'VmDߏi 503eNetBSD/earmv6hfeb ramdisk 08i 5<  i 5 rt ti 5@@<@T 08i 5<  i 5 rt ti 5@@<@T Ui 5t`Ai 5i 5i 5$ hi 5i 5i 5Ai 5i 5i 5fA.i 5i 5i 5HPXAi 5i 5i 5gAi 5i 5i 5_Ai 5i 5i 5gAi 5i 5i 5Ai 5i 5i 5Ai 5i 5i 5mD!i 5i 5i 5 (08@HPX`hpx$wi 5i 5i 5 (08@HPX`N$0i 5i 5i 5hpxK$/i 5i 5i 5M$Ji 5i 5i 5 (08@FAi 5i 5i 5Ci 5i 5i 5Ai 5i 5i 5Ai 5i 5i 5!i 5i 5i 5 ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5 ai 5i 5i 5 ai 5i 5i 5 ai 5i 5i 5 ai 5i 5i 5 ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5 ai 5i 5i 5 ai 5i 5i 5 ai 5i 5i 5 ai 5i 5i 5 ai 5i 5i 5ai 5i 5i 5 ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5!i 5i 5i 54!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5 !i 5i 5i 5 !i 5i 5i 5 !i 5i 5i 5 !i 5i 5i 5 !i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5 B!i 5i 5i 5 B!i 5i 5i 5!i 5i 5i 5"!i 5i 5i 5"!i 5i 5i 5"ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5 ai 5i 5i 5 ai 5i 5i 5 ai 5i 5i 5 ai 5i 5i 5 ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5 ai 5i 5i 5 ai 5i 5i 5 ai 5i 5i 5 ai 5i 5i 5 ai 5i 5i 5ai 5i 5i 5 ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5 !i 5i 5i 5 !i 5i 5i 5 !i 5i 5i 5 !i 5i 5i 5 !i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5 !i 5i 5i 5 !i 5i 5i 5 !i 5i 5i 5 !i 5i 5i 5 !i 5i 5i 5!i 5i 5i 5 !i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5 !i 5i 5i 5 !i 5i 5i 5 !i 5i 5i 5 !i 5i 5i 5 !i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5 !i 5i 5i 5 !i 5i 5i 5 !i 5i 5i 5 !i 5i 5i 5 !i 5i 5i 5!i 5i 5i 5 !i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5 !i 5i 5i 5!i 5i 5i 5 !i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5\?!i 5i 5i 5\>!i 5i 5i 5\=!i 5i 5i 5\<!i 5i 5i 5\;!i 5i 5i 5\:!i 5i 5i 5\9!i 5i 5i 5\8!i 5i 5i 5\?!i 5i 5i 5\>!i 5i 5i 5\=!i 5i 5i 5\<!i 5i 5i 5\;!i 5i 5i 5\:!i 5i 5i 5\9!i 5i 5i 5\8!i 5i 5i 5\:!i 5i 5i 5\7!i 5i 5i 5\6!i 5i 5i 5\5!i 5i 5i 5\4!i 5i 5i 5\3!i 5i 5i 5\2!i 5i 5i 5\1!i 5i 5i 5\0!i 5i 5i 5\7!i 5i 5i 5\6!i 5i 5i 5\5!i 5i 5i 5\4!i 5i 5i 5\3!i 5i 5i 5\2!i 5i 5i 5\1!i 5i 5i 5\0!i 5i 5i 5\2!i 5i 5i 5\/!i 5i 5i 5\.!i 5i 5i 5\-!i 5i 5i 5\,!i 5i 5i 5\+!i 5i 5i 5\*!i 5i 5i 5\)!i 5i 5i 5\(!i 5i 5i 5\/!i 5i 5i 5\.!i 5i 5i 5\-!i 5i 5i 5\,!i 5i 5i 5\+!i 5i 5i 5\*!i 5i 5i 5\)!i 5i 5i 5\(!i 5i 5i 5\*!i 5i 5i 5\'!i 5i 5i 5\&!i 5i 5i 5\%!i 5i 5i 5\$!i 5i 5i 5\#!i 5i 5i 5\"!i 5i 5i 5\!!i 5i 5i 5\ !i 5i 5i 5\'!i 5i 5i 5\&!i 5i 5i 5\%!i 5i 5i 5\$!i 5i 5i 5\#!i 5i 5i 5\"!i 5i 5i 5\!!i 5i 5i 5\ !i 5i 5i 5\"!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\ !i 5i 5i 5\ !i 5i 5i 5\ !i 5i 5i 5\ !i 5i 5i 5\ !i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\ !i 5i 5i 5\ !i 5i 5i 5\ !i 5i 5i 5\ !i 5i 5i 5\ !i 5i 5i 5\!i 5i 5i 5\ !i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5\!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5 !i 5i 5i 5 !i 5i 5i 5 !i 5i 5i 5 !i 5i 5i 5 !i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5 !i 5i 5i 5 !i 5i 5i 5 !i 5i 5i 5 !i 5i 5i 5 !i 5i 5i 5!i 5i 5i 5 !i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5 !i 5i 5i 5!i 5i 5i 5 !i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!$i 5i 5i 54!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5 !i 5i 5i 5 !i 5i 5i 5 !i 5i 5i 5 !i 5i 5i 5 !i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5ai 5i 5i 5ai 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5ai 5i 5i 5 ai 5i 5i 5ai 5i 5i 5 ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5\?ai 5i 5i 5\>ai 5i 5i 5\=ai 5i 5i 5\<ai 5i 5i 5\;ai 5i 5i 5\:ai 5i 5i 5\9ai 5i 5i 5\8ai 5i 5i 5\?ai 5i 5i 5\>ai 5i 5i 5\=ai 5i 5i 5\<ai 5i 5i 5\;ai 5i 5i 5\:ai 5i 5i 5\9ai 5i 5i 5\8ai 5i 5i 5\:ai 5i 5i 5\7ai 5i 5i 5\6ai 5i 5i 5\5ai 5i 5i 5\4ai 5i 5i 5\3ai 5i 5i 5\2ai 5i 5i 5\1ai 5i 5i 5\0ai 5i 5i 5\7ai 5i 5i 5\6ai 5i 5i 5\5ai 5i 5i 5\4ai 5i 5i 5\3ai 5i 5i 5\2ai 5i 5i 5\1ai 5i 5i 5\0ai 5i 5i 5\2ai 5i 5i 5\/ai 5i 5i 5\.ai 5i 5i 5\-ai 5i 5i 5\,ai 5i 5i 5\+ai 5i 5i 5\*ai 5i 5i 5\)ai 5i 5i 5\(ai 5i 5i 5\/ai 5i 5i 5\.ai 5i 5i 5\-ai 5i 5i 5\,ai 5i 5i 5\+ai 5i 5i 5\*ai 5i 5i 5\)ai 5i 5i 5\(ai 5i 5i 5\*ai 5i 5i 5\'ai 5i 5i 5\&ai 5i 5i 5\%ai 5i 5i 5\$ai 5i 5i 5\#ai 5i 5i 5\"ai 5i 5i 5\!ai 5i 5i 5\ ai 5i 5i 5\'ai 5i 5i 5\&ai 5i 5i 5\%ai 5i 5i 5\$ai 5i 5i 5\#ai 5i 5i 5\"ai 5i 5i 5\!ai 5i 5i 5\ ai 5i 5i 5\"ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ ai 5i 5i 5\ ai 5i 5i 5\ ai 5i 5i 5\ ai 5i 5i 5\ ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ ai 5i 5i 5\ ai 5i 5i 5\ ai 5i 5i 5\ ai 5i 5i 5\ ai 5i 5i 5\ai 5i 5i 5\ ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\ai 5i 5i 5\! i 5i 5i 5i!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5 ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5 ai 5i 5i 5 ai 5i 5i 5 ai 5i 5i 5 ai 5i 5i 5 ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5 ai 5i 5i 5 ai 5i 5i 5 ai 5i 5i 5 ai 5i 5i 5 ai 5i 5i 5ai 5i 5i 5 ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5!i 5i 5i 5!i 5i 5i 5ai 5i 5i 5ai 5i 5i 5!i 5i 5i 5!i 5i 5i 5!i 5i 5i 5 B!i 5i 5i 5 B!i 5i 5i 5!i 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5!i 5i 5i 5!i 5i 5i 5ai 5i 5i 5 ai 5i 5i 5ai 5i 5i 5 ai 5i 5i 5ai 5i 5i 5ai 5i 5i 5i 5i 5i 5bpf!i 5i 5i 5 $i 5i 5i 5`$i 5i 5i 5F$>i 5i 5i 5c$i 5i 5i 5h$si 5i 5i 5j$i 5i 5i 5pAi 5i 5i 5rm i 5i 5i 5xo$i 5i 5i 5s $i 5i 5i 5Ai 5i 5i 5Ai 5i 5i 5Ai 5i 5i 5Ai 5i 5i 5Ai 5i 5i 5Ai 5i 5i 5Ai 5i 5i 5Ai 5i 5i 5Ai 5i 5i 5Ai 5i 5i 50IX X[j~/r~nExKQ+3s/A}z 2ix‰^꥖EQ5j4yv @o,?>?i a`6:lMD$0>#&͇cz S6nu-@XS>+>#gE.~c_#8dV2L>yZTP"d7M<2:l)֩Mg,v wnC&k ov]0E4ɦm&kMD-!w_R6!:N-OFt9z]i9=7 7Zjm \db\4N#Ww*yaRPc2> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4!H4 ( f f!%7%7(LL!%7%7NetBSDGwJPaX NetBSDearmv6hfeb4p@-D0D 0@`Qp(@P`F`F&a03/T@p$U@$6A-`0`` 0PpU(pGpG@Pq`P03/T@0US o$T\@-lPQMK \!\1 P`0 0R0819  0S  /S 0Sy10S8 0p ZpG2 pG0@3'q1*03/T@Y p0pWH2H0@3(1*03/T@ ugd 0 P0 0$Tld$5@D$4%x@-l llkPd@P L ;y\`POU $P T@2N2Y&0 P@-@-O-`00R@,2tMt@0pWo  ]P@tt@( R @P p&0: S  `0SЍ@P0`0x; 0xS0S  _P0S S0p WiP  0S;00 0 pP 0s s0T TDP   PpW%&h33&:H0`  BR` pRp R>X Xp/%%@-a0 g4&0 000/& pC-؀-`P p0M@ {@ (@{{z`P$0  fЍp@Y& %X6&0@-@ M00@  AP  Ѝ7A-` l1V0zP 0 @P@TV PC  W@@7^a0S@ @0;0QP W 0XpuaV Vpla0-S XdHYp 4@0SV  W %X77& (7$O-5MpY xp `P` Ѝ  p` 0`$5XP0S 5%0 0 5X0S40S* D$尠D00CS0 @ Pp  @YT `0 @00CS0X0 X0 p>~00p _p@300 (h80: Sx h+Gp@ p  Qt X0 0( 03,$0000x 00 Q00S> 0 0 `xFp2  t4 0Z 1(#00 H  0P \\WP 4 `+X"J R0  p0ZZ3r0S P Y' p00 R0S ``0S 0 >(d P < `V k`0 ?oR20S 0  0 0R0P b`P hhZ`0S H,` P0Rt00!P & 8%Xh& & & $& & 4&070%)& 0& & ,7?&Q& D& H0@-MM@P  Hp  ;0U$C dP TTۍЍ08 cP ,(0P X7e%X7r7}& ,Q@-@ TsP DD,TP $ 0P@%X7r7& ,Q@-@ XTP HH0"P $ 0P@%X7r7& ,@-<_0 7&00$/'0$/'h@-8$@-8:@-8Q@-8g`Z@-0! 0  0 Ѝ8|'@-0! 0 p 0 Ѝ8'h@-0! 0 a 0 Ѝ8'@-0  0 R 0 Ѝ8'X@-0  0 C00 Ѝ^_'h'<00/@-0  0 -0 Ѝ'8'h<00/@-0  0 0 Ѝ'8'@-0! ,0  0T Ѝ8'`0 @- 00 $0Q@?Ѝ8%\< A-`M!A!qX0 p! R0B=0B  P0H 8 R8B 4!010,!0ЍPP =JN0P   0S  0 pP0P      0 3/R ! 7000<040LD0'h''=#99d'h89"95 9O90p@-@PP0 00R00 p800 p0  B0Sqs 'l''h0 0 0 /''h@- [ &h@-@- R $h@-@-80M@0(@3/P $ GH08 : S( 0h 3/P   00 0Ѝ00 0 1/pq]0S 00h@8m@-@APЍ@ PЍp@-(`Vp80@  03/PP8003/(Pp:@-@P`P 80 (0(3/@i] P c]PЍp'XO-2 PM`P(`,PB  0S9P06 I0S +%0 % 0 R,P0(`R0 *0 AC 000+ |tpx A0x ЍO0 P % pHp 81/pq4  |?P p 4 Tn\0S4 < p0 )0 )"MA)0 )'0 '0 %)0 VU)(0, SR '0 ''0 ''0 [X'y 00 0S04H0R004 4pX TЍ'XZ:'h:@h:R:vR/ R 0 0 /\\CC  B0R0012/P/  AA  AA  A A  A A  AA  AA  AA P AAC-hBM 0  P 0  4 $0 0!( Ÿ}/LB/DPN#b`0@ R%H }//@#b`_`SP0!!!! d 4 !P`4U4 ~" C\\ T!d44U4 k" C  !d4w4U4 X# C  d4d4U4 E? XU8<@p 0 :@d  dp@4F4rU4 'Ѝ'bM';H;0;I;\;sV@-@SC- A  `004P#"6P8P ( 1/pq$ 㬀pU Ѝ0S0C080 $0(3/P 0 `V`PE@0  Y $  'h'%\;@-TAM P!#"18 P (5/pq$ P; 0080 0( 3/PЍ80 $0(3/P`P4 00V0:0p080p0( p 3/p 4 00V0* ,0`/PRP `'hhm0P@-@ P M4Y Ѝ'pm&IO-؇M0@S M. 8S+ #='0|Y0S( 000| " ! l!x0`0# #|0 @& 4%ݍ Ѝ'|E 0 Y0 S 0E0VS06  S  S $0S0 600000S60 060 00 x6Rt.T R0r0C0C00Q0 0S, ,B< 6 B0`Pp V$  , (S$0P 000 00,0 0S $Z# 5%X(0S%0 %00   0 `5`,0S P5P%0 0H @rY,5$(X: ? X06* T 0S( T 0Sp` T 0 zS"0 0000 0@"<@ (0@ p`|<( xT6X㐧*p(0` ? X :$0c 0s'(00S. ,0S#$`0V   40S S S *FT 0 $S 0H9T;%" 8 |0圢s$ 0R`p(01  0$   w0   q"0 0000@ 0<"`hI1,0S 4 >>@-pPP`@@? SP Ѝ`3MU@>0p@-XP8@T`@D p SP<opQ<Pp'pA-AP 0 P 00$SQ ( 0$P }X h d `P, R2DaDqU`0``000P`X 00CS000 S   0,`0CS0000 (00=/U R 1X8 4D$0 00 $0 '&0@'mq'8@2T0 S 0SP/P/S/@- ' np@-XAXT0040S+@! PPP P`04 0PV R@40P 0PU4 ^*00" `0PEP P0P4  P U 4 P0CSR40PP 0 p''%\'H'8p@-pPG0`F [stlV0001PXT44 04,B00C0Cf 00CS010:uPU 0P1` 00CS0d0 P U Rt0V00PaT  00C0S"10 T00CS000 U0P 0@ 9T | V 0 00 0 @00S 0S YI'"0'$'&0mq'8'PAO-$RM`0000100010S u@0Աq`0#0P 00)<0J?oT20ST SRP }0S  RZ  @T  Z     0010S@@  0 .P000CS000 Ѝ S 0P  BR l  @0S Z0 0$'$'P'H'"0'L'&0A5'8AGA-0P!S`P@kS 0LpP0!S P OS 0HHH <00S ,$0@E&0AYAp'" A'LA-P@dp`T0S PS$  O'"0&0AO-`@ ؀P0S p0 T T R R u0pXP Ѝ PP P   P Pp@'"0'H'P'$A-p0`!SPAP@RL 0KY @Z PP0!S MP R- 0HH,H2 <00S , UpGPQE&0AA'" AO-@P b 00CS0_ p0@g mR  0`001 pTpP@0 pW2tQtTP0PP00PBR8 , 00CS010 5 t0P0CS000x0 S0 0 @ X 000 0 T0 `0U0$0T p 0 %'"4' A&0A''mq'8'P'",O-PpP0 SPEUP ЍE P 0C0 X2 Ub000NPQQ Q_ 00C0S 20  0 0CS0L200 P Z0 P CPE P 000S S ) `V% V000P sQx tp 00C00 0CS0@100 0WPX 0PFGP0 0Z CPF V'P尀VP0PP00彿P 2Qt pl 00C0m0 P0CS0<00jl00`6''$'&0mq'8' @G-P@`p P`T  0PSzP 0@^S00\P0S @\Z \@P X0 @P*0P00A%\A%3A@-T @000 <P 0S( 0C00S 0C0 Ѝ'8@th%\L0 R QQP0R/@- 2 '8 nG-P`P@ X 0S@ @0S @T@@DT opP 0S 0 0 PЍ'8BG-@P tp0SI`FPUP 0 @,P @P n'8X0000@-@ 40aA R    0/&B '840000 01h@- &'8B G-dRdr@`0 0S0 "3( 80?Y+Y# Y{00 R  % O _1@sO0"Ss @`` IQV ^Y0^Y-Yj @ 0@^Y-Y00@R(O0 0*1@s@O0"SR 0.Y@0 @R /Io@P0 R00R  h@PR 00;Y0 00 V@ T0S'8& 'B$ n0@-@00 00UP0 000 ,R;R 0S  S   0;SPp'8 p@-P@0QS@@R0p`V P0C'8p@-P.@P O, ($ p 00&0mqQ 0Q\S@-A /`@-0S*  0@000S! PDpP HPP @P  0 S</R/    N 0  '8QB8( Q 0@30/@-'800@- R 0C30'8A-ppQ1SPS a00S S P4!`0`00`0S0P S@P0.S0 S 0@00`P 00CS0#0 m W  _T0100CS00 3pP'8%G-AP pRpGWR0`0`02/` 001S 0100CS0H89  P00CS0' 0S   P 0Sp`0 0`0R00 00C0p00  %`p'8G-p0A0 SRXPBp0GB`pPPU,000P 00CS0'0  W  pP 0圑0CS00`PU*P`'8G-A 0`0P0^ P 00CS0-0 p& 0FSap ^1S  0PEP0Cp00100CS0'8O-HB`0pS41P UB!0SR0XPPP00奻PE 0Q0CS00LN!1  PP\00`F`0rP0   P*  0!0CS0P(P*SP; 0堑0 S- S   _PLb bp00CS00  0堑0CS00  K0PzP'8&0mqA-ApaV&ʐ0l00PPL -00CS00  0a0CSQ0 QF Ee0S 0`0F0 0\S0pS0 p'8&0mq0G-D0!10]PpЍ0S0  $SPPPPẺP/L彽X TP00CS00 # b0Q0CS00! P1ȃԓ 0 S)"Rʠc0U```00}P 0b0CS00 J 1Q !@o!S/ %S !`V U 00 0NP 0帡0CS000!000\Q00`PR# !RU``0``00Pd 0a0CS00km0` 1 1S 0S21a0S S`l   P7 0a0CS00>@10`! S:`Fp00  1S pDa0S `10 BRpE` S`l   岹P 0a0CS00   '8B?&0mq@BW'!( Q 0@30/@-K'8`01S @-0@!S @!FP /:P /'8B?7@-A0 R!RUUʐ0\00ZP@J] |]xk00CS00+ 0 @ R,W R P Ѝ00!S KP Yc0 Sڰ 0R0CS0000 0 Q  vP   '8&&0mqBkB|?A-O 0 P0,p W !GpY\ϟYP PP0  nQ pQ lQ 0 S , PP1S P PPP0 nR pR lR 00 S1S P P0PP_PP0 nR pR lR 00 S1S jP!S00P0PP1S 2S 0Sڜ 000@ `PP 0 nR* pR# lR$ 00 S5Po PPPೃ0S!S , 40S 1Sm cP0PPPeJ 010,0,0]0S000@ PQ 0!SP@ =P00 nR pR lR 00 S-0S  =4 b3PP1S PP%G@o%G`GooPbVWP 101?PP00 nR pR lR 00 S PP RPL nQ pQ lQ 0 S*0S  P0 PP RP, nQ pQ lQ 0 S20cS2 P0 PP RP P0  nQ pQ lQ 0 S1S @PP"PP0 nR pR lR 00 S{1SlP pP0PP PP` 0 nR pR lR 00 SX_aP0PP PV0nQ pQ lQ 00 S 9PPD B 0  P6p PP10S `Vp0VmVpppVpW 0 nR pR lR 00 S1SP0PP P0nQ pQ lQ 00 S   0  l P0nQ pQ lQ 00 S   0   RP nQ pQ lQ 0 S2S060S$602P0 PP R l Br R0" 0 S1S 2SqW P0000@ 0S0 0`PP 0 nR- pR& lR' 00 Sc1ST1S0!S k20S1S d  PXX 0S0T 1RP0PPP` gRF  R 0 B RiG `<@p>_G0"S:b-pR0 rR0 U0 SP0 R"R  " R0U0b0  `P00CS00 /P00PP2P02 aP P M v0b200CS00U. !2R00 2#20# 02 0nS- pS" lS& HPP0 nR' pR lR! 00 S1S" P20 2 2020P0PPP pPPP0SR `V0V pʈ0 nR pR lR 00 S]1SNcP0PP RPӰ nQ pQ lQ 0 S?:P0 PP&'8 BBBBW%\%\BB'"<&0 nCC-AC+'"'!Q^CD'B$%\CVQP000P0P@v ^`P 00 00 P 0 nR+ pR$ lR% 00 S1S0!S 00S1S{ aWW  EP0S0P0PP1S 2SqXP R# l Br R0"0 S0?PP0010CSE PZb@p E0"S0mPP00 nR pR lR 00 S~x2 00S <PPPP0  nQ pQ lQ 0 S`0S uiPP0S5PP]0 nR pR lR 00 SAP 5^2SFP0PP P5 "-@- 00 ЍЍ/''"<-0^S0]S0]S S]S[S .0Ls0S>30  Q  ]Q RG-鐁`P@0 SS&tPD(!RGdadqU`0``0,0吳P,E哶( $ 00CS010 [S \S @@P`0 S @ "0(a0CS,0p00,a C L0 0@S G 0&''"<'&0mq'8.C'Pp@-!0 P= P@01SE0p0 SS t`P@0P 00S P0P00 IP0 h0T v00Q㊱P0rD0 ,('A'"<C'"$'"('&0mqO-bB0  %R R 0R0H 00CS00r00 Q0&Qn0C0 RʴaqU`0``00売P? 0A0CS0l10G 0P \QH 0 SP 010S uP/ 000S S)00 S [ U 000dP Cf ft00CS0L00 0`00Pp8 P''#pC+''8' ' %&0mq0A-P0 0p@ W 0 `@P 0 R00R00 1BQC@ @P@pC0"S,"@gR000''#pB$O-@SMpcȳ00 0GS TcsT`0``00ܱPQCߴ` \X00C0+0&SK   BR  D R: XJ@p R就P$C岴 00C0S @Ѝh20  R  BR   0 \SH 1B\C00 BR?"p L\ DQ-WppB@ \ p WP BXD @X<f00C0 AQ 0 T0 Tpppp  %Pu p BR   @W0 `0CS0(00oq 0 b'#p''8&0mqO-M 0@P0P0u <40S 0 0 000 (0pP ߍ0P0`#2Cij 00 S(0  pRN0Y01 Y | $ 嶰P$*B帳L HD  B R+,30 # \  BR 200S 0 4i @ 0 0(PP. 0Y0 Y D $ hP$  BR 200S 0 3 @ P4 (0P'0 p1pG Y;ppZ .P81A/( $/ =00C0SuX   R    P< 00CS000^`W#00S xyL00S 0  `@8 0 X  'P'#p'&0mq'8CO-pᬡA0M0CQ` 01 00C S00`NlЍ,  0P5 P!` 00000`P00CS000   L[  0S00CS0x00` P  P'@'L''DB'#p'8O-RB0M00bsp 0shЍؑ؁0S 1 0000 P@  0#⩟ɐ Y Fp10S Y0p0000000CS0C01;  \" \   " L\ B  @      0C LN 'H%\'LC'#'' ' '8A- `P 0 0Cs 0x 0 p0 l   AC^  00@pT ᅯ@ 0'#'L%\'HG-@p0 PR` 0 P(S%0  d P 0 ,(O'#&0mq@-?0 nFD&0O-eGM0PS@pM$Q403/P 0: S?00W +* P8:??0P0: S 0SyP0: S 0S 0S 0/S&gP7l0p0o:P- P 0#v PvO+<*E0P ]D#P]/P 婨/>P/>P g:0P+I [(H Z% U8.<. 0PT9.<. 0P @DP ^P!T1QP o R00S$ 0SS 0: SO8PN 6  0=G=00 04K =G=00J0SP. Tqv0XG DXg00CS0 p Pp  pYW shX0 X p00CS00 0S ZP0SGݍЍ0c ?o2500\0 8n'#xhDDD%E&0E!%E/\\90\\9X X0p@-DPD@@@T ` U H H0Rp@\\9ppX 0Xp@-DPD@@@T ` U HH Qp@\\q9ppX X0p@-4P4@00T ` U 8 80Rp@\\W9ppX 0Xp@-4P4@00T ` U 88 Qp@\\<9ppX X0p@-TPT@PPT ` U X X0Rp@\\"9ppX 0Xp@-TPT@PPT ` U XX Qp@\\9ppX X@-p0tp t\@ ^0@\\8X0X@-p tpt\@ ^ @\\85S %R R S R SSh -^L^S R 0/0/0000'#O-QMTf @ `u @ 0 @0L0@@@ @@D@H@,@0@<@@@4@8@5 SS$\ 0 !00`V0S8 0 0刐0L0St 40D0800$0S00(00 C,/6$pp6,0S `4 @?C000<$0D0p0H0D0p60 $pp6$0S00<00@0#0p|p6,0S 3 @?CZ㸰张 0t#pfp6 0X#p^p60 \ 0C0CQ0B003/040 0S +YT R|S0} 00 R0! 0L0S XP0 |0xR, H  ,00\DD5H 5 @P ! t p\<@  < * R," $\  " &p P 8 04  # 0Sb Q> 0 !XX0$0Q: 0 t!dd0(0$6[( 6 0R  P 4P0k@50S00P00P00[PP\0.S0S0 !|0P$0 0P(0 $Z (U R P0L~P000Ѝ'#UUUV%cG-@a!80S #PP R&tpW Gj$<0SB|$@P ;@^$;@;0SZ5!0CS0 \q$ Z  i00L0S \0.S0S %@0S40S t&%<0Y?o20S X (y040'#H4 5EEEFG-`->/P0DL0 {P0S$00D0H0wP0pP〔0t$pZh4T H0 `F0P 0 H0P Z$4X0 s0X00 00dt |  P PRPS W( ?R004(0'R S S S3 L0St3 T0Sh3 0S\3PT#QP30V < 00Ѝ10@GS  0$ 00H00P0L0 0T0X0s0X0 00P0L0T0H00 00P0L0T0H00X0v0P00L00T00P0L0 0fb0d0_PP\0<0Y080 PT0 D0h l0N0D0h0000000Bp=0p$0,p80$00,03000@0-0 0*0p0'0t0$0D00h00x00|000000000D0@P Q: 00D`0S0\0S00S S S0 30`0St0\0Sh0h0m'#@th%\ E%<'#%\EK&0\0 80p@-@PT @@\p'$(80p@-@PT @@\p'$(-L0MSM\0 + p9剫0 ލЍ 00 i>04@pl0l 0 0  ~L00S   hE&0E'$ '$$'#$0\ 0S '$(h0L0S/0 0 0/@-00 SM 0 0$0+4pphqЍ\0\@ X0R@P00C/ 0Ѝ@\'#'#'#mEE'#EE'#P `00CS`0p S00 P0S X0X /X%: S@-  S  S/ I* S  S%|@=A-t1`@pTXPM !T@L10S @10S- ,10'p @0 0 0( 0@0S00S 0: S@Ѝ0l 0R00C/k20 T00S '#E'#'#mEÏ'$ '$$'$'$,'#E'#'#s@- P@@P `RU00S @IT EЍpx p Q \0 \@1U ,P@(UF'$8'$@p@-P@Tp!0C0  $F @C-@4M 330S`sV4Ѝ!0C0{ 0XPS !$B0S 20Sm 0$ 2+04pxp &0( TH20S 04 $ 20S    0 : SK ,0s# 8#4410S10S:1!0 0H 10S|10S : S0: S {`y81萟 01R(10C/\10  'Q /p| , lL\,00S '$@'#'#'#E'#mEÏF'$F"'#[aF)'$'$'$ '$$'$'$,'#E'#'#1O-0S$0@010S 10S,0001!0 q0P0S ЍOPa0HQ 0P 0 `0SYpUPQPU% Ѝ  B 10`    0S[  L0  $R,   V '#'#'#'$'$,%\%\'$@010G-S$0@010S 10S,0000 0 0PG0`VGcpP倠UG t!0C0 W lp0S$,  `YpP \`'#'#'#'$'$,%\0G-@0T$@0@SP 00S,000@p0`0堀S㠐@VG 5!0C0 W ,-p0 00 S $p0S$,  Op` '#'#'#'$%\@- M @ pp ЍT P 0@  QQ  00{&T צP S  %ؐ0p@-0PS``0@P 0P PAY@P4 Pᝥp'$$5{F7hC-CM@/ `4 4PȐ`T *F 0pPPCߍw ? P@4w0S ?@ḥP?oP@&@-5 |TFF&0 000/'$L@-50 jBFl&0-$ME0P!00Q00! 00 ƺ p $Ѝ "$ 0P 00t0 p0| t p\   HH/"$  ,0('$LFF2FhFGGFFO--Le@PQM ,Pn i50Sr  忞p.P 0S 'P 寞 t00CS010p0pЍ0S P PPpPX ǣ) ,4 Rl pr0! 媿0 X 00CS0p YX 0 P 0S  pվPڹP X0: S #P4P˹ P 궹X0: S]PX WpP%eb0S 㜛  ?P= ǡP J  [ (yP 0 ˯S ,!0 0 u@r!@ ({{ z0 xpϝ00@0 @P <彝p l=P Y40S  尝X0;X0X1P 奝,P B40-S  嘝طPWpPp0S  D Rp@Y'$LXG&70&0%mG0GLhG\67?GgGuGGs@-@ `PxP 0P| U`咷吷ЍpU VS\@儷傷0 P4B?@G%\GGGGG-A~M0MSP 0p`E (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx 0E}庸P3d!/`~܍Ѝ~,+P 3 !0 0E~噸P3 ~,`Pʌ3 ~, P0pE 0E~{PYp  Q \]/0 00EfPb3>$ /%\mH,H HTH~HH00CS0 〾0 /G-XD`HMp ݶ0004T4$4t0000 00$0S0 V"3`0p Q 30Sa3PZPZ30#S/媶000 0Kx#匶P20\#?/V 00@30p Q  #oP0 020" /V0020"XP20" /2000HЍp(0: S L. S*< ⪷P00S`09)03V-V)V q 1X 0/ ,03 ~\P0F ;0L S0 00 0:(pqu20S0 0V00 V V  1!00!0S ~<0~0VXHPQVS U0+0XPV P%\'$p''@%aD %]'Ф'$IYI%] II9%]Ik@8m'P 'P%]$}D00S/@-4@~M0S~, 卵P~܍'$p%\0@-p@$0l00S Ѝ00 0' P01, /.P%\'$pIL0@- R8-P 0 0 -'$pI'ь'P IA-pP@` @P@DTP`VA-pP@` P@DTP`Vp@-P@T0` Q@P 0 Q @;;S p@P00T@ y1(0( -( _-%\'$p'P J,JMs@-R@T` V0a@$00 ?00S 0CS3P3M10 S97-00@ЍpPڀ;;S" 00 0& P0Q/3P00@00" %10S @@10ES TT 0$010S10S 10S 10S $0STڄ00Q YQ`,T( H,0(00 )-$%\'$pJnJ'JJMJK&\1 RR@-LQM R ܍4ЍT 0S =! !!0`##!)# ֲ0S1px10  0( 08!ܸ0D!0100q 000`0尐01(0C Ÿ  忸 ,0 ( $0($0 t 學 00 0 `#⢸#(# ゲT%aD&0'$p''P8LX7LM'ь'+HM&''@#M<'P(%\MMC-LRLb0HBS0000 Ѝ((0 0 0S  2 r0S 1 w  0S ٳpP (0: S)0嫳 p10S10S PR_P  0 0 0S q4aX 1 H 00 0S000p000 S(00(000 P@0S 8000S x0)P 0 0t;'P 0X %\''@'$p'\'Ѹ'X'd'ьM~'$%aD'M'M'P8'P(MA-MM$ űPS.#*H ⹱PG."*RB$0`SE 0`B0S2)pY)P{ T)Pv 0 s S( -h)d)`2Dr00CSPP)H)D)@)<)8)P(.)P0000) 1 `ލЍ)0S  R  sS SS YSP )yS|) qp)l)<)P,(P 0S8 4(P( c'1P w)0S(n)^PP P0000)U)'lMM%\'$p'$'ьM%] %]N/NU%aDNNOO8O` ZO'XNzNOOOP-PTPdP POPPP00@-@BpMp`%aHO-q\ Lt0S(P1`@PPP"@U(L0 R1V10S !)@DT  A0d#0UPTP )PV0S p(@X`ꓢ" @2/PL0 !ᓢ#, 0&%a8%`,'%@%aDQ '%AP'G-鈑0@`pP@FQU PppWP<(PЍPT10S (Pp@ 0$03/0PP " R T @ AP 80| 3/PPPTT00S\ T(R <003/P 202''%@QE%aDQkQ'+H'%AQQ@-AMP/M+@P+ p`pP/0P0 Uh0h (AލЍT0_"u'/0P0 0@0 `('+LR'%@R00CS0 o0 /0O-S$M00`Y P$ЍP0,03/P00倕L30S,$ At0 0x0|06@ *l &0(03/ Pp: EP''+H'+L'+M%%R'lO-MpЍle0H03/P0 03/P]P㳓050 S 5 P ?*%&40StJGFP 0(03/ 㚭$xP 0AS0@0 a3/Ph4C00&CP 44 CP40S  ߮P S0 0  ԮP 0R S d="Q`003t Qp00PHP \SL3d Q`00/S*Pd# A S0 0  ┮P0SU 0S d="Q`002t Qp000S "SB 0 \ 4S P T20SkD20S Pm4S S/ 0CS)0PS% KzU K0S# Q0S 100d="Q`0H  p1 @R P RPPP $1P EG E^ @ ;/0S0S P0S 000[X000"4S 0S 0''Ш%aHR''KH'l'P''+L'''O'+H'O'+M'Ѱ'Ѭ'\'d'є%aL'XG-R@p T T 0 $@H03/P0 03/P0SA0 X Ptqta0 08d1MP PP9 DP0(03/P@!P0 0 @0S 0 00YP@ P0 |0 h0 0S L P T0 CX BP'S ''\'Ѹ'+H'X'dM'l'ьS7'PT0@-0S`PP 00H03/P@ ''0O-M MT崐 $0 P`0@@z=0 Cባz @*Jލ Ѝ  r p G@$<pm ?4S(4R0(4 \ QX00]0S0(4 00P 00  'ьd#''ѨXGX'Ѡ'Ѥ%aXMYh%aTYYB/O-p@M 0W0DN 00S08 0<0 WPP0C080pG0S 0`S * 0R 08 0 x x.  P8 @0 X2@0@/iP*@0 0嘠P P` hЍXX ᚋ \  ` `@YY'0',Y'8'4Rs@-Ѝp@0 @`P&Pb08  彡PT0 Y'`Y0@-@MPP00800S =J"Ѝ0'`G-`QM MJP㠔@ Y #p ⦡P 0p 0PP=! RS J(ݍ ЍPJ8 B= $L H0QP J(L0 00PJ8 PTYIYYZA-QP O000p@T+`00CS0pT0 0S0T@ 0S@ 0 d9P 0S@ @T@ S +P 'd%`% 'p0 0 S00@-@R00000S0@000S `凊P L]p 40P'''d'Ѵ Z'`p@-PP 0S|?p `^@P` @P0/S000000f PR @@@pZLZg'dh0 RX R  H R/< R/ $R/Q/ ?'d''Ѽ'`0@-0S L0@0T R S$ 劧0@'`'dZ&0G--b@ 0(MS 0SzB((Ѝ0 0p5"0C S60 |20S 0X0 00!P 0 ! " PPp  0!$$! 0!㓭 X (4 : S=  S7  S$  S03 0`! Z 0J 4!Q010P7 S  S/  S04=! 0400S -ЁЂ ;Ѓ"040+04 ƟPB0h 00  0 0 Y 'd '`ZZZ[ 'ьM[%p@-8M@  WD 0`P`~U`$ $ @ 07P8Ѝp[?[IA-t1hM0@S T另hЍA `Z(吊="(<p@<1WpP0 0000p084 k40CSL$0r"60"$]0( X4 CR+x OW hЍB>'PFS+<  g'\m[U[g[y[r@-@XM="p:(/0 RXЍ[7@-@PppP Q Ѝ0 0 &E Ѝ0@ E0S :R Q/ 0B\/0@ P 0 0B \0@ AB\7@aB\/W@Q/Pp*-0C\^* 0 \!00W0 00N0 00N ^*N^*/@-@P0*Q@H? $0S\?:!  Q0S:R T 0 Br\  0B~ \! AB~\ " !. Ta Br\ ! -0C\0S* ^!02W" 0C0 0C S*CS*80P @-  v//'[A-@((PQ U?-QQpW B :WP`0 ?`S A Aِ0:S@0 R  0 `-'Ј%<[&0[/Os@- `)0QP@ Q10*P@ЍpP mR bR kR%$+ *R xR R wR!$/QPP@$+*$& QPP@0PA- 0S`Pp ن0P  T @R p00T0p0S , @P0=0 PP['А\ \2s@-@`P0l C300PЍp@00S S@@PP 0 @D {00'А@-  "Cܠ&0\I0 Rr @-/%aD@-00C$( C C C&0\]}^T_NG-p p1@d< \P9p`80, yZ/00 ``O-lM/oPOI_PP$ P0@`p/刏0/ P0@  p?p/@p`?\?A0sQ S  R8?8/00 CRJV?zP< N>Q ,c>@>0 -R.Q0 00 0|> t>t. l>h>d> >0SPp2 <>  = 0S > 0.0 .0-0==P====-000X=00j=@ T PPlX| -1 ! ` S=<-<@0=,=<PE < -<-<,<,<,<,x<,<{T< d<{a```%```2%`aǛnb#  '' %aPa!'`'&`a7aMY'PHaha'aaa'%8'Ѱ'ѬG 0 .%`xbG'ѐ0P  /'Аd0P/X00@- HP808P:  ?F'А'bn'ьd#b&0A-`  @?\, \PA *\.  Q R( [\SPQU !\@@]^.!Lo \0QS8 /0S0 R0SP/ S QR S0*S S 0PS 0 P0^ p-W pW]W UU @U 'p@-@@0/SN00N P`pPQP`Q*C0CT3A"0L0AS*pSd'p@-1MPMhP/"P  0P0SۍЍp.S@T|`l @ @'ьdAdtdd d dee eGO-cM M 33 "@p3]PW1`0 00S  g  0 Pa`$0+QRV~ @ +  T*Q`DV;  ecݍ Ѝ&Q* \Q% 1B\ 0 BQ "P P BR00CR  0@&R\R ,  BP+T- R* ` V$p0!#MS@ 0 8TS 岝8TS p  0i 0 x塝@T *0S0T00  R S 0 }'H ere&0eeC-`PMM RP  \SP R P0S ۍЍ@P p 凍P ;㴍0 D  0S \S R PPP gS PS" SS GS 0 x0pS sS0S080 R @@@eeff7f`'HA-PP 0SpH`pf@PL P 40  R p`@@ @ff'HL0@-@0T  S  弜0@'Hf&0T1 RP p@-ZDT 4\p \Q Q 0T*  a04=P  0S/  00p0S/  0`0  @0/S000 0D0 R /'H''fg0A-j40@TPp 00S0o`0 00/S @Tt0T0o P0 SD jp04'H''2A-0@SP' 0`.S0.S0S/S XWP 0 Q CR S.R  S.R0S/S G 10S510S ;P:4 CSR ! Q0S 0/S0S.00 `  00C00S080 `V">_ Y P:4Co S Q  S  FP  ! C 0C0 0A0 B!"00@& :A-Q@pW :`L`0``L\*0 J(P0r ;; A41  =db0(p }0P0<0x v0P0@0 oP00 0 f`P 000 ZPd iPPPP P D E' nnnoo"o@o{o^'а// Qp@-(0PS$ l` @P|t 0000X0z `9V0  k@pd!o' ooO-P`p Ѝ#:0J84YqW V#2/00p0K0CS\3g P|0<0003$ r  d ( |pq  }? 0$00004JH1P t@0 B(1<P l<0 㓍 H K06S0S 3 CRQ  gSt K CRW0 40r;; (49 xS!04(4:(404(49(408400C /Q000T($4S::  $ R(4C @=0&"**40 p0 2S($0 *4($040)($84  R KS 0 0 40r;; 4KS<  4j, $ ','4 Np"pX' pp.p'O-j4@SM- S 0cS:p& SR0d0C0 PR/R0R E?o2R0S% 0CS@0 @P*0 J(. R00700=0 s++  Q 10>B 0BR* 0,2F/0 0~0< P J80@ P J-1  = 00P 0 J<@\d[G   rXO  r}0 |P J}Pߍ P$PP P qP $ | 0q0cRaP' q'pq RqGqOd! xqWq`qiDq'аqmqp@-PMM@ d W=\\  0Pt UM>@ ; 00$0$0<0 0 0ݍЍp$ ] ' p@-@, PP hp@Dq@-0P-S0S' @P#eu 0N0p S0 `C PV`P40T Ѝ@p۾qq%-@-0@P   EЍ@Ѝ/'Hp@-@ATp@0 R POP ` `P`p'H-P@- 00|0 x0x 0 0 h@0S X6P00L0L <凎 ,$ (P Ѝ@ Ѝ/'|'Ѹ'\'X&0'ьp@-xg@PlyhPP XrP phh000S  pqQ'H'q -P7@- 000@ 0 0 0 P0S xO00l0l h0 X宣T$uD 8$0 O Ѝ0@Ѝ/'|'Ѹ'\'X%'ь&0t@-] r&00@-MM@P@Mߍ00/SIPtIP ;p T6p  0RP 0RP trg(Z 000/'P@- ˍ㣊r&0A-q`@ MT pp弍hAPD00CS0>@ Pp< @Y@DOoB0S@ Ѝ0P: S ԇP 0S q X N 0 R@@p =0App Tu0 @00CS04忽0 'PrC&0rQmr%O-PQAMpY :y0 pz! 8 PP-pY :y0 pz! 8 ]P!  8gPpY !\8P; Y:v0P P! 8PPV` pP'Ph@- ;r&0 0p@-@PT 0Q00S0P0T`00000ppp00CS000S p'`'\A-pPd@d`0000SP'U`00CS0$00SA'`'Ҁ'\p@-@PD`0S@'T`p QP'ҀG-,a000P-50@ R'QS v\! 000CS000S A 09` ㈐pDVG850lT0V00CS00 lT 0`'`'Ҁs'\p%cDs$0@-S R' 'ҀA-pP`V@ @P+Pp@-TF<@P jDP0P 0@00aT:@p^'TA-ppP`0004@40 04000@0CS000SA'`'\p@-P`@T PV 0@p@@-PG-a;0PU:"0S @TP0@ T =8PP0 *T0TU00CS00 S 0 00{Pp'Ts.%c@sCs$%cDC-3cPr 0 2@0 @@000 DJ @2 2 00pD3P 0@ Ѝ/RR R@ %&@Ÿ B&Q @0=S0  "?R9R:B!P |R( ~RT ^R d!000P; 00@=S? >S 00@<S =S 00@|S0 0@&S0 0@=S0   +R'0  -R(0 )%#$0 &'< '0sX'8'$s x 0@- ' s0s@-0P`0}W0`0@S P 0R@P@.  3P@&0S00S 0ST P000 R  Ѝp' 'L%b4s! s@-AL ^ ld rs^< \b ] " Q?0 CàΌ c1Œ? l1 0\PQP̠Q  S  S Q PQ PQ!  t"t.t?O-p`t됰P0@%Sn00&S T1b! ^0 00 @ P@P@' tL@-0@!4Mp ET` 0 P@4Ѝ0@P S2WP@V P @0 F<P@$ P@⷇ RU' p@-@P0)Sp ' O-@`(r,MTS TV T( T* #T! @$TR "T 0P#S@    ,Ѝ'0DS[D pP@VP@P@'0KSV'[`000`!`0 J T! y! 0  P@@! 0  @PVZ'T`@@@P, P@   ' ttZthO-p`M8P젟찟e!@ a0 T@ 0DS'00S^^* PU @ 0 \ 0DS00SY Ѝ` pUU ' C-销`P 0BS0`0S@! p 0 00 @@@@@  Ѝ' G-`dP0@S! p0 00P@@' @-@MP:1`PL0P  IR NRpp PpEp@@0PS@ $G1Ѝ' tPG-P-PP* `0@䀟00 0R0Cp0W S `S0p 00 P11Sp0@0PH0P@4 0P@~1m%b(%b0'8'L_@P/- 0/SSS00'@0@-@PMMMߍ00/S \@p ;p  0RP 0RPZp@-`\=0@P ,0D0p@i0h070"SP Vp0mz'@tp@-T` RpH0@Q 8 NPP 0pp@'@%atG-pWR 0S)P gkB000000000CS020S @T  |S pS\T/j424b0000@/Sp=FpPJ0S0/p0CS0pppW000000pA0P00 k00/ lR `R00CS0<10S 00CS00W00 pR0S/S0@D00s0@P  R*0000t/S0S P 0/0CS0 pG0S 00CS000G0@D0@A0@'@'`'\tt%b('8%b0ZA-`p0@00P 00CS000S W0P0CS0d00S H%@ HW 406 R0S 0N'`'\t%b4'@G-2M~6r0@TES@P 0.S00.S000/SS?X20PpTePZ( ,`V @PP p` m.` E0Eh^.i@0-S0Sp1@T@dRP.sPw 0S 6.pP  `P l 0: S W g.pPXP pW [0S WJ.pPЍ%b4t'Tt D'@uuu5u<@-$0Q @ UQ @'@tuQp@-L@50P000S LTPP 0Ses@@nM 101M00CS00 tM 0 VM0pk<]'Tu|'@u%cDuG-@P@\R` V101 <P (P  `I\TQp @p0T \0DsQjSh0 @0 p0BP!0 BS@p@00CS00 M 0@0 @T0S 00CS00 L 0 0SZ00CS00 L 0 L 1 0h1@ @ @ @ @ @pp\@@%cD$P uA-@ ` PR 0R 0S SLp0S0 R M0S   MU  LTLj xL Td@00CS00 uL 0 AVL%c,'L'Ӡ%cHh%c@ 0@-P) 0'L@-@(0Q M'L@-x0@T   @@@@ @3|@00S 4060S JЍ'L'4%b4-$0@- R    'Ө-@-   0p@-'Ө-@-0@0 H@-P@` =@-@-   3@-@--@-00j " ЍЍ/p@-P@^ p@-@-   ЍЍ/ 0H P @-4 4>L,P / u'd0/'pp@-@|PPPP {p` {`P {p` {`p7@-P30@T p06 N 0d0@T PMMP0 0@ 0tN@B Ѝ0'Tm%b4'p' B@-p`P@U'<0P%{Fkk&Zg{[`[x E06S 00S T Ѝd @0t0S0T.S @N'pw>u 0    /'ps@-@ P`TЍp0P0CS0  000 P 0 4@ 00  0@-PM @T @@ 0Jhp ?+P   P@@ 0;hp 80 @ 0 0Ѝ0@ f @'p%a%a@-@P 0S0S 4P 00 0 Ѝ'G-`0S q0P00#@dT0SP^&@D1$@00CS0$10S /Ѝ00S p Uz~h:  R K)P00CS00S UA0SozAUezPbz@"'`'\'pwCG-0@P`^PM U*릐 s)2Q0 U2$PP20S H0S 2$PPPU I ^0S|2 0S@*T ^0S<"$0 0 *^0S2 R$0S0S *F@ P0S F0S F^0Sd1 R$ R @T$@0S E 0S E 0S E 0S E  0$ V $0?o2$0Mx0$ R  0S E 8I4RI Ѝ%b4' 'p'wX%c,O-@MPp*0 ;`㠀堠堰?P@ RC*Vx0$`W T ^0S W GP  0`S*Ѝ'L%c%b4'pP8PG-P* `0@00 0R0Cp0W S `S0p 00 Px*v*S p0@r)PD0(00$e* 0$ 0$/%b(%b0'8'pA-Pp`@000^0S 0S S00CS0 0 0S 00CS00 00$`0C00CS$` $0 R Ss 0$`S S'p%b4G-P䑟 M^`AV $`[)pWT0尡p0p00WZ 0S- |1|a3HlH H00CS00 gH 0= I00CS00 UH 0 7H  K^ $`R 0S S00CS0 p  0S pS00CS0 0$`0C0 !) Ѝ%b4'p'L'x%c@C-@$M p䀟( 0 0`@T+ 0S0 PU@ 000xP 0t 0 SP0 0U$0 @ R^PU $0($ЍP0'L'p%b4G-P,Eo@p0媢S' 0S$ 1a1^2HHY.HUH00CS00 G 0 G|aU000 &PD U 0S @T H1墊 [B@QG8OG1F0S  1$ Iߍ0A 0 000 0~@P00CS0 0@ 0 00x0 =00CS0 0S GlGD0FX00S h@00S b'T%b4'x%c@'Lwhw'Xw'p'`w'\0 @-`o$M 0 00^0SP4P @W'000p[ pk%P 00S (v=9v0 p000CS0(00S  ['$Ѝ%b4'`w'\C-@?mM000@H0?_00?0,@0P@ '@P0o0`p00dp@Td0hP@0po 0lP@T 00/P0l $00`0S$&`0 S 0D0>60S >0S$0S 00D0$ 01C 0>0S$0S h@T @ xPP H0B7S 'x0R8 P>0S900SD 4.000\0,0(00 0p(0&p  =&0S(7S%00S 0 0S= 8  x=, vp@ P 0 t= |K8 `= <=, R , ,( $P000==0S ?U0 0P%@I.P  @J$ 0 $ R 0T@ =l0DS'ӤA- 1@PM`Rk0 1000  ;p !XZU p@@ Q X@T@Q@@ 08AS 00CS00 -@ 0* 00CS00 @ 0 ЍQ k@@U P000+K 00CS0T00S DQ@O@80 'x@xXxah%cDxj'`'\xtxzx~p@-P@@Pp 0S%SpP @ #tp@-P8@Pp 0RxPp@ "- @0@ R0S P P\ 0%a'ӬG-`P@唀0吐00|Up00CS0h00SGC0S0 S 0S00r[PPp'`'Ӭ%a'\A-p`P0@00 Q' Q:R @":QR!@P 0`EJ0@S`@?%R00S @$P`0W:SP0R@''%axA-`P倀000|Vp00CS0T00SA0Sp00.K [@T`'`'Ӭ'\0A-pPS R+`a@T"W p000,]0 @0 0 Y00CS0H00S `P `@'Ӥ'`'\p@-P$@Pp0P0@ "@-L@000@00 Z00CS000S@`'`'Ӥ'\O-PM/`@ 0P @@@k (oP00š0 0S 0S 000V#   P@ 51P @cPM R RA R 0S   0  003 0 03 Z0 R"00Ȳ0  *pP7Z { 2 @u 0|>00Ѝ H" R," R8pP B0000S R  pbQ  0X/R0XZp "P pP t"Ps R o R k(DoP0 * R; R 60@@DK P R  TP@0000S R    BR 9D R5 P3 P'x%a'Ӥ%c@E'`xx%b0x'\O-`Pp$M `x%@Pp2, 0S*[ 0 00P@0  p0Rp`#0`2|P& ZQB=01 =@$Ѝb@DT@ P  p R   U 01W VYXU' [1 00al 0aS v00@0S v P W>W 00SY0 0 S0 P 0< S0 Xx 'T'Ӭ %cDx'%a p@-`P0000S S@H000 00 00000CS0p00Spp@i'`'\0@-x@M0 0000\0P>00xH 00CS0$00S Ѝ0@HЍ0'`%b4'\@-yP 0SHO-`pP@Md$P0cS @@ <FpP vPP VP@ 9 R8cS" -U<rP3LpPA U=< P4 <@<T 00S pB00CS00 &< 0 0@ T  Ѝ 0RPU Dc<`<@X pP`1000p  `F`l1VD0 /XPX81 0 000SZU0WC<mPU7<U~AY-<UU Ut Ud;}yyy.'TmxyQ y{y%cDyfy' yyI}yyyyO- M$B$RpJ0@0`V% VV:V  V /V   BR <` F R  Y Ѝx! R  \a[  0000S(@@Pk>NP@ @5T ~p [ /R0/S0MW 0 BR r R  BR    BR   { %b0',  '8%b4 A-(A0S 0PS0 0aqP0S00 P000V00CS00S P 0SRh`hp0P RP000V000CS00S Z','`'\'0s@-0!S1Ѝp*S@SP``00 R Q0C R R00C S@ `Q@0S00S=STL00 <0 R0AD1U0 S 0S%b$'<'\A-dp`0PS@  R R00PH @',O-s@0MR02$` 00 042嘀0C v40`SX00 @ 000CS0E0S00CS0 20S HiP*0X00*PjP U P 10S10 DC}0@0CS0d10S {ЍM0SHH Z- Z`* V + 0S9@0  NP B?`F@ 0S 0 0 0CS0s0 S00C0~0000C0 0`F0CS0V0S@@','`%b0'\'p'8 1O-0Sp0 Ѝ@1匱 100 Z :[X0S @ PxqQ@P P `X% V800V `@`@% T* R" RPP P P@PP P{ DoPQ` @P@',''0%cpA-XPX@X`P0p00T0p0CS00S ','`'\p@-P S@SN0@ p',@-QpP0` 0S*00E@P`bPP `R@ Ѝ `0P@@0`SP0S0O-0R0@ 0[1 GR00#S00 B00S0p0 G0 B0wT,Ѝp U   p  R00SPhTs '8',%b0%b4y'8'< P  _'Lzz1zTO-0M P0 4帔0@0~Q 0 `p0 @Q Q#:Q =Q Q  Q@   4  BR  P AA  `3A P W 0S@ЍQ Q@Q =Rp `p(`` L  BR  wp w     BR u   u   BR   x ( R 0BQRQ B  W `   BR  vR v 0ASq Q AQ~@P /  Q @S&~  ;@@ Y  7@P  #  ~R =Q0S 00    @'%cp',%b0'L'8 dG-Pp`d1dAf0`S 0X00P0H1 0081 (pppV0 S000`0`0CS0!0 p0开@p   0    0  R 000p 0p %b4',%b0'8%b('L'H @-0n@l%b0O-TAT`0$M`FA8q00CS0@0 PP 0@I0N P0 0C0S0AP 60P0 R"Y 0CN0PEPE0000C0$Ѝ0000',%b0'8'LO-R`p@P[ 0 0000PPX P X 3 0 E0CP00S H D/0(04  @D,0,0D & ','8%b0%cH DzvzO-Pr0BS,` @( ؂  R [ 0 0002``TP `? Tj T Y@0T: 0P[Z  R@0@Y0@FT: 0iPD BU# 2Q0 TQPR D2@Y@FT: IP7 DU0#0 2S 0TS0Q00R D2@ 0PY 0S@@T:@PF0D0 0 C00PE0C0`FT00 0 D0C0CS@0 000000C00000000','8%b0C-PpM@`᠐B 0嘀00000p000CS00 p0@ @XЍ00p',%b0'8%b(A-Pp@.A00CS00 9. 0 ` V.00CS00 ". 0 ` VL`i.00CS00 . 0`%cDF@-z@-z00S/ R%aT0QH0 0Scq o/P0//'X%a0    B /'XA-P夀0@000p `R$ #0 `0T @ `  0 0C  S000SAR'`%a'X'\0A-P` @0p0W0 P 0X S S0 000 00 0h0 $P   00T ^I00CS0 00SA%a'`%c'X'\A-bB0 pWcr 0S 8-6-0S@0PP0/P]P2b000r0S\00CS00  0S 0X0#S :] P  2]Pk- 0 0p0P0 R R A   BR 0E0CS0000`0\00S A-H0,`8 Q%a'X%c,%cHz%b4%c@z@-L@00CS00  bp00CS0@Y'X@-T T@08      00000 0$00'X%aA-P`@000e$ \V |`0Pf$p0PS  D0  0000CS0 00SA#'`%%a'X'\@-4aM0p0P0s\@P ]P(0: S$0   V\P  aPg\0 00 Z\d#TR\L00CS0,00S Ѝ'`z{{{"{<'\A-h@Q0P0`0 PHpP;<0`00CS000SA'`'X%a'\p@-`P@00P0#P G 0S00G0X 0000CS0p$00Spp@{+%a'`'X'\0/%ap@-@(`(P0SSSp%a'd{Tp@-P@0Sp%a'dp@-@Pp P0Ppv#0@p%a 0 R/%a @-@0@1^ `   VpPW  Q Q 00 r B"Q q A,PU 0  0 'ؤOr5%aA-R0S20SP`AT p #Q[pp "#DP + 1N PpW[p |[ 0P '''l[ qP [pI  KDp, I P[ P [ppH  1DpeH "00`']'Z'`'ؤ'4%aq.{k%b4'0{{0S/p@-@PP1PL1DP0a 0(00R 0S"00Do05#0s  0C?o2^0SP3p P HUP p0S *00CS0p\00Spp@  Ao PQP'ؤ{Or5'`|%| '\p@-@\P0P00 =F@00CS0p00Spp@'`'\O-@pTM R0 TЍO*ؠZ* P`PZ   0SPs  0 S S S P R00S0S@TЍ0S{22 G!0R+  p  !R-    x"f*   0P"[* 0sT ,D  * 00CS0)0 X )؀` 0S 00CS0)0 00CS0)0 | 00CS0)0` 0Z 0Zi)000v * #40  ) )P S#4sG  0  l@ h  X)Ѐ 00Cs 00`Fj&'ؤ%aOr5|G|P|U|]|f|k|z@- 0 S  .^\Q   p@ S0C $00P0R0S pO-PP10 0%SW P 0@S!!Q@ C$0S 0S  R-S %S +S @@1@YZT X@1 r9 002#00S 0S 0p?Sp  kP T"@` ] P P ` \0@00SJ R Q !" R @%a||'ؤ||G- a 0S Qq0m0@SE @ (А0Sʬ00CS00 P( 0 )0 R  0 S0!('ؤm'TOr5|||%cD|zA-pP`4P00Stp10P 0S TjPp pPP gP`W@ P1 1@x(`V Q U` 00S`AJ 0 \(P00CS0 '0S 0 0 00S0 S 0 0||'T}#'ؤOr5}A%cD800S /@-P `'ؤ8 P  /Q 0SZ//'ؤ`060S/P00S/D0Q<0  40 A!0 S00'%b4'4%c@'ؤOr5}GG-Q`0SR@00SiZqP000L:@ 0@C  @ R0000CS0H10S 0q000 100S01000000V00CS000S 0S @pWZ00萠@ 0 ZBꙂ! P00 R @'ؤ'`'\%b4A-`!@S1p@!P KT%Tp1@WV2 `1N0SN U 0S0PjXPWV 1"@pVD T#Q#060S$ J#G#D#VG%D%U 0S nPPV\VP LLrWT 0 V'4'T','ؤ%b4%a{Ez08 N R S  0S  P %b4O-`R0pMxB0 pP P Ѝ0S0S "0@0000 0#P:TR 0S0L 1 0S1060?o22T97 S 500070S а 0 Р 嚲"S :^ 0R Q0  r; R-z!   B/oZ" R" \    P 0 00CS000S \  @Vz   B/oZ"  "0''`'ؤ'4%b4%c@'\ G-pPK@P EP1N0St `?@=WT @9W>p+C t`㜠@0S0S 0S0S0`@Y 0 X 000 :%b4%aj{'ؤA-@x PPT0P 0S klP@ pP@ ZP@kt06 R0S@@PX` p: 0 P m}Q'Th%b4%cDO-`s$M3 PPY30oV &P *P xnU pUV \`H3 R ZP$Ѝ3P\ ZpP&0?oQ20S P VP  Q6ZP@@=Y pW  pP 02 QY QwVP  P(160SJ\  \@ /o"/ S [ +(\@ Q 0p0d#Pv@T R *  W R $0PS  R 0 S0C 0 SZ 0 R00YXcX `Z^ R[00V'd}r'T}v}}U'ؤ%b4p@-PT@\a000 R 0S 81i=p +B!0S 0 00E1  S k00P0  Dt@ RQ Dt@@@Q00R00S ?0S00CS0000S p'`%a{'ؤOr5'\<1p@-Q00@S-$P`0SP00CS00 # 0 $0<p A.g!$PlP000V0@0CS0800S )p'ؤ||h%cD%a{|z'`'\@-r @ 00m'T@-@ g @mp@-`@0 0 p 0Qp\ PU#00p'ؤ}O-:HRHr@@@0T$ T 0"  @D@ Ѝ0CS0 )0!@T0 R 0S\S 0S`0S S S=S8 " CK 'SI 0 ` D V@!  `0`F V`0#`V "0! V 0  }00 S$0!"0^ 0  :0 1 }S`V0 0 \0$0< "04  'ؤ n5}K}}}}%a}}A-@`s嬃MTL 0SIPU0  xS0S d##?= 0 BRS8@$#":P(&@`@P@PUV0S 0S pPdTЍP@8P 0S P wPlPxcPT tid`0DPU@ B0 =0 SPF Cy P9 P6 P3 P0 P- P*{xv'ؤ w:#}}}w}K}9}~P~_~ ~~~' ~~"~,}}}}}~7Bp@-@PTpU0;U 0S 1@p@-Px`x0PP6 R@N0S@2@@0S. @D0    p 0 p'ؤ%b4A-0P@`Tp R@ 0N@T P 0S@@QW\0HU 000000V0@ '4%b4%aA-P`pᚱp P@ 0 A?0 ~=G-PP- 0M00S _ow1q R100 0000 S @PЍ0SF  0 Q S/R iCRP" 0Q 000S* RA ``0S:SV@!00S"@; @00CS00  0 ( p0ST0 @00 '''' D'Ӥ~N%b('8~\%c@%b0C-@M$Tpp``P A0S 60SP 0|N' 0^0z P1U00S^0SP60S .0S P P PЍP ^Y8 0 P0C?o20'%b4%c@%cH%c~k'ظ0S/p@-P000 P@PU00CS000S TpP@T` `@V0`0T0@0v0S V00T00p@'`'\%b4p@-l@0P00OP 00CS0 Sp@00S \'`z'\p@-P@HPU[(p@-19Ph~@-:Pa~p@-P@;:pA-@P0PS`~Up~0000 p 000CS0h00S 0p000000C000CS000S %b('`'\P @-(.O 00C00/~%b(00  0 00   /%b('8p@-@tPt`0000S0 000D0 00CS0p,00Spp@00:'`%b('8'\@-D@ 00040 00CS000S@'`'8'\G-q0A000@0V 0Y0SPkPP) 00?0 000E000PS V 00CS0l00SGg E  P0)` 00`00'`'8%b('\T 000@0A00CS0/00S/8'`%b('\p@-$@P0 0C0C0p%b('8p@-(P(`@0@D00C0p%b('8( A00C 00 0C0/%b('8-A-@P(MHp@`DpPVP u zT(01 0P @ @`@DPpU(ЍAЍ/T (01 p@80 P Op~ O-D40!Qp R00C0@R 1 00C0v001`@G0"0 !0`0C0w001 0`0C0v0(PA(P0@0C0y00 0"!0C"  0 0H$2  `!!J00pS 21 냐`00C0@50y0C0  00S 00C002  B )Pp' "1@0Cs0S10`0C0x0000C0p0 f00S210"QQ 21Sy0pW 0 l0 n00CS0<2pP0@D21S;0 0#<R00S2 0S+0@SP P1P0U1 UP>Y/UP3>P0 |P!000P$@D 0Ѝ@PB0 ,  s0P, 0&P00 0<P_ >P &P 00p0pr0((0 @ -P 0(0  p 00@0F%c%a %b0'8%b(  n'X'\ Wn4'('$& 'h %b0 !  0{P B@ 80 } pL0 {Y0D 00 B #PD}P@ 0 0005 }P' @ 0 y BR '  =0 BR@ =0@[0%Yy :Y4 #Y5pt0@ 0 p0I Q y BR K[ 0 @ Rp 0 B p74Pr ᝩPp@< [ B + R:p%pp02!R1S 0GS2@0 Ww 00W2 ` !k !v@Ryn@pYp K/o}Y" R 0#p0CS0p pP@'P023Qw0  00"0 `!2$0  0G-`Ȁ0@T@@0PU @ 0S 0 0  B/o"Y`0p 0S 0 t 0 0 0%c @-.P0@-2aM0$ 0 10< 010@0墷1|0000OPI@1| 1Q @@006y dt 0S $Q. 4QG Q ,4  8000<  ,000 0 0 `0 0 0 S00aߍ0  p0 `0 GH0 D0 H00SOS,0㌿ 0'T%b4'L%c %b0'Xm G-Up0 00 P0    x5P $00pK@*%rP 0 R 0/`      0@0S 0 00< P0, RP 000@ 00 00 R, RP3 00300 0000    BR   0` P0  0  CR S 0 P P`  ``t 0 0008 @0C 0 ^00^`0 SlIJP X0 R   L}000`0S0 R Ӻ0/0P 0 R000< 0  P 0@S P 000z B`@`!0P00`e P0.    00PU# T 0S 0@P0@00S0P0S0S 000@Ѝ$00pp%c  a%c%b4A-Q@`pQ` @ 0p P0 0W@ 0q R$@@`FR ( X% R"p0 `4 P /娦`P 0 08 00C0@04`Ѝ Q  0Sppp0 00 00 @p 0%c%a> A-P@0 P. 000 `P ppj@`e`@@P 0`0 U000 RPPe``0SU QP%c%b4Pp@-@|PP 0 @gP P 000 00Sp xpp%cc !P/0S/80 P/0S Q/0'ܰA-@Pp`00p` P@-` g:PA0@ pT@ŗ PP " 9 Ѝ @@Pu9fc`] Z  :w%c$ 0P/'ܰRQA-pP`%:VU``P``V@ C9`0 R@:P P%' 0߼.90 %c$7QA-`P@xpT@Q00C0U U $@P0 P9'ܰp@-X@X`0P0000$00CS0p00Spp@t'`'ܰ'\p@-`H0@TpV@PU P8P'ܰ|0p@- PR QP@ 80 bP `8& _p%c$mp@-@pP0 S00C T  D8P 0S8,03O@dA T @0@p@%c$fffg'ܰp@-`P0 Sڜ S  p8@P t0 R@U o8pʹ0S 0 S X8@꿴0S 'ܰ'(%c$p@-P @0Pp @  0p'ܰ@0@-@ P  R $@:80'ܰ 0 P/ R/'ܰC-(P0 U0M0000p#0C@S0 ` 7@P @2@l  崻V 7 72 R@Ud2T /o"Rm 7h`0"07@P2V0S' `7p@! /9p.P7*P 1 %׻ 0: S700``!l`P!` `V'oPP % 0I V U0S00! 0 "1P @u% 0~700CS000S Ѝ@rT  0PųS% 8X'` 'Өq%c$%b4  '\Rp@-@`PP Vp .% x-7pPV "7pV % 0P0 ppG-` PppW@p  P0̐P0S TX  >G:  |40@ l.V  T(T 0S @V@ P%cDm 'ʷp@-P  @6p R  6p d0 Rp  6p 6p 6pO'ܰ%c$-p@-@PpD0 0RPPp03/6Pp'ܰO-@$M0@000`p@A p2@ 尲娒V 0S"2 0S2" $Ѝ@0Sp2 R@00CS 0SP P 7$ 66PsPP jT 060SX gPS6P0000 Sj\1 0R  6pPj0C S c#  N 5PP T0S( 5PP0 RPU 50 300CS0p00S ]T0 00`Y'0S'ܰ'(%c\%cD%c@'$|'`%c$'\O-P0@ph#hcMdP P00L#(p-0U40@D[T$Sg 0Tq00 0`V_ %@`00S0SᎫP0SU0SRp0sS vS UP0+S -S P ` j 8Q (` R:  ˬP     : PT 0 @0SA0MЍUF ` p0      "TR m00j" 峸r   %5S 4pT" 04p0X0 N J 0D -%<-'$'(U %cDA-PQT 00CSPDq10SK R@ 0r`0CS00 `01L00<S R 0qL0S 0CS>S RSxh R 00CS0N0 -  0p@-@Ű0TP R R R& 1S# 0 尰PpR!Q QT " "D0600S0T0S 00S0''`'\%b4@-@P @N!PSIPS@-@P IP0  9 'sQp@-@ 00CS00 P `d 5?U UH?Up!P0P0CS00 `hA-@|P|p0`00 T 0000CS0H00SAH0S 00S z@'`''\L P0  /Q Q0 S//'@-b@0pSM10S 0SPP10SR WUOT T TP160SPPP0SP;x1N0l16 R6`! R20SPP0Q: ឯp3 0S$ UEo>p' W`RU I0@D>T000 0 00 3TPx0N R T  DR 60SЍQ Q2 1 @$ ''4%b4'PPO-@`P匪P pᆪP 偪P0@DpSppTPA TtP@DP:P5@<jP, (4  \@P@sSa0S 000T $00CS030S >@@T00PpӪTW00 T\W! @P@s 0E0`P 10STw@ T@@VPT @Pb1 R 00STV@ Tx@P@UT X@Q0S 00S 467@@TppYW `СȱPEPe ?P@1 z10S VP`0-S0S`TPhOCW W0S8 _90S4 0@ V0 S R0V00 <`1 R T` F00CS0400S `=3ys%cD''`'\x_%c@"G-PPE o@0p` TUG0S 00S 0@0@000CS0 00S @'''`'\p@-H@P02`S@20CSpqV02p'40T0P?o20S 0S//'C-p@`1010r!Q0@S10C1 ЍqXPU X2PᾷP 0S ''Ӕ?0!!R/P/'p@-8P\2Sp@\Bp'0-MM01`"R !R X"R   1 1d"1!d2S ,sDPl1, ,jDP L!0,00aD@P$1, d@T0dH2`0P, U @T 0S PB00CS0 ! ?1ᬬ00 0$0(00D>S 00 y020"!031''Ӕ'T'` 0@-`"dy'p@-L@'PԜ0PPp0C/U00p p@-T@TP0 0P0 70 0000CS0p00Spp@'`%c,'\A-@R`P`p 00PPEUp WD襬0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP000Q0 000CS0h00S sDP`000>0 0C0'('`'\p@-@P@0SH00Spp@00CS00  %c,0%c,0%c,@-@PnЍ<-@-   Ѝ Ѝ/-@- 0  ЍЍ/%c, -0@-l0M, @P(0 00SZ0c10 @0DЍ0@Ѝ/G-@'`ƛP$ 0S! l͞0S00CS0?0 "  v00CS000 " 0S xpW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU UPP 00CS00 ' g %c,0Q%c,@-@0%c,@-0rSrl0G-p0 P0R(0帐@0=00=``F@VPpPER000 S=S B`` R`ĥ`PGH@%b0'8%b(0@- 4@ 00C00 0 0S4Ѝ'80P P PR00/0@-LP@^ ^  R0L00 A-鸀(  R (p`@pW p0S 0QPU  0S 0S   3/P@P00'T0Sfp@-@jPUh 0Sp'SPTP@'GPP(p@H EDh~A-P0`Sp@    3/@PP@X %W  p0@=S0U0 0 00CS00  0 00CS00 z 0 T "Pp0`0PPEEQ0 ֦00p'@-P0`V) 00  S0 0@00p 0 AdAᱦ0@0T0 A$Aᠦ00 Ѝ'&-t@- P@p|ᔘ `|0P h@ 0\AAh00 ЍV@@T @ 0AAk'@-`0@T/ 0'R"R0PP Ѝ@ꭞ PᲕ p+0BP d0000 0 A@A;00 Ѝ,pP'&G--`@V@TP L0@`0pF ,V0p@P0''0O-lh,M0X0`8P P1@01%;Pp PE@ LP Xp(p70PEAU,Ѝ0  000P@`V7 0S 0S\V $d7P00CS00 47 0$ %V0%S@600CS00 n6 0P`巵0p*S`p0.S0@*S@pZ`}T圵`p<喵p@0xZ0WZ%Zp A0Js R %X0J S00 %S00 ;댅\P  N P \R \0p\ s00vG t 0 yD\ \LQ  b '\ \\ "\  \M \^0? \^0@-000fnrtvaet 3P0030  C 1 01ᗤ뜓`P d` P  db  + Pd  xțs0 v0 t 0 4寵p B `0 0@ 0 坵t0  唵#l cZv t0 O @"0P 00t V 0{j  0v t  i 0dt 0]h0P $0'S"S{XX0S$ L v t  0 # l7y0$0$ X t 0 W"v t   0 Ht 0 NVBT0 Hգ'%cD%< % %T %b&u 0'( lhZ0C- 0`qMP` Pp #@P 0 0p#@PC 0p W ) PuY <Y0P0P( 0ES P  00S00H l^YPH0?S0 -S00H0,Ѝ4 %x &\,NT\7@-0@0 0 X%TPQ b PM  , Ѝ0@%00 % P %x3,A-p:㉋P008R@P3 0S0 =wPP R00 ^_`cVt妖P 00 `8iVP囖P 00 8唖P( @_ 0$00SЍlV傖P 0 0oVxP 00 qP _ 0(0 Q 0S_P00CSD _0 0 0SH &]x| %x9:0K00M00P0D0 0C0D080;800,0/(#Q00,,#0,0/@0D 9K<@0(080$00= 0D00<00,0/+@$0@-0$ 0d8 Ѝ@-@4000@-@4000@-@(0(S00 00,0Ѝt` p@-@>PPϏ8͏<ˏ@ɏGPD[`ŏU\忏`, 8`4V0,0p)#@-@4͹80,0@-@4ù80,0&X$1@-8 @P$|( R n8 ", 8 <  < D ,-D  , /(0S \@-@8@0<<@00,0@-$ HP P Ѝt@-;PP tn@-0PP top@-0MP`0@-S00(00P0 0  P!P 0( RT  0 0 S40(03/Ѝp#\ &,A-@`PpQP-U@Q P00  PP0 -U  `0p@- P@@0P ,pT 80$P< D0TP$ <0<Pp ' ( )0 *4p@-$@P0S 7#00Pp'0Q+  0 BR@- # M| 0- BSs^0@Q ^ 40 ? 0 C  / /'8'0Tp@-hP@`V P6#p`HV4.#,+#&#0'0>hO-M`pAPU \ #TP D #XP 0 #PW  "PU " P pT,0p zR S [ Z YXW0S@0S 0S<ST00?{[ZYXWP4T <@†{ RS [ZY XW :S 0S0S 0SlPT`7pPP X WUP$6TU P m"^R@ 0&T 0~S Tv[TqZ TlY TgX TbWp lT]0SX TTX@0S@ <TS 0S( $TN<S JTO[ TJZ TEY T@X T;W 7R@ 0T 0?S pddT7[T PT2Z@ <T-Y,(T(X T#W}T:SuT0S mT0SeT0S ]T  VT| xOxLT X\XETWH D>TU P,U$3TUPT;S < S@ SU@S@ S 3  T:v`XS&[& Z+Y0X5W:U?P(s0SSUA t<S@T[ TZ TY TX TW TUp lT`jBPUdЍ0k0d$"x  @T   Q ! i 0R녡t0 ! P]  Uᙯ ᗯP p%18?n#$+*0187?>GHPOWX^_fgvu|}FYUa %x]MT]@-M b&0@-,0, Q 0 0  '@^&0s@-@`O000 #S@PD0S  0L00S 0 LЍphi0S/#Sp@-@,P$p0P 00p'@^A@-PRP@ p`Fp 0R" Ѝ0"S0SO 00SS  00@O&@-TPL0 p@ܕ0"SWLЍ'P@-TPL0 p@0"S0/O- pPMHa  R 4$, P R iߍꃿ0 R R @sQ Q@ Q@ ZT WpY: R <| 03/PUP'PU7@-lP$ R\;K@4 H/$0S p (3K 'K Ѝ0'P'H%Pp@-@P 0Sp@啇0PS 0P0[00Sp@-hP<@< <`0S00  .0&0C-P`PM 0S00(p/p0 DP" /Q0`@ p0@4P T0p *PH$0@@ 00Ѝ N'l'PA-@0P L @R<2<1H#4( ,, 0 8 4 #4R! !4S !4S |!4S `!4S Dzh!P0S l(sL!T0S T lpHP8W ЍAi0S. a`v`u 0R 0 M0US !S|  !3 \@0US83 0 U2,  2 0t-pP% +0(Zm"+4=BBFNFVeU(G-Qt ,@Q`P0QH 4QP4PQ 80S,00 80<0S#<0P:PP:P1 QB"7`8X0apSwp R l <0RTP)0< S4P0S9`(EQ (>Q @P0S0 BS `a 0ph0S  0 S* 0Q*da 8Zo~'PU#'TO-4+M p*7bP 0$S  ߍS PP@T[D@P 뉔 40ਛR YS? "$0f0Qjf/ ኑ,2S/!R" !PP0ȡ,21S F1P! 1P,>1@oP  0 tp hT1P8 H1P, @ P0 08?s0 R* 0S 0p P 0S 0 p1Sw   P@1S  f/ 01P P%D 'H'Pz}}qVEWWEVm2]'%A-P@`+Pp %R 0R000005S P vL $0f0Q ,LH(y 'P'H}'xp@-0@P  P$p@H(0@-0S ,'P@-P # 'xO-@:PMzM 00@ l?P5 ` |P0P0 O0SP :gP`( @0080S``(`和P+V0` :|(`嬩 Y 9 0 ,09P,0S d ,02P P HHἂ$aP,1 [PFV 0SZ 0 0,0 P2 @r`(l(P,00 xP ,00,0`V 0S,00b8P,00  @8, 1\ , TP0 ,0S  S;ǑBy0;\V0`(P (/P (tl P0(`0,0P,0S ++RP0 0 E*ɋ P 0(`0,0~P,0T0 帋 P 0(`0,0mP,0`0 始 P 0(`0,0\P,0X0 D喋 P 0(`0,0KP,0\0 克P 個P 0 (`0,04P,0d0 nP  (`850,0"P,07 l\ P (`40,0P,07 {,K P (`40,0P,07| j: P (`l40,0P,07k Y) P 0(`0,0P,0x0Z Hl P 0(`0,0P,0|0I 7 `aFy0S0S  v[0Y: Y0  0J 0L뼃(0bSTB  C(`H 2[9 v0S(I # \3  0 R M 0( 03000"0,0 0 0 ,0tP L)@, 2![{0ȰÕN 0 0, 0  (0 bS P  (0,S D@pݍЍ R $0  QP$0 kP$00!CK "{Ȱ 0R ( [ K{0S|1[ 00 R  (0 bS Px  (0,S 塉 (0Sg b'PfL5 .x0  'x!O!'i'>K_m~Ŧ )'l .&JyN *s@-`0PU V  P5@P hYЍp`PD!ᯍ 00|0@bV .6$00S @-铎00%cp@-@5S4 0PSP p@QPp0S 5S 1S D|?Pp5S T \Pp< HPp(( PpD'P'xHPAdeAdr7@-1AP(000(;_5 S* 5S( P-0S )0S005S | Plh0hPL5S Ѝ0< <mP0VEW'Pdfdm%cWL'xdg#@-@P f/@'x 0 L%c'Ddm0S/!  -3@-PCT |P 0S S@@ @P@Ѝ0@ Ѝ/%@-0@QR0@`  @%c@-t@t0MQh  `P0cS CS SS 4NsS00ۍ0(HnŦ0@-MM@` PP 00YSP ,,ۍЍ0oP  0 8'%@-@M0 wP ۍ)@-@ 0@ '%'@-YMM@p p\YލЍ<0< S <fEP10YS<0<0Adr=V@-*0gj zgzz'z'&z'z{zgzzz { yЍ57@-P0@ 0$S0S/  0S' TQBQC0AQPG00S 8@ 0O0000  S0 c0As Rxt Ѝ0zg{{'P { zg{{{ { { @(H 0@-X@X0MQL  DP 0nS00 yS Eۍ(Hk'P `00CS`0p S00 P0S X0X /X%C-` 0pP0`3@P B7pGT@ U @ 0@mzHBQPF׆p 0l Q V څPU PP pX Ѝ6EFZ%G-PMM`pϤ$0@S0#!)p- P 'P P%0 x p P  `D(8p P  OP  XPa08`D( p P  OP 0(0`D, tp P  @tOP Ds0,0`D0 (p P  _OP ^000`D8 p P  JOP I080`D4 p P  D5OP @4040`D< @qpu P   OP 0<0`D$\p` P   OP  04`D$GpK P  HNP t04@`D$T1p5 P  NP $04`DP p P  NP 0P0`DT P  PNP 0T0ۍЍA'% 0Sdy9Y~'Jj )FO-M@ Mhp PS `V90S0`S7-P`P8aEX```0E8ġ0 0St 00A"S0#1` Xp P& A<★Pp,"   }P0S  3/ PAP+ pRx%4.A dp P" 4S@4`S=,4`P82a0C" 20< S :Ap"WAx5|%.A 0p^ P0 <x5 0AApqAA0 P<0QA@xZ0x5< 0RA| ffP 0 000S P0`㬀(V R s S 0 0p)0`PXލ Ѝdw%c 0 1(:h w'%(H - BR0 R p@-P@ R1! 00 X0 X0 l X0 X ( D, 80 ,8 4 < $$$$P T ϲ0p 2Q0S*X`?\PQ |Vl廲p@z 1 *=Rhw YO-pᔀ 2MSR R@`aJ 8QG ,[D 00   g0@X" E 8 ,   R`@0" /  0> !R11` 5 0S 0Cs R]!SZ0   1 0 02 t8QI X <0P+8姃Q* 8 0A0 @2<0P+8千Q *ЍO0 0 02  02 t h< X ЍOpЍ! 1=E 1/mJ]nA-@Pp(D<ʱ`8SAy 0`0/p/p@-0  R( R((,,004488<<DDPPT@TXPl XRl@PUl @ 0T0p  Q CQCQ}C'h@-@t40Pt08f/rVEW0H @-P \PY Q@sVEW'h80@-0@S K08f/J' 0PQ0//@-D0 <44߰0@ R 0&0/%d,'P7@-@ PT?P0 08P8 0 p0 = Ѝ0"(Pdv0@?o2P0S@- p`P@P P P  P@V@lPH@T@T p0 4F=@@ ЍaQG?q(Pdu0@-PM zdP@` p D'= 0 400+ +zЍ0(P@dzJ[is@-@ p =0  ^0 X0`P   O0   H0  hA0  P:0  83Ѝp(P@dtm:^( p@-@PM`P 7 p  ( V V dPЍp (pH(  p ,< 0(P@(d}E(d~0@-PM @ pP 8r<4P 0 p0 m<Ѝ0(Pd{A-`0@Pp!倁(M00l!np0SP@LAH p  ,E<eP qP p` $0Q 00S*7@P #<QVW  V 0s R|0|0q 0S(Ѝ00* *D  b`@-%<(Pd|*_qfmy@-P$M 4@P g p p;  Ѝ0(P@d@-5(0    &0O-$M@P` pH0T00X$Ѝ  n -p9 8P  p 0 S T0✐@0Ssxt ZV X ໛W 0  @D́0P  M90P 0P0P  p@耛6p@ 0x @d p@XU@@iPpdictaraynmbrstng_h 213/P/( XA-PT0p`}@},0T@@DA?@?@@( X?0@-0@ 202 0{0Q!Q3( X> 0R//G-`pB 0P{E z}@PP$ W 20CS20CS G 0( XA<@-@p 2SM"n#^   2"  E 2" HЍ@  ʚ"2d `彚E"2@ X"\4Ѝ@ ( X%dENwAUs@-P`߁  `0SЍp00S@΁0"S1Ds@-$M⡁@m{00  0 0H  m&0A-`P 0p @Tʬ8 /, q0d / 0Vwpq  RЍAL` 0S`@D@, Ѝ%dx( XA-0ppP@`ph!14P S H d" R S R 0 tU( Xp@-4@PL2S0( #0B1p( X0/p@-LQ ATp'A  …A?@@   \ @D@043c0PpA  RA?@@   ` Ƞ̌ Č @( XX0P@-<8B 0"@@$18<4@( XO-PLMx0 $0|0#(0p0@0,030儠s040,0S9 23E( `0$ 0z  0/z0   0 z 000  0 z#0_ ܂d"'P 6 000 "L 0 ` RD` $R0 S l2000#1-R0" 0DD`P@,Cs,0P00S sP  sP  sP$ 0D00 S> y0g24 p mU$[EL1E?$S%\2 yP@\2CP0p0PXBp0 X20@Pp0 X20T@Pp0 X20T@P`D`(0T$0000Z 00S $0 0(00 0h ! @ PLЍ P @( X%d( %߉7&WZ^|-7@-@# 00CS0 :P Pp pp60 P00CS08~:0 Y@o Ѝ0@Ѝ/%߉O-a@ p5Pp?C$0e@O 0+upq Ѝ  R ЍOt`0S 0 upq `BE,J~ 0S %d( X0p@-"@R  lP"n/2~0!!UU08 T0p@@PB @}@Tp( X(( VG-HbpH@,#&PPH 5 P U W0剔LI J$ d0,}U 02U!U !" +I s?@sό0QlX2 G    <1 81 41#(,$#(,sO$@wu ,! (! $!0000 0 8< 4a0 p 0 8< 4S0 @H20H2( X6( p@-d@0P01ps/Ġ2P@ `^`H"̌ B B$ MdH20CH2p( XO-Q04 ЍQ\` \X0)S sZ0)S l0#R00S  a00 0~]0X T P2SE0!~P|0( Xm| 3$5vm%d(J.`LHPpU5A-x RUP@P@gЍPP0RB1P@4a4aTSp ЍA 0p p 11!1<0  11 ?01!1<0d  1P 1@?0ЍA( X8mRbqO--F%0@-M 03s0c00@St o;PP$ R!3PP,. 00@ : 8 0PS 1P" `Ѝ0S $U0S\0S9\  0/@ \0Sp 0@ 0 @vp 0S0S  @g0S  @" } @0St @D HP@ @0 @ `-0xP|"%   T`  ` P @ @ } 0 @``a MU Pj R`(:x(:(:|PhVfډڟlۃK۵G-0@ 8 0P Q< 0 PP4  6 0`P @ pЍ Q* !URQ  l Ln0H00 p?s0W0p P @ 0?s0Q$0  1!?/s0r 0 1!?/s0r $0 0 02/1( ?s02/0, X0`Px  P\ 0SD00D0Dpp $0"3?X0(0R+* 0H0p ,0#3?803?/s0r 004  pd00 PQ  t   0P KP yKpP1S1S1US1S 3S3S3US3S, z pP0p- p202 12 1300pd00 PQ h 86"  0 0Pp00S 13?<013?@040  vd40  PQ  - 0PA0O A0  5KP 4 0R  eYX`V P0Ei 06#++R`DX4 $0S,0,  RT0ChD0"P#10P 0 # 0QL \0  0P 0PdP@dY)Sm܉ܫƃRRaArrAaU +_݃ݦݾ8@-p@C`P P00 Pc 00PQ c Ѝ z0P< 02/!@ 2/! Pc 00PQ 4 A0P<Yܫ@-@L0 \:0\l00l0Ѝ |p00p0l0 \ \ P0 S |H |<00L 8  , $nP00x+lrެG-X` p@P Ѝ0PZ%V0 0;cVU D X0 X0 P޵O-@,M0p@l@$0`P PgpP$P @,Ѝ k 0 RLŸV^S PP8 PU @4p2 P ^ ^^^@ \ \\\P   @P@CL0|!S sP0SS Op0p P p $f _ L 2/Q0r 2 q 2/"" @ "  @*"*  P0@ S 2"!"0  0@)zgP0P s s// /߂߆+lO-`@PpMP0S Ѝ X  H r0A D00 s/ r qh \&P0p@P x q0 ` P 0 00 P 0 00 ` P s0 `P pP0 0 P`8P ߍƃa~R0/0@- PBU02S0P^0A-p`|P@P  PP P0S"R0R0\ެO- p`0P\PPX $P  qQ 0 @T 0Q\(2 R@0 PS C 0BXT" R t0D s   0 TX  R 0 0 p pP YP  L BPTR2 Q PEw%\O-X`0pM@8PP\ Ѝ i0Yl0L ,2 R0 r   00 PܑP" 0 ST[R rH 0/QPJ i B 0L˜ Z,$ z ,(\  l  ,΂l0\ll 0\ll P 00Ql"! CClX0ᓊ(03 0Y` 0PQ 0& P޵dG-@`PpP0S00S <q.p@q8WO$0S  0S 0S,0( 0  P0SP  RPpl Q  P l0p<0P0Q*l0S 2Sp  lXP0P  RQ@0 P 0xƃ@-?`XPP@@\@#T@TpW @@T`L(;O-`@@M18 00TP0S<0T D0S Ѝ1@ 00 `P0DS%0 ᕈ0 0_PQ CP0 Y:0 0 0t_PQ PL@ 0  P<0T 0B(:)O-M@L0Sp<`@DH S NP PJ_o VR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T:Cg(: A-@/pp0%B?[`0S b0ES PC Ahp@@0T?  C0(:0 PK@ %/(:O-` 1cMV, 01 SP0 S@0P`00D@H0(0$0@@@D0' R$ X0p1#r3<0#4004 0,<0^<04 PQ cߍ0P@@`00D`H0(0$00 Cp`02#  ,XPW002800qL0pGL08 SD00S    804 2800,0<0t^<04 PQ (100  RR R0(10@H0L0 p0L0B =` X[P1  (10(11  K  , @ 0B0 H0P 0H S1@0S  [I@(1 0A@  0I0@;+ )f %P(10(1 0SY 0@ B /oD000"s R"0P `, (0f0000$0D0SD0! 0CD0 0D 㓢#X0X 0 PP :X R: U$0`(00`P1Sq t U; `k0D\Q U`V$  (   P`( P\0K/f0 x!Q0pq P b QQ0S*0hQh  0 U `$P(Ps000 ,P#`@P  Q .b A0 b @ @ bρ LG?@@0Cs PQ*V !L0/r s|!0<80|10V3?1 , u\R000000U\`0& V0 0$  \T P0000T 0(00P0 00 ,@lV 0$ S1S IxQ1PP|!wR \TLP PPL0sPP|! =0I|1@|QUP0U* 0" 00 0x 1S \P@ 0I 0000@1h4bPP 1|!R T@PP 1a |10|1#40L0s_?00|10I@P30 s0Qs 00RF U$0`(00`P>1 S~RhaP0S 0S \mdIR P0S 02S 0S0S~ 0\2SS\N|!)xQP hPP00@ s ; |1P 1<OP PPPPPPL0Is0PP@1?@=haP0PU+ `|1VS &P@ |a``L0Is``@ !RP P PP0 1B@`PPTD K/\4ePP05=P 6 5P0h00h04U U0@IP0U* 0RPd01S\0!8P %4QP0%8%\0 P0PEd0U03:\8s0P P|!d1 [b" :0 0|12P0P0(00`P+P$18 ,'80PI!2S0P0 S0 ( U$00 `$0T00$000 ,@ D00S4 0,<0O[<04 PQ80,R$0 PI (:) :ެ(;'?h;zZW 5YG- p@r W pPc\aPP ZPp $PK/cD08QP0Q:" 0PS00  Q p~xPh`P 80"8 R 00 05 !$u(:s5 cp@-@5%SQ%5 %SPQ %UU<:QQp  0 0Q0 Q 0(:A-lP`5p@ @ 0% Ņ{@ŕ\(:O-POMpaP) b5S5@ ET# |T 5d 50 1 S!$52S$5P R88 _P @TEOߍdvP  RR @` d0C## 0  Z0 PQ d d0P Eh0K/0h0 b0 8!,q(r0d  01#c  j b  b,10,1#40L0sK?00,1001001#40>00010 00 000L0 CY(5,%PQ Hd Sd0P(:(?@-@ P >0 5(:0/(?0/(?0/(?-@-   *&0G-P`pc@0S  0S X| U +TyY0S 00Slc@ i(?t-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  @-@M Mq` @+P|Pݍ Ѝ`!rp@P=0D@rOP 0: S0 RP00 0 PP P81: S P% S  R  r PPl PPPU roPP$0@P(?1@(?Pj؈h@-$0P  0 00T$Ѝ  Kإ(Cش0@-4S 3/ (?@-b0 @( 0$Dbb@ :(?@-b@F7b4bb@O-`M$MpP`}P"NX1 b: S/b0P  rR b00pPP W QUP 0C P"V`R V  V]PN 7P P W`1\ 0(`PIX1: S<V2"92rPpU2PV9 PW002`` 0!$ $PPt P5b0S3]`P S R SpP`-pP ``1\! S R U7Pk`|5x1 "PaY $# PppU`( FPP 0XND% ܍$Ѝ_J F  F@F0/p/p@-P@d@ $( $(0XRX0X00\00`0ddhhllppttpp@-@ P  @@@DD@@@@HH@LLPPTTXX\~`\`0p Qp` .`P0@ S p@-0@"!Rc0p@-@P????pA-0@PJ04S->C?->C?X?9>:>C??n:>CF? 0? AC>?}C>G?mF?EnF?E~G?X J.X V  $$((,S>,i?}S>Gd?mF`?HHLLPPTTXX\\O-@  $$((,0,0 P0PQȡ\5 S L5sT 0K TT`XX\\``ddh~hplzlpwptttxqx>1[ h`ebp0 p$Q*\5 S `0S&P%@ PSزK 0CA0Q R,E2.0) T U0+P0sC@p/0@-@R 8< M4 M0`! @SP ۍЍ+^000 400 0  0  0 0 0004 QP S<#0#$0 2"8<"4"rb ##̠#4rb2"LABLQA- brs@  Y PP1+\# ^0A0 0 00L B 00 00 00000u0#$ 0 ',"'("&8'$"2&,&42r"bJ 40Ѝ&@-@0S6(GH00S/0/(Ep@-@PD @ ;P ,00S 60 0pp(G 00S/=(E00S/p/(EO-M 00@2Pp[@$20S 0`0 `"X   # 3W RL!0 0  0 BW@>[! R   X %|10SI p10SET@Z000@S0@0@ a``0@S.T0  0'W ,(PSQ RЍT /T AAV@Td00S X00S0S@ FP( 0 *(G(E(D(F(EP(F(D/t2O-0@4p 0 P0PQ8, (0R000U00S-  8`P&0SP Ѝ5 p X001P``` 0 00(000,00S/", (R00Z P000 `0` R0(0, 0 ;Q 0R000V00S  P0P`#"`F0S/"0PS0P Xo5 P PpX00 0(D(Fd(EG-@PDEW@ppT@@@@   0@S*t@p g뀐` X v5pD TCT 8 0 0 00Sp(G(G (EA-P` p@S5p0S M50S"0 SRpA5p0S ;50S 0 SRP@P@A-P`p@ `$P`P00@AO-HMQ M %#0@20 C_ `P/pV0VP(P,0Hr 04P`P "0S/" ۍ Ѝ20S'  qV 03?00?s0S0?0P 0 0, (0 R?(0, R0`00lHHQ(0,   P`k B0S0S0?00@3/+ 0 00S0?0 _00@ 0_B 0|` *WBh050S ]&0 0x(F(D(F(G(E(G (D(E@-P@p`AMM(y% 0 P@ \4T0:x 0 R0*d V%@j1P 940  P,, D%AލЍ 0:(0P 0 B(02 b>"9<Q0,00(!( y(hpn h(j,0$ 0O  _@ 0 z/P000 R0T 1Ai QfcQ`8 1 t0 {1( @( P QMh'@%h(D(G(F(D%e((D(EO-M@ `) PQ0G:0  0@40$?00  52䢟2Q{ p q Br sQ0< ,42# 0JR nTp R 04  0R  P@Ѝ( 0?1 r0 4 Y: 10S<000D0`10`  0?1 010S 10S 0L` $`1}100x10S po1pk1000 rpopV(D%e((E%eX(F(G(GO-P`FM M X W@S: 0 T5 RPPLg"0pSe ,50S! 000S Fލ Ѝq00 1000D0w븤 H0T00X0404QpQ\t`  3H "0S* L0 00 0  HP! #0000S q0 0 ,.P 3 $.P0!0J 0 4 @pp  0 0S ;  P0 !-P Рᰒ L000W0 H o w 0T0X0x2  0Gq0  j000Bc00S$ 2jp0 0G 0Gh [ Y0# 00C 4 S 0040WpPa!px1p 0 p< 0 <000k+000C0 0 S  n ^ R. `@p! P! 0 S D  rP      . #0 @#`㏷P0P 0 #0 S00` @ R Q\Q\l(G|(D(F(Do(D(E(D00S/p/(E00S/0/(E 00S/((EO-M,M$@%"[:[$0: S`?[ ` p&P! l&P `!00 0؍,Ѝ0 ,(&P  X&P `h0S !  GP c0S, H : : z  [ 0%4500! ?0S S :00/0S 0 S :V00#03*  R00S :0S7 0 2:* 0S R P0@4`PƟ [9U)Q90000C/-PpP P90S 0P P!H 0 0P080S, \HTZ  Z6Pp∸ U0 00(p UxPQ0X ZzP x( 0 0pP?P84J0Po"$0 S7 R670S2 V0;Q0-*h0S* 7(d0(3  <P T70S !| `p @ (.60S0 h0!6&0(Q//V +:'<V  3 #\  R QtP   nPpQ^q U p# # PE"c:U Pp^h R[Pp%Q_'qP tPE! p 10S0Acp0 Pp ZA 0S 10000S p50S 0S 0<  pPQt0/A% 0S 10000S 40S 0S  3 10S0ꊡ  0000 04 $0 S0 0  `00 0!p$000$0 #600S,40S D4 PP @ p tx3 0R00 0pRLtRPXd00H0 0lSS/ 0S X30S> \P !/P 2 G0 \00&&t2 0@S0:000S0<`40T/806#e PR8P<`?he0?\ `P 0H0Z0`0A(BPp`1PU 0\I<5 D5@0LT 0 b32 R p'@ `008ğ05!"\ Q 0 D0/0 wE#3 0R< S< `3ȓ0S0xpp0@S 5d0, @ 0 pp`h30S9 \30S5 P0 S 3 S?pW q~p0 % s\@T`S  L0 S\00 0T @T`VT0? `@p1 0t20兑A0pY 1WS  0@# 0P0  a D000Q 0;*0 0pVTQ`p@ `V\@R!3YT @1:@T(a p@  00  P z0YT  \P  0 `P 0  R * A l!lw H10 S' T[< 80R0 š!ȡ0S  0R ؀~P !0   0p0P``0P00C0Z<}P5` (G(G (D(GZ3(E(E5tMZ(D :M(D(D &O-WM M'0ASz0 t p;P `7  <L H.P 07 00A  6P 60S 60vV6 /X W@0`06`00夦1࠶00V0:6 R0S3@`aVoPVu#Wލ Ѝ4 P P   `? 0S 3 @ F  LT0 00@(0S Sxp%+o<DH(P) 4 1  B- !  ]I% (0RW  ]/B 0S Y(0AD<0HS(G 4(YY,p?t$l4 R@ )xX( I2C 0,  R1 #( Q! R000000X!"!""Xdxhp5 ]/  , R1 #(Q R {{ x@ 0D00Y *( R ,I?2"X(,`!P@ D aV!X"Xdxh  P@ D a`V { {@0 (0S $P Q00r|0SE! $`x\ h`10!F00C0@P0 "00000C0!" p0S@0 !0C0 00@z ;BZ(EtXY(G(G$(G4{|h(F(D(F3&0(F(D (G(E#(D700S/0/(EO-̢̒0`1CMa@Tߍ0S Pdp@FDAG@D0 ddpC00@00C0 00 R2PU 20S 200S0R0S Q0:000RP p }1Q R8P@h1 R 00"P <1b00C$ P X P>0P00 0`0L00 RppfRTtaX[W`00!Pa l0 0I !000(G$(G4(FQ&0(D(D(D(F(DPsH(GIO-䳟P3张pM/`@ 0z8\1P 0/ |0/ 20 =T#T3 0RU SU <0 S 3 S  @ 00000CSGTYr! P 80R000303L32   0/*8` R b3",Q Q0r`B*$P2020S P Ps 1 PЍS   ZPe?00 1>!  R1W 10SF0T!  0 S01`00/ 7  030!ܰ 0S H0S 0 04040c/ $ 80QT $00$0 40 4L3 2   ^[0{ {<0 xPpC(D(G<T(Gx(F(E U(D(E(F(D(D00S/0/(EO-plMX <t2tt00,0SlЍ0S @d0,Pz80  Pl000P㸀@1 0 0D RpT05:E`1 PRp@R\tR`Xd00X0T0@SF0 `V e%P 10S  0o@P%P 00S  0 0S  Q\ {{00Ѭ |w0R! 0 T  L 0<3(D(F&0(E (G ;(D 7(D_ksO-MЏM@P=0!n0 ;0t0?0SX0S $5Sp0SVdPWX0S $Yk S Y R(d ?pW\ 0P%T਀X僀 H\;00!` 1B`01$dQd0ڜP0C00h01`l0R!B1d0`.0CW P0=SLq QT00H $ 0S 0 x$5> *"`>T>0S 0 0ꨭS0 $5B111`R B- 100 S H $~0S% ( 0帐- 00$%BR0ө`S<B11D%L0 PP  E PP 0S  <PЌ *堐<"<y<0S A0 02d0pA?P0;3A?`0 =<0T0.L0: ;0WHQ RX0>F@ @0:8 <48ϠQ bd{ S X$,0 Sa?^ @PC h;0S @ A>+@B@  CP;"  @0尠 \ 0 000:J*!::0S 00 0؍ߍ0<00

+?H "D H D 08\<TR\\0D7T `V=S(  H"T VpB$r,00C S=S|^q~S  j0;!"\Q 0 h0/'00S 60S tnP%5_0Lfh  d60S 0&\Q\u0D05P5D 0SP5550;."\^ `0 0/dh pN.' `n3&>/@5p !>! "$5S8 5(0W8,(2W42,2<0002SV0@ x S0!!~ 4x090 $ST0< T8$2!S\0P 8V=SL5s35 `!~ ?X00S-["!>R\ /  X B  R\ ?0  020C02`H0T SD0\ 0 3!΍0h0DH0lE ,#0AS0 000 0"0C 00S\0X00!!!`V0: 0phppPp P`lXX ুX姁0 8PPK,2!~00<0S. dA40! ST0T00! !0P SX00ԀYd4p40 0 44000$5S `0|63! 03080H D DH `VQ 42!.0$00` S`0?00S00\04 R(D(G<(E@(D(G(E0 U#(G (F(FF&0T(Fn(E8(E<(F(G(G@ 8(G ; (D4(D(D(E(E(GX(E(D(Gxp$5S|2! `0h ppWS $%S0! !42 D0D ,|  | x0  ("xH Ht L3p !n r! T0oP3 L!T0 R H  2 00000 D0F|P1  q1*110S 0 020S QL .P 0< ST0T STT P hFAPt2 L e0< ST0T STTYX0" 020S}0 S\0P S\P BFP 0P S\0 S\01T00`# 03 ppS $S00S0`" S\0?0 0 S 0\00001D0p` 0Rp/d0W S`0?00 S`0?0001D0pR8 0 S 0\000S8D0;!H H Xp㵟Y8 0 S0\000S8D0 ;!H H XG-P`@T(,p W @[A-A0 5 P0#R%(r`!00" q0SR 10a0  a*zt1h10S 0 00SP03Q0S4 5P@ 5*< 5U000S Z0 0m@jTP UAt0Up Pd0 0S L P<0 0S (D(D%exN(D(E(Ef6(E0/(H 0/(H 0/(H -@-  0 Sヾ&0G-P`p7@0S  0S X| iU ᄨTY0S 0S6@ M(H t-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  @-@M Mq` @儻P|Pݍ Ѝ`!rp@P=0D@rOlP 0: S0 RP00 0PP OP81: S P% S  R  r'PPlbPPPU rPP$0@P(H 1@(HPj؈h@- 0P  0 00⭿$Ѝ  夿إ(Lش0@-4S 3/ &(H @-60 @(v 0$5 6@ ;(H @-6@555@P/00@-0@S ̿@ (D1Q0@?o2P  R7 P0 P0S 0 0SS00 0000/ PP  P R ` -X XQ PPP0  000  /TTT 8(E,(E(F(F(FT8 t0t 0 0 \5` S\0 X SP0\5L00S/\5, S 0 $ S/0\5/(G(E8T 8T8 (ES>h p@g0 \\L5SXPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//(GO-p4M X \D\\t\Apv@H:4D40_ 0 P\ep MЍ0/-0 Pt P\JP0S 30S|30S ph3h#0S` \#STv P H0S <:0bS s*0S @"\5S 2 2\5" 0C?o"20Sh [ŚT"40Q%㓈Pd0$"0/M-:010S?,0A1(Ÿ "\ P 0 B0/ 0Sg0S 0Qh 0S |!\5St1\5P l10S(` XA L!0 0@! 0 *_ 0S f0 0 00 QL0Ph PE @X* 0R A/(E4 ;H(G(D(F(F(D(ED(E,'@(Eu(D 8(GT(G(G(G@(D(E(E8(E<(FV O-8MM 0t*08PpP3奤 80S ᓶ :P3咤 `0: S HDYPލЍ(8H0 hSO 0)00S 忼00 7숟 7 8   ݤ` ؤ8 Ҥ8 ̤[V``Z`P`@7V8 -P 6Q )P  D8P0 0l8|6 R>0 0p 0<&0x&0PT7p0p60pw>0 P0p2S# *-P *|-P *.pVXZ hY 4[ 0SY?관X| V. 0-1  , <0\9P$ V Q2C/+oPPe 2S|3%8 S20#"20$#20PA 2S@4$04040|4ƻ`02P$V20A\2@02 h,2C`, `Fb\, 0| 9+H 0/`0PPT#0`P\`Q=S/0P 5` ( 2RV0 S0Sc 5*< 5g3 30S l0 0`20S 0IL3 0 S` V 10S0`"S\\ 0D}2= C ,0" 00t rAo6#06# @r00S10S10S0=S0S pGq0007 ` 0L%000P%X30,/a * l10S Z0 0(F(E$-(E(@n(ED(HSc(D(DP(G@|zu(G(GǷ%QxT_}+LT(D-(yc9^D1e(E0(DFo3(E@(GVm"(G(G (G(E4(D(E(EG(G(Dl(F(D(F(E (G0(D(G,(G$(G((G4(G8(E(F(F=S$0S)  0`<<00P%X30*S0 00S X0 00S5 0 >0S wP@a 5*N> 0:#: 5*d1g p10S /0 000S$SP0a0* 1G 10S 0 00<cQ3dpP 0Tb<0*d2' p20S c0 0r0S0L%r0L%r0H00q" P 000cH00ST<Pc*,3830S 10T# 0 00L40q"  400cL00SPc*330S  0# 0 0t4 R.0E q\ `PVR d0SPl4d*]440S b0$ 0 0$d0Q,%R0%45 R S! p0040SPHu*-X5jd50S 20% 0 00u(0S xQ$ [0S< x 0(%0Sv4Pu* 6=60S y04& 0 08%<5HRS$ - H00<508SNVPv*660S K0& 0 0v@%D5LRS$  L00D50@S%'Ppw*770S 0' 0 0 7 70Sx(w0S0Sp0L5sl0Sd `d(000 80L50P5?T5V> X5-0$0B0^ Ӏ1`@R$@@B!!DH0 000L 00*K880S P0) 0 0d PYt P1TQڨ0QUڜ p 0 0S Pi*9U90S 0) 0 00S0 3 F0S0QQ'` >0 0S| jPdj*t:#:0S _0* 0 0 F0S F0S  F0S-(Q\KQK H R0P;0T  E~0 ppV aF!` . R  ` vF0S72 pF0Sb]<Q| hF0S bF0S \F0SH  <%L 8 @D%L<0,5S0SO p t,l000h<0,5<0(5H000/<5L08%0/@%D5*4P<<0S U0, 0 0=0S (=0S(4M*2D=oP=0S 70dmh !,=} P< P7= 0S= @6PL Z p +@TW> @0 @?00@1>0A@O@@T.P`6  +,@!>P) ^ P;00> 0 S 1 >5> > >pWP?ppX ? 00@DT@8L4H$0/dLc A! a,3 t@`1P Y( 0S  r8L4H$0/d@ A! a,3 10p60S  WT6p00_@<P06ٳ@ |6P 셟G0%#500050S 1S z'P 5 5 @Q @U0@ u`P @@0 8< 4 0<%S 50S $D P 0  0  ``1 400 0 0 8< 4Q  +0SXZPY 04 S dl0S^\KP_ 04 ,<0Sd=Pe0 $V:PP/PQ ȓ0Sd$Pe000 400Ry dc|0ScT Pd0 0 0iD\D0S 00 0 0 00 40 GD0S 0 0 00 400 03D0S 0  0 000 400 0@D0S 0`v``&$` 00p 400 0`qD0S 0@00] 400 0 \1 T1Q1Q,+ 0S xpA 5<00.X!00P!0L!0#00#p RW !0Bs00P P0S,0@&PT0 pSW0(E(D(E(G<(D(E((E0(G(GP(FLABLE3(Dd}(D(FM(G(G (D(Gn00S q: S *C   S D00S @-4労 * R  S//(E(Dx1p@-0`S d`%@ ,T D10S810S(a 1p10ST00S Pp@J00CS0KpP U 00CS0A PPYU NU YU0 P0  0 0 S(D(ED(F(D(EE%F%p@-PD0@0`S ij 0EPp㈱(DO-01 (1$100  P 1 P 0P  PPPpp( @ PT`00 XT AV =p WP @@ 00p(GH(GD(D(Gx(GP(GO-@1$M`Hp /2#$`  ` #P 0 <v  Z((偳P U 9 0 QP$Ѝ? 00 0/  0P0 0|00? 00QS / Ϡ/"0  8B0P :(G6;(GiO-`M0P8 0Đp@/2#@ 賔Z 0 Ѝ 0|xPZ ЍOʲ 0/  嘔P 0/ 0Pp(G(D0wC-P`U@ (1 U &P0 PP0 0T2`p܀*0 L@D0T@S   8L4H$0/d@ A! a,3 l1 ~0S   0P00`0@T Ѝ(Gm(D(D(E(F 0S/A-@p da Al a3`Q0 000SR P00@00 0` PЍ(D(N(F(F@-0P@T@TXd pA `anj3ƌ` VW @ 0 0 0P0@0@00 Ѝ(G(Dp@-`P@XMX  ' `P @:XЍp 0@-Q0 H0@S \00S P@008X0P00 ;p(Dhp@-<`# $  $0 \# 4$$ 0<$( 8D$ @HL$C0 5L5s0P500ߍT>(De(F(E0 \P/Q/ 4    Lq,PŒPŃ , TPH40S/<$0G-4DP,4$ 40S2 40S. T0SD #3 `3R0B-R? S*a 3`30S e0P 0T`dSTSŕPs忕PUU00Q A+P 0S ?/@堕ផP`"hR0"00S8 pr003Pb0S* xR0S* 0R0E>0*X4  2p510S q0 00S>[P10S > 1TQ d1* X1`H10S D0 0H10S <> (1P 0* 0`00S "0t 000S d0P` 0偯M 0;G8(G (E(F(F(D(F(E4(D(G(D(G(E(E(GP(Gx(G(GH(GD۵l(E8(G(E<.(D(NHO-@PMDp8 R03B@^? 03 ?P00PUaVa` 0 SQɑY\ B"0\P  0X" L0/ w0 *$$"$2 0Rg Sg r0S 3S :0s? 00S  00S`0 S  0`Th!Ϡ 0 8 L3R 25  B # R#  B ` 0Q" @* 0`00S `0 ` `Ѝ 0aS  )$  B$ $ R $  B (D(D(FT(G<(Gx(F(E U(D(D(EA-Pph0``ATR 㜑@P<b0S @ 4#1p0A(Gh<0 0 1S01/ 0S00/(Gd0 5 /L0P 3 SP 3:.  SR///(DF^QO-0(p,P0`4@8 P P0P \ 0 S   0 0 0P0  0S <0 v 0 0 (D(N(G Q/0/O-@8`夠 砰P8Q ЍP@p8Q Q0pሀቐp ; > =0` R P/! 0p P  C1p  1p @- ;t ;0` xR o/ 10#/C!000P/@- ;x ;0` |R  /  /C! C!/! !/@- ;| ;0` |R  /  /C! C!/! !/@-w ; ;G-@$Q uql#`h RPSq p$ Z!Y  @  T*B\ !B a ! L @DQ%`L  R V@T@ ^@  `R A G-`RM@Xr PP p(P`` `[dP P:  8埧p "0S ߍ<0`0(00,0 00004008004004 04$0D0(0P oW\  tpV tnp* hd7~` 8 ! @d 4d (d d d 0,0d0 d `  p 4`?`a8S$Pb 0  00*0 0Pe  0 *0 @dAde@dz = "   .A-@Mp`;@@ p@ݍ P@0-@ሥT 02 " O-`M$MpP`徦P"NX1 b: S/G!0P  rR !00pPP !W 咦UP 0C P"V*R V  VPN xP P W`1\ 0i`PIX1: S<V2"zrPpUsPV9 PW002`` 0!$ $PPt ZP5V!0S3]`P S R SͤpP`-ŤpP ``1\! S R U'Pk`|5x1 "(PaY $dPppU`( FPP qXND% ܍$ЍᠤJ F  F@F00S/p/(E00S/0/(EG-pP1P00@ʟ 0F X 3#!5` 5  121 S `05Qpp0a0!R00S w9% 0 %# 0! RXh000R T00!ǁ8P,0(D(G(N ~(D(G 3(E 00S/E(EO-,Mp0`@Pအ0V000,Ѝ000/U $p$00 0000P$ R / 0 00P( t(D9    + =(EF^^F D(E(G(N T \3 tG-QP A3aS0Aa M` 1P11r00`00 0000P0PU <D㋤py@p@YU 0001 0P@  Ѝ0ATP  "0S 5  nP@LCP@0(D^(G(D(G  =(D   (Ep@-P0 % .  @Q 0S p# #300# #:>00T0SpP8Pp(DF^(D   R/KG-P $` 0pV@`0 @`` V`@&!D( `G-@P 4pS Y00000`auP0Y0\ \! ##P0p/Ѝ_uP: F^^F :p@-@P`    pp@-`P@ ((UX0 3?X0pA-$P0 U PP(`,0@4p*^ :^ *^*X@40P/ Q\/O-@Pp02#U 1! `R$` J U c9# S!V Q  V30  P$ I` P0 c9# S V!Q V30  P 0$ P ` U 00 Ѝ  >. J _0A-1àQ`P |0| ||=0Sp P$@@` pFQL @ @Q ࠱00  >> } _p@-@P40S:a80Sd0d dd 0C800S   0圊00PP80Sp0  } >Q , _ 2,0S/`0@-0@  L3,|0,0080S 0  0@l(N  >e  _,0@-S ,0, ,,@TP X@U >x  _O--\MPpU`@8 U0!@3 @#81S41@D2s2@Ds1@DS@D50  0 00|P奤 U0#03?T[[UP͇@D @0P$05Q 劤O0$0 D 0XR @̈"!H08pp(0

 _ B > WABN   >  } > G-0,0S0 P@U`40S*᠈Ѝ00qW!  0W@P   k@Pp > F _A-`0@c,0Sh0h hPpiQ H0< D 0P@DT@ > _ aC-`@0(Pc,0S0 p=Q |0l x@PEU 0P !  0 P P Ѝ > q _ sX0sC-Ђ0@ P@` 0 00 0ሢP 0 NЍp(N(F X0sC-Ђ0@ P@` 0 00 0mP 0 Ѝp(N(F.p@-0PQ @`0P Rp   T0`! J@P 84Pɟ5(ED(N^(N@-,@P,0S $E00(N@-,P ,\  E Ѝ(Np@-@Ph0h 0 SX0d0R 3?p@006.4 Q#3RSpp(G(E(D27@-0S S+,Ô2 R0 ELh `Q tp\PCbaQ* Q( H<OP 4,B 5*< 50d30a3210S Ƕ;0 00@ @7.Bt#|3 Ŝ & 0 P xXPA 5*< 50d301$10S ᒶ0 0@ d3S+ CQ+aQ# 0AS"P 0@a3d3*`|0p00S e0 0@S Ѝ04(D(N(D(D(E(E(N2Tl @- o N0/A-pP0`R@ @TW8$ A;O-0p M"##0@` 0$03@ 0S \#复pPLs0S@P9# 00"8 zq$004$XDtUhUaU bU  P7"i0E S0 0Jp$j @Q P80 (0 0 @*0S ,00(# `!UP PiV0 XЍVp FpNP` EpAP`PDV:P@V\ 2P p0&0S01$4  !r P 0@ Qp |0@ Ip  @0P  p P0 P0  !C P4 N%< ? ?a  T 0S 0  PQ0 S RPQF ?0%<@dz(VIO-P-@p`,M$P "@p($0S0$020S'$p P V 00 0P0Ne0  +fP AP PP `pP$p,Ѝ`P0 `P , ?o  0D0 00 `z p 0Pzpq !p Up` D%<J` ?DuUG-@pPT!姊p`:D10S:p l ph o09 6X $$ yp+ P%W00S $$ ip YPPU `fV rV GTP$$ | Mp$h%< ?X!p/0/ @- ?o NA-@P`pP 4{\ X,T  @@& 0夳U  A A_&0M5@- 0R0Ѝp` P@^0Q  R SR  R $##0BR R P - (P/00#s01"$# ?pO-`p  FW Q @ WP00 Ѝpꁀo > 6 P dp7 P P*"? !  RP*  @ R*P*? ,#? O-@P0p@`P T \0᳐ 0S@P 0S@P 0S@ 0PP 0T) ?@TSUヰრ:X *%@@6 p 7 0DPu R0V@\(`@G-(`$p@PP 0㘤I$0 0DP Q PЍ PC-(p$$ 啒S%p@ 0 `%P Q Ѝ P404-@-0  Ѝ Ѝ/-@-00@BЃ 0 Ѝ@ Ѝ/-@-P 4( 囊 ǛЍ Ѝ/O-MP`@PЍ  P[ p WP 4S  0_PDpTA$ Q 0MP 0S 4S 0 0XS$ R 0  'RpH0@!!~000 0 0  @ 0P g0  P~ p9 {T되'P*K`G`4`VS ڴ 09 ` 700  p`PJ 00PX:JVzBFhO-,MX`\@P$_ 3R 4S 0᐀,Ѝ0 P P0   RSRQ" "S 0 d000 00 @0 2P^4S0 S: 00 000 @0 0P$0 oO0@ 00SS P%XPp'xp   0(b 0@S4S 0q$R  pPe0 RS  $ 0   pPN P0P 00000 0 P(p6JU)<YcuG-P`DMp~@P$y@@ C>dtC$$0840; p+p ֓-p| H4$t: S! W B.X !pH $4S< (d,T0.B.$ p (d,T0"W|(d,T04$t0dT 0r 0(d,T  00$ 0^ pQ00 @4S  0p 0fp 0 P Pmp| 0 Ppu P P 0j 0 SpP5:Ѝ0Y spX"@d@d,[w@-@P 4B BRP wp 8(4  2Ѝ@Ѝ@d@-@Pp P P4PS 4 ?dA- @PPT 0p{`X` vrp0 p~$$ @-@@T@RT ńCsH #E00<0$0@000< 0 0 @-T30    G-`P@Pp 0P} P㬐`0`00 00QPU:Ѝ 1 00X0L@0`@P1 00, 7PUm&0[C$4 A@-Q@- `S@l;ЍpP P <. 0R00  - O-Pp_o 0R0`@tMR(0S00S $ 0R0 U tЍP PU 0SHQE (0QSA 0RS R8$ 0R S R.A 50[ bP#  7/p % 7/p 40 P m0 $8   P P  |P A-@pP`{P 5/p 4 5/p 4 -C-(00PS4pe Ѝ$d@ 0 +0 0d`Q 00  0 `WP 7KO- 0 0pP|@ሐT  P Z D` 0 {@- Cpp@-P@`0 2@Tp CpO-Pp؀ $M`@0吰     Q  t0 p ` X0 T p`⟖04S0  $Ѝ CpmO-PQ@04 p 00` ЍP PDU0 E 8`P0    0 4   04 p #00 #p  30s@-SX`@ PV0 ?o2R0S  TЍp-@- iR sR aR p` 8Sp@-P@P (`UPp p-|p@-@T 40`P᧴Ppp-iR@-- 0 aR bR LR( sR% tR@P 0P0S`00p`(j0 -p@-@ M\P`nP0 0͵0,0S ݕ 㙕ЍpmtG-Q@PM Q  ЍA~␀ p$z`P phB~0 00 ` 0PP y&{t@O-$M@pP tZ p $ЍPP0  0  0` H0$0V!<#P0*Q P`0 0?V `S0S PV0P `E0t PU0 op $yP< 000 00 `P z 4! `00004 40W0000S08pu $$5 3 i0gH R*b0P01 T0PYZ-:L0SX 0 pO L004 0 00P0!(P= 4$$   4 P44- Np〰% 1a|10S 0@-@C^M E$嚔E$4 30 n#Pg#Ѝ0 @1q !_0 pY0 \zX 80 DkP<1g%< D +<Ncz0$ 8O-`DMPp4  1币<0!p 0S& ! R"!DЍLRR a0BSS0 H10S  4jP $@P   Vy@ >wP䰟 y T 0 0@  T @0  @P@p D%<e -V D(%A-p`(P@xP0 p!`P @00 0$0@-@P$0S 2y@/yO-p 0T 00S!Q` A$NP$ a@ P P TdpT T  v0$ЍP` K|%%< K?p@-P M,@(`&"3X pP0 0͵0,0S ߊ 㛊Ѝpm%_t@-WM M`pc@T 0Wލ Ѝ0S@ P忊 $4 $40 xI0 DxP x x圊 02t唊m0 $8nX匊T劊#Dc^R%h%%&h5%&'?'k%P `00CS`0p S00 P0S X0X /XⰋ%@-2Mp@Q aPp0 Ѝ@L0 HFP 000 010 0!pp4Ѝ0 80|xt 0 D!\ q@0 ?/8r 0 # 30 RS- \ $m0 8 00  pp1S1SxЍ@݉ 1\S\  TЍ@҉ K%%\%%%%%& &0&%& p%&$mA-PMM`" 嵉" 屉>2r@pTݍЍ  ៉ ᛉ % #`Vk D呉  .  `0"0"BBP pr0S91!BBgBdb $ 01P "؞P%$ 01 "TK m0 $8#0A,?#  b @B2 0B)&   0S 0CS 080T X aaa11b?Ɲ&G&M&f&_&mh5&s(OD&&&m''J%A-0p @P`M!H @<"up020SbP+ lP`P a@ P uP xP Ѝ@@ p=@@@0S001 P 0S 0S P\^ 0 Q  先 偈]0p`pV r n Q pe   `4U K'x%<' KƝ&G&M&f&_'p@-HM@P`4  01 0S 1D0!tp T  P 00S  0 iR TR LR Qa0BST plRs0BLtHЍpT p N''%< K?0 Q /0@-$M` 0 0@P!!8q0!tp#0S00Z P 0S80S5 P\^1 0T 00S! 0 a@ P Tx/pT $T  $P$Ѝ K(8%< K?/p/0 1@-  RO-PDM@4O0@( 89 `: 0p30sS) 0lS  0P07 8# 2p(?0$0>0 0=00<0 0;0p0:00(000ᾆp0 0,0P,0 0H )#  p DЍY0X K(oC-`PPA @TXPP8 [aLP? \@P; Dj%00%0CS0 iVP P5 ?P o_P0Si XVpP =P'a"a >P  >P  t{>P  `u>P  Lo>P  8i>P  $c>P  ]>P V U>P N M>P F E>P > =>P Y _P  DP ZPY P}?P @U 0u?P pUP  >PU `}"80x#x >P P P2""=P  ^P_ UP  p $ 02#W: P5?P @UPP k` [2" =P 0!xx e>P !0xx Z>P 0 +>P  0 t">P 0 T>P m0$ 80S n_P p )>P@#0T ᴴ{i00Ѝ-+%< N+ N,,!QV N#(P,,-,8,EL,T,],h,u,,,\,,,, N,--- NƝM%p/0/O--@`p<[M0+gpp  ;0S ЍO0FS iS:PpC>؀C$dP W XЍP P W00h HX:PV0PD 0 <^UP0 $40JP+ s_ LUPP HUP 8 NJP__8 ;P $8  pQ< |pG=P <X0 P < PPh0 Q000 00[00 000 0S$000,0UP T0P00 ]PP D``P D`$JgPP0< =P <hP `hP LH B;Pt 8P <;Pn L0 SH00T0$ RP0, 0`0 pq 0S$$03"pq$0`-|$4P d`$$"|$4P` V0 T`P' TP# W'xTP K]0P(0 (_`P(_&? `0 RpqBx :P.9xo d :P  L :P 4 :P   :P   :P   :P q :P   :P q/  :P q?Xr?p 40:P rL1S 0Rr/0s/0{=r?+9s?xr?  :P ,s/ z:P s!a$$c{$4Pk0\Pl _`P _$4` 0pq\8 x8D ;PS DxP D p|\D ;PC DPL >:P8  (5:P/ v d,:P& mD D;P $ D@ 9P @ Y* 0>I$ Bx $ zP$$03`":pq$ zX$  0P"]  $p  ,$8X0$08$g1T0P `\X[` $4pq|b$$z$4Pp`\>$$;`"pqC$$rz$4P`-;%< N--?!p-0-U,!,-v,,-,----L NƝM-..?.1\#,U.Q(P,-,8,E,T,],h,u,,,..j...0@-@M P } ș 0 0SHp< </ 4{p$'0Ѝ0 O/i'/%@-SM@P, H0 % %$ &&4 '@p H0P0x00p0`0h00`0 0X0D0P0L`0|`p$  D Sߍ@i/5i/Ai!/M@-@   UЍ10S/p@-!MPM@P% PA. (01P A!AtP 0`0?oS c` 06P ``$0 0A. 00P0P A Av0 0A. 00Ph0P AT TAX 0 < -4ލЍp(O(Um/Y/b/i/v//s@-6PP EP > %`@T?ЍpP  00SVV  >@ O/>^0 R !O-M@ Pxpp"`P"  V  RFQP- T?QP::QpP Tpx3QP T \B7P 0"h 0R00  p!  )7Pr 0SohQl @ 5zpal yT! R R RZ  0PW l Z X卫X (s<ㄫW 0j0S, @ hyP@ `ypd HQ L 40R !01Sp0S 3/p\ U 8 Xyp \ [ 5@ `yp Ѝ O(//_P///h0&/0 0S  Q0s0S00RPP   P@YDp \  R< PO`YV8Ѝp0CǑ O80L0i@-@BMM c 4p 0S 7  /  (ǘ(@0S700$0/ (` 庘(@0S BލЍ<d}.@ \}&@i0000@-MP@O@P RP Vl0l l1R 0 0S ,pΩЍ000 OE0Li1@-@M   pЍi@-M @q5PC0 x p 1Q0r R0s04 1p`Ѝ1CǑ P01Jiis@-`Pp@ @@;5P0 C@PhkQ P@ Lb@OP 4 >bЍp1Ǒ P;1J11/17@- P@<pT TBLN P@00 <<0400N@ Ѝ0 PJ/111J/P7@- P@p\ \0H@dN P40 00XN@ Ѝ0 PY///11Jp@-M`KNPu0P0ЍpQP@Ux|_@Pd0 D*p<Ө8 P@ PP a:122i25@-$MpNP?00$ЍyQ`J_@Pp 0 XpL壨P@ P`@ p$㝨a7|2B2Wi2p@-C{ Ѝmf2}@-000 0  Pvp `_@Pn| ` @vpl P0 R00bS x{=aCyU p{{P ix222hs@-@`/PP  2p 8o0y2p@-` MP@{MP P Ѝp P%    yP  PM@}WD6 iv0@-,M@ P3P0 C p,Ѝ0 R0 s0S 0  "DPPP  (M@GWD2Ǒ Phf1J6p@-P0p@`@@MPH0H HHPQ P 宧`p_1 Pr1J1@-T @a3P00Ѝ  p  jZ2 P|h@- 3@-M T@?3PD0D DD08 0} p$IZЍRǑ P1Ji37@-M T@3PD0D DD08 0\ p$(ZЍǑ P1Ji3E0-M $00F P  5Ѝ䀐i25@-@0L P$0$ $$sL@11 P1J/00@ P/a CRWC/A CR=C/@-00@- M@ 70( 0 p Ѝi2p@-PM `@@Ǐg{G 8 8 :zЍ$$? ?mf3P3\@-'@dKPP m'pPL`` P00 00zt0@`Vm`` PT0d0X @ @@@@z Vw03/` P3m%f@m3a3g3&040////0 L0L0/%f@0 T0T0/%f@0 \0\0/%f@0 D0D0/%f@0 d00d0/%f@p@-@pP 00p00D S 0A0CS0$Pe>P 0@p%f@@-p0(O 0`P/ R/%f@0 O- 4M@@!2T0(  DHtpď$P(0 `!pSđp D@T PoS@ڔAP`@ z pxp`P[T000 [  v R  P Q R/ 0S $P\(P  1/P r@0S  sp 0$ SR(0 SL喥\ 2/P W0(O5;e6>^5O-MMPp  T p`$s  IpP$ 0Y  $2-x  sp.X ԑp sp Q Tx @^x K p$(Q x$_X@T ⬑X00@0 0sPyxM @0I 0唑 ,0@4@sp 0[0Pd0o 0P 40,@xsp<e 44Rx](H0S #P31CxH0S;I0S8Z`@T 0 3/@: " sM0S:00!  l"gM0S Tx@8 x@03/@t J#I0J/spNI0!S㍤a`"%J` 1 0 d1 T|p 1 d\!1 Hw`@#%Jo!1 @ t1 x!|1  dwP@Th 03/@ 03/ݍЍ P/556Zi6gi~666x%f@i7>i7R7l7(O P0v 76717i<@5 ;777777O-@PpP  p T H@HPT!H}`P \PPU D1O0S vSSQS tW |P.Z  uP' J1P! K0S 0 L0S 0M0S 0 N0SO0`S PPV v 2 P7>^(O%@-,MP@vpP HP`(  p0S hr H.P00< <f0 $X,Ѝ/; (U(i8; Z(;!;>@-P@?0 PD;PG-@HPP0 `@ Y㔀KpKɔPP  ᳌pp H H@@@\@;hf Z;2;r(U"s@-@{[H@P00ЍpKPKᕔ@P <` 峌P[u ;(UVs@-@Q1H@P|0| |%KPKl@P T` 劌P[u( iЍp<f ZH;r(UVA-@"HPP0 `@pKbK;PPp ?p< >FJN@yf ZT;r(U;@-@ \>.PP0P PPL 0 S@@00 >00Ѝ;Ǒ Z];r(U&0;0@-M@GPGP GPpGP d0P P P Po 4P?p .Ѝ0y<;;h(Ui7<7@-@*d~u PP HvuDP^ P! (lu Ѝ0gu@h<&p- 9pDP08pN/KSnp `|0 @h P,00P0P,00U0,`(0DN/bo%ݍЍ(UiK!B= @-p 耐iI=p@-d`dP0S s@ Pph +jp@@pP@@%l(UHO-+pPW` 00S`1 000xSP p<14! @T Z  P 1! P `IR  B`W    0P Y:WWP P0@DBt@UWAq0@D@W@Dt@@t@@&&>>>9Qp@-@P&00S#0 000xSn`Vppn`   ,?QQ0S p@$$n 00&z>Js&p@-P M@ [U U( 0P0 Ѝp 0TPTT@ !?!0P!!`QPP  @z 0A-p`Pp@ @P( e AZi//p@-@P`M   `ЍpG-SMMPPx!x㽚pX!\ `F@pZi>i(U>Q'p@-`M@cp 0+SЍpDP  v   R # <hp 01S 0/S Mwi > 00S/@-@vm(O>A-P@`TpP @ 0SP ( &0>A-P@p $`PW\ݙ TPH0 000  (p`>>&i:@- M @pd d彙 Xz%P500 Ѝ0, 1p奙 ]>>i9>@-(M @p 唙 'P 00(Ѝ 00S H =%P 02 , pn ]/?$>i9>@- np 0QSЍS   l?? /0d 3?S $S HHH S/< S 4$0 ,/(/$/PP?9PP???F?4?K0x 3?S $S $S PPP S/D S <,8 4/0/,/(/?4???T?9?F?KG-X`@p1!0R J P A^QT T<PD@YZX40PE00G DQMJPz@- M @pl徘d #$PT0T TT0H 0p@@,K Ѝi?\?lǑ ^?vi?@-@(M!  0P p< <傘4 p(Ѝe ^?i?@- M t@2$Pq`0` `\ rpL 0@ 0ip,X Ѝ?Ǒ ^?vi?\i?A-M< Pp!90@P "` # 0(0tp0@`@$`<0~RPP100 0(000800 .p& -!P@0 @ p  :R@00C00 /Pz00ݍ@ T0S l@0 @P0  S 0E ^?@8i@?@&@0@-0Mx @pd d㽗g0PP  041p 屗0ЍD ^@O@bi@v &0@@-@CM`(  `pP 0 P P PP  8 ! ll pz l Rkjlm U#0P 6qp 6S30S j0hP 6_p 6SXH30S Dj 0 P 6Mp 3Q?jI0P 6?p 2Q8j8 ^ /p 0S0 :j8 $pt p x p 0@ \PoL2Q D]jCߍ20S (Uj10S NjKj0  `0000p7jPU0``0` Rڬ1000 0:S R PP@j`pPQ  jV pW ,Pi>iH0S Li ii! !5fi`0Q i i(i8iA5A_iAf(OApAyA )AA8iiii _AAAA&@AAAAA0@-@Pp@i-ihp@-P M@` QP0 aPp@@H ЍpiB@-< @9!P$0$ $ ЍBǑ _?v@-< @#!P$0$ $ ЍAzǑ _?v0@-MP "Mc@PۍЍ0@vH P P+bP@gHۍЍ0@b0S0S1iSBB1@-T @*!P@0@ @@I xp eЍAǑ _+A?vB@@-T @ !PM<0< <  ZpGЍǑ _5?vB\O-PMM@ 4m0L004 T49P!4'S$0P0@ 0 0 @PE( 0RtP~ 0S0'U 0<9 0490,9, 0(9P0 90909]h(@!!0 P d0 /C BRY      -B8$ B2"!0``F ^w E0tp800IcCP S@BA`p8 0P0a h!0з@"0(0(0SF g0$ P0B'S$0؍Ѝ 0 0|'S   BS>CL'0CT'S Q:,ǟ"!! CR   ##9C0C<"!% 'S&2"!2.B&>C2"" &2"!/B Q 0*Sy S &S   2S% Sq 0S  R )S\L&0C'Sz00 0S 0 t4 t0g0( 0 B( @ R `%Sp|gȅpW>3g R0 0kg`0S bg0S `p0 TPUgH5H3਀XP0  @Egp` ?g0S Z=0$3?S6.g0S q&gs!g`pov`X'v0,01ap`wpJPzXH4#,003c1s0SqqfZ'0Sf  a ,<, f3H#0P# P# ß P# f|H`#S0S pf0S5  Tf0S<f0S( (f$s嬢 `0VV /r  !"   0fV#<f0S `qfHf` pov`,X1pwp 0J,0Y<20, `&#Sqk ,, df1H!0P! P! P! pOfhI  SS !Sxtplhd`\XTPLH <iC<CCCWCB@C(UdC(O $ ^h ^pCCB~Bwh?ZmCCCCܪCCDPD DDBBPDD~ʷBBP?4D(D-DF _@BDTDBC(C-BBBBBBBBBCCCCCC30@-M TPvp@@AEЍ01 U@iDD 0 /%o/-@-@ M,00(000 P  Ѝ@Ѝ/0@?o21  @@@@0-@-  PMLM ЍЍ/@-@9M㞿`E" 0S/@-(U-@-  0M,M㈿ ЍЍ/-@-  "MM ЍЍ/@-\00S 0  0000 0 GLpЍ(UE3@-@_H^^p0U`zp c@EXEjp@-pMPP2 P0S 0@P 0 0 00 0XLp DlP@@ ((@,P0P4P8PSf00!031 0@-Mt 0:K@P \А aGLPP @ (@@ 0'KP 020Ѝ0%o(UM@-@ ((d    daG&0GHrKP@-d0 !T| T@0!6q0\ (0000/ c_ ct cP@-`0` X| TD0!6q0\ ,00 00/ c_ ct cP-4s00#p^0<\ 0000/ c_ ct cP 4ps00#\,s0P00/00 c_ ct cPH- 0:# ^4 0P$0000/ c_ ct cPH- 09# ^4 0P$0000/ c_ ct cP 4 <# \,4P00/00 c_ ct cP- 0:# ^ 0P0P@d|0:0# PDD#^<s0\ ,00$00 c_ ctI~I c@- 0 00`P Ѝ&t%oA-Pp`@WЍ +P %3MP@ p7@-P@U0  (|NH Ѝ0|IA-0@nS0oSp@ p |P`\jGP2H0nS0oSIPPIPP'@-0 Dc`I&0O-M M0 0D@00 l0oXp+0S SH $E 00,00 吊[O?OPOfOp@-@PᲟP (冊0/Spp@NNO@- ^^[O&0O-p0000@P`ᜐ (,唰00 qJp0@DTq oP0 PtP<Gt9 O4%<--+ ihN8@-M@A>0 0D@00 l0Wp0S SH *E 00,00 ZǷO?OPOfOp@-@P*P (0/Spp@NNO@-  Z&0OG-`0@P $p堐0 Ip00@DT oP0 dMtPPȉ>t  ZA+G-+%< kHN8@-MM0An H 0P0 $@bWp 圉Z3Op@-@PẞP (厉0/Spp@NNO@- ]fZO&0O-P@M P0`TrP"xIp)@20 R. +x   &  x `!p0 *00)0 &0_ WpM 6uPfPMP- 9P GP p1g@P UP|0 0|00|0|00|00|00pt`x0 xsPisPZ,0p0Y00t0V 0;;0x0U;yW$00|00|000Ѝ-PX%<J lX lhN8-MMJNP0 @PG00 x0xVp0 \屈0 0N/ 8 uy000 0@([Y2NR mPj7@-@P <0Lo SϜ 0 | Ѝ0N@-@60P@^@-@?80P@@-@ h<0S 00S0?  PЍNp@-@PvP (J0/Spfp@bNNO@-2P@-40 0,0,0(0(0$00 0<\YQQ#PQ@&0QwP7@-P @<P00S\ 0  Ѝ0Qp@-@ PX0 60(pyPP(PXp@@(VMO-@H p0H (\$$e %Gp50pGWQ. 42@FP 40S  4 40S 4 0<007a08:l$0000000Dv0@90;glP04P 0Ic0(80@008 0qPPp0       +  @   ' B 0# R #  # R" , @ ( "  )            Vq20  |Nq0$000 XDq0 000 4:q0$800 0q0<:00 &q08:00 q0@900 q0,000 q000000Kq0909R41r0$000 0 0t0,0w0 0x00007000+ 4  Ѝ%o%o-R%< n(W(W(W nN8"(WQQQQQQQ%oC-RMMIN@XPpD`p`00EL H】p$tL0%Tp0KS 04  R< pL04I0 Mp> 04n/`  wHP ,PEP.0D \P! D4Y 4$04 0404040 40$4 0(40,4`044<$@tYRݍЍ$.V(WNR q@R-R\RLp@-@P$P (0/Spp@NNO R R @-ۅ/SF0@-@MP`p 0R000 TPPЍ0P0 0 0S0 R0P ws@-0`08/00@P RP0 JЍps@-`P@00!  PT0 0R0S PU @@ 0XЍp(W( rSc(002P0/0S" -CM001010 000000 0 0P \@, (XH00Cߍo/ rO-MpP8@@`p+ p D`0 $00 00<0040D0(P080,0|0PF0<0lP<0< Dp PH00Ѝ0S R@ YX(W(RQ rSO-$MP0 7p@0` PS .V0\<00$Ѝ 03/ X0p 7QQ P0 `v0P": P0 ` @00P LH0P3/p&P7p 0@ Q0  S P0  0  W r#SA-PMM`p/ P@1L# N4AD0@@ 0@00 0p@,pߍPHڀ@T ,(W,C-P[ 4M@墸@᭽0P` :;0P`PtZQ h 00H 0 >P  (E0 0``00S0 V0S`0000 pp  pPP0QqD0D00V 0 0000P0P4Ѝ 000<0(WpSS(W,--0M 00H0 @¹P (Ń᥇ zg VЍTT @- WTT&&0O-P@M$  00p 0@"b0"@0@ "Cpx20a0CSy `2g@P 0p00@00p m! 0 mP`m P  0S Q B  h;Kz h!! <P 0S Q   -z ' ׅp x+gcQp x 0[4S08pS @p @Ѝ?B--%<U r,T r<N8TTTU UU<UoU0@-M MC^P80@0 0DP&(00 0Pp ʂ 0 $V !V V(2 P(0lV, 1 P ,0TV0L Vލ Ѝ04V(V32UUUUUUVUV7@-@P 60Lo SϜ 0 | Ѝ0N@-@00P@^@-@?20P@@-@ h60S 00S0?  PЍNp@-@PvP (J0/Spfp@bNNO0/p/p@-P@h $( $(0XRX0X00\00`0ddhhllppttpp@-@ P $!DD@@HH LLPPTTXX\~`\`0p Qp` 2P0@ S p@-0@"!Rc0p@-@PکשԩѩpA-0@PJ04S->C©->C?Xᱩ9>:>Cᬩ?n:>CF᧩ 0? AC>ឩ}C>GᙩmFᕩEnFᑩE~GX J.X V  $$((,S>,m}S>GhmFdHHLLPPTTXX\\O-@  $$((,0,0 P0PQȡ\5 S L5sT 0K TT`XX\\``ddh~hplzlpwptttxqx1[ h`ebp0 p$Q*\5 S `0S&P%@ PSزK 0CA0Q R,ׯ2.0) T U0+P0sC@p/0@-@R 8< M4 M0`! @SP ۍЍ+000 400 0  0  0 0 0004 QP S<#0#$0 2"8<"4"rb ##̠#4rb2"LABLQA- brs@  2  PP1+\#0A0 0 00L B 00 00 00000u0#$ 0 6',"'("&8'$"2&,&42r"bJ 40Ѝ&0S/!  O-,Mp0`PTXP $ $ 0P# @T 0 wbP BPG@U   P @ @ @ @g@p \0XU @ T0 0D dS1R "P  T8 DR0UQUDTP 0 @@@0X R    0NZ0 t00 S   X@,Ѝ0 00 ( 0 V+ s|VJVm(WVV@-c@ PU ppShh+0`@SPP0SO@0@,R  (R@(WV&0W\ sW%W200S/@-O(W0/s@-P0@0S 00S Ѝp@0001!Ѝp@l0`1#ā0P03V (9 0$R"OЍp(W([([(\<(\D`R/צs@-@00S#000S 0 Ѝp@?.ă\0P`i3V 9 0$Q$WOЍp([([(W(\<(\D`A-Po10MSP8MU`aO0@OS@ 0 402#0, pŒ!?P0< ??. U00S1UN@@Dᨌ 0ݍ8ЍAᝌ0*Gx0 R `\ : V 001儌0*jݍ8Ѝ([(\D([(\( u4O-C ` d 0A apS0 <0S  0#‚ 0Px0 _`0 C c à01d0 P CSQ c ( (\D([ U`aM%oas&0a u0p@-P   @ @00Sp0?0 00Sp0?0p([%od0p@-0@SklP 00000B0F0p(\4O-MM`,u 51N_R0uPSiap51ITI ?D 0SDD ?2?D44Q/nDp؍ߍ 0DŒ@ 0L 04;20d04 0e0  00@4T@:T @:T @9T @ 9T @8T @8T@@04s00\I`p40S7x 3 0 000p0  $ `  6Y 0 XY0 ``a 1n,FϠ ß\/F ^~222102?"""2Qc 0D@ő"L00 /4;2HH 0d0 0o 0 a2r 0aW= yHp`{Sia11HlH/0`22220&OD0?0 0 4C0 0D@E0L0 4;Ġd00 0L l104  22221(0$ , 4 0 2? 0  D@őL0 0/4;$!mH H 0dhl 0A a 0<t%o(W(\DA%q@%sPo(\$([TO--)MM,0=0?0(8$0HD0D`0S> 80pW:,0 0  0 J(W([([(\((\C0P4p3x000<4%$0<0D0t@ӆ0|00匐XL5P5G 0/?8`F 0/8  ?ⴆ pj pG8#PE0 0" 0 p p45p<4``0%8$Sp`qK411 <4800x 0 08PpS¿PL @`@0? 0 0`@ץQQ*0 /@Q`(6#R0:`@0$- 00[00 1p&"0 ?001>0[`0 c2# S,Z!Q Z300 !1 00^00CC Qp0?#"4 0/lWp1Wp#T0p10G 0rE 0/lPPB@TP` 0PL둈! 00B1  B[1 ` U"B !!0 R0CQE0E/0PA 0p'둈!0 1 B[0`0US  B 110S JIe @P`x16 G0<48ĔCPp0S8Ą<4-0$5BPS,pQɑRBDL0 0 0000`60S|0p ?H4L04P@0 @69p9''/ER@00 Q v,7\5?>C0P奁%4tx0dP7 8!"T a31< A202!0 0`@ 04 p ʾ 0L$4  E$ ( B, D%LV.  R*h (r < ( X ( \ (( ?.@Xt@+@B@A.@B -< Hu pV @40K pل0 ,p B A YZQ !ῄ0 XZ R  Ų{A/ 8pW $?. t{ 0ĄŸ Rï<0\@D$44 0L4( 0Āp<2 R 5#< 5 23`r0S*Kz됺 z'z'wz {' 000d0 CSQ c6Rc(;R`EI @ z犸 z'(Ȋ0 (08W;R,h3I 00 SP0\h!P !0@ 1@p0 Q0& 0Sc@ SH QQ0 뀠@t9 -j0JF 0hgK"0`0S>(\$F^ddWd(\(d u|(\0%@th%d(\4e?d%cT([ UmTe]([(Wef(\D%oe~([([ 8([ h00S; 0 #$[ ƃ$0+V. 00S  0=S,e0S10$0,1H@ pp@CPP04SP0 0R0 S00C0? S= 0,0$0P0lA 0,0S7 p开<嘥ȿ+" 8 Q \%`R 0  ᐡ! #0@(0 0 @DU@4AX820 @R40 `0```0T0(pb 0 p2 I `0 P$5"S`0 9pR80<0匀 t x00Sx0x 0\0  1`0  B1$%Rd# R0C00h0$l`0 R#00B1d0 R*%댃U` p 0 0 0 (0 0C 0(0(0 S 4`R` Z $%R0 l ! `,4 p  R2dc 4RT T  4P%QXԐ R0 d0 0ݸ ڸ  Ը0 8  8 ` e@Q ㌂+H06H (P+H6 {H050S , 0 B2\,^   00/d A! a,3 1 `&F$01=S,00CU e010T0010X0 00&S\0?0  0  B  R\ ?0  ` 00C 0 80 C  0C1448000C ST00C@ pl`p48 QT* B!44 T: $5Sl0 @0h pp^:S $%S0! !H`$p$p(0W4x0S ,4  d,04  0,4 $o 00`  Vj౻0S   0帀0 X#` x00S h)E0S D>0S 09 D00@P|:x*,EcP>0S`EN C>`>?.0S003040 4004 pCVW*DqV. P\oV.GV⹹0S  ?0 PS?\5=S,⥹??^0E/e0 0S 04  dHLĒ 0A a04 <,$0S0S 04 d ,04 0? 04?)ݍЍSleG-`RM@Xr sqPP pqP`` `HP P:  8?p 0S #ߍ<0`0(00,0 00004008004004 04$0D0(0P \ W\  a?pV t[?p* hpd$` 8  @ 4 (   0,00  ` ?p 4`?`a8ScPb 0  00*0 0PR^ 0 *0 @dAde@dz = "   .A-@Mp`;@@ ap@ݍ P@0-@u=T 02 " p@-@PoP (Cp0/Sp_p@[NNOR/uG-P $` 0pV@`0 @`` V`@&!D( `G-@P 4pS: Y00000`auP0Y0\ \! ##P0p/Ѝ_uP: F^^F :p@-@P`    pp@-`P@ ((UX0 3?X0pA-$P0 U PP(`,0@4p*^ :^ *^*X@O-4MX0p0\00``P0 0,, 0Q P 0 comQ2aQMQ AQBA0XbAP Q SQU @  DT dR$0 9QǸ"P T U8$0UQUDT P 0 sQ@ @ @U   @@@ X 00 d o0S000 00  0(04ЍV+VJ uVmVV@-_( $C+(?e&0W\ u0/p/p@-P@    dpG-@0Pv t``PE0 00000BoH0UB?E ᴀ(`(fP0  /PPP\!1cQ\\/p@-TPL`(FV@ d0 P 6V0@ \0<@p(`0P  C @- on co`/ xf,s@-@PH` 008W#V  P@ZnЍp(`(` xfGs@-@X00SPH0`ă5#40<6#V  P@;nЍp(`|(`(` xffh10 PS/C-TQ@@MPM`6`@f$q 5!`0 P08 0 T:@6S/O@ ᷲ DD6ۍЍC 0+0 R  Q\ Q 0`;Pd 0+ۍЍ(`|(`(`(`(` xO-BM p`\$PPl"lm 0F0< (0 㤛06# R 0 "m0 40 0 !m00060 &906 0@p00C0(0&V :D!Pp``Vp Z03 x(u$6/K 6   C c1 0 &$6/6 `V&L0S% 0: S$0$ ` -H0d  &ЍO&<X(` yffff%u`A-a00S FT:p#PP ! 0 0A1S0S% P @D A01 S  l0S @21060&%06@p  06p 00C 00(` ygO-@PCM0H:п? S`$tEl g3 WRQ( 0t0C@0VR > 0(b S 03S0! ,0Epᐩ A U0B 40jP40  0AS (00 0'  ,#pF0M8-000 6 0 6  = 01200U(  ,000$P`%($0L $(p堌|<d0c0@LPS:9 0T0L<0<X5 <0SLH X @<PU ߮P(   L0 VS $ ' \p$  0A! \ 11 C yf0Fय0&aPeeC0CP!Pp\p :0 0"P80a ` 㢳0Z0C$00SFj 0S 0 2#*&(:C1d:0 0 00x:Ѐ70>0* 0 ( "*> 6 !0H 0 0L:喚Pp@D H&4Ja0Sa9Q0N 0kLp 0W㓆( d0 ]P 6W0 \0<06s060 060$00SW0Cp06 0V( @p06`0!o; 0d(Q0 xx0Sx 0Sw008@ pp99PPXP 0R SHr SpP@p0S g廥L0S d0 P& 0D4#?o2%4 ED&0#0H& B 0哔)6 6卮 0  埲6唗0CT 00C0CS: B`@7  S}0S0  C02#& 9=xP0 `0V 0:aVK:e3006p)  0(01 0D 0 J>T4  060  5&+ȥ(6YD:,0TSL0S d0 .P U940SpW.@11 21`0!!!0 SH$ ᓢ""᳇ $0d0$&S: 060Ɩ  0&X0.<xG 0W4# 4 <pX0SVPEPU 30S} <W <3PUCL0S \0t2`0\ w PP1 P# j⟱P3676l0L0p0t0x0708630/P< `8rU&;`36"0U9 0 hf hlL0S `0  2#'$/%\267LGL0lp0t0x0F7080&2l0P(wP $<p+ j7167L0p0t0x0 7f&! 02/!"6 QP*dh!P@ P 0 l0PPP$!. 0vw]`P $ WP  6D (`(`g-(`gU(`gggh%ud%u`h<(`hz(`%uhQNSh(a(`h(a h(`xhi5d(`|il y%@th%i%cme]AA%xkXij j0j`j y,j%ulkef y;k.%w|(f(`(`!PU: &< " & U:0 UQ:P!0 G!0 hpL0S U %%*0 000\0R: S&:Q0  6Psd $0 {"P Sx!%x%*  30q !01P 1 !p;hP ` 5 ,2``ƔP2& 0h0D?o2|e#D&0#Y6P S2Hv pG0 rHD$6CߍW80/p/p@-@P+5  $$((,,00@@DDHHLLTT\\``dd W_ WOpp@-@P`ů}zur o lif c $`$d]dhZhlWlVSPMJVpE0AVp0Sp7Sp2Sp-Sp(Sp#SpSppG-`RM@Xr gPP pfP`` `P P:  875p 30S ߍ<0`0(00,0 00004008004004 04$0D0(0P W\   5pV t5p* hfd ` 8 ᯮ @5 4g (c _ [ 0,0U0 Q `⋮ 4p 4`?`a8SڼXPb 0  00*0 0PS ⎚0 *0 @dAde@dz = "   .A-@Mp`;@@ eWp@ݍ P@0-@ 3T 02 " @-`ps  @Pk00S0?0\ 0S 0 eS\F\GL0 \ gL|0 SDKT ЍE%KUJ%FZO%A_0 k yDk@- H D9<<P4@0 ,P9U@6k&0k ykA-Pp@`Q0V 0 wekG-`RM@Xr ePP pfeP`` `P P:  83p ٮ0S 0ߍ<0`0(00,0 00004008004004 04$0D0(0P W\  3pV t3p* h&edu ` 8 U @ 4  (    0,00  `1 T3p 4`?`a8SbWPb 0  00*0 0PR 40 *0 @dAde@dz = "   .A-@Mp`;@@ Vp@ݍ P@0-@1T 02 " 0-<\   RS  0 S& 0 /)fQ@-$ Q:n/nAO--@MMh V0d00h00X00p00|000 0\0$0l0(0t02000040<080H030<00404p 040F00G00H0040P0050<00S00|0000000S00?00H R00S Bt0S FPtp7|0p 0l0, SP&0D?i/0 1pD$ @|0p 0S @8 D0P k0 D@*/a^[@P#0pD V2P Ol0S 1 : S  R 5 L D^PPP0j VPrPE_oRb pJPU p  NP IP@D 3m`Tb&0 0D0h0ɢ&PQ T @ F⴫0S@040x0 0P0T0@0`0,000$0 T0R0 T0R@00@00S@0S100 S0P00RS00 R0 R0S0P0y />0P00Q4,%RP `R  V 000FOV 0`S`SU [ T @0S T0S2|0p 0/>0 D0p{ 耝p`STD+vpv @@0S ?W01?0#+@0hph T0S*_p_ T`[ 0٥ZK Y  Y* >05ZR[:\0Sd P!0SV\ )PXP UU \0 0P U$ PDIpSP0 @$  0  , ` $ ( @ , T 0 P < x @ D04 0`aD1pp l 2"_[[P0T`?p[sp0_[|0[Pp0 አPUPQPU\KY" Y Y A Y0S /0S 0S0 000pD0(0 h&0S X!0S D T*,00 Y00S,00,0<0S$ < 0C<0S* z<0#St<% $0R0$00S S bH0S H 0C`H000 ,0R0,00  0S 0`0 0R0 0R400 40R000X0S /4X0PL0& 4 S0PL0 L.pL]00 P1: S0R4b0ᤤ000V 0S(dR0L800S0Y00Q$`80V`5Z0A00R`(,0ES<됕Z ⌥ X,0ST00{PP(eZ  ?qP U40S58 R 0 S%$X0L000080 Y $0S8Py80$04 8 R Q R8P 40P0S4UD8040 4 R Q R  R U R PPP$0S F P3P0!01 $0,0AZ-Y  P)1 0$00TsT`A0Z Y Y0c 00 Y0 2" Y" [ * Y 0S:$0U  Y ,0S<,0ꊠ$0 0` 0S03 [T5~:0)qc&000000K000 v YQ YQRU10A0  0S0 0@c&0 0 0  0 UKpA Ⴄ 0W1!XdJ Y0 !Y10Q*H Z00R 0H # Y0 Y00 eQY!A$nPnnn znZhnZ o&>_l3o\o#o?omoop oop3pappqpq6qUq^?/qqqr qr-rPrrmfrs$s2sNsVs^sgsosss/rssPs&0)fsfffgo }TUsRRaArrAa0Q R0 73`0SP0S00`0 Yx00x0P0 0S !3# Y Y00 X00 0 00 0H300 0$0` 3,0S t3[ 2`2 0S 2P0T @2X 2 0Sx 22a4QQ22Q2 2l0S ݍЍ0/^ &>l02L.`PP W_l-&>C- 0 S0|0| 0$02#l0S Y0000 0l 0H0 20R08 0R000\0\0S0 Y0@0$0pQ T#   t  00t3Q0tp0H0( S 30S d(0HH0 0(030#0X0S% Y 0( R030"S 0R<00&&+80< S +p! P < Ll:(0<0 (0S Y0( R00S $4 0$0 Y?000 @0,0 0#40+40`00 0?1@0?1T0?1P03?08? 0 03?$00(0x03?,040?30?3)000@00 0$2?@1c4 04v 08#$0 #(#< 0 0& e1 =Q p0QX0S000t0o0 00 R  PT pȦ&?  D$+pe P` ( 64 R ( 4R  R 0( S70 71011l0( $R030#R03S 0$ |C¢Q`000S  0! YQ0R0( lR00S \P(0 00 25 0?10 0P B24 0?1(00(0S  0   k B*{@-S-%b@ 8 / Ae@00@- 44@4P\P 0B"" )f@-'B=)s @- 1.t/&0G-`@ P p彥00.P U0 0  P@ Gɑ0P`0! 0P[] R 4T] U   )f-tts@-pP@ 0  /X 0TT>0LЍp P `}/0 -0)fh)gu@-0S 0  ~0 Ѝug@-@p$M0 0S ` PC1 00P 0! 0Z0))T01 hO05/XJ00/HE0Q@UVPE:$Ѝ90uuUupu|uĶ * + (;R  PPP/ 0 @@@ ! zj{ k{[;R[.4Ѝ00B:k{{'*k{h;R. ?@@?6C-@Y)hXv)fv4vMvcvt%{v)i)ivvo@-xi0d2SK,)f@0@-0S0@d2Sb`2"R2%{)fX@-@ 081  0+t1 t t*   <(8(I*@0C Y*K+ C x 0#-S88<8xS`S?S DSf .< Y0 ( 0BK+ ⌋00CS00[I)a0CS00  I  ⶛PK @0P: 0A0 x9 t90Sh9 00K )K 8 # ( ␛PK 0 % PK. * K    sPK P 0K. 80   ` Y@Pu~y @80S 7  ԙ  AP]7'<07807407007,07(07$07 0707070707 07070707* ⤙  `P-K PP 70Sd'0 0C!0R3 D70S0S K  @PPOh awptt0@Pp,  pjt@@hP0X#T0 0T\  xpW phS  0QSL0Q40P@d0X\0D`X0D S@0S3 @DU1 PP  PP$K 0P@0 K. )K>l%l 0 (@ट8@pP @ XHl 0S$0 0C!0R3 0S0S 0`0]P `0WP c=0,C0 0 S;.0l0 )+ 0  d0d0@  4,I Sp 01 1 Q 1 \R \A?p@1cG0D H`R(p3 R  s)  Z   tY   \0T0S 0D00D0. L0 SH00H0H P0S  W  ęP0S* | 6 E d ⲙPcݍЍ 88  2  ⟙PPA0S, (P    ⋙P   ~P  | rPP@d0S\X000+ s77*y*w*sH*s,&0  ~*s(%{@c[*rUi0&O'&!*sD*sfffgCEF̋VZoы* :cF@-<00iS03S ! 5DPN%*s*w@-l@h 0\ 0 LP  @4K  0 F   A 6*~;CKT*~@-@`| |0 P0D!0PUR3P T0p0S 0@ S<<O 0,$p+( Ѝ*sD%{*s]%bC-P`@!@1 0E!YR!tM@p  10S ( tЍ000iS00S 00S d `P &W @ 0 m P vP000 p 0p: W@000*sD%{*rl%*s*s%{` @-@X 0C @T!0R3@ 0P   0S %{*sDG-pQ0S dd$ @P 0S 8<8a8qP0 0@0C!R! 1S1 1` T`Pp̀Ԑ 0U0(@P 0E!0R30S { | X]'0S8 @TP`*00 @$ *s%*s@*sD*s8*r*~O-$ 0CQ0USp0 `PP PP"* @P0 D  0S= 0S: 0P5"  UE  , ; V S 0S000C?oV20SP@Yo P`P30S  &|#0ES0 000H30S ЍYF 0" X@00020S =P'0 &X0000  000S 0DD& 0 0@0010S P0 YQG 00 0X@V0000S X0000000S~ @0 0 n RT 0@s0S  @ 0 @$ 0 x@WL00S 0 X0} L(%3*sD*r% ~ &01C`*~d1A-0S TT`@HqH 0T0 :41,a PU @T)$PXP@`0S 0D !0R3 P U 0S 0S  |%2P0S0S \ 0S < %w@*s%*s8*r*~*sD0A-0S |P `p @T V @TL$@ 0S$p$00I`@*s%**~KO-!1 RR0娑S o@Pq倡 0 P0: ЍS DPY`P 0 1F (%000k @QP:RS  0%~ Q ``P0pg0 {000 p000*s*s*sH%d*wP*s8&0(2O-0S 0b0 G`1Q,pԡ P@p0Q00]: 0Q0 *@@ 8 0X0: 0R0(:*0 R S 0T :SR00X 030"S  P 0000 S 0 SPhk \ Xb$000P@ Ѝ*s%*wP*s8*sH&0C-MM@P$Q0S Zp@ 0T0:ۍЍ0S I0 @G000@T`PP@p0 * Y "  &000PU *s%:*s8+0A-0S  `Pxp 0U0(i@TP` 0Q0F00S 9@*s%E*s8^A-p`P@P #p?pDorP 0L0 0C?oR20S   P t&0p@-? @Pi}$ Pp0 SRp*~@-8L0S$0$ 0 0w#O *r&0A-`0p0O0000 SPڤ/0>+b P0 P<ֈP@O 0 ~0O0?*~*%{0@-@0 0i0AЍs@-@P`P @TZ TT)# ?0 0/N+"+R  + ЍpL&0$0L<S/ @-鋈P*%@-<p @,}P0@0%{ O-1@`pVCMv Pap@0DWCߍ貀TX B/0S x V@0PS 0 ?2/ 00S 0S 0S0000崐(h X:0000Y&*Đ0S 0 0S 0 000R*Q l\"0S D%`W0S  `*r**s%p*PO-X3p0]MS DD{@c@C 800#0>!00RS #03!gp"& MQRPP "&NL"W 0"!00RS[ 0" !xgph"lL$QPP"L  PpDDB@@r0PSY : SVH`P؀? {!aL<S $ {@ 8( D <`  8P  H\  T  X  `Ђ{OP ,D !8!88 hR/0>+b  P<7P P  \0?0H @P QPPD  !L P QPFQ|]ߍ*s%*s0*r*s%{Q*'E%S *wPh*~L--*&0%@- @ 00: S*wPG-@q `0S+ HP 00S lP0 S00P R HRڀ00S |p7!  Y\őP Y00:$00S $!*s8*r&0G-AM`P@tpP00 040AލG/0 008/P1 00C0 0 S0+h X 0 ˀ 0  D r̋*Z6&0^A-MMp600 0/R @`㜀GZPP 0S P@ۍЍ D Bᐏ`D @P 0S P`*p@-0@ @P UP @ p@-@\@ O-3tM0 S llbh00RSX3 L3L#0H!DC4#S8344tЍOI( >  PL    + p0@`00ԢԲL<` |L\0@ WI< h`VV#Wp@Pp L<0@'pj0PxSiSbP 0'0@$ 000 ?L<0@ ޾\\վPxҾL OtЍ0 0C0X10S 0`S$0` S\Xh0SS   v,8s,0dS X00%[0P!xd0 8o*s%*s*s0*rE%%{&0* *s*s0Jk}*s( A-MpM`@PP 0ppAd!d0@P TT4L<띔+< 0+ۍЍ aD D< tpPU#! U`k p0P o x0S p T0TP 8 V8 [E &0**s*wP7b@-;P@-L@4#S 0   0#S0 @%{0A-@P` 0 Q0: 0plp0/zx @$aD00S$`V0 SR*s8l**r 0S 0 0/ R  /0S0 h p@-0 @Q0P*H`0/>x Pp0 TUp$/p*s8*0p@-P@ 0 Q0: 0|Kx`0/x!1S 0p@D; $P\P@@p$ 0*s8*@-MPM@T 0``p/VVP   夎P @T@ۍЍVP @p@-/P@P@p00/00@P 0S A-P/p\0@oC 0T@@D%yWU pDP@D*G-pPٌ`04PSp6@P`0PP0C0 T`4 $@D@**s%G-頡FpTP A `Pt&0@(0C0V$Q@$0( 6坑00v`PPEPP k| @$@@(`/>i 0`0 @ `P`E0p P0@0 P $5 **s@b{@-@>00$D *0@-S@ 0S 0S w 0S q0 Phe T` R 3aD0&F$ ЀP 0S00*p@-@`PP|60S < 0P0 @/᪑PыpJ0P 0 00pO-2p0SlM 忻20SIpPP X TL0`000@0 Q 0*`  0R 0?*@a0Sf@01 $10 %1 08`008<0@ ʑX pXX\LlЍ 0`0V@ 0 0/⼁ 0` @T`$ w000 0 0($00S0,00S0(0 0S000$0S0400Ꮑ@0 1S0 00Ⴡ@*s%$*sQ &0?*s8**s *s0*rlxC-30MS Y肟r0 uyP0 008000Ѝ PP 2h d \8$P #8 ( (@0@DE`P P!   1RQ rQT 0 $SP P0hW0 iP X1 D1H1D10S0"(P 0 AD@(C@D\ ((00( CT( (0 P < "< 8 R"8 4 R"4 0 R"0 , R", t9 R" *s%*s8*Z &0)bQ*s*s s*wP*s0*r/' e|0@-P *wP&00@-Q 0@T0 R ||0AS@ ЍH0 DOPK( %{*sH*&0%Ѐmp/0/@-x 0 RS T0R H0P88Ѝ S *I*wP/&0A-D@p 0 0SP( ` `u `*UL0@-  Q0 0P ,0Y Ѝf**wPo&0@-0xP 00S@%*S` ;P@` 40P , $  0WЍp**wP&00@-0@S 0$P B5/x0 RP`P0epqH0P@`ᝏ+0 ((@( Ѝ*r**s*wP&0p@-hPh@4S 0SP LL^H0H P0000$R0p4&**wPCS*s8*40s@-0@SP  40B3/p00S\0 pH0P`@I0 ((`Ѝp*r**s*wPb&0p@-P,@P@pP @ ~p@-X0XP0SpH`@P +P  ø}@p*r%*&0A-P 1 a051q0S :p~@P 00PFP'YPPߎm 0lltPю_T 0H^000@A(*r**s,*r%qE*,P: %+ ,q909909 Ѝ0 +"+R ! R  xEUY0+5p`PlP d<X (`e ĉ0S Q P 000/ᶀpq V00S |围0S 906;#;S T%mJ+Xp**r%*r%&0@*wPW*s-*sn*sH*P0O-t'BM @R MT'T7PP oP P Bލ Ѝ$W0S70S  H00ZP 60Sf PMJ G DA>;5h1ih.i0.04+48(8<%<H"HLLiii xx|]|h9^EhEh:^EhE@%0A(US0 (12222( , 0 4 8 @ D P T | Z40(01@ 0D0(02,020028 0T0Pp00|`P$ 0PD \4$ R> P<(4 R $ R 剳3  } z zpwt`qP n +[0/ဳ#0/00#00 20 0 0/0?(00#H0?X0?`0 0,0匓唃,p\`dP~20R000%60, (0\20=S" " X" R.x30=00 2R 00#| # #/%80/&0 %0L0<040h0 aRS! #3 l` T\1 !! 4AQ  忲 9-0CS  7 R0 R R 0N\ \0`0=0- 90 t*rlT**s% ~k*r% 1&0< ~TmC- 2 BMMP0000 00 Qa0S q쑟=聟0=P 0RP!0AS\0 =0p㈁0W`1lqTP 0RP 0!=0=0S p20000000H00%"4080&"<0<0%#L0@0h0D0"$ 0 @-Rڐ0=ۍЍx0 l0P0d0`0S L0DS*wP*sPT**v*s0 ~*sh&0*s8 2OO-MM M <$H08B@@4hS< 4 4R 4S #404H <Q}<,` B < 圃夠PM@☓{D0S[k 047h#4 "SQ A 0H3/04$!0H;s0 83 @A 6/080 GS00 G0Q0+ G!0 S004SQ 0H3/048H0 C 6/080 4S9 4,`$0? 0;DC0 4P  t Pz ׍ݍ Ѝ(`4SQ 0H3/G;q A G6/04G;q ; G$04  BRMP@0SP 80S1P@0S( 0$00S  B0SP D$S 0S2 00S \0l 9P tlx3  PHgP0SS*sPT**s%*wP *r% 0 *wPL@-@0SS*sP0O-gM< 00 0 80 4 @؂ P 0 @00L0@0HP0D pPP:P S  S  S;  S 0 PPNp SK  S"  S,60S  >60S  6f0S-% P% 050S  Ѝ50S P 0 p<50S  ,, 0 00 %`90S40S  40S (  P 0 8   Z0 0 0T40S 0 < 30S  30S30S  0/I P 0?   Z 0 8liH30S_ H [D 0  (#`0 0 020S  Z20S8x20S   PD 0   Z 0 8 20S 0  o "`g0 0 0<x 10S 403/ V V  !LEZ00 0T10S00S 0 8/ , 00S 0 4\  03/Z 4   00 *wP$&0*sl%*s *s*?%{RMNO}**sL*r*PQd1@-1M, 0  S != 1 1R 4S5 !4pq04@0TaP/ P0S  R+* SR-P- !0 010  QP 0PU 0$N P ЍPC0P;C0P|90S050 000 @ 0@0 0*sP*wPT**s8l?Q@-|cM0S ll+hChS0S YXPk0#0,,  R0 2r 0500K Pr5"0C590C990C9000{Ph|n x0S \2d"`2Q090 90,ɔ*xcMy`P0000 P 7P P P " P*0 P*000soR#P0A000/P:P1:P*24 p0S p0S004*xP@- V{0 A% 29&0O-0`X0#00P0pP00@S'0 P@@@00v P0G00 WL00L00 Ѝ@@ @LX3 "X5 z r`00L~ X aL^WLAL^7L\ R     V 0C0Y/k 0P0W0 S L0 S ْp/00   ЍO|@ 5P WL0S PW @p!P XP 00 ` R1*x% D+e LRp@-P(@P uPp@%0S R  R R[0@- ,F*@- (0 0 0 0 0~ЍpNZP P Pk|EEv-L ,M0#Q S3#: U,Ѝ  @7@-P  Q(,X7eP Ѝ0 @P .9jPP uuP+**0@-QPM @T 0d@Oo@0U0! bP Q T%< @U@,dЍ0%(Tr h \%Tq @ 0u  @y*+ Q@-.@h0 \!@@QR  0* @*0s@- @R`  `"P.iP ,d0S ,d|Ѝp l0!PU U 0< 4Ѝp@,Ѝp@%*+*@-@T T 0( ( ЍЍ@8Ѝ@*"!Q p@-@P T p@<G  p@>0 p@8h[a=O-@"PTMA@ p @@0@$(@$PP KPP / @@0P``U@|OTЍ`P0 EX y R@x   ;y0P oyZ  ,\100 0S00C00  Q,P p0 4p0 0pj [t tl`00CS`0 X0@T:TЍO0X0 X c%%@-00A Ѝ@-0  9 ЍO-@p P7 aT00SP Ѝ -QP  P P ADPP@D`FRPP@-@0 0 0 Ѝ@?@-Hx &0@-C@-QAM` M0Vp@0` aT1T!TL0P 0 x$1 ,Aލ ЍP0001!! ?t0: !R  0G1h?@Pw1 1w<T0 <=<@D@ \0@0X @ DD*^lQrmW*`f@-*0@-6S G*>@-dwaw^wx[wm/l`N@P" X%T9  <4`q, @K>tK*Y*@-w 3 S&00@-h@  0@ 0\Q0CS @C&p@-@Pp00SpP@TP,P  Ѝ 0Fm-,Mv 808"40!00!,0 (0 $0$D/CLV`&0-7@-v`P @XT@0 R 0@)  000 Ѝ0@Ѝ/%*p@-PP@ v0S 0CS 23 0 0pqvp@ TT 0 0 ev, ,Up0Sp**EA- `(p 0.pЍ P ,N@P  PP 0pЍAp01Sd0 \ 0T2Pp 0` 0S ` F(P `*%ʷmC-q@1MS0`o1SP1SeV1 묁XV ЍCVS 1S  D1ЍCeV0p0S) S S  tX t@ V(ЍC   tX   t X t`z TTu ЍC.VЍ*%ʷ%E/r!%c4 0Q 000/ *%G-AJM1MSp=Ge`0 Pt c4F0 0 F_pp 0 S JލЍ;T P0sA7J.H0 0G1$HL  $`000P Ppu Lr0S8k1!0 *6SEA-XQp1`S1S@1SFV1 1SV AV1S A 0dVS D@d0S VA0  p1S XQ 1S< ALV*%ʷ%EslA-a0 MSP@]PPQ ЍP@P2 PP  PP 0p$ЍC  0R  '0W400(00 P( 0SQP y0 Pp0!00(pP0Slp1SXJ`D0S U 0? $;P^**C%0@-P@0,M08PP0 )p,Ѝ0 R  &0 0!1SL zZ{e[jKZfke[KK{K;R**O-lrMM 00`S@ hTPL DP"x&J@ n Y:0@@  0Ep,oTٍЍo  p Y dA&o"QPX !4%*1 21N0T 1S1!T0 0*T 1!0 0*Py-  +0S qߍU !k 880U  0Sk0SpTfPYP<fP,U $fP fP040 fP040 fP fP040 fPz   f PU  jk 8 ឵804U L 0SYk0S $}f P#U  Lk 8 Ҷ8 0Up  j 0R9k R0!1S00:qzTfP"UY 0p 80 Rm aBQ @IKKLGJ 4p  ,LJHpj 8 }8 0W   R0j R0!1S00: <04140K0S0<L  X41S 4PU 0H?oU20S0H?oU20S0H?oU20X0S  j 8 -8 0W h R0j R0Q0* 0%0%04140K0S0404q)d4PU4KU* djj 8 I8 W | RYj R `0 41 40KS0 {(}S41uXs40Ss  Kt 0H0j7X' \Xb zXppU0P.' @900D@8ADQiP 8BT08 4@V80 R@00Y@0-1 `0400<0,0@pi|  @c40$0 6@ @DT5p8 80 @R1!0 @6@1"04 @1@S pco0 lhdDp$6pH TpHP%0 SX ZUh-0E1 nd! `0 D000``qpi 41!0`1T00CS$%1" = XY@P qߍOtor4S 044 (04c0(00p`000 4, Sp:Xy,s R T=0`0D (Zd@P0=S \#8 R`  LdP 0=Se $#8 R @a  >dP 0=S "8 R  qߍOi( T W0@400, 0@WD@+0S Y1S nY, pP PU-t 9 0 0(0 0,003A05/00P9T"Ysb(pD,PW\D0,S(P T'&h XpqF h0"S h. 0 SX0T R 00Sd S Se0 $0Cs" D0P T0Lp0 pT0VpTXM F000&00' T0&p*g*%, t 4ViLm;9n 70  WZvx9 0B%85+4Jl*E*0.T0hp0h0SI@@T T TA0P 00p0@L 3@' 0@0& 000.000h 00P> \0p XR qߍO:g0S \0pP0 0 0000( 0, 0Iz@-g@ @ |< xl8 l\4 `L0 T<, H,( <$ 0 &0+LZyt0p@-@PT`b P  p@0p@Eg C*`a@-M @ P   Pۍhp@-IMM @`PIލЍp P0 Ͳ0 lDzhP 0S 0S0 0S  %Ph<a*`@-M @ {PDXۍ00 R   Ph*`H- p3MM@PPYWF`8aP $aP DP! 04aP00 S 6P P00 S * ٬P2  t Ϭ`P` \2P TaP ,{VPP0 0U,00P` 0S!X J1!P J P  J1!@ Pp10S d 0a 0p~aPPPUX$ P&fU 0 $!V, )PnP`ZZE_oR 0PPfU  4S J P |嵱p- 0dTPh*` YS&04|TO-@MM`;@.p p P @ p @0T @0Z:: 40S hލЍ0 0TFPL @P@(0HT*20Sa001!pZ$0V90 ZVP zeZ.x@`P0 @Z V㟹 0Z ;P _elZ.]@ZoP SeZ.DZfP JeZ. d|Ade*`ʷ4@-0`0 0QPP c0@PL QP Ѝp@(P I Ѝp \O--tM< 8@40?PP}tЍB10P(0  (,P U  孰T T T;P0t4tT$0^T6P0X4XT$01P0H4HT$00SZPT(4TP$004 0S0R0S00 0 0 (0 @` 0 0@TF*3#03  0303P0T0P؋@(0P`,PY6*40S 0TS0[tDd  p 0`pt 0+Xpl X `v(m0P02R$06^ 0BnS01 0<0S 08 S@ p?@0?D000S+ 竸z0相S 0P0/] T08 B GP/0 L ]?L 0H ] {{'0{H 0(,00@ ,0 0D0 @ PBn| 001 00Xp`?$ 0\`0 +4p  0G$/$+4hrp X0 0T0 {{'0{0h `Pȟ 0 s]` 0m] $0pT @YM;<<HT3]=:=ë&fqEÊÔým0SQ0兤d4 00kS& Lp p4Xp p+4`p}  0[ $+p4hpp h0` XPp ǟ 0] 0 ]$0`00[ 0 \$000$ TX,0S0gd0kS㋤8 q 0pXp2 $``p+4p'  0[ $h+ p4p ,@ (@{ {'{X0@0 T0 @ @{ {'0[PpǏ 0 {\ 0 \ 0 \T0 @Ym9?Y@-b iv&0A-@p4S`  PFT0DPEE$UX  ^PV00]P V0-04 BP $B3MDPE@D*Z hp@-P@Q0 @ 0 p]P@ R 0S Ln#Pp 8pM00 0, 0p$`#%X*+@+++@-2400S (0 0 pp ***ĘG-XM0MS0 DpW,Q`@`$$Q0 S+0A<P 0 0 ۍЍ0 000nS ?S aS ppS qS x0  0 d00L0̋0 8*4**%+ ,&AYA-X`0S L00S 08P8@p0Pp00+ ,**4*@-@L0@G2@00Sg&,0, 0S00_&* **+X*ŜC-RP`tM  44E  P RQ ğE R`S U[0t`FQ ğ;   T-P ׇ Ä CR ` 0S $ L:` 84\ P0@04ßQk [Q \Q< $Q  DR?` R @T$P \P" P!0 0^\0 1Np$@@$@ l  P\p\H 0P 0 P p00$0 R  "DQ"00" t 0Q "F0S 0QX ]Q \QQ0 00DS000S+K`tЍp1A$^? l0HQ pppDW\Q> $Q" 傀ಀ 0R㜁F p1 B!$Q, ltH R' DY  DR R DRڵQ 1 f00,Q ]Q 0 $R p0 Q,Q ]Q B + 0R0F p1 B!$Qd lXH R_ pppDW{  DRw RQ =&&++-++*Pp@-@@P@T -|@| |P|`0Sh  `0 pX@ P ,0< 8$0@pp@%X*}A1+@ʷ+9A-@P@p0S0P0`x0 R ` R0T @ 0S 4 P@` +**H%X[+hP@-, 0 F+@wP@-, 0 :+@P@-, 0 .+@~P@- , 0 0 k+@*+ƄP@- , 0 0 Y+@*+ƥP@- u, 0 0 G+@*+p@-PAM C0@ 000 0S0! $:P7 0S40_=PP0 0T00aS` 0` 0R`T0 0 0@0S0@T@ @0 Q000S0&AލpP, L0 P @4  9P+T+H+D+@O-1M MP+ 84 1ݍ ЍP $9P @4@/ BPZ30S cs؃ 4PPQ / 3P㜃堓0S0S `V~`30S5 0@P/ T30 083 0% (3($3Q0Q3@OoB0B&Q20S  2` 0gP0002`P0 0R R00 R K@P 42H"000 H 2 2QU2@OoB0% Qy10Su 1@#P0001@h, =] 0PA0S0X&,`V pQ 0S 0S0 0@P+ 0! 0 00 00QQ0@OoB0i%Q|00S  d0@ 0P000<0@`+@+ , *Ę**+H*0+D+T*4*+L G-JMMPp 70@ 000 0S! 8P+ 0S(0;PP# T0  1 1 R0 0S0QW`5 p1 0Sd1d呇P* H1 @JލЍP @ ! S8PJW#P0ʡ ]0S @$00 R000S00 'l0P0V4pq T0SP00@+L+D+H+D*<+@+h@l0 0 0 0Z+hq^0 0 0 0P+hqQG-KMMP* p2 KލЍPX"7P @82@42000$uXP 2 0S@2- PP0 +qá0S 0S 00 2@P -\1@0S l4PD1 X0PP 414!00(1 0/0S P* 00 000 T  P_oR M&l0Q00S 0@0dP0 00`0@ \$+@t+ ,+hǁ+D*< *Ę**+8Lj+D+L+HqQ*4l*@@-PAMM b) 0 @KPP0 .` pF oG|0p 0pppp0+6P!AލЍ0S 0 `X+@*ǭDŽ+hqQ0P  /=P@-)0$ 00 0+@*Pp@-o@P P `hP TP (pU ( P$0 0 p=*0@- 0*+@P@-( $0 00S/0必+@*H*0@- 02*+@Pp@-0o0@PP  0S 0 z啅0S P (0 0pP@`P<P ]4P000 0Q+\*=b*hxϦ*L+@A0@- Z 0Ȏ*H+@0@- P 0ț*+@@-(@(0 E 00S 0 *Lȱ+@+\0@- 5 0Ⱦ*4+@P00P0SA- 2(0 !0ЍPAaq0S000+0S 0S1000PP#P00P , F27`0H L0<\04 +@*P**=*Ơ*, 0@- 00*0+@0@- 09*D+@P00P0Sp@- '0 0pP`P@P# 0P 30P xl00?o2`SP@8 8 <0m0S000+@*=U**oP00P0@-S x' 0 ЍP  <5P 0Pd00}S`00S T0TR0HpP 40 0, 0( 0+@ɉ*H*ɚ+`+8+40p@-PP0000G8@Ppp dp@P p@&'1@0@ 0S 000+@**+8P00P0@-S ' L0 ЍP 4 4P 0 P 0+@+`@- P& @1 ЍpP,! 4P @1@*-P0 P` /@Py*0@0 S0 0S P xP l0 Q0S  L0@ 0rP000$0@+@t+ , *Ę*+`*4@-P& 0 ЍP 0S t C4P 0S0TP0@P ,0 $ +4P+@-5=+`#C-`@ppPH_oR`TP=10S|1| ЍC4TPda86& X1 ЍHg5U@ 0 00 1"T:pXC(PPQ 0RPSp+5|0@0 +DT tT0P``TT TU@T 7@P XP $0  ЍC+D*OE+@Qʂ3r|J oʈ@-$MP% 2 $ЍPN0S!3P 0 1C$TP 00|S 6P ~P 0tT@h1d@Q) PP @4QP t, 0S!PR xk,p@lg,d*`(P %U>P00 0W,ȽS!0RҎҗp@-@P 00PU G LPp00p@-`Pp@0P< 0-0Sp h0 SÙ Ѝ00S 0C @pP2*ҢP/0S/0@-@Q0%Q#0S P   R   07W0C20s07W  Br&G-pP(P SR@A YAPP0   PAPN0 0010S / =Pe )`@=P 0PS $2` P):`=P P)P :q=PP000S`UK ⴗ0S 00S1 @RđR0 d  T@P0 0 U N)K)H) 0 011 0Ѝ @P) `8 0S000') 0S S St0 0S 0`S@)H0PU  ),Pһ* *(*$m - BR0 R  P R 'O-@M M pPE$@@P0DHLP0(,$00D (0p0,0DHL` 0 0S 0S X 0Sf@DDHL`0$(0 0,0`ލ ЍP0V0 0S ;'L@P `tP PoP @jP4: $5000S V PU@ /LV@0S  T7P @0U0C?o20S b4pWp 00C00p0Tp pW D7pPpUP 0S 70P00$ 0R 0100LE+ 7Z0<03 0 048[)3 t30S6Zl# d(@;0P0 $3@@':;0P@ 0 @'0`0 @i0 `0PPy P00@tPS 'P Y0@ 0'T00STeU 0S} W +X6+Xs6+Xo6XP+ 60!0 4Pp80L YA+ P06E>00007P1@@DcT@@/;0P  00+P 0g6 08 04@ 0R 0S10}S'u0S @0S 0S@0P/JP0Y8<00 @C&7?GO|*0Ӝ***8ӣ+`DŽ*\*4ǁў+@&0*XO-iM Mh8dLlOpt΍40,xHD@|0 !0PP0A6K0 0)p7 ,A&@0&4aD&8Q少=Ⱁ0E?oT20SHLQ 0S ᭻PVV 0S#U|U>0Sfd0sh0sl0sp0s0St0s tN&@>0S0 /JP&&>0S 00SU 0 o 0 .=0S ~YP' Uh=- (0S ~O(dP$.?O 0 (00 @P /`>0S-@|>P R* @,0 RZeEP<0S 00|SO h0S`<0AT }[ N @> = Ml,4;`0S00  U ;+ 0S 00S 0Py 0Sv %pCḠtA`P` 0S :UIPRCX :Hb=`PW ,x`x0SU x0SZ < 0 P#P %9P  0`!Y/0\1X1T100U/p `10T1S 0S \AT! 0S ,DP  (Ul0 0Jⵓ0S 00S P `Ը^%\KRKύU000,!0 0!c4 8!0R PP000 HH9c/01010U`P VDIҺ04 0 PtPt0S4 0הoUU`P@Tt  p 0k_0pP8/JP90S PP\k/k@@(D3 0300S k?/80S00?o 2#PP0 P70S P 0S$P 0S$X7XGpVHCP@38)43,70$7P 00@T XB _GP 00@T IB PGP 00PR UP`phFlP<Tt 'w(P<60S&`x@T(4!\&KV&S&5PU; W 0( Fr C& @6 ,6@T K?10P%00X@L4!%&450S(PZ= P5%& &Px0$S&&0p<00S``4TxTP<0S 50S 5 @< x%V 40S D5 T|@ @%T %I&p 5:p40S 4q`S,0H0`0#@ H0D{P: 7pPP`@P +08 R <3000@ @#Pp`@" H0KP c@ pP `@0S Pp@POȠZ- 0x0P (3P00S 0P P 0*S0 ԒP0-S ȒPP Q00 /R *R0 ⵒ@Pz000Su$2 0D忒*ǠC *X1W*\+`Ֆ՝% ʢո*Ȥ+@ #=G*`ֿ֋ym*8*+ ֹ+K0** S*q%*9N*a`nדר%&X7:ISwfؙءمپ@1`s٠*H^VQ  R m$*Acvڈڭ+\*lB@*Ǡں*L*hyt* +p+h*`*XP 0, sT0AETsP 010Ss@P f"``P pP  P000P P P  ;"P80S S WN (80K/CR032 V 0S` 1 0p 况W5V6ZV Z4 0<"2S"82Q0SK?0<0 |s2 SKH2 4@LI0SF20> u{00 PP00Sxy43r|00 P 00S% 30S0|03ho0ts3 @ Q P 8q@N0S30`yhltpp4d Rʔ4$UCp4R P 4DP! 44`l0Əs l0l0@T> T  $P8ZE0 0 گ 2 @Rl ME0"0C?o2? FE"0 "0A圮z0 S ;S0 ^@P 0 R RT 0S@0S,0?&", (0 R / T$@.͡"͡d.S l0"R0 ̡ 0#PP`#PP0S0S60SQ#@P ?B&P 0 .S0D@0$.0 pww0LppL0 LX*pX \D\P #P U pW70S 70S 7w P #;60S @DT880S DXF[  0S PZ0S= S E#n8 8`00S0T0SF wPvH  #P  ?P Ug i$90Si)0Q cH) Q0X9 7Xl9#25 9R0 sr Z.^ 0A3/@Z2p9@<c *0 R0(:Q8:I T T: 0 S 6di4h e3la2p]1"0S,: 0R.K 0S 8000S 1000S *000S #00|iލ Ѝ0S 03/0S 00s@- P@87P  27P0P ^Ѝp`P  7P 0 FUp^P Ѝp@ 0S S0S  70PP.0@-Mh 00pP P10S 0S00 0 Ѝ8 qQa @T0 S 00S 0s 0 :3P 0 S000Bp@ T d=>P 0|S q00 0S00 0000** < *Ǡ**XA-` M@p -000@00P<0P/S:S X<@=P - <y-p$ (-/@@B@P/:;BpP [@P  Ѝ@/000p0 @@PW@p00l0@@DcT@@0>0@0CcS1S@Ѱѱ&+@PP00/@-oB (0@  000dB@* *ɰ@-^B p0@ `00S T0 0Lpp<0000S ^AB@* ***ɰ@-8B@\00S P0 0Hpp8 10 10S ;B@***ɰ d0@- vT00S H0 0@ppl00 101000* ***ɰ+ , -X0lM@ Rd @,80 00ssGH * L**@-0lM@50 0 00 0rS sS l<d d,d Xg,P0 00ss,d $* + ,*ɰ+`ۇx۩**ہ@-PP`@ @0@ss00V 0ss0000@? b?P UV 0A0T0Ѝp00CS0 Sp0 S 0 /O-TMxp|W00˯? p0p0 0QA0P`0V0W B@4 D000S@ H 8PZ0S= S D0 S00 @P)#A0S A0#S A|0pS X!0 R R 00@@0`P5 p`5刵P<00CS0~0 S(P50S5U <% 00e  20We S00G00S+ O+0S 0 S  Z  S800CS0IPP00CS0>0h `10 @P00CS0 %00 0 s`83 ap0SS 00  00BލЍ@d3@t<30S VW@@ c030!13 0heV S$ " R 5U Q Q$Q V VR"d 0a0H"0O0V T"  0 C " T! RBd@Q@T [ ! @ S)S   @  @R04 5T dT(S@ V-S R !   A.U PW040 00S10S 3/1U 0   0ZR\@\0 RY P 9/ 10 XS P 8/0E,*ɰ | +@***H****C* x+X+@(&*-A-` @T Ŋ 0 ЍAЍ/0p0$ P $xh0 h0h .:oB0@S P 5/f*+@*ɰ |*hO-@FMs M` ( @= = =0$0`30(0$ 0H,@_K0P S>S0 a 3 Fލ Ѝ#K0 @,Q()2@@Ȳ@aGT  C 2 K 0 PD0P|2d 8@P `"`de) La)0S 00S , 0(d  GPP d˧@0S00?o2 )P \=0@6J6 D01@ p  d壧 01 D0(66S0d00 0d0A0`PS ʼnP P 00S t0 |0OP@0H @00,`@0?**+@+@*Hֿ*y֋*3*Q*g{0O-FJMMsn0pȖVXv600S00p i 9PpX X6  P60 9P( JލЍ60 0 00V97S 50SZ5Hg5̥0S# 0S5 Q U 5R "P 0S l500CS85Xg00H=0S P97S( 4 4%0SX0$000(00000 "PF 40000Zt40܀C XSX ,4l`0(  $   @0 CP 3( 4\ 0k0$<` ((0d $r 0+ <7$ &S t3d0 R0S R3(0008'P30SH97S00000 "0S   0~p"b008'nPL2 0 00 00Ib 0 _; ap` 087LP@ 97R] Sȁ 0S [Q0sN0010S ;70:70?70>7='<HL0S ,0< x1, >P!1 R  @ 0 &0ZP 0S 0097S|0 0S [[X  S\00000IR*ɰ*<*T**܍**@**|****Hܵ+@ܺ*ݹ**Qcݙ*Iiހ@- 2 Bp`WLM LЍ@ ㉿pP>  傿p8 00011 0S<0 ?|q0 (,00 Q 00SZ=9Q ='/?@#b!"/{p ;0S ;0#S PTN00+0(60 8Fpp ;0S ;0#S 4 p&p 90S0 00 0 07LЍ*<*T*bMސޱ*ɰ0A-H`D0 82Vp  R`RBR RB`2b  Q  ,,&00EoE?AA?1 R$!$! 1 (!(! t1 ,!,! d1 0!0! T1 4!4! D1 8!8! 41 5P@`4`$\4Q00P4@T D40S@ 440S@@$40SP{40S3cq 3 3c$Ѝ030SCP WPDh3 `3 0 HP@-:0003 & yP@#R000$ 00 0\P  tTP d@P  H 2@4,2P0 S R0S S @T% 1Ao0S3 1o10S 1 P5|zX10S  P01S 0 0S PU P 0S 0S h01Sh|Y 40 l+P++<+8+**ߤ+@n*ɰ߼ +h* $***A-ML8  0/$484(P 0@00 8@P@8@80$080SP 7Q  Ѝ 00-S0S 7 :7 4770SJ040080<0p7l 0@P`GA\TL8 3PX87,06P1PP 7`@0 3P 3P6Qu AQ ,0 p,0000.Pn 嬡 0S d6 80sk<0slHFPػ0040Sf00Sj5$  0  r 00|S  0<P,,0SpH5@540 ,,0S x t5H40,0p,0PP0: S 4 44 n0 0,0R4 P4 00S,  P 4 000S!@88<48@0SP4@y HTPX@00S 0P000 4 $|4 R4$l5 4R P 3Cg<0s <30SP 30S 20S2P20S#Br, 00CS0|,Up` VmU|\000@_ Ur,00@ 岠000@ 40CS,0"p,000q002P001!P |哠40S 40,3/0,0@00@h!0 R0$P70 S>L1#(0 ? 0!$$P 0 0 0| 0 |, 0`$P0 f0#a38E< A,0S 40,3/0a*h+`*`+p*L*H**++Q**  %+h՝+@*Tʢ Vyt q+`h*# +3*+\N*t[@-EM D, 0 0PO$(0,0DP@,D0,<@P@@<0 0;001o<<0S>;0SV 0004 8 + R<00S0 @0qPKNx,14S$`s1P $00|S $P/$5@860SR 460 SN $ 募): (1RS ,1S $00-S0S : :$ <0S $ EߍH0S X: 40sl80smp 0: S 0&0&0`7 R,T7T'TT2$00|S 8$,((0S$up6,! l6 600$ 嶿((0S6$6R P b|6Fx60S` 50S 50S5`50S 0CS0<0S 5  (p(*P$',0%p,0(0q(05`001!PPM40 SF4/00S 00(3/0(0,>,D0Sx$0 S<Q  `40S 0 4RC pq XL%&0$Xp0剸pu4P@$P咹  0|ipŝP$\忝<0S s 0 P0 (PP@ 0T0 0 0(0㳍PvTse( 00CS0(%pj P @P( 0@#%0 ? 0!$$P 0 , 00CS0,@ T@0S@ (00@ VE,00@ 30 SN1(00@B , 0@ (nT! 0 t, 00CS0,p@ TD0HQ0D0 TV A @(I, 0@$P1 70#2l@D `5TP]< 00S ,-48 (0S 00(3/,*h+`d*`+p*Ll*D****  *H*+@*TZ+Pn+h++h%* 33Qʢ ytV*+\՝*lڭ $/0\*oQP@-X@ L0 r P 兜@ 0 *+@*@-@20 ᪽ЍQ p@-P,@P@pӣP @%@-P@PDP,k $0R 0 *zt*@-P@PDP,O $0R  *,m*0P @- Pp@T Wp`W VL\ P  R/%G-@p`xM-T oTP ЍGFT8,i,a,1 (!Q@ QPv ЍGz 8S 0S _RP pP  0 @DTЍP 0 pX0   & 03/ 0  Ҽ=*`%,8 $R!R(R3 R 8( 0 Q Q QG (-R ( R 8( "^'  ^ ,QQ(88S08 S08 ( ( !R0/\^^00^ "^0 00Q8/8S08 S08/*%p@-H0H@8D0 (8080$8P  Up$80+K0*+ 0@-A(8S U[0 S /7#0) P p p $8S 80pP\ UP 0S ,8S0$[ (8S 00CS0 㘼0 0` 082 8$ 0`3/48S 0S 00CS0 S0  P0R H@ Ѝpb*#/+"+ 0"%+?;#;0@#5;DE @0!ɹ0@SX P`U0SPڼ1PL1 Q EQ@@k{H{7{Z#H!`d♹XP e0!呹P<<l@e 0 ၹ 00S @ P0S S d m@ dh0 Sl00pp A.*H*L+*`mf+`Q (+p+h!+**Kߍ@P%U[0DE>@-/X @0 R0 @00S 40 0,pp /@*`**-$M?0 0 έ$Ѝ0-4M 00 000g/P4ЍO--pMME|U= " `44  P!PU0( RPU4$ 0 R 0t*|\P $0S  0sH0S (P $0c40S` $1⧸`#W 06 {@0(@{{zdWdp00#f3` t3R - BP  ( BRڗP3Ps"B D#0 f0#2j`  0 ß S#3RPR r !00f "Q $` Q(0 0SZQ=9 =:k{<2@Q08.@{PB!5 Q; %#3[PN  d!0@! f!1`Q0Fx1p Sf Q 1*!3\7?\06W.0h!P0\1 000ssϱ$}0S##5; !lU; Ƿ`0Sf 忷`0 0ppMߍ @YA.+*`**L+ פx+dh+pm+xQm Dt (~7**+h~@! Q0 @@k{H{7{d0Xx0P  pPO`<<pGe0  \`  V@--@U-@p@-Bd00` pd00CS00p ,P P00 @R0S"P7d`Qd00CS0*p "P \Pd00CS0p000S8A PA p0 0 `V$yp0 c`Pd00CS0[p 0@S P,P \Pd00CS0Jp `V0 0 x(Pp@+%+A-pp@` P@ .!PP @P PE  P@OoB@+O- U0mMS pDPd -0S hmߍ0P.0͵14PPd(0P/S SUpE P\4PPP P,$0CS0 p, P P P0 PsdJ'P P 'P d0ppP 0? hKxdIxdAp P 0Sd0ppP0? ,xp P 0So0S di0 P P d00CS0Rp`2`V P Q82<0 0 dAQ 03p0 1@S P0S!   Cb"c!   c# 0`S<1Td00CS0p0 dL\0p 0 p P`, ^0#S^0C0 hwP\\ *+m+ +@ ,% 2d*Θ&*+ **@-0 @0S兜P  FP  0 00@ x0 lmP T0 LdP 00 ,[P 0 &&Х+D+7 - BR0 R  P R 䝶1A-0aS0P03P3U QP 00.S Pl`1h޵ \HT1P@  D(P00T,!,!,0 $1$ U 0!彵0@p000 00000P0 0p0S000P0T h0h0 @U t0&P$0`T**HΓ<***A^*I+8+<w++9+D* scnp@-@P x0x 00p @0h hP0d Q0 P0P H0@D0@ (80@0S, 0p**+<+8+0**T**** H0@- 800S ,0 0$pp* ***A-@*Qp0S `0S pp:00`P000000S p`0S pp000080xT  S*p***T+XO-`"AM |2 MR0pB h" R S4 P 04 SP 4SPP004Aލ Ѝ$Rg1+;004P/S ++PbꢭpVp們0| 00g000000000S H1ou410N 1 R100CcSppW000S 0oX 000000o❮$RV00\u@cuPPNT{ P00+ ,*0+***H+\*L*QJ^+@* A-Q0qS0`00@S Q`Ѝ0.SLP ]P t0 R 0000@ Pl00}S0s00T 0S$@,S **H+D*)R*&+@O-쁟a0AS04M00qSP Q 1R4ЍPF P0.0lP00X"P" H@,$P$,!0嚳20$A$000 0味@, '"P 0 僳@ $P 0$0 pq00P0}S0s00U 0S(@<zR D**H+D+@*Z**02@- ٝP%+A-`PY`pU L@P  8@P $@A`Ke@-@P+8 0A- 0p0@S0`P0>P㬀" NP 0S 0"S x0S R00`P"S0"S0 00+4**H+@t+8*0@-M M P  @W#Pۍ Ѝ0Phz4/S! @ /#P;0@TP/PZO-@pP`V1@@P`3:"`E"0P԰0Y/  0!T@1PSZ 0 10S 0}Q0 R Cm!0S*00 060 Ѝ+x*@-'L0@0 <pppP0 0SP0 0'@Ѝ*@th+xP  R @-  Rx000 0R/`0000/0S < S0C00S/ S/0C*t*l*p*x@-0 000 0S R 0Sd0000S b0Cs R@ S0 Ѝ && 0@-(A`0S0 0 0 0!0p 0S:S50P0S0 0 000 ɫp0S:S5000h `0P岫pTU00, 0 妫p(IЍp**%BC-@\ᄐpA`\P ^T1:00"\ \ L|9̠^@2\\WO-`p@A R %R Z0  0 @PcUF 0/U-UA%U  GR%0R0PMU30S2 2"0S0mPE_o C0RGQ .Q\P0mU nU|2G0Sx2l" 0 BQ P082 R 8cU.U00  0" R10S /S0S  0R 01B^ 0 BA R : ^^/XR \/ B/o" RQ00S 0GSE.U GT]*0SPY*0SPU*@P0LG RS QK 0TE*/0S@*<0 QS8*90S2*+0S-*> @ S'*000GS0P#0!*+@+0m+4+8/A-p`P @bqP0  T  `00T  N0@ R   `FVp`00CS0 Xz PpTD000`000 T00_m%C-pP`@0尐TO  00@)ax0@P`0 \L00D P 0 Ѝ+K0?*%* *O-M M@ P 0<`0  43P`\ &P #\ 30S) P Q PUP 弩p%0@00002F.&P t"tF$F@dNލ Ѝ pp00\ ,> rp \3020(PS @ᗩ,0( 0/" \pQ$0$S,F␡0I00S {0h$Q000SZ=9Q =*/?@#b!"/E p4$0S $0#S [$0AS  \0 0 PE0 P0/p 0S q$0n$ 0 pt0L\ }P^$<00*?q*bMֿ3Ip@-@Pp@̧p@-@PP`iP 8dPp0Sp匍p!H@-@:P l@-LlP@-@dlp P@-MP0@-PlMQ@00 00 T  40S P K00 P B0 0 0 PrCcpWX 30S q@n@@`  Hb ^P p`|P@ 0S t@P@ F M" f P@; B"T0S W@P@q) 0"0SHLo0 S8 00P 0 0P0 2  1 PP 00 @T  " P 0 0@T  !P lЍ`ŭ]DP@ !T1 1@T 0P 0`V6PP) ?000y0 0 0P@T|Q PP*%***PLQH-%E+@< +0**+ *ֹ+K0** +8+47@-P~ 1 Ѝ0Q0S 1 1JP !70 CRtA R Sd10R L1P 0S0S(1 0P 0S 10S 0 0@ @U 0 @0@M 0 @G 0 @A 0 @;  0 00S 0S+@*+@U*6*P*,**$*H++++++++++h+d*800S!@-@0M,   0~P0S8m@0Ѝ0@*0 -A-P,! 0'(⠦,00 Q 00SZ=9Q ='/?@#b!"/yp !0S !0#S @P!<00!0S !0#S 0@P0C 0000*bM/(/@-$0S 0 0 0 ;Ѝ@- @P0㫏P0@$0@-`P0 `嚏@P  P$`0+0 0Ѝp@-@P 嵐峐᱐O-鐒P0pS`@4M 0 0/! @T T@! .  0`F0C 0000V*  塤p!0S1 !0#S- !0(0!0S0T  0 @0p`F@P0,0 0#S 4ЍrP @0p00000S  ⢥$0( Q00SZ=9Q =*/?@#b!"/  wp  0S 0#S 0 P40@ 0 $; <00(0*bM*70@-S`p@  㩍P;0  000(0(0S,0SP U. 0 00 0-P (0S,0S PU` ЍP0 0PUPPP !0 S 0PEUPG K00 00 0@-p`P @P,0S T000(0 ЍT000@ R   `FV 0P 0 ST(000(0T00_m/@-6+L80!R/P$0<1s0S/ϩ10/+L%p@-3BM000030S3@TBߍpxflcdP \Y@84#1S,! R< 03/3CPQ@RTA 00@S@b+RG@PbxP @00S 00,S 00S0 @10 3/P00000S0S 11 03/0S+000P0 P0 0 Sy000 rPB0p P00 SH^0000S 00,S 00 S00S 0 P 103/P 40000 H ,000P jP++,+T +L[C%+D%+H+%wB+ 0q+ @-l 0  +@- 0++TP `00CS`0p S00 P0S X0X /X%C-Pp@  l1s0S `l|  v0S e 0s`V   Ѝ+ %+o+T@-@7 p( P@ P ,7ЍX0/LAP 00H,G%&00s@-@ 塡1`s0S P0S  咡 H厡@0 ⧡0nS Ѝp+%++@-PMP TQ P H00S@0\A PЍ @oPݧ6+%@-@80~T ȧ6" P+D0@-|AT 0S  0 6%+ @07@-LAP/A0P00  Ѝ0%G @-@0S S S 0 \R0 R \ @ RC-P0M@/00/0p0 /p` 0@YQT@D0 @ЍC+6s0 ,I@T*Qs00!%hG-AMMP`PxB  d2d `2 孠T2 PƠ 0 04R| 0 0 幠 0R  0 S!J`㉆pP@D✡0S1  嗠1 0S00SR&@@T  dT @5<1<1s0S [0Q \! 1 Lv倠AލЍpP0 SS  S00<1s0S 娦p 0圠0CZ #Z <x5 0 @+ +>+++`+++T %++0@-EM,P  P@PQ5Eߍ0 ,PU % #  x0 <  TP֠ "5ϣ%;H %iO-``3MP@ pHH崟D`4#$(3 $ğUPE 㣅Pb00CS0%p00 R0SdP1s0S6 P#hP2x2l1s0S  ⓟ60 PpP1 Ps0S  P pC PXS,1s0S 7 P 0 S 1s0S <1s0S 庥l1s0S 0x0`1 O P1- R @4 U 11s0S WpG'`PK><1s0S0  |ЍS R   RjVP00Uq QDD++ > p+++`%+ ++w++p@-BM,\PP3L1 DŞ$!41 ԞU@P 4`0<1s0S 㫄0Q 0 堞 Bߍp ᓄP`⢲TPp0功J<~+>+++`;%+++ p@-BM5,h?PP3X1 P[0!(1 $j@P3`1<1s0S A0Q B0 6 \YBߍp )P`8TP|P C@=<↤+>+++`;%+++ 0@-@hP4MTP 0P,,<<0  ] Y4Ѝ0+ =+0@-@DP4M0 0P88 0A4Ѝ0+ =@-M, ,PF A S 0 001 寝1 010000 001s0S 1 011s0S1 011l s001 012 02 2s0S܍%+?Z=+@-(@ $ @+ t{ tz@-@1T}@$p@-@PPpwP p0@-AM MPAލ Ѝ0@D@P(0|!D;PPl1LAd1T@ZX塝TR0!P0㹞uDB>+@7 U0S S 000 yp0!0!6yp0!0 .yp 0 0+#(:%4%@+\+H+4++,++0AM]~y+P+%G19XGG+ +%+$%+(;y+ ++Ǒ++ Dž+@-@ 喟  咟j&0 @-0S +tT@-00CS0p0 00S00%+P@-@aP- +x + +0@-M0Q00@ 0B> 凞 ǫP 0 @P00CS0p 0 ! h00S0@oЍ00 p0 P 0S*000+ ;h%0Aq P/P//0@-^@\P0 R NQ | 0\ P0\R@ @ 0$R ^ ?+@PP 80 dÅe"Å^ P?d" @pef"/++p@-tp@pP 0TSp 0T X0h2So@ T 0T * 0ܝ @M%8%+RV0@-P@4Ml<L 0<, p"lR < 0 2  s0-  ,S 0"!8 0r 0R><r> 04Ѝ0+%@-`0S@ P0S 0000q20\ @}+es@-0Pl00@0p`h R R  l R  T8b03/@ЍpQ P%%,+hA-$q`AQT 0SP ʂ᩻@P0000}0P vP0 oP0 thP  dd˝\0H@H  "  \ %+at: %s&0%+,0@-1s0S 0P |%+(0@- l@0 儖++`+p@-`BM Py@0 S0`01s0ST01y0 匝0Pn00x0 =BߍpB/ BR 0P00P cy0001+%^++ 0?o2 0/%H-AM MA>,r,:700000P0000@0 Pڶ0 đ  P0SS WS BS 0 +P  RVdqk0S 4A10 S0Y` 㺕1s0S ؠ0S Q  W   |P Y 0@^S00CS00 S00 P0SS+ B+ +`+%+p@-PH@P@p7 P P 0 P @% 0/@-o/A-@PP p 00CS0 `V  PP;P0 P00XA* 0S P0000 !0S0R 00 @ dOA-A`P0E!S qpU 0!0P0CPSJ0 `00CS`0p S X0 X 0P"SP, 㼜0SP`0P0CS`0p SX0 X ! RX!㡜J0 0P0 P 000P lP60"S0T0A *8+0 0P0 p+% l%hs*\x@-0S S S \S ^S R@ Br0 000 Cr@T0 0 Br@T1 0 Br\1s0 P P0 dA-x@& P0 =`P`PP2 00pPF 0P %0V @P  @0S@0Sؼ)00@ PP?P PPP P 0!SP倚+x%sop@-@MPP\1  3@P`u00u0ۍp0 P 0@ 0000S TO  P00 f (\P%+p@-`@;PP 0 /Up$o P`@ps7@-@P 噓6 . R ' #@T| Ѝ0(R( d嚓0PP O<P K(P + u@f tx tyy+ 0@-@M@0(@,0 0 @P |Ѝ00,x0 bPPP P0S bp00@SP O+ %+ @-堙 (,+ @-@ 峔 孔|mP | 0P3P xwtuh 叔 X| 傔Ѝ+ tx ty@fp@-0M`5PPS 1<1s0S |HxAx} 0 9 09Y| <幒4S,Q( 屒,0F R 妒 墒<P 81P` 2|0(0S r=R 00FS0 xhP0Ѝp\XTP D%+ %&x,1+  t7BQ^@-0 X@7+ x-@-z0 R   ЍЍ/+L-@-zD-@-Z0 R   ЍЍ/+LA-ARp`P@1T pP>`@DO-dM@P{0P 0d{0P0 0 R 8p80 0(P400P`,@@pp0p,@ T R3 U&T  (`0 (d(0p  Z0 000_o 0,@@,@ 0RT ZPPU w 4 JR  (0 R 0S0c} } 0S p dЍT 3  0@D(0,@yD00(0 RR 8:0@D(0,@(0 R 0@D(0,@w(0@D`(0,@oVl( `F  (0@D`(0,@_(0@D d(0,@WVS P ( Q @D( ,@H E ( Q  ` =V 980!((PO (g) R  8 %Q  R P(/bxtph8@Ht  C  $P ,0 000S(/( 08 40TU (0 2/Q@D0T,@(0UT(0 2/Qt0(00@DS,@T} z+L '- CUg}'O-lM($Azp>zPWPPD8@ 0 0Ÿ   0<0`2`@0\2 @0P 00)A@P 4,@` XCP`@0S($*P @P O|M|[@lЍX@?@d 00 S @. @ C< ⢖0ЍC0%%_0@-MP 0 :  S00R@ P uЍ0 dp P @TPT0dHS 8$   {+LO-0]M-SP M0S 4P ]ލ ЍOv/v]ލ Ѝ@p㬄P* 00S0W0S 0S?`` xpPD   @pW ]ލ ЍOz0: S  SQ PPou UP xa0v: S+"(3 P@`fP2gy  KⵎP p  0 0K0 00 0S0S`-嚎P``㨎vH 0S 0` EᐎP V ሎP {z Rḏ]R[^pPR ˏPw!1[Z d 0\ᖏ>ᓏZ?p`3 0S!Pv000 # P: b  0S -pP)P-Q# 0Sp<+L%M#2_DpR ~ ʷC%0 R R /0@-0S0R @ PaPLU APLU @P AC\ 0T00 0@-@P@@  tP G GP00S D00S  40 -F!_MXኑ+`++% @-Ht@-?xPp@-P@5xp 000/+p@-@P0-S@@p GP0Tpp0p@-0@S`@MP0@ V P@ЍpPU Pm t0P0%8+n;@-@P @(00S@ +p@-@PPp00Spp@- +A- `pP@P000 PP0 0dm@-@P P0P00S@? +p@-``MPU< 0S9 OP0 @@?T-  L `00@ C @ F  0*R /D/GXP10FE> P |`Ѝp~ 0@-p098 PP@>pq00Q00S 0&)ņ(\^# ;#;0bQT |` 0X R p 009 00S II(, 0@++$@-P X00S S 9(,0 @T  +p0@-@TI0 pq0@ @}01p++$l0@-^ 9 @!@&)60 Q@ ^@U+0 R$ 0@-00S0C0@ S 0S!‚"\0PQU 0000@/+P0001S0 0/%D7@-P R I00 #0 Ѝ00R0 @!"0@@pq Ѝ0@V?+ 0@- 00pq Ѝ80098<@ q|/ 00\ /+A-p` PP"@9  @0@  P09   _ 09 r`A++@@A-p`VY@  @ @ 0 oP0 0z0 T 0 0o0@A) ++0P /+\ -P0S0@  / P2:1S0BS /C-@(QM@`@|0S 1U>:ЍbS6 .S5 00C S 0/OP >cS@U:x>0@0CS000 00 B/NP @@@++-p@-@P 0S`PpPQ P@dPQVL;>nP0S  p P%L%EA-PP`p@ 01S E*0S  R@ *Sn#0S 0Sn0*S0S sS0 dS0 k0C?o210@@ 0C^S0SKP@u0C?o2+@-XM pL!@DN@N<N8MTr,3,!4!!!8!! +,++h+ +h+%   * E+| p } m  +(  +}   +l % +Ǥ+ + ++X+U@  U !UQ0-UQ00  [@0#0P2 PQ 0 a0CS00 0-P   00P< 0Sa0@S @P000S- +Y{P% 0e`0,0Z0@0S 0! m,P 0S|-P  +a0ES000 +P +0 /C: 0*U @U !U<30S 97R0 <430S07S ;07S 00#p#p{.10@S0 @007S9 P 0S S30S PP d0S7 40Sl/#0CSPvd ;P $0FcS00 0 e` !S $0 0R0)?040S " ,/!S 0%0 0R0)?0 l 0R00 !ı50S 0R0  0R0 0!ıt q 5k 6 0R00 !ı^860S  0R0 0R0 0!ıJ  0R0)?0=60S 60S 3`8!S 0%70S s!S 0 ~ 6  0@gR00 !00N!R0 eSd0C0<0S d0 !0<0<kQ0rdQ0]&[P0 !<8 NVKx3D]Bp80S0SJ8@ @ p8 D 9 H 9 uP( 6@900 00R00 !ıp900|90{ 0 00R00 !ı | 0< `0 0000R00 !ıf ` `<0P4 0P00 !ıP *P s P  0R0;; 0y%>P t0P00 !ıPj  0R0;; 0_0P00 !ı=`P4 R PPN]=pqJ \< ]F0P00 !ı=`P 70P00 !ıP + )2'<`P(P 0`0,`APU(P  00,00  d3X=0S8x Vdp- '0 ePP U U ?Vi!K0> R PP U U {!;0 ,BPP U U 9!`>0S %t.PP U U.P0!0P.% (P0 0S .00S>0գ?00 ϠR0  B  0? !S D/00ST?0գ?0/!h 00 ? ??0S080c@00S/+@-@0 S!0O-S`PpM`B`@ pP Z:T008 "1 0T S@D0X0@D@Ѝ0  0880  @/o0"S R 0CS0 Q  S P R 0T@180 0P R* 0P0 x  80 ^P ^ [0J0C+O-pZX& RP G`P|` P [ ``F 0R@ 0R U *0@S0S  Pp p@-`R P@ \0P @@@ 0ppM-@Pp M@p00`Cv RT0Ѝ0 p/<P0/D p/<P@7@-@PPe Ѝ00;SP0;S@@O@U AU \00SCBD00SBC0mS$00P# 0 +++Ǥp@-P\dpHPV@^8^LP gP @P%; @@98@T AT T ep00SCBp00SBCp0!@00CQ#q 0 DPp@{T ^gP 0S0^  PA0dP fP pip+++Ǥ@- @ @+$ @-p@++$  @-p@v++( 22G-pWkp`P| Q0PvppЍ[@P 0 ppq*\ Cp[p?SZ \0E0` 0S0MS0+S0GS 0VS 0VS0VES0VnS0VdS@0vS cS eS0@VxS 0@Vq0 #@V00Yrp*p+l+, Wp@-p@`PP%;N,!;0WV@` `;D Op *p+$ W 0 +$ 0 +$7@-dP@ PUP 0S  P Ѝ0+$Po/@- * ЍhA-`QpP P P@P%U0P 0 P l @B[T @P 6/P1[  @-~|0p p0h hhP 0X X@0L L8P0@4 4 %% X  ݈      C-P1M0SL @10SH 410SF Pp` Fi0@?oPU20S@ RPNe@LKЍPЍC 0@Sd@ 0DSd@ Td@ 0DSd@dT`P ]PEU@@+++G-@`M0PSS00/ @ R S"\R" :R R DZ Pp -P 0H3/0S@00Ѝ HP/@-颉p [' z)SZЍ00S @  di)\0PT T W' 8@pq  h+ # I kO-@h`TPbPPPpᔠ唰0SWpV  S P0Fp@ U0 PPUP@ RpP SpP%%p@-@QP .0S R SppQ0 R*A QR 0S:/@ PRS:/p@-`> PPp@pWp@1 0@-M *0 x@sr  - PP  000Ѝ0++x400S/@-$@P P@++@-@P  +P/ @-p@&&0@-M@%mPm00S@(aP DP OP AP dP oPi|0t00SЍ0 Xm0LP 00pqam00@G(+  %  O-0M0S 0S `0@S S { P 4X ЍR @p Pp 00t pPPP`\P# LP  pPPP 0S P``40SWPT]PQ ((@'#PP3`00uP0`0 tmP0`0 -P X ' X0 clP% 20SP `EP   @' YP lY |2 pd T2 AD2p@20WF0b,2P 0S P (mP11P %0S (. 1X P DP Pd1 XL10S X 010 (0 yq 000Sp 0 .P / 0 R  [ R 0 0P: l X -++ ++0 o+xh C+++++t+++%++$% P@- 0@+00@-BP &@+x A-P`XpVZPU@JT[jP0+$ 0 +@-}P@ @0 + 0 + 0 +p@-P@"@P Pp@5pp@-@`P(PpVU p@ Pp PpA-@Q`Pp _!WWUsG-@@` PР @PUЍppPV7FP V8p0SkЍG+@-W0@0S @y+0 R/%R %R0 sR0/@- @PP +nj  G-`d+d@p00CS0Pu U   0DIS  SUVp@P0 P00@- 0P AA-@0 0pR`@0S00 R0R@@0`P0S U  P@00%%O-MpxG`@ P!Q[ Z@gP[@P) 00p00 0(pЍPP P K PT VPAzP TP00pWp%% @-@KpfPPP Ѝ@@@@S`H0H 0P0oU ׃@U Ѝ{GSA-PPЍ0S `p@@@iTPP D00< 0`oW iPUiN@-@@ A-p@`P@0S P@0S0# CV* UR@ R %S0P @# CV* WR   R %S8 P0T@++C-EMPPEߍ@0 @pq `, (E`1P````PQ0p000 0`00nTP@pW MPpTW P0STЍ 46PT@+l , #%% 5 L0A-0S@`@P0L n@p8`PoT@lTjT+l T@-@@'P ,"P o +@-M@P ሰPۍ@ ۍ1O-0S# 10SPpP 0 `|R@0 -R` `P PP <9#@ ЍRP OPP  0 n S P SU @T ` vv` hP -@T@P@T 000d0i@P<`)@0SS++l g X +0A-`V8@P|!pP0 PЍA"sPp`@@@@"0 `mSS@ST ЍAʂЍ+l  -M hP  @oЍ0@-@P0MSP @-RxR hPX @Ѝ0@T@0: S *@R+0%%@-M@hP͡0 00Ѝ0@-M0@P hPl0 0S\P0 S\ tu t0Sp00Ѝ0++ǀ+x/G@-@BP P0@/R@-@ (0@0T\#@+@-00R\00S@"@+ǐ+|h00S /pp@-pq 5#@tqP PQpp+@-P!#Q3#0 R/  +ǐO-q$M0S@uP`0S\0SO@iP`@@100CS jDP`@ 0S"P`uv00 @0 00R  0嘠嘐00 000a 0 0000000P0 000`0IP$Ѝ+++ ++L+O-M<`pP@8@V |30Sp30`So`V L3``F`V`utV-,0S 300CS PQ ""Sn"PQ ""0S6 E` +20"`Px0X 0SJY/Y P @d"VD"0 <0 ut (20S2"0 000 e0 0 10S*P10S u,*Puq@Z }"Px"P<1Aq"P  "pq 410S G"P ЍO0G0 0 ЍO(V utS 00St0 1" 0 Q*)P@7ut`b++H+p+% +p+ǐ+4+%@ ++++TH00S <0P/000S $0@///+ǐ+L+p+'G-(p@P,`oP"V 410S(1`V``ut 10S1T0T0 003*`#*00oᨂY J)Puq00S@ W ЍGq!Vs V %++++T+O-M`jP P @+P! ЍO!@tqPV00SЍO0Ar!P0 00@WЍy!pP@PT p 0Z pq0 @P+++$A-p` Puq@VЍAv   0@2Ѝp@-@4P0SPpSpq @+0P  P/%0P  P/%@-P@p@-@PptP0S 0 0HS @ 00C0PPp@P  B 0+%+Ǩ0/+ǨG-`@ qPU  P9+ 'Y* OgOU&8Z@\{0 "0XPP00040000 (@0@000S < 0P00MP   0%+ǨP/P // / /00//000////0/0/p@-@4PPP wO4Pp4/O-M cD] r{PX  0 (JP 0  (XQXQ> 00 0 'P*Ѝ=ЍO <O-@P4M(0X0 ,0utP; @4Ѝ40SU4  0/QQ('P@Pp8d00 0dp P7l\   `賟V0,: \p` P PP@ᨣv V~' `8VP@,0S1 h3Z1 P@'L30pW0. 0$ `P" R $0 S S` P P  `VʏZ:P `@T_P@[ |20S 0Q S (0 S $PO 20S 0  P @1 R00 SA= P Pd p 4ЍO V 0Q  0PA R TA0 Pp``P@41`!Z 0 0@Q_ V VP@ P P P PP@ut 0w 0@Q_|l00S V V0 0 0S cP@p`0 ++T++$+++ ++T+\7@-P@P ,0 R  000 Ѝ0+O-p`4MV0  4Ѝ p`30S3V0V0 00&&t30VePT30S @ T T,CF $C0 PG0000HP!00 <0 P @,0p 200(00P P@0% 0P,0W\" ,00H" RF0{ 0Rï[0 P P p| p0Q  0PO,0-P!,0 R 1 P 0$00(0 ( #P\L10ST 0  $P @H X X P P@P P} P@P@P P T0' r0z{0 00S X X0,0,0S0S0b0 P$0 P$@++T++T+$++ +\pqp@-P@ Pp5p P P"L0L`P@0S63@TP@P0P@p%(H%0O-PM@`^P!@@T 0000 00W `F@P0 @_20S4 ЍOC".pP ЍOxy00 T 0SqI zqWU0x!pF0p!0`!0 0@0Ѝ[000S 1 0000@0@ 0TPuq@ p5Puq@ $P Q0@` 000CS d00S\`H0`0 0`0@+ ++ǘ+Ǥ+p@-p`= Puq @P 00S h0 Ѝ@1V0 @P180 ', Ѝ@ p` Ѝ++( @- kpq   Ѝp@-P p@`@P@PQp@Kpq  Bp@@PQpp@5+p@-P@`6P P pP@000S  p@+@-P @,{Q00Q  B@P+A-pPOpq\jG`vq@A4Y0 Q0T0A n+(0 R R /@-h@M0 M0P`p0@ )e P*`0 "e000ۍ Ѝ+Ǭ0w*p@-P@@Ppp@-@P \R ^R3 R   0 tS jSbS4 0CP@S 0 S" 0 Q ŸkC P eS  00C00C\T PQ  p2 p@@p 1@@ @@p@@p@@pQ 0xS QSDSK #1SJ BS0 C^Rp!XddR C&R  0 !@@ 0000 0000 0LS 0 00 060S@@@p0 000 0000 0 00000 R      R Z+Ǭ (%H+Ǹ%x? 2mO-PPAM@MPp㨕ep!PT)(pP)0,p<00K)pQp L:@P8u 0-epP!0 0 0P0  P  P ,00 &PAލЍ uPg `iP\0=Z* !Z' <Z 0J^S0͕ 0͕ 0$cv>Z =R+ =R-b [ =R<Z +Z -Z0Q =Z0 QP0QQ0QCo0S) 0 S(#S 0BS 0R\S 000S@  RG = Z* P+R( PE0P-!$,P3% R R R000#=R00S 0=S P,0E0P0 S0PS   Y PdP P P 0Su p0P  %P+Ǭ%%m&Rs$0 RP  /+0 14/+0 Q/P/%@-u04 ,    00+p+h+x+dG-P㌐剀G@GPT`ppP BHT >H  !  1H /H @`匀+A-8p@0PS` 0P0aP +@-@$ 0 @z+P 0 R   /+p00S/p@-`@mmPPPpP 0S8@pPp  +4+m@-6@PP00.IPl0 0E  A;D0'<'8'4&0&00u+E+d+p+|+Ȉ+ȔP/0/+0p@-@00P0 0R0 .PPPPPPPPPQQPQ&H&D&@&<&Pp P0 Q00++d+p+|+Ȉ+ȔC-餁@0PSpM`$p`xx!0 0 0S`0@ 0 8 @P(a00CS9 `PU: 0 Ѝ 0P  Uqr    Q   R l@S `P 0R } yP,tP+@++++%0%(+,0P$0 00S000/+++@+p@-H@P0S0000p01S 0E&P++dPp@-`0 p@X10S P@@p(1@0PSP5pP/`P0@@S  1CP0 1C"@P 0S000|  0p  0d  0@@P 1CP +++t+l+|+`O-M@pD`dC00wvP1S<& 1S8 @ 0A# RhY) Q   0  P20S P wv  P0S  ps000q`1U 0S ^ 0 S1C10410S,X7 1R 0 sr0`pS`0 P`0F[0 1R1Ѝ  p` 0nP  00KU1 0[0 `0S % Uz% 0R 0Q0tP 0C001萄 S rI  0++++4+ +d+A-p00PS` HP `P 80@0@D@ 0@0TЍ+4++ p@-P@ 0p@2A-`p@@PGE$1S 0P $@@+7@-8PPU p Ѝ0@@ @ Ѝ0+40 (! ,!/+0(! ,! /+P 0@-P/+P @-@P$0|P/+ȀP @-q0000/0@-S@ Q) 0S \Q@AOoB@0Sh Q S Q000S0000P Yp@-`@P 0Sp(P pG-lp0dES`P01SP001000PW PP- U p P Ѝ010vS00# pP0dDv0q# 0dc F $ F#P} 1R P@#1 PR0(d0 d0 0  0U*P0C0#00D001VX3 R 3PR 0 ЍG0SS QQ C0  0ЍGRP*pRS 0 0KP 0S0C 0A` 100P0C000jPPUF` 0Q 000 PQ_VP P0SPPA0SV_0Sh RPd w 0 ЍG*_V` P V10S t! RS 0  m_PP  P P0 8PPP0  B01S0R4ABe|@D pP@DT0CR0S*A8A@DvP  0 )0S pA+4++p+|+d+h+++h++%+0CA-A`pP V P = CP  V10S ! 00|QS 00 0S$ 8QQ 0XP< R0$1a 0S0S I00S$1R0$aʈRPt` F F)00z$<0u0$10P0 0S $+++h+++@-(@0S =\00+G-APpP 0P0U0S = CW`dq, `0S( 0 0S0@000Ն0 0C0S W10S0 0S J G3 CfY 0 0R  3x00S U d00SX00S D00SX    ++ ++++L+P+4<-0 R!  ^ !0+04/+Ȕ0 R 00S P@0~0/0P 0/\!4 0 / B  0/++ 0 /+pq/G-p`@PGpP 儐u U 0 * 0W 00V@00CS_P Q 0P$@P++$QG-P0Q`[PpЀ@ 0@D P V 000U00C0C0y Tʌ#P 0 BJ 0 Q@ @D 0@DSB++$G-p`P@0@@0W  S #R0C00C0Ѝ RP   >R SR?GX G E k 0  ЍO0`P @@ @Y 0A $ nXS>{2+ǤSG-@P $`P( TlpP[ `g   P@yz  0Z Pp@ ;p Tt p@Lm 1 40  pQJ+ǤC-`Ixq pY@tq@PPQ.Y U0 0 Ѝpq0  p 0a0@S@-TA0@S<0'@ Ѝ'P( #P   +P++.Pp@-: $P# 'P> P 0 srp p^P 0 &- &P =06 pPtd0`P@\0 L0Af&P,@m_006p'++P5++G-@p`dP4T#0 5T Ta0'0s000Pp0 ==@6T` P'0+P@-o0@-MPg@P  " rsrЍ08!P =0 00&++P@-GP0 sr@S0 ! 0&+P@-J rs @@@60P&6 <0606Ѝ+P+G-4@PP`j>T6k.sq 00P6 <06PU p<P0PPЁ GP +P++(@-P ,0 0R  +4l0@-0`  ^ @^TSa04S '0s05S #++P0@- P@0 QA6R 00+PG-pP@P P`PM<`J<p6W @+P00S/A- M`pgW@pqp6W @ Ѝ 0 PUP4P P0 FW++PM@-  0mS Ѝ 0 Q0 >@P 0 S# @ PPP0`0 S  P0 R pV`PPp ;pg00+17@-PU0P( P@ PJ0 Ѝ0 00S@PP ;P5;8 Ѝ0@lH00S< Ѝ0@ 0 0$0 +l\+~%  0 +<00S/7@-@( (P/@0 Ѝ0%+B@+(@-P M# @0.S 00S Ѝ 0S 00 00S000[ @ ` IUuP0@ 0R 00@0@$%+(<00S/7@-@( (P/@20 Ѝ0%+ B@+ @-P M# @0.S }00S Ѝ 0S 00 00S000 @ ` T P0@ 0R 00@0@$}%BZ+ p@-@PXP  @ Ѝ@-@PP  @ Ѝ0Sp@- Sp00S p@t l0p`uP p@"Puq@ 0p@ +l+4+(P07@- S Sl0 Ѝ0XP@T0PP J:Z@ Ѝ0@A:0 00` %%P/L0@-0@S 00 $0$ @+++P7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@P9 Ѝ04@P,0  0 10 %%+%+lh0/0r+8P/VP @P/4@-@T|: pl@0TxSPLHD@}<{8y@%$;d4h@--0@dS!@S1 CR&0C  R  0Q0 . Ѝ@A C#R  k Cr Q 0Ѝ        @ZP @ ^+ iO--PN<M`00P@*0 S 0/   00 Bp/pT*000C SY E0!R1PT*0@ S 0,S UL0D P0EPE1!0C0 0UЍ +%8%<@-PMP M 0@(ݍ Ѝ@` @70Sp0 h4 x@ݍ ЍU X7 HV4P0S(|7%8*+%<@h5P@-  0S 0 0ЍP  R lЍX 0L H 0<0408000000000%%Pt@-PM 0  0 x0 a @l%d P 0S>000D ;0Ѝ,0P mC++~P @P/_ 0 /+P/00S+0/@-@0SA+0/@-,@0S0 0900Ѝ+0/@-,@0S0 0'00Ѝ+0/400S/(00S/@-pq@++P@- 00@ ^S00S00 Ѝ0 %p@-P0M % @!`P@@0,S  i0S 0 ,R 0p 0Y0SX 0Ѝp40@0000$ Q @++w15zO0@-PMO  AQA0S1Ѝ0RS'DSSS 0e C R  E C R    C R  S -S 1 CR 0CrSdSWS ^S wS     0  E000 0 FK N R WR Q S-00 0  ƍ ƛ Ʃ+l800S ,00S 0P//+$++$0P/0 0 0C/+,++A-PU  @Ѝ`p@"`P|`V 00S0\V0S 0S`@W EP `@$V00+@-0S0*00 0P( Ѝ *  P+8@-Q00P 0R  Ѝ@- "2+bP/0S/P 0  //oP@-/~ 0LP/+8 0@-L  | Ѝ+8A-`@Pჼ0-S0p00Cp S  P T00W`O-P$M cLP 00S S03/0L0$ЍeL0 @Pp88 0 R @@-PJ &$PP 0@s093@!+P0P0h0 P @0+S9P 5n59P/P0z@ pZ)EaD[@T>0S.nP0S -P00 0 +P0P0PZF   0 p0 @ =RP    B  Xp00aK[0(!00CpS0 0U?o 200@S 3/T_U 0 [ 0S00S000 RL@<0 0 R 0eP.00S +8++]$ Ʒ@-@PM @PU`p0@ tKЍU  i  B U Rz  0H"00CS0 U0S U3/U@`x 0 FV00SXS^U 0  1 U# U U 0?o20 0 ?o2P0U U U W0 0S00P0S00 P W 0  0S00S000ESU U U J 0S0nPS000 00SD000V T ƿ+Ǥ"p@-P`@᣺000C S0 ` 0 Br ^ ST00p pS 00 000S/P/+`+@-XP H0H@ 0S0S  0  03/$@=+%@ 80S/S/ 0CS/$%@O-@pM0Q 0S [; 0S0 0 Ѝ`V$P  *0P  AAQ-P $YQY0 0@@Oop B0 0S `0 0S Wp0p%@@-PP0,n%/@-0M D20S8oP 2     G2 0S@ 10@@0Ѝ001 0R= 08"$01S 10S 10S|1 \11S(  G2 P!2 R@ u$10P@ 000 0 R  RZG0 @000S T0 0S T \0!PL 1 10S 1w0Sr 0#Sn @+++4+$+H+%+%+@-+@- - Ѝ@-P"5`<@9@@up0 `M Ѝ@-@5P  w.,~+G- p$@P`0 ҧ )  0ǧ@@ό@ p\p3#@- d0  Ѝ(7@-P@2#@/ Ѝ0B@@-803?B3c/  0 FЍbMB@40@-0@@T FP  0 %++Ǥ@-@0@%0$R/ $埾+p@-p HBHb0 0 0(0o0S 0S >20SX` 1``FlZ@P 0 @PX SiX1&`O@Ptu0`V@Ppe#W 0A 0壭 PP n0S0000Aލ Ѝ0!S  PA>004S S S j0PS  0 QP03 W0S  HH0Q/ 0 ^R0 Q\ S$R 0C 0N0`0000 \Q0C R 0 C%+(O-pQpPpMW M ۍ Ѝ@`S`FTpL3LC  DsD4c  PU Y< 3T Q8P2@DrPpp@  @@# 0 p2W "x P@ "T<"0S000ŬP ;04P S@ y- Pp 0S 1T QP 000000@ 000S @0\0 0@ 0S @00 0Q @ Q0 @0S 00@ 0 S 0 S 0 S  P 0/ V0`00002+(%%+$&-6 <-E0@-@ᯭP娭P |壭P l垭P \噭P 5P6%-P-V-]-c@-@PBP P@-i-vO-x1M0S" @`0 ЍOapP000 0 Ppyx@`Ѝ00S 000S  0P @`DI 0 00J0 J! H! 0S+(+$-+@+40@- LLPR^0S @T 0 B+(%0@- LLPR^0S @T 0L B+(%0/+(0/+(00S E/+(@-IP 5P5Pq@-0+4//@-L@Q .p0 P+S0PЍ+4\ QS *0/QR QQ*/0000/@-@P 000000/0S0C 0//0@- 0 #A3@0@0@- R@PS/ P `Q  a ` PЍpA-`pP@T@  G-P`"F$@p(, >PQ 0$ GgFP@P7P/P?/80@SQ 0@p/a0@SQW@Q7@A-@`pR  ?P P@PT*?P #SPs@-0 00Pa0C`@S0  PЍp  000@@0 0 0 0 0 0 LA-^\^1!0 f ^Q1!0 [\=[^Z ^\00]QQ$ ]Q0\[Q`.FqQ5 `@p 0]QV 0@Q0 0 @\\@0[T T nT  \TR  @0\00, p, h--.p@-0Pt @R RP D D <g@D@ p@裕 @&, p, h.'C-1`pMQp@P0x `0Y 0 c*PH D1@<1`0 $f\Y R T R 0 0P@ 0  [R .0Bs0S83 0  00]RT[T@ 0QT 0QST[@[T0Q[S@(0 R Ѝ, H, h, p.D,00@-M M00P/S $S+ +S00+ 0 0 9S#\S @P0 0 e0IS@P \00ۍ Ѝ00@00 S008@, p, h..ZO-@T Ѝ0tS bS rS aS @{S000pW` Gp 0S0QU 0VP0 0 PUP @0@ p0 0/eb`P+8,, p, h.O-peM?Mo0 P\W ?/0  e00 ϟ0S?/0 |0^0T/L? 0XdS ^@/?0 d Q 0S 00@0!0000S 00@0p00pS 0S @P#S ;S 0@0 P00P Pn 0S @,S|P0S 00@P  0S  00@aW=-0 (Q@pQ< @;Q }Q 0,< 0XP @\P 0h,`< 0CPU P@00,(< 0L5H < <P  <<0 \\^ ^00\ APP00t0I S kP0S 00@TP;0S004+40p c:*0 0S 00@l0S 00@`00P0S 00@|Q0S P @0SP X 1@( u9)0 |RP0U 0 2Px9x)0 P\XX898)0 Z$ M0P8(0 TJ4%]P M0!0 < 8 SR$0 (   8%00H 0$0 PP R00C0 0C S000lX,X< P07'0 8\RH [IQ␸0S <<00S ,l< 7P00A g 080 [%] 0  0S 00@\0gSk a9SX0SvS S 0&6 0[08 9R/RR0C8 &R* P 808z\R \ 00BQs0 S 5%0 T S00( 0  \ R5%0 n ;Sf IS00pS wS, iSY 5%0 R00vYܫ Eի0"S Y4$0 5K  0S 00@<<0 [  RR < S 4$0  S04 0S $%/p 9  U@P M[ 0S @;S ABe0110P\SS434#0 %MD  P2"0 < @P 0S 00@0@ HQpah2h"0 0H ?p Y (2("0 20S%000 S90S 0Sw @;Se }S 1!0 <v)  9099090H 0峩 ⯩p000 XH 0S  p UQa   pYP 9)0     呻!1 ! 0忩0 $(ⷩ9 09909 l0+8&,=, p, h. d.%//2./m///0 , P h0*0E0Ri+80Y0n00+<1V201!1112=222&30eݍЍG-@`@tp嘀PU@T00S Eh0d0>T0 0S0 0, P+8, p, h,,,,3Jp@-P @ 000P @p%D@-@ 0  @0%D0p@-PPUph4@P 00CS0dp }dp0 d, @A-p`dB R3 RQ R P$0SV0(  R R 4$0P ,V`P0 P0!K3PQ$00P0PT0, jPP (00S(0 #R nR0V ,0 0200#0$0,0$0>d( T0R #R nR   RpG QT000(0V0(00P R R0   $QT0P $w (0V0(0 00  T0(0V0(0, @h, t4G@-|@X0  0S 0S00CS0.dp X岅0  , @O-DMX0`SpM00S 0S _3#X0X0\030 `00d0崓XSXP 00CS0 cp XzX !pP0 V0 X PލЍP2 cp0S -0,P 0,P :p4S -D00p0p4S \PP icP %00\0,Ptp0`0d0S00d0000S 00Sh -P0  %_0 2 01_00S +o+< P0 _+0a+0J]ga-Jb 0d!1 P*J-\PP c43P\c ( p$p?,\0pp!:, 0`PS(0u02PX5000.p0\`0P l000S SP@  0  l8(00(05, @4M%:,, , 4q4zh4445{4Q@-@)P ^4P@-@@P ^4p@-@P+Pp0 u^4@-T`@PP Q 0"p0 " Ѝ,@-`MQqM0S000@03 0@ɧ0S ħR 07^ 0 0S S ` 0lS2@P *0 1 P;b 0嬗00ڍЍ,, , @-@P  Pt] p`\0 P ` P 10P S x ] Ѝ,4.MG-pA嘁!0`PU , R:(,?0(0 &U# \U   0 R`Z &R\RP` , R:(,0(0P     pr  Ppu PE ,  R:(,0(0    0 ,&A-@P p0R`*W00 Ì 0P P 0O-d/M`O0 0TPЍ0808?PU 0PH0 \ 1SyPy P\^ R2 0S >00C S0 0S4 0  P0 R \>0R*S@>0@o*P0 00H0P 0S40P 0 R =0R=0 0S= 0RR0S0S4 0 S,=0@oP 0 -=0C>S00 L0 R: L  0` pɟ``c0St<h<8 00 P\04 0<0S 9!,H0SP80S4PU 0`  E⭗P0800A E4 ŋ0T P "0 p 004 0l 0 XX 0<;r 40${0 (;0R  <0p 0P 0S P 0 *P2S 0 @N`0S0`V: =$ 00@ T:@~0S y 0([  @0UP y0 @0 [0`V: $ `0 0C0 P 0`V:L  `  0K[ -p  P 0`V:`8K8 /0 aV : ` 0 0/0 SP88 00 8h04 0<0S 3P],08070 P,80S(g04 0<0S  80S04p  G⋖`P <0 00F pp40<  0ʔ<0S V 0400<068 00 V04 0岔<0S L0 R: L ~ 0` pd00p[ R  Q 5 <604Z4000  P 04`Z Z  Z000 G 0Z0 0 0 V| Z0 QP  0\ A0 0  0RQB p0V`XNd@0p0<@p<(0000S Tt04 0<0S :p PZ 80SW0sED$D{'p?0 (jZQ 0 0 0 p0V`0  `A0P   0 PS0 0p0VX`0 0 #PQ04 0'4 0P 'P"0 000S 00P80S0s"'p 4 0&40P $&P P R0Hx(`pL<(p<80S4X ! 0`Rl0#0V*0000pW p0 1 W0 d>0H  ! R0P0 pW*0$ (%1 0X`xp@0`0h<@h`<x0h0J0 0-C, h,,+8 ɒ, , X,%%L@th3,  5 585, p5, hm&,A<0 0R0((Q 0{Q  +8m,p@-@P`Tp0wS {S sS 0p S&P 0 D.Y0`@p D&P `hG-`pJPPU00 Y01@ R  PVAGWp0!p!Q <0As\S00 0  X0 0 00 00 00:Q 0Sp0S X00 0p00 0V 0S`: pP 000BS jM,45@ 5Gp@-P0`@T P @P, 0S)0 0 00C?o2S Ppx0 0S00\0 0S00@0 0S00$0 0S00@,4 - 0@-MMPd%@P  PUX 7%p4MX+ L% Pb%ۍЍ0h5dH0  BR Rp R, p/%&0@00CS0 S0 / ,%@-,Aᬕ0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@&c,<0-01S ^00oS^ P0\ S0S Q0S Rr P0S0S0 s00Q qR  -,<0@-  `Ğ\ @ T\    %R    ,<-p@-TA0 5S <0S -00$!<1Pa0U&!0! R8  (P  0  ,P  0  4PP Ep@㩄00\P ᨦP @ 00, P$$?Sp- ,,&0p@-@0` 'T  +td lP`PT p LP000ST  @%&05t,<5@-@P |P8@P @0?SP@ p Ѝ/㬟P@oKP 0S SD40S00V555@- *q'5&0@-0@<TQ T00 *0001S R0Slp@TX` T@0$ @H4i*T(8  @,`*,<66"&0-6)656>6Q6[@-鞟 O*''7 &07@-@P᳟  0S 0@T 00 Ѝ0蟟0"S0 sr@-@VP  p UЍ7Q<0A-@X``# ^p "RG ^<0d#N R 2%` 0p02#L @ "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L "L / 0p02#L "L /0S00//00//H0H 0p@-P@!@R0 U0 ,㑙0P01p,~D,qx01//00/00/00/00/00/ 0  /,b2 0  /,bǷ00/xE00/700/700/:W00/700/7@-@֙,h00/@-@ș,y$ 0  /,wxE 0  /,w7 0  /,w7/00/00/00/700/700/700/700/800/8 00/800/8(00/8500/8@00/8?00/8J00/a00/)00/00/00/Ƿ00/8TsO/gb@-0  0Ѝ@-@ +@-  ,r0@-%R  +@-  ,k @- 0,|!,y$ @-,o$(0@-% R ,y$ @-8] @- 0,k,h M@-,g @-  ,j (0@-% R y,h < @-  p,w< @-  g,e < C@-^,f< @-  V,c @-  M,c  q@-D,x e@-<,q e@-4,qN e@-,,q0 @-  $,b @-  ,x" @-  ,d @- 0,t,q @-  ,w @-  ,e C@-,f @-  ,s 0$S00 @-,q @-@DP d 0  m 0@-0 |1咇,~D p@-,y$ @-PPL04S@ <   ] ],m,h @-PPL04S@ <   l] h],u,q @-<<P d(0  ,|!,|?m@-<<媕P d(m0 v ,k,lm@-<<哕P d(V0 _ ,t,tm@-$@合P  ,~DA-\`)qW Hg5@P |A 0 LJᵃ,~DN00/00/00//A-P@`000 #1pS02 1(S%0 nur10#1Ux  Uua r wRb=CW80S  3/1SAkrL0m(q S0#C`F m:81O-0@QM*GPPPP%Pp ) 0  0嘉`V  0 F  mVp 0S01 pt! 0S`@`F|R@!ġ0C!\5\6\00 Q0S2 10 \(0 `00L1 S1S  0dm! F10 C<ЍO軇S B/r !  20S 2 00 8p@-@` P  0p@sB80@-@Q1 0%R   @ M 2P \03S ls d` \ \ T0  H,h ,j ,g,k ,l,m8]0@-@Q5 0%R   @ P x03S / xt p pl lh00S  0  Q,y$ ,o$,|! ,|?,}>,d,v0@-@ Q8 0 S00 @L C   嚓P `03S  xt p pl lh00S   Y,q ,s ,f,e ,w,t ,t,u,d,v0p@-PQ+ 0%R   p@  x/ @hKP 3S/ @< ,A. p c ,r T0Q @ @8 8C0 , ,( (/ h,x" ,b ,f,e ,w\0Q H H@0 4 4000S  / m,q0,b,d,vH0Q 4 4C( $ $ / q,qN,f,e ,w`0Q L LhD D@ @C8 4 40 0/ u,q,x,c ,f,e ,wH0Q 4 4BC( $ $ / {,c ,f,e ,wQ Q Q/ &  ,x" ,b ,iQ Q Q/   ,q,x,r///00/////////////00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/ @-@0@,4@-@0@,40S00/ C@-,f C@-,f C@-,f @-  {,e @-  r,e @-  i,e  @-  `,w @-  W,w @-  N,w @-  E,d @-  <,d@-j.0,v@-b.0,v @-  #,x" @-  ,b  e@-,q q@- ,x+@-  ,rA-T`)qW @(1@P |À0 刃,~DNA-@PP 0S Y`F/P  .`1S0rGP 3/P 0p R: .`@-@P#C P Wv f0 0zf000A-@`\@*T<0p " RG\<0d#N R 2%` @-@Q@-@R@-@S@-  &08p@-@0S*@P) ]Z[P  eIg|Poo;@@ jP < 0@ S< 00ppp,- t%`O-,M@0P0 T; R0AT 011!0 S01  R 01 sP5ʙ\P /{,0S  R3/00S 3/[1P PP J0P 0 0S[`p: p` 00 1`@S0` $0处P$0pa$0P``Pp1U00$0PeUP0ἹS$0 0Bs0@0S SBڰDP@_@p00$S@ S\ 1  pP$ 0 `p B BR V` Z `1Z0Z[ 0 00000 "P P V`y 0CÐ   S CUPPEPE_P 0 tP [ 0 0@0 P?덈P hH5g1  0 t ?z Q l7t8XXW`UPP000;.^1/@00R  !s0 RRQ0!R0c01S 0C" !s0R1ڶ1$PUe%np&n0 tP uy:t_`P 0PSY 2@ l5g0 g b8oU P (500xP/ qP, >P( dP& <PV 400C`F V$P SuP4P 0CP  @@PL}p4P P0S 400C`Zdyk1SR !0C B/!?1@]!NRAPN P  ^Aжq0r0xP00S11A)zP`PxP@a@1S020-(PJ @$3@P, #0@S00 2P0CP?P <P>P P2P 0PTvP tpP1a@ P Osw1S'ʰ1  @ P @swP 00P1 RE40S 3/Pc PP }c P,ЍPR0y Z 0SpW 0m 3/pg P 0`? P r Tc `wOc00x00AM%0 b02P 00P000]w/c ,&9&09w9- x& ʀ- t9S&R ʎ ʒ 001/,P0 R0//,O-p`*@PP [ ! 0P @ Ѝ0姐00 1\$<0P0 00U040080 0<0<1@0q00D0`80H0, 40L0$0 0P(P1  @,:P/D0 R/0@-A1 P b@< ],O-dBp0  W`@4We0p 000 Ѝ0P@P 0S 00@ [& 0 kP U0S U000 00 `[0S kP T000 [0S kP T T0 00U P0IS0SPPk0 00k0S kt0#?C S TPU   h0Y!0Cs0S( 23PP PET,&UUUV@ O-$MH0[S0P 0L` Dp; G0Y0 0S 0g {dᆊPEkFk Sk@` 0l@0@0000. 0ESET0D0T00Ө?0S0 CR C 0DS0  0d+kX 2 d 0  BR P0{ P>  PN P P!VUA`E Dev@DP`0;d 8d5d@`"PD P AP;  KR !   ` D0=v0@0!P`1 V0p00@  \z`Wmv`F`FV0p00@  DPEv@DU`E¨` Y @ zlj@T`— R   BS0S 000 0 0z$ЍO]0Y S ,:&&0A-lP`Pp `bj@[j@0T `P@ P 4P,@-P@p 00T0) @p@Ѝp0 00l0 h` 0@ u=@t 0ÊP Ӯ %,;h0p@-P@XP0Ps H` R :༮P 0S@@Q@pu%,@-@<,0g,0g,-@-@00c  Ѝ@ Ѝ/-@-00 T Ѝ Ѝ/-@-  ЍЍ/@-@@h@-@h@-pP@`M,0 0(# 0 00`Ѝ@- ЍmO-M P`@pzi@siUiT0 0aP 0TD0PSX 0SU L00SQD冈PPL00PT]y@DO@W <p ~PRWpV`KЦo`0 S`K0 {n@PD@0 7PT0 0P00L00$T <Z  7o _s__Ѝ00D R00S 0S 'L0X3#PptnP 0 o똰BBsava ;|0 EGndP`BB`Ya\a,; - x@-,, ($ +Ѝm@-P@`$0 0 3 0 00`Ѝp@- Ѝm@-pP@`M,0 0z( 0 00`Ѝ@- Ѝm-@-00c  DЍ Ѝ/mp@-PMh@Rhp,@-C7@- :@<cA$cUPU % U]ZH00h@PU $T EMJH00000S$$V Ѝ0,b,q(,&0O-LCM@?PP`@ L&@ If}Pp  #PHCߍp@T  i0P0X Y X  @=R@8@4D0 0!x&0 ʼ1@-q0C-MM 0p@Oz`P0 PP* P iP 0S0 0M   KPP6P 0 Q000PwۍЍ0|0P 0 450 0.5,00S/ 0P G@-D,q,,v@-TP <P <8_@(!Pq@C-@M @i0S0|$P,  \0S#6{P  p0Sl Y0] #)PeA@PaCO'C;*|A^&'ЍP@R9{P'P'20S }@`P~'.@p 0$!P9z X u$P 0)AT PTP @P pZPP 0<+Q !Sp 07'SpT+pAW3.pp0W3:X# @PQ  R@4Q p0Q  R@d@P`GVp003/P,00  h0S  R l 10!ap,q|,~D,oh@-MM+@(v+(^vB+(vB+Tv(?PލЍB?P 0 T @@@@@ @@@@0&B(d>20>-MM+ Tv+L !v+ Lv+0v R?P  F>ۍЍ200@-@M 1@@$#P @  qP A0$*!PRU)QXa&Ѝ0RL00S 3/P 0$003/0$%*C%@P3P/[P+W@P'@P# 0Pyy o8qy  0S 0_ Z'P ?P4o0m%(*00,q|,~Db9D- x- t@-@M ⏉0@@i>#P* ?@  q4P 00*!R00$Q )j@P  0S 0` ='Pn%\()Ѝ,q|,~DO-`M!  0X#*0S ` 0 SS 0/p0 S00C `@ 0 S:ዅPP@ B pQ %S0S iSc %S, dS 0T PsS(200P 0 倠ಠ@ZR  @P %Q0@ 0S0 aRT @R$R0PPR@ I T 00S  0! SD 0 @S$SS0P @U: R R 00 R @ 0QR\P 0S  S t00@Qb0cR^ 0 3/PW Ѝ 0 t&7@-@ PU  2 F{CD00 Ѝ0llHP X L  .{ꎉ( 0$[+,q(QO_jʷp@-@Q`T8080P00S0S   0p@2,q(,b7@-@ PU  zC00 Ѝ0PP | zd00S 9L 0H[00 ,,b^,p$ʷ&0s@-8Q`@6ygTw \Qa}\lay \Fa82aa\2wcc 0 Ah@Pxx噲S1P}P x=)=[[ ὁ>wЍp- thY&0O--}Mp@` | 0p 6V  0S   P R   0S   똵P "z눅P zlpPT Pf   L  P 0B? 0"!!0# X  PV , XT 2t 0S h2P tJt->0S$@0  U0 <"QS < : 1P 4y 1 Q0V$2j@T  @>0XC 0@0S@ @  0R0SQ x0S  +wP 0 [ul0  PS $2 ,q,%tptb$@f,b,q(E'6,d9K,v pU\0@-0,MP0 00 0\PPP@P DD妰@0Q ,堰Z,Ѝ0@+ i%&0,b -O-iMs?!0DZ P 00iߍOЍ/P|n`P<1P 0!00N5$`P z[p P@& [PpT00Z%6AU0P 0#0GSW 010#S 00PpP@ P%,b -O-p0MT@X   p$p `V  @P'U` Q H岭DD寭i  `ێ,Pz0尪S } W:-8 4e0 w=C$ C/v F00v=0夽pQ>e0 nP400o}0 ~P40  U Ur0YR? ;/ 0pp <*@: R0 :P'P P 0X60,09Pt<&I0.\̟   0/P `0< B 0 0u`````XP00ۮtl= +D02lq0,ݍ<Ѝ>0a Xn t]~pP  `W~P pP;{ 1sS1lS;"00P%QP YP;J~pP`~,m*0x*0wo2~P\8 0\8WV*0yU l*0z\*0}\8@*0|x(:( R0U:$ R *  Q9ɟP \ɟW弩^ D9   +X9 @H- A|)1 0p 0HA%op p=SrL9)10@@ DP 0H0 H0A op  A@YpP( 0W` tPSUppkvD (! J$pH p.0~p<((0~D}P (}P {}P v}P q}P l}P g}Pe0:4JP '0\6S '0)|| pP s4l \TLD'8[7S/ ' <P&P86&Am A~0\8^P  P 5&oP p]:4S 5h_P 0T&APڴ  %[L\80&8\8~Pp l  qP0%08P vl  qP0040%S\880\8P ^l 0S 8%8P XOl  DXqP000S\80\8)P0S\80\8p?嚠4S3P  0@?S @P l3l 0{HR##hRp#xß$`RX#W%R<# 2  +0S1  P 2@T t HmHKt#0p0S l"T0S `"<xur;3S3 UZ #s?00N?C0C l0  0pF0pdPxP8A?Aێ80EpE,0x ,P"H pT0S ZzNVW5S 5!1v,oobXf2rX60Sp0 <EV4!S< "0 0 U~ x,1,bO&0r&%,v |u,#,,,,3,~f?',,B $ʷ-i+a,8,7^2=Idruze"rT~,,y}DQ#.,,<=]uP 01/ $mC-鿏`@(MP/{P3S0 p 0p :00 0p@0p00~/00 P 0P/S/00 0 /S 0/0 P0%R  @ 0  p@> ߍ&@-p`CM|@zPlP#`0R\PP @ W<0080 `0(*PCߍm3,f,w7 ,y$@-@ @,q@-0  0S P @0@ 18 0/P $  Ѝ,w ,d,p(0@-0@XMPA0  0@+ P x x0 t0Ep@1P0/Q   LL 1 0/R@, ,@Ѝ0, ,w,q,d,v,n@-M@DUPGzP  i i0 D00Sލ\0\ \P L0 (0< u0, p,f,v,e,n,b,x"N,x@-bCMX6S P \8lP9XcT20S H1\6S 81020"@(1PPr 10 =::4S / 2/\@aU 00 $:4!SO *00 0 Bx||1@P) 0l \ TD0S 4!4,!,0S    85P\6S U 8oCߍ 0 B,6,~f,Q,Au,^,,1S nP >$0`>@ppԐ* `p$pᕾ `呾 XjD$0Eb X 4` 哼0S 3SK Q|c  y  y0000? n0Pv 0Ss'S  76`. `N0B(Qn 0C QW > 0 0B,4101ßp "{0"`p~PP P ,4101tŸ~ "W`sX2P  @000@A0$"p]0N?P0 S J` xKR yx000`p811!$10 100-!(, \@a C 0 1/@P00pЍpP@00003/003/$AmO-`UM MM.|x0Pe;v.7v Qe<,Bf,pQ@[@,0p%SppW 0,0,Uݍ ЍU  n? h4F>D 7 \4040@P#`ύ֯Nl 54, Q~W <S 87h4F>D0C27\41 [ V?h4F>D0C26A\40 40 000000000 00p@ 0 l0}<55ps 1yt0 00 00000 0p@ 0< 5 5s qଔT1 @t00, n:E "at5@0\qW 42XL1຀`0pNόjppr຀qh p\  t00$? 000/0,0S00Ӥ?'N?,$#@`d|T00,0<@S0S N?,$$P4pWD4 0}10  A @a ";a 7a,1p0!,1 101$14141(8H!L1 1$1H!L1,16$1(1!R)!,0, 14q01$141(>8p $ $!R p | 0WwYu <Hp."k0$1P0 !$+4]h2P p>ؠCL $10\0$10V 0: f0G@0D@0Sp Pk $003/$`pPK `qH!> ,! 5$F0@>S  GPjDPD J;BS@ $10С>C418!<10S5 @_ 0bVQ!!10b/:t0,1014181>C0(1}1S0}1$1S `<@@,q|- t% |Zh%`,~D,v,f,qm,b&_PP$030/0@o//BO-@P MMAD0*!Rp0)Q`U0 $0   4P _ Pp ,**l'0`$0 L$P4(pP 44\,4 ܍Ѝp 4+c0Spp0 @ 04p0SW00l , Ri  000x;8,9/PV 0  x8;,;/ 0 x8;,9/T08SS "0CS0 S "S S/ Pp  R <9p WP00P0)l2YP0 U @' 'pP 0s M&P }d0S !88 "Qd0S !8\0 PS !8`0S !8X0Sl! hSd! 80\ EL0@ DQ\0S ` R  !88  Q ܌Q{֌PuЌPoX0 SƌPecpQWpph  c,~DǷf @,q|pU5;N2`ltx`O-eM0M*Q8U"lUV&dd&@$&Xu TS X &0 40UT Q jލЍ6 )qWd nP7 FP' P @oP' @ pH0X h40nP40 Z P U Z@D`@ 6 p PU   S0SD   0S # 0P000P F_P14s10D#5:d#d \%X%T%0S D%@%< -dupp80P 00 ,0ST0 S00 P0p800SS 04  0x;8.:/P>0400ST0LL S>@ S?0 0$ <0nP<0PL!@  PP ,0$  40( P; S-  S `0$} PL mP00(5S0+4^o]14  z 0R0s  o%Ȱ0,~DQغ,b#ml,qN8Qk}u O2BǷ lO-@BMTMh Pp ` T>@PpT0$(3PpppWPP@BލЍ䓟cC3ܣ0@ Y3# $04@(8 P3P@@00<DT@0\ P `8430$3 04 *2 $02(408@00S0 P 댲夒  p208@`2@DDAT L2L"LLwo#P 82 4%PI(2  =*20)ATp !0  P&!$0 U@0S   "#P 0Sp C0@ 4 000@0x; 89/P1  3%P !F%@P 0  j @$$0 @``W@ l Ƿ&8>Pd ܶmx ,b,~Dhmbغ0p@-`M2 R !,^RЍ0P @40 PP@xp0 ;87/P  PB, <,"< $0@-@"!Q(@, <@-$@2S 02,  o 0@o/b0 !!/,&@10/Djp@-@4P0 `Y1111p,&@O-P@p`ԐԠ԰0/ C !  !0  Pm00S  0 0S 0P1SR0B 0 0`p@P X 00,0` 00000 Ѝ,&@ \ 8 0@-P@M/.um1, 00 0d0@00 0T0@@@@1 0 000@P,xߍ0 ,&@O-Pp@`4M 0SpP `Ppp 0S00V0#S 4Ѝ0 L03/`P0 L03/P)   0Q R  4Y0 0P  P  H   4@R,  8pT  TX $ `\ ( ` , d pA- 0R 0  DQHa@1QRpB   !LAPAP0 \Ae0Q     TTAU @@,&@5O-PBpXQMU<2'PX\1S2\U \QUЍ0C`1H`1SZ`g001PS \1 XBX1! 0`1Vle.0X`0 T1[X " ml\:P6 \ ! cl000: S.X1 2 \1`00X1``P 0 S 0.S cXhbp ` XXP.X SX1, 2 $ eX,&@% P Ҍ Ҙp@-MM`bP(oۍЍpP@P+$X P*+hW P*+W P*P ␶Pu7p@-&M@(IG`Po3 e<0 0f P (%Kn3()K e][ <u@P LލpYa b,p$ O-p@MP! c0   0`尢Y Ip` 0 0P0SOߍP X%]P0gP0 a0CS0S  P1U`08Sڠ0SP` R SZ0  0 a00{ p 0X1勅00 0s [+4pY 0V @0Q0t00 00S 0 HP0h!R@O O0㏐ 0S* ?0!CUa0 ,!MC @dAde,'ϦuN,&@@- D@01SP@ 0S 0   ,&@ @- @-G- T1  D1D10 < Ѝ0&00@-EMP@ oS zXP0000U ($$0x:@Eߍ0,,&@L@-`MXA MSb81^ P0x ! %+g<3" H0`  0000 00``8PPpR02~"gUx:` JX (S((Jߍ,&@,ʷ . %U#@-@P !0`Rxz4cP LPP gxZP`h 1 w T *01M@0P@T l3RV Ѝ,&@%@-@<!0@- 0 Ѝ0@- 0 Ѝ@-0@M00,0  0Ѝp@-P<@0/SpQ bPp@%@-0P  ,f,wG- M@p`PP 01 RP(0 PP0P00P p @0PP0PySa00ͅ0݅ 000͕0ͅ Ѝl:m,bʷ,q0o,x,dÍ}O--,M``$W@op[@pPd $WP@bcT00S@ K`PPEUM P1P!PPd$0P0   @G$0VSS00Y00S ` P E H $V0 0$0  0 '$ VRR   Q # 2R @D e0@Qy` `P$ V@,Ѝø x G-p`@PPU  gPP 7/G11PpO-@ M$V`P Ѝp0P 0`VPPTP$`V-@- 00Ѝ Ѝ/ R@-@- 00Ѝ Ѝ/ RhA-`@PMMP\' ``epT@ FL43T0(3T$$c3Ti&  0So 0CS+PDS0)  0 0S9 0S r0S 0S QN@AP% 0 ` 0 P@oH2@P 000C?o270 o0`(D0SލЍ!7SaP1Q! @F?]@Fod!H1P0  0M(y'  0S 0S| q0Sx 0Su QN@nP  00 @"P_F? Q. QFNnQoq`,F,q,xĄIJ,4%mYm3k,x",bĘʇ-MM P  %P  ۍЍ-MM P  P  ۍЍ7@-jP% PfP %P0| S0 P @NP I0@TT Ѝ0 Zx0|+R/ @-d|+\0XT0PL0HD0@<0840,&@ ,h,,l*$,,2,P@-@ a@08S,p$p@-@PM H(@xc000H ,0@@04P,P4hPp0: S H_P ~O zO܍p,Oc 8KcQ @P@Pڤa <PT8|1|!||Ibx8&<DQiA P1 0880C8PP  Q P00S nz < R t00 00000 00l0*p@ m(ot(0S!,f,v,e,n,1 ( Ά' ې,qN,x,1 |O- 0CMSP3q `@j0!`{00`SPW!000^ @ HF@3/@P CߍW! 000\Z 0S[X 0 T@,"T W  00 0 U <0S l00S \ 0 P0W0 ! !  000,w,dF,p9ahŊ,vŮ,&@7@-PQ@0 SS 80 000] Ѝ02S  ŴžO- UMP!G4Q  b#ß0/S^P3s0ȃC0`/V`3P Q ?GU@tc A@ `PKSP 84(@1 U `PP$ 0RP P  ^ 0 10S 0S6 0 1S20S QPpG $20AP.6Q챟 !0 ab0 0 0R R` 10 1000p_R `01S RB  0 P a0S  /SPR Uߍ` 1 06UY U@P@T TpÇ,q(,p%,&@$[ƇƣƼ+- x- t,wp@-Ph`@TUdpUP`P  p%hG-pMMPp p@ < DzP P0P v  1PڍЍ} DzPu DzP1P `P 1PHdPPx x0 ,y0yz[ \P 0=Sp  F hPSQW  oP jP eP\pPxv b PP;h3=UqQ20p@-4 P@3`0 Pp@@-G-P@p4  `0pS R p2"4p0QSP pP`p 0S!40Sp  @``/0 R/@-p`0LMS@`aP 0S0L0 3/P (0! "!P 3/P 0S00LЍ 0  1/p@-@ P_P  p@X@-@ R(P@MA-P@p`p0S 0pp R=A:05#h30P200#X0S%0Q #"h0Php P#"4`V000S 3/0Q #"40P4 A-0&pЍP᳻@ᱻ`Np ὼ@p ᴼv ᮼp 0K`hV> t@[T  \~[PL,P <(P u@KZiuD}m{mp@-PMM`; p  @6p 2`P.`PۍЍpp@-@P ^` DP  0QpPppd| @dz@-PM Mp;P `p  @0PPPU_Pۍ Ѝ Ade! 0 02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/@-@p HP^00/00/4\80S0 S001/\80S  00@-\\@"SR0(SS QU S!0$0S\  0 Π1Sp@- l@$\ 0P"QS:pQQ   P \ Q0\! 0 ,04S8 000803/P,000403/, H0, 4 T 8 X  Π40S80S0 S001/S S 8 S S S0/00000, @-R!R@ b4 BRp01 408 00803/P,000403/, H0, 4 T 8 X  Π000/O-0@p 4MPPp`104ЍOm$0 L03/P# Ѐ0 \ p!ФZ ["H* 0*P T P , [p ]8``pp 0S0P 004Ѝ0,vO-P@4` Q 1SQ " 01 r " 0SQVLLSS<SQ R?!S,0S 0S00 0S p  0!"0 0  SPH P00P00 0 K`03/P L Q Q  Q R S ! N &   #D  TO-0c(0M<00PSp@sp`00 # 80s 3 0mWh0@l0 S@3`Y 0D@+ "(0P000ЍW0W*8q @ 0L03/P 2PR  "00 0 00D0@00p2 p 00&WHL 0W  (, 00  0WQ23T 40p0P<0SNP0 K T00SG0Sj00p0q  x0 0 000000  P0 0 00000PX 00808/V0 PpQXQ Q(00,0p 0#_p a X0S h^ 0$0p0 0(00,0  0#0pb>0,9,qxZ,9ȄmȜC-`F`0pSPlM^DrV0S jV0 SbV0S[V0SkTV0SGMV0SHF}V0SI?vV0SJ8oV0SL1hV0Sa*aV0S#ZV0S000$ R$000 "0& W40SU4 QQ00Q00Q00S 4 |lЍC( 'V0SWA<4W>0 P Q Q  0 \3 0030U0 lЍ3 0030U03 00$0 d30U0 0LS(0p`@ 0 lSH0pP0`@SH0pP0`@SH0\000 SH0`000S"H0d0S hP`@_0 <"_0R P0 !8 R>0 H0L0 H0L0 H0L0 H0L0 H0L0 lH0L0  TH0L0@ <H0L0E $lЍC!SH0000%0PpG0  d 9/ 000(00 ,9 ! & N TmȾ Θ,o ,qx    : : $t# #DC- pQ0@PE0EM (000S 0CSEߍh0 3/``d0 9/0 00(0 0``0 0pp07/0@-EM0@P 03/P 08 00 @@003/Eߍ0@-`,MHP E@0 0 0PP@00 RS THP pW UP00H P00P0,Ѝ @T@0/W  /0 0HEH P00&p@- MP@D0 L ` 0  040PP`TH0Dd ЍpG-%(M@PU T L@P`4 ,VV !R "2 Vr PpP`"pVp$UpWb$U  0 X0 00 00 0% 0Mpppp#PP m(Ѝ ( Π, D7 hC-40PS,MJ S S S ,!S SB 4@P? `q``X 0c`] eZ000 00 000 0 00 0 0M`P .80S=,Ѝ ,  $ LO-P@0p(AMP U  0b0 p!"`00(1@ "U`P $P cD00 P P *D00P0Z@! 0 A@BA0  0t!C @0  L!- P0  $!D`pRP@!@3@R`0 -PW @D@0 - U! @ P .P嬠 00@p `PDX)Aߍ #"3P0RPV m,o u,9,9kɦYO--T5M0<p@$P eP `P %4R 00@D0 U0 $0p0pC 0D@D0 0[@ 0S0 S,000A R`42PP00(4 0 4PA00 00PPPl0S8@P 0P40 0H03/0S,0P p p0CD 0@P000P`ŋ@0SOP pv0,01v0(1PP ! B BP2"Q%00'>  R B >"V V 0 R80pPo 0 R#,500y6000WЍ<0X ∑0L0 3/ 00X0 0b0 * ှ P 1@0 B )R R/PQ0R r Q0CFS0TR000US0a0Ѝ@0  ppq/PT00U00La@0 \%81R8 ,R4 !R0 R-R H ` ` 0R! 0R` [XoFT00U00V ML @0/P0 /S`Sp`` [XtT00U0,`0 p,:8ڛ,:$,:;mT 8T,; 8 T,>(,bO-0MS@pأЍ`  W0@ 0 P0S% cS2 %MS) CS, GS R 0KP PSS! +0C?oW20S 000 00SmS sS gSR 0R RO- POM MP#!P0@0@0<090P`(0 0H03/00040 00! 60S 0  0(3/ 0Ps`` r S08 T&a0H&XYU\a`v0$0800s0,00$0&I<p`0(`HpD0WX0h05R0lp0,h u `pV S#h l`U Th dPUh ^VU 00 04PT>j0Pd040`PS000O>0=C0H0#000D00 J$xUT0 R  Pj0 000H0P0 F0PT0S xzLP 0S80Q00`Q0S 0L0 aA3/P 0̀`0`0 &003/dP`p E 0 g&` @o/JX` X 0 Z0R0 ` @0S<00D00S8X5' a`v0"$0y$0,0,&0,0$0%$0儒 D0 dJ0 tx 00 VJ0 <ֻ0 MJȐ0  ̻x0h00l010h Ht0p}+De;+ a;L L0` S*pV 0 TPiU 00 0dTEi0 <T?iP0+,0$ Q00Q03S (0A( 2bKop0 ` &D00`P3/ ``0``P3VP0`4T¿(Oލ Ѝ X 0AZ0> X 07,qx-27,o =%cP8M@@-@!"  0 Q0 "ġ0S "O-MpP, @(`|1/0PU0@5@Z0Y@0 0 zI 0pP tIPUp TYP 0  hI X00 @$ $U<0 00$08HX000Cÿ D 003HXP0X000 0$0A00X$000 0:,qx%c-2,o MP0@-@M0@L0 3/P" ! !UP 00!SS@Ѝp@-`MMMP;` 7@P M 59 VMލЍpd{@-@P DuIP 4pIP $kIo%Wp@-0@ 8M! 0`P@@ 0  P8ЍpIIPUJ0 00  0 P@oC-T1M MPM p0S  >T ½  T @LP  0᤼;M@ Ѝ,bq,q({&0@-@ @0ʂ@-@P@@-M@  7  7 <܍ʐ0@-MP@~  7x  7 0TsP <}ߍ0ʙ@-@_@A-pPF`@P P  K$0! 0]PP ,Ѝ0$D ʥ,Z8p@-@P4Sp@Tp$ B@PpDp,Z8ʼG-pt`DTP GPP@ 0 0!PP$0R04,Z8A-TP4SA p`4㦺@ 4 0L7 H7 D,Z8p@-@4S04pTU TU Tp`040 4ᵻ0 4᭻,Z8p@-@P0 p@Whp@-@P@ op   @- @- @-  0P/,Z80@-PM  0xPP @  0PPP߼@'P,!P0Ѝ0@M И,^L@-@A-aJ?pW;$AT"0 PPЍ @> C 0 1/@P  0R$ALH R>0 R 0S yP P 0$003/$q,~D#0pQ@-s^e #"T R0//s@-(@T@ЍpH0P0 w003/@P29/@-tMw`P @P0 p@6@(P  90@Tp@tЍT0 @T|0t dl0l p `P L @,w3<K,^LaEm,bzˈ/@- @˯B///@-0@Q s㼻@&o?0 \ 0P000@-@4M0  IP0PUdE000U00 0  04Ѝ0,^L//A-pP@`VT0S0S XEPH0P$1U6E0U00 0X0`p@E,^L\R0  /p@-P@D<0Q"4` 6D0# A@$!p,qx,o A-<`P@EPp( ?5 A,^P@-չ8@-0@-AM  I0 h>0S Yk@L0LP0T 44 0 Aߍ0c7,w˹1G-1MP`@1P!t1t1t0ppl`PBL@ J噻D0 [㨺)ߍ ᨕ@P aC E@P 0=SC?A@0  \@wT@  eP 0 l`h;P P W_;@ 9:;7}ʷ ,b 'h1A-1@P$`p1P!P0P0P`P`P0  @,4; 00g,b9:LBdw̏p@-0M02000`00P0@P @T 1X 1TO/11 0PO/11 Ѝp&̢;R 0@- 9P e,4@-CM` P@G(P Tp0 0`0SO/11 Cߍ5Sx xl lPX \\T0S  <411, 1,h,g,-JM;ȹJp@-P@xF1 1  p,1p@-P`X@PT0 p@'kp@-P@᤹P `PN/1 1 pwVp@-P@1╳1(1 HP1 1 p͆V@-y@8wC-@aM.pTGTV PS2PBPG aߍP }P @"080E0$"lP ",2X , B 0, B XN?1L0 0!,kP Px1x10 pAPphaU U UL10$0PU@4!44`A,ppP0S S  @F 0` 0P@NP0@6 @uw6 0 0 0F& 000 p @,Ͳ6d,q|5͘͢,b6=9:%T,^x,,g,h,- x- t kTK kA-P$pP}@P a-@T E Z?P( 0 2P  0CK9 P B@ oЍW\\Nq P,3< 0 dQ,bt'77Βh//O-0p4`@T Ѝ@T@T' ^% L U[Z [ԡБ YZ PUPE P$P P@B0"/,O-p0, 1X#Q  F vQ 0/0  R [ R pR H0H HA R# Ѝ  W1Q:`0,^ Xϫp@-P@P0S!U 0E p(0"PE0U055403 0(2#p,^,,40@-0@SfDP0@0ӕ,^ РA-AP0`ST!U 0E p0耟@SV Ѝ 4 U(@0D`P `4p00 0@0fBPp0P &H p `00 P0'p(0,0`,^,,s/p1A-0PSp@` 0 PQQC S;0 ,B 2  0 !rRv?000 V ! (0$0X3,00S000 1RPp0S0 00 0W1S` ,^N@- @c00S T ]㖳Ѝ;O-X0MSM2"@\0@S2"`0Sb2"d0S2h"h0Sp2L"lH -0S@80S 8( SRM80S 咰, 70pHPASTPPDP @ɭ@m`P- @ E A\00`0d :.0xh 4X h0d;S X)<H!H@0+P@_ooRݍЍ 0:S 000a 1 0 0 0 0C0 ;0CS||Pp7 vϫOhЀЛе&ноQ+ Рu]m6N3O-0TM$00 (00 40 0800`000@,0 0@<00$$0 !$0 0(000  P 0STpDP@Q0HLpY Y 1!S };YPYPWp P 80$S40 00 ( 48R0(0 $p 0WW0S$ v$ pP;S S2P11: 0S <7 00PAp^U8PU0QP0 Đ(Q $<<p,0S  0S E ,vo,<0P1 00 0" S  0 0S "TЍUQU0E"1,{p@-\P@0S  0R;)r00 S0@0 N Dp,O--BM MX\t0|@P 0 P(` ; Pp៰Bލ Ѝ40 2Pᓰ Q 0 0d!epPq0 00!$0`4X00 0Fv0`F;S P l咺PS +RQ 0P \Q S@0Rpʩ0S R/ S * S, S0S 0 ʱ000`0 0P 0S  + 0 R$ ?!|"S0S "P0nAdeуO-DMh`lPPDЍ®@P >4&"R p 09`P0+"R 9p0 d00\ `0h0x00X `$P`Pt0 (04H000 00 00p; ѐе@-`X0Sg0 >\0@Sh0 `0Si0t d0Sjl0X h0SkT0< pP U0 6æ Ѝ7 xϫOhЀЛO-MpG001PUЍ` ؠذPE0S Y0@  0 0 p1/Q S@@@  Q  Q r@ 0 @0R0 0p1/P @, ѐA-Pp@`0S P8p0 S7/P 0403/P 0D03/P0403/A-㠬@P`p1S 3/`V@Td0@@ዬT0P0S@000S4000S(0000AȮ Ґ,, ѐ ( p@-@4`4P0Sp@踮10S 3/@,,0 0#0/0@0/p@-@8Pq, 00080sp `^/ 4R R0 0`40$ Rp `083/<0 0"0P000`0X0S 3/ P0001S01 0S0P000 00//00/00/00/10/Q@-@@@ 0A0003/P@ < @hC-B`0SPEM;0(_80pS W80 Sl O80S H80S8 A80S :80Sk380S00$ R!000uF 00% $ d 00qp`Y@c0,_0\pY` ㄤ8 x44@`;1  `440 000 f0,0pM 囨0$1000\$10*`\0@ pd0d600S< p0 PÁp ,h3 000000 000 0 040pvp` f3d,0Rụl0S= S@: SM`p$P H3/P 0p0072 |000L0p 3/P '0 00S 00CS`p 0SV 0pP2Q `ЍXPT00SZ 3/@@OoBS W@0 0610@!Rx!@!x@|@pPpt@t0S|0X*@5P PQ 0!@x 0T:x0S@  ?t@OoB2@|0xT:3@,~DX ,q|,` R m80Y X h, xu 7@ L,bp>O-S[?UM8 ,0,44@`D ϤpP ʤP Uߍῤ0P00 P O30 40S 0RA 80S7(1SH!<H ,LH S!? ,H@$+4Φ˦ 0@PTP@T "2B 00!P0S 3/Pt20 SU@0%0cD0`t T2R嚦l1@Y,N 厦 ,!L12HPH@"o`P`T@zP ` /@ /,/,00 0040 @" /   ,  /, @/40P1:1!3B @0 000000 0000 00㲣p` D⒠D0S#0 5Q7[T Y   0v ,,mң noҮ G-/<@JMM`0 PP+X P& 0S" 0`"`!p/4P T` H 0@T* /R  ŹPT5@m+(  P:I5?0 `H-P+0: S pW:5>00ꨠ t!峸PJ>0@0/S|0@!塾+  SᆹP`+ P*P 0/S`0oo`bS .p.0&000 SV+t P*+ P*ၹP4@4@`zJލЍZʷ@-M @᫹P(0  O@P D P [ЍWP0p@o G-`!PPp X`p'@PTЍ0S @ p/P0 \ 8MpL P Xp0 @ ݣpY@-ڻ*A-tM `PXP HP4+.9@P@0 ح@ !@P+J J.0㻭+Jx|J.0L㬭LtP 㥭PP|<k, ᜭPPs+J\0J.ጭPPcp+JL J;`D uPPLY+Jl5pd0\!0J>MP 0.XP UT ލ╸P@[+JJ┸PPp0J.3@+u (P h lJ>!PT )V5HUfe%\+ e/00/00/00/00/0@-@0!$Q4M0 ,P\ ̼P0T0670 P幣 @P ᡢ4Ѝ0,qx%c,o ,a0O-AAd2M,0!0PB,0 0000/ 80s0`0Q, p  $ ?(0$0K 0s "d5 S` @@`ݝ@0S 80< 03/P0p80<P Ѝpv'80s @0D 0 0Q:8`0S0L0` $3/P$ `0d P[ T0Y2@t&L"@(@@,0S:(ߡ(0"PP@0@00 +0@080s=0 0@( Y 峠W|Ѝ#㹡!@&(⽺00T1 0 *X!00 ص(`,`0 00P0F0 P P`0(PP,(W(P(Ѝp000Ò,,(K0,`(P- t h ˠR,a0O-X`M)1$qS W W(!0 "@PЍ0 p0> C 0 1/pP0$q Q 0 > 1/@P@p 0X:@1X!S<1@1\1(H!L1X!\1Pp ,L3"0@  78 7 0 W %&, 0ܗ80000, 0 0Η0ʗ80000  0'T#0店0H嶗LH0P (P0%W0 000p8500 %  % %P,  (P 0 %<  5 000000 000 000pp 85P,0Б9XpW* 0GS0.(>P C$ 00S H @3/4pGWp @ 0L0 3/P 00S 0Sp003/C0pH03/0 ! P7/P%$%$)@0 QIYb@J@DpH L0 ZY03/ 0 0\Q  01/ 0S 2"2$$Є  0 <Pe 0  Hp0  @D@0 ᄀX60X< Pk,0S W!pP p@H0 0H008L0P 3/P p0`0 0`0080P 8/00@D@H,p\ 0,QQTQ D@ pP Q Q0p p@08L0P 3/P `00`00p80P 7/00P  P 0000000 0*P 000,~D,q|m4p80Y 0 L \, l <u 7@  ԛ 0 @-@P`4M#}p@0S $ 0dL03/P #` 0 #8PUV`4Ѝ 0R00S0 //O-@0SpP 0< #80 s#   ` 002 $  Ԡ`0SQ,  R) 0 0#Q! Q0 2#<{# 8 0 r  1# 000 S   5p 1 SR0r01/,b!0 /,bp@-@$P x1SP 003/p@\x1YP$ 0SO-@0`PKMM~p⻞G0DI;0S K2 @,0# ,0崋 0 < o=(05#ਫ KP@T80U 00 0 00000@00萍 @@@@0I⢒pK܍ЍI~+R*<o=(02#8 ;c&@@ |u-O-`0@PMM,0h1h0p 0S (0 S> 9 H2# 00 0 <0.%#@~40kP`0V,p0U 0000000 0 00000000p 0Hp`ލЍG$ፒ,0S*< #0+,0B#X0S000C0C0000S0 0,0B$P,b |u@-@-"0 !<$10(10,1P001.@-@"0 0! 0O-4M\T`Xhp(0P  咕"\ @,@;/,P R7P PpK "p WpF2 " 0" ( 00 0嵑`ᗎ(04ЍO/Pؾ4Ѝ[;0p@-@Q* P 0 P 40 Pp <0dp@PT80 P@,0 P00 p ')*+p@-PBM `@ D2 V` Pӓ 0Pʓ Bߍp`忓P00S0`崓40Pp`宓80PS<80  4X0S0!⨬@$嚓 0 P咓\0 `0S ⒬ @`偓d0Ph0S €@l0S x@p0SH n@T`]t0P^ 9: ;=>?ABCEp@-`M<P@A   1U%P 0DPK0 @0S  d   ` 8PU@! 0 #P 0܍p(0S p @h,0S H @D00S , @$^ /1230p@-M01P@Q# ܒ  @   0`N 0S (0S l    ,`V D܍p4幒     0`N 0S (0S    ,`VP嚒 $0nP呒 0 P㋒0 Pt兒0 P`0 PLy0 Ps 0 $h#   C-GMN`RP@ |[0Al `@Y 0 P&Gߍ 80$0+40 0S*m8<0C-P808ş0C@MS00 1S |1S0" ߍC`0xpW)̏0pL0 3/x1S 1S 0S~@/00`S `$@F00 F/&0 00 00/7/P P        > C"\0S0 `F` tC0p⇞ 0S   H `,p WV o$ +`嘑 0`0"  &|ߍ@兑 0  0S   `PV 1 `S0N  `h0   0S @0S @V ߍC)<0040!00R@0Fo$ 0DL03/00 O0S !08{D` 0S \  (X 8`Y0,p `xQ0X < 8 RFO   0@ /7@ 0  n 0R0_| 0   .DUK!`&hftw|.~@-x @ ; @0p0ғd @DՆ@-D @000(0,0000当d @/Տ@-hQ`0@sKMP!   01!S=0 Kߍ0 00@ @@0P(@UTpp (`0 j0  0`0`p姑!?P?5670@-QTM,0$0`s@|!   0(⢍$1P>!^@PP@HP@@P @00P@%u D,b O-P`0P>P\@P`@d0?o2d0_h@`Pl@p00 S0p0t0?o2t00 NF,~DGIJKM@-18"@EM S60 0 00 P0 "PPG 0/S  V !0 @ 0/S0 0Eߍ1?o21!Rx1Np,1@< @P1?o211S 1?o2 1 1S 1SQIOUTpp `0 ᳧0  0`0`pj=Pf= 1S 1StPJO 1S 1S_KO 1S 1S0PN 00 \,~D!"#%O-,MbPp@$X  |_XZX2Y 0 DPpN0 @Pe@  ,ЍPp@1`SPe !R 1N0;!7@p@d' 0PPp1`SPe 01S  1S 0@!@p0@d 1S 1S$1!@p@d 1S 1S(1 @p@d 1S 1S,1 @p|@d 1S 1S01D Ӧ@p@@d,b ր fȷ,qx%ch0O-P`QWM0Tv1 L&0@ 0T&4囥060S $$000S'6L@TP| }1AS 0S@  1P11$P |X003/$}1S}A0p 0x 0 01"+Q9  R4  0%X^0S/X& 0΃}!΃L )!6X<1,!  X"0S0b㄁0ˉb/k 0x0S 0XX0P 0}!11VUi <@T0d"@T30S D00D0 C000 D30S \3L000@P00000T0D0 30S D00D0 p@ 2"b"`"0  }/T2 0"S0C 1šWߍ 0 p2 0@00 0)1S080.0$X80p$P! 0 S L0X 3/P h W pW 00$%1/pt0S _PWC0A00N  000 0" $!  8 0L0X 3/P ht0S 0_Sʚ  0j 0" 0 0p@080 0S,v,bՖ,,,f 85p,l ֤ ָ,,h  1, L60S/O-@pMU腟 MPj 00x Rp#S `ZadD80  @Q D0 \P L PC 8%8 % `V800(0S$⼤$B00,0S$⯤$B0000S$⢤t$B0+ 0 `0B/⨔P `ὠx 00 0; Q <0Sn0y0!#{#B00 0=,0#Sn0y0k#B0 00;8 R3#0ZT#B00 0=<0X#Sn0y0J#Bt( K 0 R #;"Be 0 R "-"BWx 06#0= 0S"`"BGx 00 0=$0Sd" "B60 00=(0S,"!B'x 06#0=00S!!Bx 00 0=40S!ܣ\!B0 00=80Sx!ͣ !Bx 06#0;! I1P/S P(c0(0 00 ^0SvU ( ~0S `P V  1!5:%  0IP q Q 0, ($!d $ 6P_ 00 8a4Q101U,,,vm׸HTז0S@0@-S@00 0S/, O-P2EM 2@T P0 x2P l|1S$ $P| 003/P ,2P $ ߡ Eߍ$0 R P 01/0P 003/P A10SW PaPD  <0 040000,00800 子pP@2@0S- $P* 0 x0D 0p$1S/pp@-@ PPx1`SڄP0x  xAPp0@-@\MP, (M$1L 00T0@0@00 0000(00 0P$@t\Ѝ0C$,PD0@-08 S $0 0 0]Ѝ,DC$0P10@-2cA80!0CSM PU 1S {~P 01T1PP1P D Ѡ8 8 B0R   Ѝ0 0  00 0 0  0  00 0 0 0  00 00 000x 00p000d00`0,b,~D,b؋ o, ($$, P-< , pT,0 @-M@P `00T20S'  DP!4 00 B\ \"00P0<  4 0 !- WЍHPH010S/  PP)a 00 BQ Q"041$0 000xpP0` 87/0P0 00!`0] U=00S0  P* 00APU PU000 !̓P^ X^, Rh P$0 ".R>,l,<؟,,,h),CجA-$0M^@ QP`p@0 L03/P 0 @p$ 0S0Ѝ 0Q@#*11P0\  R'l1@h1@T@0SP-D1@1^0P@@T  @T6 @pW3dpW0V82# @  R @ RD RV @  @H0 pW P^ TXV ,0"0P0 0R,0Ό R8<0,l,<,h,,,\0p@-T00P DPPp0AS@  1SAx,f,~D,v0@-P$4M0@L0 3/P T  0P  0S4Ѝ00^ @^ T 0SR2",p0\ Q0/\ P@ ^U Q0000@-,0O-`GMMzl7\2@(T H2V 00 0 0000000P@@@@ 0@Ep@a< ((G܍Ѝ$1SpA0L08 3/P `7Z Z ZT7S p$ 0ST7S8 P P C 0 1/P ,0 0L$H R>,~D80S @-0  / mTG-`@Pጐ匠X0r2 S80S00 00 S80S0|1 P%S$1S00 0VUp@-8M`@8  T P $QO$00S U 0 |1 08ЍpP ᪮P P Q V ុ P ᖮ ޮ ZP ,bA-M|P8 vU`ЍFP $A003/0 R   01/`P 003/@P$a0H03/0 p`IXEH2 08 8/PD?0 !! `b7#Hp0  3/P"#"#00 03/p p0` L03/᳼֭ c` 0SWp`?`B414!44 0<0S P L3/0L00 3/P @0D t0Rxp`0L00 3/P @0D t0R 0 `04dRP  v00`p 0Sv Z 0 |1 0? ր  T,bG-`RM@Xr PP p_P`` `PP P:  8֓p 0S )xߍ<0`0(00,0 00004008004004 04$0D0(0P tW\  嫓pV t奓p* hdnj` 8 N  @P 4Q (Q P P 0,0P0 P `*  Mp 4`?`a8S[Pb 0  00*0 0P圲 -0 *0 @dAde@dz = "   .A-@Mp`;@@ p@ݍ P@0-@ῑT 02 "  /O-4Mpd@`P(tT,$ `&Xp\>T  0 xY Y 0 0<S, S 0Xppͱ @P S$ P#2Q4ЍR <00 Y)Q X& Q   T0pTp 0pW W0 0Y4<0p8 (,W \ ^Z7 SS Z" 0 Y00 00 TpTp 0pW W00  S S\p\ ؀0@-4MP!!0  P PP@4Ѝ000P/S0D0SD/0- 0S^0$^ (H P@  @ \@0P00@0/A-` R0 >h!/000㓛#000X  Z   z,⛏( [: yT  P ؀!\R 00 B0Sx 0 G0<0< H0S< < 0 dyd|&;݀d{ ٘0$\ (00t S S  S00/Q 0P/0S 0S P// 0R@-404 44R)r0@/ ٘ 80R*@-@0M$ 0Q0 0 !0 ! P0Ѝ/00S/,b]p@-,P@0S0S< 04 p,b@-@0S,bA-pP@0ST 0S` @ P<0@P`V@,bs@-S@P ' `P zЍp8P xz`P (tPP )pP` P P(  P` DDtPhRPP 0SP` P P @0`0@0)06<DJQ ,@-  [P ڈw |SP xЍXR0S 0 t wPx] O-@M M@P;B/$@ܰpPz(` Fpt p㜌00@@Q$D0S8 R( s 0zPY0D04@T,4@0@T30@T0 00 F z P P    0wP  p 00#@؀x@0V  00# d#.000G I`#HP܍ Ѝ0 4004RP8 <80<RPv0( S 00#PD DP #pP@h Y #YDP@m  P #}P0&$ D0S(0 D 2s؃0 S 0 0 0 `岁@0x0#W@#000@40 <`㛁@dڀڇژڱ 3 (P0@-M 0r 0@S|( OwPXWxx0L @8\8  P 0  Ѝsu8 *٘@-+s0SЍ@-@M rT0  CR$00S ЍwA-pP@0ST 0S` @P0 0=00<0 0;0p0:00(000p0 0,0P,0 0H )# 1p DЍY0X ڐ(oC-`P p@-`P Q@8Md@`Q2"€ 0)r000% 0S 0L0 3/P 0  ** +"+s  S   "S2006 W8Ѝp,~Dp@-@^P8Q @ q2"p282w@-0p@-tP@0S0S 0DHSTPSD  p# @0p,b,P08S^1/,P,H p@-@ 0(  P0R0PS 00Sk ppM-Pp`NM@< Рp`0| p `  000 ;͢PP <p~Nލ~ dyG-xM` @pᜐ壠OP! |!0@P 0S PU 0 R<D1D!DD00S 00" !P@&P0 0S0L0H 3/P H L0RPP T 0$RP0 0   x@ 04/@xЍY Y ZL   [YZ( (  O-p@PBM M`/0;P( .0P@0P0iP) Y  &+4  e P!14`#?s0S4 0S}to@ U01U01Bލ Ѝ 5g0P0  e?XY$0 0I0,oi?X Y 0oS 1 SR 1S  RS1S1S p2?R0_Q  @K 0 8< 4a <0 8 0 4 0 0 8< @4P < 0 8 0Q 40 0D!1G81Q 0(, 0$ 00 0  Pq@\@Q Q' Q0PUTO 0"0S0S0@0gP P `@@!02s 2 02@, @*UXR A-00MH`LPp h1h!hh#Pg@P( T00咡0 S` 0!?020 2002p04 ph0Ѝ 0S"$ 0Q00 L03/P Q 0L Q 0 SD S003/ >,PP/0@-2S@ “B\œDL@A.XuOPvOw,S0A- P^^0`` ^ 8^ @T 7i` @ @ @B@ @ ppS@ 2AAA0q1P hp@V8aBWP08} ^\ 0Sp`82S04@11111111108 o2aqR 2@S22#040TP 2SXT0S  #O-cMM00 Q@ ,00#.;0P0PcލЍ0` F(}p \6X&PRS000o?00@ 2, 0 0S 2S 1SL2L"LL0/p 0Ẑᾠ0 0'000000pW!? 0 t᣻ 0_dG T F pJcP^RUn{ \ 80 W 800S $ 0X&  0$ X !( 0?? @ X !(??$ dpP  c?XT D , bf?X T P@d Us@-RU0 1@`d0T `Š#+ Q H `04 oЍpj ! ~@-@ T  ^D@ @Pp` ^PPVPU Sp    L"<0"8 0"4 0$< 0$8 0$400 0<<@0,P,vO-@|MHp 4  \  QD}τ$$\ YY  \^8RP PW# 40 QP}_PbV VZYQ\``\`V W,p|ЍRE  0 $Z Z 0 0`ͅ^ V ^Z Y `VRU` P(  USQP8H  @08    0 4  D "< ! ", , "S01@ 5 @ D pE W2z\ P  \Y Ƒ Y( [ PQ$\P Q1!S W^ fZ D0@ S(0, 02o(0HHTpPD 80 Ă2 R020S PP Le+00S0 0!40S`1 0U0 <0 1R o 0$  RQ   0ST0h h2 Q HW40,P݅ 3T ClO-@|MH0Z00p000 R,8(8((((LR2  XD00P} 0000"UoQP RP"4!0 0S40 00SR 0XSZ \70XZH7 00/ 0W00* 00(0000$0(0$ W000 40 080400,0(0, S$008B4Z6u?v/0800S , S 0ZP6BT@q? r?`h"s?` 080S000T0S,0Y0 < cP< GZ50\6o_P 0"H0S PP *d 0 8 @ U 0 o?0 R S RQ & 0^|Ѝw/ (0(00$0?01o?0RR<0# 0,0Y00AQ0P0T"

S@P0 { P0Qd0@SP0 0LH S  0/ 0//Z[d0Q @10`d! ἐ 09/0P@\Ѝ,~DG-` p0P@LHR0418 S ^ ?Y R  `0 X0?Qࠡ࠱000^ 0 G/,~D>0@-@0M 410810!b0 P0u0L b0 K0PU ! 5/᥹Ѝ0,~D@- \Gv@ Su@-@l 0  L|$ym&0@-<@0su(00pp^0Co%,l-$M?0 0 u$Ѝ0-4M 00 000kP4ЍO--pMMpEpeAv " P8v85p p0 0R0( 0R00S0$ 0R 0*ğ $pT0S 0s 0SMߍ0S P 0 \`_X40SP D$1zP8$HV 04 ᗫ{@0(@{{jodVd`#0ez3P 3R - BP   BRږ3c"B # et#2izP  0\ß R#3SPcS0$c10e#Qz $P Q(0 0SZQ=9 =:k{2@Q08.@{PB!5 Q; %#3ZP. a d!0@! e "z1PQ0&!`[ eQ *!9"%+0! R! yP0Se\!yPT1 0pps 0 Q 70@ 2@k{H{7{z0W=0P8  y`ᕘP</<pፘf0 | yP@YA.,ڀ,x,`,ڐ,hx,Xh,Pm,pQm ߘt~,l~@  }y@-@x@SRG-@  700pP ąP:`X:00X0 RyP@-P@`pP0S -S :S S  000`  0 0P0 ЍU0S T  &ZP&p@-@P!sp  `s@-sU700@pp@-P 4` sp@  rPs@p@-M@ Ltp$ ЍG-`p@T2 P   P0IPE PP& PE0P @ R R0 RR00#R0;R0S Q \Q  "Q0# #QS0 @-3M M p 3ݍ Ѝp@-P R`@0 @ s 00S 5 UP3PE ЍpA-@Pp {p`" j 0W0 |0WxX Uh0X`0 P U <0H  0h08 IxЍ P 0m"qyZ@-`0tM0F?oP2p @Zps XspAr{s@rp h2S?sp L0V#4 - ctЍsh"orpp@-P@w@OspqPppp@-@0 v r0 S " 0PUPUp@]0S   0 0S ]]0S   0 0S ]]A-p@PMU `0S@PE7  0P!00ۍX700S @ Q@BPE@C0 00 pL0S 0#S @UX @-M@ H bqp8lۍP   p@-d1`0SM LLЍp@@>  <P  0 !    qp0 S 09S a.Ѝp0 S   000 00P0 PS @ d0 C pDLA  Ѝp@p p@-@$`PvZPp0 @ `P0 002 0pp@-SP@`xM  j0 0pp@) pp$  pp pp  pp  P  H0  p(0xЍpt p 0 0 s@->@P`<p @ p0 p`` P0)p @ 40 pЍp p@-@PqP  bp01CpP`qpI Op0#1/pp@-pM0 p @I 4pp3p@pЍO-QMMڊ700ۍЍ .  Z } @`V o@pP` @-`Rf00 ЍPp@0STZ@PT  Q*R@00 S   0 0S0 S *ZP `[[ . 00000`0 @@P0   @-@ @Z G-`P.H@ D$:0  100 D qH $R$  080P040>0S0&0 Pp0 P W  g0L1p@-S@T1S"d1S,RU6lRUppbV7l[lbp1C[L10CL1SP [0P11C[T10CT1SX[0X11CZd10Cd1ShZ0h12,P0C2bVZbp2,P0Cp27@-@0 iPP$ H1 0D181-@80@ CB Ѝ0@ Ѝ0Q@-@    bnP p 400` Ѝ@v Q @ 00pЍ@ Ѝ 7Q@-@    nP p 00 Ѝ@F 1S70|YZXP| 01@ 40pЍ@ Ѝ H@-t0M0@Q0$^)p Ѝ i Y0<1/@-@d&P0S T P 0800L0S S@ %4*:@-p@\M Q t0 2 p\Ѝ<0@-800@@> P@-@|p t10cSt149 Ѝ@ @d 0f ЍD Q7@-@  ,," _ Bmp  Pm Ѝ0@ P 11P,|1@ R  |S%AQP |`00CS`0 XQu@ T0p 0< Ѝ0@ X0 X Ѝ0 k%%p@-PDmp44p@ @_np p@mEzZp@-P@ ` 08 l, j<U\% 00 008 , <1pp@ jbp@-`81P:81x1S0p0@Tp 0S   ʌ0@-@T 0S @ 0S %/0p@-8@` Z40 :0lFP PpP  Pp%pp@-8Q+L`p$u PD 0St PuPUp 0 P8`V(+P d SC/| ЍA"lW h"\=:080SK $0P   Q p0S \ U8 A ЍA U0 0S V ) P0S t`QP  *t R  P 0S P9 0S 0 8" ЍA! Ѝ_z* : 0@-@x P $ La@~ L0p@-S@P` 08PU $00P   <1 0800S>? $0080S  p, A p p@ @-@F@O--M`@0pRPE@T0Ѝ P R+W& 080 C +"0   Z0800 >X  R @@ FX   7 C-<1M@ ` ЍPPf q`0 P  , ipWP1 P P2 P7 PUP@ P8!88 @p$;! Q0S000 000  p xD!\10B0H1x;l l<x )Pʌ 4O1?G,ڨ  )@-@  ,ip YP81 ,,i0,1ЍP0@D81 P$z5 E Q/@-@  0S@C-q`@ xO @P00@ 0S  J0 Sx   0@ Ѝ 0 pPtg% @P 0@0PET  x PP 0S  $0$0> R>  **~X  0S ,@0 S   000x1  @  0SP P0 0 S   0 T0A-M P0 0E0@!0Eip00`+h`pSQw07S 0 S X `0E 0\!`1  `Px1  ލ ' R PpxP0 S   x0 kpP 0PPU>Txx {x x1p  P  0S 0 y 0P k#2tQ@-@  llz)p07S@\0 S 0VS0S@U A-`R@p@M PP U 700 @ЍA<P"R 0S 0 r>XU$  *P 0S <0 *b p \ <0X <V>P  *@ЍAD@Ѝ O-P@$Mp[P  TP 00A $ЍOEPw @P000 P`PP`VQ`P    0PEPE 00[PPIcHSPPP P003#Wp`r <11<100x1pW* *gPx1pF <11<1kP NP00 6PP4PPUPpP xP 0: 0 nP P ` 0S 0 0p  P YY vp 000 0S 0 0pW<11<1$Ѝ  P YY  Rp [00W0 0 0 :0D WUx1  0  R @ [ cP W @(0Ƞ0 0 0 U U  20HȠ0U 5 0S W xfx0P 0S t``W`ʀ|`0 xw$-%< Bp@-@>Pp 2R0P0 *> 0Cpǒp@-p1PSM"`! #@P T 0p1!V R 0S X\lOP De@tAtЍpp>0S N0x1@T l1S D  @>0S@ 7`l1S   0 @ yP 0  @  B.(0#p ,l1S h H!t 0 R/ 1/,ڬ/A-@P 1 !  SXpR0 qP 0`0S"000S \ \ 0 S   00S000@00P10 paU0 OP G0P@-p0p ppq 00P R0 U   p@-T`P\@0^0S\*\@\0 0SZ0 5Qk9 <R0p@-`pM@PWf (0l``FSЍ R*p 0  B\  L *R B  ;G-PP $L1L!LL<Y@10!<`41Vp(@ 1!0 S0 R S,   @T0@T 0 S4  0(p `Q ,00@,@EN@P0S 0S0 @@ $;@-^000 Ѝ ^   ;@-0 Ѝ@-@P`p!, 0B0 0p"#k ЍbMB@p@-P(0 PUPUR PU PTP,PP@PP4PP4\pQ@  8P)@-0 z0PT0/ OP@-0 k0T0/ Z//P@-$0$ $$X#08D0 f@-,MP` 01U0@0$00 ;0p@000 0<0S cp,Ѝ8010C>ST00@( ( 03(00@000 0<0S80  p @ zY@-X\N@P dpO@0  0  (0,  0004 P0-s@-@T0P0Ѝp@Ѝ/ r P @/op" R 0Q000p c00C0QOPU 0`0HGO0HPLPU0 P(P0P0V00 S   0/O0 S ,  0&O0 S 4  0O@-@@OC-@PM pb堂T0SY 00C01@0S D3/\2\"\\`(PU0S Pg0S R=0 S ,  003/00400P4P+1 P0V0U0S0 L0 S* H嗢P& HLH0 R |Q   0 00   CCU 0 HJ0SP'p(0S| $`ЍT0t0S 0S   ,r Q 03/PEU[ YW,ڬ @-8 0 (@ ,+p@ t@Ѝ&0A-`M4PspM c0 Chp@ 4b@ۍЍ4F P P  ӣ#P@@#C 0 ,$@4   WP%&0-@-   Ѝ Ѝ/@-MMP`@p0  h!P 0pۍЍ-@-   Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  l ЍЍ/-@-  ЍЍ/-@-  V ЍЍ/-@-  ЍЍ/-@-  @ ЍЍ/0/% 0p/O%@-M M t ap P@;00 dSV 00@ۍ Ѝ$P0p 4Nd%h0/%@-$@@O4 @O%p@-dP@b; P͡4  PP   vOT V00pp%&0kO@-@P81>>@M@-@M p !~bp !wbp`@-q@ 4a01p .a01@v bp@-PM@` 7  W0 Twbp 1@ R! 0 p`Ѝpii$0 /L0s P/P  //@->P\MUGV0P0\ЍU>700@ p`R0 PU B0>000 <0-  ,>  PP> * @-@T<@Q/@-@TQ=@0P/- R 0 R00^ PG-`P M0(0S @ P P P:`P 0 01 0   r08S0 00 Ѝ080 00S # p`P `PK0P 0iS.S  `P;04S 040:S&0@-@PDM QP@T n00p@DЍ0U  P @0S@-`Pp@MTЍ 0S P 0S0pQ   <@P @-*000Q/Px1P/$0/@-@M    0 apЍi~O-YM `F/@H9X0IpPpYߍ0pFK 0S 0S PP@ Y P @T0SL0P 0@S0@S@@T1S X1 yPAT1S@\1S`1 kP5\1 S S R@L1SP1 ZP&L1PC_oSRPU@P04S 0s0P8AB@@$P00SLQU IPPdh1 P Pd1UzP H@ `  0[$0D  H  `0 S *9X001H \0`p X0 RB000S0 15S4 S  CR.T X L@@RS! y r R02 > 0*<1 000S yp S 0 S `@@g0?H01p 0P0H0}>H0 @000L0PPP >^3_i@A-p X`0P M0 @R  RT T 1 # 0@ @ QPUx!@T~00 Ѝ R @F_^-Ȁ 5S   0s0 50A % 1  0  +0 ":+0  9! R500 @-`pᇂ@P@ Ѝ l0PXIIp Q,#P fPP @-`RpP$M 0S0U00$Ѝ/@P 0 0 0 0  0S dU L6PP, T/00DU W6O-`@y0p"S0W"SpG` Y PP u700 ЍTUYP T000졟0W YT X0#0%*T X3#: 0\S^0PxSmS0S< bS ST Tn C R  T0 `T 00T 0T 0000 0    00 PP 0S& T  C0 `P0A\0SP0S  CT PT0P &P /0 S S /S/P0/S S S/0/O-M EPPЍO=`P ||ЍORH@Y@S   pWDH#PP  P 0QA00Ѝ=0@S. P( 0S @P{H@\`@X.G0P 0 @ 0 0 @ @ p@-@P G` 0SPG$` PP(0S $G0(0$0p,e P,e PO-@/4M10C`pXPSp00 pHU- 9`Pp $;P@ ⅛P7 7  '$ !/P`0@T\0S @U0 @7 0H050U- H0|>0P G0 E@PA t014Ѝ EP 0 1pA 0S 'P^G01@U  CUH070 0  p` P! .RH  0R77@0U  0pP  H RU H0@1S@H000zU P0H0p ,0 00 0 I,0S@ ^ [yU ,0 01 0 2,0 S H Uw 81B80w40b儒000 0 PPP00 0 P  p@0  @P 4 UI 8180w40b儒0p00 0 PP00 0 P  0@H0:0H P0<0UH# 0S /`P /`P00 V /0P0 Q00<0000H060U ,0 00 0 I,0HST  ?h 0A  ap  P 4p@AK0  U kU ,P 0SU0 pH0 50c h050,0 % 00 0 3,00,pY 5$ UPPeUk700 5$'0 5'@pp 0 )  0 {p P H0@40U 0S 4S 04S0:006S 06S090PU- ,0 00 0 `H,0HS :U H0P SPH0;00H090U `  k`,pP C`P 0%f_ CFEH0Q7;0UlQ P0l1 xP0l1 `P0l1 P pAD0PLp1tH000|U10H 2vP0H 2n P 0H 2f P PH X H000RH020MU D 0pP(] H0 S;70:H0205H0600H0;0+H080&UV 81!8b0w4儒00 0 P000 0 P0P0P@U2 818∂04gr000 0 }P00 0 sPP00 0 hPp@0  @U =PH <p PWH0p000 SP0<00 P WH p P  PWHp   \P  HP  4P   PWH  BjvPR | ($rpq 00t %E2? \j Plzha~  ,5?DS`"?Rcr(P>n@:U3\_V +lv  ,p 00pP $ ( H,8  yP B P*WHW B $p pP (( ( H$8  HP  B dP  xPW ,0 00 D0 E,0HSv  P /o"Bf ($xP}/uP0H (0Pm 7$ ! (0'0H ($ZP_/WP0H  (0PO 7$ ! (0 '0*UZ H0$X UXH020H0 000X-H000 H000H0 00H0 00(07600R 2  *450S00T055550H0U 810(@0P@470'[P 0SxeU H$SB2{P$U <1 800 ,0 00 0 E,0S 0 P P0 0 P 0 0H080l'H010H010|H000wH050rH050mH000hH,7+,bU`H090ZAK3O0\ U0` 0 ZGAKοOAK OAKҿO,Uo \0@T$(@# B`P  ,00D,0S7PP  $pP0:0(P  ,00 rD,X|BPPpP`=PBP`PpPh BPPpP( j 4BPPpPX f dBPPpP l BP`, BPi& BPl   9 {l?o2= tW (BPb ,{BP`Y H ^XnBPc lhBP |cBP` ]BP` WBP` QBP ` KBP@` EBPh ?BPd 9BPe 3BPe l 4,BPe H&BPl \ BPg pBPg BPlw BPlq BP f Wv ZP0$, _PP" @ PP0(0ApPb WypP  R  R 0,PS0P , S%00 0$0(00XH` p @  dZ`0P ʎJZ\0PZ ZU@ HP70P7H0"800H080H07 00H070U u5P0h2~h2S H000sH070nU x`P 00`@HPp `P pPVJ P P@10̀<H0407H0302H,0$,,H020'UW 0 ypH< 5H000H000H0@00 U: ,0 00 0 mB,0HS U$ ,0 00 0 WB,0HS U ,0 00 0 AB,0HS0 i ]O-pУ@`P8 P P `nV81P ЍOR$ RZ0 ,08 ЍOR Ѝ ,O-S$M`03 @ 0QpP  8، ⨠娰81H0  00xCp0`   h    !P` U (   $Ѝ%<BA -A-PQH 1pS`01S`5x1hS`8  >>$>0g47S90>8g<7S:8>@gD7S;@>HgL7S<H>(>A>> 1`P>>1`P>X  P T0 ST47,`0C47<7,`0C<7D7,`0CD7xL7,`0CL7O-MDM`d 0*=PPhx0 3&70 0 + 0+0 0P70P70 0E00 0P:0030 0 5 Np _R ;(0 0 0 P00 + 0 P#Z 1@@\0Y,<P0047\(oP3 @5:[ ؍DЍDP lPA0 D  D 0 0 DDP078247024,0<'哸 R28=@,0D'哸 R,@=0H'87l"L'<7@7D7p"H7L708 cp0  t@0S R R P\R @0@ R #P0 00 @?op200p0S0p@0p DDP 0 0# 00lDVP P0( % < P;P6 Z%d hpP$*$$0@0S 0 S S0P\S 00@0:0p0 ჁPphqduPd p <P 0S P  P 0S P Ppp~0 0# Ps Xq0D00D00 0  0e0 S E4* E000X ,@ :{e~V0Q//Q *///G-p000@0P `P Y 0 0 `R:S@C@3@D"X HGU( IGA-TpW0 T`@V0 L0LS @sP [XX X| |00 S HH0P 0RS  1p@-P e@Pp/<@-p@-@Pp P PpT0 p@1@-0@T w0@0T0S@-0 7  ET0A-p `R0080<10P5 @P:1W T t0  pP<0S Xp10S 0p; PT0 H*P P P T T0Rt0t 0SmPt0 t0 88bPx x0R TgPRP0S P-&>M6\A-`P Pc_i@T bT0pS~@p@-Q Mz0 T0S0 PU|0h xPc_`p@P X0 @ T   Ѝp RkG-Pp0M $I F C   P :@<1A0 <1'P  0Ѝ |B @T|   T0 R0 0800, P T8jp 0SS90SSPT0c | `P 7 R|0   P @T T0R88xPY0Sx x0R / !T 00 XXWPR P T T0R88FPzp0VS tc_ c@TG [0`SS-90SS)rPT00S8 00 H:* R S  Y p 0S 0S Z@FT 00,I @P \ l uQ00@-@1LS? @q@dR@l̠ BR00 1BS@P@-;000 00S C/00 P@-Q000 00S ./00 P@-}H0H H0S So/00 P@-D0D D0S Sp/00 P@-H0H H0S S,0@o/00  ^p@-@Q0 RP_0 0`S0 SQ 0` 3Rp@p0 p@W0 p@  { F0P@-x0x xxaQih0X  P R !P BR #@@ !p@-@P M0 80S R 0b0?oScP 05R X0P0 ЍpQ/0Pd`Q 0000P 0  ,-'A-0S00@Pd` pW /0000Pp 0 ,E nP@-808 88Qv(0 0000 _@-@QQ lC-`TM@ P `dp) 0 d ````d1pWp0`V& d @ 0 K@ dT  @TЍ00C>S00`"P!@03@000C>S00p"P!@03@0 -3@- P gp@Ѝ0@ Ѝ/@pp@-@RP`@p0Sp  pptA-0Pp`@S:0SS 0  RS* R0 `V1S* nP a 0@DpR: Q  @zO-ATP` M zy=?@PA(@h0<1 Z  xp 00$PȀ P P P P  P xP hpPpZ P Ep @61@ R ,;p 0<1#3G0800 00%%)p L0S% S% p H p P p $  p w| pw P0S t0$0Q0 p 4 pe x0Sz0_n%ظ 0(HLǒ -\ lp Q^ ,\ ,@-QMM@pP\Zp000 FLQލЍA. !. d0h 9Lp`0SPE@Ep 0S:0@0DO--,Md`pP. j}`  @P1 0S  塽P@ 国fP@,P$ X^P$0X21j00,Ѝ P,P, R ᄽP,PE0S h R* 01J0 4$ R, R bP q4$ R R ,Ph!@P !!! $+ P/ P/Q0@-0@0Pb^ .^^Q\0Q CL|\0@0Q C B\  00/O-P@`MpUP:T 0T00D0S00V`F@@V00ЍPW"0$?S 0[ PW RPPUT  P70 .0 I@0 0IU:D X0 0 `TT  DSPO-@p0` 1! Y*QP T VZ700 Ѝ%P@`Fp  F00T V 00  P     @3 \Eo   ' U/U$\U0 T VPPT V\%0P00PP`F@pT V P`Fp& C-QM MP<`8up; @;pE 8_Kp X= p :4 NKpTG    0 Ep P; EhP E/   Qލ Ѝ   L20V0002 0@Ep  @`P0P@T* p0S4  p@T*T 0 hJp @ p 0 Jpw @    @  H Jp_ @  .0E/PT \E/JpN 0S @00S@%<Jp>00:h  UjA- @pTPM ƪЍR` R 00P0S 0 -0 0t0#0Q0 ^$ 0V 0  0DII/O-4MX@p 0S\`d` (0S:0 `p20"4ЍOf 0  ,   pCp0,0 ,0SPC<P ,43p 0!00G,.4ЍP V0 000!0  剺 0,psp000H!\ `F,P 0 S(0SVP$ (0S(00` 0$ ;/P $P(0 S!0`F0$00 (000$ ;/(0SP, $0R00,  (0S ,  0<,P dntvp@-P@`P 0S P$`(0Sp,e P,e P = 0N^C0@-MMP+ +p P0@ۍЍ0;0 C@P +P @- PΠ R00\L  ^@-Q00P`PV0 V=`V xЍp@M@T   y0x@ `DPЍp`Vx1@P e0>0S *P PU@P P#PI`F/0P@-000 00 Q$0  @6 HA-` (M&00>0@SP  0'0x B0dpp ż0t0 0 01 0 0S0S|0@0|0 0  X40Qx0 xPT (Ѝ0 8 0=0S ̽0xMPT)A-`|VPPFPP2X@p`Ex8,P x倂|"x20 娼V0  U|20|2@-`@MpP! D (@ (`X( 8pBPU@ Tw700@Ѝ pi///0@-$!M@ 0  m*PPЍ0 3"Qp 000)00Ap0000@ 0Aplp 00 " 0Ap< p Y R$2Ep@-QUp@p @n,0x1p@i,@->`GMV 0P0Gߍ@PF/ ᩻9  0ǧl0 p 1`0 DF?AP> *ػ0 F?A ii@-@MP4@ $P P@Ѝ dQ@-<0< <<z0SSP`///c $0 /Lp/@-Q @ ?t0@0Q00@-P@,M(  7  W PxAp 0 00S p,Ѝ0(i8p@-@MP  `  .  (PNAPЍpi:O-PQMM,3,#,, T0S3#pW3"@H`"0J01801\0t0 P00K`T0`V0 P `0P0T00T0 P T0X00T00T0PT0 0T0VP0| 0P0P0Y<0 x P0;P0R h0| 0h00x0P00`T0 0FT0T(@)@@Fᏺ@  徱Ӻ T0R  B  @ Y? P1F0FᶰF @T0  ᵺYI @T0 0F0FᶰF @T0  XP ᚺUPPEPP@ D$r >p`ݍЍ  <  YI @ k C-`p"0M` 0$`  0=,pP @T*Ѝ`)PPA   0%,p<0 S *@ ``T*x0V*,00*T00V:0 (P|+P@ ( ,Y 00@P @-@P`DM p@  ᯹  ϥ T0 U134  R2$ (@0 VDЍU@ii@-|@QM  ⅹ00p |2 0"x2t?Ѝ@-]MM`@FP#7>p PP VR 000S0S S SS wR0S H^pVPS CQRS 0  VxpD@P V$0 Bp 0S$H`  8 hY?p 5 $ L i80Su S S00,0S  R000@0S  R00@ H @ 0 H150H \0$?p\ 0S 01S llQc0 0 000 0 0pURZ1S SN F F$]ލЍRIx@P= @3 3P0 0- H)@>TY$0S! HѸM PPN0 80~Qi@i s@-40 000 0*Ѝ 2S/2S00/@-@@噹V002@-S0@0 @@勹V0002S / A-PM`p (P)P'@P. 0LL`0<p0 ,!B<pPU0Sp M>p PU0S p <(@! (( 3>p | P,>p 7/PP !>p /&P Ѝ@@BqBlBp@BfO-@p`0$M00PU  <0S;P  0P0S P弱 00SU 1 !  N0P00 0зP0 PPP0PU:000y $Ѝ@-  = ЍBgp@-0M2S`P@x (⢷VP@0 \(=ꊸ00ލp@  B-$M^ * ! ;$Ѝ@-@; '@'@-@pp B=p` B~R0@-00@ ^ 4s# R0p0P0p@-A^ T00p``0@D^ "000œ\p@Tp0,QRO-M@@00`1Q V00ЍP0p Q :8Q@SH Ӷ딂\= \ plP p,lP U  Z4\[Wpp\X @ Q*S0C '&P 0 B0 嗶 0 S2X00cSc@-@ 000P 0S00 Ѝ@-@ 000oP 0S00Ѝ@-@ 000\P 0S00 Ѝ@-@\0S R\0\0@-@`q0E`:0`0@-@08$e@0p@-800@P >0S0&0T0T0x1 RpR 0S TT0Q  0800 >0S  p@p@-`PK@%Pp00,000SA/00/0KpcScO-@GMpḀȐp Gߍ0RS*R?  0 000K C$PP d0S  GRW ( Q  R X(Qh 0 00> 0200BS *⒵0 370 RS90 T00K4 $ `BP0`  D\W Wd\ h00 P T7 ?$000FP@0p$P DPW0S <0S @FT60000<0 @0W0FS 800006 S0@0 0Gq2!31 0 _ %R  FR0+  %A C %0 @Wy 8    FRk2   0@08 R  FR]3   000FSS 700 0 02@,0 " R 07 ,04'R SJ: F0Q4%0=SW (1S 0 F0S=00(  ⰴ(100@0S W0 2S 0 FS<0 0 " ◴ 20@W0<1 0 Z00 FR P0@  2S P `0 FSQ0Y0 0 2 0000Y00 @  H@W 00  ^00FSt0p0p@x 6S 0`FS^00 &A 8 60@uW3?(, "r  P W: ART~ ,02)S P R:(, "r   PW: ARTZ  ,0  00D0C0W0 0FSJ900000@ 0C0D 4S Y 0 FS8M00 $A ʳ 40@B?S7A B?S7u 00PD0 KS:KUKe 0 S0P0"1R U0F R 0   ឳ @B 08 c#S ]cSc25<W7@-P\ R&@P\y0S x0xB08  Ѝ0PP +@ 40 p %p @-PR1!`0@ 0p\ 0C R1 00 R0  06 30 0 0P0 0:0 00P00;0 00P0060 00P00 ЍP 000|0000 00~pk0 00rp0 00} C-@PTM !P@, 000`0001iH00 P00 븀x0`  (#0(10: P  P( # 8c@  ' 0ta P( ``(1 (1  0(t!p↲0 +"70 (P 0 >``v` P( `"(1* (> >Qߍ 0*_  4 0@-p M$M0i0PS` 1!pp6p@40S i p ۍ$Ѝi@ 0 ?Pp <1Q50 00pP P( %$ @- 0080@P PU@ 0S@ `P@Ѝp ޱ00O-IM PpPHLL `PR q@P0}IߍO"0,0?"600 06400` 0 p00,0 PS2 V30a2@0 0 ,0TO;`0 P B;Z@PIߍO7@8;0 Px VT` 0X`0T$;0 4`;P' @,<zOG-@pPQP,b,`2S#PU`,@ ,x<P` <, Q 0S ,9$; P,`0 d\RC- 00`p@PT:;p T  X ⢑00U *"0 &p Ѝ0R0   @:0 4i<p : `<pp@-RMM000PS`B S@ 00 0pۍЍpd p p `F0D]:, $<p Vh@- 81SsQ S0 00 0yPЍ 0SDPD3O-04MS@ h@@ `_0P o0 00 0 RpP |3 00 y0 GpPX3 0 0S0@0g500T0w @P0p 00 0 ,`Pg 0 $ ( aX_.pPx 0$,0 (,8 P@p W0!Q*"0 0 P 0$00S0  $ 0 pg7 ps(00 , $t0(,8 ]P@0Sh0` 0h0 d L0304Ѝ 00 !0 P~ @z Xy0$00S,0 pP@,0$S S S0t0Q4 1S 2S0000s(0 $n(k,8h P@ 0lmpO-P0M040@`0 `2''`pp'`W9 pW6l0S,0S`,0r0v 2S`,080w0v 847S`,0lr0v p"Rr0,p802 Sp0刳0g47S 8 0\ pߍ0(000 `2(p(` z `(8 0 jp (`H 0 `p 00 `2,np 8 0 Mp,8 0\ Ap'0z0,404l0K 40/pl'0k@0!04,09 40p]`]`d`k,0 !P !304ǜ R00 `"`P& 00 100,0G0 ` 0 X00, }R0SuP 0H ` `  00,p7S  ,0 !P !0 `"MP 00@ 0  0xp,`p@ p@-PUp@0L0pp@- P# Mp 0` 0 ` 0@3p2@ Ѝp ` 03p )X` 03p  ୭00D0 U1003p@-p@`P<1.(080000&0S  0R  dp`H Ѝ@4@ ,0wp Ѝ@s Ѝ 4O-`@p 0帀SP$H` 000 0 0 `00`0! Р;0 `  $N7 0!0003H0<1v H ЍO<0 $07 000x3@0Sl3H000s$80407 DS ,0008 R":kg{{'{z40S& zkg{{'{ z0S+d0S( $0P$h0!6 00R::kg{{'{*zd8 S zkg{{'{* z0$6 00H0S0ST h Q 0R<0S 0S11H000s8040 P14 P18 Pp10 #\Z00@0S0i ,M0.0 0p x0h`  P0 I20S00H` % P 0dh0 ЍO Ѝ??  6 = Z a i $  AD U   H OA-@PT R0A `h0`  | R 0i0|P 0S <0S $ 6   .p0 Q p pp0 00 0ppH0 v 00 0$0 F3% FAd0h0T O-R@`pP\M$P X0 #3P 0 RT0h{00  p` hPP. aL0S0 0@S@0#/L0} ā?I00kP X0 "2P 0 Rzgjzzz{T0@d0S  $: P $[ <Y y$ 420,2 0010,00000<00@0,0D00<$P(P Q48`LPPPTPH0/pW @pP 0 0PPF  o0 0`1v`00s0 10 !E00(K@0` 0`P00 0\ 0`v =04S 1S0<10 Jp  X @0 #\Ѝ7S Dz   CDC  B O + @-`@pP`0 h0X $7S R @`00 , ` 4 0 Ѝ@4   @ T   p@-P@ $ +0 00L0p@  p@-PUp00CSp@0@ $q4  (200y0L0p@  p@-P `@pG800  B\000D 0<0L00p@8 #   `DA-P`@ 0h 0R0P3 0<1HAp` P0<1( A P    9 Pd0d dd 0d 0 &P $A  B K r 0  h00h0 C-p@ PR0  R $ RP508̀ `3  i@0S kPP Z P0  lH<18!4?788'00  Ѝ@ 0 } 0@-@4M<14(0P 0S 0 0*P00  A 000 0 0o 4Ѝ00 000 xB3  4Ѝ0@ 0p@-8 PR@   P   0,Hp@]Ppp@  Bp@-@P (h00h00L0p@5  -G-px0Ѐ4 @Pm F8 8C02spЍG@ x4p`d0 2s 3p (p ЍG`@F.L` X ``H  ЍGxl  ЍGv80   0S 0 0a 0` P  S$`0o0@00S( G`P  P1  ᯨ00h0d`0h0 0 S000s  i`Ppq 00 Q R D  0 00$0z@C40 040800 080m䑟0 Sl0&h@Ti 0Sf 0p0x0Ѐ60L  P| ЍG`0^l0 $2  @[0S> 0S; 0 S<$1   0 <`H0  @ R 0P ЍG 0PS 0 PD0A k0 00 0SЍGЍ <D cSc   +D0p@-800@P  Dh00h00L0p@ ei E m \/ R/ . d0S  0R/J>0/ O-0M0000PSp0T @R` 0 ЍOs> R*+P 0S 07S ǚ ǚY  SF1  P!  Q 0 S:500 0p00 0  ЍO Y 0 0Cs0'0S0 S0L0 p p    06P 0 0  MF0SY0A060@ 600 0p0 0 - `P  `0 S 0<1Ti@<6P P0S0 0<S<0P0Ѝ 0    0P 0Y6S700S00 l00 0[P Rd532Y@0KSK?38%05#10 Y0S0   P   C [ i0 p4 @r0S Y0 % 2)  Br  Br0 0 $ 0P 0   0 oY 9 0 Z t3@S R@00Y$00D0<0<0<1(?00; P0 !P4 000Р 00 0 10P00S* iP *   p @ 0ЍO<600 0<uP0 ,0S * >P  p̥`<1 (000H 0 000 `0`0\0S   0\!YP 0 8 R @1ЍOTY 0 `Y 0 00Sh00 00 P0{PY0 $4/ x ЍO        '   * T g ~  _ H    p@-@l PT / 0 Lp@ `D N\P d  p@v`$ %O-`Pp 0x1@TT 0S R T0 S> R *⟂P  0 I@ TO-,M@PpKP Q0 ,ЍOPE ̋UM0@SI 0SF UC:aV?0U<:0 "R3 U0:!DR-   Pp%  R P  0  Q!   pe  aP b.  0e,Ѝ J 0  BB X w p@-` MQP\@M  L0000x dp 0S TH -7 ۍЍp 0b`V \@T d$A- p`@PpAPU. 0 HA0S 0A\0S 0A q G-0 ;M0MNp`p Dd`8գ0 P480EL80H8$0ED80@X@8<8  XXW0` 0E 0{(p ݍ0Ѝ` ~  p@-@PT IG E(CA@x1S0pSq l(02p f(02)022p R Rp07@-PX0A @P 0S)0>8 Q0'Q'+ " B r R "'   00 Ѝ0@J}sy zgjzzP;R, @ 0w Ѝ0Dz  p@-@P0( Uph0Spp@ O-P`@T Q Pd0S  0 t0`d0P0BQ 0S 0P ,  0800 |# 0帀8!=0 80 $ 0R0hd`h0$8 R0 , 00C0 P0800<0  P`00 K0 00S $0 pWp1s00 2   0P C @R 00pwpWL0H0)Ht0p   60P s/0 @Rp@-00p0`PQPE@ `? @d@$,b pP/1S P///P/P/Q 0\R/ 0\/P/ P/00S/x1@-@T P@x10S/ R0 " /Px10S/ R0 " /PP/h0SdP//0 SRQ oRQ /Q P/Ph0h   RQ P/@0 RP/R/@o//cScC-`x1TM@T. 0S pW$ P  KPP@0Sh0S d0S4$qxed0 0S PPTЍ|0d 0|0 00d0 00~090 P]  PU9$0 00 {PP 00XUd8QdXM PP |0d 0|0Xx5[U" _8 P P -'| ⲚPp|0S P 8 P  JU` bP < 0$Q S "  Q  ယPp h  5< 0  hpP; t0<0t00 00 80004@ppG0SkX$0`S D4ß0 R 40<L>T @C 0 B3^00@  C310X  2` 3 d ! \C 2h00C0'0hS8 0 p0 00Y\\p2`D| <g,`;PPDpAލЍċpP hP 00PpWA C9RQ  0000&000%0}0L 0 R0Cu0s0Sp00$0k00S0Ce0cL 0 BR^0 0S0CX 0VL 0 BRQ00'0L00(0G00)0B00*0=000 0 d0d :/1, !۔lP 0H0,l % -M \,, ) 0H0S/,l0P /,l@-DAP|0`SDM)0S&y0S S fq0P 0P@ DЍ pW*P 0 0000ppŕ@ `0p坕X0 T7/0S 0SP 0 P0DЍ@ʍ,l,% G-\qPL @0P12C001b5R 0 0&0S  1h0S*0s0PE`1``d0 R1 *! q ` `  !`` 0R00倍0S0PS  &0S,P O,@GI,l-!\  0L0#0,l@-p0M  L0@31 ^AP 0C! 0Ѝl,l @-L 0 0@11D ^Q       ,lA-@b@0Mu L0 @2# p PW%cP_  Bc p\  Zና$0 HD@,X#10000 2R01   000 S" V00 S d ЍA X 1(4/00~X0威0 /SV Q`ЍQ0S ⣌ЍA蝌`\c  Z- l9@l"%0S Z c0@0,l T 04SJ:`\H㌱  ቍT  Q\ ( Q   y l Z P   ᷍T0`[?oT20S@ @ @0R @T`0-@0S S @0V D X 1D@V X*| 00`00P 4!!00S00/!& 00S00/!% ///@-@Hg.@P K(  ~@&0Et-@-   Ѝ Ѝ/ -@-  ЍЍ/ -@-  ЍЍ/ ///@-  Ѝ@-  Ѝ0-@-   ЍЍ/ //////P/ @-P 0A 00ЍQ@P ԍ@p@-0P `| @P  \*. Q  Rp R  (  p 0 B &,qA-P @`p>3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p0@- 00x Ѝ0S/1>3 !/0S 000/,0S*p@- @PrP P p Pp/0S/p@-0P @R`*0 PQp0Pp0S/@-@0 0C0 0  (  ( 0 S/! ^R/@-@0 0 0  $  $ A-P0S@`$0aH U ( U ( S 01 BpC B!r0`A-PRp `@{P 0!ṋ000A-@P`p쁟0 SV1 V00W W0Sc0 P 0 B 0  BV  B* "M A! AC`0 F  B8  B "/ A & `PpG  B0Z  Bv`FPpGo`FPA!A-a@0PS0<R&*1 21<0S 0R ,0PP0S*!!! 0R ,00S(!!!,p (0O0PA , (0 ,P&&&A-`P P0PS\ ]\ xp@BX T 0| PjPp%d0@-S@* Q 0S0000 [Q.Q000 S:0S008000R .R ]R00, 8 0 s000/`Q'Q!//&0sA-0p0@P`M⤂ p00p00pS 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0SN u P0( S,* R)\\&|\#00 |R 0S |0 3/000Q R R0SS*|\0 Q QQ S: 0S   B 0  BЍ 0S 0 c 0000  B 0B B0n0 "0 00 0W,p@-P@,`ۅP@tp Tp!Q 010//!,1p@-0@S0<QP: 1,0R04S"`$0V):8p1P8 S50#p(00<^ 00^ 0S8opU 0! R R0 0P`&&&O-P 0R@pM @_ P&  $X P 000Ѝ 0@  bMPP ЍO 0 PS@ Ј 0 00<00S*^Q0R08 ]R00-R ((g Q* ]R -RS\T0]Sh-R0 S^:0S006000S80S 00000`d0xS ,ZGV ,0Sl40Si$0Sf<0Sc(0pw_  0(`c0 @`F p@ VUj 00C0e-R [RS :R =R| 0S: R 2S0S0`0`0-S]S0S0`0`40\ 0 IY0 S:0`S0`00S00``G0 >0I~P   0y S0<R$ _LP    wP  $0  0$ 峠S0hS0`0`0-S]S0`S0`0= 0 S:0`S0`00S0 -R[ QX]QU -Z00  YJ 0S- Y0`S 0`00S0<Y00 Z0S  Z4 0KP / {y400!0ⱐᲠ40  =P0S 00100  0P  +P{ U [ 0]SS0<Z*0 P80 P <0 S P p`v`00勰P00 0  EB#ЍORZ =RW ]RTR :R ]R007 &,&&&p@- 0@0 (M! 00 x l0R 0`0]00000P0 `P(Ѝp(Ѝp@&&&A-0@``Pp\U [U_0V:0dS0`000 4\U=*Ux .U; 0Sf0 `S xIPu 844U\ 0CUUt0SU 0`B t  | 0D OU &83U N 0  , 0000h30>@0S* *Q2  0  B  BI   B0  B=Ѝ 8 0S 0S 00t200}PT\QR {RO00r0PS;* ,R8 Q 6 2000/ ]U0 R  !   p0 S*R\Q}Q00 S*0R S\Q }Q 0<00S 00$Eo/JU @0` V1@`(p 0 S *R \R0)S ) \h V 1L  0 S *R \R )R003 0S00000+,)>{^ ]&@-0@``P?Q $0As R % S 0 ^Q [Q \Q 0S Ѝ{Q |Q?20V:0S00500 @0` V1@`(P G0 S*0)S  ) V 1L  40 Sf:0S00p4000 S**@?PQ{PR ,$  "!,Q 0S 00300\0 0S 00300?P  *P 0 B5  B   B0)  B0Sw* *B?RP {Rp Qm 3000f b 0)Sa  0  $  $  0  (  (   0   000p0@20z`o ksi0V:0aS0`000<Q >Q q`x+P {N &   B 0  B  Ba  B5 "X A, k0 `S0* ,R-  0000< V0 R   0 S*}Q00@ R 0}Q 5000S 00!,&^ ]0S G- `M pQpG ~pL7@P 6W: ЍPCPP P $PPxP @廃P 0uPP6    $ ( , 0P4 8 < @ D 0 t000L R:0S005000 S8:   0A0GP0S 00,50000Y`  p0 P>3S! 1Ss Sp S <0RpQ00< 0 f  SV S<0RpQp< 000p000Q S S SS7 S S3 *S >SQP>3S S& "S 00 0\ S:0_0PS, 0E10S*P8O@00CU00C0 RB  \ U B!U  1 EU, X 0C^ဗ!1LX0RU!U! R0>P P PS 00 00H0@0 @000 0 R00d000H 80S@ 0Q10CRZ/UUToZt8Z,Ee,1p@-0@S0<QP: 1,0R04S"`$0V):8p1P8 S50#p(00<^ 00^ 0S8opU 0! R R0 0{P`&&&0p@-0PSQ@ʡ@80P p<0S P pH0@0@P(00Ppp@&&&O--P@pMLP 0H #W # 2RS T| z>#R  Ry R R Rg 0pR0R T` 0PfY Rl & R *R` &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Ra R 0R  _ R Q R) TQo_RQ_ B00/o00"P _Q0R TЍ0pP T @00S00 0S000S00u 0S*0S0T S00S 00S4 000_\0S 0S00M 0S *0T _0S 0R0S \0 o_\P0S00S* T00000_R0X0 S  _0S 0R0S0p>3p1># R{ 0G a >#RJ RT RV R _R Ra R 0 >c0D0H0 00 P0 0 B>c pr9 pRd[3 A T0-  ^P&0a !0R@pH0 00 P>cp0A0!RH|H A>3   0GhP 0G>#`0 @ \P01!># R 0 p`>c`1>3"S`F 0 D>c2 H0 00 7P0 0 ( \(& OO-Pp`0,@Q V >\# (\ \W \E \O `P \V \[ P <\[ \ \G \02\ \ \6 "\Y \F \ 0H \ &\{.\$ *\ \0s0S \ {~ ^0s 0@0s0s0S{0[00>@4N5>5. P`F`FV00@>N>0> \0C>!0>#0 R@x @O-4M0_0, 0(0 000@$002   0 X @ Q  0 R  R  PZ$P  (    R    ``S  R  Ug h V pt p r _U RQ v   _V R up  r   _U R w v  _V RQ ppX u0] v  r    _U_V QO  X 0FP|u  p $ V    upv  w( ppu  v X pX wX0wq uc v _VX 3"  Q$,ZS (  `X S 0P&v u _PU PRPU00000S 0R0 4Ѝw`Vw_SwPu4&O-pP`M80U:Ѝ0!>3S S8 S6>S1 0800@ 0 YS  D>31># R 0800@ 0 Y_  DS S- S* S( @` PS 0e800@ 0 \Y  DSU S S 0>#0FϠ0@P0  @P0  0P P 0/VP 0P   W` 0 PE >#P   0T 0  0Q>SP!>#"RPEP0>#2  F O--P@pMLP 0H #W # 2RS T| z>#R  Ry R R Rg 0pR0R T` 0PfY Rl & R *R` &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Ra R 0R  _ R Q R) TQo_RQ_ B00/o00"P _Q0R TЍ0pP T @00S00 0S000S00u 0S*0S0T S00S 00S4 000_\0S 0S00M 0S *0T _0S 0R0S \0 o_\P0S00S* T00000_R0X0 S  _0S 0R0S0p>3p1># R{ 0G a >#RJ RT RV R _R Ra R 0 >c0D0H0 00 P0 0 B>c pr9 pRd[3 A T0-  YP&0a !0R@pH0 00 P>cp0A0!RH|H A>3   0GhP 0G>#`0 @ \P01!># R 0 p`>c`1>3"S`F 0 D>c2 H0 00 7P0 0 ( \(& OO-pP,@ W`> ^* +^` ^g ^N ^_ pP ^k ^Y  OP ?^t ^ ^\ ^05^ ^0) ^D "^{ ^h ^ R i ^0 &^y".^00 *^ ^ r R0 ^ y | \0 00 r0     0s0s0Sy0 r RY 0>00 E0  ?oR20SpG pGP x0 00> 0 0 0m 000>301> \00 0>000 1>3 SPO-3S S8 S6>S1 0800@ 0 YS  D>31># R 0n800@ 0 eY_  DS S- S* S( @` PS 0I800@ 0 @Y  DSU S S 0>#0FϠ0@P0  $P0  0P P 0VP 0P   W` 0 PE >#P   0T 0  0Q>SP!>#"RPEP0>#2  F O-3S S8 S6>S1 0800@ 0 YS  D>31># R 0n800@ 0 eY_  DS S- S* S( @` PS 0I800@ 0 @Y  DSU S S 0>#0FϠ0@P0  $P0  0P P 0VP 0P   W` 0 PE >#P   0T 0  0Q>SP!>#"RPEP0>#2  F O--P@pMLP 0H #W # 2RS T| z>#R  Ry R R Rg 0pR0R T` 0/PfY Rl & R *R` &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Ra R 0R  _ R Q R) TQo_RQ_ B00/o00"P _Q0R TЍ0pP T @00S00 0S000S00u 0S*0S0T S00S 00S4 000_\0S 0S00M 0S *0T _0S 0R0S \0 o_\P0S00S* T00000_R0X0 S  _0S 0R0S0p>3p1># R{ 0G a >#RJ RT RV R _R Ra R 0 >c0D0H0 00 P0 0 B>c pr9 pRd[3 A T0-  RP&0a !0R@pH0 00 P>cp0A0!RH|H A>3   0GhP 0G>#`0 @ \P01!># R 0 p`>c`1>3"S`F 0 D>c2 H0 00 7P0 0 ( \(& OO--lM%PQ0p @%Qk pph        Q 0!RS. 0 YK,Q 4^ 8[ <``F0 0`Z01S` 0s vQBo \R 0C1!S` `0o0 0Q[0 000,@4H80<@ U PP  0 TX\ L0`s Vd 00 S`FY1`0 0 0`,UP XD0S 0 0D0,E`PD00D0 0R < 0JS : QP Z Z `p2`XD0SZ 4P ,0@P4 pi,0@ 0S%00D ;0$0 0D0,PP5DQ/*0 F00,`PD% 0 00,P0HP 0000 0D0,H0SPHDhX 8 D0`F0C X?4@0 ` ,0@`\ 2ŁŁ XP4P HP PR [S. 0 Y&,Q~ 4^e 8[b <``F0 0`Z"01S` 0s vQBo \R 0C1!S` `0m0eE& 0Q10 000V,@40H08 <@P0T0X0\0 00S`FY1`0 0 0`,P XD0S7 0 0D0,`PD00D0 [ ` 0R< 0JS: tPP Z`XD0Se 4P,0@P4  p4P (HP $lЍ,0@ 0S%00D ;0$0 0D0,hP5DQ/*0 F00,'`PD% 0 00,$P0HP 0000 0D0,H0SPHD_X 8 D0`F0C X?4@0 ` ,0@`\ 2ŁŁ XPpS0 0 Y,Q 4^r 80S 0n <``F0$0`Z!01S`$0s vQBo \R 0C1!S` `0l0 $0Q0 000,@4H80<@PP 0T X \ L0`qV 00S`FY1*`0 0 0`,;P XD0Sf 0 0D0,+`PD00D0 0 S` 0P< JP:$0 OOP $0Z`XD0SX 4P,0@P4 ,0@ 0S%00D ;0$0 0D0,8P5DV/0 F00,`PD% 0 00,P0HP 0000 0D0,H0SpPHxDjX 8 D0`F0C X?4@0 ` ,0@` V 2 1(1( XPpps pqpo-Ѝ///@- // //0p@-8P00@S PpdP p,7@-4P@0S TP Ѝ0P ,@-@P 0S k@P/aP0 0 0/ /0 0 0 0 0/////0P P@- > / c, [P P/ /O-M@pD`@`pS0PH ~* 0000N 0Y00 R0030#$όZQ^A2  # T P@P2*0 0 0T 0C2@TPT  # 3S R 0 RS# X#0 H0X 0Y00S0Y Ѝ 0R #3SQ 0X 0 0Ѝ 0S! 00HS X00X0 0U P8   @X0H0n 0 4Q0p@-MP $@0 ?#( $O0So /, P@,.A<T-00ŵЍp0G-M@0p`W PV P%Y P.X PmZ PNx P4 p[W Pf  h[ c[V+  \[ W[Y  P[t K[X5Z! L @[< ;[ЍYXZ-  *[ %[  [ [Ѝ [  [ZVY  PЍG נ ט p p 0 H ֠ h pO-PQ0 M0R0p`TT00 0 ቹ@P @0S nSc a0CS0 ?kPL 9kPF  Ѝ0kPzZ V000U000kPLZ V070U070@kPZ| V000U000jPZ V000U000ZW V080U0800oS jPU000V000~0@DjP 0jP jPiZL V080U080]jP~ jP jPSZ8 V000U000@U080V0807U000V000.U070V070%U000V000 ЍU080V080U000V000YjPZw ZpPjP XIjP  C X X Ԅ t Ӹ | Ӑ ` 8 Ѩ 0 A-`M 0 P!!0@H@>SHPPP PPP8`"`!P03 pP0  Vp, 0 np@ np@  Cp@@@dn0 PnnPn0 P/nP`Ѝn00@O-1MM @PDX D"$ "4"(0 )p C. `pX3@D;@8 (h0Sl pp  ` ᰑ 00㨱$ !`%0p@ t0!0v [PYP 0S R[n001ݍЍTn0S 0K0S R Pp 08D<4! @ P0 0a0Z  000h,R <!1ݍЍ$p Ѐ HHtF  x x htg0@-P@M 0  PLp Rp@ P K Ѝ00 0Ѝ0@A-@@0s/ PP0P0 'p` ``p0`0mppeX`p m``Y0`0m 000p@-@PCM1 /]P3 ,,pPB ` @m0003t2 @ 4{P@0F0 {@F:b0S VS00 SCލp@@0SQm@h0h 0P@0  P@1:dm?00@^m00 @< ˀ ˈp@-QMP4@SMZ TE //]PB QP0s+ dhP =QaP0 `0'pO @0 @bpqF @ p? ۍЍp)0si/0p0! +Wl@0 P@0 v P@1:l?00@p 04l0#S2p@ l00l@l@PX @% | ɼ @-rP`O-$(pX,.R`P@+Wu00Sb [0 0QQ:K%" 2Z$> * 4"0x"3S20*sW00Sa [0 0P Q :;! "B@T#.PQ$_At00{ Qp w{_ P Q :;%" Z# * [0 0PQ:u' 00{S' w{P c 0PQ: :%" B@T#PQ$_A[0 0P Q :Ky'Pw{ 0sPQy: )JP 0R0o2 T$> * Xw{U WP Q ]:5# JP X0R0S2" R$>01"_Aj0S20YD""""""""""""""p@-@M@ P, ` 0 ueQS    00R  V!#ό00NY [ȏJ0 y YP$Ѝ 0s 4$Ѝ `p P040  .S R 0S  00000S3Q, 3 R. 3QX 3R? {dP08 P00 XsSp HQ1  eP 0S00S Q eP0.S0000S0xrxpf~Q eP m0S,eP rp*}Q ePSq䑟p !~Q ePc@0sS: qp }oeP pQ 0S 0P0 HQP][eP. PQ0.R  RQ PPf^BeP PQApp!~3eP pQs00 u   $ama.m.pmp.m.T  tS  R  Rd xRQQ\Q A-P@U 0U0PUP!A`FWPFq ``NP 0!Eq1pP 02P''O-0PMhP X8 @4PP0XPhPTP\PlPpPtPxP|Pt x`pl, (` <0+{  +娛 P pPSS[01S 0 S 1=S 0 S1,! R 0S[v 0401S 0 S A!,! R0, S:p0(0<lt x0|`lt0p,0x0lp| (0 0V\P<` LS <*Q !OT d!$ *0C 3S00 F< {{NP 01C /AFPT$ 0P  [ `0% [ Ps$0SP U(SЍ00Z`F* 0C!R Q!,! R@, Qp0(0<lx0t|`t0p,0x0lp| (0F 8`0V1<PS. Lȟ ,!\4 ^, S*P008$ 0P 1<` \ ,\Vp0(0<lt x0|@t p, x lp0|@( P 8$  N6?,0\0w <Q0r 0 =S@00l@0\00@DX h0G(00(0000,00,0= F 204PHO S F"x%  SQ8F#0 S/F Q\&0s F&F 0 R0* ^*{q0s {#0 @0D 00 h$% 0S 000000(00(0,00,0(00(0$ R0\SQ : P# 01 ?"x2$00$0 00 00000S <\ H NR LX \ @D0h0 S{{AP{$hz` &0P 0 v> 0d0?`000T0?P00<0?800D0?@00L0?H0?X00\ 0 00#QL0P dS 0 {{ {{{{{{&{0{007(0S  R $ R, "R !:6Ÿ$4&60 $ 0Ϡ! >0T"!!!0C 82 Q02@.3H0/#0Ϡ R  " RD#L .@0L  ?< H D800 0#!/":N6@ 4$&60.$ 0x.>Â!!!0C@ \0RDL,"΃0,ώ #1 HL  LH @00SD  %0 000A`00$0S"x$0S"x0$0 )()q''&'%EEh%D""""l'%.Q\(\)0 4080DP @:$(\0<Q0H0 =S|%0h00H @D0c0_D0@#:6D 0 0@ . 0Ϡ.>! 0!!!0C 0" !.\ !!DDQL @T?#"  ?00 #1?B! H  HD0 0S@L 0Q # 0 10DP :Q00 <S$0h00 0Dc0@v_D0@#:|6D 0 0@". 0Ϡ.>! 0!!!0C 0" !.\ !!DQL @?#"  ?00 #1?B! H  HD0 @S0L  R0004 0  0C0  CQ $0 h00$% 0d^   Q   @D Q D  D D  R`0@0dPT0h  P0  R000 00SsPT8< RF !M0 F!G0 !A0S(0SW 85<0P M: c0 @D^00D0@|#:6 D0% 00@. 0Ϡ.>! 0!!!0C 2^!>0D0.LS@/2"́ ?0 0 #1?B! H " H D0 @0SL 0^ #0F000$02t rt p p 0  SQ  0 & F% F SQ#!F SQF# &$0SD0(0@000<P  =RH0L^LX\ q@0h@0D0D0 000$0y0$0v Q#S ^  Q    RxP0 T&V0dQ(00 3(!:60 0 $Ϡ0! >(0!!!0C Q?$ $. ?@ /" R  " R D!D0 @ 0#1@0L h0 0%H0 0D0@ C00 00S" \ 00 $0h0 C0000S ^  0@D h0 CQ0 $0h0 y|s0; Q  O-M@`$c0P|0c0Tp0 V) 0 2c1 000< PP/ 0v> 0d0?`000T0?P0 0<0?0 80 04$$%"`˟$` 0000  000V ;0h0PJ 0TP dP; P< $`Pm0Sj Rgʰ R cʸ R _ 0 0c 0S0`pd@?O$@T'pET0}Np0`pd@00Fc00D@ 00000 0H0\ PQ h < v^D Pt PE PQ#TLJ☐lpx|PX|RSY  Y  hp@| Ux Zt 0Sp0Xl0[h0 Rwt XX8P0>C 0C̸0t00@p0p`VPu x0S b0pt0 0800p4@0 h00 0P  ' @ PZv> 00! 0#/!! !./᪐ B 0S.?)0S 00#0S<0 !pv.A BϠN ^Q| Sx000t Pt0Łb 0 9zq  A 0pq `pV@P0 ?oR20S_b00ߍ 0Vb0h0:pwq@ 0[ Q#! !pY@1NRp. h0 P0,Pd000 p0  ZR 0pS 00@ b0h`  b0S  0W0ZS0 `hd x0hT0? P0o0h<0? 80f0hD0? @0]0hL0? H0T\$pXTZP MpaT00a0S@Tpa0S: *ß쓟"bY02#:"b"R0 \TP)e<PP 0 tß0dT0CX30@p>a000h0` 0p4@P8P ?(/( R ß&0Q 0Y/0 #10">/ 0C!a 0C0 0"#0R"P#. X0pX!10(/ "#Ό Rà3\"= #30, SDA^ E0  ERpq? @p(@|Ia#00a0S p㼀@ h p@a00p@ߍ輀pX@) XXʍ 0 ` Q 0  sP`T00`0S!10(/` "#Ό R0"c01 2c1@T^`T00Vl.着\)P\( ɚv $I%@-@ Lp T2 taX00 R 0 R 0Q/  /   |  DQ 0@-0P S@@H  ^0 S  Q 0#0S0 0/p H  Q j.0 0#  Q/⼈00Ɠ\ 0@-pPo> 0@" \ 0 /dA-@P `p@P0% P @PPA-\@`@P pjNP0& P @PPdA-\@`@DP pH@P0& P @PPO-P M pP9 谟P nF`P P @ % mP @P0S  Ѝz T W 2Y  gE0p0Sh A-pPQ `@Q 6P 0@DDB(000S  @- M`pPPp) I_ 0 0@0S =_0"S" 0p000S0 7/ Ѝ)_0"S1Ds\0pT000S @ Ѝ1Ds$ DD   X@-@i g@dO-PMU@p  PP2SPR 1PV P` A T @ pP) 0nS: P= NP0 p0Q Q P P 0 IB"Sq0 000EP Ѝt0 00 S  Ѝ0oSP   LLO-BMM@p}^,0  0 RP:[NPP  RPm00XvP PC @@`K'0 PP7p a0P0 0 PP)p H@P! 4 0dSPkPU0 Pp` (py  0KYP @PP0 PpO <P 8Pi g^ 00BލЍP/U ` P wp=]0SM  HP H0H0PP0 p<  yH]00  0HP`! 0 90 0]080  0HK] !0 >ˣ]00,]00  0eHP]00  0 PYHuz]0\0  0NHPj , ( @dz  T < 0 T-{M 0 { 7PЍ -{M 0 { !PЍ >-{M 0 { PЍ ?0-,M 0 IPЍ ,--u0$ S   0/ 00ݐ݄p@-PGU@p\? $0$`0 6/p, p@-PGU@p\? $0$`0 6/p `@- @P 0003/܀ T@-@P 0003/@ p@-P?oU20S@p00 03/ p@-P`UV00P00S@p  P05/| xp@-P?oU20S@p00 03/ Dp@-P`\@PpW\$0$ @0p@/ p@-P@P p 0 0 03/pڀ -@- M  tp@(0(003/ Ѝ@ Ѝ/( @-tp@0003/ `G-- M` P @P0Sp Ѝ[00,0 P@:/@ G-- M` P @0Sp Ѝ[00,0 P@:/ؔ t10!Ph /////x/p/h/`/X/P/H/@/8/0/(/ ///////////////////0 | ` 8 \  t d L $ t d T @ ,  @-@$ MP#055050%A0!0%P$00$0Ѝ R/,0p@-S@pP($ARp$0S*> $0( 0C\ 0 CR$ *#0$00S3 5$07$050(0$0,0!PpO-@Y PDM@p, fzY@ [a P @O [ [8$0P$0 @Y Q< `@@ QQ3 Q0 S0A1@ 8 ,0R h S,3 5407,050,00 00 Q, P0Ç0,  0, 0 Qa@Q8,0P p S>3 57,05  50Q,0g 0 CQ * 0CQ,*# 0 ,0 0,0S3 57,05 50S 5,07,05 50S,0YR#00C RL00C F5$0qS<3 57,058`0,0= A/of[" R  :AoF[P  f[ AA0@ \QZ,0 S#3 57,05 50,0 QS 57,05 50S,0 R#00C R00CP,@DЍQj p`0t FQ)Q* AR  bQY fQ ?R0@SP p b:@S B77r C c3<20p80 S ,0 S,3 5407,05 50,0FQ0 00,S Q 507,50 , 0 5SQ= 305 7,5 0 ,Mb@0f`N2$0?Qa R^  2! a, A0! @ `3 8 Q,Q<3 57,5 5,8Q,  P,  , Q0@ `0 _P$ P! Q P3 ``` VRQI[  R `S` 0P0`\ P \=Q,0 S 57,05 50,000 R,0 Q ,0 0,0 R0`S<3 57,05 50,00804Q,3 547,5 5,y ?R0@S@`0%#jo%#jx%ju-M{0{0Ѝp@-`PM0@ 0  4/ЍpG-PRM\  `UpP*/a@qHP D1000< pp Ѝ80S  1 000< ppcX0S Ѝ贠 YX0S 0 < @x0000< @ pp>X0S9X005X00 ٰ   `  @-$$@M Ѝ'؄O-EM MaX@P+p `EB W0P@)T 0 W0P@T 0 p0EAP B BUEލ ЍW00Eލ ЍW00 v @-@` pMPRP* /AW 0R rR  P   P @0C/ЍP  rR 0rST 0 @0 Ѝ@wW 0  A-`@ p 0P/S /VP @0 Sp 0 S R= jVp@-IMM@`PP 2p 0: S X0 0tp IލЍpAWO00@IލЍp9W00 p@-IMM@`PP p 0: S X0 0Ip IލЍpWO00@IލЍpW00 \-{M 0 { PЍ P 80Q 0 08080//p@-@P PP` < PP u rHP  p@%+PPp--00 M (0  ЍЍ/"X0P --M  Ѝ Ѝ// -@-MbO<@P@ 00  0Ѝ@Ѝ/!00-@- M@rOP  Ѝ@Ѝ/O-q`Pp,M;  PR $ Ppp @P$[ PY P@ 0 @JYP 2O6!,Ѝ000:Q!0P00,Ѝ!<<0p@-@P(M & (Ѝp0 00 0p@-`@POpp p@p@-P000 0 (M` & (Ѝp0p@-@@ @  `  @PNpp p@k80p@-(M@PNp & 8 [(Ѝp@-@PP P  ,M` @Np & A,Ѝ0C-PP,M/  @` p`FV`R V @`0 @T |N ,Ѝ00 0:2 0,Ѝ4<0p@-@P(M G& (Ѝp0 00  0p@-`@PJNpp p@p@-P000 0 (M`  & (Ѝp0p@-@@ @  `  @P"Npp p@w`0p@-(M@PNp % 8 g(Ѝp@-@PP P  ,M` @Mp % M,Ѝ0 P $ Q80 @-8M80@08 Ѝ880/LL0000 0<AR 80880Ѝ/`lP/0@-@0@0 M0S 0000 X0P x0PP d00 CF0P00 Ѝ0@IP,B0 z zO-3M0PP 0 @q|0 `0Dp@ P P00U tpp0 0C Z 2ATT00  RF LD@D T]:[ 2 0000~`K =M0 V0 W8 \2ATT 0`Fs 0Ry $M 0  0 B0SH M0Ѝ0 V  0  L ` 0 0pHX;0S2 0 Lv 0 B@ 0 B  BL`FtY  0 Bx  BL 0 nz L 0 a0S 0 BX00Ѝ 0 N] 00  0p@-@PLppp@ 0RS00 /p@-@<0<00P  @mLppp@ 0808 00 Q0R00 /<0p@-@`PMLpT T   p@pp@-@P\ \  ` @0LpTT  p@p0O-!PP Mn 10, 0D`S1H0?a0P^1!p !q1 W0C@(t  ,0@@KDAA|` dBp2  W R ? P QQ Wt ,0 000IC1100Q0 0, Ѝ000$0 00w 0@-@0@ 000 @T AP80@080@-@P |AP80@0800-M  uЍ0-M  ЍO-ϟiM PȡЁqal QP@ P? `K͌U P`? K͌T P? F͌(Z P> F͌(1S P1> C͌ X yP@> JB͌8W gP= ̌V UP= ^B͌`=@ 0S078d H0P< `P P  P P P P p PL Pp(, qP P`P (aP Px PP'( Q780D0x100C40S000C,0h0Hp0L`P$$0PQw ,0 p0`@ , V @  f`W/0!1AQ 0 0 @T @|T, V   @@dqXhP 0Z Piߍ P 1 S  ,00 0! 1S 0D 0| 0K@p00GP,,0`L0!!\V, @  B  (8<`@ [$ 00A00@S9 00a1 P Ua PU, [000 P,0匠0Zp(0p1P0@`@P㖽P`  V 0@0@S P8<`@P$04 0R$0'HpL`P1L00P@@X1(@P00P0$001T00PPP1 PX00P00000P0, 0pBPBHPP@ 0T8`<@OH Us,` p@PW 0g1pV@10P00 00Z00 sZ,0W0 P ܰa[@@P P  Z @pV @@ PT 0P@ UfT0@0p8`<T4 ! , <B B P $@0p8`0[/To0, q 0q00` p @@HP\V 0f1`W10 @ 0 0 P00U00 PU,0 V0 @ PqY0P@ 㗼PP  U `W @@HP\@4P,00 0 ,0H0 V 1封0D|A>p`FR 0`0 0 0[0ꈰ  0PU 0P  0@TP0 @  0Z 0^ύ @  0`V 0 Jύ @  0X 0Q̍ @  0PU 0P΍ @  0PU 0,0$ 1@,  BU00p@8`< ,   , 0 H T0封.1D|Q>p@T[ 0p8`< T P H00 0R_ (0Sk ,0P0 P < XC h!(0ST L0!11 @ T p @彽T,00 0 @,0 PCT0p8`<,04 10 ,0 H0T0 就!D|=p@.!(0R1P@PB10P@ T  0PP0,0ST,0 00C, P P0 X" 0 0 B00 S: 0T 0 q!1 @Tq` @GT,000 @,0,0Q@ 0@1>PpP`ں Pp W  `P P$0SC ,04 1@X h!$0S5 P0!11 ` V  `V,0 0@ 0 `Tq$0W1`V W  0 ㏺0P`}0p08`< 0,0 SV,0 00C @,p0 [# 0 0 B0!0@SA 0X 0a!D 1 P U a P婼U,000 P,0|!0RP0P1`@?0P`. V  0 @ P50 0R80000S  0p8`4{!*prQ>{ R 81 R 0SЍQ L0 0 0IEl0T0Ѝ!f|t~@0l 0̃ S/~$O-C@p`ᜣM[ +(p( $WǸ0CS0SLླྀ3ɸ8θP $3$0/# {% 08:x{rH̲ pŸ夒堂8ırxrhÃqpr(rhrq`r`PrXr弁qPrxrHrÃq@rr8rq0rr,rqps rqrqrqrqrq rrrqrsrq}@s: R 0S 18p10S pWЍQ 1 0 0bDh' Jl`p \p  00(@T(0Ѝ `a H\!}H+!,!-%!.%0%#fq&i%"`j#%ok{% |l%m%<ns%t%$u%4v%,w%x~#p#r"dy"ez}8@z{D>pp<^v8#:0'ݶ#ڶ0z# 0նH#Ҷp-϶-̶`_ɶ|ƶoöpr㽶y㺶z㷶{㴶@|㱶h}㮶5A-\`'^`@ p 0\@(`V(Pz(O-8g887M`  `P `0ǟJҭp 7 000 S00 U0S}Wp  @00  4` S 0 `0 40 s 00bR$ 4S4 0((&00 Ѝ$0 s 00bRS4 0㋰ ?<21 R R3 $ ` r  aR$ $ Q ph0  T5 U0pS p ! @00 4 ` $R{  40 0 ;0յ $Q B q/ 0 ;0 Ƶp4 S S040ST 004 0r0  cR$GU  p p P p0np P 440 s 00bR4 44300fS t30l3 `^ pS 83003 `O p 30 B  `40q0cR 4S02$00$0C?o r  aR$2#T p SO p  0 s 00bR40 ; 0%p P `R pa 40 s 00bR4 4$R40 s 00bR40  ;0 p E  `Q q 4 00 0q0cR  0 ` Ѝ 100#?c p; 000#?c pv/` 0 `00! 04B 4 00 40 s 00bR 44 `ALQd  ;l0(  0 + 0040 0/4O-T4P@P0DM 8 `$Qq  :Q#R3Z 300S 8093P0@P@P@x@-@l>P `f>P <P10S. ,P:  0@S0S0[S0mS S@ 0S 1 CR'0@S ;S 00C S00 0@S0@S mS 0C;S P   0@S;Co  5< 5$zO-0\fS`@pMDvpZP ,T0 prʍr 0H"Rp (0$00 03S7PK :T7P 1 0XSڄ%$ x%T 0l5"00\4S03`00S5 p0S2 4S, 4S 0㨄25X】匡Tp2 3Pm 4p2[& LAT# `P P 嗈@ɱƱoH5S4S 4S0?o2ᳱ04Ztx2 PsY  i=P3[x2  `=Px2?;~0x2X  V=Px278x23Y|2 PU t3|2gЍ0 D p$l h $ <%$(LYh 0=P Z )=P [" "=Pp2?;~0p2|20P?0 rr 0H"Rpp2[6odcτ00 0#d#lm0 p,_F?2? 0p2ͭY?w 0`w b2VP`0  0 0Pdp@-D@D0@Ppp (0l0m 00 pdp@-@0@P:#Rt t# R- # 0ppP`p8:p(hp@-@0@P :Qld^p- pp#P`p  :(hp@-@0@P:#Rt Ó \ "R-- , pp#P`p:p0(p@-0@DPSP @p (0008 <@%8 pp0@-H0H 0@0:#R#R"#0:(@-`0` 0@ :Q Q-  :@-0 0@ :QQ σ #ppEPo :X@-0 0@ :QQ σ #ppPG :p@-0 0P@ :QQ tà Ãpp#Pp :hp@-0 0@ :QQ σ #ppP` :Q`p@-@0@P:#R  #Rp @8 %8 "R--  pp#P`p:pp8 :(0@-<@<0@00:3S 00  @-8@80@00:3S00 @-0 0@ :Q&Q)   ,0,0͂ $  $ "p"p#)P`S :Q0p@-@0@P0ʃ#R(#R+ P-, 0,, -00$0 0$0X0 R0pp#P`p0ʃ#RpDhp@-PPP. 0@` :QQ! “Tƒld l pp#P`p :QppLh0 0 l00 0 H0@-@ MZK*qQp* c0 0 `000050 00508003 Ѝ 0< 503 ЍL L0 0`0` Vj#c儥P`@  0 000:P/@-0 000OT0T 00:3S 0@-pp X,P`/X0X 00 :3S 0-pp@- P`/($0$ 000:#Rs/$0$ 000:#Ru/000 000:#R s30/X(0( 000:#Ru30/0 000:/p@-P0P`M0@0 0ssǼp 0S|000 SC q R 0:#Ѝp R 40,00 3/Ѝp@thR A-RBP0@SMq QP 0S `[ 1 P00pp1p0 Q41 1`p0V0S  d100V0S  034ppu+ 03, pp//%ЍP  QÁP 0:|   0000 0 70 ` 0@600R@R$@th 0`@-,@@0S600P @-$@@0S600O@-X@M@ 0S Ѝ< 0000 060 0ЍO<@-h@M@ 0SЍ 6 0R  (00 Ѝ 6 O(N@-@B@2@P$MQ :cVT0r3ppp*0Saqp 0SO1p0S@ 0  B0*1`00|PM 1@ 300 R 8 C 300 X30(0 W :3,pp4 7P`$Ѝ0`00|P @ ,6 0R` 00 `500T @8 300 64NdNLlL0pC- M P  V L`u㓹<0`00:3S \ e Ѝp h 0 000:3S/IT0T 00:3S 03@-pp)P`/@-<0< 00 03, ppP`@-808 00034pp)P`40@-PPP M* 0Q0@00xP 00 02000*C&' Ѝ0|P H00 020000*' Ѝ0l/0@- 0 @P0:R M# P P&tP 000 20& Ѝ0`P D000,PP Ѝ0l0 000:!-Q0 S0 0 Qp@-@Pp80pPU,LQ (0 P0C0S0 U@TpW#80pP 0S,01///A-PPM Q@`Q00?`FV`V` ,p(L 0@VЍA-PPM Q@`Q00?`FV`V` ,p(L 0@oVЍP/\ 0,  B0/\//A-`MVP@,p(L 0@CTЍA-`MVP@,p(L 0@)TЍ@-PP M+ Q@7`pV00Ӣ?0`FV`V` W ,1( @Q Q( Q Q V Ѝ,@ 0(@T0 p@-PU,NQ Q@(`@0@@`` \0C 0 S0Up(,  0 R S0/0@-P0PU,LQ (@0 P0C0S0 U^00@-P0\0P#, 0 BP 0 PU0,LQ (@0 P0C0S0 U0\0O-#4R lMVCT_ ,PA^@8 =$^8R@ 0000@0pP 0-ȣPp4S-`@PP3@ 0 00p) ,ଣ4, [ 0 + , 0 ^ lЍB0  9lЍOH0O-:$M$pdZ0  r$ ,PUv P0p 0 p b Vp(:0PSH7 0  Ȣ@P$Ѝ0SH S4 SpV  1p0004S$ЍOAp @0S S SpU  1p`Fp@0SF0Vᨀ *HVp P @FXp  K1p`FVᦀ* P@Xp P @0S SVp @Vᦀ:Xp PQO-PM 4 3`S,[*Y= @00! 0@ @00@ +TP/ { @p ` PPE @0S 0  `PЍ` D J P 4A " 2Ѝ @0  @TP0  0 /1404 000S :P /x<0<0 0 0S :P /4404 000S :P /<0<0 0 0S :P /404 000S :P /X-DD 0\ ʌP 0 @-|0| 00@T 0J#4R B0pQ 7@.P g @808 000S :P h/,D0D 000SP:P4@//000 000S :P /L0L 000S :P @-p @`/PA-0 00pW* Z3$SP! #R`@4Sp`3@Tv AmB0tQ 6A).-0    p000 000S :P [/O-00 0 MX% p `P 0 ٠p @˝P  0 P͠p@ 0 5@  Ѝ@P  P /p@-JP 3S P`4`30PV  0s3 S 0增P 2 $R 0X0S 0D3 20X #$04p03pp+Hp@-jP F3S @P4P稟30@Sp@衟A-`Pf JSU?sW< -@P3$S3 SW*0N, SsH0S0 WP3PSSpP4S{pp3PUp,0\4000?a000401C0010L10|1spp@-@P PX0:"C0T0XppG- ؀\/P@p  `*P LTL VW PT VW  P000S<080 0 0 8|O-($Z Ap`PџP@8P (  .T2՟P* T ˟P 0  . @00 .0WXT P  RX8 @(  !:.@0D| @-? p0   0 `T1@A pP`U@  0000% p@O-p0 S;,0 0D | 0 00P0qpI PX 00C 0HSP 1TX[00CS``[TY0IS`YPY0 0CPYb|0 00^0p@-@PpP`0P0C(, ,1C B00R00@UpP 0S 0@//P 0S 0@//P/P/P/P /P/P/(!O-PP , 10, 0DS 1H`?c``  AAp0@!qW#갑@W0 8 0| 0p@ P@ 0@0 0CM]40 00\0\000S  Q R P (!00//H( \/Q,0,  R/1S \/\/1S \@/O-A1@ 0QM5 P`p, @p 0S# Ï#SÏH000C  ```P 00(00(00S0000C00T0 03/p 0PS@  ЍZP (0A-S$'p`P4@(0PS@Q Qa ppQ p 0P(0@Spp(0S/p@-`@0P (0@SpP0@-0^ @ 0 Q@R0XO-`@ MP VT``D0S  00C(00@00 T0@ 0 S `&, 0 S@p @ RᴀD`Dp `| vp Ѝ@0 S RQ Ѝ,vP d,0o0P 00X p  ``F , B,(`aaA0  T p0D`4EP  Fp`,004@ 0T` p0Du@U   PB  0SQ 0 0PC 0$ 0\R =@U 0 BQ 0C R G-l@P 0Sp: P PR E PPQPEPUP ` `R F `0`S W0` XP0`F`V` pW 1 $p00SC 807`PL! R@! P( 4! R# $! R  R 000S1Q0/P00` 0S0  0V(W ѳ`F`V`XP0U0P`W`V``0 @p 0 $p0PEPUP U0 PQ8 0 /$ $\/ P/R|PQA-a@`؜1Pp0$ TY 10 0 QT$ D 0R U ETpL @10 0 QT$ D 0R U EBp: x0 0D  Q SC$ 0R U E,p$ 0$@ P0*@0B0TP @T 80@Tp` 0QR(0 PQp@-P0P`0*Â$ @P uT00PU pp 0QPDP- 0S* 0@- \&@T!\8x ƌ8 t @,0A0@PU 0P0U00 S0/0?o2?=XA-$@0S00â?P4 0\/@0 T`A pB 0S%0^! 0S0X K"@0 0 0 9@U/P 80Q@0@08080//A-P  0 BS0@( p`0,,0A0C1!0 0U0`S@( 8XE?*00@-B  80 P R00 8 $ P R  R0 00S00!R0$R0 R d1S0800800080$RQO- M4zڌ`;@Ps |{툰 {4Pp,p IPP0_ Y4% 800S0 X0 08` ``#$T`LH0|0P08 @!\08 `0d0h0p0l0 ЍP4- P' 0*Q- Q80 SpG V P  PʫR Ѝ @ Ѝ  A-0QM@PP(C p`QAR   B P1 \.X) P$,P?PP H0 DH00R00D p0$`P!b@0SЍPЍI@-M @ 0Ѝ@-M @ 0Ѝ- M ЍO-M@ā` HP`JU@p_WNVPED  0  PI L1D00S*Y p$`(D0p0S0`@0,0U00 D0U@pC@`C0Y Ѝ00H00H0t  P PEP` V IIP ЍP @H|$ 0@-0@P0M t  l 0 B/o 0"00  lPP :Ѝ0PЍ0F$0@-44@M00 MЍEQP-D00M  ( @05ЍE0P8 /00@-MN  P@N000 0E DЍ0QPO-4ŸDM PPhlpt@x` RK SL0[ B\ 0CQ@A PDPU A@A\UQA PNPU[[H p @D11A0100!0lp,00@0@0-*@0l @ V 0 000@ [@:  P Q [@* p0pW  DЍ 0Q0 AADlO-DM(0X04 ,00S80  S l0( S࠳ࠣS࠳00CS࠳h ^@4 @D,  p04\00\0T00S@u80<80808080ql00s0SL0Cs0p008 P(@T ^800qQ000- ,0 (0q`0s0S$, ,  P(p@@^ @P8@hPuPC ^hP4@N~@t@~PpH~^ ( npH^ , 1 00T=08 <`! 01!a S 1  0Cs020Cs0Sq 80rD 0S 1 @t@PT 0uPs08<` 00 000 h00 h (000 0 000CQ00( @ 0 0AP8 h(A^ (  h   BQ 8000c(0 pRp 00(0 R 00SX 000 0 1$ 0S0 !1!0$1Ḁ{0Cs020Cs0Sq D 0Sp1L0|100 pC 8000` 0D0 !L| p. 00MDЍhCpPp4p 00 (pQS 00ã080@0808@8p@@pDЍ [O [L 80&PU0,`A0s0 ,pNq ,p  B   S ^020S@:A-U5P`0%@00?C5Mp 00TP 50 05 0@0@0@0  00P P50 0@5 0@0@0@0  00P 40 04 0@0@0@0 00LP 40 0@08@0400S@0@@0 0 (P !R 040 00@ 0,@   8P !R 30 00@ 0,@ T!R   P 30 0{ @0;@0  00P L30 0j @0:@0  00P 30 0Y @0:@0  00 P 20 0H @09@0  00P 20 07 @09@0  00P <20 0& @0;@0 004P 10 0 @00@0 00P 10 0 @00@0  00P p10 0 @0 0@0@ 00P ,10 0 @0@0@0 00P 00 0 @00@0 00P L1S 00 0 @08@0Ѝ00@P L00 0 @00@000 :@~l`|0@-h@h0@P M006S 0  Ѝ0(0 000  Ѝ0@x4$lp@-tAPQ@`7 Q`1000S 1Sڸ0  @T @TU p0 0Z pp1S1&0C( s00B0Cs0SBB 1Sڸ0l0 00:h2P000S l @T 0 03| -M 0ЍC-P@ p$P `?LH\/ ONI ^pGPE ࠡPJ@$ @ 0C@-B2@`P0 M@0 !p Q,  !1pP0 01 0@00 @0"! . l!OP6X10 R00S Ѝ@,QP: * Ѝ 0pP0 00 0@00@0 0 0Tz0 @00P@0 Ph0p PX0 0L 0b @08@0  0pP14l~|~`A-@`PpiTV,1 @ 0 @A O-/dM ?, 0L00*#Rt,/@ T8  (   ` (`RU(080@80@ @ ?0Sc,?@8? 0@000D L00  0SF (@@000h0S80@0804 L00S8>, 0(0\,0!0 s0  S^LPIL00"A @ t@T,0Q0@t@T80(00S&L00S= ( R , LP S800,0 1-$00Q$0 0\( 0qQ 0 , S(0 0 00,1$00 04 S 80p0L|@0H00D00cp 0SL01H@804 0,0000[,04 0Y0Y 00S0`S0F0Q804 0,00 1 1 01IY0Cڸ@LHPQP YpH @ R T0 00P P 00 SPR P)!R00S 00P ɟ`V0 0CSp SqVp4 0 AS0 S P0P ` P R  0R  `9,00SM@ Q0C0E 0 S00( 0S(00000 0 S(00 R0 000:3s P  RP   L000Sj9, 0@000h0S(00S8000S3 80 ;8, 0`V 00Pm0 0CS<0 HDD<0NN Œ Č Ȍ N LL\mɟ`VWY8 T0T T@00D R 0 R PP! YR  rY $Rg  0E0 p0_   0E  @000$R , 7@  c@000!R :x8 8000Vv00C000C0)X6, 00SA0X *1h"0 @, H60H 0  8 0P4, e `p$t00S000 @0p 1P11qW`5`%``0 @00 00S  05# X0:h280V @ 50S 0S4, 0pQ0A0 0C0 ꈄ 10&0 SPP 1 11RY@ڒ RRQu 0    m,Q Q !PB#`F p0p`P@ !?3 pGWaFP `/p @ 0  L H P 0P0P00 XX0P0P0S^L L00S3(080 y 800  L,,20 p`dЍWL008 0080@080) R d1SdЍ( 0 0=x \X1, `p0, Q0A0Պ8! ,\PY @@YP 4P0@, QeJ   8@,@ APX@T `P `p. | \ drϴT`lPT` P @ p0 `, APYD PDI  P! Y   @@T`Q00 BCP`P P8p0 CQN @0p  0@4$<0S P 0,0[1,01`w @@[`o P  XPn0$00S00 $X00@ p4<PLPA\L0(0 0R( , p0 `, Jz @Z0,  \F `0{8 0,00@ 0C}(@ 0 0800  { 0XPx    0Q0000 CP4`0X0H080 0DP# @P 80@0PL Z J D| p~Pc d1S` , 4@  TP:X X@ P S@DT H HH E@E0 0: 80R0,`0C 0B0X00@P `0 40 0E00஼ PU U R0 R  X R RR)0SC 0 R /7,  @000 @ ` `(0,0 000 0S 0 PC@08 0 0U0P$b pQ_ R$R $Ry X  QAH5S>  9, @` 0  `f@0 0p0 `Y00P c 0@` 00 B0W P0 P<00 p 0 P0+ 40U( R X R$R`V] 0` 0 0 |:, @p@0 0`rUH%RPP p RM $R $R X  ôQ R9 L5S<  (;, @` K0  `@0 0p>0 `00P  .0@` 00 B0 "P0v  Q0@00` 0  @000P  T P$ , x<@ 000 @000P" , <0 0 0 C R! U p=, @@0 0p1S U `=, @`@0 0PL5S 0 0RU p=, @@0 0Lp0 0 0 1@000<, ,>@ 0`C000` @000tW # v 0 U@`= 0 0LfP4Pj @00 pWU zʕH%Rn0 @@TI 0$ppP@<@U; <PP$p`@0 0H`*UpH50S0X0S* 0 0 0 0, @p@0 0H`U~0 0 0 @000jP$pPdAlp@-P@PPM/ 0`0 R    80x t00 0 000P 0 Ѝp80 @000! B/ 0C?0Ѝp 0 00 0C-鬐M@P 048! \` d0hlp`PpPg80  D000 0 B0C 0/? 0ЍЍ @-@P @T(!G-PP 7 1D00SHp0?sppS/, ` !a@aT:#80|0`p @V0 S00? Q R!R0 S   0 00 p0 0R" 0R0 0#0  -QR ^ Q QR 0P //op@-PP0 @ @T $U0` VP `Vp`}0P 0@PUpT` @T @pp  ! !@-@P@T R/A-p0,SP` @T @T0`SP R0Q/ C0A "" Q/p@-`Q'P@0N "" ^ "" T \ 0L "" Q\PV@pp@-@@@0S P$00C$0I8O-:z0Mx*p$P( ,pP H*00\c S@@s  nRXal HR @@i`40IS0c0@T ^OoB@TP AA  RR0|)\ 0  |  bR\ H)` R&8) R! CP'I@, 4R S[80S 0P0$ 0B$0X @C, 4R CPf S ^\ X( 00Q 880, 0,4(0RJ0H 0@0' $P)0S700S00l0S# 0 S , 40R#0l P, 0S 0P0$@P$@70 RЍ $70( U$(00 SBFf@`< & (00 S4$&P0C (00xP0S  {P$00C$0'@`&  T60,@(@0 R 5060, 40RpfF`@ 0 0, $P,04 CS (@Re 0 KRaڠ5%0 p p @d% 0(`Z ȶq`nR `F%` V ,00P0S 0P0$ 0B$0X@@aV  @ Q[Q $ 0(@0C,00 K[Z p<40,04$!,1010y d 4`000P ^$ $@$#@ P(@h0 Ru ,,Zq  P+ p# J d# (@$@ ?#R W( , #\ $6 (@  P 10(@$ R s P $@@ lP "  20,  , o40 S _ ) @20$ ܀(B@0S E0P0$ 0B$0$܀ 00P0 ! 뼱 00(`V7ڨA@ 10(`0 V0|!0`Fx P(`0S  0P0$ 0B$0@,0(A@0S 0P0$ 0B$0 @,0HdhTHp`<4`@ T L(<(dH4O-lsl3phC@00 S M T400040,c`(,P Zm34@3`0T&#0C S402PK袟  ?0@DS(00S00lP 0S 20 0 204@,P0T0hP \RP0 @P 0( 0CS RP 20 0 P1040 ,( Ѝ00S00h0S00~1 0T0 w@P,P  Ӵ@1(`0 R*T$ !P0 0 @T 0 R 0 P$ 0 0 00 lP @T00,P 00( p0  04@SSCPE@D4@P,L 00SL004P\ x<hlxHt$@- ,(4 00@-  ,(4 00O-x1x!0 p *⨒YX!X P!0P[& Z( 0S!`,ppGP@0   R     P0 P00P0`SYPU0,@a@DSQa@U S@00 0 Q  ST 040 00 08QD0S0l%R h%R /!R!RtP/P// 0 000 0P/G-MuPp0 5` 80s3  S̠`D Pr LR!1S85@450 50 `\Pᴖ 40 00P 40 040 0:p@00@00l%R h%R 0ʀl2 0h"T0s# 20T0$,,h"h"+h"h"+h"h"*h" h"*h"@h")h"h")h" h28h20SK\Q*g^SrA Q WS~VZ]9 Q oSf2 Q PSSVi^* Q j^S! Q WSVk^ Q S Q[-S 0Y[=20  0SP R!=-pRt000 0S@"R 42U8,Ÿ= @0A00+ 2bA`PU" 0S 100S H0 0YH0 ,N 0Q  YAPUЍY 0   0 0 00R0  00!R 0ʀl2 00 !R 0ʀl2%R t5S 0ʀl2Sp Sn Sl Sj Sh Sf SUcll\\1P0PP PKPK 8 QD\B@- 00ʃlœ\ 1:t“ '@T tƒ'> 'tƒ A\ B\ ^tƒ    //O11P0= 00` P7ʀ :l“3\0 /@ P 0000CS0 00000000000000000/tG!@-@P@M&\\ Y #3t P P 00 &000 0vЍPl`P -P\P Y͌# /@-00  |00S d d0 8=0!D00 R 0 44@-$!$1 00ʃlœ\   R  ,Ǡ 0:'.t00 R@\ A\ h0Xll@0 000:h/p@-@0@`P0M*l"R R &Ѝp`   P H00 040@ 00 @ &ЍplX02C-00$bS`@ M "2p @  "0S 1QX0&R  l"R R, !p@ '( V@ Ѝ1=00QM0SJ\1p20l P10 0O0剑Q:20h1=00Q!0S0p20 00 0/0剑Q:20t 00 00`0pU0!Q 00pI0!Q l0 000/p@-x0x 000@00CS0 S p0 S P00p᪒Pp00p@-0CS@0 S p0 S P00pጒPp0p@-,0, 000P{w@pp@-Pqw@p0 000S  @-@J Q P\,Q    @/H00P JP\@-\,AP /P/0S/p@-    A BJR@Q`,PTa@@@AR  Rp0O-3$MC0P`Pp@ W ,wP 0p#0C S-0 00$Ѝ(T0 S80  (2 0@ @D BT p`$ЍJʯ,0  1@Q!R 1Q0 CPg(^01A@D D P[Y :0 0 0I U0@D0?Y 0封@0p@`P`p JsPP+  U  P `X(0 SCJXC0 0(0C\00C'^$ЍX TP P  D0|0ap H0@D002 T `V `HuV `` P|`80 00ެ0p@-@Pppp@p@-@80800P  @ppp@P0O-`6lM0@P,0 j Q 0pv`Pa Pr0P0[ W   0<0P 0R 080ЅP 0@SF0 0800`P0S 0P 0 0PEPUV 080 00PS0P<0? 0005 000p`P0 @R  <0T R8 2 0<00800C?80uP0`FuPY00` u, t480pP pK 080 `0p`8ppP P08 E<,QpQpP Qձ4pp( X< R!p! Bp G" RX :     HU pG< S8 8 (P4`< @p$0,0 1400H0@0 @0 0D,PU<$0 (Q00C 0 Ss 0( 0C04 Q00SP{ 80 0? u2, 8 P I000 0P8p0i08 k800C?80tP0pGS00C0`FQtP00C00p000P0 0PS08 B! Wf 0 0H000尡pG WD0|0pslЍ80< p` 0<0T pR0`<0 yPo 08s lЍ`{xs0 00 Wׄ0p@-`@Ppp p@I G00 ?$0p@-@Pppp@ 2p@-@@ @  `  @Ppp p@0p@-@<0<00P  @ppp@ d0p@-00P 0`@0000 0PP`U1000C1.V P*U /UpR00ppP00 0PEP``O-ԑMS D@HP 0S p `@ 0Z  @ 4/ 0[ 7 $[0<S<0.0S0!10>"P0 0@0 0}00 P00 Gr R0S0 0?P4/ZXЍ G\00r R0S@0p0pP4/pWQ# @-@ RM !R "R pPĜ\  00@bЍ/0Q # @-  MS S PpP$R ,@8Ѝ/Ҁ@-0@,M @ Ѝ(@-@044M0 @ Ѝd0@- RP\\0N ^\1   %@@ _ ,\'\ { X"LN!!N0 ("!! L}0 0% !  <{  \@@ RA 0BP8dP P @@  T0 B! { c\ "0  '  0  o %X  +p {o\\:\   QO-M  n EPP@ 0 p % p 0 5S p/ Ą`@Ḵp,S 0 0  C@00 S  Qr%S+0@ GS0  %@0iP@0@ `fv` 00#1.Q0*Q 0S @0 SE^0 @00% d dP00 @0@00 S*L0 0 r 0   0 0  < @ 0D@0 @00 S^pp  00PЍ0 S0^ ` 00 @@D"0 C0 0 S^ 00000 h0!@ @0 @0g0 S!00sp pp00p 00p 0@p p0, T \0@410 0rp 0  0@ 0ppTp0 S\R W' I00 S0   @n  00w0`f Sv` 0S0\S 0 Sa0 00 %p%c%+%c $</>p@-P0P`@0MS SP!  00 0Pl 0 Q00Q H  8 x0 Ѝp0pA-@0MS0D0@!0@P0S?  0 e!~|!!`"bNL LL 0 0210B qP `0 pW$P@WP 0fSPЍЍ 0ЍǼNgȧA-@0MS0D0@!0@p0SE ] 0 !^\RN  L !0 120B QP `0 pW$P@TP 0nSPЍ"0ЍЍDLkt>G-`0MS00! 0p0S[  0 `1` I $L0!b!bIO4ቐ გ1c1cL0 0#3cl 10B AOP P)0< X" pW $@r0sS:P @WXV @T 3mPPPЍЍL?-S*0 O-TMlk`PM ,$  0 : 0s @P 5U000P 0:c @P 0S  R 0X F #X =X =P 0000pP, p WIZp  C00Y*S m`P V30  Z l0S m0q,0@  0pß $ 112cA112c B LL0,#0#pr!qpC 0u0P0q0pr@B P@=rH`@X 0Sp  [l 0` Ql@X0`0TЍp  0g "$ L䡟‚  H !1 2ਁሂBP㈁K 00@>p  0: \1\ $L $$H0!b4!b Lƒ1c$1c 0L 0 00 壀((!h!b!CP㈁ 0tS0cS0Spp0@00p< =p0S `y l(, NgȧLk>L?-S* A-P`p0\ %\0@pS sS lS P0\UUW ]000@1CP0PCV` 1E!L00O-̟qM PQ P` 00S040 p$  l@H Z 1  RS GZ P P 4 Z %Z%Z400 R,:@kP 400@,%,`+P p` H˟,@ 0:ZAZ JQ  0JPPp0-00 >Z A0Js =R* =S00 C?QRp  Wp1PW -.R0 XZD cJqQ   Rp~ PA0JlRpY PA0Ja0Js Rq11OStw00qߍ|I@[/iP 00040viP, 000#pRp  Pp1l X   QU PEQQQ W! 3400`P, T*R 0 ᵅp 40P040 P PPp1  \1SE 0C111SB Z0! Jr 2( R'Z OP0S'Sl 0S'S'SPPAT 0DS11a d7@D!&J0AqVZ ຠ `OT` a 1l!01ATe @DAAAa0Js RA0JS3J Aؕ 0000 0 B10 OQ4 }RRT0  R}R}RP!RU 1h BY!r :#P`!`1`Q,*P  0p^ 40040i10Js Rd1lp1OS!!0l1PUAT @D`1AP OT0a11@A?0Sl00l0 0St00t030S%   ?R ;R P0S %S0 01S2 0C11AT/ #Q,,*P  4 @ , 40,0PPp1BA0JS30J1OS!l!011@00@`viPv 400`,Vp p2ji Pj 400p, 000S   ?R ;RH eRQ` P0S %S0 0AT @D1A !OT> `V ```&``VP``P``ý`@oobP``V ፿``@Q AOQ AAT @D1!ZAo!᪢Vp p2hP 400p,PZf00!Jao0 0媢Z0`0V001&J0GZ @poH0`0B00>00-90 0|@V``pT@`V`pO@`fpK@opG`@pCoo@bp>x' p8V -- M0 0 ЍЍ/--M0 0Ѝ Ѝ/-- M0 0 ЍЍ/00/Q4A-PQp@M 0S XA hP P`V 0v0) V Tz 00 PP0T0d 00ЍT ! 0 0 R Tx T` P0S T`(  ~p 0S R s0r (0 000ST00P c p0 (0P c p0 0TįT@ྯ4ຯ     X@thO`     $0R @-MI0@S 2 ЍA-pPGP U) @`TV 0PS |@P0DV  P oA-pR `Q 00@ PP{ % P P 8$0 GS  KgP  0 /0r 0 /r 0R0 /r R0 /r R  /rQ  A~pp0 Q?Us0 \PQ  0?s0S $ pP  op   1@⡏pqP V0?s0 q%fP v0?s0S  pP  q0Q ?s0U@pP 0?spWB 0岀ḏxS$pBPB " X8 $ 0?"s0Ž nP5 sPA fP,0p/oS" R0000qQ :!+fP#$fP%$ pP Qg$pMg fP$0V0 p03?/o"/00000@ /r RUp0p?s0(C-pQ@|!P`M0 , P 000S9 @ЍPP Fp  0p R 0S 0P@ [P@ @Ѝ 01 .P LPP+@ P *PP004] (\\HO-M Mp:S$0S:S@ 0PS:S``E[ P!* 4 `0  nP 0P:S ۍ Ѝ@ۍ ЍC-pP,Ÿ,MM @`t;P9 0/SI JP P0`fX PJ  P 0 ۍЍCt0P d!  WP"0 @ۍЍCy,0P 0S/S pP #fX0 ۍЍC0  PۍЍ p 0fYW L0L 0 $ۍЍ404 0 $[  T 4   Y( Y G-p`@P  X0@eT  NP @\PPP P @T  @0G[@-@-@ MA00 Ѝ@ Ѝ/VB Ѝ@ Ѝ/ 0p@-S@ 0  p00s0?0 0?0P 0 p@-@repene@leje he0fe@ce 0p@-PS@:pS wdP!pb@- ^ @fR^ qQnR sRq^ 0  Q A- @X `PfS@X pwpP 0@nS sS@Ot@@X@ 0 0S00@PA-P% Ppp R,R    0S,S@B(b`P  v rl`00pp@ 4 MxG-pt@`PP#6pWY*nU> sU\ fUH0D Y-R0 @cP$ H0D@ / H0@0 H01H0nUp@0 H PO sU: fU& L00L0 @XP @P "b 0S0000W 00 H0@ H00 ,00H @,0s0?0H0@0, H0(H0, 0H0 0@SH  $03?0H00H000$P0s0?0H00H0  O-@ M aPZ p ZpY ` S`(080H0aP3 0 0 u0?0 0Zw 0/    0v Y/ 0   y00P> ;08@50@ Ѝ0@-1!000 @S0 0S0:PA_oRQ@ \T  0S0Q@000@T0\SET00 0S00S00A-p ``V@PR bP A0u0W00 x /    0 0 0P`8  O-`0@ $M 0IP p;cPpUP5  9Pv Kb0P  0 c pP|@P P[@@1bP c $Ѝ cb0,P U 0(0$0,0& @ p 0S00qkPn PU Y  2/R@PU  /r R@PU b0LP@U@0H0D0L0; pfS*p @P& PU%  @Ot@0nS sSqpY @p4O 0p( 0 b $Ѝ@pOt@ m\i\@d A-` ppW@P R# aP 0uϿ   v0?000 0  0 P_0A-` pW@PR OaP 0u 00` 00 0P_0O-LM<  <+, , 0?pP |@P0|0`P 00=ZPT 6P2:PP`PP p pP V 0T 0,P`8 ` 0100#$090400S) $ .S  ROSD =6pP" 00p`vC <0P;0?s00P4 0?s0V,P `aLЍ#@P? pp`v , R 0S00 R 0?s0V0TS 0 0000000 P0(-Z80_80 R(NaPLЍ@0@SH p@t`00 0 0f0 hPYn (@[ 0 [P p;  )\[  R-Y %\^[\= @[0P0&0GS1v  0P (W0 KrQ40E K/RS  [@ [d&,0  @ 00@$&,0  O pW00 D[D0 0S+P Pm 0 i 0SX v0 j 000  00 n0PB p (_801` Q  Q 0?s0T00  p    800 ?[}$v 0 S00P0@ P  0BP,  0 80o Y80! Y0@B PT@@p( 0 000 0s07P (`@p@tlp@t< , Ri 0S00 Rb 0?s0TC!PRPeT` PD0 |,00 ('៘P00gPp@t0o <0 QK0?s00Q D 0?s0T0 d )0 0MP4(0 00 0S00 P 0pd0  <  00 00Pp P1  `   @P/$P00//0@-MPl0 0^\!1l!1"b2cNL 0@@0#@B!A@C0PЍ0NLgȧ P0`0K?//p@-MP10  0nPel b N00PEK 28@0#AB@C1dPЍpLkl>$0P00?//p@-M`0  P0el`E $`L0b!b4!b E|@R1c1c@L?MD@D 0P0@$C!d!b8A@C1CPЍpL?-LS* p@-0P0M`2"@P 0Ѝp\, 0 0S Q20ЍpG- 1 !0 qP P@3 04 S0`0`2,0PP00|Q``  VPeȄ`EQ  V|0`0ȇ`H00>p>T@-@P ^^^ ^$],]],00!R  !=4 001/<001P//< 1@--@X@X0@0@0s H ʅPJI HH @ PA--(M t$p4`0 @[TR  k{XF{{=!00 (ЍP P 30 00XB0m {kXkh%!00 P ~P X# 0X 00 "~P  0cP0Q 30{kXk 0 lP  0cP0N20[DX{ 0;2"Ũ""VPg  0cP0|20X 0u0 "DP7  0cP0u80 X"  2P4  0cP0y10l[DX!{ 0]2!"MJP&  n0cP0ʘ0 X"  P `0cP0d10X 028!"P  N0cP0 10X 02 "P  <0cP0<00X 0-2 "P6  *0cP0Eʘ00X 00 "P   ??P  | G H X  P 0cP0(00[D{ 00@ @ X" P  0cP0wt00{kXk 0 }PZ  0cP0ʌ30{kXk 0+ kP  0cP0pH30X 0a24#"YP>  0cP0N30X 0?2""GPD  0cP020X 02""5P  0cP0Gʄ20X 082d""#P*  w0cP0@20{X{ 0 P  f0cP020t{X{ 0 P9  U0cP0 10X 02!"P  C0cP0|10xXB 0 P1  20cP0m<10X 0^2!"PT  0cP0(00X 02 "P  0cP0ʴ00X 02x "P  0cP0Dp00X 0520 "P  pG ߜ 4 \ $ x ݌ 40cP0$00 00X"+ pPs  0cP0h00 00X" ^Pq  0cP0ʬ00{kTF{X{ 0 JPj  0cP0`30X 0z2#"8PS  0cP030X 028#"&P  z0cP020X 02""P  h0cP0`ʔ20X 0Q2""P,  V0cP0QT20 00X" P  D0cP020 00X" P  20cP010fk[D{X{ 0w P{  0cP0ʄ10X 02\!"PI  0cP 0810?X 0$ P^  0cP0b00X 0S2 "P~  0cP0fʴ0 X" 3 P  0cP0Np00 00X" pP  , ی 4G ڼ $ 8 ٔ ڌ 8 D  @ ,  <  ք0cP04L00X 0%2` "@P  0cP0ʌ00 00X" .P  (P  |000  X""00 m1010s 100!X""00 ZP10X100d!X""00 J100!X"|"00 =10{kXko!00 030300|#X""_"00 \30T30[0H#X"O!00 (30t0#X"B"00 20200"X"2!00 20200"X"g"!00 20Y20x200H"X"E!00 H207@20i0!X"!00 200!X""00 10100!X"9!00 10+10^0T!X""00 p100!X"w!00 @10i810010P( 10q0 X"!00 m00{kXk !00 ]000H X""00 P00 | ְ ,   ָ ֠ Մ X L |  Ԕ լ l D D @  t Ӡ h t Ӥ d 0{kXk`!00 !30y0#"ZH ]H 0#"XG"00 l30{kXk:!00 <30{kXk-!00 30\%"00 "00 " 20A p PH  T@ "00 "00 !00 !00 kk!00 "00 "00 !00 "00 "00 "00 !00 kk!00 "00 0Sf !00 0S/ !00 x0S !00 p0S !00 hP  b0S !00 Z0S !00 R0S "00 J0S !00 B0S\ y"00 :0S< q!00 2@ !TD- Ҁ t  р ј Ѥ0S \"00 0S T!00 0S L!00 0S D!00 0S <!00 0S 4!00 0S) ,!00 0S  $!00 0S !00 0S !00 0S !00 0S !00 0S !00 0S~ "00 0S "00 0S !00 0S !00 0S !00 0S "00 0S !00 0"[D"P !H H 0#"0SQ!00 k0S !00 cx30ip# |"00 X"00 S"00 N"00 I"00 D~"00 ?y"00 :t"00 5o"00 0j"00 +e"00 &H mH 2x""2l0 0d2L0 0[ 2,0 0R@2 0 0I\20 0@820 0720 0.10 0%1l0 0"1L0 0N1,0 0 !00 P10 0V,10 0]10 0<0 @@0 ?0l0 0? ˜ ( l \ p ( | \ ˀ ʤ X \ |   T Ȕ Ȥ Ǽ Ƅ Ǽ t 0P0 040p0 02X00 0|00 0`0 @@"0 }s0 @@0 p100 0gu,1P0 0^,P1 @@0 Qo<!00 10 0C!10 0:10 01G2 @@(0 $82 @@X0 l2t0 020 0+;R\0@-L @AQ MOQ,0PP P 0 0 QȠ\ 0;B{ 7G 0 Ѝ03Q Q, ;B Ѝ0A@@1 0^ 46 0b0` #6 !k(7(@{6F{7{   ;B Ѝ0 0T/ /P 0S $0S 0S P? @4@P//A-P08pP`' , R0( 4", 0R40G@BT@! ^V @D 8W,0400GP ,04 00 @(0( 4/P840,0S00 40Q 0 @-P0 R 0 I H SpTPo @$ @ < ?40P R $ R  R S /0?00H?0$ R'4000  0p@4>0U 0PEt@T$0Sp0  0@p=0U 0PEt@T$0Sw  '$   0   0s 0h @$ pRup@=0Up 0PEt@T7p0pp@=00SM <0000CST0S2 < 007s@ Q<0E(0 S0(0@l< 03pT<0U/ 0PEt@Tw0Sp <00<0LQ`D0*;;0\0T  0T :C0PEt 0@S9U 0P0,P0` 0U@@ ?N?P?5 ?JSD?M (?H?A?L q ?:?;?<B 0?C?9 ?R?D iL?K X?B g d?E?I?F?O  ?? (?Q?GU F$0S  P D0 S2D57[U0  0 $ e$ [PE`0 粰\@* @ 7s@D 810000*;X0P0T : 0PEt0@SU010\ \ ^PEt@^zU@pE$ <Ë 1(00^(,$ 0PEt< 0@Q|U( b 2q@D0{ D0B @'8<#0#w[/ 20020H 0S3q0P0;T02@D0743 HL07P;7sD@D v 0;=0 _ 300DS30| @p3003q@D0 7s0D@C s P=l0~90r0\lj^PEt@^U,( 粰*@D7pR !B" 0$ P0l00X0S>0p0P0?0X00 p0tP 50040 I@r 850050 7?R5@0p 0V 700p/500|505l 01^\PEt@TV*U0 C00SU 0 000$6Q0 0S @0p 07s0D@CqU$0(\$ PEt 0@\8U ؂=6L070 0s0P7s@Db 0@D'qZ0@ph0dl70l0` 00P00X⽿p0P0tp0 (0$P$(02 80080H80080 0sMSR: @3 0@|0-D9@0F(@ p \ p T d \ h P 900900S90<Dp@-@%PP80S ($03/$0(3/00pPA-@` PP@p0 QR 408 B4 08@V000PA-@`PpP 0R| S  P00S  d a0S  00?>?RP 0S $0S 0S P ?,B4 BR/  $0 /C-T#T3 0 M000P@P`^-@\3 R < 00 2#  00S "$< @0 P0cA Q # 2RN  S=P0Sd2 R @< 00 \2#p0@< l0^ppW} H Q0c& R#2Q3 S"Q0S Q*0 P  Q*0P  Q:0pSp R0*Q  R*0Q  R:0l00p0C0l0pSp)x0 00 0P0,4P0p0 p0 0 0 30 Ѝl0Spp l0@@@ n<,?S??9HP 0S $0S 0S P?,A4 BR/ Q /@o/?AA-`Vz@ 0!(3/PPw 8pWG  ( 0(3/pP00 f  @T 0  d! P S>0R`*p  BS>00p0 (08#8pPoRS B P T W B T p 0Bpp00  @T 0  d P S>0R`:oRpS. 0A pp $0(3/P 0S $0S 0S P ?,B4 BR/ :+/P 0S $0S  R 0P0?0@@/O-PM@ @㬰(0U 0C00$P $p`0 sRpW(`$0 p p0 Ѝ0` Q`V00p;J\S10b60s0P0U 0 CP0S 0U\!\ ! 10T2 0# T 0SЍ0W0T0S Ѝ0D?o 280%R00S4040020,0@00004@,008@(00<0 00 0 00C$0 0R0pP0 R`0ࠃ,0Nࠑ@00t000( @<90C1@ R@P00F3 0S$ Br R$VE  ` R*$  \ F C 0 Y(  V F( *FW  BR 4 Q  Rc8 %Q  R]<  BB!    S @ 1P <01( 0 ,08 ( 0 04@, 00]@^[O-@X0 34M00C  B T@[ q W3> BI  p Wۄ2  B37RL q`36 B Jq`36 BA@g @PKU 2@EAa P%A0@  2 `"<0@ 4ЍP [P1:  XT@p`0 pW`6@^ B37[`pNV*jkV`HV$+ `\``\pWLNW\NW`Np\ \2Wۅ  >`V7*pG(p\ p`$p`p`(p$p$p@ V(`$` PI:`@`````^Lp\`@\k \c$`\``$(@$$, V,(`@  %$(@$$, VpLF$(0$00W\(0`@]m T?Q?? LD, 0qR0C0s0\0@0qR0C0s0\0/O-,Pl0AOE@DS8@$M@AO<00x00@@D@^00S| Pt0`"!!^!@p4 0TT* RR 0 P^ ^ ^YY  0PU<PU=PU>PU?PU@PUAP0UAPR@oPP 0C  0001&=  &6`Rt0l 0C `t0l u\0S8 B0 l0\0V00S8#  #800#"0  B 0 0 0 0 0 S0 S00ӈ R01q 00  R000 0$0%*W6: &R \ R80l0 C 0 B  0<L0DC0C Zt0S*l0\06x\0l S 8 B0 l0\000S10e\ R80l0 C  A-`pPTq@PB Q00V0SI0S: (0sT Q 1@0@!A00000 |0 `bp( 0S*t l00\ R$6S S L D0 BC 060@D0 0!1 0Rppp@-@2PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0($03/0qVP0pPO- M8\04< `08^1S00PP 0 0pS{ $0Ss wpVjV`F0HSs0FSRo WmZkFoY㫲[dV @!( `4/@Pi * @ !2) X  P "L  BT  A0`, `4 ( P6/ `,8(6/ `L@(6/jD 0(3/68 R! ( @ R% D PR! 00C60p删$0 ЍO{v `fp00$0`(0 } Ѝ8 80  000&Ī-M 0 BЍA-PCUo 0`0@ 0S@  00 0h!(3/@PR P!@ 0 ,(P3/ 0 ,8(3/ 0 L@(3/z 0D (3/080P. @ R+ D SR% , 8 , @@ L DD &!0 0C006& 0&;> 0$0;/ O-Q$M R0ß ! 0 R0#s0!03o0P@pHß  @$ *  #)z0 (ay0qx0t0@Ar01 P!:RuPQ`&9RuPQp'8RuPQP+P5R>"r uP!@$0# "@QP @@0 #400k.06S0k. ς 1O- p:PTU$0!`Q U @0ς!\KU` ẠZ 1 @1:  V:0Q=0^  pQ Q Z @ O-pp5 DMP[Q @!M080I j\PĖ PĆ0\@ CSP$ R(㨆 pPp 0Q= q[P$尐6H0C6RƆp 0€00@ jX0@PQ- 0ඟ0 pJ`{P09 `;ST`+0HAX{T4T+ pQ}Qp0Wq 20|~6{`0,Z`;p HT$@P;0>0 0 0p70S01Y0嵏  0100W0Y0[ B   װ 0Z.061#60S\+ ೎LY LQ LG⋰@ 0p@Q0C Y> 00A@N0 \0000C01 LQ @00^ 0 P 00Q0 0S@\ R @02^02N00 R0@\DЍW@  xP 01LY 1R 6 G2#6pP^p N0j 0=C-@TppR!ಐ0N+m^\dT( Y!. Q =^0p R. \HANpR 5 ^0@ Tp5  \ ʰ Q ^0 Q ^0 Rp^0@Q^0p ^0@ Tp@@  @O-M\PPRf!   `0  +M @Nk@^ᶰZ἖p S 1>@0ny SwpFP0N`ppP`p%TPVPeTEtp漖0@P0dy Swp @0`pp0`p#406@D@0cUSupNT~F0PDt@`@`@@0P#4``0F0d^~p@D[pF5 [0@Q p[ ` Q^kp徠἖0pj9Ys0pJ 0 00#4 0编0iQq0 `V0἖pW 0@S p`W0@T P`㶰[ Y0ʀ p ^C @0@Pc UYuP@ 0PpP0CPpP%TPV0PeTEt@ S6`F3@Ps0kp0p0@0P#4pp06[@cVd 0C`6A0@Qe pW `r 0@P9pd Ws0 @p0@D0p0#406@0cUSu0 TFP `FPDt@k>p@p@@P.pp[@nVd N` 0@Q# p[20@S P`㶰gtwp@ p@ 0T0 `W2 @p0@SЍ༖N~C[0k@6 N~4[@k0F| P`㶰00@S P`㶰%0@S P`㶰0T 0 i p@` 0 `aO-ʀ6MS 3003`003k^0 0300300! A@b9 Ts0@p000@p#406 B 0c^&6S0@ 编0$` pḀn9 Zs0 0N 00#4 060cXx0qX tq@DphWt@>s0挥pH000p#4060cTCt0 BR@@@CAԕBԅqಀAph>Ys0H000#4060cWsw0 p0@sW `D Br @g>Ts0=@000@#406pGp0cR#6 SvekN&0Pn2Rs0 P`0`00 @#4PP0&N0bQq0 k0&Ѝ 0&;p0v7  00@-(  ;0,8+J &̀+k. $ˀ0G. 0S0 0xS0 0LSZ=I, ( &&A-@ k΀`P s0! Qr p p "$  aS2s Ak> u 0  u0#Ġ  <##4U0 0 000*60@-S S00k@@6 0C60k>@PP@@!PPƂ0*0@-k6 Sq00@PP0#4@@06c\| 0Ck΂ S600@PP0@@@#406 0CS6 S00k@@6 0C60k>@PP@@!PPƂ0O-0 QR@ MJ, R 0Kp&]EP+(+;0N  q/ ! R7@P j   Q& R \3 "[k. Z0-q:s00 00 "$ 缦0jQ3s0 J+ ZB(弦| qk>0#40缦0j\3s0 J Z㼦yzk>0#40缦0j J\3 Zs0漦@|qk>0#40缦0j\3s JXM⼦k> / ! Zq ! 缦jR!r J^ἦ b _ J  \ P+R +R ,RE R  Q ,Q3 "[Q6k S op3 s0000 #406 cPp 0Ck N.V6 0G. 0S0 0xS0   0LSZ=00IX  && Ѝ R3 "&][Pj 0 ЍO y: Zs0漦)@q:s::s0 r :s0q#r 0{d:Ɠ0@-PV Ɠ!DPV @Ɠ@QF !6@o0ƓAƃDQ  !I.Ì!ܕ"܅&   p0S A-P p@0 C`^0@DTUT @Z&P %/@- MP`p)@P @I   Dp P . @P  Ѝ臿 0@0 Ѝ耿0@0{0@.T  Ѝp@-P)@P @@pe 00p@-@{)0P 0000T 00Qp@-MP`g)@P @ @0 0@Dp .@Ѝp60@.T /@Ѝp0p@-S P@0 C`0@CT 0 p%0P@p$aray0p@-S P@0 C`0@CT 0 p%0P@p$dict0S p@-`@0 CPv0@CT @̾pp/0S p@-P@0 C`[0@CT ]%,0P@嬾p$p/aray0S p@-P@0 C`80@sCT :%,0P@剾p{$p/dict0@- M@ |Cp  P Ѝ0p Ѝ0l0 0 Ѝ00@- M@ bCp  < P Ѝ0V Ѝ0R0 0 Ѝ0aray0@- M@ GCp  < uP Ѝ0; Ѝ070 0 Ѝ0dict- M Ѝ- M} Ѝdictp@-@P$0PPpdictp@-@P$$0P p00pboolp@-P`@P  +0@#p@-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@$ @-@@: @-@@P @-@@i @-@@z @-@@ @-@{@ @-@u@ @-@o@ @-@i@ @-@c@ @-@]@ @-@W@ @-@Q@ p@-P`u @P  0@a#pp@-P`c @P  0@O#pp@-P`Q @P  }0@=#pp@-P`? @P  k0@+#pp@-P0`P+ @P  W0@#pp@-P` @P  E0@#pp@-P` @P  30@"pp@-P` @P  !0@"pp@-P` @P  0@"pp@-P0`P @P  0@"pp@-P` @P  0@"pp@-P` @P  0@"pp@-P` @P  0@"pp@-P` @P  0@s"pp@-P0`P @P  0@_"pp@-P`y @P  0@M"pp@-P`g @P  {0@;"pp@-P`U @P  i0@)"pp@-P`C @P  W0@"pp@-P0`P/ @P  C0@"pp@-P@"(0P p"0P 0pstngp@-P`@P   0@!pp@-P`@P  0@!pp@-`P@}"<P pP U pdatap@-P`@P  0@!pp@-P`@P  0@!pA-Pk@B"X0P p(`P  P `*stngp@-PM@$"(0P p0P 0pstngp@-P`@P  0@R!pp@-P`@P  0@A!p@-@R w0@7!p@-@ P!$0P p00pboolp@-P`@P   0@!pp@-P@P V 0@!p@-@@ @-@@ @-@@ @-@@ @-@@ @-@@& @-@@? @-@@U @-@@k @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@~@ @-@x@ @-@r@ @-@l@ @-@f@ p@-P`@P  0@| pp@-P@P 0@m pp@-P`o@P  `0@[ pp@-P_@P 0@L pp@-P`N@P  ?0@: pp@-P>@P {0@+ pp@-P`-@P  0@ pp@-P@P Z0@ pp@-P0`P @P  0@pp@-P0P@P 40@pp@-P`@P  0@pp@-P@P 0@pp@-P`@P  0@pp@-P@P 0@pp@-P`@P  0@pp@-P@P 0@pp@-P`@P  t0@opp@-Ps@P 0@`pp@-P0`P`@P  Q0@Lpp@-P0PM@P 0@:pp@-P`T@P  -0@(pp@-PD@P i0@pp@-P`3@P   0@pp@-P#@P H0@pp@-P`@P  0@pp@-P@P '0@pp@-P`@P  0@pp@-P@P 0@pp@-P0`P@P  0@pp@-P0P@P 0@pp@-P`@P  0@~pp@-P@P 0@opp@-P`@P  b0@]pp@-Py@P 0@Npp@-P`h@P  A0@<pp@-PX@P }0@-pp@-P`G@P   0@pp@-P7@P \0@ pp@-P0`P$@P  0@pp@-P0P@P 60@pp@-P@(0P p0P 0pstngp@-P`@P  0@pp@-P@P 0@pp@-P`u@P  0@pp@-Pe@P 0@pp@-`Pe@B<P pP U pdatap@-P`h@P  o0@jpp@-P`w@P  ]0@Xpp@-PE@P 0@Hpp@-PV@P 0@8pA-P @X0P LpE$`P  cP `&stngp@-P@(0P p90P 0pstngp@-P`@P  0@pp@-P@P 80@pp@-P`@P  0@pp@-P@P 0@p@-@Q 0@@-@R 0@p@-@0 P &&p@PPA"0S <"pW5"0^@-$@@"U^DpP 0R @-P Q o// Q QP ᕱ0 t@-0 / @-P Q @耱@ @0@ f0 ( (0( g0  x T 0S p@-\@`@@ PPp/P p@) aA-P`p" '#@P  `P pp!!P` !U @[%!R%O%B h\p@-P @`PpP p@@- "@P $ 0 0 0 TA-pP "@P"  0 0 0 [P"`P  ᨴ` P0 000 ,0< f@ t /@-@P 8@ g 0 0X K <  }-A-M `V $P0 P>@P{"pP  0P> =ЍAЍ/ЍAЍ/ 0 0t  p P U @-@P @  0 0X    P}p@-@P x0 0 0R0 P0"0P Q G# p@pp Lp@-@P `0 0 0R P"0P Q %# p@p, KP/0 0 0R /P/<0 0 0R0/P/// K0P @-od  QP  QQ "/( JP/ 0 0 0R/@-@P \0 0 0R  !0P Q "00t IP/00 0 0RP/// IA-PPM /o00 0"P R Ѝ R0 p 0 p^!`P 0 S  R H  = pP` #  00 L H HA-@PM 0 0 0R ЍQP 0  0p#!`P 0S d P = pP` d#000( (0( $0 ⾱ p G   T; P -/o<0"0 0^ R  R/P/D0 0 0R /@-P o` FP/D0 0 0R /@-P ׮o FP /ol00 0"\ R RP Q  Q౮ / F FfP 40 0 0RP / EfA-(0`SM.P@U Ѝ P0&P h pP 00  0P* S'P0S0"Q00 I @P X 0 0 0 @Ѝ(  P "P 00#  R0SSQ///@-s@ h5OOp@-0(MS-"@R{S#  P{ \<` `P P (Ѝp(ЍpL P { @<0  (0( (0 <4 x$@-@_ "N@-(@@$\NA-Pa`O@P g(pP  U6@P N!ဪW@, ,0, (0 3NH@ 0M2P S0 P \0/S 0 P */\03#//0P S0 P \0/S 0 P */\03#//0@- P@M @ aЍ00@- P@M @ UЍ00@- P@M  @ GЍ00@- P@M  @ 9Ѝ0@-@P ,0 0 0R| /P/0 0 0R /2S!Q  P*0  S */@/0 SR* R0:/ /|4P $0 0 0R //{xP $0 0 0R //{@P $0 0 0R //{P $0 0 0R //zP/\0 0 0R /2 S00 P0* /R0:zP/\0 0 0R /2 S0 0P0* / R0:z(P/h0 0 0R /2S! R0// 0R0* /yP/h0 0 0R /2S! R0// 0R0* /y<P/H0 0 0R /"0R 0 /SxP/h0 0 0R /2S! R0// 0R0* /xdP/\0 0 0R /2 S00 P0* /R0:wP/\0 0 0R /2 S0 0P0* / R0:wxP/h0 0 0R /2S! R0// 0R0* /wP/H0 0 0R /"0R 0 /SvP/80 0 0R / 0 R0* /v0P/80 0 0R / 0R0* /uP/80 0 0R / 0S00/uP/80 0 0R / 0S00/uLP/T0 0 0R /2S0 S0 /! /uP/80 0 0R / 0S00/tP/80 0 0R / 0 R0* /tLP/80 0 0R / 0R0* /tP/80 0 0R / 0S00/sP/T0 0 0R /2S0 S0 /! /sh P -/o<0"0 0^ R  Rw/rP/P \ /QQP/ZrP/P \ /QQP/Zr@P/P \ /PQRQ\/qP/P \ /PQRQ\/qx0C-M`000 00Sp pP Ѝ(@YP+ A' 0Q xRH ͮ QQq%*0 00 0S  P Ѝ誮 0Qq:0"Sꙮ0"S D pq  0 00 S  }0"SO-MM(@PD1 p000$0`0$ 0 0[ Q` $ 0`;/0 `P Mߍ ׊P 03/P 00  $ 0:/P 000 PMߍ0p@-P2s0AL7@LP@a`Lt0 0LWLV p@|0 T0s0^0ppO-3KM `0 0@R @@@$@@@(@0 0Cs0S50fSQ ="SE [Sl2 0 @3/P 0p0  0̠<P p0S !S$0-S-P00S00PP -P 0-P P 0>P 000/SR `,`0 S S0p p S :S 0 S S0GU0 RAP0/S7 0(00>S: SA 0S p03  0Bs0SR 0 S S6 S4 /S 0 S S,/S >S S`FVx0Su `Vp0(00>Spj 0  $ 00 0 $ S =SB0"SP0SM   0"R "R R@C$ >R;0T ʌ`G-MX@`pI P dV W$ P[ <PT &P@ aR lR gR' qR uR oR  tR ;R"@ tRT Ѝ mR8 pR oR sR ;R'@ tR ;R>@P P"Po \P@ V   WP UP PS00S@Ѝ pR ;R@ uR [R<\ BR   ;R<@{  @!1 0 _"R /R 0jP 0 +r  R:Y  Yy*     SP00 Rf \Rc  uR_ <P Y +r PU6I0 r    0 # <  P,!*-"-  ƠP  * --  (  " "0   Ǽ DŽPO-`Ÿ M @ 0Ds0S<_SS @S  0>S 0 T  @P (0SP  R @ ЍT T$ @PV` kP @P ` `Pf0S  0S\`l0 pDG--PM_`f@PL ,-pC E/pF 0F fppSp>0@ P P-u&  0  `p .~Ѝ00 `0p``.i`Ѝ -`` Ao/A-PP P`p @@PD@@@P p40,p0P4080<0\\+X@-5@ Q +,@-(@@8 p+ \`Ϥ̤@-@@O-4@T p`, ⹤P @@D¤@`T P礀Qㅑ@0@ @@0 FPZ PZ Pڰ L @-R 0P< P 4Q ,  D D0D )0 , ,0, (0 [4 8 pdp@-@M4 00R1SP,0SFR 1`V. P` 0 0?P 40, 0C40P& `ЍpS( RmiЍpЍp 0 Z0D ¦p p0p l0D ⹦\ \0\ c0D ⰦD D0D @0D ⧦ H\ظ $ؔy ٸp LiA-P`,p@P W 0 !ῧ,@0`,@0`C-`0@SPpMD  P00Ѝ!0 rP ,0ST |!0 hP ,0S(0S00  0FP 0S>0S0"S:0:S 10}S "S000"S 8P  2P @` 0 @`P , ,0, (0\     (՘0p@-S `  Q P@/0@)p 0  0 ԥV 40S 40 00$ $0$ @-0 ⾥U <Ԩ 4 @-R 0, B4 P @ @ @0@ <0 ⣥, ,0, (0 ⚥ < `O-80M@ Ѝ@p` PP @ ` @ЍĒ  2bPP0 z *004QY r 4 ,R\ 牱Q1v  ᩢ P 0YIV  B B!V,0 P 04 `<0 04 <0  P,UM<U7U+kY& 唡 @0 |P  PP( & 0,S<SS= eP# @ <0P0`<04 y<5 !,0P 6YP |,!x x0x t0F/Фd d0d W0,ǤL L0L 0 ⾤`"R!x 2 \Ҥ 8@Шp@-@PP0S L  Q <0 0 p@ 0  0K/⑤Q (p@-@P 0`0VPP l l0 0  0@S0<  pPp( (0( $0K/cP$, p<O-0@SP MR z`40SM x `4P@ ЍP pP 00S 0q 2 00PX 0S. @0R* P# [` P 0\P 0S P'\ X GD` ЍOiP 0  03/P  40R 1#PP 0 0U/ϣ& 00C 0P `@zh h0h d0U/ⶣT T0T 0]/⭣O PO(N\ |dM l̈ `dd@-@0,S<SS$ 0  0 ⁣l DL˴PG-V Pp0`WSW@6 404 S @  S3 F000,0 100,0$ 100,0, P  ?o @ 2\0S0S P@P : } {404 SS@ o @D D0D @0c/0 000 ,0c/K ( ! x,7G-PS @- Y`' T 1p 0R    004 00R% OP  0S 0 GVkd d0d `0i/ɢ0,S0 000 ,0F/⸢JP d01 4Ȑ G-PP' 0 0R"4pP 40S @,0aᄡ1 ,0`儡40@T:8 408 pI 0P 0  Q@-P80080/HTp@-@P80080p@p@-@P 80 0R@ pP4@pGp@-@P \0 0R@ pP`00S@#:p@Gp@-@Pt@opA-PP 0 0R4p`_40S @40S ,0} P@N* `GFA-@P 0`0VpP80S ~P @T @ @0@ 0]/١@@FD A-PP /o0`0"Q@@T @0R p K@P @T @ 0  0]/⟡E (,0P \@- ^ 400\@/ 0  0F/‡D @Tð 0P o@-x@ T\ @\400\@/ 0  0F/WDD ð  @-PP M @1 0R Ѝ`@80  Ѝ@ P 4 0R S!*,\&0 B!p@;400C40<00<0B @ h h0h d0s/T T0T P0s/@ @0@ <0s/C xlu T8v 0(w P/?o0 2 R0S/0@ S/B0P -?o82 ^0S 0 S /AP/0 0@0R/A|P/0 0@0R/AP P -/o<0"0@0^ R  R /Ad A-`P @PpP (0Sp0P  pA`@X `E@@-@0P |zP 0R R@-P 0S/~o/@ @0@ 0\ ⽟( (0( 0\ ⴟ <xL |(G-@` QP p 20 Q0 衟  ᴑPY @N Y5V W%*000p@ Q<Q =Q R YB Y<R O RS R0 <R R 0BY 0UpS 0Y V W*V0 X " pV0 X ! p<R@ 0B RS R <R R=R  A-`Pa@P h)0 U0 0 PpP  :p P'@;@p@-`QV  RPP`6@P 0`0 Pp:PQp@-PP @`PP   `@P $0P0 `Pp:p@-`QV  RPP` @P 0`0 Pp9@-@P X0 00R 00S P0009pP/0 00R /9P/0 00R/80P @-o\  QP  \Q\ ᒟ/8Pp@- 0 00R@U T  `P  x@pT P P0P L0p 5@p0 000 ,0p )8, , P/0 00R/7P P -/o<0"00^ R  RT/7P/@-H@T ?o 2^0S|o60S A-(`@VM PP !0 P $0S6Ѝ/ 0P ` pP   0P6 0S3$ P, V8  @P0 0p0 `@ɟ `  p` 0$ 0R0"S 0 |0 |Ѝ訟0"S@ @Pp !,5d 8H/P/?o8  2\0S /0SP/4pp@-4P4@P@U0 0Pp4(H0S   033@-@<< T (@@5@@ @ld@-@P (0 0R"3HP/0 0R/3 P/0 0R/20P -?o82 ^0S 0 S//20S /(0p@-S@ `P`0 P0 P lle `@@ @@pDDD@W @0000 ⤜ A-PP  P`p @ @P#@@ @P p<``` 0,p0P4080<01X@-@ @  @-R 0P< P 4Q ,  <0< <<0 I,0, ,,0 A0  Q4 VPG-? Pp0`W<W@ 404 S P l j S /000P,0 10,0$ 10P : O M 404 SSP A P@ @0@ 0( ( (0( 0(  p p@-@M#S,RP, R8S 1CaV) P` 0 0P 400C40`ЍpR SI  E ЍpЍpd d0d k0< ➛L L0L |0< ╛4 404 l0< ⌛ x \8T 80A-P`,p @P W 0 !ᩜ,@0` ,@0`p@-00P4Q8 @Q r4 <0,04Q<0pPp 0 0P A lo@-P MU2 0`Sp@#  LPR00 Ѝ 0 2P ,0S @t 0 @iP  Ѝ0]S$ $0$ 0` 4 Rp@-@P 0`0VM PP l l0 0 0@S0<  pPp( (0( $0 ͚+@ <4w0G-S@PK Tp 40SF   P@P P 00S 0>bP7 0 03/P0  40R 1#eP' `P 00C 0EP  @ꀐ pG \ \0\ 0 `8 808 0 T*()4p)  XP40S 0C40/ 0  @-0 : 0p@-S `  Q P@t0@np 0  0 ( ldip@-@P 0`0VPQ0S R <0 0 p@DD D0D @0 0 000 ,0 ' | XwG-S )X@ `V 0P 0R 00p W` V 0S  Gs@ @0@ <0F/⨙0,S& A-PP 0 0R4pP 40S @,0a, 40a@T:8 408 p%@-P80080p@-@P 80 0R@ pP0@p$p@-@P 80 0R@ pP4@p$p@-@P \0 0R@ pP`|00S@#:vp@$@p@-@Pi&@dpp@-@P]80080p@Vp@-@PQ8@@@Lpp@-@P 0 0RP`>40S ,0AT 5p@p@ 0  0O/ۘ#< tPlaA-@P 0P 0R@ p`8040S ,0X <0, 0Q<0@@?@D D0D @0S/❘0 000 ,0S/┘" |t XPp@-@P H0 0R@ pP`@p!hA-PP1 0R@`4P%80,0!qW% P P ,0P < 0@ 40< AiAD D0D 0W/5, ,0, (0W/,!   0P -?o82 ^0S 0 Sd/p@-`P pP@fP (0S p@  ( &  0 //@-`UP0 p0 ڗ O-IMP # @T p `0 R 2/0KU\ P Y  9/0  pDPV @T!1 0 ⥗003/Y@ 9/T  UT T @T@" 000Q 1/0 U' P70S+ 03/P. Y 9/T@T 0 0( c 0 0 ZIߍ 0 0( O 0 0( FY 9/Z 0 03/X X0X 0( 3 0 (    D8P0/O-@MM(p fT 000 0\0+`P$  T%0 `P4 0@ 4/@P`P@003/0 `nPMߍT00 0%P 0 $ \00 Mߍ0 000 ,0H ⵖ R00 L@# 0/0/@-@@7A-pP`PM1 @T. t0@0W   WT 0 /R C 0CW /RW  W0 0 B/Q d!0C@T@! ᡗ0@ 0.< 0A  R0* 0 0hp@  U |0PQ@tPۍo?00@ۍ S0p tPrH>p p R0P@D p@-R 0@S PR :   Pp0P  , 0`0` `90 L0L L:0 808 8;0 p ~ ~ ~p@-@Q PPpQpA-0MSz@`PA7 Q <Q& >Q &Q a`Q PЍP QЍ|a&`Q ~PPa&`Q rPPU q/UpU"0E'S0 rP\\P WP PU /U\U fPnPtPbPUx 0  ! QQ 3P0 000 0 ?P | |$ 0S p@-P@ P@p 0Sp/p@-@QP Q PpQp@ 0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Qp@> 0 0@ ̔ z8X8#0p@-S+@PPU Q PpQp<Pp/P PQ P Qp@> 0 Q0` ⏔ yDdD0p@-SG@`PU Q Q aP<\Pp PU Q PP QPU Q CP QpPQ 6P Q/.P p@>( 0 0| 7 wcA-PP` Qpp0` XpWVj@PR  fPK <V`p p0 8/PP`<``Q P P 0S (P P 0SPP P P P 0 gP wLp@-P@PP  P0@O@p zy011/A-\@`pP \1S 0 €  P 1P1 `p P 0808 8A0 |$0$ $B0 t v  v@-@^ P ^%QRS  T00NQRS"  TŒ 00 0 Z0 4 u G-@R0(M0QP P 0 ` p Pl `0T?o20S00(Ѝp`0 0 2/ / /    \ /0 2/ / /    \ /0     Q /0     P /p@-@PP`(M/ 0S, R00$P (Ѝp0-S0 0 0 0 0 0 0 0 0 0 0X P0V00(Ѝp@ R 0S V000Q000 00/@-@;p00T000,@-@T @-@T000 000S/@-D4t000 000S/@-4t000 000S/@-$t000 000S/@-tt000 000S/@-4t000 000S/@-t000 000S/@-t000 000S/@-ԓtt000 000S/@-ē4t000 000S/@-㴓t @- @?^ʎ0 !00@S  \pt ? ? lR! 0^ < 0  0^ \#|D 0 01/001/0 01 /Ҹ0S@-@1/00/p@-P0P0 0@0PS` Ppip>@t/j000 000S-/@-,-t@-000 000S/@-tAo//0@-p@P M 4 P, Ѝ0 0 ;0 tvt lx@-p@M L P pЍ(0( (;0 @tw k,0@-pP@ M T T T  0 Ѝ04 @ Ѝ0 0 :0 ؐt\ kp@-@ @ $ 0 80  t^ j|p@-@PP (P$Pp0 70 ୐$ j|Lp@-@PP (Pp0 70  j<(p@-@PP $Pp0 70  j@-@P  Y.<+ < 00 ;0 i i@-@P ( 0 70 X( i`@-@P $ 0 70 F$ i(xR/-ptx` P RgJP5T   RDJP\ P?e0 ?o)0⃑ iPI> 08P?e0 ?oP 0CP(5H RJ@= IP?e0 ?o5H0 SP RJ@. 0SYR03<PR 03<@@PP!R  @0!32P@@@2 R@ᑐ P//-ptx` PP5? PP?e0 ?o%0⃑ iPI 0 08P?e0 ?oP 0C5H@IP?e0 ?o5H0 SP@ 0S0Y 03<P\#4@@PP/8@-@P(80 0 @  0""048# /UUUU3333   p@-PQ@t : Sj E Sd0 a Sp0  S?0c0 r-w-!- R00K <Rx  -   r-w-T  Q5 $Qx-$1r-@w- T" T T-x:0p Ss0  Sw0 S?0l0Q s! R0s  tTSS   S?0b0A0a0-0$0$ $90 ݎd cO-8AP@:  ÆpPA PA  pP% 00ņ` 0@T' ӋP0=S AP` AT BX ! XLJᡆD0D D>0  ꍐ00  bdC-@``"`2`M 0P$@P@Lg p`XP `@\@h@d@l@XLpk p Ep` o{{o{ P  {p[ p0 0S04@R08@<@@00000 -0E-G-0.-DL1L0 00@0001R,X  ##0S op@   | ЍoЍ @0 0 ޏ ؏ ԏ  @~O-PMp 0GW"S00`0v@ᔈP-TPg +T@`0@ ǯ 0 %t 0t P p   @00Ds \a0DSW0DA0DS"70DUr Y :P Q   S  R  "000T7 W. 0p0R00S 0qS 0F0 Ѝ0S R 0@0`Y00 R0  Ѝ p p᠀堐 XR A B0A PR @ 0`X0X X?0 +SW ppqW { \{00 0M0Ѝ2/O-PMp 0GW"S00`0v@ćP-TPg +T@`0@ ǯ 0 Us 0Ns P p   @00Ds \a0DSW0DA0DS"70DUr Y :P Q   S  R  "000T7 W. 0p0R00S 0qS 0F0 Ѝ0S R 0@0`ꉎ00 R0  Ѝ p p᠀堐 XR A B0A PR @ 0`X0X X?0 [SW ppqW xX Yx`00 0M0Ѝ2/O-MD@؃ [0`P@HpV:V^ U0DPW p T"S 000@0`Ѝ0000 0L0z@0S 00000S0S Q .:[ 0:0SV00ЍW00 Q0!:[00:S0S @ d0d dK0 ҋVH0H HM0 ȋ"00@ "00v Wvv Wxv\-M{,0,0 0{ {000{0mЍ<hO-S$MpPP@HL T P0S X0S `30 000@ 000@0 0 P`0"SW T 0"bC P 4$;RPE`  P0*S xS S& "0 @P`$ЍX0 00T0 0P000P00S5#0QPP`V 0bZ0i0P 0$Ѝ5%&;RP#"00 !0 p!0 ?/&1RP:*&6RP0$SPP  `01!&?RP0 0 TH0 0 ڊP0S@0 0 ϊ7 0`PT  Gn` 0`PT  =d V(uLt@ts Tss$ Srs Srs s@- M|d"{@{ @0S D <0 0 |0 30Ѝ C4]-M{(,{ Ѝ 0 0 9/ANm00/G-@SP, pE`J4Q# 4Q JNQXP0 S0C0 PY 00 0 &p Q(pO- J4MQ@p0T Ri 0S 0) 09 P0S009`0S ) )嘩嘙  @ (PS0+0CO `I @p  q 0 0  0C 0B0 0 S00QE0 0X0-SQZP0-S`0!00 0 4Ѝt8ttH0@q 0p D80  `4Ѝ(H@q 0( . 0 B0C0@藟 :Q` C 0+ B Rd{P06 WV :R 0S000l7@0| | -Q0000  (  ,0 7R'0 `=4{Pz 0A00Y  p @$P @` Pp@T   HP҄P2O x   Q Q 0@RTYpBpx 0 bY Q! 500S 0:S  0S5 00+ C :S:`D ?`4Ѝ0IS0 `S``X0S4ЍpBwdT` P 0 师W 0S 0 ⮈Td4PP`0 ᢈ0S |$|4|  0,400S 0:S @ l- 30 $4  0yc;R0S00X0300300S 0:S 30HW X30 0+ Cr0p 0S0- :R 0X0!  8#8 000S000200S 0:S 020CQ 0E L200S 0:S Y2(0 10S,000)100S 0:S (00C(00!S0 0 (00+ C1 00S1 0ׇ!1  0·-1 D0LJ 0 ‡X1X!0 000S 0:S ,HU000+ CN10H0 0,(@0(ptoX|$ LL@ Kk@kL_ K,jk Jjj J Jjxj<a J H I8 H Hlhg Gggg< GLgO-pQ ` V 20 R" P@T60弢 R01-[@P-T@PB T"pRPP !yP@ -@y0P  :R8 (20 0S" 000PP@:T0S! 000100S 0:S 1 0?@0S|1 0 0@`P 0:S  X 7 0100:R@ 0S 0 0dP00P0 0 0 R0 െVV0 S0 ૆MQ0 0  |P8td`dX`Lc$ DPcc D(cd@-@P @ 0 /0 tc CTc @-@P @(0( (/0 a@b C c @-@-\" \ \ R3s 1# 0P01 0 RL^%0 s 1# 00  0^'00H0H H0 404 40 T00b< Aba AaG-P @p0#03w0q0W`@DT@!   0R ! 0 mP   G0@ pQP@-pp M P@P `P% -{0 @p{0 PP  Ѝ譇00P Ѝ覇0`P垇`ꛇ0P`啇P|t0 0 X'-0   X'Tp@-@PP` /o"0p@ ZK0 40 \_\ ?_`@-@P 0@ EK 0  A0 F >__ p@-@PP /o"p@; ,K0 60 .^ >t^@-@PM 0 0;WPЍ0 00 ^ >^0 p@-@PP U z00QUPQzp z00QUPz00Q0 /0 ]| =\]1R ! /A-pR P@a@T T 1 !03/pWG /p@-@P%T 0p@/pA-`Qp@P RP0开D00p 00$`,@(P0R 0 A-P`p@PB 0U0" V W- p`Pp`PWP, 0 0 00㼀@$P,`(pD 0W pPpPV W lpl`p``PPX``P`PP`PN00x`|Tp@-@PPM& U 0`1S ,0S -$0S & pЍp@0@ @<0 (0( (;0 Z : ZZ 9Z@-@P 0S% y0 P @0P V0 000 01 1 00y404 4<0 Ӄԅ 0 Y8 9(Zp@-@PP% U 0`1S ,0S ⾄$0S ⷄWJpqp@0@ @90 ࠃ(0( (80 Y8 8dY`XH 8@Y<ЍP@0P@ 0ంY( @P@ PU P 0 0  2  E~ @Pt@P@h0h h0 P0 0,Hl| 4VVɀ}V^8V< 4 VV- M ЍA-xx1 0!M@P0<80P`I p4 81p4PP ! 1 0 <8 30:!ݍ0   0 PpȐPP@T Cn` 0P8TͅPJP @T@ᐐ卐404 440 ,،\W$ 2W,A-!1 0!M@P0<80`b QPP 14叅P?p4 d1p僅 P30P0 $ ( ,  0 0 pp]PP!@T Cn` 0P8TbP~P @T@0S  i p0 0 <8 30!ݍ`00 PH H0H D0 +P`[U 0UU O-ğFM MPQdč@`ᐴt嘤 T V [ ZX ( 0H0;d 0P0S  0HfPW 0 ]P(00DgP $PxPs$Wj ,Pj(,'gP *$W , b T#L3 0 d4 30Fލ Ѝ( 0P3#~P~Ps / lP @@W  E0Sv ST2" @0 8tt (X0T (P(( "2  0ীTC!1  0V:!1  0[1!1 _ 0'!0  z80$0Sd / P!P  0  e8(1(! @0 Y8 A  T* J4ӜSTSSSShSl -(SX -R ,R ,RQy ,|QQz ,PQQT{ ,$QQ(RHHpQQ +PP +,P +P *P@-LL1 0M`P000@P=  ḀT p T0U0P @@P@ 0 0 0 30&Ѝ߁/000U00000P0ݡ0́0@hȁ@0 000 0( )Ϙ (O,M @-@P @  0  ~0<  (NMO-((ǟ GM MtčĝĝP ! $ $0S 0Se 0Sn 0SU PICP@80X D,0( p= `ph6P000p Op@!  PgR00S" N0@=S`T`V`W`V Ee`Pp;0#S: PU (@000C00'0 @p0 00 <5ĂP%@( p0 Pp0 00 4専P 4   $k $k 0S000C00  0pP40 0pP$h`0 S z 4xz0X0H@45PP€0H0 BPڶ5 ,0pC Q0PJU 0Pq0Se Sc PLz PEz P>z   P4 R1("2 0 t4 30Gލ Ѝ0@q"0  (@t  040040 S  P 0pW 0 ( 0   4`ށPs Po P!1 H 0~x!x1x 0H ~0ST!T1T H 0~8!818 0H }$0St!1 H 0}j0S GA$090pz0'͜M@LLL4LLL4n\JXyXI "xHG| "PGGT " GG$ !HDF !G$FHHL*HPHhC- Ÿ TM@PLЇP`pA VJ WS X\ !u0,P   x00000 $( 00 PLQ PQ,P[PNjP0 @ !0 0 L0 306TЍ 0 P 0O}V 0 P 0D}W 0 P 09}X 0 P 0.}@囋 X@6'dx HDDL DD DlC DPC<-M^ЍO-llŸ \M@PT`pတ儰删W V` Wi Yr "4P  x0j0 0$0(0,0000 00 pPc0Q Q,P\PiPP 0S 0 @2H!01 0 T0 30C\Ѝs0 )@ 0 i\ 0|V 0 j\ 0|W 0 k\ 0~|Y 0 l\ 0s|@ d@{&xaD|D|<D \AA` 0AA4 AA Ad@9-MCЍO-pMp qW 8 [A 0S) 0 0Go-0P nPg 1 S S   $@ $ S_  0s000 S SR S0 R R R R  RQ@  B RQS 0S1 @+S6 -SYQU @U0S 0S 0  0_o0`R0+S4 -SF xPPUpxO XPK7 Pp S 0QUP @UG0S 0Sg 0 0_o00+SR0Sa @SA0 PP P P0S @S0 PP`xPPU@ " 2 0 2 30zߍ P P0+S3 -S0S  P`P%w0+S$ -Sv0S 0+S& -S P gl0S P S!@0Se 0S  n 50S Pw00 0 0 d 0zx x0x td 0z[\ \0\ 1d 0z$x0$ =|: =4: =:O-@@ßM M`PȍP@yu T~ W 2U0&N 0AM.0; PY 0SV P +g+NgH 0  0  0X9PP @PrP3H0: SW 2"0 &P 7  !1 0 8 30lލЍP 0 @PP - 6100SPp1p!0 &`!`1` t 0@zT@!@1@ <t 05zWw$!$1$ t 0*zm6 $P \0S  S 0 0 &0 0 &H0 0 0 &0  @P$z<<E y;0Dd;0[x:  88 :t7 :87x:lw:<w:DA-@P`p0M5 V> W' 0 z   0^P @T@T 0 pPP /0Ѝ @)Px x0x t 0y` `0`  0yV@ @0@ < 0y;$ 85^ l85p @75D]- $MT00  4 (0 0 0 30$Ѝp#`-|| $MP00  4 (0 0 0 30$ЍJ#pG-p PP`  By0000 C Ra CRE@0@Y)00 C Ra CRA CRS:Y 00Cx QaCQWCP00Cq PUaCQWCQACQ7CMS00 D0C?o2R0SX ? R0T*@D T T-@A CRSb @ A BR0G?oD2Z0S\  Z?0X*Y 00As Pa0ASW0AA0AS70AQ P,1,!,0 x00Cq P 0 T:aCQW0CACQ70CS 0  }0x   DACQ7Cz|0| | C0sx D@`S| P[@0@ @`0 ax5 54 444 \4@4$ 3 G-t1@0P?  @RP>T !6*wTt t0t 0 3wUT T0T 0 (w)y 0  0\0 |K/ P0/O-0"02 0TMP0L00`w Vk 0  00 0 0 !8 zPPP @p100R0 p@P< 0+S+0S((P,00$00 0(P 0$T,$.,0S)^3 0 0 L0 30*TЍ0 9P ?UPB3x00h h0h Y0@ vL L0L X0@ v} /`6/X/HX IH-X --0O-!1 0pIM010rWW PPN @`p 0 `N@P; 0+S+0S(3P  0 ]P  0S2 0 0 1 30Iߍ P LsP2x00< <0< 0P v L4|-,-,0 G$+40/n0@- 0 0MPP000@' T  ǎ0MP ""  0S0 0p d0 0 0 30Ѝ0!@P000 040 uP * *@-!1 FM0 M@P0d40p/ ` 0PPd@",+ P w0@2w @Rh \0 0 d4 30Fލ Ѝ4 404 N0 qu< ))@-0 0dM@P0\00p` Pʍ TX P0 0 \0 30 dЍ0 000 h0( =uN ((x9w9@-<@<M@ b0 (Ѝj(P1Spp//0@- 0 0M@P000P' U  0 @  "" 0S0(0p d0 0 0 30Ѝ0)PP000 0F0 t 00', 'G- M砐 p@ e$UIPH0S T0Ep +6@P2  PUo0 ;u0 UB #@P  U0PUo0v0@,v@  n 0 0 4 30܍|v0PwvTP  0-lPcp x`|Ptnx0 - M Ѝ@-0 0dM@P0\00p` |   #X P0 0 \0 30 dЍ0 000 0 &t7L $$O-/? 0M@Q000C 0S7 P@@P 0\@?@ P ` pL@@& @TP@$@l&!gHSNzmv3he;#0T0 0g;)0隠l c{0P $h{cp0fa"a(f `hHekb.b(e P]@a[n&an( h4bf%bf! Lp `$ R0 00//a@-Mp @sf`P`W P0D>S 0!3100 0ZfЍ>SD 0!3100cf00_f00a/-p@-M4fP@U@0 ` ` Px0x 08 R;0Ѝp@Ѝ/0 a0( ( `+\\+8,*A-@PP`p; =U( X0ES  S0 +0E0VpP00Vp&2!0` 0`00+XPp -X =X00-0V0`0+00+0`0p@00000 0]0 c00 X  p@-PP@F 8a `0RuSpWS6X0CS0 p à 0R Q PSPQPQ  0    X0 0+S -Sp0( (0( b0 wc F@I `8O-0 xSpTM 0@@ 0`004080<0tr 0(0We @(T Pe@T%|7(P0p00000TG @ @D 0 a0GS00 0e00-e0@(e@PTЍ+W = W0 -S0000 0` X B R  = G/oS"!"   ( P:0,Pd , d R, ("@P0 @(偑  ( 0S# (p W:,Pdp , d0S,0"@(p剑pGPp(pW [0 0X I0 0p(ppW ,Wp`uS(`! Y0,Pd` , d Rm, "@(`0`FP`(`   i`(=W +0G?o 2R0S$ Y,P|d ` ,x td0SB,0(`""`FP` @(`傑V [0 0X I000 `(` 0 V:,PWd ` ,S Od0S,0(`""`FP` @(`傑0X0 00($ KR; I?I00 KR<I &d0 @$$0`0Sd0"SF  V*(@ T:,Pd @,  d0S(0,@0CP@(@T} L2-+ 00 ` 0TЍ'pC  001!]0 a1!]0 ak긱1Fsc00(0UpL 0{+l-L +B XR R  +B0 -R +R XR 0 -R  X@P`Qpt0t t]0 uax\ \0\ o0 ka]  H Zܼ ܘ ܜ , 0 d 0@-@PPM 0{ P@{3p`Ѝ0(0( (:0 0 ^A0P R@Д МO-P4MP@\pv WjX0S. `00 S 5 000 0?!S5 0 0 0;!WbW0^ Y\ X00Uh5Sd50 0 0 0 0@0` P(0`0p 5`0$0XY 0S40`hW ,A0 `YVWP@ ,(05#K 0P` X $ 2@0 <$*&  # #. B@T$0#"A $1?Ϡ "!,:#  0t`V4Ѝ3 00 0;!o3 0 0?!hl30$0H\.d0La#0L0|2pST0,@` P !8YQ 0`V ^ @P,x ^~[d"$:600%$0H"%>!!!0C0"0T(P%"1 #1O"QX00 0 " 0$0 0?S%D P P@`1T101! T$?01>! R01"_0`A(0 x10X00`d(00@t`dP(0 X  R11@$Q5 0A`X0 0A$0PE `0P 0  `3`3 0 9@ 0] 0 8@ 0]~`  zGGQ\(\)( \8SQX xʸʌ P,dO-PP@` Mo Tw V p0 8T:R P- Ÿ P2 1L PPq@pQ @T*RP P 1L P R 0Q_ SQ Ѝl P @@0 L0\? 0 \ @ p R@p\ p W R:\#Yp 0 0 u\T0 0 k\V0 0 a\vp,@ \?[*!]-H HHH  , p@-@PP U p@IX X0X 0 0\U8 808 40 %\p@I @4 HEG-P@U T^ Pp ppq W00"1gP: Pc 0Sb 0 R 0C ` PP0 XA V  0s0S0 0 Q 0  ! 00S3*_oRe`V5P( U  !{\ 0 0 [Tt t0t p0 [\ \0\ G 0[]00P XL ,p  A-1 M0M@P040`P$ QE U9  0s0S0 0@ $03/H!@1 0 4 30GۍЍMQq1p$p 0P[V U$ 0 G0 C[ 0 0$ 9[ 0 0$ /[0 x0([p p0p H0$ [/==  C XÀ dèXE <Ü0Dx <O-xxƟMM lMPč pTDe0d XA 0SJ VS 㰰\Uc0U@@ R R0 0C?o2 000RU$00 S0E0@u0S0000SfV H0+0G 0@ 03/[o 0@ 0000,00G(0 03/P    0S00* z 0.S  Z0S0 Wy:0S 0S  ,P80: S $ xP (0JQ/03 10J10 00@P~000$0 000S  0P*80: S&V 00S 0  00s0S0 P@T  0s0S0,\04/P/ 0,0" $2 MލЍ  0.S0Sm 0. S|i0S  0@ 0L  2/0S0?  000.SP _ P 0 @JP? @ m  2/0H(100+$0 00 `P0!1 |4 0Yp0[ R 0hF0@!@1@ 0, Y0S!1 , 0YV!1 , 0Y 0 , 0Y0~$ &QIz[0/(0 0 @  03/0t$F"F0ox;x;T*7 \P/  d  |O-ßKM MPčp`Pؔܤ; WD UM YV \] /\@ @ 0\/\0 V'"2 0 4 30KލЍRb/\;/00P/\V\- pd"d2d @ 0XWD"D2D @@ 0XU("(2( $@ 0XY " 2  @ 0X@Pp P<P 0   R  R 0T/S 0: S+ S 0 0 0 0 PX! +0s0S0 0@ (03/0S0: STi*/80 Rb0P夰0P H 0uX0G 0 oXoZ/8 0G43 TH (m n o XXSO-şM5$M 0`P000P 3 QE @0~S<   pH 0S/S;RR 0B0 4ZS 0H*0; MP4S 0 0CPR3 IR*0S0;R) 0X @H p S    န値倴*S1 s00@0S ?S! [S!^H QM00 S@000XS 0H , R @ 0< 0@Ⲑ 0R  R QR Რ@  P+Z@PU P#<3 0 0 30ۍ$Ѝ@\0 D SP 0]S2!^0m 0]S  s000-S]Q q0]S  0@< 0T20u  0BW 0R S0BW 0R S@d 0 Q{  001A0 hGY0 [0!^0  @E  p4x[N0P- H *; zP =0$10QqAp@P0 VU 0X V 0 0P V 0 0X V0 0V0\X V@1@/0?**-[-]\!  8|, X4O-`QM@pM R W T   DWI^ @P}\ @\ [\ {\PU PE0]\\ \8(/PPލЍ ]RRRF 0@Q`0,^* [^ ]RR6R` T: `{^0 }^S0CV  B0S00 8(N 0SV 0F0C  06W0 0 @ ]RR ]RR x| |0| xd 0VX WdX X0X Fd 0VX< <0< 8d 0UL X 4 thp@-@P`PM( V1 0  0 S 30{S 0\ {\ P 0 Ѝp0}S0S Ѝp@rd d0d 0p UVD D0D 0p UW 0 dX 8|,A-MMp@PP` ; 000000,  0 +R0 0S0 0 ލЍ \R@ @R@ )\ L 0 R ލЍ$ $0$ | 0NU@\ @p@-`P Pp@0T1@D 0CPP @T*000p 0  0 &U \0S$ -*S ?0Cs\S0 P0S Q 0S 0 0/ 0p@-0@ TpP"TC ^ (a`00 0DS'0 00@T7 "T- 0 P \T0"S0@T&0@00 CR S 00p@T "T P 0#00p P@.T \00p p@-$!$Q$1 P0 QMMR050  0 0 5 30.QލЍp , @ ` 0 Sp x @EO0 \ PD04 P 0`!!| L05C-0$eP`M 500S xE@ p#S".V0 P$ 0S %P @ 0SV0SЍt `p  0@S0 0 40  0Sx t倄倔p 0fS0fS 000#3R0 4$ 0000@SV 0oS 0oS0nS 000#3R0 # 000 PP 000#3R0 p# 000 PP 000#3R0 # 000 PP( 000#3R05 " 000 0#S 20@ R@@ZEP00Ѝ0 S S\ }PP 000#3R0 " 0@00q  gPP  `PP2 000#3R0) ! 0 00T 000#3R0 ! 000ElP Xt0@S0 @  &PP =QD 0P0 0 PP=Q 0 @00 D 0P0 0H d$`(8<|hT zpt(4 yp@-PP xOP e@PLPPP B00p( (0( I0 R xX@-,@@P"00dO-ȟ MȟpP P`@ UVYT~ 4 }HpJ0<, SW N U~ 0p00 2c110 0p 00S? A8$00 0p P3.T<000S[  RU` h'\7 0 0 30Ѝ `s?0l0` Ⰸpp 00 {PWpJ 0BqQ #S P BqQ #S Q BqQ #S V BqQ #S S BqQ #S R BqQ #S# I BqQ #S% H BqQ #S$ G BqQ #S< L BqQ #ST M BqQ #SJ N BqQ #S@ O BqQ #S9 D BqQ #S  E BqQ #S F BqQ #R 0S:U 0p0S7 Rj BC{P `0000  00  \$   <4000s00   $   3000s00S0 @  # 00   pW p[ pS000@S@W 0\ S000S S0 0RY 0  [ R000@R@00dmp00,(@ ((@(@00,0pX 6[  ߿Pk{0Sz[u+xQ$1!_0 PER00R   ppb pw0`00U0`0 0SCN Tqp Y*0p0^0 }R0SY00N pp0S00  pE`00C0$  p9pQpNpKc[> 4pDkp.pkAP0$P|@ qd(x0ˠ- M0 Ѝp@-`@`MQ P0ˠ 0P ЍpF3pP $P ЍpA-P`? A@0S' A@Q0+pPpPP U3M@@P  gp0 @BAQA Tp0 Kp0 ,0, ,<0 OlX<8 m(p@-p`pP`PC@T T0T0 R@@7pP00,8(  A-P@P`@p0S |@@,K R"@`vP@P00iQ0@|d@- 00 p@-`MPF@P 0SL0! V ! U@Ѝp ⻻0P  R 0QPG B&R  4(ཛྷ๜RS% S @  S& J S E S  A0  A6 A|p 0 dX A; ߐ| j4D p40O-00% BMM $ %u  %p 000 0000+ 08P 40 4<P P@\ P 0S p400#S \ P 0S 848d0``\ P 0S 4d0``\ P 0S 30   \ 0P 0S o30\ 0P 0S od30\3PE0 +;D3D0 0P`\ @P 0S IPP[[ FKP200xS| "l2 0 4 30BލЍR@P\ iPx 0S \200#SL \ ZP 0S $2$R0P\ LP_ 0S 100xS0xS0S) 10 0sS?0wS<0!S 71Q0P \ $0P 0S nd10\ 0P 0S n410(10P" 0 $:0xS0S {00  00 0000JP dt i4lܔ hTX h۬ۜtU fxڈH fe٨ ehp<,ذؠf p@-d@@0S P Hp@P@P 4P p״bp@-@P$ 0PP 4P PPGJP SPph`h`PLep4 404 0 LD( b$ bpXp@-@P$ 0PP 4P FPP JP Pph`h`PL+p4 404 0 L\@$a< ap0p@-\PP 4P p<`<`RP@p|\p`@-@@P0 00O-@$M@P  0 0S 0Su 9P0 p` 0 0V ?  800q0?Q [QR *Q0@3 p8000s0*S) .Z S /S //>PP$Ѝ[S8 \S 0S0@00?Sb S *S0@V0*SV0 ' *S0  0s0*S YP$Ѝ[QJZ /Zz 0 !S^S  V H  Ɵ  R 0@00  & p0]S1T -P ]X@00S /SD .SDB 0S| = 0U/S:v\Q:W 0@6/P Rj]Sl /S \Sq S\ -P @0XV@]P0^J q  0@P S ><@P0@00  $ P *  R%   U/R S /S @00 Q@0Q S @0 @Z0]S-P ]Jo0 RV 0 00@@wP 0-S P4VP]P@0t@ 4pP]P \P9 SX0_P 0-SZ PY0^ qf[Zd 0^ q  0@P ft2t"t0{ J0SIT2T"T|0 J@@VZPx St0P Qn0@zb 0-S P@00}`@S 0p0C00@P0V0   峠zZ0  0Pc/Z  "L    pP SP0h /0<90]SS /SW \S$D YLH Y @0P@-@ P *L 0 Q 4Q`?o2cp@-@lP7GP X1GP T00pT 00pK 0 pl\O-0Ÿ M =pc P   = ;10 230Zߍ ڸPT 0 p H  ̸P 7 R @; 0`  0P .P& PP 0 pP 0 P0@T*p@ J 0 pP zK - R   O-0Ÿ M pc P   嵺 ᳺ10 230Zߍ RPT 0 p H  DP 7 R @; 0`  0P ᦹP& PP 0 wpP 0 \P0@T*p@ J 0 ZpP J - R  O-0Ÿ M 'pc P   - +10 230Zߍ ʷPT 0 p H  㼷P 7 R @; 0`  0P P& PP 0 pP 0 P0@T*p@ {I 0 pP jJ - R  o lp@-X@0`P@ \P0S SMP 0p Op@-X@0`P@ P0S S3P 0p O|p@-X@0`P@ 8P0S SP 0p O0 00 -H- M 0 S 0  00\100M0 R0    R 8 00 0 0 30KH Ѝ/P-H- M 0 S 0  00\100M0 R0    R  8 00 0 0 30KH Ѝ/d -- M0 0N(--M  --M  A-pPPp` V" Q @Q PD@t0 0000AhL0L L0 JG404 40 AG00l Kvv Kv\0P R   0//O-`'`7 0LM@P0D00 @ P$7f/0Gǟ 0 A0 S 0* R 0 :R|RF@   0  0P Pl DPyX00X0AD: P ,& X00X0$` p<F$0 @(0p$0 00p 5$ 0,  p 5$ 04 E @;Pt ! d5 0 T tp$08% ,00 (E(@ 80dp840$4 0<Wp40 Lp40 Ap40 6pp40d +pL4$0P@  p(4$0T p4$0  3p0`0*S$ 0P3 3 3!002,6"!,̠:<#` 0448",#< B0p@a@P8 <0@( $ R  , p ,xBpE pE` ' R E\ @0s@qTP  A@=@9@5@1@p (   p$   p0@ 2 00R`BP#$#< \P00 1@p0@$0t@5T0A1@00!0 0 D0 30,LЍ `p h1"0   P E Ͷ$BPX00X0!1 h0 QE0b4,´u\uHNutk]ttTht0 $s;$sxsTTs,(srp0rxr`rP8r,r$rr ׼p`VEW|o Dhnp@-@P> 0S0 @0@0T9  T04 0R/Q T:\% 0 \/RT0C"0C/QT :0 BPU0P!T0l0p`@@PX E0<@@0/S (@@ @@???1A-M`Pi@(A0P@: !0C p0 00    0 b0C S&0 pF0 0#0@S` 0S 0SF0"S D6#Ѝ T1r0:|F00H$ AS @-@P1 0S* @@T. 0T)  /Q0C T !@# *0P@/S |0 B@T@!l0 0CE  T @@4@0@/Sp=(=.0{-DM  {000Ep 804S DЍp@-`P *p P@!p V U p@p`_UP tp` PMJVz-kP?o?o 0C-@c^?c^' ^./ "(0C0;: `pCc&Pc2681E270G2&0H000 /0 @- /0, 0-;BP @@ 7[D0 0/E0E0C004 0-;BP{$@G{6[D0{7P/ E0E0C0!/0Q Poo G-@a^?a^) ^?!1?1>(A14!50;:@pAa&`a43V4X4G0Y00000 /0 @- / k{0   ;B 0/AC0C0 [k{${@{7P/ AC0C0 J@ @-q@ Jw@ @-tq JA@ @->q J6@ @-3qPP `g@-D00p@-@PP  p@$R 0 10 BU4 9ft?0/R//R/?0S/R/P/R/p@-PMP`V Ʋ@T 00CЍp{ : { d*p@`($   800 R γF$,@-D00 0S@0 /"b0!s!!@ 00lRR0c0A1R 0< 0 B``C/  "bQ0"QI$\)P A-P0E \`dp0LPSa0@E: T@@ X@TS^!:O-p(PB`=@ 7P PXY  P A-1 0M0201 0@`0pS 00S \P#P3.000R`0@ t d0 0 2 30ߍPP @@ @v0(@$0 0 0XP(<Ѝ 0 P(000U00S SD 0$`Ph08P p`C P< P6P p W R0 0$`0P 0p`C P< P6P pW R0 (000@ 000@(X(P(PzW0  GS( y +St -S 00 00$P P䅐ಐ P:U X$P( 2c2c2,S \0c$00P 0(0w 50 ,P(^U0W0,0i0pPQ<0  P46P1 pF<P  *6PP% 0(P 0  R9,0X0!0 B 1X/0 00|; 0  0P(10 ,0 c0,@ 0PS,0(111v>C 0C,0   !/"b!!A0,0 X0 0000 0 : ,0 :,,0 v>C 0CXP0( 000 50 ,P(0PX%S(P 0 ,, ,0 0CP0(000Xp 0  0P S(B 0 00X0 009 0  0\P(X}XD9\0   0KP( =0 P( X 0P( 8 ,, ,0 0CXP0(o000{ 0 P(a000m 0, ~,0P#/A!b!b0C P0( I 0 Br0 SW0(0S0X0;7 0 0P(B c0 ,S 0PS(, 6 0t0?2c11!, 0 0 0000 X780   0P(X ;0 mP 0 0 S0 (0X(P3 0  P(((P000 c0 ,P(00000  R 0s @`0PPv0 P@ ` @a0Ka1c B  B0   0000 P!/#b!!"A @@şK/"8bP 3:,bQ # 3 P b4$  Q000000%0 2?3c112B x$xK?##p$cR3:d$cR#300T$0010 !00C0 00@ZP8 R0PR00J0PX$`p(P*0000PX$`p(P000,P 4!/#b!!0"A ((K/" bQ:3bS0#03   1 01 B00DRd , 04 00N(0~0 S!0r @PQO"  HPI 04 0N~ Q @(P0GPv 0(P00(PP @ ACLC|q \^JS S 00#3P0 z G/o"(PzW (PUSX ZSP  @ 0!P ( $0 0A010PE0,P ( $P( PT#/"b!C;R, a2ba12մ 4Q]Ql'[[lnI$Y4P\)\( * * * ( iTQ(tP ⎀Ḁ@CP(fMP P(P @j @0C2c2c2P$00( (0  @c 0 @]XP( 000 SlXP( 0000@>0S; 00@70S 0@0 㸁,0  0P P(00, 0C$0(~,B2000c^\0M0c$P   0P  P(00 , 0C$00(0W    0P ,  "P ( (0 b$ @00 0M0Ѝ!dA-1@0QPHP P MK Q$`10 P1#L@p P@@ (. R! v P` U Ѝ0 P0  P La@` Ui>T 0 Ѝd   0!V>00` " "*NPNMNfffgNM@-0M@ \0P 00Ѝ@-0M@k0P s00Ѝ@-HP@gp@-LL1 00Mp0,00`@P= U2    P00Q Q Q  0 0 ,0 30#0Ѝp  |= 0 \0\ \;0 ;D0D D:0 ;,t8,t,t> K4 Kp@-@PP U 0DPp P @pD0D D70 ;U(0( (80 ;KP KTKX K,G-pP`' X/ Y 67V @P0PES  R  Da#0PEV R  RS0@0D@ D0D DH0 ];X(0( (I0 S;Jt J|J JTR@- 0BAs @Q 0CR ;@O-阡PP p MU WC 3@PI A4PI  r3p`M 64101S Y74 Ѝ0<30P@#3P- 0 0P 20 0  ;= 0  ;l0l lD0 :2<00808 8C0 :30H H> HtRQ@-M @PЍTT <@Ѝ8Ѝ< 00O--M⨁ Mpō@P`pG x1PR %pJ @\CKX0 ^00pt0 OD00 T>6 q@Ѝ0,  (@P - P 0 0 5 30ݍ Ѝd0d dD0 C:D<00@?<00K. F|0   M Ѝz--M  {Ѝ Ѝ/ -- M0 0 ЍЍ/O-锒@P p`M X X00?/_-00P @ P U00 00 P! !  E1XPG  -VP WU V[XPVppPpW` C 0`f`0 ҨpP `PFPPP1 0 09W`!00!1 00v/ Ѝ0XP C0PP00 a/ Ѝ0 ~9`ᑨpPP V ከpP `P@0@ @?0 d9b\ \DPDp/| 0C$@-@ M!/(0S2 ,0 `0( `1/pwqP0)  0 0 PUR <0PU/ ЍPpTP 0S  0CP.;00pP.@-P M.(0S: p,0 "p0( p1/`vq@0/  0 0 @ToR <0@To.1`V ЍP`T@ 0S  0C@o:T00.:00.p@-PPE 4A0S5 @Tp1 Rp00P0  P 0S P0 0c0( 0P0 0 S,P 4P 8P p@T0T T0M |80Sp000 0K0 p8eE@ ?? h?p@-@$PPTp@T\X@- @@T@T$$p@-,PP U@ڥpS@-a@P`ME P 10p00S `  0 XR` ` 0@@S8  V8 CR 6!0A0 S0Q^*:ЍV   "Q @^ #R.S*@A a  00C0 F0 7 "^ #RN^^ N0 s0Q@L= P=Ȥ4  R  *4 8/ 0X\S 040:8 R РS /\iBx@-@`Pw9LpL0ppD尀 "T   3x@-P`@{90 >A-逆pP`@P( T0  r0 SSS0v S00 S 0050000005%0 97T5%0 /7|%0 0  00L50000  8 70Ls0 20-V00 ^V00;\ 40000 00B0!0000LS 0100C0 0?V`000 00000 \ \ 00y $40000  70Ls0 0 h", 3010P;\ cP3`b0001~dP0j R SXc\Q t30100 M \; =\H \7 00C00 LR0h0100C09" 0 0  Y 00Ls0f" 0W0Cs0_2 F0nR!  \0F?o2%500%0F?o2300&0F?o24 00=`Foob%d 00!0 0   00Ls0! 0W0Cs0 0 #\ 0 0 00Pk 00L0 0000 0 0 0 0 0 0\ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0dP@cP'dP<00Ls000Ls00<00uP00p(  ; ;8;8 ; D$ O-`RM@p , [5 X PI 0 0X P@0 `D-PF V0F7 `  [ 0U, 00 0 }/05[ 0 /0v50@SS0T 0 0@D0 T0 E0 Ѝb700Ѝ S Y700 Z 44X 4l4,0  00~  ऺ9A-R@P0`Sn !"#b! DQqU> 0S$ RT 10 R RO 2/!1 00U00' 1/0P p $@!0081003/0P !p0 $@ p0V0 00 R (P000P3/0P! U  R  SV  0STP000U 3>/G\`G8F8FhF<=A- R@P 0`Sm !#b!b DQqU> 0S$ RT 10 R RO 2/!1 0 0U00' 1/0P p $@N!00810 03/0P !p0 $@ ޿0V0 00 R (fP00 0P3/0P! U   R  SV  0S^P00 0U LEDD6\hD CA-@P| P/`Px rpPh  00^c<!"#b!0CaqV8 X p1PXU $001p00S  \1003/P00> 000$0(100S100S 3/! 000``0S 000S 3/000(ĢP` p  0000StΣP0000H0003/P 0L3>/B`PB A=A,A-@P{ P'/`Pw rp Pg  00^c<!#b!b0CaqV8 X p0PXU $001p00S $ \1003/P00> 000$0(100S100S 3/! 000``0S 000S 3/000(+P` p  000$0S5P0 $000D0003/P 0~䂌~H?}?}}?l}H>SR: G-P0`00Sp 3/0Y @IOP 5 T 00 00 Y @IOP " T P00 D0D 0 p`P/>d|h|4|${{=SR; G-P0`00Sp 3/00 Y @IP T 00 00  Y @IP ڣ T P00 D0D 0 p` P$/=H{L{{zz003003003?00{300A-@P Q P`\Pp@P P`V ]30"S ᾢU300@p@-La P`M=  ,00QP0UP ; 00\% 0@0 :\0@S \S 0@ S @ 0:S:\ \000ЍpL0P l 800  2 0 @v@uXu@p@-@P`P3 V( 0Pp:P @R0R P:U P0@Sp P P@Rp:UR:Rp@0@ @0 0(0( (0 0' ' '00/5p@-@PP" U+ 0PER R:Q|Q00Q0S"P0@|R  :RRpT T0T P0 t0U8 808 0 i0p & &O-ȟ M MDčpĝP$ 0v 0S 0S 0S t4!S Sdh`P @P5  KpP 00S RD@0 @'D@ ` @PT"0 S* Z :S `\S S S 0U:HበPPE TpP+ yP`0@ SZj0[P0#QQ 8P6@00PS0 006 p0040(0,@= P :S~ 0pS t40@0 0(<QP<4` GC pP> :00`00 [00S  `U@P   0 `, PPu0S00`YPE*0 S :S `b[ ` Pf `b :S& 0@S  0D`F00S:S:00` F0H[0 E07  3 ᰠ0 PCy `#00p@ H PEIpGཟP P p ,@ pT ƴ E0AX0$0p#3 0 D4 30ݍ Ѝ@ @ᔟPpm1 00&P pP .`3P00PS0,@`TB R`@0T<S= 00@D0@00"2 0 .0S"2 0B .0Sv"2 0 .0Smt"t2t p 0.c H D0@0S> 0K0C 04 8 0S:SZD H R0 0  Q!000AM04@@0+ ᧯0:S , 00UiPe0 E0 )I0 :SS008$ 0:SS00@ z8*X y$H՜8(H ݔ x@-0 00 v-H-M0 S0 00 0 0 0@  00^100M0 R@0    R L00 2@ 00 0 0 30KH Ѝ/v`vHu4@-I0 @ @0 W@ O-`@$MPڗl20pW^  0p0 u0?10>IP Zp P p J  0J0PH0 S#: 5*% U10 r 1$4S1$ !t@00H 嗴H0S "<100S (!0 0 0 306 $Ѝ U r pP Р P 5SX0( ,VT00#    %PH H0SKGu|VU l hUsf xˠ@-(@M@@0=PЍT$  {{ { kG[F { // =A z z kk'k [FKE{{ //=A  {{ { kG[F { //=A@{ kk'k [FKE{{ // =A@-Q@0M 0    ",  0$0(0T '*P0 0# 00Ѝ *0Ѝ0-$M  00 0唭P$Ѝ0-$M  00 0儭P$Ѝ0 -M 00 0 sЍ 㘮 㟮0㗮/C-DD sMPPp`/ V7 @X0^00pAtAm0O⩕4{ PP0P >TA{#0 0$00 @8 |0 0 1 30sߍ`0` `G0 'VD0D DH0 'oHHn Ԥ |0   M ЍmO-ϟ MPÍp0_ Wg 000!R !X P  7"P4%X 00S)00 R .> 0 3 30 ߍ`. 0zS  000P0C0 pX\P o@0 0 !P 0C PSGP =- 0 'W=- 0 'a`0`F p0p0S8@0 !P, 0P0CS0 0000偼0S0p0@0 0 !P0 0C P0 SP 00 pg0p0SP 0Sb0 0_00S 0p000Sp000b  0 P\PY+"T $QPO00SVp!p3`0 S` 0䆲P P` 00 000020p0S 00hʠ@0^T@pp,(0'TIP 0', 0$ 0 0$`-Q[ ]QP0 ` Q: @$00!0SVp!p3@`0 0d:P000 ZP& 0  B00  `#'0  p PTPpG@0SW `3P 0@0080偼0S P -00SG0p00p0S00 P 08pG0Wdp 8pFWp!>᠈ m@(0H0p0 +0BMS00 [m0H0 00CS0c000pWH%\0XS 00 0 ( 0         0H0 0(0L0 P00-0F SJ*N0 `p(@0V '  0 '(0 4 8@` p>(00S 5P V ,$00SOV`@ T@0  R  R=  0 BV0 5 R P/0pH  Ry @0H  R'  `V B   H 00 0SP HX A 0p0 0000P00nLH HHQD@$ml H  Ӹ| <  ʹ | ,H< ɴ A   `pG00P0W0S`J 0000P T0$@p@00Lp00 0P00( ን P5 0  B0 0  S$ 0=p P p/ ;p 60S $0 PS0pS`F V T P0 0@00X@P ($@X T 0@0 0\0S/P [($@  0(zpB00 ?+k00 :V+$  ]R Rt@Pp00@0 0fP00s$  ($ n4X y@PP0 0GP 00p,004@cP P P P P^ P 3#0 "000C ,0P[ 0$@(j ` @vV @ ](0\0LH0\ -P-@0 `vV`p ,X@0Vp@H0 PH0 B   H `V  0ScP H0 p H00CPZTX0p0|5Lp0@P0 00 ?oV20SX 00 0 0p B0V 0\ R*PV0 P O ' P 0  B0?0C  ". 0(  דp0 P s PX P`Fp0S P [[ (0 {1(0 SA-@P`p0 0@@-@`P MDpk@0p0 000@g ЍUA-@R@QP`w v (200S8 H0P1S010s G000Pv`$ pW@0PE PP_ 0 \"00P0 0 C `C000 0  Q  Q*RQ2 <00@8 0 B`0P%00P0s0 /P ˠ0/B0T0T T`0 !~ B0 `U Lp@-@P ~0@p@-0P$L`T M 0S pW  07/@P Ѝ"@ Ѝ$0$ $08 0p 80 00M 0ЍR<A-0P$L`TpM 0S $X 0 8/@P Ѝ"@ Ѝ( (0( 0p 0$ \@ 00 0M0ЍQTA-0P$L`TpM 0S (X 0 8/@P ЍY"@ Ѝ( (0( 0y, I 0( x(00 0M0ЍPpA-0P$L`TpM 0S 4X 0 8/@P Ѝ "@ Ѝ( (0( 0D  04 D00 0M0ЍOO-MD`PpZ@@` T6 0US``$ZG 0SD [A 0 `;/0S+ @$lV 0S H[ 0 ;/@PЍ!@Ѝ0$lV 0 0 0H 0 0[ 0h h0h 0Jh 0D D0D }\ 0  h p`  @-$$@M sЍMT@-0P$L`T M 0S 8pW  07/@P ЍZ!@ Ѝ( (0( 0 J08p |,0 00M 0ЍLt03?0/@-@`pP!tt0l尀 ẫT  6@0 -ᨒ$ ⧫L<0sO-ß$M `H0 B 0P 0u pP3ʿ00000! B b09<Bp  UQPE @ 04BL3@0S0 MTT  MT   ^DQ"2!Q   "  R  R  \00t0!#300@ 00@00 @0`PU*$Ѝ@0 0M  04P-0 S^^?0@0 0`0  1P 0J ZS0 { 0J ZSw R @ \H1 0000 $Ѝ\v`\f`\r`\s`\00 00 00Cs0S  ``\a`\b`\t`\n`0ӏP0e 0 Dr Ra0\  @`rK| qA- Q@Pp`! ؏P=0D?o! D2]R0S =h0$"0@ !1 0 V V 0- P0 A  dA-P@p``P.T T t0! D32 0 A_T %<0$"0@ !1 (0D,TS6I ,O-@@ȟ SMD(ȟPP x`pt  ?o2V0S Y W w@㼍0P0  ᴍ0P0 [00 p1# 0 S@ P(T- U T 0 1 #LP00? PPk@T`P @  TP 0@T0P00HC1S@1@! <`ipPJ 0 (00S V <0 G0CPap1  * 60 0  Rp1  ' 50 0  Rp1 00p1 00p1 00p1 "00p1@\00p100Sp1 \ OP@T`|P454%40 @L5%0  P* N4$z0  xTPP{4$0 4$0 Y4$0  p T$ `p@T 0p 9/P00$3 0 D1 30 Sߍ@@Ҏ0`S$O 0S,0  VR U 0004p@p`00 0 (  @ `ɠ8ʌ p`PQ^_A (, ^]*  P2 0*A5)q @. 00 (0<0p ႎax ~$0~s$@ 20 ,0T 0 0S0"700 0Pjhf{00, 0R 00$00S$0000P04p0S 0SV W1!0 4p00Id1 @`,@((0 [PY4*(  $0`0S$0 DQ  ᥍P T`I 000p0FE ܤ Dl T \۔ ۜۜ x۔ PAd, 8P@-@ M(0|0x000000@  @ 80P @0 0 30 Ѝc=$<@-@ M,0 0(00x0 00000 @@ 80P @0 0 30 Ѝ6p@aH H0H X0 , ,0, W0 _P p@8_p0p@/L L0L w0( T, ,0, x0( ;Tk\k ;(kp@-@PP U p@ 6aL L0L g0< U, ,0, h0< { :jk8 :kPk 0@-PP@ M T# ^P Ѝ0`P 0Sl00 aP P0P 0L KT0 000 0L @ 9ijL 9jtj p@-PP@! T* 0 0S p^P `P ^P  ^P p@^L L0L 0\ T, ,0, 0\ 8hiD 8i|iG-PP@J T  R# R `V$ V  0Lhhqh pl 0P R R4 0 00 0 `V000 0`V 0| 0 F0R%  0 0 0 I0l 0l ` 00 00 0000 0Li 8h% 7T 7 hg @-*/ 0SAS/0- Č Ȍ$(0Oc?S_c00 P @ P $4#4#4P 0U0P5_oPT 0/p@-PQ@`2 V' T ^ 0S^  S 0RR00p@@Tp@0@ @;0 (0( (:0 f$ 5|eU` 5XeC- MpPÍ`@PL TA A< WP7 Y` 0S d!\1 0 3 30Nߍ(#@- R? R0 ! E p0S % 0p 0 0 0 0 0    RP = R0ꖧpePd 3ddh 3dldO-`IM\ğ,M IM$J͍$@@P p`WP W0 $3 I0$ 0 30Iݍ,Ѝ0SJ=00SX30 2 8UV00W  R R  R PRl R Rg SJ= 0 J=00W O<  WP 0S J=00h00#<0K8 0J=00\h0 P J- 0SXJ=  0"K0  T J- 0SB UV 00R R SJ=00:0x1嚏0 0000H0 ,0RP' @E Qw ",u R RoJ͍0 ,G(& RWLP P P J=00W0  mVP_J͍[PV o4 2TE$a 0`hO-ğ M@pQ `@#0 0CPS0 #3 0 0 30Ѝ#t3 0 0 300 HD@pЍOWX 8# 0 ᕇ XU:  0 " pPBT@0S0SQWX00 R0SS 0SV S-YP00SH"0 XT@@O 00QWX00VT iT 1i #pVT00|pYp 1夡失 P0 pY 0@D    P030#? @!0 YRp1PP0 p   P030#?pW 0@Dw D PTph D  ߆PT_\  ӆyb .4H^^(]n\w\n\XwD[[[dG-` 0 FM5 P@pp, P PV  HPV> 0@Sp000 0q 00  0P 0 0 1 30Fߍ Y:wp0SX 0S uP 0 0THA-@P`p z0  0P 0p@-MP`P@@P@T 0S  R0S wP$@PЍpPPЍpp@-@P QpPpPTp0 @0 q3 'XX0S/. AA0Cq.S .R Q P-S Q P_S /@-0 S@RO 0RM 0^G @PTO 0S`V DDp Wf U` \# DPD`VR S`/ @@@0T*R^00^00S 0 0 0R0C?o20SJR 0R 0^ 006 S0S0^ U. \2 D0D@T 0U& \ D`DPVS` D@D0T\U \ D`DPVS 0R`V\0S0p@-d M@0( P  0R0 0S  R la  haR 0Sd 0S 00 Ѝp  0S S R, 0S 0S0S 0S/@-d/ 0 R /0S S/ 00S S/0S/ //0@-@P M 0S PP80 PkE@00S0S 0S  Ѝ0$0$ $n0 kT "R@-pQM @Q`P Q Ѝ0SSp P*V0S" S  0`S Ѝ Ѝ00S S<0 P 00 Q|4p@-PP`@ V T! 0pPpx x0x t0 V\ \0\ X0 T@ @0@ <0 XQLQ  ,Q,P +PO-ŸM2pC @80 0P`[P00  03/P 0@&<00&,SS00 40R0SP 0S@p$pU> ,``:00(Zp0 C  0)[PPf00  03/P] P[@[[[p M40S?&<00S !T? [ [[\5pz_0D0 Z@P200   P@) epP% $0 D0R4  4Sʄ[ 4S 000p0 T &<00Sa 0D'TS@`V0(pX,`B [t H0D0P08 pPh@ 0(g[1 { 0{{ % %  0E {000000WP 0`q` R R 0   pRf[Wz 80LE0S6 ([00$[0030 0&<00S4 @~P@W 0 8(5$%02 %R (0SP #0SfZ00@ $0R }T? TTiT @x~P@W`(0S <0pPC80D\L X<0 C,0PC 0P,0(00(0800S@@Z@l@0 1z_0 0 Y@P%00  03/P X00pS  @@ 80RC.P@]&<0P0@d $0%@P h \ 4  B AT@ A4@ @@ < <0< 0DD $0S\ \0\ 0dD 0S| |0| D 080PRCPP.@%@0.QhP U0@ 6YPc0000S 0R $R[ $R 0pyaO-@ğ SMDP0Uc`P QcpP $0  08X0`00pS0  PN 000 LPJ @@PX 0  ;Pnele@|#t3 0 D1 30SߍY 00Y00 Q. 0 .Q0Q RS# d!"Ss** 0 P:e8e @S Rd!"Sf*.[ 0 P< D Pd!q 0 DDQ0000 0000 Pzʟ0=S =Y0S# S S Q 0 Pe0s70SS0S #Y000000  Q000S0000 P?Y00 0 P5X0.[0 0 0sy X00u 0 *.0@I0 sPX000 DDQX00V<dX00Sl  p;xO-`@VpPM 3 0 S_ )`PL 0(H0L0P0T0X0\0`0(000 00000HSC S$ S00 %0 #(,pLp0  0Phh0000 0000 d1 Ѝ0 ,p#ᄀ넀XgX00dXP P P0 ,p#npP h08 H0]  @ W0 S6 10T0  0CP  0 p5 P0{0(,0(0  {&0PcZ 0 Sd1dXO  00S ! 9TO-Ÿ @00@$0` pY i;92 I520Y0 0 S   S  R  R Q\  ^ \/oQ" S R0S   0PQ ,-0 0S Q0S %0P 0 PA  0 B   (DP(IY! 0( P p0`4P8p`P,@<Y  0S@TM 0Sb 0S S 00SN Pc(0 0<[ RIP RF RC0S0S ;0S,\%`;3<! P 0 0PU `V  ;00\ Q  P U V  R R  p' Y P` 0S   0?S C" 0c6#PY  ^i \S㔐Q^ @ pTp0S 0`@ p$p T d;42 D52H 0SE0 S > S PR  PO 0@P0 0`P`&0e/0 8(0 @YP_(0@ S0 `P@T $PP@P ``T$PY@T@ pTu W 0/0P` 0 PU`VX _PS 臟PpH0!L0 0PPHP$p5bPPPB `0S: 0S ` 0`@\'\7\ Xy/0.QRSP㔐  P   P \?oR20S b R㔐I GP\BR PLV `$p(,PP00 00SqP@T0 ,6$p0(,PpP S 00 0 P@T 0S00S`;`9  0 qP pY 0uP-Mt 0P R 00S R00W  P5 0xPY 00S"S㔐R0S |$|4| 0t}/p 00n,@ p0`4P _RSQ \`@ T P@P __TS㔐b ` `_@ 0-P 0  0P ` @P __Y@4#434 0,0 ` `S_] P r_`00]P 0 PP`PP HpW0!@%`!!:P]@P  H HFH`L WP @L@*`@ D_0 "(` h`$ P,W 0@VP` @JHP댠 p0W|0E0B l0b 0 0  Tp`h !ltP 0sPU0E D $0DItP00EJ$H|$0U St S 8^ $P"/8L.. h +0T} p)<(8c '&uˈ iIQ D 0P03 P Q$P0Q W : rh,pt0(` 0X 0q"0S0 0^H@P P0U 0P}^P0U u^0`$p(,Pz$PEb.> fֿ xsP1x00x0 O^`@`@HP0U00L0P;^P`O-PLM` Zi  y@㰱q p  PP0 0 0PF ``0S S S T@P `0S `(0 ( (`%P00 U `V Y 00  Y``VU$@LЍTT T0T P0".[Z8 808 40".P  !( h  iG-XMp@6|P `P@ 00  0 @|P 40S0- XЍ PP ] 0 #|P o]8 8(Pğ  $,4P$ʃ @ ! " xDb(@@ #! P\D@@0,0#P0@Dc>@ @",$P$Dʃ@@ ! "0P Db(@@ #!@ @",PCʃ@@ ! " P Cb(@@ #!,PC@@0,0#0hCc>@`" `& `jDPDC@P! P%@P,#eX @# @$@#D  , $0l̈́ 0 ! ba` ` " X`"0  0#0 e0@ጒ@$ @|ŸdM   " b0T"0  0#0 X0 ,,  b(Ņ` ` "  bMD`!0  0#0ck0 ̑!  Q<P0 P0#0Q5 PP "@ b-@@@P4d , l˂ Da @`` " (p,P! P%  PpLЍjxǷV$ p|G*0FFi؋D\׾k"qyCI!%b@@&^ZQǪ/]DSء!7 EZgoٍ*L9Bqma"8 DKϩK`p(~'09ۙ|ĬVe)"DC*#9e[YÏ ̒}]o~O,CNS~:5*һӑ@-@P 0D DD@  00,0, ,0 wͫgE#2Tvx G-PPp`6 W* 0!ᣑ000? 0"@@i>V0: Z=0iS@I"p ` *40V@@p`F GCH H0H 0 4, ,0, 0 *  Dp@- ! 1 0MPP0 00@( T1 `  !? 7R8 bx b$   0 0 0 30X Ѝp@` `0` 0 T@ @0@ 0 k 8kX ۸@ ی xC-("(2 0 M0002"00 @00$ p P`0R   0XS 00 Q !. 0N X!H1 0 0 30 ЍQ  Aa 0s00C 80BS.R ^U* 00RP 0ES0 S S^*0Wy000@^0 8< 4^*0 8<jjxi- MiP Ѝp@-D!D1 @0(MT0$00B  `RP?o2T0S8 0T0R0S A 0 0 $0 30((Ѝp (0!@$R0@0T$0B0S \@0S ( !0$ R0Dh,g x 8A- rM`PpP: UB @X0^00pAtAMS0OS01 000TAΌ LTP5  0 FxpP& 0@+VP 0 0 1 30 rߍ0 <0 Uh0h h=0 P V00z 0P0ꅏfBep ֨t@ րL0   M Ѝd -- M0 0x ЍЍ/--0 M0( 0 hЍ Ѝ/dp@- MP@0x x` 0 l0  `@P@X@j0@T  Ѝp:<d@-HH1 0M` !000kp @P   kp j@ 0 0 0 30'ЍjPpW @@T PU 0SP@YTT00@Ҏcic( 0p@-P0@ 0 p0V(0PV(P,PV 0t0PP 0"P 00 0p88@qP 00 0pp, 0@-@ 0 0 0 0 0  0 00@- 0 MP @0U 00P 0 LA?o20c Ѝ02 00 0p@-@P 0U0 0pp@-@PU0PPU(0PU(P,PpO-`0Pf PP_ 0@00 S S0 S S dpPN 00Sp[ p5 (q@P 0q0p0S S S@ 0A S  AY@P % 0 S 0000bTP  TP0@@ PG-@ 0`pM,0(Su: (TY0 T0U 00SQ 0 RK@D@T0PF   RB 0@D@D0P0S+ T0V  0 1  @D@TPH 00S#0A S0偠0k  hd0S000 Z WS0S% O0p@T0ppT(0pT(p,p>@ЍSP  (,@4(  Ѝ00@- 0@P M   p P  Ѝ0 0 0$ $ 0P Ѝ0@p 0$  $ 0 5 Ѝ0O-PTMe pE,P@ @0 ppUPd,Q`P` 0 ppUPU,PPU0 @\ \G \Q \C pp 0U00S QP. p0 0] 0@ ` R  R2 R[ R 0 @U 0 `S 0JX0L 0 TЍ @\L@ 0U  0⼰  Z0 ` ` 1 0 00LЍ 0 /?Ͽr s0|13? <Ͽ2/0 0 0@-S@ 3/@ Q@-p] Qdc @P 5_2/P ` 0@ PEPET% B B&"@@" PEPEX% B B""@@A PEPEe% B N B ^ w" ^ v N1 $1 0@`@DF$FA!B@  D B &"AA!@@  B B!"AA!@@ a Q@'P 5_2/P `<ϿL,PE PE T% B B&"LL",PE PE X% B B""LLA,PEPEe% B N B ^w" ^ ^ ^ , ($^$^4 ^0 ^2 `1@^ ^ N1@N1 `1@}^{ ^ ^ ^D@p4`@\lhdLH7y h x X@-@P @ ;K0 /0  p@-1!00 P@0 00D@1011.T 0@\0 S@  P pp0  00C1000L  00t@I ; C-P MO뀐pM%ᙞlaapGQQNHH0  @ N 0} Ѝ Q@-2"00 P0p 0C0@@@m 0@@@f 0C0 @@@@E 0@@@> `0@C0a`.SM @000@000@ 0@E0C2S p 2S 000 @ @  @0`00n l afAdaDn l lA`00@  0@A00  0@@0000@00 @ @@`iH  l O-`!P@@R@@Ɵ GM MtčƟT ࠤH86wL0P00 0 0q\&\6 0 P< < 0@00U0,006`P0D0h0(00  P,0T00S 80`1  '@0`V 0` 0V X DiX0`0Sx (0pe?p d5`00` 0V7 W(0?p(5(0= 0Q8 W0 i@X(0? )R 00pdp`   P* 0  +t4 p0 TdT4` p084 p04p4PU  0R40008 g`1S   ;`1S0 P0  0NPJ0  0BP7P  P6P$0  0*P0  0P0  0P0  0P0 0P`1SxYz < P0ppW  0R 0XgpW 0pW  0Rx 0EgpWf 0pWa  0R0 ,02gpWGpWD 0 PS00  g`1S   0 ` 0 `@0 `0 `, 000 0I tЍ   Y _2P  0001p 0001p 0001p 0txt1p 0j[%ML ftЍ tЍ 0 $10 0  0 0  00 x0 =Hx2XD008|<ޤ.Lܐd8 pܨ܈hH(@-@`00AMM0 400p00 >PP0S ZD 80 0 4 30AލЍ.꧃6`50,@-@ M pp Pp>`P/P 0S <0000 Ѝ00S.S 0S Ѝ@T  0U Ѝ0O,0@ 0P Ѝ0#,4DMp@-@ML 0 Q0P0<00P@ ` 0. 0T @D G000T H0 0 <0 30 @Ѝp@Ѝ/.0 TE1R-$,O-PM@PP p`0 Q  ЍSs SRPP -\0  0+\0 0 30P0 00L1011 .\ 0 @T@ sq'R Q"  S#3 @ R Q" 0  S # 3!# 0T$+<0+80+40&<0&4 0'< 0'400&( '( ` p0R0` T000@0S Q# 0R#300@0S Q#  00R0#03!3 T 0T @ R P"  S#3 @ R P" 0  S # 3 # 0T}0 0K 0N0 000J00  08+O-@Q0 dM R R{20\0QS0N0<0l2a!##\R2b1!A`2aL6RX2eDPQFW0E0@02h8's2a>?2crlqqHL01NਂhLΆbfXT P0H` aNx t p[P0 T XF Z H Y J (0L0$0\04 0@0,0H0 0<0p 0D `40B[ GZ GY GdЍ00N\0@R@(@m  0 0dЍXZ HY  8,gibMӈQ8)˜@-@P 0D .R S0@*ST .P@Q QA.@P@@$ $0$ 0( 7 \@-$MP&`@P`\0pv> 00pp< pp_p  `Pc$ЍhC-@P@ `p MPOP @U 4^P@Wt Ѝ @Pt0 0000 0 P!@0S0Toᨂ##C-@P@ `p MPx@P @U ]P@Wt Ѝ @<Pt0 0000 0 P @0S0Toᨂ#Ϩ"lp@-@PI00CS0 S u P `0 P@pa`u0 0CS0pSr P 0 /a@-M@0  00 00 !R !}0@Ѝ@-0@S@#0@0Q R#  004S V0@R Q R 8 @0Q     Lp@-DPD0P`@0pp 00p@,X0@Lp@-@ @ `@0Ppp0p@,*LA-DD p@0P`p0 AlLC-P0 `0pMrp@ H 0D @ <8 8@Ѝ39LC-tPp0 `0p MHp@ ( 0  @ Ѝ9hL0 00/L0 00/L 0 00M0ЍLA-TT p@P`M p 0 ЍtL0 00M0ЍLC-tPp0 `0p Mp@ ( 0  @ Ѝ8LC-|Px0 `0pMp@ 4 00  @Ѝ8TL0@-P@000 00M 0 09Ѝ0Lp@-D0D 0@0pP p@G`8ptL((  M  0 ЍL R) p@-P`@V P 0S.S  0@S \S 0SBp0S @Dp DU!B2p/@-P0pSp@ M` g0T  0C0 ЍH0H0 p<0<07/0H 0 `TO-Mp`@PpM WC*00V>:Y ` <1 p0 p, `P 0 p- 0 p 0% Z ` p0 p F0?V0S0 0 Ѝl0 op 000000Ѝ X`O-M 0?͍0,0= 008(0p=͍000\ @ @LH$0 PX (0@S4 P =D 0H P0 X8p 040 0Hk=P0= <<0@PU *0,/h 0X> x0;/ 0`Hk=0PE0PP00>x`d P0P 0 p 4 0$p WWA = G0R  p ( R 0S .S 0S 0S00S.S=0=0- R, L C +A0Y 10"3 " 00;A0==0;A020 0;A1; +A0Y!1 000!;A>A C1;w+W =00SpA0@d 00dpP0 p  0 d T0 pv $0@T 0DK*P$p PbtL 4 HE j0TT %h*Dx L | {< { y|== x==== x,84UUUVT<0\tpp8,҈`PD l j@ iTTDK L 0d 00 0 p  D (0 BP 0DK$0T-*PH\J pP倠P 0(W=  R @0 Z$ 0d  0 p @T0- 1!?C0 ST!(p@  !p=00SH 1 0D;2d 0_ Pp0 p D0(<p`8p@C 0 P;Pp0 ph 0 P`*P_H=00S =0|30 !$PL=03000d 030 !Zp}6=00Sk =0 40=@  0] h1@e1@00 0DpDh4( 0 P@0 *p - 4B !?C0 Sx0 p:=00SQ 0d 050 !p pW@ D 4 $ 1R7@P` @@@@`=H 0 0U% [P *, 50@@5 04/-0K0 0W HD $0 S@P,0 p @PD0Pp(<8@C 0 PpOP0 p| 0 Pp>Ps0 pk 0DK$00CSi  70=00S 0 H[=@ 00$Tp *0,L'p 07 d08/=@D@P0 p0H[07d 0 !Np+ $0ZD2*p@ 0 DPZ W 0  .p p 0d @ 0  p pG@P 0$ Z!p2@PD (0@P BP 0 p PDK0 0@0H0H  _7 =00@P , 9 0P9 05/Pp/ 0@)DK1#0Ys! pD (0 BYP( 0 p HzDKp/PD[ d 0N 0 pp /PD[ 0d < 0 p^ /P /0 @/;d 0@P# 0 hpE H=00S \+0 S00 =00S K0@d 00 pP0 Ap 0 00d D;0 0 0p  0 d 0 "p P< 0DR  =00SG 4/@1/P./P P0@D;<@2 0 `p0 p D (0`p BPH (0   D  BP 0D{$0PCUp@ Q @T 1 X2 ^ 0d u 0 p=00S .@. >@@2 0DW Pp0 pw $0  Po N@0 Dpc 0  P\ 0 DupR 0  0P@J 0D; 0bp? D (0@p BP|5=00S$0 C|? 0=00S (0   D  BP 0D$0 SZ/ C 1#00 Sm!(pK 0 H=p 00"9WP *0,/ @0? |04/ 0H;=pG0DpL!p 0 H=p 00a" WP *0,. @0> 04/ 0H;=pG0Dp>W =0>0=0x>0$0 Ch>0$0 CX>0P($0 PU 0D[:=0=0 >0P  pPWW m`@P 0T00 Eph 00d0W0@D0 }pYP  @PNT T ,}p`P 0V00 E_p< 00f0T0`Fv0 Qp-0 a h F0J F A-Pp@KU`, T @ W0``W0 .pPEVp P7000 2000 S70Q00 V00$ $0$ g 00x D|/ؔo/|///@-` @0 0DM0<000p2 020 RP000000C0< 00 0 <0 30DЍi X O-h2hrP0੒ 0 M #r DrgqC2(00B刀B# C@$AR i!dP @`3@CG*TNXWnY1Z$* @ 0 Sp: [ @B0?R0SJ  Ѝ @ 0 Hzp# W0Y[0S    00000000SW 0 Wp@@ 0 DLp XW  0 M?p Y L0L Le0 4 Ѝ @ :$I% $$, Ax@A-`pPϺ0S-@ T 0D0@D0C .R T  S\RT  S0C\R@D @0.  0 @@( 0 p@-M P@ ȍp k`\ p  Ho4 (0 0 8 30ލph  ʈ0-@- M0@R0  JPP * Ѝ@Ѝ/ + Ѝ@Ѝ/hPRp@- `@,PPtP0 ?p@OEb00pPRp@- `@ PdPRP0 ?p@0E@b00pp@-@Q `PDP2P0 ?p@ E B00pp@-P@DP p@ p@ p@-@P 0PS <0S P 00p00pQP@- 0R R  00p@-PP Q@ @Q Q Q ARt032 00pP @pP Qp@-@P PP  U :`0S @P/0`* L0p-W 000W00 00G S 0 1p00G L p0G ^.QQЀp0G90pW @pW X @ ER6    0 QP;BЍ ^ pEWK  LPL+^ -^@0@  0@N T@LP 0^Lp pLp0^ 1@NT@R0 0#Zi^ !I^ N^HL@tP L00(S- 0(00XS Lp0W W00n0 :g{ Q {@Q࠱ࠣ @@ fkR[kkPq qPIP%bPk0SD7 b0A!Fk{1[{'{' QL00;RrB[^ [PPyMPqP  p{`Pkp{'PPW{Xa5@X{k{&{VPPP{ONPp4f5éXfPvPP[l0%%P)u'u%u@#u !uT"00% PLQ !";BЍ :g{Q PR࠱ࠣPD R{PfoLQ 0R8 L 0R j 1BQQ ER 0 0 :000L0pW 000L @qD NspP@p 0 S B  D ?R   @<008dL\, # @ B"( ( Y ``Q0QH`FISXY0SVY !v@PS PtvPN 0 ` 0Wv0S P :s  @{DJЂ [ X 20jSk&BXHV 5 2X R\0s# {{7{PPtNtLt JtsPP   ! w ldvPP t@P dlQ00 0`B A00`AR Q6`q (  yp{0 S1@B0G{1k{ RL00;RL 0pB WrWLO @ p  L 0pN WW F R ? Q10QЀQ^F Q 0@NL0N XAL@0@D0N XIY`@{0pW@d @?A Š : :\q|Nn^ t@P P`tP4j Ps4P.uPPP^0tPPP_  Jr X\V\0Si46S{  ^H{^0C;R\#E X <0jX00S {Nj {:S03:gVH{PP k6C@X{{ ;R{,380SQ {{\0$&00G8{NjZP2s0s.s@,s *s 㰂{@{7{ꝋ VH{;R;R 0S 0ES 0SB c03HŸ0 l00T 0lP0Lxn0@ S 0SZ P%%[0!%{Pk{'{ {KoᎰq0t!;BhtL@qP L0X0CL0qPL0 !0L000!%{5LX {"X2"{;B{;R Y{ 0Rq 0 %N0 /L@ 0B  10 ER   ??A?5? .pj|| + N{g[E gk k 00S0S:0:g{ { ؂`@kPjD{8 k{'f pT@{0S0G{0 1k{&RL00;R1pW 0L0 &@0@ @{NjJ{Nj0#%Sl\j0 %P dPR 5pPq0T X"5&X @ @R[PPk{{ PD{P X`&knP P4P7Knn\PXX`{@{p`[e0\00S80S[N YpboPqqq@q qD0S kn{{&;R{Q|w%0 [%p@]xl klP&46X0\ %aX <V(0 Q S\0  DX{{7{P`Y\0pS`X 46S00jS^k&`BX{F{{{ rP  sPpX`D0S X L00jS ?5?559P? (\00rX 46Sm,00kSi0S0Sc rPN rPX YD0S00C kSA7SPqpp@p pRQ\Q S 0; DXj{@{7@{{2P\\S\0 ' d#D\Q djQ!ʠkl P S 0 P6C#: :\ X0 p1R 6X00\0 @  0 00M 0Ѝ1 .A-P@U `s0pS @ ڴP 0S U@Dp@-P@dP`P0 S :pSSp 0R:pp808 8e0 Y$0$ $f0 Q` #`` #`A-P`/@,T*(P/ $P4 pPW 0P P B $$P W 0 P l l0l C0 T T0T D0 < <0< E0 "`_ "x`_ "T`_p0 0E@-@PDQO-^ `Pp  A@ 0S 00CS 0 \V0 S  RYWppXpQpW\`\\U0 SP\p !hQ@-P0-r-w0-0x000襸 00蠸000S wS -S rS  0S /xS  / p@-^ PB2 pr 0 pP P//0S/ S S/0S/0S/@-@0@0T S R RT/ ?/PP/=?0PQ/?SQ $0$ $p@-0 /\ \\( ??SS $0$ $p@-0 /[  [?S S S`/Q/AQ/Q Q/?0 H0H Hp@-0 ༵Q/?S0?/0?/[( t[@QP0 ?0/@-շ 0  p@-$P 0P0(@`ķ P^彷0Sp跷0@'벷@`p@-@P`M P0ES  aЍp 圷 P^啷0S 0 0 Z0 Y Yp@-@PpP Q 0S P&0PS&p@&A-PPp X P@PEX `ၲP@`( (0( 0 B` XXO-` MV " p@IV PXP @0SV F!0 `F`1 Ѝ Ѝ u&` - ^ p010C. *     A-RP`p(M @x 0 @0@0 P0 P0` P@ 0 (Ѝ 8  X00 5CS @/0cS#:3 3Q31:0CS! 2#0p@-@PP U Pp S 0\\0 0pD0D DL0 wU(0( (M0 m. U. UO-PM`p 0FV"S00 0\ P@P-UN +UP0+ pv"@0 P00Es Qa0ESW0EA0ES70EVt PSQ #@0U0 V)  `0q 0T00S0 S` 0J0 ЍS T 0P 00 0R0  Ѝr `00XS 0A0C0A PSVr `Pr ` 0 ?0 ȳg 000 0M0ЍT pQO-PMp 0GW"S`@ rP-TPr +T [ ?0 0  0 000D P @pQ 8 PQ  S  R/  " Q 00Bs ^ a0Bs0SW0BA0Bs0S(70BS%| [X  PQ  S  R " H"00A"00 0S \0F0 Ѝ[@`K ?0 0 㢮  0㛮0c 000D00 R0  Ѝ[@`g0TK W@0 p 0 00Dm0T00XS>@ 00DA Bs QR cp >` S0T3 W 0p p|x 0@`p> PPL1L!L?0 0p 0>00D,00XS W#0p 0 000XS W ppp 0A0C0B QSWpppPe0p 0> 0W 0@ p p0@ p 3333334 $O,00 0M0Ѝ ( | 0 Q?0S @-q\-- Mv ЍЍ/G-PP`P VX 00 !PER !U6@  PG0 2PU pWW@CoPp X4 00  @@pG  p00ާ  0@0 0ӧT0T TB0 V808 8C0 ủ L$ KA-@PṳH`H0``@p d>T  S A p@-@Pቧ00CS0 S u P `0 P〧p>`u@-@P g 0`00@f0 60  LJ- M 0/ Ѝp@-PP@ T 0 0 00 pD0D DD0 bT,0, ,,0 X$ J0M# JNA-pP@`' T0 V9 0S 0S 0P Q00 00 R` FQ`00x x0x 60 TX X0X T0 V< <0< 80  I8I IHa XHHbO-ß OM4`lPP `p@dh V Vt Z.` ĢP 30 00 [ .Q Q\.Q _ :!ᢢ!PX [ 00:[.[#4N[0Q.SH Yf0IS00_00 I Z  0V B P00 0 ` `.0 0C SA: {0  `0  +00j/00P!@1 0 41 30GOߍ:[ 000$0( @,0 000 `0P  P00 ZZ00700 0 ( 0(C<4 ePPI U.R{  :P o%Z <  x0 F EHBO-`PM@  0X0 X0^( 0 P> 5000 00 P @ p OP 0 "00P > R  R 0 @`V  pWI1:pG`W:\pG`R C0 ᱰ ` Z`pG@ R ! 0 0 圱00@ߍ R R0 S S   P| ` Q PD ᧬P@ !T: p P@D X0P@- #[0k0 Z  Z[` pG Ka  M pG  Vb XV P 0(P ` `p R R R RT T * ቜP  RPD(P@D PV p@`V2  /P' T <:`P P !T014@1:r 0 @ 0ޮ0 0A @ 0 @ 0 @0`pP_. , 0@ 0@ 0  PP P 0 `@pC| +0@ ^@-pp10LM`P0D00@G Lp0PS- @.0 P( U( qp0 00 0  >P 0   0 0 0 D0 30LЍX>Ptpp P@ T@ @0@ <0L FWX L?  >l d4=A-PP@M8 q`p@T* X pp00թ 0 5>P0   0 Ѝpp @pT Ѝ=P @, ,0, (0\ (t' B PE @ Y6:I S@@1 ͩ @ I@o Y!:  復 U@In E1P`P@G   ᮩI  U=pN` V`똪 0  0\!H1 0 <0 30FDЍ( PPE pP .PEڍ P/ 0 0  0喪 0 OpP`0 00 0 0 000I00pQRp` t|p qp@-M`@P ),0,0   0iЍp~~@-M@ $$ 9 Ѝ~P~`@-MP` @pP0P0 ɠ@0@ 0   @0PЍ}~0@-P MP@T 0t  P00 000~ P 9 @ Ѝ0@Tl 00}}|}dC-a@P`PMR UZ !0 `   p 0S  <  0C ^0 .SEW 0  @Ѝ0 XR   9S (@ pG W0 QU4 8<00`0` `m0 _UD0D Dn0 U @S nd " "O-ß3 0,M@Q0$00`P RM Pi PW0`:V000 0l Vn 0 (#@ P@`0 P ] PUX @ ZpWP `$pVᰐH0S V0FB S0 s\b 0U5 0S 0$ SP`$$q$ p 0I4 ┦U V V 0@ ≦ST00@ … 0 0@ wA0S@`$pl@ `.V `$pVP]rPVj l|   j j  t@@-1 0,M@P0$00`P& V.  0 0 0 p 1P*   0 0 $0 30,Ѝ! 0 X0X Xh0 V<0< <i0 P hp h   ߘO-ddş tMQl@p 0 R P P/ / 0 %5 0 l0 307tЍTd4P`I0 ̥Tx T 0S4 0࿥$4 0 ඥ 0$40(,04801@ R@0`S U P Q 0S0@S Pt0Su00 Y0S @\T<0000j:000@T `0= Zf 0Sf* 0CR00_:2o"2 0 l0 30 tЍOP@PUE*0: T00S Ct"H 0 0[P3@T` 0Z00S RZ  @T0`zu YPs S 0 S P0@o Pb0SF: 0 Y Y Y@L!0Q 0  HP ዠy8 @R0P`P`0H ȤW Tr T0 ⽤uA0< P@0 j0| : J0@

$0[' + P&p 0;/pq 00P @ P 00 0 00 Ѝp p-+P 0 Q+ L WY pp 0+P 00 0 SM  00 0;/pq 00PQßQ <PU;]0 {p0 ;/yqP0 r 00 0PUßR <0PUß`X0p\ Ri0K0dX0P\NS  00Q] <P800CPU0&Z   "  RPPL0i/  0P;/pq@ 0P000P @ P 00 0 PZ 00 `P)0S&: I y AJ0C0M;PTP 0S  0CPß@1@!@G0 ]APU0 Z 0CJ P'JPP @0P 0000 000 0 /0+ 0 H0H H0 0 a` 0 \xL  O-P,MPp@P` T 000S000Z00忘$0 0PP`W0 00@P $ 0R00SQR+X` P  \0P 0У0  VP`P嗘 [XhU,Ѝ CRoo$ b  B0 S $ `R``V8 PB0S0: `P`$ R``VR`%X00S P0D0P \[ TP|[  0P \ PPdP^[ CTs[H U $P` Pd z :P 0S   00S S0S S ^ S@@T000S00՝i0\#00& ^@ [ @@ S@ U@0@ @h0 0ؗf0B ϸ$p@-@PP` U 00F Gp 00p0 60 ܡUd0d d70 ҡ0 0@p̣0TSȣ00\ $    -M0 3/Ѝ/0@-@PP M) U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0@0@ @0 (0( (0 z  x ͨ T0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H 0 D, ,0, 0 :   | ̴ Tp@-@PP" U 0S S S 0p@0/p0p@0/pH H0H 0 , ,0, 0     xp@-@PP" U 0S S S 0p@0/p0p@0/pH H0H 0$ ֠, ,0, 0$ ̠ $ $  0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H D00 0 000 ,00 $ 0 0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H D0@ T0 000 ,0@ J 8& %0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H D0P 0 000 ,0P  F E0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H D0\ П0 000 Y0\ Ɵ <e 0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H D0l 0 000 a0l D 0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H i0| N, ,0, (0| D P |0@-PP@ M T 00~P00 Ѝ0L L0L H0 !T0 000 q0  P0 $ڀ0@-PP@ M T 00P00 Ѝ0L L0L H0 T0 000 ,0 Øx8 l 0@-@PP M. U" 0S S S Ѝ00 0S0 02/ Ѝ0003/P 00S00 Ѝ0H H0H D0 ଞ0 000 ,0 ࢞ | T40@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H D0 j0 000 0 ` t L,A-PP`@7 T- V= 0ppgS S&0  03/P" W 0 A 0/0 03/P W 0 A0/CoP P0P L0 8 808 #0   * HA-PPp@`M4 W= T& {P R P P P @ЍPX B00@R X# ЍAs 0 & 0Ý 0  0๝W 0  0஝ P` I0@SP@@ @x P^ $_ 4p@-@PP U  ;p@zL L0L H0 pU0 000 ,0 e l, `A-PPp@`. X7 W@ T P  R 0 R 0\A/V 0A/ 0  0' 0  0Xl l0l h 0WP P0P  0 h @  |0A-@PMP` 0L U@ 0pS S  pP R`V V V ЍW ၘ s0SP.00Ѝ W`" ]0SPV 0 0 ࣜl l0l /0  Pp 00 X 0 p@-@PP U p@T }P P0P L0 lU4 404 0 a#( |\? P0@-@PP M. U7 0S S S Ѝ00 03/P 003/P  Ѝ0{0{ 03/P 003/ Ѝ0L L0L H0C/U0 000 0C/ 8W 0@-@PP M. U7 0S S S Ѝ00 03/P 003/P  Ѝ0{0{ 03/P 003/ Ѝ0L L0L H0G/˛U0 000 0G/ { lp@-@PP U p@UX X0X 0K/ज़U8 808 40K/⚛p@= `@ 4p@-@PP U p@|X X0X T0N/|U< <0< 80N/qp@d ڜ\ L8p@-@PP U p@X X0X 0R/RU8 808 40R/Gp@  p@-@PP U p@)X X0X T0V/)U< <0< 80V/p@ pP D@-M@P0.S00Ѝ7@-M@hp  B0?R0S Ѝ(0( (0 0CЍ@ X0S.G .S > -.\6 AAQ00C S;R .R0P S.S AAQ0B Q)S .S 0SQ0B ^-R 0S .00 R0/0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C//0 0 / 8L0 00/ 88// 40//O- M0 R Pē0 Pm \ Xh@.000\a @\f  X\@PAR0SI <  cSB!  S   XH`#SpP@@P   pGW`W0P@W `0FS@0 R R S*   Q @CT00S<"<2< 0 řT S ›(00@ ЍAS0S010! 0 X@P \P!S" Cr <"+  X 0@Q 0;S@S \S ! C]R X8!#!! Cr  @ D"!!1Cs0#"1 D0DX0@FSP0S pg' 0`b0l pg'!"p0`U0_O000S*. 0 f  \Q0 O-@lğp$M W0P Dd`XV @ppW \W* .W 0E0CH XF0 R S.R? pWP 0E0C 5 X3S0 X ń- PEU*0S0P(pW [W$ ԊP @Qq ɊP @Qp ᾊP @pW͚(00$Ѝ] ᯊPX p GYN0xSK2  000 B @0XW  /RX ]R=Q P00 "  0]R' @R " XWQQ   Y I b"r RyA  PRA .R pW@Ne@l@i00Q    Y  " ^  @WX  P0R XW(@Qp59:fX0  0…1^S X ńY PEUV0SPUWX 40  0G-XA Q@L*`0S% RC @RpP000 0Y:0  ࠟ 000s0 P00`S`00@NT00X0Sx x0x t0G/̗AS 0SPQP!00P0Y(0@0 /$ x 8RO-P3P#RP3 M0U 0p`\ @W @RH R R4 (00 ЍW@ Ġ[? A @ GRPR@\ 40S4  0@0[A[V[ 0 0K/_  Y*@T*0PW 0A\ R!ɑ" 40S04 0 - M} ЍO-pSP$M Y p 0 pS 0S0^@w @^` \rS0  H Y B `@p p@TW @0S @S] pZM TP @`T00 S Sn*p 0A>Sc B P_^p0Q ^ QC ˘(00H0S 0Q* 0F S0S 0 `  0AS^01"0!0\Yp 00埘(00@$ЍAT{0S"@@A@pZ ፗ@0Ġ?  0^q0A>Sp0pSr000^ 0AA^ AN[ ^( SQ0SP9 Zp? 0.$ @C /Q R 0 0R/4000@G0?Q0S 0 0R/~ Vs*p+Y P HP @ @0@ <-0< 8J lj XXp@- M P0 `004p @ !p < 40 0 1 30ލp@? '< &A-P 0 0M `0 10@0 (qp 0 p0 (0 0 1 30ލ? & &(Q:/R/0S/S:00/ @-R@3 *0\ @^ ^ ^  Q0S0QA\ x(000 R!  Q 0 ARL ?R@- RQ0A  RL ?RO00CH(00/C/A-@P`TP% UVT ŠP @TP 0?Sp 00(00QSp@-`@P 喊P@`VP  0R p/pA-PAUQ?UU@A`pp W ڀ1APӖ(00Ζ00ʖ?00Q @-A?SSRB 0@S A诖00誖(00/-- Mt ЍЍ/@-M@ ^p TЍR/0S0 \ R 0S0000/O-P MPp 0EU"S} `@&P-TR +T} Y >pN[`00D" [*SP# K@00Ds P a0Ds0SW0DA0Ds0S70DS| Y[SP;+0S \0J0 ЍY@0Tg UGp Pa 0A0C0B QSnUPPZ`K>pa00D0 0R0   ЍY @~0T- U% Pp8a00D~0T00XS$@ 00DAAs PQ2Pp>cj p>cP0 ?0 ৓@Pp>c00DX00XS UPpb 0L00XS UpbPPp>c 0=U0@PP.@ p>cP334  000 0M0Ѝ <A-00 rMPPp`, V4 @X0^00pAtA0O `p00TAΌ 00`L PP%0 @t0 0 1 30rߍX0X XF0 (V<0< <G0 /=   P D 0   M Ѝ  -- M0 0 ЍЍ/--0 M0( 0 Ѝ Ѝ/ 8O-@SM \ YXb 0pS000!R !01 ᓆPP E`#3`7P*Q30A 0#1#2#4#8 <P 8   ୓ U 0C  pSOP0 0@pQ 0S  Ѝ荔T 0 @00808 8@0 {| 0 0 ҌA-@`Pp70 {0@7$0$ 0 M Ѝ| Tgxp@-0 000St@@@pdddPP@PK@P 0000 0 tg8 lgp@-P@" p@A-@`Pppp0php T  4<0   A x,)A-pP@`  F y000b@P p@-@PPpp@O-N>?#c!!"N .  "bQp.5:bQ\. 1h.#c!!2N 0  ]0@ S 0!Yw0`0S00p S `l0 @ pE``0 S00C  B2=Q/0A!b0dP  @YG0`0S00@ S 0   B2<Q/0A!b0dP  @uY'0`0S00 S$0 p@`; Q00dP  @QY0`0S00 S0 p@`\; Q00dP  @(Y0`0S00 Sa/0 b !P :Q00dP  @ Y0`0S00 SB: Q00dP  @Y0`0S00 S*  0 p@n``p0 @`~9 Q0 0dP  @Yo0`0S00h SPQ / b !P  @)0 dP0  @YO0`0S00H S(Q0 0 dP  @Y60`0S00/ S Q |((0 dP0  @jY0`0S00 SU*P#U&P(Q0 0 dP  @IY0`0S00 S7 Q00dP  @1Y0`0S00 Sj0 <008@0 0@D00dPH00L0080 0X0h' Y0 `0S00 SD 0@E0@ S0 Ř Y0`0S00 S-Y@0L& `0S00 S00`&@1?2c 1 R11Aãd0Sâ/c1S0c05dP 0Yh0`0S00a S 08  @8  p480 S0R`05I0dP0 5 0@Y=0`0S006 S0 p@ `'0dPS004 0@gY0`0S00 SY@ 0,$ `0S00 S0 p@` 0@S 8 @ pq   pq 0 ARh 0<S-Q S b 3Q" "2<0 0"b@ Y V YH ` R  dP Y0`0S00 Y"`0 p@j`0@S 1Y} I` R  t S`pUP 0@Sh P 0P  Y   R ` R   PP0`p @`E0@ Sf 1h Y<0`0S005 Y0@SV 1 Y)0`0S00" Y   lP\)\( m  4 ~p }* } }  |T { {p { z z Ҝ,dD u@n~~}}I$Q, pL8 8  0@ XP(\  cd00Zl  t  0$ (P, VRO gR 0` p `0L, ?A1c$ (P0?"dN2c 1 11N @0?2cQ  111@/ d0 S  á/c1S0c01dP 0Y0`0S00 S 01Q00dP Yp0`0S00i S( ` `o 0P 3 dPC-MP@`p<0@000 08 @pT `ppFЍ"00Ѝ@-$$@M Ѝ C-`pP\@\@ M D0D 0 00 @  Ѝ 4C-pP`@XX M @0( 0 p 0@  Ѝ 4@-0N~ \0N~@ T \ځT00\x00p@-0@-S`M `+SP0 P( 02c2c200:S V00c0Ѝp;0 P 0 2c100:S<0 P 0 00Ѝp@-0@JS( MS 00C S! 0P 0/S 00 0  P 0.S  0{P 0.S  40n@0 dm A-10#Lc\3j*0Sn SW @Q ! 0h !!!0C0Xÿ0+" ?00 #2>`T[ c0 (: 600+$0+>! 0!Â!!!0C0(AX Oÿ@1+" ?00 #2>[?W'`F@PGp1#1 :#0! a,V"! / $25:(" 0"8#2>@"Q0 3 #P201d0U\d25? B4sppp0/S[0 hs c0 ㌁(a"(: 6 o`00+$0+.21110BX2;#(0`T[`n@t c0 d4#$: 600*$0*.T3$1110B@Tp3 I:#$B0Ns3`0 `cR`@ V0$T Ba!kYC(1 ?  0c0(0($(: 600)$0!)>T$ 0Â!!!0C0t$X|ß)" ?00 #2>r/E B  2?A1c1c0R@ 0B 05P!@ 502c,%2c2A@" "b1C S/  0@ p0\\%\:#吅  00u!ό#1 W?0}:5$  *4Ϡ! 5*111A T 1#0 0! C2 ! 02">"@T0@000&  0@00U``PE0S0@P P$ 0Ѝ& t)1? 0 c0n0'):60 0($00'(>!!!0CH'0YP("0 #2>L<0`0@<' 0 @<0`0@꾆T 0 @-M0@vP T 00t0(0Ѝ 00p0 ^ ^lO-M 00 S` P@$ 0,  +!/ "b0"b!\ 2J#"  , a p Bp{0Sh+p "?"pWpp'pW00̇#1? @?Z R<0"# aᩀAppjR?c# ? Q!Q00́ 1>0!  Z0S  T*Ϡ.l  a^Z R `Szʟ   VP@@%y .X )  W.y 5:IP % ^, Ό3# qdO0RS@00C| 0R `?# 0Ϡ 0,όក(~C1   ቂᡍ  ǟ 0R0 pƟ ' ^, Όp3p#p q\ ` V PE   Uʨ6 00cPS;Q$0(080` P@p`PL40#XTu YW W0d#Qp? 00?0S 8<@W 8<08$ #3@`TFJ#M @A 0S1 0NpsŸ " 0<0  0 S !P10_g00<0 S" 0Q0 U 0< UQ{0 #"<pp0U  0  R!yh&0P l6m&NS 0S >S`@0FS@|ЍS*S0S -S0 C R0`@0FSH pP Z 0S10ƒ!1 hh "00@i}Y OX10\1 001Y <Y"0 S0S >S@p 0H0N<)`h0hlpt 8}*YY -Y00I S@0JS0   S ,S;SQHAL d ;S,Sc SsH^%- Q 019mPhi`019mo\` @KOPhiR`̠L 9 bp&kg.htlw@0 0N\hP|00 @| @ P 1 @00 S1 @0CP00lP 0,Sd0,0bP 0S  H LI$ bh& `p&g.tl6w6p `4@ `pؔ؄ğ@(0$cR0#03 1d002c2c# b?0cZ[  Y  R `pI  <$cR*4$LP 0 S 1I0 `p4@ 34@0 ă@0 p0`cP0#031d002c2c3?0cP`cs \pP  P0D309#cP*430301c00 p S00`4@0՘0"4p 8` @@  `p@D 00g 04p8`<p0 HR0C°1|p `04@ yx 9̀\) \({ 83P 7A-PQ@D 0S! pN,00 01h6l6h`P`P 0:S _P `VpFPW N hu0PPT`V_pHPNLg@P`kPpV`P 4rA-A`P@pM uPPPWwPqpATS  P;UD |QL l1l!0 t0000`0V m``@ vD P =D0C0CS\@0d/@D  3@DPt00#  1PWPࣹ Q0IUh,hP@P0P P0p0 000` 2 dPfpHS 1 c0@-n@ 0 0!R !d b bx@-\F ! L3/L2S @00P2S T/0#03T0#S0 P0P@T@@P20CP2P2SU PU Ѝ\00P2S `@T 0400P2StH< A-`0P0Q0\\ MS@P1 V9 T@p`0 80xq|qc8OT@D @@p@`8P1TA`NPP]0@ 0 0 1 30ލp0p pP0 tVT0T TQ0 tvT 0  ( X^$ H^48  ^ -(0( 00M 00Ѝ  --8M$ 00  0 0 0wЍЍ/ H0--M0 iЍЍ/p@-0 0@PX#j`00CS`0p S u P `X0 X PXjpXs`u \0\ 0 `00CS`0ppSr P X0X /XT <--00 M (0 X( ЍЍ/ --4 M0( 0 X0Ѝ Ѝ/ tG-@SpP^ 0S:X( (S Y" WH i0` V V,* t0p0J00PQ`uT 0 @00 `pp`0P/0`Vp C000 i t0 0SJ 0 00ui0 Q0 s0 =0 sI#pPX0X X0 {s0 0CNi Ip%8 Y YY Y--M  zЍ Ѝ/ -- M0 0 ЍЍ/@-aPP`@M8  /pP& $o@P#  0P S 0p@ 0$  0, 0 (0 0 Ѝ&u0000@Ѝ0 {jЍ808 8>0 s 4X X(@-@P h 0#C@h0 ;0 r dWp@-P`@n R T0U:T0T:p@sRZ@-p@-@QPJ 00!R ! 00! \ uP 0B RQ`' Q0AP R 0 U00SpjfP#1fP `+fP0 \0\ \0 W}r 00B808 8<0 qrrt 00Vd V8 VA- R`#P$@ R0 0,°0` 0  a0R00SH PA@\`2 0[1!pP  w0S< 0[1!pqP  w0S p w0SB 0[1!pS w0S, 0[1!pD[O[Mw0S 0[1!p3 P>   w0S pT 0[1!p@@PZ@P"Z P PP 00B S01 00B 0B P$R w0S p% [1 0!p0 *R# 0B Q@ 00B SP i  w0S  qp q  w0S `p  ;  w0SV 0[1!pw0S Cp  0[1!pwX0S 0[1!pw0S 0[1!p}wM0S 0[1!ppw0S  pw/0S 0[1!pWw0S 0[1!pJ pu pn pgs R  0p 0Z  [@ 1, pJ pC  w0S p6  0[1!p  w0S 0[1!p I w0S p J w0S 0[1!p npD gpp T  [p$ Tp MpI Fp)_ w0S 0[1!p] w0S 0[1!p , wt0S p 0[1!pnE w0S p$R_0@' p7 w10S py  0[1!p?w0Sj 0[1!p2w0S pXw[0S pL@ w>0S p?  0[1!p  w 0S p*  0[1!p p P  pC {p tpD mp P  0B Q^@ 0B 0B P$R8 w" R 0Kp0 [1@ P  P  P  P  P  P  P  P q0 S p  0[1@!r P h$R@00 P ] P X P S} Pz Nx Pu Is Pp Dn Pk ?i Pf :d Pa 5_ P\ 0Z PW +U PR &P PM !K PH F PC A P> < P9 7 P4 2 P/ -  V P( & P# !w0S p  0[1!p P  P  P  P  P O-@ϟM M0Pƍ0TH P@ H0S 0T00!R !000h00 Q 0SN   RT p H 0  0 L (/찍 4 K/@(嘰d 00080l0`0$00@T& `%T @T0PFU$0pJ!(0PQPw00$pT  0 @P `~0-1,0`4 0EZS00 P`P   R00s H0S P`p>+h1RR\hOh>TQ.`Cmˠ0MPQPDH T,TdD@|8HLI`P$`G`P`$`0@ 0@004p00EPqp00E S$Ua ,pS2 U zUP ^0P00(00{0$080S 80匠0@0S$00$00ZZ ,< 0 6 30o$܍ЍUX +;   0Ol>U`X QP @n~@\X<D-$0\, Q00S@00儰0AXP\ 0,0\K0@DT%L`0`P0Q ,pAW'S@0$000(000@T0St 5^paU` P X0 D -1 00 S0 00 SP0100 P000p0 `P 0BL00?V0X r -!S 80S 0P80 $0p0S-0~00s<0 P=^'` X  `  h      " P @NP0`00@p0S' 0 0p1S 0qSt 0倀0 0 o@@@PJ@@,```Q @0:p8 ^ 0!S0~0 Vw 0@@0\0L0@ R Rd d`!2 > 0, 0f 0dP0pPE@PI0`0`a0` p :) R 1P- 0 S0~0<0V @H`S-0`~0k @0` dPD`PEUVdU 0 @~U \0  X0<0D01S L0 0< D0010R+ S0bB- C S1!v,,BcS0C0P0`00pBEQ0@*n0 Byi   Be0b S00dP`NdP`0pPE0p0BPEP 0\~0-\ Qd00,0[,pAWWڜ堠 ᘐpGW   R ^ WZ P  pGW( 0P0\p0@DTT5ژp(G@DT   0R0 S Z0P00O@DT 0 @0\@0L DQQ8LP<@ET@T ڜ0Q`@0F<THX`p<W`  hQ00 PEUPU ڜ0Q`P0 UJZYZW`P(pP@FJZ"   0RP0 S Y0P000{Y0P002 Q/P`ph@qp@\q`L0 0PLP0 S  MY0P 000( L@NZl\00S  /Y0P 00e0= ,(0pAW00WKY`(P@FpGW   0RP0 S Y0P008pGW0*0 Pp0 S@0$0Xz堠pt@ @ᘐpHX   R ^ X P  HX( 0t@0\0~Q-Q/>S(-0d0V~^ 0 @\0U X0  <0D0S  XP @@U S(0^L0(0CP0)0A00Q_  h00Q@T^ L 8P~@\0`0Sd  +XP @@b0l0>00(S0  X0P 00K(0S0  X0P 00:~0S 0~Q00t W0P$( - t QS t W0P(  t T800NS `U~/o`0 @P0\@X@<@D0S<0SP 0PS@@Z(ڀ_`P(pP@FJZ   0RP0 S W0P00JZ0  0\0 = 0  S0 P0Ϡ P0R-0q~0 0@S࠳   @V  R 00P1s 0P0 S-Q1X\ ܎@X  D@d+;   04dk`S<0( 8  0\00 SP0000! 1P0R 00P1@8`\0X0D0/ 0\0Y0\}o` ʟ< DpX `""  $ B Q/:2#0/ 0  0 !.R@# @@'A@@ @ pQO |A0F0PF# <@ `P QpppPppW @"D<" P 00,0QK0(S02(0D 00 ER0 nn2!  00Bl00?R0Sc 0l S~PL@P8`/\@X@<@ 7T 0P n( <0SPL0PS 0@QL0 0O(0T0P00. R T0P 00} G-P9pR 00P1sS~ 0 0pp0uSP001P$0 ;% ^< 00~  0S ϠD^d 0Sp~` @倀R 0P ^Z 0Sp~`-@^Y  00 S~  t S0P 00o  SD0P 00 00 0\`` d X T H`h8ڸt3\  Hۘ x ,\ ϔ  <D ̸ ` pHt0>@h  %LQ0#"002(c`38 CSD0P 00 xS  P000 P000p 0{ *S0P 00 _0-10l0XDpdP0pPE$S 1,0P`#p x0D RPPS 00C? 0@*S(070<0@8`\0X0/=P000 P0et@d{TR堀P(PpH@DT$   0RP0 S  R0P00 0S  R0P 00 ,0\@0U@Vd? PPQa T0qp@*  $0@00S0  {R0P 00(0P0P00P0}NP0 00~RP0 0倀P 0p0P P0PP0P0 00~RP0  00(p^p 0 R! ~0W`SW 0 0p1.R9 0P1^9 0 R! ~0:C^ 00~` 0S@ @@@MP0 R ~P0'P00ppP00P0 R~pP0@m  >P0 R~pP0@^P0 R ~P0\(\8\ 8 0_%S(@0P0PpP0P0PP0Jm(8  0^ B0?V0L @ SP00P0$00 00H 0p 0SP0 , P0P0 R~P0@ "P0 R~P0@bP0 R~pP0@VP0 R~pP0@o @8 HP00ppP00LP0 R~ ϠP0dm @P0PϠP0< P0P( @ < bP0 R~ ϠP0AJP0PpP0EH 0@000\0X0P`00E SUpqp00A S$Q0)S5 1 0P`:0S P0p4 H SP00P0$00 0` 0 0$ 0H 0_p9S0P0`1 ` 000 P0 0H 0Hp# 0SP0  P0 0pwp@-@`P MDpS@0p0 00s0@S Ѝ FA-@P`pS0 ]0@SO-[T/ M p0D30P  $ ЍO{[D{&{3`): @y 0Se0T0 2aPPlv"! 0#000  @ 0 l`@Pr 0Q/ R  B / 0RA-@P'`Bp1W@* R0C@C   TV X@@pp0 `f360@p1W@:b d PPO- -TM@0 ` O0t00 0'P |0p-P 000P0 0 00@ S0<0 ` 0@|`00@ SVV!Ђ0 @ 0SЍ 0S0 EP 0t0 00S 4`@0LSu ?o2D040Q040吊g{V{ V ڐ*5 g{0[1k{ {5UV00 S 00Sf0 %0fS00 8 FY+0 S 8% k Y1{{'{"" 8xP. 0x0LY0 ] 0xP00 A RH Q8 CY YxUy0x000<08 S  H00S80H00 00 400V 00@LS A4D(PQ۟䫟˟滟P?@0 0PXT0`@P@e 0P0  T ! S0Y P    !Sx@儐V 0PDp0 W40@0( 8 @p`C0D4p@`@Q0C @D@`@T00S0S@D`FpG40SDQ]00SVW 0P0 Y `P 0S0S @  @5 XpPppW6 D0  R P" Z_H08 S0t0 (@ T0 @DTQ [ Z.0MNp\0 0x( 0#[00S0L0I pl @P< lQW【   !  P+ 0Sv p  UpL0x 0Z0 0C?o20S )K{8Ik{mZɋr 0S)     &?@<V? ̀?N00XS p|p0P P0 04 Q|000St00t0R  tЍ @(|0|00+S -S0 0C ^0S|,|00S 1C\L!Z  ( R3iS; 1IS8 NS,d|`c P% 0t00 00|00(ST 000 P PI \ @( EQ0 030 |t0)2S$"4{LL؂(* /B B Hk'0CSX 0 "0(0 {" II0{  k{{&0{ 0|V0u0S|00S n1CQ 0ESa 0 ;|Lj i  |3 k0Y1{{{"" )2S#{؂(* /B B  Hk'0CSX 0" 0(0 {" II0{ 8 k{{&0{000|0P> p000000|00L `|00C ^^|@|00C ^^0 @S0@0 V`∀V!Ђ PP`oV! {{V0C|00C [s|00N0C [L\gL0QLaLnS s 6L0D k @  B1{{t00{0 G Т\Pq0800 $&%&( {{& II `rP  XZD 0IP\0 P#  B\" 0SG x (0 0R0x 0 0P0  P DQ k| Ph pu 0P0e@ 0P0\g P H0 0C BH0  R0P 0ꩋ{ ZNj Z{相D0吪SI83 D0S0\0 0\0␪相\000c\0Pja|/ @Py B\gH08 Sx  Bx {0{h{I{7{t0\(P0`@t0 0S 0 0ljhPfd 0R! 00SS SM SS V000 t0000 "aQ!*0P00  0c230 0 Sw <0S:t0Q000t0j @0t0]Q"00c @B P= 0x0C0Em?A??NH¨0 00 t00 2Q"000 000S0 EP Re )!0(t0 0Ip\0000600D0qp pkW000 0|0Pt 0 S 0|0@0a4`D00L0dH0 0 H0  U (P`@xpEW- 5 P 00C0#Z{相D0吪SI8 D0pS 0\0 {Nj0t0 0L@0AS4`0 `00cD00 0D0 0t000 P, (@T @DP(P`@ H0xP0C0cPh|`,P |0$0C|0#P|0 0|00000 t0m PH x0 0x0> !d d d dQ 0ES0(0@b|p`0C0@0㈀m0000 0P 0t *P"0 00d^L0HP\0 0H Pp\0P `r| 0 `@ ( t P"S050 0V(06080`L% k D005S!{{'t 00{Т G Pn 0 `(@B(;8 B(P`@ 6 k0D   f{0{' A1k{'t00{0 <0\0 0Dp\0b08050`R!00(P`@t0Z(P`@r 0S x0   ~\0 !80 00C tx 0Z(P`@h!0[t0 08 pH0SpW`PH P p0P00t08 0 00t MAds0S0S 0(P`@ 000800P0t0 $&%&( {{|( II&[! 7 0t  # U  R8 b Z[ 0t0Y (P`@t 3 Sy 0t00M P  xp1MpgpPx00x0!0t07H08 tS 00CxP0Q!0t00 R%0S<00<00t000CxP0Pb 0@0@-00G-` 0Q`@PJ PpPa0s z #8 *8"80 V# F0V B 3E  ^ pG0 s#8)8^ᲐB0B#Y 0U 0 Q 0PP   ! ZM!@P@O-3ß0 M00@Sp 21``C000 0S  0S  S0SB00XS 0Q P@  Q RWU\Q\WI:Q0 X \ 50QR j T0#03\0SWf*0 GV*0F@S3 F B S   3L0WR 06S PW*@DPD@ Q0B Q0Q l  l>U00XS Q0X j00Q )Q  0Ѝ|;^0  n2>000 )AoR㩒Y 0u Q=0>0l1 c, 0# Q:i O-M<0p μHJH:@`00S 000S 0@0S DA R[ % PD  \  P 0PS8 ZPP@Ѝ P0Q[V R 0 BPS10W ^P0E0CSڣ0SoP [ FU 0  UE\ PN Q UP   U 0CC10B0P0DS0 SE@TS@DTDX`  `R ߰ BP[10P0+S -S0P: P80 0@B\ P~sPP0 PBU0L[0lZD^ PdP [ 0 S S80S 000 0 b@0eL"00IZP0D^0[ @T0 QL 0S@00S P3 4^E *@C $`P `D21 2 Q\` T00 00S@0T@DUQV`Db  218 PE 8 @0T0 T1 T@00@0PS  Z @D@ R, 0 R Q 00PS00= 0P0@E FP 0 C0 RZ@Rh@DU 0S{ S SUUv EPq KP@"00ЍSn Sh S4 `Pb@00@0 00V@ !PJT 0 PeS5 0 0@0saF PeP\  0 S S GzK@"00Ѝ@?0PS- P l@0 Ѝ80S@V 0S S S@80S000L080S80S  0h800c8080S `T0D  RP!@I0@0  B0 QP[ 0Q SP߰ P[A1P0[80S@[- Z0`, D^  000P0E80S 0  BR "@w0P03880S P `Z ^  0`p 1P50PSP P | /A-@> RP`pn3 ^P 0 W@0 p0U0`PEPV 0 BP @` pT  0 BPp0U`89@-M`p @ 0  B00C2S  6cJ @{k Ѝ@-@0AC^ 0S R@-@A0B@SA *@QAAT D B @ H0"S1 1  !2R / 3RS/0 |0|0 c Ra X0X0 c RA 4040 c R/BAAA-@T0000bQ1 !0U2. n" p(  U2.0D10C#0R!0 0U U0D1 0CC!S R 0 @-P@M: Q @ 0 R Q @ЍA-(a(1`pP0MS3 U10AT !0S 000 z@T  0S00 0Ѝ  @00D1S@000ڴ0S 000Ѵ ht@H ܌0p@-@P0p R pPQ`00App@脸D `Ჴ80 0QApp@覴 t?H?h0  +0#10/sQ#8sQ#4  00/sQ #2#01  //30A-`p@P p1,0@U00p 0Sp1P@P$pP   ! Gl`hP0301#S412ss /"r3J / R//@-@P0@0O-0Z  @ S MpP; PaU* F B  G  ^ !*0I0C X00 ZP`V 060Y00ZP`T@T 06S @ ЍG-聟0PpS%Q@Y A@iV'10SQ`P] 00001010i0S p1⎳ @P4 P1 p@T `P@T10SfP@$ 000S 0d0_@T 0C  pP@h0LiV0S <0A ,0R0i ;Xtq;HhH9G-`0b@TP塢ڃ0TP$ Zp  7F p0   a!  \2)R0L`0C\0030 `.pG \ `$-0P!1^$23\ *G-0@`@DTP  !1QF*32\ H*@@P`P @P @pq0 0S 0S W 0G`WL3 ``PQ@ H 00P0S 3 # Q0 A B  02NS cP 0!0P` A-P@Q`pE: 0` P0T @ *\ l1 0E%T& 501 P%&0;B0T `6,#511,?C- M{VP@P А4&66W0p0Y 0 CII5` Ѝ z P `!300SY 0C@@1` Ѝ0S0/0 R /@-`ap`@PMA H1P4PP2 pP,0S  Q5 ;p 0: S.@P 0uPP0@ 0$  0,  0( 0 0ЍF00Ѝ\PT0T TE0 D F00FO00 4U$b0p@-@P 900CS00 P9pP0 =0 CYDa@-@P 00CS00 @ 0  I0 CalXp@-@PPD 0rS= wS+ aS3`0S  +S" e0Cs\S0 0S``p0S0S0S`0`SxE 0 p` 0 >0 dCa`8p@-@P8 0S> %9 P00P! !' 0S 3/PP೼000P @ P 00 00`埴00aa 9d0`` 0p呴6P404 480 CE 0P0VX_ @-@P 00!R !+P 0C 0 ;0 BU^|@-@P 0 0 S @R60 ;0 BUh^@0PᱰHᬰ5P00s07l l0l J0 zB  0@000 psD 0 @00 t\S-Ѝ/@-^@S S S  `0@ m D0@ cFD 0  0@ x@600 0 00000/<P@- 0At @"D41S} C- Pq M  a 6/p`@`A/|pd APpMOĀmX@Q 0p5jPS`Q 0p*jPHQ 0p jP> Q 0pjP4Q 0p jP*Q 0pjP Q 0piP@Q 0piP  T ЍCOC, Ѝ/aQ@-P @41S  P hP0CA-4!@ pPP/1S 0L1Ѳ @P!ʲBPPPUQPMoP PQp ᰲW ECp_oR@Cp=Cpp@-@P 0@ᗲ@A-@`WP] VapPJPQ V 0E( Q Q Q Q Q Q'  Ǡ    Ǡ   V Ǡ Ǡ Ǡ  V B0@BB@SSO-P M1 Sw$aVp$(q SSp A`TO X`A ( Pʀ ರ[ `(q^ 0P@  Ѝ Co$B/0S (xp Ჰ[ Q @pT`xP0TC G(VK ( 1$! AT$$(0 [ `(0 A^& S :0  @P:B@@,A \$R(!r8 V(, T001000 @([$<((~ Q ذ0 0 @ $A !`($aW夰0 ?0(S 0 oP_ D0^0x$USLpRe`e RO-,M0 0 S ! rp2/0, (Q0 Py @`P@P\&$P 0  CZC 0@PUpWW 0 `PQ 0@SPPU2J[Ipp,Ѝ 0 `nPPu2  $`nP$`  0 `P% 0@SP㲀0C  P\ \1 \"  IfP  0 tiP@0`00,Ѝ 0 ciP0 0 †Ằ[ PಐU I  fP(A0DS V(Qp  0p^nP 0 @-@ ! \ @$@,@00,1S@-@0@ @00,1R@-@1  @0@,@ ,!G-᜕0S M; Ppw`@PJ WQ    @P 0 bp@p/ uP  0Rp '0 X$ PU! A/ Qp AP` V @Z|4  !2/@P Op ίg@pލ8ğ P(P ZQ(P aD0!B1\0 Q!N@X QW0 ppP$4q$QFP ll 0hhhSh@dC 0` p 0! `pލ@ m@Qyd @`V <P "4 008P` aD>@ >X PpP^4U Q\3P DD"PPeL4p:P3`Y Š  0$ fPO13 JI< ,0(`Q|P8XacP0Ƞ jD 04 `8P D ! E>@ A>dPP |?``0S 0q?n?@ph?p[e?p0#]?@X?@ PaX,l O-(P`P10p5fS@(Pp5 RؑeP- (3 ,0[ D D S 1"1 Onhꂡ )P ر $ J= oؑ@-@ 13/, (Q0@-@Q .00 2> 0 O-fMS` $ [pW 00PЍ p 6&0P 0լ@P 0Q10$12宫PP. 5@X0 20S00500500x50 0p50 0h500`500X5000 S S q>00P ѭp ˭ 20 2  00p *0gWp W|3Wx# 2[ 00 20120qSG  000 1S 08 G8 @Rr*X w?w?Á Ñ 0 ,P0 "  D-P 1S0S1S -0 29 20 29 20S 28 2DPU01S #P,D nPxP   R < "4 < p0"< S04$8<(048, 48 (4 <0(<0'4<0 '< 0.4<0.<$0,4,< 0,< $((0+4 ,<0+< ,0P0SM p "0!0 & [&@P8 Vi V1 Ve (0aV@ &TA  B&@P 10CS`*0Fs @崒 0S 0S 0A@T @崒(0QaVU @b,  1& &@P 0VSa V0F &@ & & @ ⴒ[ @Iy洒 U(01ḑ0CS㣠y'*z0YV+ ` a&V %@P 긑0(0 @崒 /`FvVv @: 0 b4 @2"b0 4 @崒, 12& %@P 1ᴐV0CSy`!*v0Ya V0F1ᴐቐ  10@! & %@P] ` ` ?1!b0 B40Cs 0 0 0Fs+0!10@崐 % S%@P0 10CS`:t0t tb0 4\0\ \b0 4+fhf|*e$(e4a%0a`|$,`_#x__#T_p@-@`PP Y0 00(0`00Q(0pO-,@(ƟP LMQDp` %00 2^V  500%5 0 D0 30cLЍ0w R*R* 4p 0$00 <000S0 P8080 0Vk 1S6 $P䑄/  0尡0 0!00 BR{?ⰰ0弰:1S 0[S ZP 0 ᰰ0000S !% o P 0崐V` S0! 1 BR,*0  P 20 2r(k i0w Qx X$`P_ 0 p $R0CS㣰*{0Y* C00C 1! 0Cs0 ! 11 0 0(0  0RK 1S RQ  RYF  $ 20 2JZ㪠o*zJ [i PcM0V㰐0`0 2 i Sf m$ 7p 0,00 4000S0(p0000(01 S0"1!{/010CSP *u00C S {?尐!0 b0 y2a0y漐ᰐ0`0q400\0\ \b0 c2D0D Db0 Z2k |YXYhYYXXO-(0pM I @aP0`f0PP P FP1uP0y1JZqa@0 R 0 1Q@@10CS㣰N* 0Ks0S0Cs00 VqS10C1(0  0R/ Ѝ@ Q! R b0 `(0p+ 0  UPS  p 0 0 p1 S0C1ȁ,3,#,b0 1T> Y3 0I 1pP(00(0U QPEUP*0EY*0 p1Pu YQEQPEUP*uP0EY Vp崑 (00(0B10CS0I*S ```@0 `p崑P Q "PP @ PAHP^(00 (0#0!0!0 |"PPm 1P0CS㣠=*0J 1(P(00  "0 b0 .10 1pP(00(00 0b 1u00C SpQPEUP:x0x xb0 1u`0` `b0 0 "kVl4V|T,T<SSS\SSp8Sp@-@PQQp "P 0 0"Q !P 0 0"ppO-P,a V0Fj  1!@P! `Vp0ഀ0 0 lpq 10CS0s0*S0SU P P 1!b0 0  H k1zp0FV㴠q1p 0 R 0 1Spp10CS㣰4*0Ks0S  Cr 0 S00s060W10C1  " R `P  0! 0 P! !(0( (b0 )0Q`QPP(O-Pp@Q$M !00 2T T 200$Ѝ(  @h 007嘷嘧0 0  `P]  R [t@Y* P 0PeA 2@D @dT㴐: 0 bt@/Y:Aᴐ@DT@* 0t@ @DOoS0CB0  0jp= 0S0C@0  P 10CS0P*s0SUP@  pP 10CS0*s0SG 1 :1@0CS0*s0S#P 0!k +!fTy*t@T~P\ 20 2$Ѝ050%0b0 Z/T  !5%b0 K/ T`  0 0M P+  0SH @`tl S: `V  q, W@ t@@DXL  q Ws 0G 13 P AᴀW@DT@:b0 .3#b0 .    pPRPp 838#80b .03#b0 .8@W1 @t@ @01p 1 0@1@p01g  P@ Iy0  W P 0 o@T (F T"000{` 8  Pm ,` 0R X $ qV@D  q0V" @0G 1PL WR  B1r T 崠0@D1 %!0I@Dst0p崠1 加1 0p  aP$ 10CS㣐:0 b0 #.   IP OlOPLLLhLLLK,K<J|JJTJH H@-@PM 0 0P Ѝ0 50 - GO-ŸJM M@Pč`pPg VW00?2$0S 0SNIPIT/ P /00P"D2 0 4 30Jލ Ѝ$ > 0X0 0UXS 00; Iw0. T:+[) P0K/S  0d0P00: S }/000S0I Ss/?00(1(!(?0 e-QP PV# 4- p!X/0SY  \0 RK Y .PA/00W p xP //@om9 G H ER Q0P:Q0Q:.@-&@-@@ᤚ $ @ 2p@-@ P #)P$ p@ѳ 10@-@T M 000 @忟P 0S  Ѝ e 1 0O-TM Pp`0H0 @D8  $(4PD 0,0`< @@pLp PP  좟쒟肟 `p  @$ "dXb`%0#  `!,l(a `& `zcna'b(*abf` +l(ldH)c: fj.`d\l` %pଊ眉a*pl&`ah猈b,)` &`dL(bdl+`|.plXp`<%cjgpl& ```ga*aldH(d` &b()`b`j+g .pl\c:%pWpl̠>7O- @\X1XM00p 8`PP   000 0Xp. R+ X   h &  0 0  < 40 0 0 30ЍQf] } |@-pQpP`MD⫙f0S7 喙@P P=UЍ Ѝf0S" #p #'p0 00  0p@  p YTp@@ePU ቘ @ PJȱC$ +@ *< )0O-ŸdM \000 00A0PEZ!0 B"3+S+s`@? Y: Ri:0GZ0#Z*WI @`p @ `@`@P W0@P["Zc!1 0 \0 30\dЍt!t1t p$ 0*@  +W? @ A S@ 0 ` n+@ 0 [ 0`@ 0 $ 0T* T:0GZ0Z 0 0$ B*0GZ0ZW[`0@D z y::t9999l O-Ÿ2 M0p@`000 刀 * @!0 @  S P &\  @ ㌱?P ^艐    n@PF *Z3 Z0  D 0F VP  P 00e @@ԗP0 f0`00d X (0 0 0 30Ѝ w88$ $ $ $d u0@- 04M 0P0,00C @T d 0T T H0 0 ,0 304Ѝ0$ .q u # u,A-$!$1 0HM Q0D00@P ` @cT( 0Tٖ ` SV p 0V  S h X0 0 D0 30 HЍ$ $ ꫖! t " " sC- 0 04MP`0,001&`@ pW:T p 0T &T H0 0 ,0 304Ѝ$ n s ! r0@- 0 ,M0 0$00 @ P#T ` 0T P D0 0 $0 30,Ѝ0$ s@ r r<@- 0 0,MPQ0$00` W p@ T 0T x l0 0 $0 30,ЍP P0P 0 q($ 8{ q  qxt22(A-@P` Aq08c8q0P00P 0p0S   L| P)00  000 0S$1  @p  P 0  DP 0 0 02ZO-رK[@pv*{0 8c80 Pa{`FP 0` 0 VH*vP P  C{沱ᶱ PaP`F ` VB*vP P00 000 0 OVv`:*V 0 rPP:Vv` *V 0 0sPP:1 0 b 0' 0 0b '1 0 b 0'h h0h b 0'L0L LL0 '\..(4-.----/</LO-,M01P0CSPᰐ0*10C 1R0 0r0 0*0S) @p`4 00 04 00$PY P P0ES00 01P0P0PYi00CV 0@p P `Uv`d* 0Pu@S0SZ 000pVwp:@@T$P*t@1@A(0  0R 1 S0"s0&1!V 0 0C01ő YP0P 0Ӂ 0C00V*S 0P0@Pr V @Bt@Q 01Y00!00Se*00CVa YPU:T2T 0&01 P0P P P q01P0 P0P gTP   r` @ps0v`@Vt@@TH*t0 Y !0s00 s01,Ѝ   r   rpGwp@@T$PK: 0  0L&A0 0  0@& 0 b 06&t t0t  0,&`@pOXX),(\*x(,*H(H(\h')C-Mp`@P%  PP 0!0 000 0`r 0@@!! 0 040000 00v@PЍЍO-M@ p8pPPN 01 0 0 0رR 0ⲱ 0 1ᰰ0CS`G*v0[: ر `PH 01 00 00Q00岱000 P 0 0V<0 00%!p&Vp@PЍpЍ 0p!0@P4 404 b 0o% "t%,%@O-\M`0儀pS>D0@ P(0$  p@T X6*1#0Cs0 11 " r S 0 0 0@SD@ a,^p  l8 00`8,000F 1DPR `V 0`0 v`0CcS00 p㰑1 0CS*0S 00p"@ `V@ 00 0 00CS00 1!R p0p  0  00 0VS00 IY㩐*y扐1 0 0TPLH0PH2/  Wp 00 1p0 pp,0 0#S1 0Cs01 1   00000 { 0@00DpS, 0S 2  0 s  1 -a0S @ R3@p00 ,L 0 S@Dp     \Ѝ3@S00 01040封HX㨀*004 1xpC0wp0qqᰁpHX㨀*0x03@S00 01040封H⨀Xx*X 0 0 sP:400 H x0 岁ᴁqpGpWwp*W 0 0 sP:0 0]  IY㩐`*y0V* C``F  001`01jpL  ~ z@ t pe`V@Dp  0 00Q00 0 P 0 0 0N각HX㨀p*x戀1040F각HX㨀[*x戀1040`!1 b 0v# 2  03 c?W@ Z 0 0t!t1t b 0Y#+X!X1X b 0O#7 n j;1!b0 !0@K{0' 1 0p1p@01N P01 @Dt@ @U0PE10Z!0s00 !((ݐ8p`pۀ(R0</ B$0A00 0P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/000/ @-@P L  0 0@ (!0 "وO-@P2M0\0(P 00$` p @ ` pP0%0g#" 0," ^0  0#0F &0eA$  "eK$  0 h10\00` pP 0 1 cIC$A$ 00#l!!00%b !b  A@YIH$*E$00@0 @000000 00 0 0 00 000 000 00Ѝ 4$0G-1?p@P` @g(XQ q!$0@0$0 0@`F0( 0`Hp& ?V8@F?@( 0@  @T 0 -$0<$0 00T 0?`@p?V @?V@F?@"@@< T"?@@@?`V (a!"0 "A-@PP $`?7 ) p0(0 0`0$0d0V0 SAh   08R(@R )@ b (p8  )8 b (pR @-S/ @-@-@P P Ό 0 0@ (l 0 "R @-,/ @-p@-@P X00m]\`  0 PB 0 $$p@O- 6LM0^o~? 00p(@ @,@@0@$@4@ (@8@ HP$D, @<@P0P8pP@ `,$` `@,P@P(` .w0` y  ,`0 .) 'p',') "!p00 "`(   " p$0%/$! p   !p 0 ,$~o%arp' +lc  !``&``&!p` 0 p $`Y(`300~?004@8      , 0! A"Ġ0̌? 0#P$Ġ_̌#,,0#, ' IG) "@P@P@!W!IYG`%KD "@@Q< ! @@8`a` A0iAqNf`&@p0yAvN@$"#%C$-Q "P8`ˠČ ,0 `P0@0#<`@0@`Q `.0@@p0 P( 0$ /P)Π+! Œ,+N /)! B,p`@$,#,@$ &` .` ` " ` .4@0c0P PX$( X DP0 0 0 00 000 00000000000$00$0 0,0 0,0(040(084000 000 <0 0< 080LЍЀDp@-@  0pRPQp bPPo QP0P0L0@H 0D0 0p@RR Q bPPGp D0G-1p@P` gPX9 $0 #$ L00L0H00H0`FP`P.VFppp$;  S$P*$0 $UPP`V Pa$0 #$$0 $VF Pp h$;  S$P*$0 $U`‐V PR @-/p@-@PP C0 E8R pp@-@P X00k]\`  0 P0 $$pɀR @-H/p@-@PP 0 E(R p00@-<PM0 P87@0;P3 zP DP6E@05P& 6P $ڼ6P 0P@0Ġ 0+ P0H 坏p Hߍ000ߍ0?CPn 0P@ @0H rp HP ߍ0T@0ĠEDCB4P P@0H A04pH0<,+*)(&%{ {@ @0Ġ 0|P`zfbGlFh@0Ġ1p@0ĠX@0Ġ#A=951-73HⶢPLH⫢P |@0Ġ\@0ĠD@0Ġ     dN{0H {Qp l P@0H A@p D0/ 0=@0S,(@0Ġit@0Ġb R̸<8t8h` iD{G-p8M(`P {{텉@W@V@U@T4 0S !Q4 0S3 Q!-VL W`0b U p p P\K  0 020  @U =8Ѝ0SZ  Qp 0{ 0h2{`"P 0w ! r R  #m:VW$ Upm P`10    0 0UU0  P R & U  Pp\ P0 0VwW0 UpN 1 P0  `  } z00 R y000 P0SQ q0Sy Yb @aU^ PTd0P0  T 4p h 0`$ p L  X H 0 P0  7p@-0@T 03/@TjPP f00@T 03/@T\qpWH00@T 03/@T$Pp  \@-@M@P Ѝ{  0{ 呌p P000 0A0  H-M 0ЍO-p@R M ഁУP  `B80 S! 0SK: Z 0 Z 0"80S8  0Q@0 E 0 0 Ѝ 2  Z  00  00 0 P 00  P00 2  ᯉP   ꨉP  000@-0 P R@MP Q( ! 0  0 Q   0 13/Ѝ0s?0r? <P100@-@P0U1!^ 0C B^ \ L0D0p@-0P`U1!^ 0F BS @\ `fpUpG-`P @P0Sp:ؑI Y `1`! { E PU p @PpP pPO-Mq0 P0 pG 0  PU @P U`1`!   8[ 0PU0  ЍЍ0A- P@d P 0 a`F X P@D pT P/0@ 0A0S*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-40P$<D%LT,\ Ġ.̌8 R*0 :Ġ.̌ R*A R: B0-80P$8H%HX,X Ƞ.Ȍ8 R*0 :Ƞ.Ȍ R*A R: B0-<0P$4L%D\,T ̠.Č8 R*0 :̠.Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-#81 ,Ġ̌%T\$DL0P  R*0@ :#Ġ01̌  R* R: B0@-#81 ,ȠȌ%XX$HH0P  R*0@ :#Ƞ01Ȍ  R* R: B0@-#81 ,̠Č%\T$LD0P  R*0@ :#̠01Č  R*0@/p@-@Pp00Sp (PW7:w` 5 7's0_UPP604< W00S  0 \$ YPPU PBWY0– 2\< Q(( Q :PU 0 SR4@T 000S  00P<@T 4Z @ [`@ UD 0S7 0 4P0@SpU1c/`> SG 0 SR@T 000S $0S !0` 0S 0@T 90@S c/\f0S   P0 SRPU R000S  ?000 SR@T >00 R 00"00#3 0 2 30ߍc/\% p <@Td0 SR@T 000S  ]00c/\@0m@ *tX *㈀2 `0 R$S Uᅀ00*PKY`l2 0<`0p4p哅T4ᎅp%0 S ((Wࠓࠃ\^` `0\w\440 0 < \R< \T0` @ g P0 SR@TH `00C@ @ `5` 0PP ` <@T@@ b W {@ 0 SR @T ^000S  !@ 경` ' T< Ԍ !t 4 A-P`pX@M@`@"00 0,00(000f0@Ѝ ̤@- A0@ @ €1p@-P@Q 0P ! "0 2pp@fp@-@P` VP#p0-P@  P 0S RP0/P *0?c0 ?oPP0/0/R00 B-ptx` PP5y  R i  ` RPJPN P?e0 ?o60⃑ i`PI 0 08P?e0 ?oP 0C!P05H RJ@+ IP?e0 ?o5H0 SP RZ 0P@ 4 0S00Y+R03<PR#4@@PPrR PP @0!32P#4@@@ P5`P_eP _oA/@-$!$1 0MQ020# 0S0* /!PR*  R @ 1@r0Q R Q*Q  Rh `0 0 2 30ߍ@ 40 0 2 30ߍ@5 X   /O-p?o2P00#R00,MSP KW@  0R0 000$00 0000SU 0SS0哨(g 0 00(S@C0 $P#  7/P 7/P` 0S 0 0P`0`cV0= F B R Q @E"PBPEUP!U Y*0SF* Sc:P 0Cn0 0000S0  RR㢀@(@ 0 P   `7/ 0P 0B  P @V, 7/PX X  00R0X 0 00 @`0#!0 R0 0X   S X 0 0 00  "! R0 0 S*S:  X  QX F ^ @E"PBPEUP!U @  B*7/P  7/Px 0 S 0SN 0#10S0S0壀S0哨( 0 0 X BuPS 0 1 0 07/`P  7/P0H 07/`P w7/Pڅ0`DP 7/P ]7/P 7/P]P$0@ "! R0 C  7/P P0P0Sy,Ѝ! ^ @E"PBPEUP!U  B%QPU P 0 'P 0 C07/PK 7/PPC7/P 7/P7/Pm  7/P e@S@8 ) 7/Pg  7/PP0 0 0@哢)YP `c⃰Z~* P  Uu@P 7/PmY Y   0 T0 0#0Q0 @0@ @m0 (0( (l0 <-0 M0 Ѝ4R Q0P:Q0Q:{@-ӹA- 4PS@M  $3/ dp0) PQ00 }4P4S  $3/000Ѝ00A- 4dpV:@T@T 0P0 S  00 S  0@P0`0dp@A A-`M pJ@P0: StsPP ˅P@ P 0 tdЍ,00PЍ( $$4/p@-P$0r0" @`Pp$U04  0B0  0R 1 00 0 p  0% 0A ΀ 0@-SN 00AS 0;O-4 MS{@Ap⇁0PS`*0S'  TP Z !P0 00 Q   0     Ѝ P?  0  PQ20 {$R P1)400@000dS0  pq0Vp 0  $6/ Ѝ W00 ЍQ00MO000Q 000A/0@-S@  R   0 0Sp@-@PT @T 0 app@T嬓P`p  0S S/P/ Č Ȍ$(0c03?c00 R  0 !!!0 ?oP//@-P0Sp@M:Q !SV@Ѝ0A 0` P Fb @ЍT 0 @00O-PP X 0S L K 0SH p@ap-[0T B,B R`  0S7*V5* 000&P<0@D0CS0 T0@p@pT T 1 ! ,03/P00CS@D0/PQQ    D R ! ,03/`Pʼ@00 "R( T`1 `! 00PVQlRO ,03/`PY R 00CS@D0 T@0Tp   P @V`!  0 0C0   BR @pZT `@ 0`V:t}0P 00``F0``G  0Y0C00 00oP   0 0C0 `  000YP nd0d dG0 XH0H HH0 00Z 00V|ŬŰńp@-PP& 0 `V 0@0@DT`0@T`  ,03/Pʼ0@00pD0Spp@/0 V0 b {tİ0p@-@P0 &0 P'pN 0P0, @^z cPXzp tR0 q R/ S/p@- Q@PP: 100S 0  R 0   p.  0R00  0 0c00 P @P _}0 0 $0s0 ,0, ,<0 p yx@-0aPP`p@M) W1 T9 p pɒP0:*C/o" R  S L 0( 0R  ; 0 Ѝ;0t0t t0 WX0X X0 T<0< <0 xl@-"2 R0lM@PP0d00< 0 C 00  h"\2 0 d0 30lЍ 0`0S& pgz0PQ " WP00^0pS pp?PP000!1 |0 - 0S!$p@ ᥖVPC \10F LL10/R  0 p8{ {7{ 00{ 0SQ ` 000p p00` pp| |0|  0 ` P ` L Dv$H,$p@-@0MPTx00TaVyV( gy0T1S Ox0T1SYy0`Ay 00UTX!\!R Ѝp@/x\!Fy00Ѝp@&x00UX\! X\!0 000S/ ltp@-0 00PUp@0x00TQyU0` TQUP wpX1P0X1x0T0`X1 <th0h 000S/@-@0w0X10CSX1 @wT1O1x0@w t0 000S/g $t0 000S/p@-P@0wU0 \AQ\ X10CSX1 p@w`x0T1Ow0p@w t-X X0 04M 0,008 00 0 ,0 304Ѝ P (p@-@QP  p@$ې 0 90 @,tvO-MD@؃ [0`P@HpVV^ U0DPW p T"S 000@0`Ѝ0 00 0 0L0@ 0S 00 000S0S Q .[ 00SV00ЍW00 Q0![00S0S @ d0d dK0 _ VH0H HM0 U "00@ "00l$ll@l-M{,0,0 0{ {000{0mЍ php@-@PP` 0S&U  pp᪎P%0/%p0:0pl0l lC0  T0T T0A  0S 404 4B0 {0~D~ ~p@-@PP`M% 0S.U7 0  0 pp00pq 0 :pp0Ѝp@7 0S$0@ 00DA Bs QR cp >` S0T3 W 0p p|x 0@`p> PPL1L!L?0 B0p 0>00D,00XS W#0p 0 000XS W ppp 0A0C0B QSWpppPe0p 0> 0W 0@ p p0@ p 3333334cw000 0M0Ѝ ,0@-PPM @0  8P 8 ,0 0 0 30Ѝ0Ӱ8  D0 S4 0 /@- Lu0 S 0,/00@-uTH0 S8 0 / 00@- u0 S 0,/00@-tH0 S8 0  / 00(@-p t\0 S 0, /000@-\t H0 S8 0 / 00<@-G ds0 S 0,/00D@-3shH0 S8 0 / 00P@- s0 S 0,/00X@- rH0 S8 0 / 00d@- rp0 S 0,/00l@-r H0 S8 0 / 00x@- xq0 S 0,/00@-q|H0 S8 0  / 00@- q(0 S 0, /00@-pH0 S8 0 / 00@-z 0p0 S 0, /00@-fp4H0 S8 0 @/ 00@-Q o0 S 0,@/00@-=oH0 S8 0 / 00@-( o<0 S 0,/00@-nH0 S8 0  / 00@- Dn0 S 0, /00@-nHD0 S4 0 / 00@- m0 S 0,/00@-mD0 S4 0 / 00B@- $m\0 S 0,/00@-m @/ /H-M 0ЍA-`@PpA8#pW 0P@-M?#O0S!/"  QO$R!Q Ѝ  0S RP/0?c0 ?oP/p@- MP 0 0000`!@!`0@PP  9P< (0 0 0 30 Ѝp @ ߴA-P@`PpR#W (`SRQ Q` 0Bj ?o/o0CS 10cÀ4B0WR% /o?o BR Y 0b1À04BϠ@U\ ^@ R0᠏W00 EW  U$ 0e0?oc804/oo@p@! R b8<Qm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ / 0@-@P  000 / RC/A 0\R#R! R/ 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/ 0 ///Q R Q/U/Q0 R Q/00/Q- S 0S  P0 000S00@-Q @% TS 0 C0 P @D^TPPU0N QP Q  00S @R S Q0 S 00 /0 0/U/S 0 0R0Q0 /0 U0/Q@-# S% @P0C S@  PQP @ ^  0@@U0@ @-Q@ S^ QNP  S^ PU@Q @0SQ RU // Q#/  //s R PS 0 0/0 0/U/0 0/SR  Q 0/0 U0/0 0/0/R  -/p@-@RP` R V  U  R 0 p0 0 ]fQRp@-`P@ 0S0 0 0R0  0p 0   0f04R S 0Q00S0 0/0 0/0 // Q#/Q- S# PQ P P0C S00UPP-Q S0S P 0000S0@-M | @00PP00J L4 ,0 0 0 30ЍD м \- BMMRč `` T @P   Px72   DT 0@- @-xxŸtr M Mp$ȍP|`@M TF 88" ` (R(" @$@ P0 t!1 0 $8 30jލ ЍBn!`0 @p [ !0 xB^P.`!0 xsL100@A@  ,0 P0 \ AL+\ \^  \\\\\r1 \ pC|  δObD2, 0~xa ~0 K0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-40P$<D%LT,\ Ġ.̌8 R*0 :Ġ.̌ R*A R: B0-80P$8H%HX,X Ƞ.Ȍ8 R*0 :Ƞ.Ȍ R*A R: B0-<0P$4L%D\,T ̠.Č8 R*0 :̠.Č R*A0@-0M 00 000@>S@P  !0#00  :P0ЍM00&0 @-0M000 00@>S@ "0!,03,0  P0Ѝ)00@-@3@30 00/ -$0$0 0M 0(Ѝ Ǵ -- M0 0 ЍЍ/4 40 00S 0M00Ѝ/ Tt@-@p@-0@ ,ppP|c0Pp$$////// w//1O-0pPW`,M 02 00000"00  ( 05/,Ѝ蜇@PM 0S XXX S0 S0S3*0! 00S S( S000S  0S S * RpC 0QW 002 00 0 0 00t0t t0 O0X0X X0 EC@&4&%%%d%$$$$(YY///O-̟ M00P0Q0S Y [00< 0 0 0|<00$00%SSppSN 0 @p 0HZS00 X ;  0`P, 0,@0 R000  Q 0S00 [0ʄPU*0S [0Ԅ0ʄ`V* 00CS0C [ ʄ0S*00H00H S B  ] 0\0sRb{- S @# %%:P ऊ b`(a B0S`倊!h>0dU00`0d?* 000D@D0P0 `prpo@pl 0  `, P ,@0q *XP 00H S V ! 00H S /L|HP @T R 0P  0CR P0bP 0`BC p-0x $PpRPRP` p@ 0  0P00Q0@ Z"* 00[ʅ Q 00CS0C0 [ʄ0S* 0J C   0lX pp|  0000Rp%\{0S P`@0  0P00Q0 Z0504p0 z R| @10Pd0P00S00LS0B 0? T0SPA`B 0,Sc  0000 +00gpd0S 00^{[U P0 ) ' R ǣp @!#2d00 ^< 0a0 0R000P$0 R0   p0BP`  @ 00CS0C0S&0S+ Z  04040 ,0s 00CS0C  [ʄ0S*0S[ [0S000SS0S j 0 0000u 00CS0C8` P @ 0 Z0J0$#2 0 0 30Ѝ     000D0@N0|3 0  0 [000z 00 S}*%P ?0R PP 0A@00q0  0@ s0 0"@ s0pp-`A@0p000e@00qy!1  0 0  0%@#   " 0 0/ pT0 0 C pT YYXR $O0uMNMH`A-@P@ `t0pP@PU J0S 8/`PEuX@pW$0$ $:0 xXLd 0SS S  0R @-:o/ 0R0@o/O-$$@CM Mp4čP`0@  0 @0 44 30*Cލ Ѝ 0p `0pP lt0t  0pL+  i 0i/Z p X= G-0pS+ S'QU$ X!`@0S  0 0#40S 0S0S0S(  P# `VP@ Q@0 R!R  "$0 R R QO-`BM MVčH1 0!Ȁ Pp `V' 0  ]P@P U~^{^0 ZP9PH <0 0 4 30BލЍ꾢  TO-<<AM @ MTč1 0Y,:0`x0(SP3 0pW"W0 0@T 4^1^  0 P pW p   0W]PL @0 0 4 30Aލ Ѝ0x0(Sh  O-M Mtϟ0 p w [ !R & R! ` 0  0 ?8@X@0 90p t  0 H  . R< R30` တuP @R LP p ᰐ P R!RC7P `XP00S 0 0 0[ Pp@uopp0S 0PS 00 9 S 0S$< d d-  L X- T p P Ra0@0040v?D0\84 0` S1S @ 300S S00X01@ 021帡ZU0H0tSp0<0400SlATi @0CPh D0PPPyf 0;S<@  ޡP} a@_0PZP  4 @0 4 D 0 D @0R\80S  H0SQ ;<00 p  R  H *P{t`pP|@600P @:/P |+: 0 6 30Oݍ ЍY 4@PD0Py !}D0P0 w  0 ; X0\ D04000SR0X0S@0`S\0c  ۽`@0V000p`G/`50$0 P /0(`,0/ 00 ,   F )|PP1 UC(0 0R0O `1  0 90 X0L80Z   80080B$0 0 0 SP@0b0!0l刐?A9c!{P h0S d@b0P iȟ00( @   ,80P80D Q"  (<  0 0P bR`1  0 70TX0 800 00  1 01 080<`0  @{P'  0 Pm`1 q 0 70X0 80_0 M 00 X\6Pa0&0@ 8 XqV1a 00 0V$00I@0 ] 0T(0P0 `@vQP  Š20[000Q` ]0 0 v(0 01$000Pv 0 \5@X0 0HP80* {P0D v@t0P hğ00d$ @` 0  (0d0080hğ00$ @  0S0(0ʡA0+S .0CS:9P70 @v1@  +@)0Pj$P AQPRm `1S 0    R 0H080{|P8R4`!!! Q0   30 @| X0Q S0H R/ - qW *`\RP|@0p t@7/P `V q0 T2@X0 0`!02 @XKUS0 \01S@ 3`0`00S S000`P1; X`0 g{P00 `&zP101@PD7ZhP p0< 00 y<00P{00P 㸠D5 HBX }\Cރ{ z@yyx8wwpvvv,9,utpplp|pHopo0non nnlllplLl(l8lLkkTk\ TP Br R D yP%0d0"P 0@@ d06SV `mY6pSm06s H0 D0P TP Br R D yyP0d0@0P wg@00! @ q0S\ 0RT 0`1 i 0 10XP0 &0R  W Hg00L" @P B0 ,2 X@|0&0R   PD SH0Sk=00^g00"  c0|p w0006 Gr R D P T Br R D  R,#xPʉbU0@ 0zP`P 1011S1 C000 30 X0J/0 44@X@0" @&0R  <0d0"d000 d4 X0)0000i 0+S .0CSX@0P f00% @ 0+ (0d00d0@0P of`00% @ ix0d000 `0 1 mԜ05 @XPIf00 &  C{P0 @r 3fP00X& \ -e/0-P@@0/M- 0  0 R1#0e(6,  Ѝ/;M-  0S R B 0S N   Ѝ/;M  0S 0 0 0CSЍ/RЍ/0@-$MP@xP$Ѝ0 yP͡0ıġ0"c110$Ѝ00@-$MP@xP$Ѝ0 xP͡0ıġ0"c110$Ѝ0MM {{2aЍ/MM {0/1A#b{ Ѝ/bMO-@Ÿ CMM,čŸR1 PXd ,p0$P0000 0  } 0p d P;QP0@\400X PI00< !7 S000 $W \40 ; P0 0000 ; PP@ P0. !W H010,430CCލЍS  W 0S0Q( Q" Q V       0l00 }VVV8 i6@$@ 0gggC-LLPAM M č@`p04" R3 | 0@` || P,8ĝ0  0 0 4 30!AލЍR PP 0@ .R` @@H T|D D |uVؚ g4 (2 ff\O-AM⨑ M  čRwpPLpPG `L}PPB t @+0/>P7 0S4 `  0S+ 00@ p1P00@S 0S0S 00@ @K @ ` @ D ,0 0 4 30AލЍ_ P 4eX O-ß CMM`,čPp@X\6@U0S`  .S@0SVI:TW d1#T*0 ` D DR\ 0$00 0@@0S .S 0P0=S 1S St Su @0T$0[0 Pz8"02 0 ,4 30CލЍ0R.ST@ 0 @1( PPd!"" T00 0 00P00S !  @D DR0$0 0s<  FU80 vP0 1 00S|z0000   Rl@00S}0000  0s0S0S  UvUk t O-p0Ÿ\M P@`eT V 0"  #8 0ŌpU@ W 0 `\Ѝ 0FSX0 0 0 FTP0swpTT0SUPPf   B RX00 0 BSP TTT `HTVTѺ5,10c  0  z0 `F 0S0 s Tw~T T0swT0S`P  0P`HVTXV L0L L0 \Ѝ`HVT H^^ <^$C-@0 M`P(p)@D T@;)6T0Wp/T뵐0 " &T  @`D!T0?U0 S   Ѝ\ P P0P L0 N Ѝ0 `]0\\\G-@P` p嶒Ẃ- F0S@`@0WV!< S@S @,"0G?o`D2V0S ?V0*vG`DS0?U0S dX X0X T0 < <0< 8 0`\[p[A|[[X=O-0P䡐 M0S5 @@d@t@`p S S0  P&  P0 PI  P00^ l0  SR 0  SRS ЍPd1 02d1 HqyP0 dy  P  P060 P0 Ey }P  vP090\ -y000<&yi0:0  ZP  SP090090| DP010r  :P020h  00P0Z^ d@?P 1? # \ 0 2M$ 0P0ZC @?P 1? # \ 0 (32 P+ @ P010  P010[[[,([tZZ|Z+Z*Z8YY<YY))YD X dXXlXL@-@HMsxs% 0{ L  | 0 x{ 0sxHЍ L@-AMT  Ms0000 00sЍ@@0@- 0 A0tMT0l00  /s 0P0#0 -@ 80 0 l0 30tЍ0@@T  `A-@Pq 1!01n0SPpuOp qp0PSp@-Q@U x3s|p |]01P v]01000pqc sVxqP //5 P //TG-P@`>V$0QV@0\!R p Âp QVp "@p O-@8;_M M0,+0$; 0P050VQ0YU 0 0Z01'`,K 05p d!  d!. 0`1q1110[PP  <π0ʏ,z p", d10 d1r P% `P [`0DPS_H W p\ S S00 PpP0S SR#3:0 0CQS0 0CQS00000 9 wP ~?080}o 0p+08P 1#S;S 0(S# 0(So 0(S> 0(S 0t(S h8 R00sS1 S S08(  $8 R1 S S0S00 S S SS@@ `0 Z_A40P@00Q.0A#A'S? |7R1 S S00 R00S 0P0 S S00 $@@0S S 50 p@ @@@@@00@00806uO 0+ 0GPd4P R`P 0w4P 0R@wn@L0d!S 0 0 0d1p Qo|1 |Oqp @ όx0`0S W`0`SHPDHp .Sp0SWP`.pGWV0 0$PP % 40%004 0 5 30_ލ Ѝ4 Rq W W Zʨ$( 0$00,` `ᄴ  V V` VV00;V0SJ`V @4 @0p ;V  00@`V  PP   P 8 Q$h!P ``V;V #0 00@`V;V   P 8 Zl`(,`|3 R1 S S0Sq00 S S SS@@f `P 8Y _AcP@`0DPSH  \ S S00 QP0S R:0 SQ 0 SQ000004(}_P.-P `pY0!x3!|3p DPDQ xa` uQ``- IP 8 Qh!h!R1!RkP=hQeQ``P@.pO 2 N P ~D ~03 RR -@ddomasearnamesortoptionQxin0erOPtN0N$ wlist  chJ<JXJ0 p@- 1 P@hlHM QP T 000HЍpp Qx#r coV p 0 xP00oPT $000HЍpX<x@-@ RP0` PU ` 0P\\PpP pP sP pP O-0PSMp0  h4h0t0P0 `SW0P0 0@0$ (    >P ]qPX" RN  0!#X㼠`Ff 0PP P =qP R X@ PU& 0  0 `F@YP) (,$@  Q PX `F #Z }Yh 0 ,Y00`Sߍ @,(0P PEQ*( 2 " 0 ]  @  0` S  : 0C S : P CI⼰ R0 P XPJ( # X  r TPPJ, 0p  f0 H Q T P pZp  X   0 XC 0 y0 0 XrУ 0 k !D@-<0< 0@P @~5 0 0s k 8@-$0$ 0@P00 k00/ @-@P @X500s @-@P00p@-@PP  P  0 p 0  |0 DLAp@-@PPM0 0 ` 000dsPP0 GP _=PC  0 Ѝp;Ѝp  0 Ѝp( (0( $0$ 8@@ @-A`P@ MK !1 |Q0 Pp 0 RpGST `Up? Ѝ4A@oP! 0oP 0S@ R oP@  0 `Z Ѝ  0 Y Ѝ|0| |0 (dd d 0 `Y ihDH$#P?!??<!? >>?H!@>0A-0PU" 0U"0PUP!q@@ ``FVP  (wVP 0!E`1(,`P$02~Pnj''T O-Ff@0 MS`0 4 8 t& ( 0, \F\V@PR8 H601vW00g,1@06 B0R   50,@ 앟ş 1 c0@8' 0p,8 @ P 0,0 P| tup80Sg0S X 8 0SnX6S 8% 8 0S$up40S S 508 RU 8 0000040S4ğ0 , 4XA4*0210S P10q S^ X40, L40$0Sp 04041%40 ,< ,UjP0880^ 30, p ЍqR $0Q*# 043p084,P< p!@,%4%1Ru4#! 30@)!^ ^ ćrp$ S:p 0,"@ !0,0% P^8)20,  p20,@  \20,@  H20,@ 420,@ 20,4 20<  ,0쑟 0,0, 10, 꼑 ,0,10,0 R 00! 0x1x0 0 d10iTp ,8p ЍBp N=p 0y^4nqp2  Z 00K WƸ fƈPL44hH$ <(Ĥp,Ô08˜lD$tP< D776xO-01M0 X B* 1 a001Q0,0`P ^/?^_ +~0 0@S@ 00T 00}O R :R,000P R 0Y $00 Ѝp@-$0 01p m ]/ A-@@`V 0 CQPqTP pG 8PSP 0`04@-@00 R \\  $0!0D0 0@ ($ TT@-@PL  0S  T0S@TT@TP/0-` 00 0Q,000 P0($0 0p@-@P0`D P 0(S  1T  0"00`pp@-`0PQ@P PQP 00p/2 A- 0@S  P p00  ( $ 8PP(p`P0+O- ,0吻S 4Ms 0 x+x   / +~` P @<+00{p^/  [@P^_@@ T@ } @Q0 :Q , @T  :R^@Z t:0 hZh:P00<0 0PH` `@ 00H4S   !$R; PSk0 0,0Q090( RC 900 RB ) 0S  Q )0 0($k\Io@(p` 0,90 4 R B ɟ  B QR80  P`0N( ( ( X 0 80P ` |Up4Ѝh8 0`P jP @@8p0 00  ( 00DW0DS:7B0`700G@004  P`0 0 0H0C 0 1 ,Pp$p$p(,(\q*ppQj(pW pA$pW PF@`@`A$ppW0@  ^(0 1,P. @P&t@ @(`P, P  QP P  BR\`Ap0@(`P,  P1#0S0 0 PPp`@(( p( Pr $0 0@SA @`p  1P$  pW+00^00$p ^P; 0000 @`000)h4000C?00w( $0-Q$00( P A ,P$ppV (0$0 100!0@`p $P1(P$@ dmP@` p$0 V$000\JW 20$1,k, E0, 02B0@ (7mP 7 R-3P( 01 (0-lPP$ 0 1(P$@<0 (P$@$10$*[XU 0ppP10<0S  pt! ^O0}ς00P +.000P,! / 1:Q0@ Q10 `@ @0`9D YdL|@, p<.|$`,(,p'''d'$@-@P  0Q ^  00$0000 0@ ($ Xp@-l@@`VpPPp0U1pPE1PSp ( 0$ 0p QA-pA@PT`QV0GN@P 0 P"P`p p``@t$A-p`@)NPP T  000P   YV$$@-@@0/ x00(/h000/T004/@00/,00/ 00(/000/008/008/A-``PU 0AP pqpT0APP404 0 ,(0P LM!OO/-< <0  M00( $ HR Ѝ "@-@P E0`00@H0 50 gÈ4"@-@Q 00 2 U 0 G-hsPp@M 0p T 0S0{00 0  0 0$ -0{JPP 0` 2$ "Z &= " 28  0 0 0 pq| X X 000@Ф ci <R 2"00@Y 2: 2 (dP)0] 2< 210 010010 010 0100100100P 0 R00   0sT 0 2 13/p ЍTh0-00 PP 0`2 2y00@Z@P0S~X 2: 2l $Py 2 @0 2@001400 H8<,C-@`pQP M 000ES90 2 ] 0 R0S 2 %13/PP"?o2R03SH mP (0 $( p 2 P7 ЍP Ѝ00P("- $X000X "R0#03(0 $X "X002S13/p  ЍR @-@`pQP M 00U+0`V' 2S * 2 P13/PPF `P 0 p 2 P Ѝ [ Ѝ00PO-1PSM3:00 X'*q`I`[ 劘p@ p W 30 K PtZ 2< 2ЍЍЍLP O-MXr=*`00A̱PPpP W [K DL@P' Ȃ @1@DT0 @ 0S 2< 2Ѝ1@D0 @0 Pu 0SЍЍC-1`S M.:rWB R* U"R  R00U00SR 0  PpXB Ѝ 2< 2 Ѝ^LP ЍG-pZ RbM* U0U @ RD0  P XЍ@ 2< 2ЍЍG-P഑p 0@E `` I`qt1Q1v`01 @Q?zQAq @0 R 0 1Q@10CS㣐3*y0 0 00CSÐy0S Cr   0U0s00R!2 B0C!2 pl0l l0 rq0 zP 2: 24Ѝ?p`(0 0,9/P 0 CP' Y  0z S40  0(10S0 1$10$10 0S0>P 0 P0S 0.P  00S 1$10$100O-MYP@000X00 ``FV(:S 1 !r `p pGwp 厺 0 F pF000H00 B 00p0@000 ``FV>*Yv`G V `!0p pGwp f0I`v`0s0抠G0Zp01`*0ಠ0`0p00`PP~ Y```0S0`0F2"0y L02"0 BY0v`0``FVm*Xv`W ```2 0 0 00000``FVL*Xv`? Vp1p!w 0S Br p0 0`H`Fv` 0pwp0s0扐F0Y`01p *0ಐ0X0`0p0 00PP @00S80`0FMЍЍ0 00 0 0 0 0 0e 00 0k 0#`t0t tb0 dh<@`h<D h|G-p`P@ S  R0 ͘U@ T6 P X0SJ0SQ 0R0Ӳ00ô00 00As0R0 BY001*r 00 000`UU800C80| 剐BY001*d KP P0P  0D! 0R0ಐ0CSpO- R P0@ Br( R(,W ᐯ0P P I# F@P 0R  Br( Z`pV Z@  lP@@p@-P@ 0^\ ^ P0Q Pp\ p pG-@` 0PS 0S  0 Q@PS"  00S p\: 0 BS P= 0 \˗P   00(!S$! 10$1P0 ᷗP @0徐p 02p 0 S 510 B\r ᾐᖗP  $1 0$1(!600 O-\0`0CS0P@Lp M P A I@P& 0 0  eP 0z S0  Ѝ0 0S0LP 0 0P000@- M@ P p10 Ѝ0O-@pM 0 0p`Hp` ’ P PK0SRD0Z 00 @ @ 0 pWM0@r s pGW0J*0@p 0@000S p0Cps0W㲀Ḱ0=*0p00ᴀuPP D0ZPPЍ0 ᾖP 0  0Z 0  0P0 ph h0h d 0BP P0P 0H 80Tf,L4}$G-Ÿw?`0 0MR,@pl2SL:0JSI FPz P崐2Sk1! BRE:0CS㣠j*z0Y* C00C Զ101@0p扐0pĶ  20 28!01 0 ,0 30C0Ѝ P0 ZP崐 Z y0 pEP202 ,p 000 p$  ` 0 p E,0, ,b0 x ɀ|xA-@pPQ`M '00 2   Q Y:1Q|I0" B1"0001 0 VA0 0PU: Q * 2 13/p1  R* 2<00?0 P  R: 2 E0 EP VP V$P "0* " Ѝ 00Ѝ0PU Q:(0 $P0PU`P=P   n>P 21 zC?@-0 -M  @@00,3,#Ap: RPGP P k f0@3 hP>  2H@ P PxPePXP dP0 02@00t0!C!-\\ R0C0<20pW WT  R/ Y  5PPXPPqT! 3h`P "  4PP* kP0SQ tYPdqPeRp`@ 8%,1 B R  0S ិV X g 0S X  R 7/P  R 6$ > $ > \YTm%X4r -%<4444H4 hO-yMPf=0`Hx00 00 (Cp8`K[( 0RI Sh 0 0 P}vPePRPGPʚmf0@S (H0@ S aP0000 0`0 00 `00``0 0`0` 00 `0$``(`,`S7 0S 0SP0PK4P q'∷ P MS6pP/W  0 1+0S |Qp0S |&0S0@0@P0P/S VQ 0: S00! [sUQm0: S 00000#/W00S %҂0S0(00S00JpW   ۳0P0I \50 0"0P @/P05%0CS0 $ `=   `pPP0S 咂0Sr 00 |  B R\ L` V `,Q% /0 u!P@`40 !P` J/R  S/R/  # C  R: z ` I5 x3 0S S/R% 0`SR' P0sX0 0H!LR\0X!\R\ $MX00: S ϵ C C `vP0: S P1: S  : S!  Sm  Se 2j S^ S L0S !kPM,0SK ! FUF0(尥 0Z Z80 S801!Q p*PPP1: S >00Z0S 80X!0CS!80T1T!TviPR X0O 0S !k0S !qk剳yR[ (0S0S 0 0 Op!wm&  4%<557 %X5{%X 5 545566)6]& P6} 666  ?6hO-@Psd8;$&^Ap6V@ F&lP50Pel0S0 $ P0NP :m4P0805HP40lP0|%/,0@lPP8P08 454%HPNP8P H0 0 %43/00P08004 l4p!0P01lPP ,lP /0P n$0 nP0; S D0( @, "1H P85/TP0PN2PP P0 Ss堓0 CS /1#S!lP0 0, (S* B"!!0 l8PU H003/p0S0iH0803/paPP 0 &lh 0 S * X  0 $03/0 0 -Q0  U 43\m0  0 -1/ 3P0 0 0 ,&0 &P0$ ,!4l0 ,ذܠ[Z0 P  0 0&0 &  000 Rl0 0013/v Sxk SB}kX`\P0R , "PU`!0X`\PC @Pm:%< <'X%\'::'hh'X:' , 0'h:*dO-MMb9Gw '?p 0 Q 0  hH0(0X7G@-Pn 0@00$0<00D00000$0100000$000,00$0;0H00L00$060(00P00 00T00080S H4PU R(nR oR0P<0,㑸`P  6P8`P,}PPP{m SORN , 0xt5 PvvPp\a4 1SzH0S?80S<@0S9 P0SP \vP4PD0S 0$, +.p P44X(D`尠XV 0PU 0040D0S NmލЍS ,0SH sP 娠=`0@0S0H0S 0  FmoP P 3R㓵( F P3m W` 0Z ⓤP d3  TI%6P LT 0440`FP LPP oPPT0S810: S oPPP4 01!ǝP4L  0R p 0P0 T0SlZH R 0 T0S@"<LpnP4T0S 2<YV 8SS # =WpVH  #  !  ,"   $ ! , (,"   < 8    L H  3]P   JlP40SP8`m'p->> h>L>q>>&0?'%<?{ һ?T?h?MZ??s@-0DP000T00Sr0C?o21$=p0 1000C00S8 000-S30 2R(0pP EP SP 0 ,rQJNsP xP  4 3" 3" 3" 3!00000C0u㹺P#GDAx]@P ThYdIT(cQJtPL 32S ,#,(Q #o 2 0S 000S 0~{P 0sPvPC000!S 0 D0S <h000S ZP<43P0 A1S bVQ?P2S 1"P:Ua`0:EpoPQ100S S ɀ!0`0001v@P{ Pt uPo   Pn 2S 0"r r r2SA嗀PR2Sw |0"PP( T0"p(qP< <lP'8%<C{ z&0Cf-Sb'CwC'"<L'!CxBkh%CC@%@-@MP`/5P@@@P8B8r',"A<p 20 ER!kIps|wPePLP= PP0; FP f0@ S0 0!<p|1Q=0 q E - P. R1 R3 R 0!BSQ/ MJP*0: S&\00 {000 0 0 0 0  Q cL  J@P0: SpGP M@'# m%<E:hZO-`M@^5"IqpP!;p 10a1S 000`F0PmP pP Qz_P xj{`_PJ4[A Lp@ҷ,0Z 0IP0 0IP 00.0 * R 0Z /0 0 U:Hp @TLZIP U:Hpmz%<-4hO-JM M@&^ 75`R!;p1 @DTo0 aS T  KiP fP hP {vP00`0` 0QD$IpP0: S ! PP zP 0Y/S / J>00$CP@T ̽0p/SX/P弽0 S:Lp` ᄎpm'$LG%<pGA-`P@M]D4 0忪 HP  H HP  G HP  G HP  GPhd3P0\3P P$P@3( 0P+( P3( P7( P;( {P?P ( PsP( mP P8$@Ѝ(P (_PuP"㷿(0S (PP(0S (FP(0S (<P(0S (2Pq0S FP=|!0S0S p Tb`PLa @1R`ԼPU 0E /R 20P(PU  00,0/00p,0 0CS0 㘘P0$0v00S try0s00咚꩚ 'X&0gP'lL(g%aDZg@mg'%0 6'$h p@-@Ps\3`LP PP C`t V9ph00SV<P0y7P j$G 0@Jm]%<%%:O-MP<\`M3`pTFL&$9p @6@X/(60S ЍfP WP! PP p `RP dP 2vP iP0p0 `rPxP pp0p0p$plq [,1 i0?S: e0SܩHS 2  00PU 8FP$0 S`0S;D*0: S R   S/o" R 0: SDP0S  P SQE 0SE EP 0S 0?S 0Sm'Pr%< kr4rhrG-P@Z01`p!x7p 1 R1 p0C@P ?HpP vP0p`EP*p0S yVP /1P 0S 0S DP0*p0S [mF%<'xh0@-TM# 70 $ CDPD@EU0(E0T000D 0 DP00yC#1嚵P3 yWP 30S S S" 30S!  R `#6 R D#!SRD3IIE 3! $3 003 3  2^20S ( 2 20S L0S'002@T$SP0"/@;tB00CS00 t 0 8 V0S60016 R0S 10S<&0PR<U0 01 10SO 10SK(!l1X1PLH10S D10S `1 T1 u0S 160S ,@1 D01a()0S0F0S 00s0S0S 00c @|P@To' m~%b4'X'Ӕ'P'Ө'`'\ D~%c@%cH~'L%a'T~ C-@MP Y02b@@0 S p W"5pC 0 L1 0VPl7h 4DPT(Px ,DP<(88 $DP$|(T7 0DS 00S8 @0xL%0QD0@0 0Q%@0SV L PQ~u!a0@S0 @qzBP `ju@@L# $P "P %P 0@0 00  @L,L(,0@0 00 0 ׹PL #R =(D0S lx CPX(Fm%@%<@ tB@th@t& *-htg@-.XAEO-Mp%X$6/[@0o0C?o`S20@@@ @3#@2p3 X XT 0S9 Z`7 [``3 tRPGPP '`3H@ P `hP dP fP00vP003@0 0`00`k0T 00B0 S; : P" @' A0S #S(`'<2  ᒥ`P5 p000#Ǧ@P/0Sw '. h0P0 ʇp0‡p ' Bp Nt0S<0 0@00tDt50C S?0 0S $ pA/ P p0 R qX  Pp P    3/P00 S &$ p/ |( p[p000S 7Dm'@%ct}%< *- *4'L44hpLP4"4!( "0X!  P Q !0p0P0.pTK 0@SC|C )x08aP8 pJ0PU ,8 A 9 P P YP0ZS 6(`V  < C0P`||Q-%<z'D~DD{"/(D|>KZiuD}h&0araydictO-0-xOaM222 22223220`p@@ 0$00,//pj ?" 2`FS 20000b2^S R2SVV10 dbV% ``L0)p L&pP  ``L0)ppd2S P=PX0: S0d2232d2o``So}0 =`Ppo0S g ] zPRP3P/P6S@'P L=1@P A@P(=P 00j0000\ ,2,00SP n<P0d2M0 2J02G02D02A02>@X\ T @CBTaߍ02.202*02;/P8P000S a6p% 00Z / &PP000S O6p 0$0U /P000S =6p0 04n0(+2 [000 0B B{P 000S 3 S;3*00Z 0 {P 000SX"\2RRX2LZ/ ̧P P<PX0: S 9 PP 4'/ᵧP )0  pP>n`A;PP !UM;?<p \:zX10t C Zd `* ;Z 4 !14,)S$ !;̢03S8  803L8X8 P 0@A RZ 2SW 2S 0sS :p` d2SM K<p<W \1X! X1\!0\42T72P7( %dVƂS 2"0h 20pSb@H 0 00$0  00;2S1 bV.0@tb2@2S<5P! >ԋ0/00<48@)5P (3!` V!0T2<<23S 52BS``2S ;>8$)0 z4P ,8*8x82x4P `` 2H3< !` 2$3?0 !0 ` 23Z24P i/@gBE0`V6 `EV ``谝@t 1000S'V T#0   :0sLP ==z )>d P# @T3>TS >O"20"0]{7P|7Pkhh Ʈ( X(%ǓbŖŰ%%( ߉1ƿǸ-0O-EM MP 00P00`P蔟PP@ 0$*p0040pV4$@ ލ ЍyPcP PP! TP& P4 LLX>0;@$d0@S0 000000 )0 000000S : ᆣpPj00[ = 嵮P=0SH R) Q(nQoQ0 )#0PPu "=00"@ီP' {P" vP  iU.;P [p@.P FD"D28PB60Rb?00 =YpWH ` jTP/ ᒲPZ1!04P(`CQښ. .a0C 2 03i(4-%<4t 8&0 8(4(4>L>q%em(4t<Gg;(4@dz(5ʷhAdeLjא׹G-p@`㠁Q!#)p$V】 0S 0S h"``10pWA  P 80S  pW$ZЍyPmPPP fP A n0@ S0  0 0000000000`kNV 0OPPiAPeAP 5X-(:x%< :O-(4M$$` 7P! 26Pl50pCࣟ00PPP#(p4W00S 0S 0S Pp3 a X( 0S00uP Hp0S 4j,gWPY30S ЍzPOPBP FPG 6e2P@*P 00 ܬP2 ֬P2000b 0 eh|;0X 0忬P00 8帬P00 0 ceP} x000t00q00n0 md1 P :g00000X000T00Q000M000IpG00000A000=P;0SzYPXzU 0LP `IPozdZ 4dZ(L@(D-(H6M%<x(L :1g8|"%etlO-@MP8@J̰H(PUPE10ŮʤvPlP,HP1 TP3@ ` 5p@&ϰ  L@tqð0 S < E<0@Zs l+gd2m@ P ` @"<'p4 R 0S00!S0  1 ,0Q ᵫP,00S  0( @*P@J00-SF 80@0$0 @P@Ѝ$0W0}1 4?$040P ?000R0Sp i```8⍣p]0S=0S 00 0@@`p @$@ @P \s 03/p Tᖠ-= D`X%< Dldx1%e@-44,$0$00 Ѝ%f(Ox0O-@p8M -P`,@奮0F8 0⠮$`^ jp ep Yf5 R, 0PT 4p80P0\80@p|H X6LEUIH吅,5DuHuBh%9&p0($5O005SO 05- + 0(0,00(00 0  EP PP$eQzS `SNS7 AS( CSdt 0˾p0RDaC Q WS4$  $ 3RD +K L J sO 05N W WX3pM H $0%0 1 0 Hs ӣ$0@S ,eI 2Wppi zS ekSLSa"m0C S\00 rUrSXmFPH0SI0SO005SP L6PL ( HpP (0S  0C#P @P!M@᰺p``Up!? 'P!9  P|! 0S1`!w3/ 0Z|@ Phl PP"6Hc P<1R~p>(0$  p@5= 10>0S=D$R$r R  $tmBt $Jɧ<$.}p|0A: x0@ <$0x(0JA-p0, z_`PEB@D4T@@ 0$0<@P  Ps < $  x<  h<$$r $pL P 0<$0 00 L 0 0=0 08 L<  ;0Ar _; ;$i0 00 0  w`;[0 01 d0 | i(; M0 08 ,: H [:$?0 01 0  M:(10 01 0  ?:,#0 08 0  1H:0`:@4:0S  P p: 000 X u 01 0 0 :0 01 0  :0 01 0  H940 0c0 L0  D: 0 01 0 X 888Ȩ@0S C.0$ HP]^HP0@4 P@ 8(B^\8@,PD40 PD40D4  H 30P(0v `800!0 0!848Ce7@ P00]7 000  PL7$G: PgP/ bP ]0S 0T480 04001<4 4*8T?1. PEU UY V 0.p 0 PS 4S<4Y1 H$L40 V,p4l?H4LP80ԕS 4EnF/ᥠFLdHV0.= 0 4/ᖠ`p5VHLd4SL$H4R0 %*pP  V+p  4S@  iH`P  =h]  OPP;h%NPPX%XV+p (:: S0%4( $RQ*@P%4TpP$  ס脟P0HpWZc$R0 >$0@0p!$Tk = t,0帡P,0 r0 4P ⷡP$403m`Tk 40S0X44S.=0@+R$)SR' (80# *~咡Pb 0T40S凡P 3T#0S T4SdxP\3 s(8`+"ŸR L4H$Q*p\`` 0 H$L4#"1 '`pH2 C  \$0. ;|pnxkj 0P0 T  㹤H$Ld?&"h4S 0/? 0V0 N`0$$4RT SQ  0 V0  ;)p `VS  S!0$Qf +S0$0 Q$ Qq*4\m(WWrWW s%<Y8Ye-1g&0WU]X cF^<^_^v^&X0^XA_X_{X^%pN8NbXoX^XXZg(\0XXY YwZSYY(WYYYY(W tZ Z Z7 u ǷZxZZZ[[M[%o[[\%K[[\0WF\7\ELH$ P,} P+P *+0$PjS0[ 4S$DjP 44崀S04144 0S @4S 0 0@4,4S $4R#1ѣ1,40 0(0Uu (t (0S 0+@p@% P' 0d!|.;]P`E}~M+ zP9X+-Q :$4+041$4+T4S$ )d0,"|X.(u(s(q(P>)\4$8: L4d4: x0<$+0@ 0)pa_|P Z +ӟPڟPN  <✃p  T< > ,0+- , O-0pMI Mh4, (pP_8`4pGs04WZ h+  'YaB 4S<44S$$ 4R0XT('p D hQ)p , 4 SP,0S x 4$t W0 0L 4嵝pW $t1SC $4 $Q<*`|ZZU CUʘd7DPEUPP bPEUUPP 6 ('p00( R0C0s0So p mZ044s04d0 00 l0 6V0 08 4V< \0AG D0 00 0 70 0: ;  +0 0: ; 0 01 0 0 0c0 x0 @50 01 H0 z,00!0 0!n40(40SY00; \$6K0P0D$YhW(p 4S &PP$l$BQ`P#T  H(@_P<4(0(00`V Z<0 00p"#7$p = 0DP0 r0 4HP CP #0Y3}p$p4S80S4h 1S 1!B0"D 0S4 P $3" b1p1  $4 1 "\pX2   UY% xp& P tc $$t 4r(4S 0D,?0W0  4tS $$&R0 $$9Y0; 4 440 W0  %p YpWY0:R $RĔ\ 0  2 &0S Z &)  ۛY0⫱Y+(\x u-f%<YY(`ZSZx u%u`e]X cF^__X_{X^ZgeYYY(\} xfZ Z Z7 xZZZ[[MO-GM MP`h Р,t@ $p40PEPEUq@@5P 3D0403003x3-(|3 p0,@0p0P3000@30800838# 3@ 3D 2H2"20L02"`2h"@h2H"~{ P2 vp0V 0 $2lWi2 dp0X01!ZW 1R`Op0x0p0`1 ;&p㸐%X  y=yqL0 S H D 0Z W0S60SPT0 A/P"0 0 @x*x^I@PW Gލ Ѝ yR zx%<-Lpkk>l^_ll!l3qql?lPl_lnZg=_lO-` -@Mp L`K@%\UP^W %P$ph- $$pX `@j:< 4$WpJ( 0{@{0{SH{{S $P{{Z$P<;Sڧ$PP[ $ +< }[@ֻG8 ({:< (;S[dt \30T$2pGS1<+0X2$,30S# XC@4P 09 0(3 P P P  Q R2 V 0;8;08; 00p2H2Pf4"2 P R  ,y{ k;RV82 P P 2 R / < W 0< 0: 0 V@0 010@;E 0@0 00 008;0x1 P} P @ X1 R /  1P% 00z 00w 09t1 PP ` 0PR x0 PQ P 0 R @RE |h ??zG{AeA@bMR`wwx }y$)r(yIyeyyy%<xx6xOxlxxxxx)r<`y)rX-ym)i)iy&zQ)s z)rzz)s)rpwU)fzz)r@z)hX{D%{P)iK 0; 000 ` 0 0 000 0P 0 P R  Xp<00 ,D8d;2S 0: 0 h>t8@|10!Z 1@2TȌp Tpp̌ ňpp8 Pt  U 0@ @ 1 0@T`Pb 0C S_0400000,00(00$00 0000000000 0000000 0b0p R= @@(ȂW> {(Ns8;p 00 L0#p(8; 00 L0v#pH8; 00 0L0h#p 8; 00 hL0Z#p 0  | x+ y+ z+d+{+ + + ; '0cy;0z;(0x;p+00@⁝p L0-#P\;"0#10@00 0`K`QHD  `   ` 0#PpK0S `` K0"Pc 0  00 85"PDVd &0 XX(```5h%`"P`5%"㰝!2`(10kkkk,a0a4aU 0P````㗝<;SV">@˟ Xz{@ k:L:۟"@ 3XVz{@ k9I:`"2RgdD' { h30S 0 %' v L N@^IN2 X0引$!pV00 I@+P@0W0 00Dlz'@\2 appW T p ,2;"P L4"0:CS0L2"`pkL1堋{8 {'NjCAZAG@8țINrU{({ *X PaU7 O0S3 @h0xpT0T00p0p+t P :0S {ώ!t;<000[ X1 0 d|% &d2"SS% 0 " @$?6C-A~8@@)hH)r{%z)s )r@{!{a)r({{&0{)i%{< `H1 PS 2R`2p0Cs0WPP0R?L!Ld0 0 d20틟   i  `0/0h0lp0hs{{7{{{h3{{ {  M@ 9:#pR@h2'0h2#2d0Xp |e%<0 00H @0d2 0BS; (SC; = 0;c&p@0S:p2嶀!0H0Css0S0 0 0H s0<r M& 0 @2币  0h 0S h ;    0;&& 0' W |%<00 H 0@0p0V 0,1 JxP<0[0W G0 0RZW |$<00 H 0@0 0 0D H%p0Wp`%X%pL 0CS0 )i%{{|M{|()s %)r|> ~ ~"|||}}/0 MP @0Q,0 T%\`dl%`0ߋp@0tplhd`\XTPLH0 Pt (0  Pk 3Q0 \%O%0 PM C%0 P@ 9%0 P`6 0 P. Q Q ($~ |0 P |0 P 0 P 0 P 0 P 0 P` 0 P <0 {P $ 0= R90Si BS] S W |#<00 H 0@0p$I }T}h}}}}}}~~~4~F~k ~2~y~~~~~ &>Wm  3fEM)r\[aSIZ0KWI7Lx$DDD0J0ZD0 0I) 0K J0Kb  QJY0KWD01ʸ+Y vP WD0 D$D0J C <帛[WT3$pDDD0I0YD0  0J#1 KJ$ iW$jO-M`P @0-S@PP- @3 pģ#p*30SP a`F0P[:PQ9 JKP9  D oP4P@ 3C d0@S  Lp@20SK@HGG 0w 0E|BX `:PY'H`P-P`4b 2 R M  f 0 S A  < U+ 0 R ! 0!00 W  p8 0p_0S ^}WY}` pM0S CP0pt@@  0O Vt2}`*r ~6%<htBm5rʷKO-PAM M+@`:뼦P 4P60V00-S% @ P ្PlO@ p0K0\Z B`F0S0`@DDA@Du%ep ,0S@bLpP53 Q [ aP -00 `@Z-00  D0B5S0  00S OPN0 0F 4P N0000|400 |4 0S dN L4 00 8"P ~  300S Pl0$0g0(0d0,0at0C?o#2p R0S0$0P㴗t㱗P㬗Xy0H! @DT43a00@`FrS= RS iS1 mtS xSw$㨢в+ !30p 0A00@00S  0XY0S oKj`D<8 Q (0 B/S mY(0S b0 @(OB0S (0S |L1 0t0\xS @X=)(0S 430 @ Pp+ 0 pPUV>a@m*r ~P7OJ-l*(%{^%<4&0>%{T%yZ*,O-PLM'P N n. p=(,# PER a0:  @@0SCMvPcPSP TP LP Kd0@S0 0D003030800H00 30$30(30,30<00",00@)0,0p - qW3S)P  @ Px< P /P LЍO3S 00p,04 8<@ 0RWS[Z0DSPQL  0gS @!{$;0 0EY0P aR @L0Y S L0-Ss0 @ 3R:  "0 0|: ` P0 0\:0 0H:43043{0830<3@30@3ppzzyyx||{U ,0TU ,0U ,0U ,0U ,0 40 0U ,0'L00L0U ,4U S S0X0X(0CS0 0 PD#8 D#<#  T Q0T0083 00b0 X0X 0W@0W0W0W0,0  ,0 ṴP 坐PiH0Sx'xx 0>@PH0ST'TH02 ,0XS`X `43 S`IpE/aWF cW1 gW0Bp703S\0S^ 0gS$ H0S!*YP 0x&x  00S_ XZWZV 0S00  ,m0k4i8g<e@cDaWLЍ0000H3p0P xH30`pD30& 4 004 SSCP 0C00 ,0  4    0R:400,R0t ,0 0Rp B p z<0S $3S 4p0 00 R  B   0}z< Q $0Q p0 40 R  B   0ez< Q $0Q p0 80 R  B   0Mz< Q $0Qn p0 @0 R  B   05z< Q $0Q\ p0  <0 R  B   0z< Q $0QJ p<0pGSz $3S0S zD0S\ @~p707S ,00'c<sr=S  f  x     { Wڀ|p֓0S 00S 0S  Q 0   ytpW u8 30(#0<  / *x S 2%<Ew( ftm/ z%** ******!*}|St**GTbp}G-PXMp-yPHh  IDP b0@SS0 t80 6d( pX80U 0$60(60,6006046060860<60@60D60H6$&R 4&<  <&,&R 8&R 4&R <&R 06l'ShhQasHPA47=CP %PW0S  fP 0000唌P&T60 T)APRP061 (VUvp\f20+SpD(<6 000T<0 0/0P& !%T00p00 :XJP00G00Xp7 l5@P 00 B00C2#S0d0P0 00 B00C2#d v>C 0C0 0@0 B "00P 0P0A1#10C0 0P0A00C1# 0 0P0A00C1#0  00 B00C2#0pq,4 0Q0TPP3H܋JZp=V  x`2o`F#P0 0SU030#:U 5%$Pɪ+P t=" \T&P6K/r083TvPS0 0$S5# G@uSPEX 0K/r0Pu"E0<6SR46SR 0&2RRPX2 01u6S pzP0W0`W 0 +Q Ju,6S m/'`P 50PQ!VLuD<6S:46S: l1Q0@6D&S1 0 00Rt!  H&hRd! $&RX! 8&RL! 0&@R(+$y.CnA-P`pI䁟HM!p10PEU RHP h0@ S S HHIIp1%h1X1 T1 pa 8P `  1 ! KaRPP CG L<$@@`3@(@ @ RP P0S P|W JP \G0 0000  %<-%ʷ*ih ty tC0G-pHM`0*BR"p 2B1 pGS 1S 0$  !RS@# P+PTdP<$FxP`PAP MP !a0@S0 00 04044041! 00101@30@3101101101101ДY 000 0 HЍP PP  wF0S  #T0 `PJPW a W {#pGW R $Sw ,0< sW p*-%< %"h*%C-Mp`ᔏ݊PPEUx%Ap5U@U`F V/@T xŊP hP (aP tP,5 R '0%  PV 0S A@D 0(P`V  tP@PA@3P zP0S<0S000S00S00S00S00S 000#pPU 3 `V= V30SU7 0S4000000S@0000000 0$3D 0Ss<0Sn00Si2P0$0:^0S 0SX`V UURtP dP lPC UB U USD2PEUOPP UI Q PB 2E U2 @U U70000  n). U,O?PKz!0000 0 [)P  A' ~'$0S !) ' ppq,*c@HT " 0 s#&  @ #47$P @wP xrPh#*` i%< -&0 Lhe+>NC-@PpMa M!p10S QฑPE R ލ ЍRP fP74p*y/P` yDWOJYP1 JP/0: S2  S)J *P0 JN@n` 0S4S00`aˍ0S "pphJ *PJ *@PJ0K@*ė%<hĴybľĚC-PGMM |xK0lL3'dOoB:pp X*:(8ppP `,ZT`h[Pdh0p`*HJ<0 <*pPU0I P* 0 W0C 00܌10 \:  \⊋8PPT0>0 XP\0P) S%ŒP0 tilP9Tx TP 8h(p4xP 8T(X(f BbƇP 8h(d40EDS00  `8(, D8X(T( 08,8 8P 00S~ `8d B7, ,, ,q 7,m 7H(i1h8PIh7, \] h7L(YW+$w PR:?@ 0 7P(G7W)hp_P|78[ p;[YT!@PH1[@ .[0@`zPP0@P`p@+u0(@0@000pUp,`40U0 (P<P8g,(PR00S ,R  \0,0S f,8SH= ~n,8S m*QI_e@mu%% %<]}-%%*&0:May-%LQ/ #;3rʂAtK,V4  8* < eA-P`#-E&h&DP03qp2S l P@Ut~PO p 9P/P00@˜7' sXvP3034$}p(40pEWQU 4 000`ဃP C,tPE0S3 4# 3?POLIFrPl&@`pX P^L~PD304y8(v4S (SuP   @i P 4SsRuPn l  PpR},1`<01 1> 11/΅01<2F01$1t   #2R  'Kmp`a P^ Q1s0S >mj`xqāFtp  oQ00S up P *`3P?o20S R=?o20 P P lPu1s0S 0! SġS 0Rtp  \t=`S 0 0000 l*u1s0S v`+vx+3b)%<&+ ;%%a%++ h&mx@-@`ᚈ|PP h1 dq\!EpP10SAF01P> |1)ǃP  ƒP 0 nPbP 9P0P   c0@ S0 VP   00@0 P0  @0  00 ,{|0S3k+L %<3f3e &0x%A-`4C0P@00$ 0/P0 0hP008|Em므؈ƯdW]哤UP0r0m0"SP OU 0+0C0SPP \p<0PPE ̛P 0SěߛP10彛؛P1 0Q TU 0SǟPϝ㼟CPEl10S `10PM>HQ~0S,1,P#P 8k}R Pdpq 000000S 뱓{PP`0S PPt00S8+`3r+EF=++d+4%0+(+T+\+O-`pPLB!D@`4"p(2 0 qQ pPpGefuP`P GP IP EP 0 a0@S 0000hp:0Tn0C 0 0R080 h嚣0 l10 B1!1pqӴ0 iPPZh0[ = 0ZoR =-00+ 0 80 =0ZSVPMP 6P@ ?P7 4PHD=N@P fP j@P=P =0X1h<o)hVPȼ0V30 [0000z00u4 ˙Podl\i 0p?P 0P 岙0$Q^ 嫙0 Rj0 ڱPP  0p 呙84'000d1Zpdd 兢Ᵽ1S<P P; z ݔ:0P 0@ @ Tp  p U(  00 PQ819:`!\*d1 P p0@ 8AP-( (010S  0zP` 0Z) Z)  +x) 0  |`0G0` M  x9x@奟ⴟp(X  X ~0S` , ɡPQ 0S d!Zo00080`8"/0  ^  2s$8"/0 P2s Y"# Fp; 0<勡 RP$ m 0 00 7@Ԟp 138kMPTxHu 7@up0S dn0HX0S8l0S  F Q 8 0 'znp0S &dEapz0S &08P q |.tt6ql^0 G S 0p<7 [cp3 P $0$A>0 0T1 6T@pzXv$0 T1 5T@pLp -cp P 000Ql(僞 T夠0@00 P  ,0 @40 pP  0$ $# 433p D+p塠 4@嘜p4喠!Rd14d11ŢP0` {!BP0!煠00!R00SR`1hd1Z  R! Q01Y: /wd1 D1pW3 !( ; X >< 9帟(((1PU 0S 2PRP 0S  ŕ 0S }ݠp P ( RX R   (001&0 S   0V`V|aY嶟0@0@rUEhodok0/  s% BA %<m  -, @"Z4  !/X{ޠ=7NtY.dN4)Cjx%ؔ  Q/0p@-x@0Ppp@ P T0.9p@ 0 0$010x`0/O-1bM!0 Mb  [ !1 b0 0 30Zbݍ Ѝ  0 "m !l\ $ |`  $; 0 0 +Hp0Gp( 80G( G'p` x8_S0؀00 00 P00 @G0 TxP x8##[`@*IxP0 l8 40GPU P0 l8%L@HHL4HH0ƒ S$*0@- R P@ 0\ R^ H00"@ 800 0^ 00"@0/@-M  p LЍ h  0S/ -PM00 0 p 0 S 0 0 Ѝ :  /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b~*/{*/x*/u*/cr*/2o*/l*/i*/9f*/c*/`*/8]*/Z*/W*/T*/Q*/ N*/K*/H*/0E*/QB*/?*/)<*/{9*/|6*/#3*/)0*/=-*/**/'*/"$*/!*/*/*/*/////^*/ */ */<*/*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/ X*/*/ */|*/y*/v*/Ks*/+/jn*/Ok*/hh*/ie*/vb*/_*/ \*/Y*/V*/S*/P*/M*/!J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*Q/"*/*/*/6*/*///*//7 */>*/ 4T*/@-@z@*/*/*/*/ps_strings missing %juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeara.m.pmp.m.dstmnnoonmiddayiqvwututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!csp != &blank/usr/src/lib/libcurses/refresh.cunknownbel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangeacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error unknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat1.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON/usr/src/common/lib/libprop/prop_number.c%llirpn == pnintegerarray!((*cp) == '\0')/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNELSIOCS80211hidessidsocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)IEEE80211_IOC_FRAGTHRESHOLDIEEE80211_IOC_RTSTHRESHOLD RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: unknown standard formatCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %u%s: can't write sector %u180320360640720123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Checksum error %o, inode %ju file %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctlatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvp%s: unknown mode. TYPE %s %sTYPE %sContinue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20251028NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Can't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! timed out at eol chars transferred in can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular fileusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDtiso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARSLESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadtildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileTag not found%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread commandbranch%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 11.99.3 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.3 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.3 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.3 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.3 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.99.3 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.99.3 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog11.99.3xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv6hfeb/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv6hfeb/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failed executing: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICbase32dtbgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdm/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %u %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartmanlvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorparts->geo_sec != 0t != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interface%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duideloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6vsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %srt != NULL&ctx->froutes != rtsrt->rt_ifp != NULLaddingchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIASepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/etc/group/etc/master.passwd: (malloc) Error in munmap(): JPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSHTVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d 3gQ2VFZDBcMjr2x&!z2z2|2,d#,ыG#2@22Et22)p2t2ǧ2ĤDz|$222333 $D3,l383>~Tx9 8t&8&83I*3H*wO24A 3QJM 3ZPzV`XfT3bfTl3el3klxm3rm=ql3wt 3|yŶ{t3L2N// //////////"'+16!**33 $(*,. pushdnepopdne998#P@@99@@999`  ::d@@3(ld@@:unblock and -DNO_CONV?(|XLwfllll%,l2llllll8lllllllllll l"(/ll5ll;100 0prtstatTTT(IT@TTTI(1TITTT1sETw#Fm%c9wOdUsage: %s [-] [-ESsx] [-p string] [name] 49;9?ACBD69`hn<|AJ.O? [SV"ekqty2'3Rg!4&4,4411999999999999999999999999999999999999999999999999999e9999ln999999n999999999999$9'+-/91ANPRXPZ\^9b??????????????"%?????????????????????????????????????????????????????? ?????????!&*/?49@?lnuz? abcdfiklnoprstuvwxABDEGHLMPTUVXYZ2 )  A "11 eVeee././@LongLink+KKK<KK!!PXHl'Zha!U;D5AGS%-Y"VMffffikfXZfffffff\fff^f`fbu u uvvvv(2vv(2rv>vRvfEvwZvvvv#v v_v^vFv<v>w?ww'@NI$2Vkks{PATH=G   6:> vtjPED[[[[>0>&*->>>7;W[_cccc $/:EN%% /  KQyc L7 f Q/t)ѓk[Xng N!*":                  -Z<THS^H@})3yX~,OTTL 8T:dDƜO4_O\|Ʒ$$};< |G/c0pы8 d!4:4LLlixH # %%%%%""%% """"""&"" $$++BBBBB99BB>IKMOQS    2.*0(, 4 ,=P+/* Ɲ G  bKF:#h%D###"##$$ %"1%$&&0%##%%$q%UY]af#e3n#m3u2t3{3z# @B;@FEHP_gX @$+p1N8? C$C C$ C&,@4@ < ـ@ ov} @ ====0==0=9 % /"&),FBXi|~@@ @@@#@,@1@6@=@E@L @J@P@Y@a@hmsz Ԁ@ۀ@ Ձ!&-4>DJQY`g!om~)6Tpy5NRWн_djpv} )-,v5! ) .:J) !&-6>FLPWkajqz 5NRWн_djpv} )-,v5! ) .:JCXCXXSXCXXKXXXXC5NRWн_djpv} )-,v5! ) .:J0147:(@+TMP.2  ,m )<RsȆȭ . M x ɔ ɶs$^ʃʗʬ !+l#+l$"&+l1+l2*3+l4+l5F6+l8Q9W9^:w;ˑ<˯=@AB&CRDyȄF̤G̤H̤J̺LMNOPQ!R6SPTYUaVyW͓\͝a͸cdef3gFhFiFpMq+ls+lt+lucv+lwix}ΙΪ$6Wwϓϳ8Ja}Ев7W_PlяѢѱ+l+l+l+l3FSeҏҪ#;PmӅӣӾ(Hc~Դ+l+l +ԿE+lXՈ+lթ!Q 9Z][-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]Ƿ2Ƿ,v5! ) .:Jreturning to single-user after filesystem check readDosDirSectionreturning to single-user after filesystem check `gw*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~? wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_read 2X%e@6%e8< %e5>%e@@w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-6=P[w1c%eKKKEKKie4%e@,IWjE]a_cq ? N ?0 ?D ?X D D( Ep K, K@ KT Kh N K K K K N D(   ,v5! ) .:J vp%e@m )<RsȆȭ . M x ɔ ɶs$^ʃʗʬ !+l#+l$"&+l1+l2*3+l4+l5F6+l8Q9W9^:w;ˑ<˯=@AB&CRDyȄF̤G̤H̤J̺LMNOPQ!R6SPTYUaVyW͓\͝a͸cdef3gFhFiFpMq+ls+lt+lucv+lwix}ΙΪ$6Wwϓϳ8Ja}Ев7W_PlяѢѱ+l+l+l+l3FSeҏҪ#;PmӅӣӾ(Hc~Դ+l+l +ԿE+lXՈ+lթ!Q#{%e@G`~%e@#\%e@% %e@ 3%e*$&(Kd   '%eLd%e@ %eHFS0eC)IUFS0eC)O!haHdInotNeedEFI)Y)^*s(ҺK>;])hQn|n֏- q+)s)Qn|n֏- q+))Qn|n֏- q+))Qn|n֏- q+))Qn|n֏- q+)J=Gry=iG}))硝M;t?))WmCĄ 3KOO**yD¢<#*=(**(YBbRuoqr*2*AРD3h&*P*X \M}-*k*|ޔM@jy֬**-ıܹчH*-ܹчH*IZܹчHǷ*I􍂱ܹчH*I􍪱ܹчH)*I2ܹчH+LǠ6 %?a+#+('S@ۿ )Ѹ+5+<1*@ە )Ѹ+V.1ۏx )Ѹ+[+e.TSqHBo6֯i+u+hl%e@-%ebackupstore_gptstore_tbl3I%e@in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercaps1"101?[%+-/EYYYYYYYYsetifflagssetifprefixlensetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandsetifmetricsetifmtusetifnetmaskusagestatus58printallmaindo_setifpreferencedo_setifcaps8iz%g5iy%g`/%j%g`R%kx%kH/%j8_%j1%k: %g`7|%i:%g`:%j:#%j:%g`:"%g`:A:L:W:c:o :{::@:::: :0:@:::: :: ;@8init_current_mediasetmediamodesetmediaoptsetmediasetmediainst%m8?$>%m?#?$m(GNPwy]_wwwwwwwwwawwwwwwwwwwwwwwwcegikmoqsusetifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchansethidessidsetapbridgesetiffragsetifrtsDDDDD%mD%g`D%nDD@%g`A%nHAA *%g`%nE%n(E%mE%g`%nxA *%g`e%n(?%mE@BBAzAz?l?lА ,V4invalid major numberinvalid minor numbertoo many fields for format' !ffs@LSL` LlLuLL;L@LLL LLT J~LLLLMM'M:c MI@MUMfMtM@MǷ22MMMǷMlMM)(N[Net<GLHNpJ~ LL JL`CJv@NwN~NNNNNN bnorripbgensbextattbnojolietbnocasetransbrrcaseinsN[Net<GLHNpJ~ LL JL`@CO"Jv@@LLN[Net<GLHNpJ~ LL JL`Ll Lu@COL@"O;Jv@LN[Net<GLHNpJ~ LL JL`Jv@ & 2N[Net<GLHNpJ~ LL JL`@CJv@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirror &)<##03CFI !N[Net<GLHNpJ~ LL JL`"CJv@RS+eS S@SS!S)S/S4 'S8 "@QQS>QQQ Q@bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacrecvrpcrpc_getportrpc_callsendrecv $mCN[Net<GLHNpJ~ LL JL`Jv@LL- 1 / "9MR`n|='HVk\Z\\\]]Y]]]^^/^V^j^^^^__C_h___``6`[`%s: can't read disk label; disk type must be specified%s partition type is not `%s' WTWTbSS /+-$ '5GIUamz -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinit  #'+3;CKSW_goy@lBlClFlIlLlNlOnSm ambm.cm9emMfm_hmimkmmmnmomrmsn un@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:@@t @h tptp tptp Y `t t% @ t* $1м|^t0 Non-system disk Press any key to reboot bj #'@PSVgmpOXv  "$&(     @=1&)-191J1[^1a      &C]u+85/ f)+T"RKOMM MMMLLLL %!%%%#   &8808Yy8QI8y6A8 888ymeq*,y"yyy8y4888882($88.%"DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYBl RzUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdef       " % ( +8/& FPFP*0 XXX,,x<< {R  " "&bitmask_print-4=IS_e6z_ƜǬȨ ˌ6xxP^nvnnnͼ<@\gz0HMθθsǬxxbitmask_scanI !&ADGINPSV]bg9?LiLLL2hw.disknamesfetch_urlEpsendrequestrecvrequest2B_{ "*.>PTdjm***************************************************************************************************************************************************************************************************************************************@[9>plEt9Vx'1HBHHHP -;FNU^fju} NetBSD gzip 20240203 0000000)  " $#!%Z^\`[_]a.CH @j18RnMkkk=kkkk>ddddddd+1YNY^H<cuJ&8EI5 ,oZN`t !j?NQe9& <oZTZNjQ g g: SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. 2&*.)/35;!#%'+-1]8;2"$&(*, " $ & 1!4\V%G .8>RTc+AHcccccdccccccccccccccccccc cDMcVcc_qccvccccc--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for datamf=4   {m$ b$*-5?B2}}}}}}=}}Zf}}}}}E}a}}}}}}}}}}}}}}}}J}}Tam}}r})}Q}}}\  . ' &26: #&/)  #&- ),/ $     #3( &" &,~H,dm,vm,n,q),r:B,s_j,f,e,tm,tm,um,x",b,qN,q0m,qǷ,x ,c%,b18q,w>8q,fO,hX+,ifn,j,g,km,lm,m,y$+,z#m,{",o$ ,|!m,|?%m,}>collect#EsP=====NB,v5! ) .:JNAME=2Mmount_disks>    "#$%      "#$%&'()*+. str_arg_substget_available_cds!,,v5! ) .:J edit_fs_type_ext & N T    #D $t : :1L e Xu Hedit_and_check_label ,v5! ) .:Jdisklabel_freedisklabel_set_part_infodisklabel_write_to_diskijz r ~ 8 4 | @ yL u v y| u u } {X x q w p q q v v v z| udisklabel_change_geom ѐ (  %5outer_fill_part_menu_optsedit_outer_partsselect_part_schemerD----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_default " %2RAHXblv%/9#AJPV\bhai8258 7:=@C !&1WQT\_bhm"'7;])hQn|n֏- q+)s)Qn|n֏- q+))Qn|n֏- q+))Qn|n֏- q+))Qn|n֏- q+)J=Gry=iG}))硝M;t?))WmCĄ 3KOO**yD¢<#*=(**(YBbRuoqr*2*AРD3h&*P*X \M}-*k*|ޔM@jy֬**-ıܹчH*-ܹчH*IZܹчHǷ*I􍂱ܹчH*I􍪱ܹчH)*I2ܹчH+LǠ6 %?a+#+('S@ۿ )Ѹ+5+<1*@ە )Ѹ+V.1ۏx )Ѹ+[+e.TSqHBo6֯i+u+P qބޜW*ޫA޻{ mbr_get_generic_part_typembr_init_default_alignmentsmbr_create_new ѐ x ll4l 0 hl \TLxH@L mbr_get_part_devicembr_read_from_diskwrite_mbrmbr_write_to_diskinside_ext_partadjust_ext_partmbr_add_partmbr_free!***************************************************************************************************************************************************************************************************************************************mcontrol_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_start7#&))뙙 dhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_reportssiddhcpcd_readdump2uJ\dhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2025 Roy Marplesmain duid_geteloop_event_addeloop_event_deleteeloop_q_timeout_addeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_signal_maskeloop_startif_discover mmmmmmmmmmmmmV\a2 2/ma222mmmmmmmm.4jn22v2<2AM}24JmmT25mmm&0y!+mx mP"'=Sisplitvadd_environparse_optionbcdef]g6h\ijkilRmsnVozp+tqrsKtuvwSxztyABCDEFGHI/JKL[MN OPQS!T'U1V;WEXOZ1^4g6%pV|C~}8 -7HFOMUb`Mhnv{_default_configread_configrt_compare_proto\t\tYYrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_recvrtZZrt_buildrt_deleteYYsa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_init{7?FPY/e~dscript_buftoenvHO7make_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_osA|if_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @DCHDdhcp_openbpfget_leasedhcp_initread_leaselog_dhcp 4 ? KBs Zdhcp_bound f  o wA   Z dhcp_informdhcp_start1dhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifa OOOOOOO OOOO'O4O>COHOMOOOOOOOOOOOOO OOOO!O.O;@OEOJ))))))UVJqfg]UVNI%DE@<=85340.,*('c%$#P"#! BrBbFCV{SJ\B M M@ M` MM M 9MN N NN@ BN` #NBBBBB@@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ 2& 6!H!P ?!H!X     9  N@ B #! !!cs_pathEX H bc_base_maxm bc_dim_maxm bc_scale_maxm bc_string_maxm coll_weights_maxm expr_nest_max m line_maxm  re_dup_maxm  posix2_version m  posix2_c_bindm  posix2_c_devm  posix2_char_termm posix2_fort_devm posix2_fort_runm posix2_localedefm posix2_sw_devm posix2_upem stream_maxm tzname_maxm atexit_maxmaaaaae%JaaaaaaT[ ll mH mn o4 9op| q Nq Brh #s B 1 ;4fb^  jljX/*]P= 4?$$]gp !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: -o %s: option not supported`]ZWTQNKHEB?<96 0-*'$!c3 d38- sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU HeNKmakech    #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef'++9L.DDҵ;15MS7) q:e%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZHXo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;plpn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9,1nn|:pZnF$n20QKGC?:64*(++#+/'++ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQwQwQQQbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X `%K  |bjm[Ip^H" 67%VD22t  |bjm[Ip^H" 67%VD22t" C00*8M&(xZk8hiM`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     @@ !1Aa  0@`M #+3;CScs inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  氒j%b}Dg׻jD~pd'MG T-06/{Z1i*lևM_zN7.N^NrB0* ,<C˦ǐ<Ԅ[S's4K| O݄aY,2Qh$A3}Q>R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9, ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5k   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_cstringprop_string_create_nocopyprop_string_create_formatprop_string_append_cstring_prop_number_externalize_prop_number_alloc1:74_prop_xml_intern_find_tag_prop_intern_decode_string_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dict_keysym_put_prop_dict_keysym_allocprop_dictionary_set_prop_dictionary_iterator_reset_locked_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equals_prop_dictionary_internalize_continue_prop_dictionary_remove6_prop_data_externalizeABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_equalsprop_data_data_prop_data_internalizetruefalse_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_removeprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_extern_append_char_prop_extern_append_encoded_cstring_prop_extern_append_start_tag_prop_extern_append_end_tag_prop_extern_append_empty_tag _prop_stack_push_prop_stack_pop_tcsetpgrp_tcgetpgrp_tcflush_tcdrain_cfsetspeed_cfsetospeed_cfsetispeed_cfmakeraw_cfgetospeed_cfgetispeedstrmode_unsetenv_int_strtouq_l_int__strtoull_l_int__strtou_l ` F g n z__strsuftollxpermute_args_getopt_longgetopt_internalunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s_getoptatolatofmemstream_seeksetbuffersetlinebufsetbufmkdtempfwidefsetposfpurgefgetposfgetc_regerror__icheckhost__gethostlooprshrcmdrresvport_af_addrrresvportresrcmdorcmd_afrcmd_af__ivaliduser_sairuserok_saruseroklink_addr0123456789abcdef_ether_ntoa_ether_aton_ether_line %x:%x:%x:%x:%x:%x %256s _ether_ntohost_ether_hostton_MD5End0123456789abcdef_MD5File_MD5Data_SHA1End0123456789abcdef_SHA1Data_SHA1Transform_SHA1Init_SHA1Update_SHA1Final_RMD160End0123456789abcdef_RMD160Data_uname_ttyname_r_times   +(&_DB?\\\addcmd_getmodecompress_mode_sethostname_popenpopenve_pclose_initgroupskMGTPEBKMGTPEKMGTPEBkMGTPEhumanize_numbermatchcompareglobextendg_Ctocg_lstatglob3g_opendirglob2g_statglob0globtildeglobexp2globexp1_glob_globfree%%%%%%%%%%%%%%%%%%%%%%%/_getttyent_getttynam_getpassfd_getmntinfo##: _getfsspec_getfsfilefnmatchxgettype_getdiskbyname/$$$$)$$$-$+creatTLS allocation failed, terminating <Q5vf9.z4  }Q5H@5UCmm};Zx0Nm<[y1OnSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec_tcsetattrwcscmp_stresep_setenv_vdprintf_lsetvbuf_regfree_inet_networkCof\$u0LDD????????J^YaTO|wrmhcG unvisAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~fts_pallocfts_sortfts_statfts_allocfts_build_fts_openfts_maxarglen_fts_close_fts_read_fts_set_fts_children_closedir  khwcschr_strcoll_l_int__strtoumax_l_opendir_initdir_alphasortinsertionsort_mergesort_rsetup_seekdir_unlocked_getdomainname @_strncasecmp_initstate_setstate?getenv_getenv_r__freeenvvar__canoverwriteenvvarauthunix_destroyauthunix_marshalmarshal_new_authauthunix_validate_authunix_create_xdr_authunix_parms_xdr_array _xdr_rejected_reply_xdr_opaque_auth_xdr_accepted_reply_xdr_des_block_xdr_replymsg_xdr_callhdr_seterr_replyacceptedrejected_strtok_rm D ip6_parsenumeric_filenoØŘstr2numberget_canonnameres_queryNres_querydomainNget_aigetanswergethostby*.getanswer: asked for "%s", got "%s"res_searchNexplore_numericget_portmatch_freeaddrinfo_getaddrinfoaddrconfigip6_str2scopeid)&_yphostent_gethtent_getservbyname_r_MD5Init_MD5Update_MD5Final @_vasprintf_l_getifaddrs"_freeifaddrsNBCDB atoi**!!**!!SPDGJM d'B@;__dn_count_labels.aFpFB)e,}%%B )ϵ) charstraddname0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuv__ns_sprintrrf__ns_skiprr__b64_ntopABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/__b64_pton _inet_nsap_addr_inet_nsap_ntoa__ns_format_ttl>\e54<Ҳ؉9I#ը32D=%[όh(doC4)$ _posix1e_acl_entry_compare_acl_differs_acl_brand_as_sl_add_sl_find5_strsep_int_strtoul_l_int__strtoll_lfgetsrewindmap_v4v6_addressmap_v4v6_hostentgethostbyname_internal_yp_hostent_yp_gethtbyaddr_yp_gethtbynamegetanswergethostby*.getanswer: asked for "%s", got "%s"_dns_gethtbyname_dns_gethtbyaddrgethostbyname_rgethostbyaddr_rinet_pton40123456789abcdef0123456789ABCDEF_inet_ptoninet_pton6inet_ntop4_inet_ntopinet_ntop6_fseeko_fparseln__fgetstr_xdr_int_xdr_u_int_xdr_long_xdr_u_long_xdr_int32_t_xdr_u_int32_t_xdr_short_xdr_u_short_xdr_int16_t_xdr_u_int16_t_xdr_char_xdr_u_char_xdr_bool_xdr_enum_xdr_opaque_xdr_bytes_xdr_netobj_xdr_union_xdr_string_xdr_wrapstring_xdr_int64_t_xdr_u_int64_t_xdr_hyper_xdr_u_hyper_xdr_longlong_t_xdr_u_longlong_t__dn_skipname0123456789__ns_name_ntop  __ns_name_ntol__ns_name_unpack2dn_find__ns_name_pack_int_strtol_l_vsprintf_l__getdelim_nsdbtaddsrc_nsdbtdump_nsdbtput_nsdispatchaUQY9~~zejjlN<7]%02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04d-00mnEtc/UTC _strcasecmpbsearch__cxa_atexit_internal__cxa_atexit_vsnprintf_lfreadfopenferror__swbuf333333333JiJJ yYZJjJJJjzZZ  , OOOOOOOOOoGJo>AOc'`0123456789abcdef0123456789ABCDEF__vfprintf_unlocked_l__sbprintfexponentaj[ce\Q_strndup_strdup_gethostname" !#&(*-/14}?@$@Y@@@È@jA.AcAׄAeB_ B7HvBmB0@BּC k&4CAy7Cv4WؠCmgNCX`=Dx@DKPDMՒ<Ҳ؉9I#ը32D=%[ό (doCCAy7FnM8O?ZwH02uOs<_fdopengetcgetc_unlocked __sflagsfclose__srgetlflush__srefillhash_seq__bt_openNEXTINDEX!#%')__get_bufnewbufbbNEXTINDEXNEXTINDEXNEXTINDEX_mkstemp__gettemp0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzVcrypto_prng_bufQcrypto_onetimestreamuޝ3r(Ѿ唵V dj٧IY:Jp,.*ap+ѿ#K`_arc4random_addrandommbi^6U!v<bt_rrootNEXTINDEXbt_psplit__bt_splitNEXTINDEXj ggQR1m'ȿY էGcQ))g' .!8M,mS8 e sTvj .r,表fKKplQђ֙$5jp7l'HwL49 NتJ[Oh.otxcoxPlqx6|0pY9 1hXdOj ggʧ;l٫Ak[~!yB/("q7D#e͵M;/ۥۼ9V[H8Y?O^mB[Epo$1N䲌U }r]t{oޱ;%5ti&iJG8O%Ƌյ$ we-,oY+uJtn\ܽAvڃS>QRf߫1m-2'Ș!?YǾ =էG %cQo))g np' F/.!8\&&M,mZ*S8 e sTcvj &aц!}}Onxgro c}ŢȘ? q 5G(w#}2ʫ{@$< ɾCgĜ LLԾ>BY)e~*_o:lDJGX˻]b)*6|YZ0p/Y9g3&g 1JhX . dGHOA$e   a]YUQMIEiea]BJ|xtDD0*m:31HB;\\9############9ZZ99Z#########################n^_getpagesizeqsort_r__sfvwrite__sflush__swsetup*!*!__swhatbuf__smakebuf_tcgetattr_int__strtoi_l__sread__swrite__sseek__sclose_int__strtoimax_lCisalnumisalnum_lisalphaisalpha_lisblankisblank_liscntrliscntrl_lisdigitisdigit_lisgraphisgraph_lislowerislower_lisprintisprint_lispunctispunct_lisspaceisspace_lisupperisupper_lisxdigitisxdigit_ltouppertoupper_ltolowertolower_lc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB _citrus_NONE_stdenc_mbtowc_citrus_NONE_stdenc_mbtocs# dl_iterate_phdr_setup|333333333K<<0123456789ABCDEF0123456789abcdef_vsnprintf_ss_fwalk {__res_nmkquery__res_nopt__res_nopt_rdata/&_hf_gethtbyname2_hf_gethtbyname_hf_gethtbyaddrD!*07 _nsaddsrctomap ]:[=             WEEEdg          DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::clearerrF7Z77<7O__rec_dleafNEXTINDEXNEXTINDEXputpair__delpair__get_page__add_ovflpagesqueeze_key__free_ovflpageugly_split__split_page__big_insert__big_delete__big_splitN??S??E?NEXTINDEXP0tDH      (,4<@LT\`lt| ltN'`p<  `   D               ( 0 8 @ D P X ` h <0 x < "d , hD  <  X0 #    L@    \  D H | l 0P  L P T X\ < x` d hl p ,t,x h|h    XX X X         LT .     \          $ , 4<D L T\d h 0l 0t0| 0(, 4 ,048<DHLPDTX\XdDlp!A@!D9!D!H!M<!RU>p99 94H 4H4H 4H 4H 4H (<L!h!!!!@pstng pnmbrD<˜,dict$P@xl` ddkey4üƀƄôdataxboolX!!! ! aray TlɌlÜ<HdpӌӜӸ ,8T` |Ԉ ԜԨ   $0HTxՄըմ$ $,4\<@HtLTX`  08@$HP X`dp|\t!! $,4<D|LT\`dhlptx| (08DL`p|,8DTh4L`t(<Pdx,@Th|!e$e@4l(dtl(dt!!!!T (Pl HdP T T TP|x   ,0 &< DH hl P,4<LlXT\d`dx  !@D"X`#|$%&')*+,- ,.8@/HP0X`1hp237c08TD\d#|$%&'$()8HLTXH<HP`l|  4< HP`hpxxt8DT\%VC!!!!!!! H%S%S|%R%S@DHLPTX\dlt  ,8<TP`hp0H\p@P`t(8\|  0 P p    ! !$!D!T!l!!!!"" "D"h"|"""""###$#8#P#t######$$8$P$d$x$$$$$%%,%@%P%h%|%%%%&äìôü@pL` |d!!!P,&L!8%7- - x%- -X-Xq<&&-@&L&-%7- p&-&- %@Hp- J8- \&\M-0p%-P!X-e--0| u$-- \- T-b$p!-h&%7%- P- d- %<- teh-,x--Z&%-|L-- I-7h- % #-&8&- `- X- p&%-- hp-&-!-- l!&l(%C#d&\!&8- - H%- L%Xic(-B@-X&,&b%X&P: 'Hz|P%\.~ bbbj`Hj8cfbhbkblbmbococpc pcpc5qc?rCutcFvwcNwc[xDŽxz3kzccBrCJctOc~PcScTVVcXcZcZccccc cc d 3|dd#(h&XjdhX&XlhLhxLid!(p`pPq0hXpXuPhLhxL; cc cdd/dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbin'd}-+?=###%%%}'@'DvaEVe.FIiLElmCnfpbu:qshcFv=VVx't@=%cH%c,d bXTZ(`\8Y`^&Y?nY`=4Y|oB* uXd>X9B~ ]gy|vmtNmt my8mwdImDs 0ur%e  ... ...* =m": m]"`##C%%Cy'''y(@(Vy]+-#/ \0%g`0C OX%f8AabCdhlNsuvW:w:z%f%f%f%f%f \9a%f%i< \9$%g ]Ќ9a \ \9[%f ]9a ]ظ9a \9q%gt%i\ \9*%g%i \95%g%i \9L%g%i \9V Qh%h$ \l2 P%hP \(/%g`1C Xh%h| \6%g`2 T%h%jT%h%h \9>%g`(O%h \9E%i(O%i \9~%i(%iL%gH%jT%gH%g`%hX%h%k%h%j0%j %i%h%i%h%g`%h,%g \7|%g`7| \h9%g`/1/ \9%g`1_1 \9%g`_/_ \9e%gH(O%jx \:%g`: \h:/%g`/ \</%g`1 \8%g` 8 \1%g` 1 \t%g`  \R%g` R \< [p%k \(y%g`y \l<%g`< \<%g`; \;%g` ; \;h%g`;h \= ] %l \=?%l=? \=F%g`=F \> ]%m \?$%g`?$ \?+%g` > \D%g` b%m \D _P%m \ D%g`D \E%g`E \$?%g` ? \e%g`e \A%g` * A \%g` *  \@D%g` D \E %g` b`%n" KI(I(I)I'I)L9W(I(&|5' I(tv(I(I(I(I(I(  '@@N[Net<GLHNpJ~ LL JL`@CJv@L...... ...... lost+foundAd.##.5xP F ` y DŽ {M}|/1 !"#M$%&'(')*+,-/1123'4?0576%&0) !. (prog_root)`Tw`[U`8~+h #ʂ,4 l -. l N`@ l 7c? l D l   l `w l H l 7$+ l :@ l #L l @2 l 4* l 6 l  l :h l " l % l (Q l 6) l \ l >a l =g l =S l 7$m l Lv l @ l  l ] l DŽ l   l "pƷ l  l t{ l 5[U l р l $x l Hф l Gpъ l 1 &! l (я l Bі l &82 l *ў l H2 l 1ʞ l * l (ѣ l M " l lѨ l F3r l HѰ l ǁ l Hѵ l ѻ l G,| l ( l ;T l : l х l H l < l (( l ( l (c l "3 l  l 7 l 8Dѱ l Dы l 0t* l 7$ l 4 l @ l I l  ǂ l  l M l ' l  l A l 6`2 l 2| l F l >`ۂ l D l `3 l Kl' l 4| l E<ϩ l IG l ` l , l >8x l Bx~ l <4 l @ l L l L l 5 l L= l t l .cF l 8ϰ l I l t@$!+Ek @ яi Q, P S<<!{ < )> +Ht *Pp$ +|< l$M !HCo "+o "c .   '$ '$s %? ># &+lEpFfP c"a!lsh+ !"$'(+-.03569:0A00011/11111122 2G2PMN`|ף0RTfhk`oooop"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp|  ( ( ) )oK_pp0J#%')-Y[  : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----0*0-00ooprt} %&,,&-GQ).1256CCLL||װ /vz       8 : ? ?   $ 'FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB4@4@4G4Ujjk0k6oOoOoooo-0Fgi{тхыѪѭBD6;luuڄڄڛڟڡگ!#$&*06DJ%%%%%%%%""%%%% e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ    l h b  w  i x X       0  $  k  j [<    is a directory is not a regular file (use -f to see it)%% ($(,4@"L>WdMs;~ 7   #28  (+ !#,9>HR&f])is5|e:%6* 4 +,-.*?{,EG3/?/M'YFf )8M  fF   WmkRkRkYcWbkCkc kG ky wb YMYrWca%+tJkb%@+8 eB%+<c%x+p@kkd%p+X%pA+dD%h( fe%`+`/f%X+0OgF%P+\g%H+h%@+LMfi%8+D e,j%0 ^J%(!+"k% H a%H bK%+:_L%+}m%+ln%"+@o% ]`"O% ^-p%H cP% d$q%+|8`r%"+4s%!+T 7 OS%!+$ l |t% bT T% c u%+h   V% e8w%"+ !!Mx%( h!!X%xA+!!y%p+H!!z%h+,"","%` i"K~%X!+"T"x?%P k#%H `""%@A+""%8+""%0+##A%(+#]#% ( j#%+##%+ k$ $3$O%+ k$u$%+$$%$+ l$%%$+ l\%%%;%+%[%u%!+%%%!+ l%%%!+%& %( mX&:%!+&I&]%+&w&%+&&% nX&%+' '4%+x'U'i%+''% l'%!+ ''%x+((C%p+(l((%h+())%`+)/)f))))))+)')***%*7w1*I*U*_*i*s************E*+ ++#+5?0+>+N+b+t%+z,+++++++++++,,,"",5%,A,N,[+ (press RETURN) Ȇ *%%%tags643{}abcdDgGhHilnNpPqrs tw xy !:#=, d, @-e^H-i^C-k^UK%є%4 ! % 4 % %Єm%d m%D 4Xm %4 (% }% < %$ % mF %$ T ,mF%ʹ $ . %̈́ %T%4mF%  /pmF%̄ | /mF%  0`mF%  0 %t# %D: %mF %tL  *hmF %N  +$ %ɴ; %t%D 7m2$%: hm2$%Ȥ:m2$%4:m %m %Ǵm %ǔm %4m %[%ƔZc%TumF%j 1hmF%Ŵf .mF%tj  1 6t 6 6u &| L (   "u 20 6, 6P u 2e 2d &\g 3h &L\ 2^ 3|] 3_ 3a $) 8\ L `Ƿ t8T 8 8( 85 8@ 8? 8J 8 8  7 47 H7 \7 p &l 2 3 3W Q 6R S %TX de  P 8O DP Q lR S TU V %x  y $< 3L= 2> 3l? 3xE 7 7     $ #8 5 6 S 3\   | L $ # ,  TT |: :* ,:L @xE 7 7 :] 2: 3 : 3: 3,! 3< ` @   2    4 5 5 2  4 4 5\j 3k 2|  5 5 2p2 Ƿ   3 2 2d  2 2X L ( 4l 4 58 44 2L P ,     %L $ p X 4 2$         h P 8  d t  Hu T !h !@ !  2< 2  & !' !( !) ! " "p x "L "<% ! " " " "$ "; l      4 \ ;8;Y;i;x7;|%aL;;;;b;;;=`=}?j@BBCChD+D;mnDMZ(kDbDeDhDEFH ISIpI}&=hIIIIIJJJ1JKJtJKKKKLFL(LI%LLLL38MO?M]MdM|MMMNN#N}NNNNO&OPQEQpQRT-UTVXYNYOYZ[[\5\I\j\y\]5]MZ^S^__F_[______```:`F`Xa aabb.bdbbbcbddeeief?fzfh}idijjzjk k"kJkul=llm]mbmmmmmmnn!n5nCnRnanonnnnnnnnoo oo'o3oAoXooooooppppqq[qqrrt5tuIuvGvvvwww|Uw"w+w:wRwpwwwwwx x:x(xAxMxZxlx}xxxxxxyy/yJyyyFyyyyyyyyyzzz/zHz]zq~z~zzzzzzzzz{ {{,{6{C{L{[{p3{|{{{{{{{{{| ||}(o_*7};@JV_t-Lz"-I}a$AEnbs%)3K &.AbvbLƝM^_Q%0*QY ]nyBl5I%&rw3`n`)b3?lZc?Z~-CNo9]RY>yf_߃9bz \"DTjs$19CHR[l= #)0;BIR\m}#&4>Sdvy$3GS]bgyb&4$8Pait,=KVcot&K4,g6H il h  &)-1)/ u nJ  ՚9V /0 !'10/&+'6(?)F*+K,S.1/ftp4@غǁxEnjǔ;@GJ EǡǬǻ i6> k # k? k7@ iQ hAN f`BS f`CX f`D :W hDE ` f`F  f`G *$ f`H  f`I emY em em t 0  1u 1e u tӂӑӞӬӺ ]A\ H]A\ * ZmmmmmmmmmC     A  ) ) { )   2?  "пJ % ) - 1  5 9 =  A E I-S M  Q\N U! f" u# $ % & ' ( ) * + , - - . .0/ /t:01 2 3 4 5;6 $7 *8 09 9: 5; ?< N= Z> l? z@ [0\ \ ] ^ ^ _ _ ` {  { | +} 7}*~ K -dd-ddTdd:dd:dd  @@`#####$ $$$ $(%0%8%%D%L&T&`&h't''((()))***+++ ,,$,(,0-<-H-L-T.`.l.t///6;;00011<<== >,>8?@2H2T2\3h3t3|978:44455  ! " #  $, %8 &D 'P (\ )h *t . + , - / 0 1 2 3 4 5 6 7 8  9, :8 ;D <P =\ >h ?t@ @!@"@#@$@%@&@'@)@*@+`&`'@,$@-4@.D@/T@0``(p@1|@2@3`)@4@5@6@7@8@9@:`*(@;8@<H@=X@>h@?x` `!`+`,`"`#`-`$`.`/`%(C8CDDLDXE`ElFtFccddee##&&0  (08@HPX`ht   @@    ( 0@8@L@P@`@h@t`|` @i $33333333D`pҌҤ3333<UTC33%G%H'l(!"(<"'!33-339gt>QNPaPkqj,jH6T7YqϑI 7RǤq)>Oq9NNL(Kɲ@KCS[kA%\%h%\%ؙ %I 33UU33UU33UU%ehb$dc(%H%ehb$dc(% &0ehb$dc(%&%-<,4x   @ H333333333333333333333333333333333333 33 33&4 !L!L 0000000000000000 -3333\333333&T&\&d (root)`33%VC!!!!!!! H%S%S|%R%S%S!!! !&@`p t}}}}~ ~P~`$@xd~Service unavailable,A0aeabi&6KZ  "D;7x-oARZ>J4T`0_! CH$ D4Ap% $;g^פZJ.;V^,KY 3[Rj~y|,xeQWZ&k1]v>7^;>𷂼e]kp#Hӿ,Gsw+{nǞ=Dݛy?j5f-Q>;d<|̫5=36كY^kubrz^{z 5ǬқJ?|ϳqԇm|Oev>Gqu1-kηov{-Gϯ{Z.k~վV#ngȯ;}oȯEQ 1 Dso 747d ̼qpvp-M}qy!p[\+HU h8gl{x 6 j;#!r]x:F|f1ɠɇ&ndDJPj,r!, Ur>vU+;.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf / BHVP%7!V%7!$b%7!g%7!tt%Vd!&d,y%X!( &!װ&!װ<-!װp!װ1!!ږMSGTXTS627 5032 5057 5074 5096 5099 5104 5112 5119 5127 5135 5138 5141 5144 5148 5160 5169 5182 5211 5226 5769 5803 6486 6774 7482 7538 7612 7708 7883 7906 7929 7935 7944 7966 7970 7974 7977 7980 8085 8288 8527 8968 9406 9441 9456 9468 9474 9486 9535 9555 9595 9612 9629 9644 9691 9729 9777 9859 9983 10119 10160 10198 10235 10270 10280 10329 10479 10485 10490 10494 10514 10624 10644 10650 10664 10676 10687 10724 10758 10782 10884 10921 10943 11042 11097 11155 11166 11182 11234 11402 11609 11780 11844 11896 12167 12716 13244 13675 14013 14346 14459 14474 14483 14643 14814 14964 15128 15151 15175 15190 15265 15405 15582 15737 15749 15829 15930 15976 16002 16072 16083 16092 16105 16131 16146 16162 16175 16230 16241 16256 16460 16693 16722 16737 16806 16880 16953 16983 17021 17075 17529 17555 17584 17688 17794 17979 18091 18206 18310 18997 19256 19396 19432 19602 19643 19779 19802 19839 19884 20135 20231 20285 20384 20395 20432 20469 20496 20505 20539 20546 20571 20598 20633 20647 20661 20690 20704 20721 20730 20752 20770 20787 20798 20817 20843 20861 20884 20901 20916 20931 20949 20976 21003 21025 21064 21082 21114 21342 21416 21459 21505 21652 21808 21852 22131 22158 22517 22701 22853 23034 23181 23339 23360 23408 23418 23426 23437 23448 23458 23465 23480 23492 23529 23559 23598 23651 23709 23730 23737 23756 23777 23784 23806 23828 23848 23870 23901 23938 23960 23974 24020 24049 24083 24123 24158 24186 24234 24243 24252 24257 24266 24275 24292 24296 24301 24307 24311 24349 24358 24385 24405 24428 24447 24474 24496 24528 24544 24549 24559 24582 24604 24621 24638 24651 24660 24669 24675 24702 24709 24733 24754 24778 24791 24810 24835 24858 24874 24880 24892 24922 24930 24970 24981 24992 25003 25020 25037 25051 25068 25284 25588 26036 26252 26516 26788 26840 26876 26912 26963 26980 27018 27032 27039 27056 27059 27064 27073 27085 27096 27105 27126 27168 27206 27222 27253 27278 27313 27369 27409 27430 27450 27491 27520 27568 27801 27836 28043 28062 28099 28160 28198 28237 28393 28408 28454 28502 28525 28561 28571 28581 28592 28597 28660 28708 28752 28813 28846 28947 28965 29104 29126 29249 29263 29273 29296 29401 29457 29573 29604 29609 29635 29674 29684 29727 29737 29753 29768 29786 29809 29839 29860 29886 30083 30126 30130 30136 30142 30147 30158 30172 30201 30233 30245 30292 30342 30382 30409 30425 30434 30477 30483 30491 30495 30515 30532 30544 30575 30831 30880 31456 31483 31515 31543 31595 31601 31607 31612 31633 31649 31671 31700 31841 31975 31988 32124 32126 32128 32130 32147 32160 32178 32205 32209 32215 32220 32228 32234 32274 32276 32286 32301 32318 32352 32384 32422 32451 32480 32502 32545 32571 32615 32751 32753 32833 32879 32927 33032 33134 33173 33240 33247 33308 33372 33376 33383 33505 33574 33862 34000 34141 34222 34269 34275 34298 34344 34347 34373 34416 34481 34543 34613 34681 34774 34993 35018 35022 35058 35076 35104 35146 35190 35254 35304 35380 35402 35454 35498 35537 35571 35601 35632 35657 35666 35678 35686 35697 35709 35728 35752 35801 35818 35842 35885 36207 36210 36224 36237 36249 36256 36267 36274 36281 36290 36300 36317 36333 36383 36391 36399 36409 36420 36438 36455 36476 36498 36507 36517 36544 36550 36560 36579 36595 36613 36633 36642 36653 36660 36677 36696 36717 36727 36744 36750 36766 36781 36796 36817 36839 36858 36868 36873 36878 36896 36915 36934 36940 36959 36979 36999 37017 37022 37028 37045 37061 37082 37095 37103 37123 37147 37164 37172 37183 37204 37210 37222 37244 37258 37267 37288 37306 37315 37349 37372 37399 37431 37454 37474 37485 37517 37533 37544 37557 37580 37602 38110 38140 38171 38199 38213 38414 38636 38803 38890 38907 38925 38942 38971 39018 39029 39048 39070 39149 39341 39369 39487 39509 39650 39669 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-11.99.3. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? - wd: SATA, ATA oder IDE - sd: SCSI oder USB-Speicher - ld: NVMe (z.B. M.2-Karte), SD/MMC-Karte oder virtueller Speicher Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis (leer lassen, um abzubrechen)?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-11.99.3 ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-11.99.3 ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-11.99.3 ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-11.99.3 ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Die Installation wird abgebrochen. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-11.99.3 InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-11.99.3 ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPHTTPSNFSCD-ROM / DVD / Medium mit AbbilddateiDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzDas Verzeichnis, in das die alten a.out-Bibliotheken gesichert werden sollten, konnte nicht erstellt werden. Bitte starten Sie die Aktualisierung erneut und stellen Sie sicher, dass alle Dateisysteme gemountet sind.Eins der Verzeichnisse /emul/aout oder /emul war ein symbolischer Link, der auf ein nicht-gemountetes Dateisystem verwies. Der Link wurde mit einer '.old' Erweiterung versehen. Sobald Ihr aktualisiertes System gestartet ist, mssen Sie das neu erstellte /emul/aout mit dem alten Verzeichnis abgleichen. Sendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd (Secure Shell daemon) aktivierenntpd aktivierenntpdate beim Starten ausfhrenMulticast DNS aktivierenxdm (X Display Manager) aktivierencgd aktivieren (kryptografische Laufwerkskonfiguration)lvm (Logical Volume Manager) aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte Partitionierung (Software-RAID, ...)Partitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen? So knnen Sie 'su' verwenden, um Superuser zu werden.Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden? Wenn Sie von einer Diskette gebootet haben, knnen Sie diese jetzt entfernen. Kann den Bootblock des Filecores nicht lesen Kann die RISCiX Partitionstabelle nicht lesen Keine NetBSD Partition in der RISCiX Partitionstabelle gefunden - erstellen eines Labels nicht mglich. Keine NetBSD Partition gefunden (eine Nur-Filecore Platte?) - erstellen eines Labels nicht mglich. Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm rmdir sh stty sync . .. dhcpcd.confgroup master.passwd netconfig protocolsservicesMSGTXTS627 5032 5070 5087 5102 5105 5108 5113 5121 5129 5137 5140 5143 5152 5164 5176 5185 5194 5220 5231 5766 5793 6359 6659 7300 7347 7460 7553 7587 7606 7624 7632 7641 7666 7670 7674 7677 7680 7802 7987 8215 8735 9086 9115 9128 9141 9146 9166 9185 9206 9265 9282 9296 9318 9363 9389 9430 9508 9626 9740 9794 9823 9855 9894 9900 9933 10056 10063 10067 10075 10099 10181 10187 10194 10206 10220 10229 10262 10281 10293 10403 10465 10484 10603 10654 10706 10718 10737 10789 10993 11201 11392 11452 11501 11767 12225 12890 13312 13634 14059 14191 14223 14235 14413 14610 14771 14905 14925 14958 14972 15041 15154 15326 15461 15481 15593 15685 15708 15731 15790 15805 15826 15841 15862 15882 15907 15921 15945 15957 15975 16185 16435 16456 16472 16525 16593 16666 16703 16729 16805 17300 17326 17348 17455 17562 17763 17836 17920 18020 18515 18753 18904 18938 19073 19117 19256 19297 19342 19389 19633 19766 19828 19922 19927 19961 19995 20010 20038 20071 20078 20103 20121 20147 20154 20169 20184 20204 20244 20261 20281 20302 20324 20339 20359 20381 20396 20409 20423 20435 20447 20461 20484 20507 20525 20568 20619 20656 20841 20904 20940 20989 21080 21210 21263 21523 21570 21931 22081 22250 22390 22510 22642 22682 22729 22739 22747 22757 22765 22776 22787 22801 22826 22867 22900 22933 22968 23022 23047 23066 23088 23093 23099 23128 23145 23172 23190 23211 23233 23252 23262 23292 23318 23345 23394 23422 23449 23502 23512 23522 23528 23538 23547 23567 23571 23576 23582 23586 23621 23630 23661 23678 23705 23726 23746 23765 23791 23804 23812 23828 23859 23890 23911 23937 23950 23958 23969 23975 23999 24009 24021 24039 24050 24070 24086 24112 24134 24150 24162 24182 24208 24214 24244 24258 24272 24295 24314 24333 24351 24369 24592 24898 25316 25517 25757 25941 26019 26074 26141 26181 26204 26238 26249 26257 26280 26283 26286 26292 26303 26315 26328 26358 26402 26415 26428 26465 26479 26490 26501 26512 26529 26540 26587 26610 26659 26900 26933 27188 27209 27242 27295 27321 27348 27504 27510 27553 27573 27592 27621 27628 27635 27642 27647 27696 27734 27768 27825 27853 27898 27915 28016 28021 28098 28112 28122 28146 28269 28350 28460 28488 28493 28509 28538 28546 28587 28594 28608 28621 28629 28648 28681 28701 28721 28937 28968 28973 28980 28987 28991 29005 29017 29032 29065 29078 29133 29191 29227 29245 29263 29281 29318 29324 29332 29336 29357 29374 29385 29407 29585 29629 30331 30355 30389 30408 30453 30460 30467 30471 30495 30506 30511 30574 30695 30818 30831 30965 30967 30969 30971 30981 30990 31003 31030 31034 31040 31045 31054 31059 31086 31088 31101 31113 31128 31156 31200 31247 31263 31285 31296 31329 31349 31398 31498 31500 31565 31614 31663 31767 31865 31906 31997 32004 32065 32129 32134 32140 32249 32308 32559 32700 32827 32895 32932 32939 32966 33012 33015 33036 33081 33132 33191 33260 33307 33412 33555 33580 33584 33618 33635 33659 33711 33762 33834 33900 33998 34015 34046 34082 34116 34140 34164 34197 34217 34227 34235 34243 34253 34264 34278 34304 34352 34375 34395 34436 34735 34738 34752 34764 34771 34790 34804 34811 34818 34827 34837 34854 34870 34918 34926 34934 34944 34955 34973 34990 35009 35029 35036 35053 35070 35077 35090 35125 35142 35161 35181 35191 35207 35220 35238 35258 35279 35289 35309 35329 35342 35361 35374 35398 35421 35434 35445 35450 35457 35475 35494 35513 35521 35540 35560 35585 35603 35610 35617 35630 35639 35660 35673 35681 35701 35729 35746 35752 35763 35794 35802 35815 35837 35859 35868 35889 35907 35914 35937 35956 35983 36001 36021 36034 36049 36070 36084 36091 36105 36120 36139 36684 36717 36745 36774 36782 36819 37131 37308 37385 37402 37420 37435 37457 37507 37517 37534 37556 37615 37773 37797 37927 37952 38078 38096 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-11.99.3. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-11.99.3 ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-11.99.3 ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-11.99.3 completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-11.99.3. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. La instalacin ha sido interrumpida. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-11.99.3Salir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-11.99.3Ejecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si ha iniciado desde disquette, ahora debera retirar el disco. No se puede leer el bloque de arranque filecore No se puede leer la tabla de particiones RISCiX No se ha encontrado ninguna particin NetBSD en la tabla de particiones RISCiX - No se puede etiquetar No se ha encontrado ninguna particion NetBSD (disco solo de filecore?) - No se puede etiquetar Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): NcleoThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located. umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS627 5032 5068 5085 5100 5104 5108 5113 5124 5130 5136 5139 5142 5145 5149 5161 5173 5183 5213 5225 5654 5681 6257 6617 7302 7363 7441 7536 7576 7598 7616 7622 7631 7657 7661 7665 7668 7671 7793 7978 8206 8735 9153 9182 9195 9208 9215 9235 9254 9277 9320 9340 9359 9382 9426 9455 9496 9562 9674 9788 9842 9871 9903 9942 9948 9981 10059 10065 10069 10074 10115 10252 10262 10270 10289 10303 10312 10344 10385 10398 10523 10581 10600 10719 10775 10827 10838 10854 10893 11143 11315 11487 11542 11577 11826 12229 12527 12794 13155 13335 13654 13674 13687 13876 14020 14216 14350 14370 14403 14422 14523 14678 14866 15053 15073 15152 15250 15288 15311 15401 15422 15445 15464 15488 15518 15562 15595 15618 15630 15648 15916 16235 16266 16301 16365 16440 16510 16541 16571 16663 17154 17184 17201 17341 17482 17679 17798 17945 18112 18670 18966 19147 19192 19355 19409 19544 19580 19640 19690 19981 20090 20147 20244 20249 20284 20319 20334 20358 20391 20396 20421 20437 20460 20467 20484 20499 20518 20550 20554 20574 20592 20604 20617 20635 20659 20677 20696 20723 20750 20762 20783 20813 20843 20868 20901 20936 20974 21227 21296 21351 21412 21530 21689 21743 22004 22055 22431 22586 22730 22870 22978 23163 23193 23236 23246 23254 23264 23276 23297 23306 23312 23344 23384 23420 23458 23495 23543 23567 23579 23593 23601 23609 23636 23653 23682 23703 23726 23735 23754 23766 23810 23848 23875 23919 23947 23974 24027 24038 24049 24056 24066 24075 24109 24113 24118 24124 24128 24163 24173 24203 24226 24255 24277 24299 24321 24348 24360 24372 24391 24425 24458 24479 24503 24516 24528 24541 24547 24573 24583 24594 24618 24628 24648 24668 24685 24711 24735 24748 24768 24802 24809 24838 24861 24884 24900 24915 24930 24945 24959 25147 25452 25883 26074 26309 26497 26539 26589 26643 26691 26713 26754 26765 26773 26797 26801 26805 26814 26825 26836 26851 26882 26928 26941 26954 26984 26998 27010 27022 27034 27052 27075 27120 27143 27203 27455 27482 27744 27762 27789 27838 27868 27899 28031 28038 28087 28110 28134 28163 28171 28181 28189 28194 28247 28296 28336 28402 28435 28479 28502 28603 28608 28685 28699 28709 28733 28856 28937 29047 29075 29080 29096 29125 29133 29174 29182 29196 29209 29217 29236 29269 29289 29309 29525 29556 29576 29582 29589 29593 29608 29627 29653 29662 29674 29728 29786 29821 29840 29857 29869 29904 29910 29918 29922 29943 29960 29971 29996 30174 30228 30919 30938 30973 31003 31049 31055 31062 31066 31090 31106 31112 31187 31337 31456 31469 31537 31539 31541 31543 31553 31566 31583 31610 31614 31620 31625 31634 31639 31666 31668 31681 31693 31708 31736 31780 31827 31843 31865 31876 31909 31929 31978 32078 32080 32156 32211 32261 32360 32455 32503 32593 32600 32661 32725 32730 32736 32839 32891 33137 33298 33453 33524 33577 33584 33611 33661 33664 33685 33731 33786 33845 33914 33961 34066 34209 34234 34238 34272 34289 34327 34380 34420 34496 34561 34655 34676 34714 34754 34790 34814 34837 34876 34906 34913 34922 34930 34938 34952 34968 34996 35048 35065 35086 35130 35472 35476 35491 35502 35510 35529 35541 35548 35555 35564 35574 35591 35607 35661 35669 35677 35687 35698 35716 35733 35749 35767 35774 35792 35809 35816 35826 35857 35876 35895 35915 35925 35944 35957 35977 35997 36018 36028 36047 36066 36076 36093 36107 36130 36154 36167 36177 36182 36186 36204 36223 36242 36247 36266 36286 36311 36326 36330 36337 36347 36356 36377 36391 36399 36419 36445 36462 36470 36481 36512 36517 36530 36552 36567 36576 36597 36615 36624 36668 36692 36719 36734 36751 36765 36796 36820 36851 36858 36872 36887 36906 37451 37484 37512 37541 37549 37586 37898 38075 38152 38169 38187 38202 38224 38274 38284 38301 38323 38382 38540 38564 38694 38719 38845 38863 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-11.99.3. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-11.99.3 est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-11.99.3 est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-11.99.3 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-11.99.3 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-11.99.3 Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-11.99.3Excuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si vous avez dmarr sur une disquette, vous pouvez maintenant la retirer. Impossible de lire le contenu du secteur de dmarrage Impossible de lire la table de partitions RISCiX Aucune partition NetBSD trouve dans la table de partitions RISCiX. Impossible de crer un label. Aucune partition NetBSD trouve (disque filecore uniquement ?). Impossible de crer un label. Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationditerGroupeMSGTXTS627 5032 5073 5089 5107 5111 5115 5125 5134 5140 5146 5149 5152 5161 5171 5184 5192 5203 5228 5240 5748 5780 6272 6561 7106 7152 7256 7342 7378 7393 7411 7419 7427 7454 7458 7462 7465 7468 7579 7764 7992 8468 8802 8831 8846 8861 8869 8883 8901 8922 8973 8989 8999 9019 9065 9095 9148 9205 9316 9437 9481 9514 9553 9587 9594 9627 9704 9710 9717 9724 9753 9865 9871 9882 9899 9916 9925 9954 9966 9976 10077 10139 10159 10279 10316 10372 10386 10407 10444 10654 10829 10978 11013 11065 11281 11594 12117 12478 12768 13161 13296 13309 13320 13466 13645 13776 13910 13930 13963 13982 14065 14180 14321 14446 14460 14568 14661 14690 14710 14786 14803 14821 14837 14856 14876 14893 14905 14931 14943 14961 15162 15401 15428 15445 15501 15563 15623 15654 15678 15737 16113 16143 16160 16268 16378 16518 16592 16668 16746 17238 17458 17569 17600 17727 17763 17891 17918 17958 18004 18220 18344 18412 18512 18517 18553 18589 18603 18626 18659 18663 18688 18707 18733 18738 18753 18768 18787 18812 18824 18846 18863 18876 18888 18906 18930 18945 18962 18975 18986 18997 19017 19046 19075 19099 19134 19169 19196 19383 19432 19464 19512 19609 19742 19788 19980 20010 20332 20461 20601 20741 20858 20993 21037 21080 21088 21098 21110 21122 21130 21141 21168 21202 21237 21268 21303 21339 21386 21406 21423 21441 21446 21453 21478 21494 21515 21532 21549 21567 21584 21597 21628 21653 21684 21715 21750 21777 21830 21840 21850 21856 21865 21873 21888 21892 21897 21903 21907 21942 21952 21981 21997 22023 22040 22059 22080 22096 22109 22114 22122 22137 22163 22182 22210 22228 22239 22245 22251 22272 22282 22293 22311 22333 22350 22363 22384 22404 22424 22435 22448 22470 22477 22502 22517 22537 22549 22566 22583 22603 22622 22799 23083 23393 23573 23784 23972 24038 24085 24140 24184 24204 24233 24245 24251 24267 24271 24275 24283 24293 24305 24320 24339 24375 24386 24397 24436 24448 24458 24468 24478 24494 24512 24561 24582 24627 24871 24897 25151 25166 25192 25249 25283 25318 25460 25477 25526 25547 25563 25592 25597 25602 25608 25613 25652 25687 25717 25772 25805 25851 25865 25944 25949 26003 26017 26027 26051 26137 26185 26291 26325 26332 26347 26374 26383 26422 26429 26451 26470 26486 26504 26536 26555 26572 26729 26760 26767 26776 26784 26791 26805 26823 26842 26852 26864 26905 26950 26979 27000 27023 27042 27080 27086 27094 27098 27119 27136 27145 27164 27310 27352 27862 27870 27894 27912 27956 27961 27966 27970 28001 28014 28023 28069 28195 28286 28298 28362 28364 28366 28368 28378 28392 28407 28434 28438 28444 28449 28458 28463 28490 28492 28507 28518 28533 28561 28605 28652 28668 28690 28701 28734 28754 28803 28903 28905 28973 29013 29058 29133 29199 29234 29315 29322 29383 29447 29454 29460 29559 29615 29891 30015 30126 30188 30226 30234 30256 30305 30308 30329 30374 30429 30488 30557 30604 30709 30852 30877 30881 30915 30931 30956 31004 31040 31101 31155 31236 31258 31297 31334 31366 31390 31417 31443 31457 31465 31475 31483 31497 31510 31522 31546 31587 31613 31630 31659 31983 31986 32000 32012 32018 32034 32046 32053 32060 32069 32079 32096 32112 32155 32163 32171 32181 32192 32210 32227 32240 32266 32273 32281 32298 32306 32323 32347 32366 32385 32404 32414 32425 32439 32457 32477 32497 32506 32529 32549 32560 32575 32587 32606 32625 32636 32646 32651 32657 32675 32694 32713 32720 32739 32759 32784 32801 32807 32815 32825 32837 32858 32874 32882 32902 32922 32944 32952 32963 32986 32993 33007 33029 33046 33055 33076 33094 33103 33134 33150 33177 33196 33216 33234 33255 33269 33289 33296 33315 33330 33349 33894 33927 33955 33984 33992 34029 34341 34518 34595 34612 34630 34645 34667 34717 34727 34744 34766 34825 34983 35007 35137 35162 35288 35306 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-11.99.3. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-11.99.3 zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-11.99.3 zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-11.99.3 zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-11.99.3 zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Instalacja zostala przerwana. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-11.99.3Wyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-11.99.3Uruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPHTTPSNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Jesli uruchomiles komputer z dyskietki, mozesz ja teraz wyciagnac. Nie moge przeczytac bootbloku filecore Nie moge przeczytac tablicy partycji RISCiX Nie znalazlem partycji NetBSD w tablicy partycji RISCiX - Nie moge nazwac Nie znalazlem partycji NetBSD (dysk filecore?) - Nie moge nazwac Instalowanie bootblokow na %s.... Partycje NetBSD na dysku %s wygladaja teraz tak (Rozmiary i Przesuniecia w %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766:  . ..zerowd3pwd3owd3nwd3mwd3lwd3kwd3jwd3iwd3hwd3g wd3f!wd3e"wd3d#wd3c$wd3b%wd3a& wd3'wd2p(wd2o)wd2n*wd2m+wd2l,wd2k-wd2j.wd2i/wd2h0wd2g1wd2f2wd2e3wd2d4wd2c5wd2b6wd2a7 wd28wd1p9wd1o:wd1n;wd1m<wd1l=wd1k>wd1j?wd1i@wd1hAwd1gBwd1fCwd1eDwd1dEwd1cFwd1bGwd1aH wd1Iwd0pJwd0oKwd0nLwd0mMwd0lNwd0kOwd0jPwd0iQwd0hRwd0gSwd0fTwd0eUwd0dVwd0cWwd0bXwd0aY wd0Zurandom[ttypf\ttype]ttypd^ttypc_ttypb`ttypaattyp9bttyp8cttyp7dttyp6ettyp5fttyp4gttyp3httyp2ittyp1jttyp0ktty01ltty00m ttynstdoutostdinpstderrq st1r st0ssd3ptsd3ousd3nvsd3mwsd3lxsd3kysd3jzsd3i{sd3h|sd3g}sd3f~sd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2a sd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2krwd2jrwd2irwd2hrwd2grwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1erwd1drwd1crwd1brwd1arwd1rwd0prwd0orwd0nrwd0mrwd0lrwd0krwd0jrwd0irwd0hrwd0grwd0frwd0erwd0drwd0crwd0brwd0arwd0rst1rst0rsd3prsd3orsd3nrsd3mrsd3lrsd3krsd3jrsd3irsd3hrsd3grsd3frsd3e rsd3d rsd3c rsd3b rsd3a rsd3rsd2prsd2orsd2nrsd2mrsd2lrsd2krsd2jrsd2irsd2hrsd2grsd2frsd2ersd2drsd2crsd2brsd2arsd2rsd1p rsd1o!rsd1n"rsd1m#rsd1l$rsd1k%rsd1j&rsd1i'rsd1h(rsd1g)rsd1f*rsd1e+rsd1d,rsd1c-rsd1b.rsd1a/rsd10rsd0p1rsd0o2rsd0n3rsd0m4rsd0l5rsd0k6rsd0j7rsd0i8rsd0h9rsd0g:rsd0f;rsd0e<rsd0d=rsd0c>rsd0b?rsd0a@rsd0Armd1cBrmd1aCrmd1Drmd0cErmd0aFrmd0Grld7pHrld7oIrld7nJrld7mKrld7lLrld7kMrld7jNrld7iOrld7hPrld7gQrld7fRrld7eSrld7dTrld7cUrld7bVrld7aWrld7Xrld6pYrld6oZrld6n[rld6m\rld6l]rld6k^rld6j_rld6i`rld6harld6gbrld6fcrld6edrld6derld6cfrld6bgrld6ahrld6irld5pjrld5okrld5nlrld5mmrld5lnrld5korld5jprld5iqrld5hrrld5gsrld5ftrld5eurld5dvrld5cwrld5bxrld5ayrld5zrld4p{rld4o|rld4n}rld4m~rld4lrld4krld4jrld4irld4hrld4grld4frld4erld4drld4crld4brld4arld4rld3prld3orld3nrld3mrld3lrld3krld3jrld3irld3hrld3grld3frld3erld3drld3crld3brld3arld3rld2prld2orld2nrld2mrld2lrld2krld2jrld2irld2hrld2grld2frld2erld2drld2crld2brld2arld2rld1prld1orld1nrld1mrld1lrld1krld1jrld1irld1hrld1grld1frld1erld1drld1crld1brld1arld1rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rflash7rflash6rflash5rflash4rflash3rflash2rflash1rflash0rfd1prfd1orfd1nrfd1mrfd1lrfd1krfd1jrfd1irfd1hrfd1grfd1frfd1erfd1drfd1crfd1brfd1arfd1rfd0prfd0orfd0nrfd0mrfd0lrfd0krfd0jrfd0irfd0hrfd0grfd0frfd0erfd0drfd0crfd0brfd0arfd0rdk7rdk6rdk5rdk4rdk3rdk2rdk1rdk0rcd1crcd1arcd1rcd0crcd0arcd0randomptypf ptype ptypd ptypc ptypb ptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0 memmd1cmd1a md1!md0c"md0a# md0$ld7p%ld7o&ld7n'ld7m(ld7l)ld7k*ld7j+ld7i,ld7h-ld7g.ld7f/ld7e0ld7d1ld7c2ld7b3ld7a4 ld75ld6p6ld6o7ld6n8ld6m9ld6l:ld6k;ld6j<ld6i=ld6h>ld6g?ld6f@ld6eAld6dBld6cCld6bDld6aE ld6Fld5pGld5oHld5nIld5mJld5lKld5kLld5jMld5iNld5hOld5gPld5fQld5eRld5dSld5cTld5bUld5aV ld5Wld4pXld4oYld4nZld4m[ld4l\ld4k]ld4j^ld4i_ld4h`ld4gald4fbld4ecld4ddld4celd4bfld4ag ld4hld3pild3ojld3nkld3mlld3lmld3knld3jold3ipld3hqld3grld3fsld3etld3duld3cvld3bwld3ax ld3yld2pzld2o{ld2n|ld2m}ld2l~ld2kld2jld2ild2hld2gld2fld2eld2dld2cld2bld2a ld2ld1pld1old1nld1mld1lld1kld1jld1ild1hld1gld1fld1eld1dld1cld1bld1a ld1ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullflash7flash6flash5flash4flash3flash2flash1flash0fd1pfd1ofd1nfd1mfd1lfd1kfd1jfd1ifd1hfd1gfd1ffd1efd1dfd1cfd1bfd1a fd1fd0pfd0ofd0nfd0mfd0lfd0kfd0jfd0ifd0hfd0gfd0ffd0efd0dfd0cfd0bfd0a fd0est1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drvctldrum dk7 dk6 dk5 dk4 dk3 dk2 dk1 dk0consttyconsolecd1ccd1a cd1cd0ccd0a cd0 bpf0 bpf ...# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin  . .. dhcpcd-hooksdhcpcd-run-hooks# $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use fi done # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  . ..20-resolv.conf 30-hostnamen $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime if [ -n "$rdnsstime" ]; then ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers if [ -n "$rdnss" ]; then new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi fi fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime if [ -n "$dnssltime" ]; then ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search if [ -n "$dnssl" ]; then new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi fi fi # Break when we don't have either [ -z "$rdnsstime" ] && [ -z "$dnssltime" ] && return 1 j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf retur# Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dkctl drvctl fdisk fsck fsck_ffs  fsck_msdos gpt halt ifconfig init mknod mount  mount_cd9660  mount_ext2fs  mount_ffs  mount_kernfs  mount_mfs  mount_msdos  mount_nfs  mount_tmpfs newfs  newfs_ext2fs  newfs_msdos ping reboot restore route rrestore shutdown slattach swapctl sysctl dumount ... ... . .. binmdecsbinshare . .. cu ftp gunzip gzcat gzip less more progress sed tar tip Htset ... . .. chroot . ..misc ... . .. db log run spool ... ... ... . .. lock . ..