEfUME䍓T$ 8T$D$bP2$&EfUUVS*T2uFt$觶F FF(U VUfVF([^]ffffUWVShA*1E EċEE T8EEEpFtD$D$$$F &}Et&}U+uh[^_]ËEċ@}O9E}9|$EĉD$4$tEEEEȉEEċ@EME@Eă9EЉE0} D$D$$諧DžnFfN @EW)‰UEċ@UB 9EGfVT$UEĉD$4$~fdžF fEE̋UF(h`Eċ@}O9ED$FD$$谦Dž$FfEEED$ |$EĉD$4$1D$|$$ӨGdžD$|$$裨ẺD$EĉD$4$KJ…Ezf}:}% EEEċPMQ GO)MJ9MsBED$T$UT$ML$ EĉD$|$4$> 1=f9Ms(UɋU)ɉL$DWD$DW$UfGG)fGMfDOMċAE@BEB AD$D$$U螁UBD$D$MċUQ$}F(tu 9Fpu4WGu"f}udžfdžD$|$$٦ 1EzE=҃9FD$EĉD$4${F fE`fE~}t  >D$|$$)2|$ED$4$}EEEEȉEE@EME؉EEċ@E9nFf;EfFvdžG=҃E9~džEf\MUD$ 8D$D$bP2$ZMU.fEEfF fE~EUčD$ 8D$D$bP2$U'UMD$ 8D$D$bP2$UMSfffffffffffffffUWVS8 #*EUE@(t5EpLB< GGǃ ZU)ىL$D$$]~f}Ufz|rrEXftBۍLZ]&.&.&f9sf]f9u]t^J{f+Eft7 F].t&.&.&Ff9sf9ufjE@(tuE9P18[^_]ËM:9yI;MMA(  UEfEUED$D$D$D$ D$ED$E$]uUiUMG D$E$]ztGUM,UMD D$E$]zMUP9UUfBUE]䍋L$ 8L$D$bP2 $UEGE #EEUUEfEut$E D$E$]lvUBM=E9EUUEfEt$E D$E$]vUFEu BtB=ƃ9EUEfEEEH(tB=wtuOUUEfEEE D$D$D$D$ D$ut$E$]YsEUBMU1ۉ\$D$E$]qƅvEfEED$E D$E$tUUE@(EUUB(1ɉL$t$$]}UEMAEfAGUD$D$E$]ӜƅE@U=UUEfEED$E D$E$] tUtfU1|$t$E$]̞UE䍸8P2E܉U|$ L$D$bE܉$]UE@(EuU]䍻|$ 8L$MD$bP2E܉$rE9EM؋UB=VVU]䍻|$ 8L$D$bP2$UUfEED$E D$E$rUEH(EH(]䍻|$ 8L$D$bP2$U;U1҉T$t$E$]8UUWVS ï#}u FuIFu 1 [^_]D$D$$xtYVPD$D$$ȜD$D$$@t!VPD$D$$萜|{UWVS0K#ljU܃,E싗E9BD$BUD$$輙ƅUBfEHMTFEDtU D$<$tUF=w@fuj>t$<$ut$<$ˇ:0[^_]ÉU썃D$ 8D$D$bP2$UE EF )‰T$L$Eȉ$luEfEfFEDFfENUBftIЍDVEȉMu؉UUuf.&f9sfMf9uMu؋UԍLQF=f+Eft6Auu}}t&Af9sf9uu}fnD$t$$QE܃8tRE܉D$<$ t#fFfFF 묋E܉D$<$+`D$D$$1CD$t$$ę#UM䍃D$ 8D$D$bP2$UMUWVS@N }EpFtD$D$$JF Tt:t@[^_]F(tڨ1EEE؍8EԉuED$E D$E$:ƅEM}$f9t$E D$<$mFD$ ED$E D$<$E@  V=vE܉UE؉D$ EԉD$D$bP2 $JE܋Uf9b~EP|1f9ǍJfNftf}u BGD$ ML$t$E$WG1f MHfOft|$t$E$lt}E@=rfUEFD$FD$$蘔Dž@=fgFD$ |$D$4${G=f D$|$$胖bD$ED$$cB=NfoU 1@[^_]ÉM썃D$ 8D$D$bP2$7MTD$|$$ו럍D$ 8D$D$bP2$D$ED$E$菕\uIuD$|$$aFEčMML$D$4$7!N9wfE}Ѝ8}̉֋9MFEȅ/D$t$$G,EE9@9}D$L$M$蟔EE9‹McBD$BUD$$U9BEA=qMԉU؋EЉD$ ẺD$D$bP2$MMԋUBHfH\DFLMf@D$t$$蜒D$ML$$1[mMufED$t$$QD$EȉD$$ȏƅOE룋uD$D$$ufЉD$T$$豑ED$EĉD$<$Y3wF,E׉B9OMUD$|$$UU싲19u/D$T$U4$&E9uU;EFD$FD$$y…F7ft։EfM܋61ufqpuU+MfPmEDGDED$|$$AD$ED$$踍Dž@=wU܍D$ 8D$D$bP2$UBU`fU܉1D$|$U$詏1҉T$ED$U$DžUa։ffffff1̀ffff ̀rS[& [UVS÷ut5D$D$ D$ED$4$Ot6E[^]ÍD$ 9D$D$52$럸fffffffUWVSn #UE pu T8lE1ptEuAx=EGu4Ѐ:d)hx9׉drD$/$t)1lU+Ĭ[^_]ËdrL9d`'$>\F d9rƀ>Xtԉ`dD$ h)D$|$`$Hpd9rv.&9>/futD$$d6/|%=@dt~8u)сt?hD$ ,9D$D$?2$hMX\pD$E  D$\$u8 X9hƋ`L9d)@u08r9hD$d$职uYEt)D$\$4L_tD$\$408,d`q:fUWVS ǙEu U9Urz9s 9roǃs"u5u7[^_]Í 9rQ9t׉ǃrިu!u)tftɤ[^_]xfƉ9ffffffffUVS 2 ,4$(zD$$D$F $3 [^]UWVS ã}$ L$K#1$KD$$D$<$h3t$<$2 [^_]USw,,$my[]US,QEEVEEED$D$ED$ ED$D$E$讘t}u E,[]ø,[]USÁ,$x[]UWVSxÉUʋ1y}IMB EBEBEBERUEEE@EE@EE@ EUE̋EEUUȋUUMEE܋MM}ċMUE te kE2-byEnd 3Eexpau֋U쉝|]11 É]1uM1EMEu1]1 M1ΉMˉ]1u؋M1]1 Ήu1U1ىuuU1M1 }11Ήu11 Ɖu1UډU1ЉUċE]E11 4u11E1]E؍8M1щM1 :]1؉]1ωEE}NjU1]1 1Ӊ]1m}uuU식|UexpaUnd 3SU؁2-bySte kS CE}CE}CE}CEȉC E}C$E}C(E}C,E}C0E}C4E}C8E}C}}̉UȹEE9tL9t,EȋU+u0<[^_]D$$D$$.#ԃ $Zi(UWVS`: EE T8E1} w6}̉M UERE9t~L9ue $hXM̉MG} EME9tXL9thM UD$ D$<$^"E+uI`[^_]D$$D$$7"D$$D$$"똃 $Ih'UWVSD* T8EE1uUč}̉qMȉM}ǹU7UȋE9r}9t"L9t81uE+u=ЃD[^_]ÉUD$$D$$i!UȉUă $gU&UWVS8m" T8>}}̉11҉EE9tL9t)E+u18[^_]D$$D$$ ׃ $ gfx&UWVS<ß U T8E1E x;Uȍ}̉/M UȉEFE9tKL9t[E+ua<[^_]ÉUȍD$ 9D$D$<3$̭UD$$D$$ 륃 $Ef%ffUWVS% }lj։ʋM fFfFP@F uzYˉM V)fVfVD$\$$U]PMUBfFF F D$t$$]u1[^_]ÃQʋ]C ^)fFfF] H@ L$J UL$ $]lOUBeD$B D$$]rtH D$D$$t&KUWVS$^ }E΋x!fzfz:EF~ =(M9AfZfZۍ E@ EE@utN=$1EAfBB B D$T$E$]s$[^_]É=ft1MM\A4f9rM됉=w+f81&\F<f9rZUM]D$ x:D$D$bP2$蚪MU룉UE]L$ x:L$D$bP2 $_UZEUEME\$ x:\$D$bP2$UEMUM]D$ x:D$D$bP2$שMUU]D$ l:D$D$(3$蜩UUWVSL/ u܉E։MM  fMEE=EffEFEfE=f}EfE111EEf}u։ʋME@ EǃtVE}TG:z Z]f;u]9fEA)fAfDY|$T$UȉM؉$]MKUԋM؃f}Ef;ErE EȃEȃ]f9]f9u}EE\E9E]9f9u9tMԉU؋]܍D$ :D$D$(3$MԋU6E}TG:,E}TG:EE]TCE}}uL1ȋMfAE@(t 9Hf;UE f)8EEf;}ǍFEfEu}l&gEHEA ÃW)fW]fT_D$L$$]IIfEEf;uf;uu fEfEE@ EhEHEo}uLMU]܍D$ :D$D$(3$蚥UMMIUѻEHE E4w(ufFMf9MuufFEL[^_]Ë]܍D$ :D$D$(3$fEf;}'1뗉@f;ErfAf9stEMA]܍D$ :D$D$|(3$菤9]܍D$ x:D$D$bP2$]8M ]K)fCa118a\t&Sv.&CUWVSQ ƉUMED$4$!YǍED$4$YÅtxEEGCCGfCfGfCfGUB EC G ED$E D$$M9U[^_]1[^_]UWVS(Å ƉUMED$4$UXEljEfGE}fyUzyAB A u.E B=f9mEU܋ED$$qEUMEABAfAEfAB A BtHUD$D$$hUU}HD$D$$jUED$E D$E$MU܉RE䋆U܉׋usOuCu1u9ut2U܋E$kuEU܉E]E([^_]äu9uuΉUftt֋E$ uEE([^_]ËuBfF] fu]EvUM썃D$ x:D$D$bP2$UM%f] z>1D$ED$$`iFUWVSp! EЋ}uE fEڋE M܃8MED$EډED$EE$U …l }F Bf+EfBMfDJ SURVP]XP E@D$ED$$Uԋ]BFD$D$uEF$BuE܉EԋE 8_G,E9 EEEEEEE} FE E̍XOG)9Ẽ?D$ED$E$MEee} EF ]v: Af+EfAUfDQЍT ]/}X_]̃XM̉D$}G D$$]YAE܉EGM1}Eą0E 8uE <$MȋU WD$EԉD$E$]fD$t$E$fE9U EȉEԍB]D$BỦD$$]cDžUBPfUڋN y EOG)9f9s%)D$DWD$DW$]?fGEF  UډU]܉]fDQȉEE@=f11҉MM.t&\Af9rM}EԋGAf+EfAUfDQȉEF=}f+11Ґ\Ff9r]̉C}Eą}̋}D$L$$]dD$EȉD$$]dD$ẺD$${d1p[^_]ËV]XVT$T$$]>FE E̋EMAOMu fMYUɋULJы] MU MJ MML$M $ЉE M9ȋU=YEE(}̋}D$EԉD$$]TcD$t$$>cűEȉEgy])fyEf|AωM̉\$ED$<$]5=GE܉EȋMUڋ]܉]fI|QϋEX%EԋGyf+}fyf|QV %GR}E܉EȋEE̋E̍XE-}8X][XE@=UDzЉETD$E@ D$E$]J_UMKM̃H D$D$$]aMwE@=PE|xXESEĉUȋ]ЍL$ x:L$D$bP2 $ZEċU!E̍X . 4$Mo‰11ҋ]̉CM]ЍD$ x:D$D$bP2$ϗM"M]ЍD$ x:D$D$bP2$藗MTME̋]ЍT$ x:T$D$bP2$\MEMUEEЍ\$ x:\$D$bP2$MUE }D$EԉD$$]_D$t$$_G$n }̋}U  뙉MĉUȋ]ЍD$ x:D$D$bP2$nEMċU6MU]ЍD$ x:D$D$bP2$'MUrM]ЍD$ x:D$D$bP2$MUԋ]ЍD$ :D$D$q(3$贕UűEԉE}EEqqqUWVS4  }G,EЉE؍:ED$t$$[…?G@=ffEGEU܉GfEfft?fE<Ufy ED$E D$ $M2MUt(fuU܉B EftgU܉}B E苇20fHEDBtD$T$$\B E1뭉UE؉D$ EԉD$D$bP2$Uȃ4[^_]ËEMȃ4[^_]É  u>f}uAfEA=f9uu AM܅uEEfG Mȃ4[^_]D$D$$YEtfEED$E D$<$1EɋMD$L$M܉$[EUGW E9uЋMp?E؃9EID$t$M$h[EM9}GD$GD$M$XƅMGEFU=oMD$ :D$D$bP2$M:  GEu\uBMEt H(x)Z]fmfm sMM Z]IUWVSß E։MB R$ǃ?F V$$T$F V$~)71@F(^(F F`F$Fd\$4$JM1}\ȉ9uh1tft[^_]ÍGD>(8w58)|>)1tfS^(M@@t(@L>))t1D9r^(\$4$mߺ81tffsg fӃ]KMM9sMuFDM9r96fGM9rf7HfJUMt U E}]U U E]UWSUtm؞B|6Bp0B 9YB1 BXhBdBOz(@1uHu9uuB B$[_]êft.t&f?UMt U E]?UU E2]UWSUɼBg jB;ʄB gB+Brn+B,hB0kAB4كB8y!~B<[zP1uQuBu-u%BHBLB@BD[_]êftf뷪UWVSĀ2 |MqPuQEĉUȋAQ ẺUЋAQEUAQEԉU؋A Q$EUA(Q,EUA0Q4EUA8QPpp)|>Q1!t=^P:~Qo1+uGu?FP^PFHFLF@FD\$4$1 [^_]êft=t#)|>Q1tft^P\$4$ߺp1uPJf?f*fn.ӃKM9s}u.D9rf#o G9rfK6lfnUWVS(É։T$$L$@@SDǃ|$ )D$|;P9tt&D$111C@SDC@SD tCHSLD$ T$DD$T$T$$CPD$$D$$|$kD$ƒ​t$$T$SPT$$ڃT$L$D$ |$$ָL$ktftT$ D$$D$$Ts@{Ds@{D9T$ rCHSLꀋD$9wL$D$ D$$d$D$PЃt$$1L$T$|$ |$$|$$C@SDC@SD9rCHSLD$ 9uL$T$‍D$$d$T$tHЍ{Pt$$tftD$111C@SD C@SD tCHSLe[^_]f{Qr`T$Ћt$$ruZjfpjuXu??tCP{QD$ffD$D$QUMt U EN]UWVS } Et.1T$T$MTuۺ1u)u/tft[^_]êtfUWSU؞B]B|6B *)bBp0BZYB9YB/B 1 B$g&3gB(XhB,JB0dB4 . B8OB<HGzP1uQuBu-u%BHBLB@BD[_]êftf뷪UMt U E]KUWVSy. } Et.1T$T$_MTuۺ1u)u/tft[^_]êtfUEȋU ʒ]fffffffUVS迼t MDžDž<<,>z DM E5 ?x  D$D$D$D$ D$t$Т$(uVD$D$D$ 0D$T$4$mLt0[^]~y[^]Á uDžDži뷸밸DžDž D$D$D$ 0D$T$4$KL0>[^]DžDžDžDžuDžDž\DžDžCD$D$D$D$ D$t$-$'3DžDžEDžDžDDžDžCDžDžBDžDž> DžDž DžD$D$D$ 0D$D$$It0 DžDž<DžDž,DžDž+DžDž*DžDž)~DžDž(eDžDž&DžDž%3DžDžRDžDžD$D$D$D$ D$t$$$ADžDžTDžDž;DžDžG[DžDžFBD$D$D$D$ D$t$l$$2D$D$D$D$ D$t$]$#4D$D$D$D$ D$t$A$x#DžDžDžDžDžDžDžDžDžDžDžDžDžDžDžDž0D$$NDžDž0D$$D$D$D$D$ D$t$N$"3oiD$D$D$D$ D$t$$!D$D$D$D$ D$t$$Y!uDžDžDžDžDžDž DžDž DžDž DžDž gDžDž NDžDž5DžDžd iDžDžDžD$D$D$ 0D$D$$CRPLDžDžDž D$D$D$ 0D$D$$u}u tE E E~ vMiM0 DUWVS ô <$t V6uD9j$Et+,9t V6u<$E [^_]9t V6uD$<$<E [^_]US$U t$[]EEED$D$ED$ D$D$E$E]놋ED$ED$ GD$F D$E$LE!@F aD$ $2t̋EUBL$$2t}VWVUVS诩d uURH fu xutmLPDu%B EEED$E $[^]à D$D$ ED$T$4$uE뭸빸UWVSEU zpu9rt)t&9t8t)؃[^_]ËE)[^_]UWVS]E xS9sJы0t1}U fx9tT8Tt[^_]Ë}U9Ѓ[^_]ÉUWVS 8 E}E pE0EEE90EuNEU9sщL$MFD$E$]7D$t$$(M)Mt2MVD$T$$]Q&ƅu [^_]1 [^_]ÉUt$E$]>0Et͋]E0U=UWVS(@ E }}8}xEEE3UHD$D$E$(U)MMuE؉D$E$nƅM@@@ @E9s‰M܉T$UED$F$EUMXE)uD$t$E$k'1([^_]ø([^_]UWVSӭ }E pD$D$$$tW@ u^JM"D$ED$$~$t&M)΋PUD$<$9ur1[^_]ø[^_]D$D$$&ffff̀rS[ & [̀rS[ & [US #ج EU D$T$D$ED$ED$ ED$E D$E$ []fffffS[~ & [f.&̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fffffffffffffffffUE@U +B]UWVSÕ tMƋuA~8t:F4@9s3`V8F4@9r$/F8[^_]ÉUWVSh! E}}u T8ENjE1yvV8t1ME+wĘ[^_]ËF4J@E$]&F86]E F4F0E|U1EM yxD$`|D$EtD$ F8D$|$$]"3NjUN8#UV4V0]LTD$ D$`T$ $F4~81.& @rPu B8~8BX;F4rEyF8$]-F8UȉȍB=]I_8 4U]0_UF8$^-_UF8$]$F8tgD$`||$t|$ D$xD$E$1DžuUN8]^N]^{]UWVS@茠A EE M T8NjE1lI%;E" = 9#ƅDƅdHD$$"8BƅC8 D$BD$d<$9sv@DžD B BD$4$3!) D$ |$t$$Ƅ=D\D$D$$CƉ׉\‹ :9 tD$D$ $pt[U+ @[^_]Á}$ @ Džh1Dždd ׉<$!D$`D$D$ t$D$$-f 9?LTD$ D$`|$4$ $9uDF(Q( L(9Ɖz9x&_1ɉg99@Ћ8u@8I4T9PuV(9P(o[Džp8H41`9{t9F@VT$$KJu"dhD$T$<$nFPp @?.T$GxVuEENjExEEML$ED$M $UED$ED$U$UZ>EډU)E}|$t$lj$UqED$}|$4$UE<UT$|$E$UED$\$<$UED$\$E$U`U)ƒ}v]Éΐ.& OB9uE}̍xHED$|$E$UC(MU؉]ZGu]E؋} 8]]E9<[^_]ÉMED$ED$ ED$E1uD$E$M>ED$ED$ ED$1uD$E)ȉ$s‹E]uf.&1pYu]uE EEE))+E9U).t&.&.&2wBu\UT$\$<$UUT$\$}<$UrkUT$ED$4$Uut$ED$<$UzukML$UT$E$UML$ED$E$U[EEE@}G} (E]ЋE EEEu99]߉]339}+}ED$\$<$UEԅtȃ}t/U M.&KPU9u띋Uu.&.&.& 0sHuu[ȅED$|$E$UuUT$ED$E$UEE|}E Et3D$ @D$D$l3$>WD$ @D$D$m3$>UӍ UT$gD$ ED$E D$E$9]ffffffUVS ҅Ç EU M9Mr/9r 4 9r$9fu49rL$T$$7 [^]fffffUWVS(聅& ulj֋ tRT$VT$$$ЋM^ȉ]1҉EUL$D$ $T$]ӋE111 ufEUD$ T$ED$FD$$]&;u?tVT$VT$$$Ѐf1([^_]Ë]mBUWVSx% Ƌ; rEu =v[t3CuuaStqPCS t[P ؃[^_]ËD$$ Åt@C؃[^_]ÉډSu1V룋KT UWVS袃W u xD$4$8E%=D$($ Džtz@@&@9uE ED$D$ EЋUԉ$T$EČ[^_]@1Č[^_]UEU U U$]UVS詂N ]tstWJ}u tFP@Lt1ADTP@SP PS@[^]Ë븉D @*.D$ D$%D$3$U D$E D$E$]UWVS讁c E HMPpt)rP@t6B E$ 1[^_]ËxMt P@uʋMAUWVS4: }u ;VЃEljE@uts;puXY LADTPPX Z O@H PWEuH@4[^_]É[EM܉1҉EԉU؉L$D$ $T$%U11MM1 MMEԋU؉D$ T$E܉D$AMD$$9‹Mt+AMT$D$$ MqEAAE@HEHEDAAGA AGtQMT$t$$$ЋMA4[^_]É\ L_D Y=14[^_]É\<1BEH M<O1UE @M ȈB1]UVS~b ut PtH J H $ u4$ 1[^]UWVSc~ uu2&.&[tCtډu[^_]Ë$[^_]ÐVSD$ L$t 8trtl@͉ эv.&ލ1΁ €t8u.t(8u!t8ut 8uHu1[^fffffffffffUVS b} U EtUM"t&.&.&.&t.ZYutD$D$ $E [^]UWVS |Ê } uw vtօu 1 [^_]ËEEUUU܍EEED$E$ED$E$Xu#ED$E$E܃ [^_]ËE+E1:TEfH @jffffffUWVS({ E܋}@u lE XYE@ uNtz} ]z}Z]u}]tqvD$t$E@$EP,3)NjM IM)E Hu1([^_]ËE$]E@ d3{끨mE1u@9‰ÉϋutftU}<$](U)UU)UE @E)Ћu FBEE‹u9sEX9HY9\$ED$E@$EP,…wEfH @([^_]Ë}E9s‰EЉϋutftEM)HEE @EM)ȋM AyE@ .&];}{}]UtMqu ҀB^E9HszE‹}9snϋutftUEu0$])uUUE @E)Ћ} GE@ UbBEXE91E)yD$ED$E@$EP,…z)Ez}9|EPp)щϋE &.&6p9rD$$]‹E@ ]+KKMKSs :  ]؉ϋus$tftME)A1=UJЃtMUEED$D$ u4$]tv)EЉϋus?tftE)P)UtUE$]w1ɋUV룋EEZÍw0D$ @D$D$G3$.u ]܍D$ @D$D$H3$.bf%BBff+E XffE]F3G]33 4UWVS8u| utvF tP~tI)>tI1Fu-)t'\$|$F$V,fN @[^_]ËFDu1[^_]ËF봋VU[^_]w0D$ $@D$D$V4$,[UWVSxt-| utLD$4$F t$4$D$4$[^_]2 %.4$$Flj4$[^_]ËL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffVD$L$ t$}t :tw@Nuo͉ эvvR1ʃ€tv:HPu8v8ъPu )t&8ъPu t&8uHt:t@Nu1^ffffUWVSræz u7tfF t#Vt6F u>uRFF1[^_]èu@VfF uʉ4$F tFF؉FEa1맋V0 t~@9t $eV0F FV덍w0D$ 0@D$D$<(4$d*=fffffffUWVSqÃy u}E FftRxT$$<xU+u 8[^]њf̀rS[q & [UVS"jq u tt$D$t,@E$[^]ÍD$ AD$D$9p4$4"UWVS4irq D$(׉΋ED$M L$ UT$ML$9‰ȋL$ L$(GU0Et F"('D$'ED$ t$|$D$($@D$$&8&L$EuKD$(9t:D$$T$9ЉL$ 9D$D$=8tyEVnEW\$$D$9ÉL$ |}E9\$L$tD$$4[^_]I&MUED$(D$$1D$$4[^_]ÍD$0E|$,E"D$D$$t$ D$$4[^_]ÅtsD$D$$t$먍kD$ AD$D$K$' L$(=^D$ AD$D$M$E"UWVSmgo EU uM] $\$M] @1.}}$}M] $\$M] e[^_]LUWVSEU ]\$ u}M] $\$](]M$M $\$M]u} L$ e[^_]UWVSfcn u} 9vtGFfuUT$|$$xFP^T[^_]ff [^_]ÍD$ PAD$D$C4$덍5D$ PAD$D$A4$W9vVDD$ PAD$D$B4$$'UWVSe_m u} 9vF t5Fft\D$ D$D$$!Ѓt<F fF FfuUT$|$$[^_]ø"8F 뱍D$ DAD$D$V4$5D5D$ DAD$D$T4$9v DD$ DAD$D$U4$?UVSPdl u9vufFftEȋED$ E UD$T$ $QF !ӃtNPVTfF ȃ[^]ù뷀fF ȃ[^]ÍDD$ e[^_]ÉЃD$8D$,txUL$$D$,D$0T$4D$T$ $D$\$(_D$D$0T$4D$T$ $D$D$ T$t$8L$$}t$80 }1th!|$ D$t$E D$L$T$ D7D$D$4$D$t$$Ұ'ljUED$ D$E D$E$4UWVS8G=O Eu} T8E1>'!T$ t$D$E D$D$|$ D7D$D$$u(u~E+8[^_]:|$D$ D$D$4$ND$t$$ut,JH󥋅D$ 27D$D$$x:'ǃ#$|"…1A<+wLKuىD9u˃u뷃z럃b뇃JluUED$ D$E D$E$R]UVSwN# t$ED$EȉD$4$VxE<[^]EӸ<[^]/UVS<8DK uE EEEEEEN>w@ D̍ED$EȉD$4$x E<[^]ø<[^]USCZK ;UT$$L[]|C5K p-f̀ffff7̀rS[K & [>̀rS[J & [USCJ D$% D$ ED$E D$E$[]USBÅJ ED$ ED$E D$E$[]ff&.&$D$4̀D$̀fffffffT̀rS[J & [PS[I [USBI d7u a8[]&[]f̀rS[ÔI & [USAxI $1[]UVSAQI t [^]É4$buF1f1ø11GAI 1øUWVS<(AH  }1fE9s't G9sD9rEtf E̋ E fE؋ EЋE D$D$(Ẻ$U<[^_]ÉUcEƅUu't<uF=f t/tv=uF ދF ӋF ȋ t@ 9s0.&8u +P 9rt Iƃ Uȍ7D$ KD$D$x7$FU.3D$ KD$D$x7$D$D$$n=E D$D$ED$ ED$T$<$qU+,[^_]Åx$u=wttH|.uT$L$ D$D$$mU?D$T$8$nqD$<$9$3UWVS(H E E T8‹EE@ pcE$MT$$Nr-EP2.D$ D$D$4$KZ ,t&.&.&.&DA@tD$4$j.t&DJ@utSFNu tDJ@tEpt$|$<$调7$N$<1U+u ([^_]L1UWVSPp u} E T8ËE1fD$4$^1ۀ.Ӄu9d9ZF FDFDDžDžDžDžDžB./ML$L$ML$]\$ D$|$4$1#^8=g1ɃVtt^uuE u7ED$D$ED$ED$ D$|$4$u\Ex.]ED$D$ED$ED$ D$|$4$U+P[^_]DžD$ D$|$4$|dfFFDFDDž1ED$D$ED$ED$ D$|$4$=/F D$4$HED$D$ED$ED$ D$|$4$cED$D$ED$ED$ D$|$4$tfF7FDFD#Dž1x1@<t 1}|$|$}|$ }|$D$4$D$4$AFDFD`DžDžD$4$,fffffUWVSl6 u} U(Ft}}, ~wBBU(4$ fF@fU(fN  Jf fBUEt l[^_]ËE, vr U(EEML$D$ E,D$t$E$TxƉt$E$踿EEFD$ $蠿U(fBMЉU(E,) X}|$}|$ D$t$E$л,Ɖt$$ 0FD$E$FD$$FD$$ U(fB )Ѕ9EQT$ MT$D$8$El[^_]ËE$訬EE$߭ML$D$ ED$`+.D$8$PeU(E H E, 9(B B U(D$E$$U(BD$E$U(BD$$ U(BD$E $E U(t5BEE ϋus3tftuu )fBfBl[^_]Ãu"u fBzE UWVS  U }E@4E)Ѓ FD$$)FD$E=s$VfFE@ uG1T$$ǼF D$$贼 G fffG )~ [^_]èu2밸9u1 [^_]Ík$qU *Uy$qU븸UWVSó M uU E@}ω}EE‰EPE)9-UB9E9}}|$4$GD$u4$读W׋u$ssuXuQ}׉+u9~ED$4$V+E~[^_]äft9}u1[^_]urpU$HpUM 9}t9D$ MD$D$=8$SgMAyEtflffffffffffffUWVS(1 ljUM܋EGkE8u䍃EE썃֭E.t&< t< tD$ED$4$+D$ED$4$ D$ ED$4$)D$D$4$ˢG~$n< t< vtu([^_]À>6F$~d ʈdGtD$$_띍F$蹊~GtD$ǭ$_iD$ D$4$tD$ WD$4$̡uEO!F $=~GGD$$<_D$nD$4$itjD$D$4$KuXO@E܉D$ED$`9$^O]L$T$<9$^zO TD$ D$4$ՠt*D$ D$4$跠ug OD$ED$4$聠u O@D$45D$4$Wu OD$D$4$-uZUr D$4$9ƒ?v?T$U؉t$E$tEUƄ4D$$D$4$赟uZE r D$4$ƒ?v?T$U؉t$E($sEUƄ(D$ -D$4$= D$8D$4$u OmD$)D$4$Kg?UVST\ $@it."|xEEE%EEEEMD$D$D$ D$ED$t$}tT[^]UVSh Et4D$E$nEEFEFh!fF [^]Í UWVSxV T8EEtbUD$E$Ef3EfF}<$_D$t$<$}_|$4$aFUM+ ux[^_]Í IUWVSp }x$ZLJft/1t$YDŽ9Ӄ[^_]UWVS@ u4$`t&tuOxu:<$)zdžt$ zdžf[^_]É$0Y뼋|E9Eut$ YUW Et]Í]U- Et(]Í?]UWVSu] }4$sfdž1҅~!1u.&{t뀃9uuV [^_]ËMt31sqsqs q M31sqsqs q 뀃9tuUWVSI uD T8 E1D$4$PF u uD@@$oD4$U4$fF@@1ƅfDž5B dLdǂ`ǂǂǂǂfǂD$$8sF WWPWPWP ǀip6.ǀarpaƀǀ(ip6.ǀ,intDžDdD$t$<$G$i w`D$D$4$jmƇ_WHwDG` \Dž01< t/t 201Ƀt&9c< [< uuDž(D$0$WZ8 Dž4DžHT,8D$ D$D$H$8Bs<;t<#tH8domaH8searH8name%H8sortH8optigxionsZ< t< GmbD+<< ~< uvfxinJ< t< I(  t t Dw`D$D$4$"kƇ_`D$4$VtDž0]t DF 4DdLʃ Јd8$sD$D$ $Rx8$&s,D$x$h}t<hlp DDx`0DpHH`HD@H@`tg.&<.ǃu~DD$. $hDFHGD$.$hDqPALD@$t‹DHDH U+h[^_]Áxservfxer< t< 9 < t< t^D$4$萷< X1DžX DrDž\DžTD$5D$ D$ D$<$PD$ ,D$|$4$V)MPB=9Dt/RωփtftPBj@D<ЉT$L@$dLt׋$ˆL,D$ $VL <4,LTDD|$@$%d<mFV9xDw@ut;u㈕$<,t$$U<$TDLD 44 K}D$ D$4$!D$.4$2cD$D`$9Dǀtǀx|Dž0Dž(9$4[DxD@DtxD$4$Lu덃m$Z< tt< uDž0]L$,D$ $=TLtċ4,LTDDDLD<ȅy%%=t'"$1+ 뱸vLDž0)@DDumuT>uvuYLpD$D$1ɉyffL LsUD$E$]UWVSX6 }u h3 l3 t;D$<$t  F FX[^_]Ë 9puttl|E9EtztIMD$D$ED$ D$D$t$kBt  F F1X[^_]UWVSuU N ~a^1]$9|9t0BꀃN E9~3;E}.u͋]{uӋ] KJKJK J 뼉ȃ[^_]ffffff̀rS[Ä & [UWVSdc .D$4$L@$`DžDžDžDžDžx@ N L$T$ VT$D$$dT$$"=F 9VωփsUtfth@ lj)#Pq덋ptŋ t|$$DЉD>]T>ӉT>lVMHL>@CD> C dT։‹ xzt =w ;NEt =w ;N tH~k LJ yU) !ȉ UeUTv$  ULJ   M싗 1ɍN]MEUtwM<9ErMtu艷  Ѓ([^_]LJ 5 LJ D>ED>ЉD>]]Ӊ\>lV TLU;D> rU=UsD>HL>PD>HL> HU=Ë ; eLQH P H HLJ U MULJ D>UMD>ЉD>]T>lV T]ف9NLQLJ 롋 LJ$ LJ( D>ЉD>]T>lVoMU,3.E b8E $¼UMD$1ۀ} ËE)؉D$ D$:D$$^UMLJ D>ELJ D>ELJ D>ELJ D>EqMUD>@E싟 ]X] É %LJ LQ l mUUxz Mt   ; r tXLQ H P H HUЋ]!LJ ɮ$:fffffffffffffffffffffUWVS0f EЋH , u䋸P }9EZu؍LYLWu썰 XuԍYu̍YEE]]Ef u\ d E<}:t6t0P X xT HEd ED0FT FP , 8 X [^_]UWVS葸F \ t`d EtN$nEt9d t)PT PP , 8 X [^_]UWVS uE vrx|uh|ua$0ӉU;ÅUtSx pp@x@@@(@,$ ؃[^_]1ۉ؃[^_]Í;UWVS c U BE$ ;t[U tNjuru3u+DML$$t(@ [^_]äftf򍃴;[PUVSʶ u4$cD$4$<[^]蝶V 8茶E 8 {4 4 j# < Y , UE U8]U- U8 ]Uν U4 ] 0 U U0 ]UWVSֵLJ \ u"$d uމ4$ALJ\ LJ8LJd LJ` LJP LJL LJH LJ8 LJ4 1[^_]US$ټ E$8[]USö E D$E$=[]US״Ì E$@[]øUS讴c , D$ED$8D$ D$;D$$H[]UVSZ ut,D$4$Hff D$4$H[^]Íw0D$ d[D$D$5<$^lUVS Ý EpFtD$D$$4F!u  [^]qUWVS4 uM5D$ ED$E D$E$yTl>LDžXF\Dž`DždFhDžlDžpF tED$XD$ D$D$F$WaDžH V€ʀ UTL@pD$ D$D$T$sOM P!ЃLPoo0<$oT$7o01[^_]À Voxo0<$o  PxD$T$GP^E E DžTED$D$ D$D$$_Džt HƁ Snn0En01 3 G GVDG @ G @ G@ G GD$D$L$/PLPP LЃHtfD$PD$L$1H  D$ $PP D$rm8LlPu  P-D$T$6PD ƒ@ u hp ffffUWVSæ }EpFtD$D$$/F p[  D$4$uc  t$un  T$U4$DžU9B(E kb1UD$D$4$0tՀN(UV$ED$E D$ T$L$M4$y NjM!@uiF[^_]Ë`[^_]F(F$P9&F(V$uD$D$$7.[^_]fffUWVSǦ EpFtD$D$$-FEE 9s  uy\$4$…u\D$\$4$ ED$D$ D$L$M4$ ‹M!@uFЃ[^_]úЃ[^_]ÉUD$D$$-UЃ[^_]ÉiUWVS$v }9EUEEEE;E MmG$~4u݋M…tEL$D$<$77UUD$ ED$}|$4$9uA}UcE;E s $[^_]Ɉ1$[^_]ø$[^_]ÉT$${3t㉇UWVS({0 uE䋆EMM܉;E E苷EHMU$H3ƃUtY9Euȋ})lj}苊U|$$2U}낉֋E})lj}unE;E s\ ([^_]É׋Eu)ƉuD$ E܉D$ED$$a7u@EE9E 1([^_]D$ ED$ED$$%7l([^_]UWVS$æ M9EU E;E sjEE9 .t&9tQuUD$ ED$}|$ $Mp6}9} MUu1$[^_]Åt#UD$MD$<$&4MU눁 $[^_]ÉT$$0Mt$[^_]UWVS(諧d EE] ;M sc]]9slE v9t:uU)É]D$ E܉D$L$ME$]G5u?FM9M Uu]1([^_]ËE ([^_]ø([^_]fffUWVSͦ EU EpLB< D ?ZU )ىL$D$$]f}U fz|rrE Xft1ۍLZu.&0f9sfuf09uut^JLB)wqft& F]t&Ff9sf9ufjE1[^_]ÉU MGD$E$]jMU ̉EU ]썋,L$ [L$D$,< $]EU QEU ]썋,L$ [L$D$,< ${]EU U E]썋L$ [L$D$bT< $=]U EUWVS轤r D$T$$tV@D$T$U4$NjUuD$T$$%[^_]D$T$$o%UWVS 2 }EpFtD$D$$.%Ft:ta [^_]F(t⋆u0 [^_]ËE t9ruF$Pun$ 1UWVSDm" }wFtD$D$$l$F}  8GuD$4$D$ D$D$$@ F$EEEЉE܋G!D$ MԉM̉L$M܉MȉL$<$Ѕt"ND$ ẺD$EȉD$<$Wu.E؉D$EԉD$$G ;EtD[^_]ËMN$tD$ D$D$$D?Љ!ƒtL$D$$*u 1D[^_]ÍUED$ MԉM̉L$M܉MȉL$<$Ѕ[EE$D$ ẺD$EȉD$<$W/EԉEE؉ED$EĉD$$ ‹E؃9tD$<$]D[^_]UWVSó u~GtD$D$$!GD$4$C uUEu@t*$+u*4${^tME[^_]Ë$ tE͋D$$E EUWVŞ uM Ut'}8BEt^QLPDu`!@tHx9D$BUD$ $U]C1[^_]Ë]C鍆D$D$ ED$T$4$ul}D$$'M UtEdžU|$ $'tU#DfffffffffffffUWVS 荞F EE,E}1EED$ED$$]ƅ1@ @=fU1)t&.&.&.& 9M rTVÃf;EuUMUfY]][]]}t>}tNM0DF,D$t$$]EDFD$D$ljU]荃D$ [D$D$bT<$UU]ZE}E9}twu})D$D$$]9utAFD$FD$$]OtVTP‹}u뙋u]RZ}8 [^_]ËEpE )}fG w [^_]fUWVS$A uƉЉfMy} ~ϋX9U)ω\$D$M$]BEffEEԉEfueMfyvDTQ9.ED$E$E@EMUEHfEEf;Euf]fD M)Ɖu]U)؉EEt$L$E$]39E U5]f{vDTS9szED$E$E@EMUEHfEEf;9]tED$E$1MUEUԋMf9MsGfED$E D$}G D$|$ ED$ED$E$]uOEEtE@EEEt5@EEESxEE@ =}g}gČ[^_]fEEEE]ϯD$ \D$D$<$ <Mt !EEfEE:M]ίD$ [D$D$S<$;MdUWVS$0 Ɖ׉MBEF =uMQ)ЉEW UfyMȉE苆t$ED$$ Eu>E9G ED$E@GD$E$E$[^_]dž(Efuhdž $D$ |$UDBD$4$6B…t EME$EPEwD$ |$UDBD$4$A tʋ@f8 $dž ?UWVS,苁@ uE xEFEEEE@E%TGփBVuM ‹u9sfU܋u9M ELf+M܉ΉT$U؋ED$$:UU)UEftfDuf)tGfLGM yIDGƃ=VuJҋu9sM DG)fET$U܋UT$7$U)UUPMf WfЍL)΁M wdftGuftGfWL$E$E(DEfEfDU܍,D$ @\D$D$y=$7M UaM ,D$ @\D$D$=$7M VuM DOƃ=Fu ,u䍳@\uDG)fET$UUT$7$%U)UUPMf WfЍL)΁ftGMfLGWMfE HDGƃ=FUtZ‹u9sыu96E9p*JE9pEfDJ,[^_]1,[^_]fE D$E${E tˋxMUED$ E܉D$D$=$5UED$ E܉D$D$=$5,D$ @\D$D$=$5D$ @\D$D$e=$h5E@E,D$ @\D$D$k=$05ޯD$ @\D$D$b=$4FE!UWVSx|1 EE @u E1OftsDPND$ t$D$E$]D<ƅt|$E$FX}ufYf|Pu E덋] []1] CEfE@ =T)Ӊ]ыM]f\QMfDQE Ht$E$]t9t|$E$Eh81[^_]DPfCfCFW[^_]ÍD)‰UwMUfTAa]썃,D$ 0\D$D$=$(3E@ M]f\Q=맃1fM1UWVS}z2 U EzMq uf+4GMM9U t$ED$DM$u)uD$ U T$MDD$E$9…t|xEp uf+w;udLf|Go‹E9u-t$ED$WU$lUu Ѓ[^_]úЃ[^_]úЃ[^_]úUWVSCy Eu} 'D$ D$DJD$4$]#9tDPfzuft,ˍ< fED$ ED$GD$4$\u=}} t5 D$E D$ |$D$4$([^_]É~$F(~$E 8EE 8~9럋$UYEZUUT$L$$H#T$ $%GE$?]]fff]D$ \D$D$$4$ USkrs }xsn]f$ZUPKFAfff]2].t&%].&fffUVS(kr EEEEjuVjZ uǃ Q8tj'jj%jVjj'j>'UWVSEE] }3t>u j/VrZYtp@ &t0MPVZYMu}] EEAe[^_]Vhp"hUp"h*.裖UWVS]u 6_ht"VSX tful73.ۋ=p#.)u,3.u%ht"EFZt3.3.t"t"hjP3. @u53.ht"j/hٖjXu4'ht"j/MUW6ZYMtUBk #&u6ht"j(/VKSW(#&PiUWVS] 3hq#j,hq#Su@ @t hx"p#.DP<5.Zu5.x$15.5. %&55. %&jjP5. y 55.4.4.M=0p-v5.u hx"jE.4.u#4.4.x"4. %&4. %&(4.HthRPm4. yQ4.P(4.HthP54.ң4. 4. y54.h&$j-4.84.f(4.u/4.u4.Hӣã4.uj4.D5 4.4.94.$4.s薣ã4.tá4.4.t4.4.=5.u = 5.tӪ=4.u =4.t趫(4.%h=`u; 4. 4.4.4.4.%4.RP54.4.P (4.t hx"jh4.4]hj`!h#jT!1=4.=4.= 4.4.h[0p-P0p-5(4.04.44.ut H4.L4. @4.D4.9щss 4.4. u154.54.55.5.P$lj uu154.54.N5. rPPh&$yBQY[5.u9j54.54.55.5.P ut55.h&$2BXZ*4.4.4.4.4.4.4.^4.E4.E܉}E4.4.EUE9Eu:E9u3 4.4.EUEU4.4.@4.D4.L*4.tM]܋EU EUEU 4.4.4.4.H4.L4.(4.t14.4.4.4.j(1=4.=4.XsG4.4.EU1҅uth4.l4.EU4.uRRܣ 4.4.84.u84.=%u=u=u!*4.t=4. 4.9ȋ4.4.s")1=4.󪡸4.4.4.4.=4.u =4.t j'[` 5.5$5.utL 4.1=4.󪡸4.4.4.4. 4. 4.)։ 5.5$5.uu=4.uj4.PY@uB 8thx"54.4.PZ@u hk#jb(jUWVSX ] 3hq#jD h|"SuU G-$L%&|5.1l5.H5.x5.t5.1l5.H5.@p5.z<5.l5.1=H5.Yh5.J15l5.H5.3d5.$`5.1ɉ l5.H5.\5.X5.T5.P5.L5.=D5.th?|"=l7tu hd|"j&1nuou85.j,PiYZFt@jVD5.^Zu ht|"X8pj,W5ZYt x>1>Ph|"h*.jQp5.T5.=t5.t t7h|"Bt h5.t+h}",t=h5.thG}"\5.p#.jW@5.ZYu hn}"|;R=d5.u6=D5.u-=|5.t$=X5.jWj[^11ɉ=|5.u >=d5.t =Cɮi ȉ=X5.Xx*7.tPh&$Y[h*.gXy"=9.th9.hn#h*. uY=8.=8.h*.h"HZYh"1ۉ$Z.f%L*.18.냋9.| thr"yXf%L*.^19.zx$7.PRR tt t6j1ɉ 8.h*.h"h"1$d=9.ujpj Zuh9.57.h"h*.Gh9.hn#h*.. h*.h" Y[jZf=9.ujh9.57.h"h*.UWVSXu} 7 h"{2YZu" ful7h"WV- utt p#.)NvKE8}WZE1)& tAB9EsEUPQMW UuMt6QWh"jVփ빅u Whق"AE@t1j URP7E ;F|E8tEph"jE1~PS?YXF=mw2=m=m@w=m@r=m8@=mF dUuFfEERhmW* UWEffEERhm+fEEERhmW 1!EPhm8@Wˍ x E`)&6Shf5#j"f9tfuPh"EPsh"KUE"K U8" Wuuuuuh<"調$uuuuuh\"莿uhz"聿 uh"qXZQURPW x%uSh"M ,URPW̌ ySh&$j0Phă"jjEUWVShu E1E1ۃ}~F8-tEhԄ"7/_th"PZYu :.h" /_th"PZYu h" Xjh"h"Jv(EP膿uh"\0胃E_t<1ɉMMMMMMBh "d(( l7Mt&t"QuZYth+"jEhQ"WE)PE @}w}c}6t^%}4E뷋Edwy$,&}8tEKv_l7Eh'"5l7EXZnEbEVp#.p#.}uCp#.Eu4>tj@uY[t}u U9sUPUxtă}uEE1ۋtPZ\tS\XzEt'U)RPSS#SÃ~t C}u"h'"hY%LEZYu ha"K}uEEuh:.WuuEpEP4u yj=:.y h|"}tLjuVjhSWy h",XjVjh5:.Wy h",Xh'"LjuVjpSWjVjw5:.wW,uL&1ɉM̉MЉMԉM_1X,&H>v   DGu΍EPEPjZ =:.t}t.D1}tEjEP4X,& Gu觡Ey hk1#jVh~f5:.Vh~fSUSME}u j u#XZj记UE 0Qj蕰UVSEU nJ P.uc1E1ۋ4h.&Vh#!uUz*.H*.Y^yh*.j XZ*.P*. Cu z1e[^]ÍL$qUWVSQpq14u.8u.@u.Du.Lu.Xu.0u.Tu.Hu.,u.DžDžDž1h<"Vj @I&/0$.&S'$.&1=q-q-q-rq-c,u.jP5l7ל :uy5l7h"/q-0u. u.Du.Xu.@u.h@P.h"-q-@P.-jPR诱q- u5q-hf#P$[^ =u.tRPZY@u5q-h"E̋UЉ1ۅuthRP5q-h "`M̋]Љȉډ%1 w.12vxu.w.tu.w.w.pu.w.nhw.hrdAPa @uX5q-h?"i#hw.hedA5q-6@u-5q-hQ">#^_5q-Sq-[ w.1ۉ u.u.=w.=u.w.u.w.q-w.u.?w=xu.tu.pu.!ȉډ-u hu.lu.\u.tJthVPq- @u=5\u.h&$c"5q-zq- q-q-jq-~SPT.Yu Sh`"j u.11xt 9t.1u.u.`t.Ί4u.t#(u.xu.$u.tu. u.pu.DžDžjjVjjSdDT.Zu hN"j# jjVPjSy5DT.1DT.Xq-j/SL^_ޅtpt}Cr<l7?CrxC,r mC1%r0B`5l7cT~CX1p#.;E}?M ~ P2.DJt#@p#. ~w=F(~uF1(~C1 CDž}r<l7>Cr<<l7>Cr< 1ɉ<@j2 h"Vh"jhr ~e:=.r jhn"!r ~>XZJ  ~<~$[^~}Ij裑Y1uhLx#j9~!vu0+/hsx#VSj u%/~k |Љ=x+/vh`x#TXZšp#.)KutmP2.DPu^S_=vhhx#hSh@*/v ;tC+/@*/5x+/hx#j ]S>fhjqhjehjYhjM SA^u h{v#j@uhv#jh*.0hx#{ u -+/Vhx#L[=l+/t"5\-CKYt5\-hx#j#t Phx#j=l+/u5\-KZu€=@+/t8jj5,/ke y hx#3Pj5,/Ie xh -/j`-/ -/ `-/%l-/%`-/%d-/f-/,/ f~-/x-/Gh,/h,/h,/zhjƴ?x#=t,/t3x#Ph&$ezL,/^_L?f=\-t j'[FÈE8-utJÈE͋t,/u t{8,-u1f=--< t< u=jEP5,/J f=-yq#} u1#P5s]tu8̧-u 0FÈE5-PGZYf=-tCۡP2.t H2.fEjEP5,/pI f=-EP|cXLhKo#jKUWVS E 0L//W1//t0/h}#\^_t }#$Z 1/ }#h!}#2[tT 1/MBugl78tpjRPG :uS1ҋ //buV0/0/ //hZ~#u u蛛à uC$ &5l7h9}#1/1/먃 //륃 //뜃 //듺S}#l75Y낃 //vl7u)hV}#hĚ&h0W //he}#S+mZYÀ;+hi}#S^_ƿ&t&VRS6! u <2t&hB%SZYSPhl}#N // G//O3u<=fRh}# <=tRh}#N_X\3hB%SeY^Ɖtt t.iSȢZS&^h#HjPSE‹ 3 9r(<,tuxG //QRh}#SV7h}#MU5l7uh~#h&hKh|#腬1k$@1/t!VPZYu@1///kGh#~#Vh&~#^MjVl7hL~#h&hq둃 //'=p#.u)// uuV~=//u,P?Y@u hl~#jN|~#qV////Z!Ãt~&t%Ft!á//0Rh~#L  s//0h~#hLXZ s//0h~#OL_Xt Sh~#:L[^jҀ uh#tth7#LjUE uC0/3hRNMǃ u R3hf5#kPhP~k u////t #1 %1/hRPC]// uW5//hm#jθh//PHZY@u5//h#//t&h//P_ua//05//h#jT@1/=0/t://8th//P¡//Yu$݃8u5//h#j =//uh#hԚ&h0hjsW\t0/ u sh #hx0/Pb_Z@u sh*#0/%=tE//Bt,=@t shK#\5t0/\t0/Y shv#7Cp0///5//h#I]//_Ztpp 0h#,] //uB0/%q#=@u|#|#up0/u|#RPh#\ 0/t Ph#\Y[////th//P Z|#8th//P_|##Nu@u h#jXh//P^f#u Rh>#(//%=u5//Z[@u5//h\#@X5//^[Y@u 5//h{#t0/tP=[Z@u5p0/h#jjRUWVS}u 1ۃ~^;-tp#.114<Dž8h#VWɓ 1҃i!8-t+:t!;B tBu l7BPr5σitot8DuFDž4뉅u l7zSh$hˌ#G bDž<Su]dx1jSVGqCtjjj ǃuh%VhiP蓋 @u h#j茴WYY-7tvFtjNt^HuT`ItBQ]Z.0QXɋ0u h#j`돃넃<t^8td4t;ajOUWVS$u] 3Ahq#j} h#SVɑ Btb$&jj5l75/5/5/5/5/5/5/s5/d5/U5/5/vBeR0G.f"$l&H $&a5/5/5/G5/15/5/a5/15/ 5/?5/15/15/"5/5/15/5/1=5/5/5/5/5/p#.)Ӄj5/=5/t*th#5/ 5/ 5/tihӒ#jt:Dž|=5/u Dž|=5/t=||)Dž|=5/tDž| Dž|4̹5/j@5/P5Cx<hSh-W=v Sh#h-舐Y--X/u!-= -vx/uP-@ߣ-1h1j'XZ=5/t Ph- Ph- ZY@u轠8t%E%=@tkxtHZxM=5/P6 Y_@%=@t&/h-h)#jUDžx0Džx=5/u1=5/x/lt$P;ZPvЀ8/uj|Vрt 1pluv6h&$jlQh- ^Zh-ċCHfuFs uPshf5#:lDžplt:Zu)wfush?#9Y[ftf tx)-C,--=~TSh-h\#9 o{DsC(huTxtClj/V YZlt)xlh3#>P贏YZlhl>h)8/t z/t/Bс-vPh-h~#8 VPRlѽl- -= -vx/uP-@ߋl=5/xt Ph-l Ph- ^ZSP@xJ9|uD;u@EJ9Mu5;B u0sh-h#8CP@% =@B%=@t,M1@ush-hœ#1Jl΁@w `||t {DPS^cZY+=5/(h-sh1"J sH 5/ 5/u&fNush#6Y^jSt{fuV55/V5/6/Mh#h&h6kE%=@V軛Bfuk=5/u%5/H5/6/y/hA#hܝ&h?jRX[ZY+h,#CPph-EL^XshL#6Y[=5/t'PRc=5/tPRbPS6\{8t h#j#tp6?1x=5/t5/ 5/(P6b#x:DžxxUWVS|]u >j/WYZtxh&W蔋_Zu^hq#VS誀 @uip#.)Ãu]p0sIZY@u jjPje;LtEPtIFu'E%=@t {"st/$tSUG^Z@uStSZYy7h&$荵[^DžlOt?t7GZY@)l_:UWVSu] 3+hq#jh h^#SV/| tUit)ft5huTF0σvuCF01F0F01=F0F0뗡p#.)ƉlN4jlF0h jb =F0tluˋV=P+l|tP7=pY[uË|%=@uh7R輩à =v7hc#j輜htx/tlhƄ/C[9t H@>8/tj/WZYtPRd虃Y dv1Whc#.XZDžplt5>W]ZD@PRhx1 p pI8UWVS@] 3)0*.Su]Sjt0uEUEUSj^_SjO0ZYuEUEUSjŬ^_Sj+0ZYuEUEUSj衬_XSj0Y^uEUEUSj}XZh #豱001=0=0=00P]1E؍}ȹE uVSjđxVSj贑 x"}ujVj蛑 y}tVSj耑 xjVjm y}tVSjR xjVj? y{}tVSj' xjVj yP}tEVSj y1jVj yVSjА x+y y跑h#0j, ^=-tUjhv%+>-[^y |h5#0j+0 #=-u=x-t 豣@h"دYt8u`~"VqZÅt @|/tCPV0_uh[#j_*0ZYtlj؍P0/hG0Kh) j- t! ttBGuBĬ@豥9=G0t h#j还=-u-L֣t 00e[^_]UWVS]u 6@&hq#jfb 1h$VSwv tLtPt9p#.t*h#e_8/u|h#P:Y^ukh#S)_ZuZPSY^@tHxPhv%_Z@t2|9u;xuM9 u;EtjjjY^uj SKh*.\XZ*.@t hx"jHjj3UWVS}] 3%hq#j'a 1h#SW8u ft]/WPtwR)d0벃vtbit6rtxu{0010p100Z0K0<0-p#.9=0 )zu8Quth# (Xt0؋Ht ʉA?j|d0[0 0u t1=0t =0t@jPWmǃ uh>#C =0t.u)WrXCHHf $P&PDs bPshf5#jd=0tC ƒ?uts aPshf5#&0k=0^KPSC#'HjSW2wC 1ɉK +{uD{ u>=0tCHSft\wlfucKPSC&usZ=0u&sh&$蠪0Y[Rk9%8X=0usZuKC1'tl=0t8Uي8?Gˊ8r40 0#10s5GX蒊8t h#j˒W7o[\xVS7¡0YYu3t>j_PShf5#%0_uEE%=@u"=0uShN#$0Y[뱃=0u=uE%=uS82ډ%uv=@uS=0u S~ZtX'&t?=0uSh&$迨gX8J8? <8u=0SEX50-1e[^_]UVS@jj*^X1EĉEȉEEjEPjQ4  E9u 9EE 0j j5Y[(0H (0j $0$q#jZZYh#V-1ۉ]$h@0^Z0tt3Hu:0.%|0x010E H000t.U=-v=x0i`[=0tEPX100tA:-HyPs:X-H J hз- :XGEHm0@0@|0x0tZ_BEPXu u:XZu uFY[}um=-t,Eh#^E= 0u PEuE=-u}rEj^=-'7= 0uEhH#IH[u&jh#PjÃPT$Y|=V-uL= 0uCEP$#GZu EP\X8tEP5$XE11ۀ=n-t$=0uEPX0n-u'j4&-^XC̈́RPCNZY=n-=04-1506h/#f9$з-7XUWVSpE 0Ahq#jgW1ۉ]t#. 1p#.] ;E9hs#W=ZYEW%t_9Euphy#Su9k tZftatDeuI렃gu=j5l7(1EZYz5l7h&$j贌^p#.E ]Su8\ZYy h#yEPhBt @ugc y h#tX}Whht@uDc y h#QXEPht@u!c y h#.Xt$FvE 8uVEPuWStSyk^1ɉMME 8URu V#qYZURViYZuURVr^ZuoE 0P2.DPt"VV\PS=VSp=E9jh#Vs uVSDkEZYVh#2|E E}tSju臹 y h2#j}t Whgtua y h#Xj&UWVSu 6hq#jT1 xo111ɉhdtlp11ۉ`jh-hV#Vu^`Rtf(LtntMH1һ뮃PthtPdtXfuuDžl뇃vudDžds=l7hDžpYMDžt@Džh1p#.M)tIu uzpt$t*tt h_#j; t)ˍ411>=1tzj:WDYZt@0j.W@YZ`t!h1W_Z@`u Bz>t0<#u< %z1h1WZY@u ۉ]z8xPWZY@u Whn#j肈=1tE1E1jSV'aǃ tl`1h#>pu jSWHk WeX CHHf wg$ؿ&s ZUPshf5#rDžl=s 0UPshf5#HttDžl Džl1ht)KPt9Qu1t;Au A<51RslЃ t"`tsh&$EY[ds_;Z~8t h#jV#UWVSu #!fT(1h(1 P(1 ʈP(1d(1e!P(1 ʈP(1`(1Q(1%$1fV(1\(1h}#譜[tyh#虜Y&t7GtPS/oYZu IySh #Wh#jօ1hz#Vud A6$`&(13(1|(1(1 x(1(1ˋ=l7h;#WqnYZuh*#WYnYZ<lx댡l7xj j5l7gǃ u|8"u 5l7h-#D=d(1Ej j5l7,ǃ t =h(1!|8"u5l7hF#j跄j j5l7ǃ uO|8"t=$15l7h_#뺸l5l7TZ@_Pt(1`(11`(1y(1jp(1_t9t z $1v jh#uh# \(1tt h#jv 1P(1ǃ;=`(1u/;d(1u"T(1;h(1uQ(19rt1= -(1(1  -=t(1tPu=|(1tp#.U)…4=x(1tt  1Ljhh@$1PQ1PLy h@$1v=(1uJLxPPQZYLu&%=u(1(1w($<&J$|(1P҂JP聎h"@^u`~"h#Ph,y%hSp&S脭ǃuSh&$轘Y[h"PBXZthW)h@$1h(1V蟟5(1h(1V VFX1\`dDžXhVXPj\$ Džy0x8#tjVj:$hk1#j#I_jVj$ِP#'辐P蘑h@#ƃu#SVhR%TP4Tu h "jjPhN#h%h%~ÃuVJYSxTPZ9ujVjg#TH h!1#V*LY_uVh&$XZ(1e׋H󫋅LLDXtP-Džu VI[gh #%h*.DD*.HD*.ZYyh@*.$FX@*.P@*.0t- t( D*.y h@*.E_@*.P@*.΃߃NP貪^ JP聋=,)1u ,)1 =0)1u 0)1 Ph(1贘Y[J(1l(1P(=l(1X=(1t (1lv,h@$1h(1h*.萜5(1h(1h*.Ԡh(1xZxd-h!1#v([_uvh&$jLM1JPhmdP h#j}^~W~Yu Wh#{(1eȺ(1t jSR9 h(1wZIP越WZUWVSjj]Sjjh&G@u hI#j}u:YtjjSPjh&jG@t͋EE11һ9}~T >tItt9Ӆu5U1ۃ jj@QMQBMQh&${"U1G맅u) *.yh*.j )XZ*.P*. 1e[^_]UWVS ƅ]-ƅ_1ۉH*1L*1H*115P*1T*1P*11=@*1D*1@*11h#u uZ ycPtJTtgxPl$& 0+1뫃 0+1q 0+1 e 0+1Y 0+1M5l7)L8+1Ye5l7>Vj:V 7[Zuh#SHP*1t)XV3dZYXu C[ӉP*1=H*1t h?|"jzl7tuhd|"1Ҁnuxouܸ-hB%P^_tq#H*1v֋=l7u 0+1iq#l7@*1HOph@&Ph#h*.#j?^]4+1U0+1t 0+1t 8+1p#.M Tu)tP1ۉXh'U hS 58+1P肨XRrRh#RLxbZYTLS蓥jjLRPV9X}XTPT0VhP à uj/S'ZYuSh"hp%hS{V_Xu"V_Xu9S_^ty2LhVz à LVh&$juh"LR\aZYhZ#LRAaZYSh#jjhVjSo&ǃu Vh(#jwh`*1hzd@PN uWX+1`PhedAWN @uVh9#WV^H__9~VhW#(KE XB1 6Pjhjjj j5l7>B1 5l7hl%o<1DiIuWJƀ`<1z{k Lmm _$h&-L̽-B-6-*`- -ƅ--=p#.=<1uu =B1t_;jmK^+=<1=<1=<1uu =B1tjLQKY<1t B1t t Dž PPtVSE PE)PitDžuh&hK$PV|j @u hP$_t*HkttWP9XZuh&hP$GSWS;YXuVnZ@u h&hE$S9Yuh&hF$jiV3JZuh&hP$ji@ uhP$h&h*WSй%1󫍅PhP$SKuhN$S_Xuzkhf$SZYuh&h&hqP ƍH_v󤍅PhiS{p @uhP$YShc$WBZYu%F\u vhc$WhPIƒ NFjjLWv XP j\P4^_1u?ho$jXi T\P$ZYu \蓏F9|1hSWNej/WƚtPRT~?YTD9HH\PhedAWA/ @uWu_&WdS.?DZYax9}(ZYutI1Gjjjjjl7#贸L-qjjhjhl70Shq$jdW}j0PV y Vhc$jXFWP/ZYu1jZVP. uhFm$Pr/ZYjPS" u hw#j Z9iu R~PVhq$jEhq$j E&UWVSt]I11h{$u S# @{Z2CDq$` 'Dž맋bL$ 'jP5l7af- :uPfXPh={$I1=I13I1$jjjjjl7#|-Vjjhjhl7*ZYtVRW.*ZYuShJ1ho$ 늍`PPjhJ1&@uhJ1h'>=I1uI1u ho$j{@tX uuhJ1ho$u.h b%Pg)^_J1th"Wh 'j@J1t(I11RP5I15I1I1I1I15I119|z<@u t#I11RPj؉ I1I119| ho$t0 I1I19sSQWRPho$j?tOtF I1 I1I1%I1RP @u5I15I1Wh:p$j>*0P)Y[@uWhUp$UXZ  I1 I1I1%I1=I1~SWhp$!19Ћ}N9}PV u hp$j=)VZ I15I1I1I1I1u_t I1Z@19}I1 19|I1=I1I1t1RPI1iދ1SQRPx@19}! 19} I1WZ9ttVrXj^ I1 I1 L$qUWVSQ\yDžxƅwjjj軧,X3 yh$Cjjj蝧(X3 xjPZY@u hÄ$RXKPnL^@u h܄$j;7[Y1ۉd`1h$W\ [C4$'&1=W3=W3=W3=W3=W3=W3=W3W3E EĀ1EEEEjEPj'(h j%XZ19\V2~h V2j;CY^hV2j%V2XZٞzt,-V2݅(=V2ݝ01HLd-&ݝH104h V2j較^_݅0zt - V2݅(=V2ܭ0ݝH`V29XV2}{݅H؞vl V2U2-&s=`-t#贘tjVPh&$j}tVSh0#j} Džu/P_Z$t8=d`3tj jh0#'Wh~$=``3t j jh0#Wh$jg8j jh0# tVWh$j?Wh$j- hq#h!"h$jjhq#h!"h$ }u}jjjjjjjj jjjj jj;@u h$jjj ZY@u78th΍$=jX}uj_j jZY@u8t+h$F5Y2 u h$詰Z WOXVSh!$5 0Tjj|ƒ q#Bu^$SPhp%jUWVSDu]  'tc3h$'SV v~jm cStITtbLuc3뼃dw$'c3c3c3c3zpc3kc3\c3Mc3>p#.)ƍ蛈c3=c3tjjhW%c3 >Ejjj"sc3jURh@hPx^ @u hr%3Y=c3y h%j];u=c3! . WAZ) '    ms / =c3t1ɉڸ1ɉMhjhE؉EhjVE܉EhjDEȉEhj2EĉE hjEEhj ljEhjEMU ʃ} ʃ} у} хuu h8A#E1҉c38gtj5c3/_X1ɉMEq#Eq#FEȅCEċS:-%BRUZH3U$H'c3"0-c30-c30-c30- oc3dY|c3Jxc3;c30(  @uCEċSEP1ɸ uCEċSEP1ɸxuCEċSEP1ɸSuxCEċSEP1uXCEčM̋SEPmECEu$CEċSEP1ɸ:Xc3uCEčU؋CEusuċs t^0c3hw$']1R8c3F@c3:Hc3 .Pc3@"Xc3`c3 (c3 c3 |c3 xc3t  c3 $c3t1|c3jjV1s Rc3uM̍EPU EuM̍EPUR)YuChx&sK^Z=c3uh0$hE$h%觩 c3DHw*=c3uh]$hx$h%u 1ۉc3SEP1ɸ[Y]ċuc3Ã]uh$1];au uh$c3c3t]ȉ]thԒ$jHuąu}t }ċ]=c3uMEȉE 18E0 1҉`31atctguTE`3Eģ`3`3c3@c3`3c3`3`3 c3c3`3tyUU9sHxt)Јc3tKU؊B<w r7ED T 9sJU L }؍W9sIH `3c3tM}tHpVWh`34 =c3t =pc3t`3$c3tKMtHxWQMVߩ =c3t =pc3Mt$c3tKMtHxWQMV苩 =c3t =pc3Mt$Uc3tKMtHxWQMV7 =c3t =pc3Mt$c3tKMtHxWQMV =c3t =pc3Mt&$c3 tKMtHxWQMV菨 =c3t =pc3Mt3$Y`3f5`3=c3t!=pc3u=c3t&`3=tc3Vh`35c3谵 u( 87tz ~Phw$:Y^9~kPh$$XZuH 83u =c3tH3 8tc3 c3 c3 c3PSVW 11ɉډe[^_]Wge[^_]UWVS }Gh$PZYƅh"u W t.at"t=g3l7g3þ뼡p#.)Džt>upg3t&h#$S|^_th$SkZYt2=g3u)U g3ujOuSh$h*.蟹Sh$h*.菹j=$g3u.$g3h$u W t@A3w$'z=$g3u$g3먃=$g3u$g3듃=$g3u$g3{=$g3u$g3c=$g3z$g3 G g38 g3)g3 g3 =$g3"$g3@ g3g3g3g35l7`g3X=$g3$g3=$g3$g3j=g3l7g3hIc%P/Y^>g3/=$g3F$g35$g3)p#.EU)tHt:t#u =g3= g3t =g3=g3tEt h#$WoYZt&h$W^YZthIc%WM_ZE U @|7@tCƀ5g3jj5g35 g35g3 e5g3jj5g35 g35g3>5g3Sj ISh&$jF g3=g3jEPj @u h֙$#EUuuh$![h`RPh$讱t SYE  1SQ%1RPh$nf1=g3t:TTphc%VP_Zt)hR$V?ZYtuSh*$j ShU$ j3j,UWVS u] 1h\$SV tRtfu2Hk3ֿϡp#.9td1ۉ`"XVS:aZYVxPVsnZY%=`h=@uvu^Ph_$訜[^Dž`ddPhS FSh&$j 0hٺ^uٺLÅjhhy$hV*l=Hk3u Džp1$lPV胇ZY8t Vh$O ^X5Hk3SZY@Sh&$- `e[^_]UWVSdhq#jXZE 0跖1ɉ 3t%4CN%p%4TN%1ۉl%4$$^uټ$l%4747474P74L74\741ɉ 84 ,84 x7431ۉd%4`%4 84$847415-4-41=-4-4-4-41-4-43x%43h$Xt/hSh3^ =vj?$Sh$4b3h"Z-4u -4`~"h$_hy$PY^u P74h%Sj_Zu15P741ۉL74Qh$SGZYu x744hIc%S*^_uP74L74 Sh $FY[h3$P_ZuP7415L74h{$SY[u x74h8$Zt74t8u t74q#=x74tt748uhB$轘X1x74h%x_thNm#P[^1ۅfN*.ftP#Y84084*.f*.ftPZt!84ut ,841311Bh5l7h3* =v#j?$5l7hf5#j$x%4U Eh1$RPc SP̃D<$'x%41=L74=P74-4jP5l7! -t8{5l7h$ 374Y-4J1ɉ 74=j7X5l7ZG3=31741=745l7Td%4$#P)ZY084*.l7t%4P741L74j P5l7 74~8o5l7h$jz`%4Nj P5l7 -4~85l7h$뮋5l7j hF#W 5l7F_hB%P耉ZYt"8u5l7h$GujPW- @Xq74b1745l7XDž>1=84=,84+84,845l7RY35l7hؽ$3t7?u*.1Ph$荔XZ*.b5t7h$Ph$+jjj50849Ep#.)ЉEE E 1374T7474tq1x%4DžDžhh%4RjV$t& u0Pn~_PVhX$1ɉ 3 3hH#T^t8t P Z32uPXu;PJXt߃=3uF t8t P_36Y3=3uy3uh!%Z3ghPh3 =v&j?$53hv$ 3hhn$h3 =w=3tj $ h$P j hOd$Vp h$#X񸰨$Ǥh$ Xq#$諤hè$Xq#è$菤hΨ$Yq#Ψ$shڨ$_q#ڨ$Wh$Xp"@$;h$~X$_#h$bXq#$h$FXq#$VjXZhj耰Y^hjr_XhjdXZhjVY^hjH_XEt7U ESRP:gà 3uS}jj_XjeXE j:0[^t*E 0[YuU ERPeXZGjh74^_uhj蟯^_hj 葯XZE 8j@W蛹Y[ƅt @hPSR E @1ۉ74t1ɉ -4 74EQ@PNXZ74=74u u -4ujVWg =74t 1ۉ-471҉3Phľ$5084| 5-4Y=74\뿃jh74XZhj`Y[hj R^_եe[^_]UWVS}u hmq"PiZYtWhhq"SXZYthgq"SGZYutE4)~3ltXnuzh$VWE dupE4׃Vt1PσwB0-뾃cu3tE4lE4h'hn#h*.Djӗh'hn#h*.)ShV$h*.j託p#.9u!=pE4t#M1;u5hE4aUWVSu 6hq#j'1ɉ tt1Ij5E4h*.3 t hx"j5D`4UWVSP}1ɉMM1h$u W t3gt!utGu.l7El7;ul7E85p#.9t3SZt@E%UMM@uSh$j 1}1ɉM}t E E1}t6hB%EP~YZt"8tu h$jGDʋE 46: Z@u6h&$jhv%>Y@ttEPWl _Z@uh$}tuY@u h$jtuVZ@uh܄$FtVRPuvh&$jVh# Xu%jh$SSSh&$j%UWVS] P4144@4b%14hz£4a1X'lt2Ft&V =(4uRh(4%Y_ RvPL <44444h% Z1u"h*.hQ%jGDuG4h(S%SuI tsmtW~ԃptXrth*.hQ%zjft$Cuh4h4hQ%5l7-뚡l7\뎋5l7T4wt1HVOUWVS1 }~YE Xh%S^_uh%3[+h%SZYu!h<'ho%踑h% 01jDž`%@.DžDž$Dž DžDž1((,Dž\EEEEEjjُ @u1jjÏ[^@u jj諏ZY @uê1$ƅh=%u>% Rh?'Wu usV4M 6"?4uƅ뚃Nw$ :'ft,jz$D:'Dž%DžZl7`Jlկ5l7Tl^_'Àt ˀDž%DžhDž$Dž$Dž$hh%腝[ ƅDž%DžjDž(%DžQEp;5p#.t dS lHE tEpp#.U)‰} 0SjjjSǃu#h ;5p#.{u uPjS> t%huʅ h%o $h%QY;5p#.u;WS jjp#.} 4Skǃq u uPjS Y*0t@h͒%LHShڒ%ӛTPShC  h%诛D@St dh  t u @ 俀dh%@1҅~d%1҅uzuvtSZvZ0Sh!" uD#tD#tq#hv%PSh%j+0PKhq#hq#hq#h%j+0PdE9p#.u t1ht0P@X h!%7^@uh\;'h%RY[uh\;'h#%4 jj 0ShPjhd<'YP$@uh\;'h2% S28ƍ@Zv8VhH%sV軉t#8t h#`0P^-@~ Vhd%S , dh1ۅ Ӄdh1ۅu,u(PPp#.u 4贖 d%1҅u3u/ Qjp#.u 4n gPjjB @8th\;'hϓ%OXZg@uwd8Gh%HL8/>dh9 Ӄdh%1҅hh%G[^@u!8th%h\;'h% hh%JGZY@u!8th%h\;'h%e 0S87^t&uSh\;'h#%SPh8%Fh^%1蘢d%@1Yҍ0uF(Pjh0j@u hR%o,\(ZShj\ȿ@uh\;'h%zXZ@uh\;'hu%cnt$u/MPh% hk1#)Sh+h%eoh(\,蟆Shj\ @h\;'h%^Xh@S5[tPh\;'h% .Jdh% u =ue]d1ۅuLuH%1҅uu p#.u 1QP0P脑 @uh\;'h%dhӃ %uq#ӃDž%u Džq#%1҅uu p#.U %VPhd%m0SA@uh\;'hӔ%p1҉Ih[PU6ZY@u h%EXShjd@uh\;'h%^Xu/dh@1ۅuu dhVP0P1҅uHh\;'h%4P$Y[u64h%[^$P$9x uً4h%‹t x td@Ah uhE%V0P d%1҃ uuh_%Yt{ tjjM U胣XZ[ލV0SVS1d%@1҃utSuXt"{ t%S^ X[ڋdh@1ۅ1ۅut% t$y tIヽuc11ۅut@1ۅu2u. uh%Rk0Pz 0t,%@1҅ut0PhWVj:W0P}8[^ tWhYjjՋd%@1҅uu h%[u u0P֎ yh%4dhÁ@1Ydh0Phjje@+0Phj i@P$ZYy1h\;'h%[^j1ɉ$ 1Dž$d%1҅ҍ0uuSԌZ@uh\;'h%Y^PSXZt;t HptqrP PXRȠ1ɉ^WS _ZtPן^蚠菠S ~SmS;@.tPT[hӃ@tRt \tBhĕ%wh@Yu&j$RP| @uh\;'h%XZ:lٟh*.)ğ$ht(P1h\;'h%&h\;'h%e[^_]ÍL$qUWVSQ,Y1PT)51L)5108@<4h%S,> H0"$0Z'@J7%@J75l7fp)51Ɋtrat<GtD AtBCt.@Lt,Slt" ctgt#su,'" @fp)5F누0fp)5%1ɉLj LP5l7hbƉP 8u!l78tL8u ;Ph%kj LP5l7l7 ~:t L9t Rh#%)5 @J7@st=hC%jJ @J7jh*.b1|...XZ#l7@ @J7j LP5l7Q.l7 :t L9t Rhc%j@=Rhw%l7< @J7 8LP5l7Ol7_X:tL8t Rv)ݝ ^݅ t,j踣Ph%-&v Rh%EٽFfF fD٭D߽ ٭F $5|.=.߭ \-&٭D۝ ٭F .xy5l7h% uh%h.^ @J7[mt%h%j LP5l74l7 4x8tL:Ph#%'0%@J7 @J7 @J7 @J7 l75P2.tDFu h?%4B卅(R$R RRRRR RRRRRRRRPh $Q ƃH1Ʌ~ )1@J7hQ$zY1)5@9u919~)5Ph(#yGXZj x @J7t1DžtDžxDž|Dž:h(*7Vj5l7@QtPPPhh%(*7pH)7P)7PP @J7@Yj LP5l7B.l7 x:t L9t Rh%=hh%@J7% - @J7z@J7%@J7% @J7RLP5l7J)5XZL8u 5l7hօ$@LP5l7Jx)5^_L8u5l7h%p#.,)HtkE4BJ7j.V菍Y[Åu V豸Z)?wSVPƄ t@P2.t L2.fA۹1󫍅P){KjKPP{SVPv{PdP}$TVh %j Hd`hSVjS;X@J7t=. h%cXt1DžtDžxDž|Dž:h(*7RjV$NtPMPh&$j(*7HtΉ5)5pu hM%H *7p pp;)7 y h%GAJ7@t"5)7h)7P2 t h%@1DžDžDž:PtPj@5MtPLP@h`%j xtAJ7t h%aXppj0j)5)7t h%YOLXAJ7tVDžjSj'j)5)7t h%jSj(j)5)7t h%nPHcP=@J7^_Шu h% u0.1҃‰)50@s Dž@0 1ɉ )5.@茋,Zu h%Rtd)5)51)5)5Džd@J7@t8jdPjh5)7s@9s)5@Dž@=*7u(jPj j)5)7+@u h6%)70t/҉jRj*j)P@u7hJ%YDžjRj+j)P@u hg%,@J7%u) t DžDž j Sjj:5)7Py h%AJ7t-DžjSj&j)5)7t h%=.t188tb Vv_u h%Td)55h)51҃8t4P 1 C)C.C,ރ 9s11ۃ<t/8 ..., where is one of: %s: %s not compiled in chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodlnmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6usage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s %s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOIELEMinvalid unit number `%s'%s: too few arguments%s: too many arguments%s: CHIOSPICKER%s: CDIOCLOADUNLOADinvalid modifier `%s'invalid element type `%s'%s: inappropriate modifier `%s'%s: CHIOPOSITION%s: CHIOEXCHANGE%s: CHIOMOVE%s: CHIOGPICKERINEABEXENABACCESSEXCEPTIMPEXPFULL%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: status not available Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu /dev/ch0f:CHANGER%s: opencan't register cleanup functionunknown command: %sunloadinvinv1inv2voltags [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortslotportaloflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizeoutput block sizeinput block sizeblock countfile countunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiAvailiUsed %*s %*s %%iCap Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklMmNnPqt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %scannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp filedes_cipherbad hex digit in keybad binary digit in keydecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileEnter key: des_setkeyunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input filecannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionp:sxES ? interruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-f device] command [count] %s=%o%s=%x/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d %s: block location %u internal error: unknown request %ldWriteProtectMounted76543210asfbsfbsreomfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache [-u locuser]usage: %s [-46dn] [-l login] [-p port]%s [login@]host command pollRCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloctcponly super user can use the -u option468KLdel:np:u:wshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrport must be between 1 and %dbytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dusage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: needs_cleaning returned %d%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progress%s: clean_fs returned %d%s: shutdownnfss == 0/usr/src/libexec/lfs_cleanerd/lfs_cleanerd.cLFCNSEGWAITALLincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blockscoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost taildepth <= nbufs/usr/src/sbin/fsck_lfs/bufcache.c!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)bp->b_flags & B_BUSYSuperblock magic number (0x%lx) does not match any of the expected 0x%lx, 0x%lx, 0x%lx or 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) ix < ULFS_NIADDR/usr/include/ufs/lfs/lfs_accessors.hix < ULFS_NDADDRbc >= 0/usr/src/sbin/fsck_lfs/lfs.cNot enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x pseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%jx/%d sb0 %ju, sb1 %juAttempting to verify newer checkpoint...done.** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data No -b flag given, not attempting to verify checkpointPrimary superblock is no good, using first alternateFirst alternate superblock is no good, using primarylfs: ifile ino %d read %dlfs_balloc: bread bno %lldlfs: ifile read: cleanerinfo: error %d lfs_valloc: inuse inode %d on the free listUsage: %s device %s device command [arg [...]] Available commands: rw%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. successfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringdecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionreallocarrSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT header%s: bootcode too large%s: bootcode too small%s: invalid magicInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionPBR is not bootableNot bootable%s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedbootmenu%s: [%.*s] (space to clear)'%s' is longer than %d characters. The bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: Bootselector , infinite timeout, timeout %d secondsNo active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdB0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks? Geometries of known disks:Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. Boot selector configuration:Timeout value (0 to 3600 seconds, -1 => never)Select the default boot option. Options are: %d: The first active partition %d: Harddisk %d Default boot option We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tableusage: %s [-fqrw] [-s sector] device Invalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. and on-disk sector number (%s) incorrectly specifiedsector number (%s) out of rangefqrs:wget labelNo change; not updating disk label.Updating in-core %sdisk label. set labelNot updating disk label.Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS# %s: type: %u disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdusage: %s [-o options] special node getmntoptsmount table fullincorrect super blockspecified device does not match mounted device%s on %s: %suserquotagroupquotardonlyunionhiddensympermrumpautomountedgetargsrelatimerealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-bdins] [-N nsegs] [-o options] special node bdiN:no:s/libexec/lfs_cleanerd-b-d/var/run/%slfs_cleanerd:m:%s.pid%slfs_cleanerd:s:%s.pidusage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%xWARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too bigfs->lfs_hasolddirfmt == 0reclen > LFS_DIRHEADERSIZE(fs)spacelen > namlenspaceleft == 0/usr/src/sbin/newfs_lfs/make_lfs.csuper-block backups (for fsck -b #) at:%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version preadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld insane maxpartitions value %dinterleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit width%s `%s' is out of range.AB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:bit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume/dev/%sr%s%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Anblocks = %d, not %d %s: fragment is not last block%s: ulfs_bmaparray returned %d looking up lbn %lld%s: bread bno %lld%s: no clean segmentslfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_number/usr/src/sbin/fsck_lfs/segwrite.cfs->lfs_is64 == 0devvp is NULL!(bp->b_flags & B_INVAL)idx < lfs_fi_getnblocks(fs, fip)bp->b_flags & B_DELWRICould not allocate %zu bytesdaddr > 0unlock to 0 with no summarySeglock not heldunknown disk type `%s'DIOCGDINFO on %s failedsectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sCan't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytesabsentCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'%s: Unable to allocate table%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingBad number `%s'usage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev ioctl (%s) failedRAIDFRAME_GET_INFO%s is not a component of this deviceYesNohardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_GET_COMPONENT_LABELComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d RAIDFRAME_INIT_LABELSgettimeofday failed!?!?%02d: --:-- %3d%% |%s| ETA: %s %cRAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. RAIDFRAME_CHECK_PARITYREWRITE_STATUSParity Re-write is %d%% complete. Reconstruction status:Parity Re-write status:UNKNOWNdisremainstat failure on: %sinvalid device: %smirrorRAIDFRAME_CONFIGURERAIDFRAME_REWRITEPARITYBad last unit %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vUnable to open device file: %sRAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTUnable to create RAIDframe configuration structureRAIDFRAME_FAIL_DISKRAIDFRAME_SET_COMPONENT_LABELInitiating re-write of parity# raidctl config file for %s START array# numCol numSpareSTART disksSTART spare# WARNING: no optimal components; using %s START layout# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c START queuefifo %d Components:%20s: %s Spares:No spares.%s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYParity status: cleanParity status: DIRTYraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure RAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure RAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity %s: Parity Re-write complete RAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANoptimalreconstructingdist_sparedused_spare|/-\ForceSoft*invalid*usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list extract directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseto an alternate location with more disk space.or set environment variable TMPDIRTry making space in %s, %s %s bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer /dev/ttycannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? towards the first. with the last volume and work file(s) are on you should start Unless you know which volume yourYou have not read any tapes yet. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump coresymbolicwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). strdupwho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctl%13u usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable %s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable unable to allocate defect descriptorinvalid block number: %sunable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- : noneinvalid target: %sinvalid lun: %sSCBUSIODETACHSCBUSIOSCANSCIOCDEBUGSCIOCRESETSCBUSIORESETunable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. %8u %4u entire track defective%10u vpd%s: scsibus%d target %d lun %d <%s, %s, %s> VPD Serial:VPD Device IDs: proto%ubusunknown %s command: %st10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISASresetscantarget lun[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcachesetspeed[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#Diagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xParametersError in %s, Offset %d, bit %dError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:%s: Check Condition on CDB: %02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedWrite ProtectedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This TrackNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare Error%s: SCSI command timed out %s: device is busy %s: device had unknown status %x Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at poweroff/sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-zCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:tcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s %s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]%x:%llu(%d/%d/%d),%x %s: size mismatch %c%x0x%0*x0x%0*llx -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2xunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorLESSLESSSECUREVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDticmso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYts=tabstop=pcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARSLESSMETAESCAPE%c%s%c-clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifttildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileTag not found disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! timed out at eol chars transferred in can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdvcudiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x), Valid options are:=number=word=stringSupported machines are:usage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap mach != NULL/usr/src/usr.sbin/installboot/installboot.cInvalid machine `%s' from %s (directory)(none)(to be cleared)EditClear$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSInvalid block number `%s'-moption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'fstype != NULL-tInvalid file system type `%s' from %spaths != NULLb:B:cefm:no:t:u:vDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown typeparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s Secondary bootstrap: %s Please specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'params != NULL%s: bootstrap installation is not supported%s: bootstrap removal is not supported%s: bootstrap editing is not supportedalphasumioaddrkeymapresetvideosunsumbootconfboarddtbbb16 != NULL/usr/src/usr.sbin/installboot/sum.cOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x Boot options: timeout %d, flags %x, speed %d, ioaddr %x, keymap %s Patch area in stage1 bootstrap is too smallconsole %d console %s invalid console name, valid names are:/usr/src/usr.sbin/installboot/arch/i386.cparams->fsfd != -1params->filesystem != NULLReading `%s'Reading `%s': short readWriting `%s'Writing `%s': short write, %zd bytes (should be %zu)Invalid magic in existing bootstrapparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)Cannot enable writes to the label sectorWriting `%s': short write, %u bytesamd64i386com0kbdcom1kbdcom2kbdcom3kbdusage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCSWAVELAN[ %s ]SIOCGWAVELAN(wreq %04x)Transmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d string too longSIOCSIFFLAGSSIOCGIFFLAGSscanning ... AP Information No APs availableap[%d]: ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] Unknown[ Unknown ][ On ][ Off ][ %s ID: %d version: %d.%d ][ 0x%s is already specified to %sa:d:g:hi:m:or:s:A:M:R:DSIOCG80211NWIDbadly formatted addressLucentgeneric PRISM IISamsungD-LinkHost initiatedFirmware initiatedInquiry request from hostWEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: NIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: %s: not a regular filemalloc, using %zu bufferUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv%6d %6s Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx ls: %s: %s total %'llu total %llu humanize_numbertotal %s %'*llu %*llu ????????????????????????%s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too long-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%lu secs (%llu %s/sec)%llu bytesunknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sTar header field is too small for %sFile is too large for tar %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEGIDMTIMECHKSUMFile is too long for ustar %spathname too long: %scannot open %s: %spathname too long, line %d of %sFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryAlias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDUnable to determine new working directoryPeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sCannot determine current working directoryunexpected argumentUnable to find current directorystdout: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifiernull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode nul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes[%d] %c %ld RunningDone(%d) (core dumped)No current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d [%d] %ld lpZmore than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${LINENO${#LINENO${#${(((...)$(...)">|>>>&<&<> && || ! | if else fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %s+-Unknown option %c%carg for %co missingNETBSD_SHELLNetBSD shell: %s Bad -c optionOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionUsage: shift [n]Usage: rotate [n]can't rotate that manycan't shift that manyallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntil";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %sBad flag `%s'%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error '...'<<nonblockfsyncdsyncrsyncaltionosigpipecloexecEXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLequnknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'evalbgchdirletfalsefdflagsgetoptsfcinputrcprintfsetvarulimitumaskunaliaswordexpPPID20220122 BUILD:20251111151705Z SMALL REJECT_NULSincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s [-L] format [arg ...] Arg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: not completely convertedArg %d: %s: %sArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: %sArg %d: '%s' numeric value requiredformat "%s" too complex#-+ 0'%s: missing format character%s: invalid directiveprint failedoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeol2lnextreprintgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d illegal gfmt1 optionillegal gfmt1 option -- %s%lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqcs5cs6cs7cs8-parity-evenp-oddp-pass8-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... %s: invalid %s nameHLPRdfhvthe -L and -h options may not be specified together.DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %dusage:%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/vi%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipszaurus%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraAutomatically adjust partitions [%s]? Invalid answer# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition tablecan't get msgbufrq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%suntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDwrong type to dirscan %dNAME=%s NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** Alternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s can't take snapshot of %sEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) ADD '.' ENTRYREPLACE WITH '.'ADD '..' ENTRYREPLACE WITH '..'DUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x ** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKSINFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATE-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %d%.*s/%s%s/XXXXXXXXXX/dev/rfss%dDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %da:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootablebiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBR[-r]PriSecRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]%s: %lluCould not find index %dDetails for index %d: StartType: %s (%s) None (active)UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part GPT part %lsUnknown %#x[partition not found?] %*s index contents %*jx %*ju%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaxGPT not found, displaying data from MBR. %5dshow[-aglux] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedsifive-bblSiFive BBLUUID changedab:i:L:s:t:U:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]gpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.csector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile] [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] %s: getsockSIOCGIFAFLAG_IN6SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6 inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime %s: getifnameinet6 address lifetime not allowed for the AFeui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addresspltimeia6flaginet6IPv6 keywordsia6flagsanycastSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEnetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflag/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTR%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sifcapclonecmdNote: trailers are no longer sent, but always receivedSIOCSIFMETRICSIOCSIFMTU, %s byte%s[-L] [-m] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimeSIOCZIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s input: queue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecatedexec_matches%s: prop_dictionary_augment%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types? media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkmasterno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNELSIOCS80211hidessidsocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)IEEE80211_IOC_FRAGTHRESHOLDIEEE80211_IOC_RTSTHRESHOLD RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsCAPSS:NRATE%-*.*s %-17.17s %4s %4s %-7s %3s %4s %-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s> DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): dlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] %s: address resolved to multiple valuesassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dFlags%-*.*s %-*.*s %-6.6s Internet6InternetAppleTalkEncap Protocol Family %d: %-6.6s %u.%u.%u.%u/%dillegal prefixlen(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 swaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)PriorityCapacityDevice%-*s %*s %8s %8s %8s %s %-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvp%s: unknown mode. TYPE %s %sTYPE %sContinue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20251028NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandEPSVLPSVCan't create socket for data connectionwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cWriting to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Usage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpBad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular fileusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gz%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread commandbranch%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()works for regular filesin-place editing only%s: %s %s%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtvUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages%-35s %.50s2001:4860:4860::88442001:4860:4860::88888.8.4.48.8.8.8.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page downCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exit9600192003840057600115200BIOSrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/i386 11.99.3 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.3 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.3 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.3 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.3 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.99.3 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.99.3 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog11.99.3xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02X/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:ipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.statsnet.inet6.ip6.stats/sbin/route get -inet default/sbin/route get -inet6 defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/i386/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,nosuid,noexec,nodevmtime,nodev,noatime,async,noauto,log/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/i386/../../disks.cbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%sxbdmcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%s/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/i386/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/i386/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /EFI/boot/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootablemachdep.bootmethodUEFIOut of memory %d%d%d%d%d%u%uwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_bootsel/usr/mdec/mbr/usr/mdec/mbr_extCan't find %sgpt biosboot -b %llu %s/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdm/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstypeparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ---- %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/i386/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %u %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartmanlvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/i386/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errorparts->geo_sec != 0info->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: IAID conflicts with one assigned to %s%s: connected to Access Point: %sNOCARRIERPREINITEXPIRE6EXPIRESTOPPED%s: removing interfaceDUID %spid %d failed to exitdup2 %d%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leases%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z: [ip6] [ip4][manager]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET INET6 DHCPv6/etc/dhcpcd.confInterface options: ND options: DHCPv6 options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 starting%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duideloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %snd_dhcp6_unknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6vsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.clen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefix - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sSTATIC6ROUTERADVERTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIAS%s: if_addrflags6%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_send%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/var/db/dhcpcd/secret%s: cannot read secret%s: cannot write secret%s: IPv6 static DAD completedcannot find a loopback interface to reject via%s: deleting address %stemporary %s: adding %saddress %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u seconds%s_ip6_address=%s%s: waiting for %s to complete%s: pid %d deleted address %s%s: regen temp addr %s%s: too many duplicate temporary addresses%s: waiting for Router Advertisement DAD to complete%s: unable to obtain a stable private addressipv6_makestableprivate%s: Router Advertisement DAD completed%s: delaying Router Solicitation for LL address%s: sending Router Solicitation%s: no IPv6 Routers available%s: soliciting an IPv6 router%s: delaying IPv6 router solicitation for %0.1f seconds%s: impossible RA flag %x%s: %s: router expired%s: expired %s %s%s: expired route %s%s: part of a Router Advertisement expirednd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%sIPv6 ICMP packet too short from %sIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %s%s: delaying IPv6 Router Solicitation for LL addressreachable again%s: %s is %s%s: status truncatedUnknown Status (%d)%s: DHCPv6 REPLY: %s%s: server sent USEMULTICAST%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: %s: DHCPv6 REPLY missing IA Address%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %uTIMEOUT6%s: %s received from %sINFORM6BOUND6RENEW6REBIND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: %s: no valid lifetime%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: waiting for DHCPv6 DAD to completemulticastingunicastingdelaying%s: %s %s with xid 0x%02x%02x%02x%s%s%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f seconds%s: %s: sendmsg%s: sent %d times with no reply%s: ignoring unicast option as not manager%s: declining failed DHCPv6 addresses%s: DHCPv6 DAD completed%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: soliciting a DHCPv6 lease%s: requesting DHCPv6 information%s: no advertising IPv6 router wants DHCP%s: failed to request DHCPv6 information%s: failed to decline duplicated DHCPv6 addresses%s: failed to request DHCPv6 address%s: DHCPv6 lease expired%s: failed to confirm prior DHCPv6 address%05d %sDHCPv6 packet too short from %s%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %s%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: discarding ADVERTISEMENT from %s (%u)%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: ADV (no address) from %s (%u)%s: ADV %s from %s (%u)%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 lease%s: delaying DHCPv6 for LL addressSTOP6RELEASE6%s_dhcp6SuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix AvailableSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RECONFIGURE6-%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host ping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmapunknown qtype no address(TTL=infty)(TTL=%u)TTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> RefusedIPv6 address/etc/group/etc/master.passwd: (malloc) Error in munmap(): Z Pu___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumcntrlgraphpunctxdigit%s%s%s 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d snaparchivedsappendschangesimmutableuappenduchangeuimmutable ,N/Aappletalk%a:%p%a[%a]:%p%A:%P%A[%A]:%Plink#%hu%d:[%d,%d]pqrstuwxyzPQRST/dev/ptm%s%s.pidjanuarygmtmidnightyeara.m.p.m.noonmiddayutcwetbstwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdttomorrowyesterdaytodaylastthiseleventwelveagomonthfortnightweekfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdayfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshautoselect10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTEthernetTokenRingFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT.sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy stringCannot allocate %zu bytesCannot re-allocate %zu bytesCannot open `%s'Cannot format string%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sinitscrESCDELAYTABSIZEcsp != &blank^Gkbskcub1kcud1^M^Junknown error%s: generic terminal%s: hardcopy terminal%s.cdb$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number/usr/bin/rshRCMD_CMDCannot exec %sR%zu W%zu L%lld %d *0*1argon2idargon2iargon2dargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$$1$Argon2idArgon2iArgon2dOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesMemory allocation errorOutput pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureUnknown error codeacosacosfasinasinfatan2atan2fhypothypotfexpfy0y0fy1y1fynynflgammalgammaflogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error log2: SING error log2: DOMAIN error unknown header flags setincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthsinvalid code lengths setinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeatneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible versionstr != ((void *)0)fmt != ((void *)0)src != ((void *)0)0x%llxrpn == pn!((*cp) == '\0')?xml !DOCTYPE plist