DOS' `"netbsd -ASn2A"p0:$@`BZӐpBJf0f/N,_#P/ aXpNuO`H88(/v֏pƀ/NBNPJfHzHz2GNBHzQE.N$OIjBHzEN$PjBHz=N$Pk>//NPJf. C&(tfHz#NX&</N$HXJf:p #/:HzN/N3 NbNDO pLONu///NO gp#// NP`Hz/ NPJg BOOTf/N/:// NlOp`NuNqH00$/fHx$Hz}N,#TPfpL NuHzBN#Pg#0Hz2BN#PgNn#gHx0/G2N#Pg!y(!|$B/BHzETNOJfVHx(/9N#PgdB/BHzNOJfN$<BC~fZJgp#N.`HzNXJgB/NPJgB/9BHzqNOJgn` IR  g -fRf"H`~ Cfr`Rf`Jfp#B`/ $zTJgz *g/N/*NP *g/N/*NP * g /N~X *g /NX *g /NX :g /NDXBB$_NuY/ / $z@ jr!A$rҏ!A(1|Jg /N| $z, jp!@$rҏ!A(1|/IhN4: XK|GBMJyft j1| B !|$/N/* NPf./*N/*NPBy/*NX/IL|XNuJgNrg @/*`pg/*NSX`tNq z!z~,BNupNu/ / $o &o pf45|%o$ /r кH%@,%o(/ NXJ*g Bp$_&_Nu& B` o##,Nu o!z!| o BNu z!z,NuNVH80BEJf8 . R$BB BBBHn/./ N$O g(`ZRE rfx#v`L xȀDkJg2 nJg.Jg*Gxm0*f j h Jg/ NXB`r$ L N^Nu/ /. SNPJfpL(T%B `rg(RG`YH,0 /&o $/$re"0 ft #pL 4XNu$@DfXN jHo/ /G "t +t 䨂/Hx/* hN#Of /*B۫"ӄ&`/B j Ho// / hN#Ofn `fNqH00 /&$CfG 38g~DftĀDjDB9BL Nu j Jg/ hN$X38g(o<$l&j "*,+<*ʆ.+P///NO ( jp lD&+0*jg~tԁ,솼g *rL AB2|ހ" 充me`$*&* R"[Int&+0g$,rL8Jf/B/*N%CO %D o@$*ԅ oD (*** "*/C0B,$&,/,./0bB`Ɔ֫DƫL`r?ā0|&,r`|"L@,rdJgnN lHo4/ /+0"j ")d/Hx/, hNOJf| k04f ,u Jg rSā`HxpĀHu(HjN%FO `N lHj/*/ "+d/Hx/, hNOJgL|O Nu. oD `p`p`/ / o $hBJg. *G bg j/(0/NPHx /*NHx/ NOB$_&_NuOH?>$/\&o`HxM N$HHxB/N'JHx N*H%HN kIh/ / Hx HxHx/+ hN"O,ff Tfj T\f^ -0 nP _cF&-txf2%A/N%H/ HxMN&O f z!/E@|/FD`R`. R /gJg2*A A@f$R BIJgx/f*/E<,+BB"F"#A()*)nr`HoPHoP/ NN"O fx oL"/P(؁e/A0B, /,"/0 F(Ҩф`JhgJgZB(&o@*/D$/H$oL,k|8܏~4ޏIK\JfBJg$L|ONu ".&.(.l/// NO Jf&/8d&///8/N/C&o4,/84|M`K k( nL&< !CI,J*o8(o< /fRHxI0N$H)HHxI0B/N%|`IBI&lOJI(fBBB/ N$O fA IIԁf'BI$ +I,'@I r'AI~Gv4֏( z0ڏ||܊%KI// / Nx$O fHx// NHxHz B/$< BNOJfp%@I HzMN/Hz/ BNO.<Jf&HzN/HzHr GNpЯ@r %@IOHo,Hz/ GNHxd/ / BN$Of%o,I L|ONu"/,G  Jl SR/@,g "<~`$HxI0/ NBP`pNu/"/ / o htgtgJf !@I"[I$Nu (IЁ` (I`pr`H>>*o,*/0(/4(o8HxN&H$mXM,<JfBJg(Hx/ NP L||Nu *IIl&Jl SR/ jIAHp/ N$O f <$*IId$d$/Hs8/"FNժIڂO `lNVH8 n$n Jgt&hHxB/ NHnHz(HkdINHnHzHklNO$HnHzHktN%n%n%n %kIt[I%@pO BLN^Nup`/ $oJg *gHxI0/NBPB$_Nup`/,z /"<N:,_ @Nu/,z"o / N.,_Nu/L`Q$NuNq/L`Q$NuNq o"o`"o o / gdSfNu!SfNu/aXNuH2EC o,zNLLNuNuH2&oEC o,zNLLNuNq,x o"o*o EGp&QN NuNq o FJfЈNu o"og$fgfgfg gUINupDNu/"/  @f0 0 g&tĀDg$"h // / iNP# $Nup t`p-`/,z "o / N,_ @Nu/,z"oNb,_Nu/,z o / Nr,_ @Nu/,zNf,_ @Nu/,z oN`,_Nu/,z oNl,_Nu/,z o / "o"/ND,_Nu/,z"oN>,_Nu/,zz"oN8,_Nu/,zh"oN&,_Nu/,zV"oN2,_Nu/,zD"oN ,_Nu/,z2 oN,_ @Nu/,zN,_Nu/,z /N,_Nu/,zN,_Nu/,zN,_Nu/,z o"o /N,_Nu/,z"oN,_ @Nu/,z"o"/ N,_ @Nu/,z"oN,_ @Nu/,z o"o N,_ @Nu/,zt oN,_Nu/,zb o"o N,_ @Nu/,zJ oN,_Nu/,z< o / "/N,_ @Nu o"o / gJ"gf4Sg:" f"gfSfgfSfNuYYp`BB !NuNq/ o"// mlB$ሄሄሄ gSRg0U g"S QB@Sd gS QgSQ / @$Nu / g8 o"og.f,Sg$g"f SggfSg g fSfNuUINu-26811.99.33.2 (Tue Nov 4 08:50:07 UTC 2025)USTAR.volsize.USTARFSNetBSD/Amiga 11.99.3 Primary Bootstrap %s /boot.amiga/boot/boot.amiBad size, using 32K DOSError %ld intuition.libraryconsole.devicetimer.devicexd@Warning, unexpected short transfer %d/%d ustarfs read512block Please remove disk %d, insert disk %d, and press return... Disk is not from the volume set?! %9oustar%99o%12o%8op t *f\`mJ88F`(T$  &   ,"X   4 2j6z$X x8 88($, jJPlr*4*6\"޺04v4rr "< 08i ?86<  8i ?l:q 888g gi ?86@@<@T 08i ?86<  8i ?l:q 888g gi ?86@@<@T Ui ?8g44 Ai ?i ?i ?$ -i ?i ?i ?Ai ?i ?i ?$i ?i ?i ? (08@BA2i ?i ?i ?444wAi ?i ?i ?&m.i ?i ?i ?HPX$-i ?i ?i ?`hp$i ?i ?i ?xEAi ?i ?i ?Ai ?i ?i ?&Ai ?i ?i ?4Ai ?i ?i ?4$G_di ?i ?i ? #(#Ai ?i ?i ?4Ai ?i ?i ?4Ci ?i ?i ?4m+i ?i ?i ?&&&Ai ?i ?i ?4Ai ?i ?i ?4m;i ?i ?i ?&&&&&&&&&&&&' !i ?i ?i ? ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ? ai ?i ?i ? ai ?i ?i ? ai ?i ?i ? ai ?i ?i ? ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?!i ?i ?i ?*!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ? !i ?i ?i ? !i ?i ?i ? !i ?i ?i ? !i ?i ?i ? !i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ? B!i ?i ?i ? !i ?i ?i ? !i ?i ?i ? !i ?i ?i ? !i ?i ?i ? !i ?i ?i ? !i ?i ?i ? !i ?i ?i ? !i ?i ?i ? B!i ?i ?i ?B!i ?i ?i ?B!i ?i ?i ?B!i ?i ?i ?B!i ?i ?i ? B!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?~ai ?i ?i ?}ai ?i ?i ?|ai ?i ?i ?{ai ?i ?i ?zai ?i ?i ?yai ?i ?i ?xai ?i ?i ?wai ?i ?i ?vai ?i ?i ?uai ?i ?i ?tai ?i ?i ?sai ?i ?i ?rai ?i ?i ?qai ?i ?i ?pai ?i ?i ?rai ?i ?i ?oai ?i ?i ?nai ?i ?i ?mai ?i ?i ?lai ?i ?i ?kai ?i ?i ?jai ?i ?i ?iai ?i ?i ?hai ?i ?i ?gai ?i ?i ?fai ?i ?i ?eai ?i ?i ?dai ?i ?i ?cai ?i ?i ?bai ?i ?i ?aai ?i ?i ?`ai ?i ?i ?bai ?i ?i ?_ai ?i ?i ?^ai ?i ?i ?]ai ?i ?i ?\ai ?i ?i ?[ai ?i ?i ?Zai ?i ?i ?Yai ?i ?i ?Xai ?i ?i ?Wai ?i ?i ?Vai ?i ?i ?Uai ?i ?i ?Tai ?i ?i ?Sai ?i ?i ?Rai ?i ?i ?Qai ?i ?i ?Pai ?i ?i ?Rai ?i ?i ?Oai ?i ?i ?Nai ?i ?i ?Mai ?i ?i ?Lai ?i ?i ?Kai ?i ?i ?Jai ?i ?i ?Iai ?i ?i ?Hai ?i ?i ?Gai ?i ?i ?Fai ?i ?i ?Eai ?i ?i ?Dai ?i ?i ?Cai ?i ?i ?Bai ?i ?i ?Aai ?i ?i ?@ai ?i ?i ?Bai ?i ?i ??ai ?i ?i ?>ai ?i ?i ?=ai ?i ?i ?<ai ?i ?i ?;ai ?i ?i ?:ai ?i ?i ?9ai ?i ?i ?8ai ?i ?i ?7ai ?i ?i ?6ai ?i ?i ?5ai ?i ?i ?4ai ?i ?i ?3ai ?i ?i ?2ai ?i ?i ?1ai ?i ?i ?0ai ?i ?i ?2ai ?i ?i ?/ai ?i ?i ?.ai ?i ?i ?-ai ?i ?i ?,ai ?i ?i ?+ai ?i ?i ?*ai ?i ?i ?)ai ?i ?i ?(ai ?i ?i ?'ai ?i ?i ?&ai ?i ?i ?%ai ?i ?i ?$ai ?i ?i ?#ai ?i ?i ?"ai ?i ?i ?!ai ?i ?i ? ai ?i ?i ?"ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ? ai ?i ?i ? ai ?i ?i ? ai ?i ?i ? ai ?i ?i ? ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?!i ?i ?i ?4!i ?i ?i ?4!i ?i ?i ?4!i ?i ?i ?4!i ?i ?i ?4!i ?i ?i ?4!i ?i ?i ?4!i ?i ?i ?4!i ?i ?i ?4!i ?i ?i ?4!i ?i ?i ?4!i ?i ?i ?4!i ?i ?i ?4!i ?i ?i ?4!i ?i ?i ?4!i ?i ?i ?4!i ?i ?i ?4!i ?i ?i ?4!i ?i ?i ?4!i ?i ?i ?4 !i ?i ?i ?4 !i ?i ?i ?4 !i ?i ?i ?4 !i ?i ?i ?4 !i ?i ?i ?4!i ?i ?i ?4!i ?i ?i ?4!i ?i ?i ?4!i ?i ?i ?4!i ?i ?i ?4!i ?i ?i ?4!i ?i ?i ?4!i ?i ?i ?4!i ?i ?i ?4!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?~!i ?i ?i ?}!i ?i ?i ?|!i ?i ?i ?{!i ?i ?i ?z!i ?i ?i ?y!i ?i ?i ?x!i ?i ?i ?w!i ?i ?i ?v!i ?i ?i ?u!i ?i ?i ?t!i ?i ?i ?s!i ?i ?i ?r!i ?i ?i ?q!i ?i ?i ?p!i ?i ?i ?r!i ?i ?i ?o!i ?i ?i ?n!i ?i ?i ?m!i ?i ?i ?l!i ?i ?i ?k!i ?i ?i ?j!i ?i ?i ?i!i ?i ?i ?h!i ?i ?i ?g!i ?i ?i ?f!i ?i ?i ?e!i ?i ?i ?d!i ?i ?i ?c!i ?i ?i ?b!i ?i ?i ?a!i ?i ?i ?`!i ?i ?i ?b!i ?i ?i ?_!i ?i ?i ?^!i ?i ?i ?]!i ?i ?i ?\!i ?i ?i ?[!i ?i ?i ?Z!i ?i ?i ?Y!i ?i ?i ?X!i ?i ?i ?W!i ?i ?i ?V!i ?i ?i ?U!i ?i ?i ?T!i ?i ?i ?S!i ?i ?i ?R!i ?i ?i ?Q!i ?i ?i ?P!i ?i ?i ?R!i ?i ?i ?O!i ?i ?i ?N!i ?i ?i ?M!i ?i ?i ?L!i ?i ?i ?K!i ?i ?i ?J!i ?i ?i ?I!i ?i ?i ?H!i ?i ?i ?G!i ?i ?i ?F!i ?i ?i ?E!i ?i ?i ?D!i ?i ?i ?C!i ?i ?i ?B!i ?i ?i ?A!i ?i ?i ?@!i ?i ?i ?B!i ?i ?i ??!i ?i ?i ?>!i ?i ?i ?=!i ?i ?i ?<!i ?i ?i ?;!i ?i ?i ?:!i ?i ?i ?9!i ?i ?i ?8!i ?i ?i ?7!i ?i ?i ?6!i ?i ?i ?5!i ?i ?i ?4!i ?i ?i ?3!i ?i ?i ?2!i ?i ?i ?1!i ?i ?i ?0!i ?i ?i ?2!i ?i ?i ?/!i ?i ?i ?.!i ?i ?i ?-!i ?i ?i ?,!i ?i ?i ?+!i ?i ?i ?*!i ?i ?i ?)!i ?i ?i ?(!i ?i ?i ?'!i ?i ?i ?&!i ?i ?i ?%!i ?i ?i ?$!i ?i ?i ?#!i ?i ?i ?"!i ?i ?i ?!!i ?i ?i ? !i ?i ?i ?"!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ? !i ?i ?i ? !i ?i ?i ? !i ?i ?i ? !i ?i ?i ? !i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?2?!i ?i ?i ?2>!i ?i ?i ?2=!i ?i ?i ?2<!i ?i ?i ?2;!i ?i ?i ?2:!i ?i ?i ?29!i ?i ?i ?28!i ?i ?i ?27!i ?i ?i ?26!i ?i ?i ?25!i ?i ?i ?24!i ?i ?i ?23!i ?i ?i ?22!i ?i ?i ?21!i ?i ?i ?20!i ?i ?i ?22!i ?i ?i ?2/!i ?i ?i ?2.!i ?i ?i ?2-!i ?i ?i ?2,!i ?i ?i ?2+!i ?i ?i ?2*!i ?i ?i ?2)!i ?i ?i ?2(!i ?i ?i ?2'!i ?i ?i ?2&!i ?i ?i ?2%!i ?i ?i ?2$!i ?i ?i ?2#!i ?i ?i ?2"!i ?i ?i ?2!!i ?i ?i ?2 !i ?i ?i ?2"!i ?i ?i ?2!i ?i ?i ?2!i ?i ?i ?2!i ?i ?i ?2!i ?i ?i ?2!i ?i ?i ?2!i ?i ?i ?2!i ?i ?i ?2!i ?i ?i ?2!i ?i ?i ?2!i ?i ?i ?2!i ?i ?i ?2!i ?i ?i ?2!i ?i ?i ?2!i ?i ?i ?2!i ?i ?i ?2!i ?i ?i ?2!i ?i ?i ?2!i ?i ?i ?2!i ?i ?i ?2 !i ?i ?i ?2 !i ?i ?i ?2 !i ?i ?i ?2 !i ?i ?i ?2 !i ?i ?i ?2!i ?i ?i ?2!i ?i ?i ?2!i ?i ?i ?2!i ?i ?i ?2!i ?i ?i ?2!i ?i ?i ?2!i ?i ?i ?2!i ?i ?i ?2!i ?i ?i ?2!i ?i ?i ?+!i ?i ?i ?+!i ?i ?i ?+!i ?i ?i ??!i ?i ?i ?>!i ?i ?i ?=!i ?i ?i ?<!i ?i ?i ?;!i ?i ?i ?:!i ?i ?i ?9!i ?i ?i ?8!i ?i ?i ?7!i ?i ?i ?6!i ?i ?i ?5!i ?i ?i ?4!i ?i ?i ?3!i ?i ?i ?2!i ?i ?i ?1!i ?i ?i ?0!i ?i ?i ?2!i ?i ?i ?/!i ?i ?i ?.!i ?i ?i ?-!i ?i ?i ?,!i ?i ?i ?+!i ?i ?i ?*!i ?i ?i ?)!i ?i ?i ?(!i ?i ?i ?'!i ?i ?i ?&!i ?i ?i ?%!i ?i ?i ?$!i ?i ?i ?#!i ?i ?i ?"!i ?i ?i ?!!i ?i ?i ? !i ?i ?i ?"!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ? !i ?i ?i ? !i ?i ?i ? !i ?i ?i ? !i ?i ?i ? !i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ? "!i ?i ?i ? !i ?i ?i ? "!i ?i ?i ? !i ?i ?i ? !i ?i ?i ? !i ?i ?i ? !i ?i ?i ? !i ?i ?i ? !$i ?i ?i ?*ai ?i ?i ??ai ?i ?i ?>ai ?i ?i ?=ai ?i ?i ?<ai ?i ?i ?;ai ?i ?i ?:ai ?i ?i ?9ai ?i ?i ?8ai ?i ?i ?7ai ?i ?i ?6ai ?i ?i ?5ai ?i ?i ?4ai ?i ?i ?3ai ?i ?i ?2ai ?i ?i ?1ai ?i ?i ?0ai ?i ?i ?2ai ?i ?i ?/ai ?i ?i ?.ai ?i ?i ?-ai ?i ?i ?,ai ?i ?i ?+ai ?i ?i ?*ai ?i ?i ?)ai ?i ?i ?(ai ?i ?i ?'ai ?i ?i ?&ai ?i ?i ?%ai ?i ?i ?$ai ?i ?i ?#ai ?i ?i ?"ai ?i ?i ?!ai ?i ?i ? ai ?i ?i ?"ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ? ai ?i ?i ? ai ?i ?i ? ai ?i ?i ? ai ?i ?i ? ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ? !i ?i ?i ? !i ?i ?i ? !i ?i ?i ? !i ?i ?i ? !i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?ai ?i ?i ?!i ?i ?i ?!i ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?! i ?i ?i ?:!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?!i ?i ?i ? !i ?i ?i ? $!i ?i ?i ? !i ?i ?i ? !i ?i ?i ? !i ?i ?i ? !i ?i ?i ? !i ?i ?i ? !i ?i ?i ? !i ?i ?i ? !i ?i ?i ? ai ?i ?i ??ai ?i ?i ?>ai ?i ?i ?=ai ?i ?i ?<ai ?i ?i ?;ai ?i ?i ?:ai ?i ?i ?9ai ?i ?i ?8ai ?i ?i ?7ai ?i ?i ?6ai ?i ?i ?5ai ?i ?i ?4ai ?i ?i ?3ai ?i ?i ?2ai ?i ?i ?1ai ?i ?i ?0ai ?i ?i ?2ai ?i ?i ?/ai ?i ?i ?.ai ?i ?i ?-ai ?i ?i ?,ai ?i ?i ?+ai ?i ?i ?*ai ?i ?i ?)ai ?i ?i ?(ai ?i ?i ?'ai ?i ?i ?&ai ?i ?i ?%ai ?i ?i ?$ai ?i ?i ?#ai ?i ?i ?"ai ?i ?i ?!ai ?i ?i ? ai ?i ?i ?"ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ? ai ?i ?i ? ai ?i ?i ? ai ?i ?i ? ai ?i ?i ? ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?!i ?i ?i ?ai ?i ?i ?!i ?i ?i ?!i ?i ?i ? B!i ?i ?i ?!i ?i ?i ?!i ?i ?i ?ai ?i ?i ?"ai ?i ?i ? ai ?i ?i ?"ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?ai ?i ?i ?i ?i ?i ?/tmp/fstab.shadow$i ?i ?i ? i ?i ?i ?/tmp/hosts$>i ?i ?i ?$i ?i ?i ?4$si ?i ?i ?4i ?i ?i ?/tmp/resolv.conf.shadow$i ?i ?i ?4Ai ?i ?i ?4Ai ?i ?i ?4Ai ?i ?i ?4Ai ?i ?i ?4Ai ?i ?i ?4Ai ?i ?i ?4Ai ?i ?i ?4Ai ?i ?i ?4$i ?i ?i ?4$i ?i ?i ?4$i ?i ?i ?4$i ?i ?i ?4$i ?i ?i ?4$i ?i ?i ?4$i ?i ?i ?4Ai ?i ?i ?4Ai ?i ?i ?4Ai ?i ?i ?4Ai ?i ?i ?4i ?i ?i ?/tmpAi ?i ?i ?4zr~@m,)9v[WN`M',}0+&l(w3gluGDI Hc5Lp?gOUh'z}w`">2%~,3t`'+i+%ܶa}#XvNU^wX ~/U+#6prH-CSBN1Hj@iwe4qԇYpUYEHj̅K]<h @4|!59Oc K:rDs ^YM~ 9 xP1b͆GN3f-E *ps;EvfS|ccwDau`oǬߩd!hY/ AvUo8fsxB̍Bw*I)$V]n6[@HR4ygu?n Y0 |7B:V8 !豠1f `"S\{ݟ$?qI4˻` :G~n~Fv^aI6k3[pTy-]XJ[%ec^*6!cTpe-^^F>I:EcK{Ft.N&4P~ ;oOL #.t"b )7a[ЏI at"EN;uޑdGht!(b~ie&.40:3BPz+ nQz^wJ <+|uhIE,픃L5Ts!5=/b_ZAJ:pF@FоlJQ@։S{yKaI {KfZ Fo gkD;uXM Lx(B1BPsS 1u^Rz:VUsn1 O]ƐVs <J:8NXv9B !; ^!HzdNm0hc>KYvbPOفYSb&(3bqj$$hV`0E MVcfК%D0*5b=&_ֺPtNU҈Nhh!,_p#BZg-/?nsB\m\cT"!"N6/6IJ/7i_=T6|e  \b68 }Qv1b1whQK]+M*YD3-UM_0BKW9~Bū)|])}9QqTNﴳ=*R*`&>k20h #zK!'4RucO2^S6˴&~eLDs"PR .S'*( >CM2[d{`.犰Z;N}cO'C ;ETJZ4vHH\/Gg{G1Pb)/c  wm,Rz'@Q ls4\c:*!&eA";`in8;t}-_g ?nd+,&,fn|8x*ةlUcF<| BKӬآ5_S'@);tL;fPC[`߸|xEdcC7jɎ;Y)r>t]Wӈ_} y2t+>&j;":Xsdvdl\TOfP/A9O4@22>}. vƵbftMz}Nh }@wmqDY(, q3++Jю#c.-*7_0iv$Vz5JZ% Iz&n4 XT '{-8jGym~iJ=y>Bt63{Jzl".q}y?>y$>.AY j,Ho@_,a%?&vd t-2J nd 5q؎GiSO@auEhMTmYlBZWazlYc$#Q`"gnL Q4w 9!+ Xzu]`YdbzzpE%C2kdJYly~wh695^o&4'm|G_ttmW+bmFAX+/ N bbk{: q BL9CzDWSh!o<J.N5GSZ'cux,-)\m+J@;~_4Jr+ PS i_RZ 6ҋg&Bw} 1, njvn&5 f!p2:VV)c;X|4UGnBZ 3> h Ҋ<3z9BFp0c= efkcg N9'f/)f T;i}$*equbL,CaDu2pb[+E 4uGy$po+3AqL=JJ*!Q;tz.^Q+(4n59|i`zA0fu8!NH#&U̽^29_D?j7p@0CKWxJsDRMwsXpVWpPBUBjL(t<'U|]oJq? %fW~2x` k'.te0jyF=}q̂][I(/y<#T}}Z`&m̱/R9% PK|j-Xy{@%>o16,Ur)S!47Q*!{}h;pz?UU6?B}xBqYEz?t34Kt?F$vw$AuVJ ,V_MTz1ɡ+ ]hF[\e},ݯ?fc'gN*A޻u+i9$8H5U!ZS| `ˠm*<V KkATRYKr\M@"f "* C2nN& 4Nl- :sOQ1OT!/EsZ"Gxg . ...profile bin boot.amiga dev etcinstall  install.md  install.sub kern libexec mntmnt2netbsdsbin targetroot tmpupgrade usrvarstance too far backincorrect data checkincorrect length checkinvalid distance too far backinvalid distance codeinvalid literal/length codepj $T$'(h(l(zJ00F`N@ 6  ,N`8&6N r   4&\ 8 :6$*hnT`~*4*6r,@<@rHNTjPdD *4.6` 0V$ &V(8* 8,(t (, T.,(J&V4($*4($8@v lP@rH&^ . V $*  0 4 h(* tR0d0.* 2H `@ .&,$ |NB> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=vt220 export TERM HOME=/ export HOME umask 022 if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? 9600 # Select a keyboard map _maps=`ls /usr/share/keymaps/amiga | sed 's/\.map//g'` while [ ! -z "$_maps" ]; do echo "The available keyboard maps are:" _num=0 for i in $_maps; do echo " $_num $i" _num=`expr $_num + 1` done echo echo -n "Select the number of the map you want to activate: " read _ans # Delete all non-nummeric characters from the users answer if [ ! -z "$_ans" ]; then _ans=`echo $_ans | sed 's/[^0-9]//g'` fi # Check if the answer is valid (in range). Note that an answer # < 0 cannot happen because the sed(1) above also removes the # sign. if [ -z "$_ans" ] || [ "$_ans" -ge $_num ]; then echo "You entered an invalid response, please try again." continue fi # Got a valid answer, activate the map... set -- $_maps shift $_ans export __keymap__=/usr/share/keymaps/amiga/$1.map /usr/sbin/loadkmap ${__keymap__} break done # Installing or upgrading? _forceloop="" while [ "X${_forceloop}" = X"" ]; do echo -n '(I)nstall or (U)pgrade? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; *) _forceloop="" ;; esac done fi  . .. catchgrpchmod cp dd df edexprhostnamekill ln lsmkdir mt mv pax pwd rm shsleepsttysyncBOOT `"netbsd -ASn2A"p0:$@`BZӐpBJf0f/N,_#/ / aBPpNuNqH< "o$QA*  g -f (RP $f(RvB`DR`B` 0f(p FtXgRv `(T` b,LIЂRJg  czgS"JfL| ${ps jp!@$rҏ!A(1|/IpN4;ps XKpGpMp Jyft j1| B !|$/N/* NPf./*N-h/*NPBy/*NX/IL|XNuJgNrg @/*`pg/*NSX`tNq {ps !{pr,BNupNu/ / $o /&o$rf45|%o$r лpr%@,%o (/ N-2XJ*g Bp$_&_Nu& B` o#<#,8Nu o!{pr|!| o BNuH8>$/$&/($BIpV*|0 f B*L|NuNr€xm:xxg: Qxe0Ѐ05NF&4&&4&&&&p&&&pg /N X`Bx /D$L|`.d~SHxGpNHx NHxNO `ZHx GpNX,BdBI/NX`Hx N X$B`$NqNVH?<*.(n &l$k,Lj`&B.*FBB"†Kp/*[I///NO,."*[I////NO&*[IցՀևՆLj@xKp/*`/BNP.d,.ށ݀//NO &$*kN> lHn/ /*0-C-B//Hx/, hN$Of>.*0f@LjPxHxHuHkN)pp'@'|'|O L(oP$l&j "*,k<$ā/B4*kP/ //N)@O A(***&[I| lL,+0*j "gzڈ",Ag *xLHB2|ހ" 喙mܸeښ`,*.* R" /@0[I/A, /,"/0n,+0 "g((28Jf2/B/*N+%FO %B%C oT$/4Ԫ 4 oX $*&* "*/F lHoH/ /+0"j )d"[I/@L/AP///PHx/, hNOJf"+0Hf (5 Jg rSʁ`Hx~ʇHuXHjN)p%NO `N> lHj/*/ "+d"[I/@L/AP///PHx/, hNOJgL|O Nu. oX `p`p`/ / o $hBJg2 *Gpg j/(0/NPHx /*NHx/ NOB$_&_NuOH?>$/d&ohHxMp(N$HHxB/N+'JHx N*H%HN> kIp/ / Hx Bl/|pHx//pHx/+ hN"O0ff \f| T\fp -0 nb _cX&-txf2%A/N%H/ HxM8N&O f2z!/E@|/FD`R`. R /gJg2*A A@f$R BIJgx/f*/E<,+BB"F"#A()*)nr`HoXHoX/ N"O fx oT"/X(؁e/A0B, /,"/0 F(Ҩф`JhgJgZB( kHoX//-0*-d"[I/@X/A\///\Hx/+ hN"Of//`^r`"`r`OH?>&o@*/D$/H$oL,k|8܏~4ޏIKp\JfBJg$L|ONu ".&.(.l/// NO Jf&/8d&///8/N/C&o@./D4|Mp%Kp k, nL&< !CI,JHg&$<HJf4BL|ONu/B/N+$(܃O &< `BI,`N(jp *[I8| kHo8///D*o8(o< /fRHxI0N)$H)HHxI0B/N+%|`IBI&lOJI(fBBB/ N$O f"A IIԁf'BI$ +I,'@I r'AI~Gv4֏( z0ڏ||܊%KI// / NL$O f Hx// N)pHxH{p^/$<, BNOJfp%@I H{pQvMpN/H{pQb/ BNO.<Jf.H{pQFN/H{p^qHr GNpЯ@r %@IOHo,H{p^P/ GNHxd/ / BN$Of%o,I L|ONu"/,G  Jl SR/@,g "<~`$HxI0/ N)*BP`pNu/"/ / o htgtgJf !@I"[I$Nu (IЁ` (I`pr`H>>*o,*/0(/4(o8HxN)&H$mXM,<)pJfBJg(Hx/ N)*P L||Nu *IIl&Jl SR/ jIAHp/ N$O f <$*IId$d$/Hs8/"FNժIڂO `lNVH8 n$n Jg&hHxB/ N+HnH{p\HkdINHnH{p\}HklNO$HnH{p\gHktN%n%n%n %kIt[I%@pO BLN^Nup`/ $oJg *gHxI0/N)*BPB$_Nup`NqNVH?<&.(n &l$k(Lj@"*[I/B//N)O**[IځـLj xKp r/*`/BNP.d,.ށ݀//NO ($*k N> lHn/ /*0-D-B//Hx/, hN$OfH.*0fJLj0xHxHuHkN)p'|'|'|('|,O L(o`$l&j "**k<$ ā/BD&+P///N)@O /@,/A0(*(**,,/,./0Br o$+0*j ,/,./0g$(/,*/0~ه rB&,HoX/ /+0 j/(d//H//HNO /@\/A`///`Hx/,"C iNOJf +0Xf///N)@O /u4/u8Jg&S"[Iƅ(*`\HxpHuHj N)p,/H./L%F%GO `zN>*lHj$/* //+d//H//HN)XO /@\/A`///`Hx/, mNOJgLL|O0Nu."oh"`p`p`/ / o $hBJg2 * Gp g j/(0/NPHx /*NHx0/ NOB$_&_NuOH?>$od(ohHx0MpN&HHx0B/N+)KHx N*H'HN>,<nlO F(*,prfr` lHo\/ Hx "Jl B"<҅ф$v~ /@X/A\//Hx/, hN"Of \f$-&-얅f| -\ Tg  8ff -0 nj _c`*-t[IBvfF'A/N'H / HxMN(O f2v!/CD|Jf BBBD L|O4NuR`.  R /gJg2+A A@f$@RIJgt/f& /C<*,BB"E"#A$) &)$nr`HoXHoX/ N"O fx oT"/X$ԁe/A0B, /,"/0 E$Ҩт`JhgJgZB(/lHHoX//-0/-d//N)XO /@X/A\///\Hx/,"od iN"Of//`p,`"`r`OH?>&o@*/D$/H$oL,k|8܏~4ޏIKpJfBJg$L|ONu ".&. (.$l/// NO Jf&/8d&///8/N/CL<pr|?d҅фڅلQL|Nu/aXNuH2EC o,zWNLLNuNuH2&oEC o,zWNLLNuNq&O,xKNF'O"k$+,k k +"+.+(k *+$(+(&+,$k0,+4 +}$&k8gT3g N{N{N{N{N{N{N{`&K@KLHg K &HVeL.HY/ / &OC/A7!f W.@/K `.&_"_'!Yf`&YfC&/ Hz^&ٳeXg/tN{ $Nu$ }fN{N{N{N{N{N{N{t"B&B*B.N,BN o FJfЈNu o"o / gJ"gf4Sg:" f"gfSfgfSfNuYYp`BB !NuNq/ o"// mlB$ሄሄሄ gSRg0U g"S QB@Sd gS QgSQ / @$Nu / g8 o"og.f,Sg$g"f SggfSg g fSfNuUINuNq/,zU"o / N,_ @Nu/,zT o / Nr,_ @Nu/,zTNf,_ @Nu/,zT o / "o"/ND,_Nu/,zT"oN8,_Nu/,zT"oN&,_Nu/,zT"oN2,_Nu/,zTp"oN ,_Nu/,zT^ oN,_ @Nu/,zTJN,_Nu/,zT< /N,_Nu/,zT*N,_Nu/,zTN,_Nu/,zT o"o /N,_Nu/,zS"oN,_ @Nu/,zS"o"/ N,_ @Nu/,zS"oN,_ @Nu/,zS o"o N,_ @Nu/,zS o"o N,_ @Nu/,zS o / "/N,_ @NuOH<0$/X$o\&/`BBB B// /NDOxzgRHx4G$/ /NBlO zfPH{pLEpN ;pRfXg$/N?/H{pLNO $;pRB`H{pLNX`r4gNH{pLEpN ;pRXg"/N?/H{pLbNO xO#@`H{pLPNX`HxH{pLR/ N+O Jf^ /$fVz#B/%#// / /N7$OfDGg**/H{pKN)P L (/@&oD*oH&/L/k,(U* c$EEpUDBB4/| 8Hx //8/MpNO|~fTH{pJEpN ;pOXg$/N?/H{pJNO pL|ONuH{pJxN)X`~dgHx / / N)zO  VID$@ +g~/H{pJ".<) GN +/Hr/NBlOrf8H{pI GN ;pO2Xg`/N?/H{pI G`E`"+g:p#@`HxB4/@8/B/NO|~f H{pI` g +  g f<$ Dg /H{pIZN)/HrN>O g +Dfx/H{pI*$<) BN Ќ+@/+//NBlOrf4H{pH BN ;pNXgJ/N?/H{pH BN` g8p#@`HxB4/@8/B/NOz|f H{pH` gDj$/+ H{pHpN)/+ HrN>O g tăgHxHrHkN)zO gJX* +gxJgN/H{pH!.<) GN/+Hr/NBlOrfH{pG`B`g8p#@`HxB4/@8/B/NO|~f H{pG`JgHx|<܏//.<Bl GNO rf H{pG`Yg z#@`Jg&HxHr/N)z//DH{pGN)OJgX /8Y/@8n H{pG``6Jg2/Hr/ GNO rf H{pGQ`8g8z#@`HxB4/@8/B/NO|~f H{pG `Jg8*./,ތ+G+k ڌ+E+JB`NqQH8 $/ / $o(BB/@/B/NDOvxfRH{pFEpN ;pKZXg"/N?/H{pFNO pLPNuH{pFN)X`/ //(/NBl"O xf H{pFo`Bgp#@`QH8 $/ /$$o,BB/@/B/NDOvxfRH{pF4Ep:N ;pJXg"/N?/H{pENO pLPNuH{pEN)X`/ (/$د,//NBl"O pf H{pE`Bgv#@`NVH?<&n .."n-Q0+g,$i @gp#@p`8+0(/N)&///+ /.N&ORgXI4Bp4'@ Bk*Bk,Hx4/ / $<)z BN LAI  @*XO *EB"nȓ-IB2+0nj$*EB"nȓ-IB2+0"An// /N)z//N)*BԮO"n#J#BBLP".҇+A FA( Ї"LBRK(`///- /./.NORf//N)*`^,- rgerg>RK(`rg.r ` EBrfgRA(nB0+2gB `///- /./.NORg".҂+A Vp̀Ԇ`"nB @fB8+,/KpN&///+/.NOrg0$CBBI-A|"-Ar‡-A"-A"-Ar‡-Ar‡-AB0+,n//Ip"NVr‚-A  Pg-Ap4Ѯ g"n-Q6+0(/N$H///+ /.N:ORg$Ԯ0+2g(A((,(f/N*////.NORf// NPJg//`zpf *CggJf*gJf j"jc:Jg4/ H{pAN) j */".HpN>O j"jcJg ɹc$ RE `Jg|"nJf n#H"jApAQJfApAF/ /H{pA?N)/*/*/*/./.NO RgB`Jg"nJf n#H"*d-A(Ac$ `B`////./.N(ORfZ// NP` 0+2("% VrԀK(r-Axr‡-Ar@‡-AB2+0"Abg0/"n".Hq/ N)zO JfH{p@JN)X// NPJg//NP-B$ng$Bp4'@ Bk*Bk,Hx4/ / N)zO ".Ү"n" n#Hp#@ $.Ԯ`BB`$B0+2g -rgergUgB`_fJgpdHxHn/-/.NORgpfrfpfHxH{p0HnN+O JfHxHnH{pCN)pO `tJgnHx H{p> Е/N,O JfL"-JfD +@ -VrԀBRK(`4A,prfgRA(b` <|Jg <|//H{p>tN)/-//-/./.NO Rfz`Nq/ 092RA3r0 nI/EpNHxNP$_Nu o /gBSfNuNq /Cp/ iJf(/H{p=Hx$HyN)OA NugP`/ $oJ*/((/,&/0$p] *8r€VfpL|(/H&/P$/L*/Tpd r #@`|Lh$F2pKf&/ET/BBBJf)M )E()D%B<%C@|`BBBNn%@)@0%|??O . [gJg(ppƀ%|?N`xJgSBԀPrdp%@BWgHrgNSg %|?A`6%|oPp %@X%|o\Tr%A\%|?Gp f`n%|?D`)|~`JprƁpd"" A rF@g )|~`JgSBԀP`%HD%|?BpBB g%|?C"*Dg8 d d Jg// / -@N)p .䘀D`,%|??`:JgSBԀPr dr‚%Ad"@R%Ih @X%H`ppր brd )|`8Bl%|?E j``g0p`& ?>g$/Hu(/ N$O Jg4%|?RpL<NuBBBInN// /NOgp`r%A`/ / &o $o/ NXJf k(g!J$B0$_&_Nup`YH<0&o / NX&f$kJf p@d ?SgF%|?S *@tĀ"*(/ oCPEp&IBYf$o"JBfF"o In2|JTf@SUJf$o R0@BhG$1|@Bhp"o"B`B2RwPR`IRrJ\fRtfB6/RtkBԂB:78TTJmzfJgJg|fBorIrt6s(8T~fBfJd c $o/R4t&S/CLJg^xg@zgB,ExKxB`D4g:7*p6ERK?*p1ZR` Tc|pL|OdNu$H*H|/F,/H8,o4&~/G@B0B|E? o8T88XB: EG,eP,eP,.އrx>8ux A*./ED*&Ez/EH./0 GˑD*AXD>o?1LHJf&AS.* G*ʯ0fJg G. ί0>7PSG?Pfg&o8B2ҁ&o23cf*ʯL&E@gXJf(~&.&b.ԇ~f Tb. (o4@.49G/K@/H0`/|,ExKx` Pc&`bB/>`ƙ|`>`.`B:7:P(E(CRJohއ& `Zzfr Pch`Jg,Ah@o?Bhԯ4 o `p`OH?>(oX$l"T ,[Љ/@0 l ,"\҈/ALG /K,/j,8/j0P.*4,j8$*< *@/jP /D oH$/L"vzf6BԀ c Ё cr㨀L|ONuJg(ve$Ԉf c$L| z멀`BЃҀ`PC/I n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      @@ !1Aa  0@`M #+3;CScs inflate 1.3.1 Copyright 1995-2024 Mark Adler Amiga %ld ??? A4000 BonusA4000 bonusA1000 BonusA3000 BonusA3000 bonuscard.resourcedraco.resourceExec V%ld, need V%ld NetBSD/Amiga 11.99.3 Bootstrap, Revision %s Boot: [%s] expansion.librarycan't open %s Loading %s: Kernel load failed newer bootblock required: %ld kernel too old for bootblock *** Loading from %08lx to Fastmem %08lx *** Error %ld intuition.libraryconsole.devicetimer.devicexd@Warning, unexpected short transfer %d/%d ustarfs read512block Please remove disk %d, insert disk %d, and press return... Disk is not from the volume set?! %9oustar%99o%12o%8oread header failed: %s read header shortELF=0x%lx open %slseek text: %s %ldread textseek text/%d+%ldread dataseek data+[%ldread symbolsseek symbolsread string table+%d]symbol table too shortread stringsseek stringslseek section headers: %s read section headerslseek sectionread section+ [%s%lu+%lu.SUNW_ctf%s%ld]Unknown error: code %dbad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorInvalid argumentNot a directoryinvalid file offsetPermission denied1.3.1unknown compression methodunknown header flags setincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid di#!/bin/sh # $NetBSD: install.sh,v 1.29 2025/08/30 15:14:32 thorpej Exp $ # # Copyright (c) 1996,1997,1999,2000,2006 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE FOUNDATION OR CONTRIBUTORS # BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # NetBSD installation script. # In a perfect world, this would be a nice C program, with a reasonable # user interface. FILESYSTEMS="/tmp/filesystems" # used throughout FQDN="" # domain name trap "umount /tmp > /dev/null 2>&1" 0 MODE="install" # include machine-dependent functions # The following functions must be provided: # md_copy_kernel() - copy a kernel to the installed disk # md_get_diskdevs() - return available disk devices # md_get_cddevs() - return available CD-ROM devices # md_get_ifdevs() - return available network interfaces # md_get_partition_range() - return range of valid partition letters # md_installboot() - install boot-blocks on disk # md_labeldisk() - put label on a disk # md_prep_disklabel() - label the root disk # md_welcome_banner() - display friendly message # md_not_going_to_install() - display friendly message # md_congrats() - display friendly message # md_native_fstype() - native filesystem type for disk installs # md_native_fsopts() - native filesystem options for disk installs # md_makerootwritable() - make root writable (at least /tmp) # The following are optional: # md_view_labels_possible - variable: md_view_labels defined # md_view_labels - peek at preexisting disk labels, to # better identify disks # we need to make sure .'s below work if this directory is not in $PATH # dirname may not be available but expr is Mydir=$(expr $0 : '^\(.*\)/[^/]*$') Mydir=$(cd ${Mydir:-.}; pwd) # this is the most likely place to find the binary sets # so save them having to type it in Default_sets_dir=$Mydir/../../binary/sets # include machine dependent subroutines . $Mydir/install.md # include common subroutines . $Mydir/install.sub # which sets? THESETS="$ALLSETS $MDSETS" # Good {morning,afternoon,evening,night}. md_welcome_banner echo -n "Proceed with installation? [n] " getresp "n" case "$resp" in y*|Y*) echo "Cool! Let's get to it..." ;; *) md_not_going_to_install exit ;; esac # XXX Work around vnode aliasing bug (thanks for the tip, Chris...) ls -l /dev > /dev/null 2>&1 # Deal with terminal issues md_set_term # Get timezone info get_timezone # Make sure we can write files (at least in /tmp) # This might make an MFS mount on /tmp, or it may # just re-mount the root with read-write enabled. md_makerootwritable # Create a disktab file; lets us write to it for temporary # purposes without mounting the miniroot read-write. echo "# disktab" > /tmp/disktab.shadow test "$md_view_labels_possible" && md_view_labels while [ -z "${ROOTDISK}" ]; do getrootdisk done # Deal with disklabels, including editing the root disklabel # and labeling additional disks. This is machine-dependent since # some platforms may not be able to provide this functionality. md_prep_disklabel ${ROOTDISK} # Assume partition 'a' of $ROOTDISK is for the root filesystem. Loop and # get the rest. # XXX ASSUMES THAT THE USER DOESN'T PROVIDE BOGUS INPUT. cat << \__get_filesystems_1 You will now have the opportunity to enter filesystem information. You will be prompted for device name and mount point (full path, including the prepending '/' character). Note that these do not have to be in any particular order. You will be given the opportunity to edit the resulting 'fstab' file before any of the filesystems are mounted. At that time you will be able to resolve any filesystem order dependencies. __get_filesystems_1 echo "The following will be used for the root filesystem:" echo " ${ROOTDISK}a /" echo "${ROOTDISK}a /" > ${FILESYSTEMS} resp="not-done" # force at least one iteration while [ "$resp" != "done" ]; do echo "" echo -n "Device name? [RETURN if you already entered all devices] " getresp "done" case "$resp" in done) ;; *) _device_name=$(basename $resp) # force at least one iteration _first_char="X" while [ "${_first_char}" != "/" ]; do echo -n "Mount point? " getresp "" _mount_point=$resp if [ "${_mount_point}" = "/" ]; then # Invalid response; no multiple roots _first_char="X" else _first_char=$(firstchar ${_mount_point}) fi done echo "${_device_name} ${_mount_point}" >> ${FILESYSTEMS} resp="X" # force loop to repeat ;; esac done # configure swap resp="" # force at least one iteration while [ -z "${resp}" ]; do echo -n "Ok to configure ${ROOTDISK}b as a swap device? [] " getresp "" case "$resp" in y*|Y*) echo "${ROOTDISK}b swap" >> ${FILESYSTEMS} ;; n*|N*) ;; *) ;; esac done echo "" echo "You have configured the following devices and mount points:" echo "" cat ${FILESYSTEMS} echo "" echo "Filesystems will now be created on these devices. If you made any" echo -n "mistakes, you may edit this now. Edit? [n] " getresp "n" case "$resp" in y*|Y*) ${EDITOR} ${FILESYSTEMS} ;; *) ;; esac # Loop though the file, place filesystems on each device. echo "Creating filesystems..." ( while read _device_name _mp; do if [ "$_mp" != "swap" ]; then newfs /dev/r${_device_name} echo "" fi done ) < ${FILESYSTEMS} # Get network configuration information, and store it for placement in the # root filesystem later. cat << \__network_config_1 You will now be given the opportunity to configure the network. This will be useful if you need to transfer the installation sets via FTP or NFS. Even if you choose not to transfer installation sets that way, this information will be preserved and copied into the new root filesystem. Note, enter all symbolic host names WITHOUT the domain name appended. I.e. use 'hostname' NOT 'hostname.domain.name'. __network_config_1 echo -n "Configure the network? [y] " getresp "y" case "$resp" in y*|Y*) resp="" # force at least one iteration if [ -f /etc/myname ]; then resp=$(cat /etc/myname) fi echo -n "Enter system hostname: [$resp] " while [ -z "${resp}" ]; do getresp "$resp" done hostname $resp echo $resp > /tmp/myname echo -n "Enter DNS domain name: " getresp "none" if [ "${resp:-none}" != "none" ]; then FQDN=$resp fi configurenetwork echo -n "Enter IP address of default route: [none] " getresp "none" if [ "${resp:-none}" != "none" ]; then route delete default > /dev/null 2>&1 if route add default $resp > /dev/null ; then echo $resp > /tmp/mygate fi fi resp="none" if [ -n "${FQDN}" ]; then echo -n "Enter IP address of primary nameserver: [none] " getresp "none" fi if [ "${resp:-none}" != "none" ]; then echo "domain $FQDN" > /tmp/resolv.conf echo "nameserver $resp" >> /tmp/resolv.conf echo "search $FQDN" >> /tmp/resolv.conf echo -n "Would you like to use the nameserver now? [y] " getresp "y" case "$resp" in y*|Y*) cp /tmp/resolv.conf \ /tmp/resolv.conf.shadow ;; *) ;; esac fi echo "" echo "The host table is as follows:" echo "" cat /tmp/hosts echo "" echo "You may want to edit the host table in the event that" echo "you need to mount an NFS server." echo -n "Would you like to edit the host table? [n] " getresp "n" case "$resp" in y*|Y*) ${EDITOR} /tmp/hosts ;; *) ;; esac cat << \__network_config_2 You will now be given the opportunity to escape to the command shell to do any additional network configuration you may need. This may include adding additional routes, if needed. In addition, you might take this opportunity to redo the default route in the event that it failed above. If you do change the default route, and wish for that change to carry over to the installed system, execute the following command at the shell prompt: echo > /tmp/mygate where is the IP address of the default router. __network_config_2 echo -n "Escape to shell? [n] " getresp "n" case "$resp" in y*|Y*) echo "Type 'exit' to return to install." sh ;; *) ;; esac ;; *) ;; esac # Now that the network has been configured, it is safe to configure the # fstab. ( while read _dev _mp; do if [ "$_mp" = "/" ]; then echo /dev/$_dev $_mp ffs rw 1 1 elif [ "$_mp" = "swap" ]; then echo /dev/$_dev none swap sw 0 0 else echo /dev/$_dev $_mp ffs rw 1 2 fi done # # A PTYFS instance is required for programs that use # pseudo-terminals (e.g. sshd). # echo ptyfs /dev/pts ptyfs rw 0 0 ) < ${FILESYSTEMS} > /tmp/fstab echo "The fstab is configured as follows:" echo "" cat /tmp/fstab cat << \__fstab_config_1 You may wish to edit the fstab. For example, you may need to resolve dependencies in the order which the filesystems are mounted. You may also wish to take this opportunity to place NFS mounts in the fstab. This would be especially useful if you plan to keep '/usr' on an NFS server. __fstab_config_1 echo -n "Edit the fstab? [n] " getresp "n" case "$resp" in y*|Y*) ${EDITOR} /tmp/fstab ;; *) ;; esac echo "" munge_fstab /tmp/fstab /tmp/fstab.shadow mount_fs /tmp/fstab.shadow mount | while read line; do set -- $line if [ "$2" = "/" ] && [ "$3" = "nfs" ]; then echo "You appear to be running diskless." echo -n "Are the install sets on one of your currently mounted filesystems? [n] " getresp "n" case "$resp" in y*|Y*) get_localdir ;; *) ;; esac fi done install_sets # Copy in configuration information and make devices in target root. ( cd /tmp for file in fstab ifconfig.* hosts myname mygate resolv.conf; do if [ -f $file ]; then echo -n "Copying $file..." cp $file /mnt/etc/$file echo "done." fi done # Enable rc.conf if [ -e /mnt/etc/rc.conf ]; then cp /mnt/etc/rc.conf /tmp sed 's/^rc_configured=NO/rc_configured=YES/' /tmp/rc.conf \ > /mnt/etc/rc.conf fi # If no zoneinfo on the installfs, give them a second chance if [ ! -e /usr/share/zoneinfo ]; then get_timezone fi if [ ! -e /mnt/usr/share/zoneinfo ]; then echo "Cannot install timezone link..." else echo -n "Installing timezone link..." rm -f /mnt/etc/localtime ln -s /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." fi if [ ! -x /mnt/dev/MAKEDEV ]; then echo "No /dev/MAKEDEV installed, something is wrong here..." else echo -n "Making devices..." pid=$(twiddle) cd /mnt/dev sh MAKEDEV all kill $pid echo "done." fi md_copy_kernel md_installboot ${ROOTDISK} ) unmount_fs /tmp/fstab.shadow # Pat on the back. md_congrats # ALL DONE! exit 0 # $NetBSD: install.md,v 1.35 2022/05/28 21:57:39 andvar Exp $ # # # Copyright (c) 1996,2006 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE FOUNDATION OR CONTRIBUTORS # BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # # machine dependent section of installation/upgrade script. # # Machine-dependent install sets MDSETS="kern-GENERIC xbase xcomp xetc xfont xserver" md_set_term() { if [ ! -z "$TERM" ]; then return fi echo -n "Specify terminal type [vt220]: " getresp "vt220" TERM="$resp" export TERM } md_makerootwritable() { # Mount root rw for convenience of the tester ;-) if ! cp /dev/null /tmp/.root_writable >/dev/null 2>&1; then mi_mount_kernfs mount -t ffs -u /kern/rootdev / > /dev/null 2>&1 fi } md_get_diskdevs() { # return available disk devices mi_mount_kernfs mi_filter_msgbuf | sed -ne '/^[sw]d[0-9] /s/ .*//p' } md_get_cddevs() { # return available CDROM devices mi_mount_kernfs mi_filter_msgbuf | sed -ne '/^cd[0-9] /s/ .*//p' } md_get_partition_range() { # return an expression describing the valid partition id's echo '[a-p]' } md_installboot() { if [ -x /mnt/usr/sbin/installboot ]; then echo -n "Should a boot block be installed? [y] " getresp "y" case "$resp" in y*|Y*) echo -n "Boot command? [netbsd -ASn2] " getresp "netbsd -ASn2" echo "Installing boot block..." chroot /mnt /usr/sbin/installboot -o command="$resp" /dev/r${1}a /usr/mdec/bootxx_ffsv1 cp -p /mnt/usr/mdec/boot.amiga /mnt/ ;; *) echo "No bootblock installed." ;; esac elif [ "$MODE" = "install" ]; then cat << \__md_installboot_1 There is no installboot program found on the installed filesystems. No boot programs are installed. __md_installboot_1 else cat << \__md_installboot_2 There is no installboot program found on the upgraded filesystems. No boot programs are installed. __md_installboot_2 fi } md_native_fstype() { echo "ados" } md_native_fsopts() { echo "ro" } md_prep_disklabel() { } md_view_labels_possible=1 md_view_labels() { _DKDEVS=$(md_get_diskdevs) echo "If you like, you can now examine the labels of your disks." echo "" echo -n "Available are "${_DKDEVS}". Look at which? [skip this step] " getresp "done" while [ "${resp:-done}" != "done" ]; do echo "" disklabel ${resp} echo "" echo -n "Available are "${_DKDEVS}". Look at which? [done] " getresp "done" done cat << \__prep_disklabel_1 As a reminder: the 'c' partition is assigned to the whole disk and can't normally be used for a any file system! __prep_disklabel_1 } md_labeldisk() { } md_welcome_banner() { if [ "$MODE" = "install" ]; then echo "" echo "Welcome to the NetBSD/${MACHINE} ${RELEASE} installation program." cat << \__welcome_banner_1 This program is designed to help you put NetBSD on your disk, in a simple and rational way. You'll be asked several questions, and it would probably be useful to have your disk's hardware manual, the installation notes, and a calculator handy. __welcome_banner_1 else echo "" echo "Welcome to the NetBSD/${MACHINE} ${RELEASE} upgrade program." cat << \__welcome_banner_2 This program is designed to help you upgrade your NetBSD system in a simple and rational way. As a reminder, installing the 'etc' binary set is NOT recommended. Once the rest of your system has been upgraded, you should manually merge any changes to files in the 'etc' set into those files which already exist on your system. __welcome_banner_2 fi cat << \__welcome_banner_3 As with anything which modifies your disk's contents, this program can cause SIGNIFICANT data loss, and you are advised to make sure your data is backed up before beginning the installation process. Default answers are displayed in brackets after the questions. You can hit Control-C at any time to quit, but if you do so at a prompt, you may have to hit return. Also, quitting in the middle of installation may leave your system in an inconsistent state. __welcome_banner_3 } md_not_going_to_install() { cat << \__not_going_to_install_1 OK, then. Enter 'halt' at the prompt to halt the machine. Once the machine has halted, power-cycle the system to load new boot code. Note: If you wish to have another try. Just type '^D' at the prompt. After a moment, the installer will restart itself. __not_going_to_install_1 } md_congrats() { local what; if [ "$MODE" = "install" ]; then what="installed"; else what="upgraded"; fi cat << __congratulations_1 CONGRATULATIONS! You have successfully $what NetBSD! To boot the installed system, enter halt at the command prompt. Once the system has halted, reset the machine and boot from the disk. Note: If you wish to have another try. Just type '^D' at the prompt. After a moment, the installer will restart itself. __congratulations_1 } md_copy_kernel() { # This is largely a copy of install_disk and install_from_mounted_fs() # with some special frobbing. local _directory local _sets local _filename local _f if [ "$MODE" = "install" ]; then echo -n "Adding keymap initialization to rc.local..." echo /usr/sbin/loadkmap ${__keymap__} >> /mnt/etc/rc.local echo "done." fi if [ -e /netbsd ]; then if [ -e /mnt/netbsd ]; then echo "On the installation filesystem there is this kernel: " ls -l /netbsd echo "The already installed kernel is: " ls -l /mnt/netbsd echo "Do you want to replace the already installed kernel by the kernel" echo -n "on the installation filesystem? (y/n) [n] " resp="n" getresp "" if [ "${resp}" != "y" ] && [ "${resp}" != "Y" ]; then return fi fi echo -n "Copying kernel..." cp -p /netbsd /mnt/netbsd echo "done." return fi cat << \__md_copy_kernel_1 Your installation set did not include a netbsd kernel on the installation filesystem. You are now given the opportunity install it from either the kernel-floppy from the distribution or another location on one of your disks. The following disk devices are installed on your system; please select the disk device containing the partition with the netbsd kernel: __md_copy_kernel_1 _DKDEVS=$(md_get_diskdevs) echo "$_DKDEVS" echo "fd0" echo "" _DKDEVS="$_DKDEVS fd0" # Might be on the kernel floppy! echo -n "Which is the disk with the kernel? [abort] " if mount_a_disk ; then return # couldn't mount the disk fi # Get the directory where the file lives resp="" # force one iteration while [ -z "${resp}" ]; do echo "Enter the directory relative to the mount point that" echo -n "contains the file. [${_directory}] " getresp "${_directory}" done _directory=$resp _sets=$(cd /mnt2/$_directory; ls netbsd* 2> /dev/null) if [ -z "$_sets" ]; then echo "There are no NetBSD kernels available in \"$1\"" umount -f /mnt2 > /dev/null 2>&1 return fi while : ; do echo "The following kernels are available:" echo "" for _f in $_sets ; do echo " $_f" done echo "" set -- $_sets echo -n "File name [$1]? " getresp "$1" _f=$resp _filename="/mnt2/$_directory/$_f" # Ensure file exists if [ ! -f $_filename ]; then echo "File $_filename does not exist. Check to make" echo "sure you entered the information properly." echo -n "Do you want to retry [y]? " getresp "y" if [ "$resp" = "n" ]; then break fi continue fi # Copy the kernel cp $_filename /mnt break done umount -f /mnt2 > /dev/null 2>&1 } md_lib_is_aout() { local r test -h $1 && return 1 test -f $1 || return 1 [ "$(dd if=$1 bs=1 skip=1 count=3 2> /dev/null)" = "ELF" ] && return 1 return 0 } md_mv_usr_lib() { local root root=$1 for f in $root/usr/lib/lib*.so.[0-9]*.[0-9]* ; do md_lib_is_aout $f || continue mv -f $f $root/emul/aout/usr/lib || return 1 done return 0 } md_x_shlib_set_14=" \ libICE.so.6.3 \ libPEX5.so.6.0 \ libSM.so.6.0 \ libX11.so.6.1 \ libXIE.so.6.0 \ libXaw.so.6.1 \ libXext.so.6.3 \ libXi.so.6.0 \ libXmu.so.6.0 \ libXp.so.6.2 \ libXt.so.6.0 \ libXtst.so.6.1 \ liboldX.so.6.0" md_mv_x_lib() { local root xlibdir root=$1 xlibdir=$2 for f in $md_x_shlib_set_14; do md_lib_is_aout $root/$xlibdir/$f || continue mv -f $root/$xlibdir/$f $root/emul/aout/$xlibdir || return 1 done return 0 } md_mv_aout_libs() { local root xlibdir root=/mnt # XXX - should be global if [ -d $root/emul/aout/. ]; then echo "Using existing /emul/aout directory" else echo "Creating /emul/aout hierarchy" mkdir -p $root/usr/aout || return 1 if [ ! -d $root/emul ]; then mkdir $root/emul || return 1 fi if [ -h $root/emul/aout ]; then echo "Preserving existing symbolic link from /emul/aout" mv -f $root/emul/aout $root/emul/aout.old || return 1 fi ln -s ../usr/aout $root/emul/aout || return 1 fi # Create /emul/aout/etc and /emul/aout/usr/lib if [ ! -d $root/emul/aout/etc ]; then mkdir $root/emul/aout/etc || return 1 fi if [ ! -d $root/emul/aout/usr/lib ]; then mkdir -p $root/emul/aout/usr/lib || return 1 fi # Move ld.so.conf if [ -f $root/etc/ld.so.conf ]; then mv -f $root/etc/ld.so.conf $root/emul/aout/etc || return 1 fi # Finally, move the aout shared libraries from /usr/lib md_mv_usr_lib $root || return 1 # If X11 is installed, move the those libraries as well xlibdir="/usr/X11R7/lib" if [ -d $root/$xlibdir/. ]; then mkdir -p $root/emul/aout/$xlibdir || return 1 md_mv_x_lib $root $xlibdir || return 1 fi echo "a.out emulation environment setup completed." } md_prepare_upgrade() { cat << 'EOF' This release uses the ELF binary object format. Existing (a.out) binaries can still be used on your system after it has been upgraded, provided that the shared libraries needed by those binaries are made available in the filesystem hierarchy rooted at /emul/aout. This upgrade procedure will now establish this hierarchy by moving all shared libraries in a.out format found in /usr/lib to /emul/aout/usr/lib. It will also move the X11 shared libraries in a.out format from previous NetBSD/amiga X11 installation sets, if they are installed. EOF md_mv_aout_libs || { echo "Failed to setup a.out emulation environment" return 1 } return 0 } # Flag to notify upgrade.sh of the existence of md_prepare_upgrade() md_upgrade_prep_needed=1 fd0ffd0efd0dfd0cfd0bfd0a fd0est0erst0enst0enrst0 dtyC0!drum"constty#console$cd2c%cd2a& cd2'cd1c(cd1a) cd1*cd0c+cd0a,cd0#!/bin/sh # $NetBSD: install.sub,v 1.66 2024/05/11 06:31:59 andvar Exp $ # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE FOUNDATION OR CONTRIBUTORS # BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # NetBSD installation/upgrade script - common subroutines. ROOTDISK="" # filled in below MACHINE=amiga export MACHINE VERSION=11993 export VERSION RELEASE=11.99.3 export RELEASE ALLSETS="base comp etc games man misc modules rescue text" # default install sets UPGRSETS="base comp games man misc modules rescue text" # default upgrade sets THESETS= # one of the above local_sets_dir="" # Path searched for sets by install_sets # on the local filesystems # decide upon an editor if [ -z "$EDITOR" ]; then if [ -x /usr/bin/vi ]; then EDITOR=vi else EDITOR=ed fi fi getresp() { read resp if [ -z "$resp" ]; then resp=$1 fi } isin() { # test the first argument against the remaining ones, return success on a match _a=$1; shift while [ $# != 0 ]; do if [ "$_a" = "$1" ]; then return 0; fi shift done return 1 } rmel() { # remove first argument from list formed by the remaining arguments local _a _a=$1; shift while [ $# != 0 ]; do if [ "$_a" != "$1" ]; then echo "$1"; fi shift done } cutword () { # read a line of data, return Nth element. local _a local _n local _oifs # optional field separator _oifs="$IFS" case "$1" in -t?*) IFS=${1#-t}; shift;; esac _n=$1 read _a; set -- $_a IFS="$_oifs" if [ "$1" = "" ]; then return; fi eval echo \$$_n } cutlast () { # read a line of data, return last element. Equiv. of awk '{print $NF}'. local _a local _oifs # optional field separator _oifs="$IFS" case "$1" in -t?*) IFS=${1#-t}; shift;; esac read _a; set -- $_a IFS="$_oifs" if [ "$1" = "" ]; then return; fi eval echo '"${'"$#"'}"' } firstchar () { # return first character of argument local _a _a=$1 while [ ${#_a} != 1 ]; do _a=${_a%?} done echo $_a } basename () { local _oifs if [ "$1" = "" ]; then return; fi _oifs="$IFS" IFS="/" set -- $1 IFS="$_oifs" eval echo '"${'"$#"'}"' } dir_has_sets() { # return true when the directory $1 contains a set for $2...$n local _dir local _file _dir=$1; shift for _file in $* do if [ -f $_dir/${_file}.tar.gz ]; then return 0 fi # Try for stupid msdos convention if [ -f $_dir/${_file}.tgz ]; then return 0 fi # Try for uncompressed files if [ -f $_dir/${_file}.tar ]; then return 0 fi # Try for split files if [ -f $_dir/${_file}${VERSION}.aa ]; then return 0 fi done return 1 } twiddle() { # spin the propeller so we don't get bored while : ; do sleep 1; echo -n "/"; sleep 1; echo -n "-"; sleep 1; echo -n "\\"; sleep 1; echo -n "|"; done > /dev/tty & echo $! } get_localdir() { # $1 is relative mountpoint local _mp local _dir _mp=$1 _dir= while : ; do if [ -n "$_mp" ]; then cat << __get_localdir_1 Note: your filesystems are mounted under the temporary mount point \"$_mp\". The pathname you are requested to enter below should NOT include the \"$_mp\" prefix. __get_localdir_1 fi echo -n "Enter the pathname where the sets are stored [$_dir] " getresp "$_dir" _dir=$resp # Allow break-out with empty response if [ -z "$_dir" ]; then echo -n "Are you sure you don't want to set the pathname? [n] " getresp "n" case "$resp" in y*|Y*) break ;; *) continue ;; esac fi if dir_has_sets "$_mp/$_dir" $THESETS then local_sets_dir="$_mp/$_dir" break else cat << __get_localdir_2 The directory \"$_mp/$_dir\" does not exist, or does not hold any of the upgrade sets. __get_localdir_2 echo -n "Re-enter pathname? [y] " getresp "y" case "$resp" in y*|Y*) ;; *) local_sets_dir="" break ;; esac fi done } getrootdisk() { cat << \__getrootdisk_1 The installation program needs to know which disk to consider the root disk. Note the unit number may be different than the unit number you used in the standalone installation program. Available disks are: __getrootdisk_1 _DKDEVS=$(md_get_diskdevs) echo "$_DKDEVS" echo "" echo -n "Which disk is the root disk? " getresp "" if isin $resp $_DKDEVS ; then ROOTDISK="$resp" else echo "" echo "The disk $resp does not exist." ROOTDISK="" fi } labelmoredisks() { cat << \__labelmoredisks_1 You may label the following disks: __labelmoredisks_1 echo "$_DKDEVS" echo "" echo -n "Label which disk? [done] " getresp "done" case "$resp" in "done") ;; *) if isin $resp $_DKDEVS ; then md_labeldisk $resp else echo "" echo "The disk $resp does not exist." fi ;; esac } addhostent() { # $1 - IP address # $2 - symbolic name local fqdn # Create an entry in the hosts table. If no host table # exists, create one. If the IP address already exists, # replace its entry. if [ ! -f /tmp/hosts ]; then echo "127.0.0.1 localhost" > /tmp/hosts fi sed "/^$1 /d" < /tmp/hosts > /tmp/hosts.new mv /tmp/hosts.new /tmp/hosts if [ -n "${FQDN}" ]; then fqdn=$2.$FQDN fi echo "$1 $2 $fqdn" >> /tmp/hosts } addifconfig() { # $1 - interface name # $2 - interface symbolic name # $3 - interface IP address # $4 - interface netmask # $5 - (optional) interface link-layer medium, preceded by "media ", else "" # $6 - (optional) interface link-layer directives local _m # Create a ifconfig.* file for the interface. echo "inet $2 netmask $4 $5 $6" > /tmp/ifconfig.$1 addhostent $3 $2 } configurenetwork() { local _ifsdone local _ifs # _IFS=$(md_get_ifdevs) _IFS=$(ifconfig -l | sed ' s/lo0// s/ppp[0-9]//g s/sl[0-9]//g s/tun[0-9]//g') _ifsdone="" resp="" # force at least one iteration while [ "${resp}" != "done" ]; do cat << \__configurenetwork_1 You may configure the following network interfaces (the interfaces marked with [X] have been successfully configured): __configurenetwork_1 for _ifs in $_IFS; do if isin $_ifs $_ifsdone ; then echo -n "[X] " else echo -n " " fi echo $_ifs done echo "" echo -n "Configure which interface? [done] " getresp "done" case "$resp" in "done") ;; *) _ifs=$resp if isin $_ifs $_IFS ; then if configure_ifs $_ifs ; then _ifsdone="$_ifs $_ifsdone" fi else echo "Invalid response: \"$resp\" is not in list" fi ;; esac done } configure_ifs() { local _up local _interface_name local _interface_ip local _interface_mask local _interface_symname local _interface_extra local _interface_mediumtype local _interface_supported_media local _m local _t _interface_name=$1 _up=DOWN if isin $_interface_name $(ifconfig -l -u); then _up=UP fi _interface_supported_media=$(ifconfig -m $_interface_name | sed -n ' /^[ ]*media autoselect/d 4,$s/[ ]*media //p') # get current "media" "ip" and "netmask" ("broadcast") _t=$(ifconfig $_interface_name | sed -n ' s/^[ ]*media: [^ ]* \([^ ][^ ]*\).*/\1/p') if [ "$_t" != "manual" ] && [ "$_t" != "media:" ] && [ "$_t" != "autoselect" ]; then _interface_mediumtype=$1 fi set -- $(ifconfig $_interface_name | sed -n ' /^[ ]*inet /{ s/inet// s,/[0-9]*,, s/--> [0-9.][0-9.]*// s/netmask// s/broadcast// p;}') _interface_ip=$1 _interface_mask=$2 # Get IP address resp="" # force one iteration while [ -z "${resp}" ]; do echo -n "IP address? [$_interface_ip] " getresp "$_interface_ip" _interface_ip=$resp done # Get symbolic name resp="" # force one iteration while [ -z "${resp}" ]; do echo -n "Symbolic (host) name? " getresp "" _interface_symname=$resp done # Get netmask resp="" # force one iteration while [ -z "${resp}" ]; do echo -n "Netmask? [$_interface_mask] " getresp "$_interface_mask" _interface_mask=$resp done echo "Your network interface might require explicit selection" echo "of the type of network medium attached. Supported media:" echo "$_interface_supported_media" echo -n "Additional media type arguments (none)? [$_interface_mediumtype] " getresp "$_interface_mediumtype" _m="" if [ "${resp:-none}" != "none" ]; then _interface_mediumtype=$resp _m="media ${resp}" fi echo "Your network interface might require additional link-layer" echo "directives (like 'link0'). If this is the case you can enter" echo "these at the next prompt." echo "" echo -n "Additional link-layer arguments (none)? [$_interface_extra] " getresp "$_interface_extra" if [ "${resp:-none}" != "none" ]; then _interface_extra=$resp fi # Configure the interface. If it # succeeds, add it to the permanent # network configuration info. if [ $_up != "UP" ]; then ifconfig ${_interface_name} down if ifconfig ${_interface_name} inet \ ${_interface_ip} \ netmask ${_interface_mask} \ ${_interface_extra} ${_m} up ; then addifconfig \ "${_interface_name}" \ "${_interface_symname}" \ "${_interface_ip}" \ "${_interface_mask}" \ "${_m}" \ "${_interface_extra}" return 0 fi else echo "Interface ${_interface_name} is already active." echo "Just saving configuration on new root filesystem." addifconfig \ "${_interface_name}" \ "${_interface_symname}" \ "${_interface_ip}" \ "${_interface_mask}" \ "${_m}" \ "${_interface_extra}" fi return 1 } # Much of this is gratuitously stolen from /etc/rc.d/network. enable_network() { # Set up the hostname. if [ -f /mnt/etc/myname ]; then hostname=$(cat /mnt/etc/myname) elif [ -f /mnt/etc/rc.conf ];then hostname=$(sh -c '. /mnt/etc/rc.conf ; echo $hostname') else echo "ERROR: no /etc/myname!" return 1 fi if [ -z "$hostname" ];then echo "ERROR: hostname not set in /etc/myname or /etc/rc.conf!" return 1 fi hostname $hostname # configure all the interfaces which we know about. if [ -f /mnt/etc/rc.conf ]; then ( # assume network interface configuration style 1.2D and up if [ -f /mnt/etc/defaults/rc.conf ]; then . /mnt/etc/defaults/rc.conf fi . /mnt/etc/rc.conf if [ "$net_interfaces" != NO ]; then if [ "$auto_ifconfig" = YES ]; then tmp="$(ifconfig -l)" else tmp="$net_interfaces" fi echo -n "configuring network interfaces:" for i in $tmp; do eval $(echo 'args=$ifconfig_'$i) if [ -n "$args" ]; then echo -n " $i" ifconfig $i $args elif [ -f /mnt/etc/ifconfig.$i ]; then echo -n " $i" (while read args; do ifconfig $i $args done) < /mnt/etc/ifconfig.$i elif [ "$auto_ifconfig" != YES ]; then echo echo -n "/mnt/etc/ifconfig.$i missing" echo -n "& ifconfig_$i not set" echo "; interface $i can't be configured" fi done echo "." fi ) else ( tmp="$IFS" IFS="$IFS." set -- $(echo /mnt/etc/hostname*) IFS=$tmp unset tmp while [ $# -ge 2 ] ; do shift # get rid of "hostname" ( read af name mask bcaddr extras read dt dtaddr if [ -z "$name" ]; then echo "/etc/hostname.$1: invalid network configuration file" exit fi cmd="ifconfig $1 $af $name " if [ "${dt}" = "dest" ]; then cmd="$cmd $dtaddr"; fi if [ -n "$mask" ]; then cmd="$cmd netmask $mask"; fi if [ "${bcaddr:-NONE}" != "NONE" ]; then cmd="$cmd broadcast $bcaddr"; fi cmd="$cmd $extras" $cmd ) < /mnt/etc/hostname.$1 shift done ) fi # set the address for the loopback interface ifconfig lo0 inet localhost # use loopback, not the wire route add $hostname localhost # /etc/mygate, if it exists, contains the name of my gateway host # that name must be in /etc/hosts. if [ -f /mnt/etc/mygate ]; then route delete default > /dev/null 2>&1 route add default $(cat /mnt/etc/mygate) fi # enable the resolver, if appropriate. if [ -f /mnt/etc/resolv.conf ]; then _resolver_enabled="TRUE" cp /mnt/etc/resolv.conf /tmp/resolv.conf.shadow fi # Display results... echo "Network interface configuration:" ifconfig -a echo "" if [ "${_resolver_enabled:-FALSE}" = "TRUE" ]; then echo "Resolver enabled." else echo "Resolver not enabled." fi return 0 } install_ftp() { local _f local _sets local _next # Build a script to extract valid files from a list # of filenames on stdin. # XXX : Can we use this on more places? Leo. echo "#!/bin/sh" > /tmp/fname_filter.sh echo "while read line; do" >> /tmp/fname_filter.sh echo " case \$line in" >> /tmp/fname_filter.sh for _f in $THESETS; do echo " $_f.tar.gz|$_f.tgz|$_f.tar|$_f.${VERSION}.aa)" \ >> /tmp/fname_filter.sh echo ' echo -n "$line ";;' \ >> /tmp/fname_filter.sh done echo " *) ;;" >> /tmp/fname_filter.sh echo " esac" >> /tmp/fname_filter.sh echo "done" >> /tmp/fname_filter.sh # Get several parameters from the user, and create # a shell script that directs the appropriate # commands into ftp. cat << \__install_ftp_1 This is an automated ftp-based installation process. You will be asked several questions. The correct set of commands will be placed in a script that will be fed to ftp(1). __install_ftp_1 # Get server IP address resp="" # force one iteration while [ -z "${resp}" ]; do echo -n "Server IP? [${_ftp_server_ip}] " getresp "${_ftp_server_ip}" _ftp_server_ip=$resp done # Get login name resp="" # force one iteration while [ -z "${resp}" ]; do echo -n "Login? [${_ftp_server_login}] " getresp "${_ftp_server_login}" _ftp_server_login=$resp done # Get password resp="" # force one iteration while [ -z "${resp}" ]; do echo -n "Password? " stty -echo getresp "" echo "" stty echo _ftp_server_password=$resp done cat << \__install_ftp_2 You will be asked to enter the name of the directory that contains the installation sets. When you enter a '?' you will see a listing of the current directory on the server. __install_ftp_2 echo "" echo "The default installation directory in the official ftp server is:" echo "/pub/NetBSD/NetBSD-${RELEASE}/${MACHINE}/binary/sets" _sets="" while [ -z "$_sets" ] do resp="" # force one iteration while [ -z "${resp}" ]; do echo -n "Server directory? [${_ftp_server_dir}] " getresp "${_ftp_server_dir}" if [ -z "$resp" ] && [ -z "$_ftp_server_dir" ]; then resp="" fi done if [ $resp != '?' ]; then _ftp_server_dir=$resp fi # Build the basics of an ftp-script... echo "#!/bin/sh" > /tmp/ftp-script.sh echo "cd /mnt" >> /tmp/ftp-script.sh echo "ftp -e -i -n $_ftp_server_ip << \__end_commands" >> \ /tmp/ftp-script.sh echo "user $_ftp_server_login $_ftp_server_password" >> \ /tmp/ftp-script.sh echo "bin" >> /tmp/ftp-script.sh echo "cd $_ftp_server_dir" >> /tmp/ftp-script.sh # Make a copy of this script that lists the directory # contents, and use that to determine the files to get. cat /tmp/ftp-script.sh > /tmp/ftp-dir.sh echo "nlist" >> /tmp/ftp-dir.sh echo "quit" >> /tmp/ftp-dir.sh echo "__end_commands" >> /tmp/ftp-dir.sh if [ $resp = '?' ]; then sh /tmp/ftp-dir.sh else _sets=$(sh /tmp/ftp-dir.sh | sort -u | sh /tmp/fname_filter.sh) fi done rm -f /tmp/ftp-dir.sh /tmp/fname_filter.sh rm -f /tmp/ftp-script.sh # Prepare ftp-fetch script to fetch binary sets _download_dir=INSTALL _ftp_opts="" _ftp_url="ftp://$_ftp_server_login:$_ftp_server_password@$_ftp_server_ip$_ftp_server_dir/" echo "#!/bin/sh" > /tmp/ftp-fetch.sh echo "cd /mnt" >> /tmp/ftp-fetch.sh echo "mkdir -p $_download_dir" >> /tmp/ftp-fetch.sh while : ; do echo "The following sets are available for extraction:" echo "(marked sets are already on the extraction list)" echo "" _next="" for _f in $_sets ; do if isin $_f $_setsdone; then echo -n "[X] " _next="" else echo -n " " if [ -z "$_next" ]; then _next=$_f; fi fi echo $_f done echo "" # Get name of the file and add extraction command # to the ftp-fetch script. if [ -z "$_next" ]; then resp=n; else resp=y; fi echo -n "Continue to add filenames [$resp]? " getresp "$resp" if [ "$resp" = "n" ]; then break fi echo -n "File name [$_next]? " getresp "$_next" if isin $resp $_sets; then echo "echo Fetching $resp:" >> \ /tmp/ftp-fetch.sh echo "ftp ${_ftp_opts} -o $_download_dir/$resp ${_ftp_url}$resp" >> \ /tmp/ftp-fetch.sh echo "echo Extracting $resp:" >> \ /tmp/ftp-fetch.sh echo "pax -zr${verbose_flag}pe -f $_download_dir/$resp" >> \ /tmp/ftp-fetch.sh echo "rm -f $_download_dir/$resp" >> \ /tmp/ftp-fetch.sh _setsdone="$resp $_setsdone" else echo "You entered an invalid filename." echo "" fi done sh /tmp/ftp-fetch.sh rm -f /tmp/ftp-fetch.sh echo "Extraction complete." } install_from_mounted_fs() { # $1 - directory containing installation sets local _filename local _sets local _next local _all local _f local _dirname _dirname=$1 _sets="" if ! dir_has_sets ${_dirname} $THESETS then echo "" echo "The directory at the mount point, \"${_dirname}\", contains: " echo "" ls -F ${_dirname} echo "" echo "Enter the subdirectory relative to the mountpoint, that" echo -n "contains the savesets: [try this directory] " getresp "" if [ -n "${resp}" ]; then _dirname=${_dirname}/$resp fi while ! dir_has_sets ${_dirname} $THESETS; do echo "" echo -n "There are no NetBSD install sets available in " echo "\"${_dirname}\"." echo "\"${_dirname}\" contains: " echo "" ls -F ${_dirname} echo "" echo -n "Enter subdirectory: [try other install media] " getresp "" if [ -z "${resp}" ]; then return fi if [ ! -d ${_dirname}/${resp} ]; then echo "\"${resp}\" is no directory; try again." else _dirname=${_dirname}/$resp fi done fi for _f in $THESETS ; do if [ -f ${_dirname}/${_f}.tar.gz ]; then _sets="$_sets ${_f}.tar.gz" elif [ -f ${_dirname}/${_f}.tgz ]; then _sets="$_sets ${_f}.tgz" elif [ -f ${_dirname}/${_f}.tar ]; then _sets="$_sets ${_f}.tar" elif [ -f ${_dirname}/${_f}${VERSION}.aa ]; then _sets="$_sets ${_f}${VERSION}" fi done while : ; do echo "The following sets are available for extraction:" echo "(marked sets have already been extracted)" echo "" _next="" _all="" for _f in $_sets ; do if isin $_f $_setsdone; then echo -n "[X] " _next="" else echo -n " " if [ -z "$_next" ]; then _next=$_f; fi _all="$_all $_f" fi echo $_f done echo "" # Get the name of the file. if [ -z "$_next" ]; then resp=n else resp=y fi echo -n "Continue extraction [$resp]?" getresp "$resp" if [ "$resp" = "n" ]; then break fi echo -n "File name(s) (or "all") [$_next]? " getresp "$_next" if [ "x$resp" = xall ]; then resp="$_all" fi for _f in $resp; do _filename="/${_dirname}/$_f" # Ensure file exists if [ ! -f $_filename ]; then if [ -f ${_filename}.aa ]; then _filename=${_filename}.\?\? else echo "File $_filename does not exist. Check to make" echo "sure you entered the information properly." continue 2 fi fi # Extract file echo "Extracting the $_f set:" case "$_filename" in *.tar) (cd /mnt; pax -r${verbose_flag}pe < $_filename) ;; *) cat $_filename | \ (cd /mnt; pax -zr${verbose_flag}pe) ;; esac echo "Extraction complete." _setsdone="$_f $_setsdone" done done } install_cdrom() { local _drive local _partition_range local _partition local _fstype local _directory # Get the cdrom device info cat << \__install_cdrom_1 The following CD-ROM devices are installed on your system; please select the CD-ROM device containing the partition with the installation sets: __install_cdrom_1 _CDDEVS=$(md_get_cddevs) echo "$_CDDEVS" echo "" echo -n "Which is the CD-ROM with the installation media? [abort] " getresp "abort" case "$resp" in abort) echo "Aborting." return ;; *) if isin $resp $_CDDEVS ; then _drive=$resp else echo "" echo "The CD-ROM $resp does not exist." echo "Aborting." return fi ;; esac # Get partition _partition_range=$(md_get_partition_range) resp="" # force one iteration while [ -z "${resp}" ]; do echo -n "Partition? [a] " getresp "a" case "$resp" in $_partition_range) _partition=$resp ;; *) echo "Invalid response: $resp" resp="" # force loop to repeat ;; esac done # Ask for filesystem type cat << \__install_cdrom_2 There are two CD-ROM filesystem types currently supported by this program: 1) ISO-9660 (cd9660) 2) Berkeley Fast Filesystem (ffs) __install_cdrom_2 resp="" # force one iteration while [ -z "${resp}" ]; do echo -n "Which filesystem type? [cd9660] " getresp "cd9660" case "$resp" in cd9660|ffs) _fstype=$resp ;; *) echo "Invalid response: $resp" resp="" # force loop to repeat ;; esac done # Mount the CD-ROM if ! mount -t ${_fstype} -o ro \ /dev/${_drive}${_partition} /mnt2 ; then echo "Cannot mount CD-ROM drive. Aborting." return fi install_from_mounted_fs /mnt2 umount -f /mnt2 > /dev/null 2>&1 } mount_a_disk() { # Mount a disk on /mnt2. The set of disk devices to choose from # is $_DKDEVS. # returns 0 on failure. local _drive local _partition_range local _partition local _fstype local _fsopts local _directory local _md_fstype local _md_fsopts getresp "abort" case "$resp" in abort) echo "Aborting." return 0 ;; *) if isin $resp $_DKDEVS ; then _drive=$resp else echo "" echo "The disk $resp does not exist." echo "Aborting." return 0 fi ;; esac # Get partition _partition_range=$(md_get_partition_range) resp="" # force one iteration while [ -z "${resp}" ]; do echo -n "Partition? [d] " getresp "d" case "$resp" in $_partition_range) _partition=$resp ;; *) echo "Invalid response: $resp" resp="" # force loop to repeat ;; esac done # Ask for filesystem type cat << \__mount_a_disk_2 The following filesystem types are supported: 1) ffs 2) cd9660 __mount_a_disk_2 _md_fstype=$(md_native_fstype) _md_fsopts=$(md_native_fsopts) if [ -n "$_md_fstype" ]; then echo " 3) $_md_fstype" else _md_fstype="_undefined_" fi resp="" # force one iteration while [ -z "${resp}" ]; do echo -n "Which filesystem type? [ffs] " getresp "ffs" case "$resp" in ffs|cd9660) _fstype=$resp _fsopts="ro" ;; $_md_fstype) _fstype=$resp _fsopts=$_md_fsopts ;; *) echo "Invalid response: $resp" resp="" # force loop to repeat ;; esac done # Mount the disk if ! mount -t ${_fstype} -o $_fsopts \ /dev/${_drive}${_partition} /mnt2 ; then echo "Cannot mount disk. Aborting." return 0 fi return 1 } install_disk() { local _directory cat << \__install_disk_1 Ok, lets install from a disk. The file-system the install sets on may already mounted, or we might have to mount the filesystem to get to it. __install_disk_1 echo -n "Is the file-system with the install sets already mounted? [n] " getresp "n" case $resp in y*|Y*) echo "What mount point are the sets located in? [] " getresp "" if [ -d "$resp" ]; then install_from_mounted_fs $resp else echo "$resp: Not a directory, aborting..." fi return ;; *) ;; esac cat << \__install_disk_2 The following disk devices are installed on your system; please select the disk device containing the partition with the installation sets: __install_disk_2 _DKDEVS=$(md_get_diskdevs) echo "$_DKDEVS" echo "" echo -n "Which is the disk with the installation sets? [abort] " if mount_a_disk ; then return fi install_from_mounted_fs /mnt2 umount -f /mnt2 > /dev/null 2>&1 } install_nfs() { # Get the IP address of the server resp="" # force one iteration while [ -z "${resp}" ]; do echo -n "Server IP address? [${_nfs_server_ip}] " getresp "${_nfs_server_ip}" done _nfs_server_ip=$resp # Get server path to mount resp="" # force one iteration while [ -z "${resp}" ]; do echo -n "Filesystem on server to mount? [${_nfs_server_path}] " getresp "${_nfs_server_path}" done _nfs_server_path=$resp # Check mount_nfs(8) options echo "Use small NFS transfers (needed when server or client" echo -n "has a slow network card)? [n] " getresp "n" case "$resp" in y*|Y*) _nfs_tcp="-r 1024 -w 1024" ;; *) _nfs_tcp="" ;; esac # Mount the server mkdir /mnt2 > /dev/null 2>&1 if ! mount_nfs $_nfs_tcp ${_nfs_server_ip}:${_nfs_server_path} \ /mnt2 ; then echo "Cannot mount NFS server. Aborting." return fi install_from_mounted_fs /mnt2 umount -f /mnt2 > /dev/null 2>&1 } install_tape() { local _xcmd # Get the name of the tape from the user. cat << \__install_tape_1 The installation program needs to know which tape device to use. Make sure you use a "no rewind on close" device. __install_tape_1 _tape=$(basename $TAPE) resp="" # force one iteration while [ -z "${resp}" ]; do echo -n "Name of tape device? [${_tape}]" getresp "${_tape}" done _tape=$(basename $resp) TAPE="/dev/${_tape}" if [ ! -c $TAPE ]; then echo "$TAPE does not exist or is not a character special file." echo "Aborting." return fi export TAPE # Rewind the tape device echo -n "Rewinding tape..." if ! mt rewind ; then echo "$TAPE may not be attached to the system or may not be" echo "a tape device. Aborting." return fi echo "done." # Get the file number resp="" # force one iteration while [ -z "${resp}" ]; do echo -n "File number? " getresp "" case "$resp" in [1-9]*) _nskip=$(expr $resp - 1) ;; *) echo "Invalid file number ${resp}." resp="" # fore loop to repeat ;; esac done # Skip to correct file. echo -n "Skipping to source file..." if [ "${_nskip}" != "0" ]; then if ! mt fsf $_nskip ; then echo "Could not skip $_nskip files. Aborting." return fi fi echo "done." cat << \__install_tape_2 There are 2 different ways the file can be stored on tape: 1) an image of a gzipped tar file 2) a standard tar image __install_tape_2 resp="" # force one iteration while [ -z "${resp}" ]; do echo -n "Which way is it? [1] " getresp "1" case "$resp" in 1) _xcmd="pax -zr${verbose_flag}pe" ;; 2) _xcmd="pax -r${verbose_flag}pe" ;; *) echo "Invalid response: $resp." resp="" # force loop to repeat ;; esac ( cd /mnt; dd if=$TAPE | $_xcmd ) done echo "Extraction complete." } get_timezone() { local _a local _zonepath # # If the zoneinfo is not on the installation medium or on the # installed filesystem, set TZ to GMT and return immediately. # if [ ! -e /usr/share/zoneinfo ] && [ ! -e /mnt/usr/share/zoneinfo ]; then TZ=GMT return fi if [ ! -d /usr/share/zoneinfo ]; then _zonepath=/mnt else _zonepath="" fi cat << \__get_timezone_1 Select a time zone for your location. Timezones are represented on the system by a directory structure rooted in "/usr/share/zoneinfo". Most timezones can be selected by entering a token like "MET" or "GMT-6". Other zones are grouped by continent, with detailed zone information separated by a slash ("/"), e.g. "US/Pacific". To get a listing of what's available in /usr/share/zoneinfo, enter "?" at the prompts below. __get_timezone_1 if [ -z "$TZ" ]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null | cutlast) TZ=${TZ#/usr/share/zoneinfo/} fi while :; do echo -n "What timezone are you in ['?' for list] [$TZ]? " getresp "$TZ" case "$resp" in "") echo "Timezone defaults to GMT" TZ="GMT" break; ;; "?") ls ${_zonepath}/usr/share/zoneinfo ;; *) _a=$resp while [ -d ${_zonepath}/usr/share/zoneinfo/$_a ]; do echo -n "There are several timezones available" echo " within zone '$_a'" echo -n "Select a sub-timezone ['?' for list]: " getresp "" case "$resp" in "?") ls ${_zonepath}/usr/share/zoneinfo/$_a ;; *) _a=${_a}/${resp} if [ -f ${_zonepath}/usr/share/zoneinfo/$_a ]; then break; fi ;; esac done if [ -f ${_zonepath}/usr/share/zoneinfo/$_a ]; then TZ="$_a" echo "You have selected timezone \"$_a\"". break 2 fi echo "'/usr/share/zoneinfo/$_a' is not a valid timezone on this system." ;; esac done } install_sets() { local _yup _yup="FALSE" # Ask the user which media to load the distribution from. # Ask the user if they want verbose extraction. They might not want # it on, eg, SPARC frame buffer console. cat << \__install_sets_1 It is now time to extract the installation sets onto the hard disk. Make sure the sets are either on a local device (i.e. tape, CD-ROM) or on a network server. Would you like to see each file listed during extraction (verbose) mode? On some console hardware, such as serial consoles and Sun frame buffers, this can extend the total extraction time. __install_sets_1 echo -n "Use verbose listing for extractions? [y] " getresp "y" case "$resp" in y*|Y*) verbose_flag=v ;; *) echo "Not using verbose listing." verbose_flag="" ;; esac if [ -d ${Default_sets_dir:-/dev/null} ]; then if dir_has_sets $Default_sets_dir $THESETS; then local_sets_dir=$Default_sets_dir fi fi if [ -n "${local_sets_dir}" ]; then install_from_mounted_fs ${local_sets_dir} if [ -n "$_setsdone" ]; then _yup="TRUE" fi fi # Go on prodding for alternate locations resp="" # force at least one iteration while [ -z "${resp}" ]; do # If _yup is not FALSE, it means that we extracted sets above. # If that's the case, bypass the menu the first time. if [ "${_yup}" = "FALSE" ]; then echo -n "Install from (f)tp, (t)ape, (C)D-ROM, (N)FS" echo -n " or local (d)isk? " getresp "" case "$resp" in d*|D*) install_disk ;; f*|F*) install_ftp ;; t*|T*) install_tape ;; c*|C*) install_cdrom ;; n*|N*) install_nfs ;; *) echo "Invalid response: $resp" resp="" ;; esac else _yup="FALSE" # So we'll ask next time fi # Give the user the opportunity to extract more sets. They # don't necessarily have to come from the same media. echo "" echo -n "Extract more sets? [n] " getresp "n" case "$resp" in y*|Y*) # Force loop to repeat resp="" ;; *) ;; esac done } munge_fstab() { local _fstab local _fstab_shadow local _dev local _mp local _fstype local _rest # Now that the 'real' fstab is configured, we munge it into a 'shadow' # fstab which we'll use for mounting and unmounting all of the target # filesystems relative to /mnt. Mount all filesystems. _fstab=$1 _fstab_shadow=$2 ( while read _dev _mp _fstype _rest; do # Skip comment lines case "$_dev" in \#*) continue;; *) ;; esac # and some filesystem types (like there are swap,kernfs,...) case "$_fstype" in ffs|ufs|nfs) ;; *) continue;; esac if [ "$_mp" = "/" ]; then echo $_dev /mnt $_fstype $_rest else echo $_dev /mnt$_mp $_fstype $_rest fi done ) < $_fstab > $_fstab_shadow } mount_fs() { # Must mount filesystems manually, one at a time, so we can make # sure the mount points exist. # $1 is a file in fstab format local _fstab _fstab=$1 ( while read line; do set -- $line _dev=$1 _mp=$2 _fstype=$3 _opt=$4 # If not the root filesystem, make sure the mount # point is present. if [ "$_mp" != "/mnt" ]; then mkdir -p $_mp fi # Mount the filesystem. If the mount fails, exit # with an error condition to tell the outer # later to bail. if ! mount -v -t $_fstype -o async -o $_opt $_dev $_mp ; then # error message displayed by mount exit 1 fi done ) < $_fstab if [ "$?" != "0" ]; then cat << \__mount_filesystems_1 FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the installation process. __mount_filesystems_1 exit fi } unmount_fs() { # Unmount all filesystems and check their integrity. # Usage: [-fast] local _fast local _fstab local _pid if [ "$1" = "-fast" ]; then _fast=1 _fstab=$2 else _fast=0 _fstab=$1 fi if ! [ -f "${_fstab}" ] || ! [ -s "${_fstab}" ]; then echo "fstab empty" > /dev/tty return fi if [ $_fast = 0 ]; then echo -n "Syncing disks..." _pid=$(twiddle) sync; sleep 4; sync; sleep 2; sync; sleep 2 kill $_pid echo "done." fi ( _devs="" _mps="" # maintain reverse order while read line; do set -- $line _devs="$1 ${_devs}" _mps="$2 ${_mps}" done echo -n "Unmounting filesystems... " for _mp in ${_mps}; do echo -n "${_mp} " umount ${_mp} done echo "Done." if [ $_fast = 0 ]; then exit fi echo "Checking filesystem integrity..." for _dev in ${_devs}; do echo "${_dev}" fsck -f ${_dev} done echo "Done." ) < $_fstab } check_fs() { # Check filesystem integrity. # $1 is a file in fstab format local _fstab _fstab=$1 ( _devs="" _mps="" while read line; do set -- $line _devs="$1 ${_devs}" _mps="$2 ${_mps}" done echo "Checking filesystem integrity..." for _dev in ${_devs}; do echo "${_dev}" fsck -f ${_dev} done echo "Done." ) < $_fstab } mi_mount_kernfs() { # Make sure kernfs is mounted. if [ ! -d /kern ] || [ ! -e /kern/msgbuf ]; then mkdir /kern > /dev/null 2>&1 /sbin/mount_kernfs /kern /kern fi } mi_filter_msgbuf() { # Remove timestamps, sort. sed -e 's/^\[[0-9. ]*\] //' < /kern/msgbuf | sort -u } mi_filter_dmesg() { # Remove timestamps, sort. dmesg | awk '{ h=$0; gsub("^[[0-9. ]*] ", "", h); print h; }' \ | sort -u } wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766: ...ELF&4G\4 (;d?x@N$Hza+(kernel jump to zeroa&^a Nh/HsPg /9>sPaB/<` o ,fN(WR9BHp`: 9fN(WpBHNh/HyGfJg B@('P/< `H?/Bg//a)RPL`BHNh/HwTRB"!Ӏ"LS:;0`FR:;0HNgHC>wTRB"!Ӏ"LR9S:;0`R:;0H y>s ( l y>ug/F'a&&XR9C>wTRB"!Ӏ"LS:;0`R:;0H y>u(gn(gfF'/a%XR9 y>uJ( 0( ( y;ʢ@ 1@ J@eB( C>wTRB"!Ӏ"LS:;0`8R:;0HA90/@R@Bga)XC>wTRB"!Ӏ"LS:;0`R:;0HA90/@R@Bga)BXC>wTRB"!Ӏ"LS:;0`R:;0H y>s( lT y>r0 g/C/ a$XR9 ga\"C>wTRB"!Ӏ"LS:;0`> y>s@ g//( hNX _ PJg y>r0 R9`R9NsJ>ydgZfTF BHNi/Ir A>s A>s `8A>r A>s A>s A>y A;ʜ r…gA9 A9 `"r…gA9 A9 <rʁgbA9 A9 pN{N{NzJg. @NzHA A0fHAN{N{ |9N{pN{N{A$&NO$A>yD }f2A DN{ <N{N(^pN{`TA"|(EF"صnN(A9 f <N{N($A @N(ЋO9a8"y>{O?$|Nb#JBQB@aWXNu o 9gJg ((8NuJ(g((8(<(@Nu o 9gJg (8(PNuJ(g(8(<(@(PNu/ /aTP/ NX oyDg y>r"H <BQEAI ڱo 9gAr@AfLH`pN{N{N{A hU PNpfNNqNpN y;ʐAp|` |P |0 |@` 9>rAADN{NpN{N{N{N{NqNp x.xNA~ gNuNDB*y>y;| < 9fNqpN{F'.9?_*9>yD o /"/(o(/ &/$$o(,/,,o "o$/&y>r&Yd 9gG0@G$LH`tN{ N{(N{(tɗ˛NNqr /"99dNuR9`C$R9`]R9 `]R9`]Nq/,O . "n nБ BN^Nu/,O . nЮ BN^Nu/,ON^Nu/,O n . 0 N^Nu/,O n .  N^Nu/,O/ n . Ю"Үf$N^Nu"@`/,O/ n . Ю"Үf$N^Nu"@`/,O/"n . "ҮB$ Bf$N^NuR`/,O/"n . "ҮB$ Bf$N^NuR`/,O". . @JfN^NuXS`/,O/". . @ .ЮCJf$N^NuXS`/,O n . 00 N^Nu/,O n . 1 N^Nu/,O/ n". . ЮJf$_N^Nu$@2R0S`/,O/ n". . ЮJf$_N^Nu2X$@4S`/,O/"n . ЮB$ Bf$N^Nu0P2R`/,O"n". . @JfN^Nu00PS`/,O". . @JfN^Nu0PS`/,O/". . @ .ЮCJf$N^Nu42PS`/,O n . 0 N^Nu/,O n . ! N^Nu/,O/ n". . ЮJf$_N^Nu$@"R S`/,O/ n". . ЮJf$_N^Nu"X$@$S`/,O/"n . ЮB$ Bf$N^Nu P"R`/,O"n". . @JfN^Nu  S`/,O". . @JfN^Nu S`/,O/". . @ .ЮCJf$N^Nu$"S`/,O/ "n n . ЮJf$_N^Nu$@2Y2S`/,O/ "n n . ЮJf$_N^Nu$@"YHAY"S`/,O/ "n n . ЮJf$_N^Nu2Y$@4S`/,O/ "n n . ЮJf$_N^Nu"YHAY$@$S`/,O . Ѐ"n nБ BN^Nu/,O . Ѐ nЮ BN^Nu/,ON^Nu/,O n . 0 N^Nu/,O n .  N^Nu/,O/ n . ЀЮ"Үf$N^Nu"@`/,O/ n . ЀЮ"Үf$N^Nu"@`/,O/"n . Ѐ"ҮB$Ԃ Bf$N^NuR`/,O/"n . Ѐ"ҮB$Ԃ Bf$N^NuR`/,O". . Ѐ @JfN^NuTS`/,O/". . Ѐ @ .ЀЮCJf$N^NuTS`/,O n . 00 N^Nu/,O n . 1 N^Nu/,O/ n". . ЀЮJf$_N^Nu$@2R0S`/,O/ n". . ЀЮJf$_N^Nu2X$@4S`/,O/"n . ЀЮB$ Bf$N^Nu0P2R`/,O"n". . Ѐ @JfN^Nu00XS`/,O". . Ѐ @JfN^Nu0XS`/,O/". . Ѐ @ .ЀЮCJf$N^Nu42XS`/,O"n n Ю BN^Nu/,O n .Ю BN^Nu/,ON^Nu/,O"n n 1N^Nu/,O"n n N^Nu/,O n"n ЮfN^Nu`/,O n"n ЮfN^Nu`/,O/"n".Ү B Af$N^NuR`/,O"n".Ү B AfN^NuR`/,O n ЮfN^Nu`/,O//".Ү $.ԮB"B Af$&N^NuR`/,O"n n 01N^Nu/,O"n n 3N^Nu/,O n ."n JfN^Nu20S`/,O n ."n JfN^Nu22S`/,O .".Ү nCJfN^Nu2Q0S`/,O/ .".Ү nCJf$N^Nu42S`/,O . n JfN^Nu0S`/,O/ . n ".ҮCJf$N^Nu42S`/,O"n n 1N^Nu/,O"n n #N^Nu/,O n ."n JfN^Nu" S`/,O n ."n JfN^Nu""S`/,O .".Ү nCJfN^Nu"Q S`/,O/ .".Ү nCJf$N^Nu$"S`/,O . n JfN^Nu S`/,O/ . n ".ҮCJf$N^Nu$"S`/,O n"."n JfN^Nu0X0S`/,O/ $n/N". Ғ n B$nN^Nu/,O n 0XN^Nu/,O n 0.X0N^Nu/,O n XH@XN^Nu/,O n .XH@X N^Nu/,O n"."n JfN^Nu0X2S`/,O . "n nБ BN^Nu/,O . nЮ BN^Nu/,ON^Nu/,O . n0N^Nu/,O . nN^Nu/,O/ n . Ю"Үf$N^Nu"@`/,O/ n . Ю"Үf$N^Nu"@`/,O/"n . "ҮB$ Bf$N^NuR`/,O/"n . "ҮB$ Bf$N^NuR`/,O". . @JfN^NuS`/,O/". . @ .ЮCJf$N^NuS`Nq/,O . r "n nБ BN^Nu/,O . r nЮ BN^Nu/,ON^Nu/,O . r n0N^Nu/,O . r nN^Nu/,O/ n . r Ю"Үf$N^Nu"@`/,O/ n . r Ю"Үf$N^Nu"@`/,O//"n . r "ҮB$v Bf$&N^NuR`/,O//"n . r "ҮB$v Bf$&N^NuR`/,O/". . t @Jf$N^NuS`/,O/". . t @ .ЮCJf$N^NuS`/,O . r n00N^Nu/,O . r n1N^Nu/,O/ / n". . t ЮJf$$_N^Nu$@2R0S`/,O/ / n". . t ЮJf$$_N^Nu2X$@4S`/,O//"n . r ЮB$v Bf$&N^Nu0P2R`/,O/"n". . t @Jf$N^Nu00 S`/,O/". . t @Jf$N^Nu0 S`/,O/". . t @ .ЮCJf$N^Nu42 S`/,O . r"n nБ BN^Nu/,O . r nЮ BN^Nu/,ON^Nu/,O . r n0N^Nu/,O . r nN^Nu/,O/ n . rЮ"Үf$N^Nu"@`/,O/ n . rЮ"Үf$N^Nu"@`/,O//"n . r"ҮB$v Bf$&N^NuR`/,O//"n . r"ҮB$v Bf$&N^NuR`/,O/". . t @Jf$N^Nu@S`/,O/". . t @ .ЮCJf$N^Nu@S`/,O . r n00N^Nu/,O . r n1N^Nu/,O/ / n". . tЮJf$$_N^Nu$@2R0S`/,O/ / n". . tЮJf$$_N^Nu2X$@4S`/,O//"n . rЮB$v Bf$&N^Nu0P2R`/,O/"n". . t @Jf$N^Nu00S`/,O/". . t @Jf$N^Nu0S`/,O/". . t @ .ЮCJf$N^Nu42S`Nq/,O n .Ю BN^Nu/,ON^Nu/,O//&.$.//99Nr y9 h4" A "HҮҮPAJf $.&.N^Nu  S`/,O//&.$.//99Nr y9 h4". Ґ҃P nCJf $.&.N^Nu "S`/,O//&.$.//99Nr y9 h4". Ґ҃P nCJf $.&.N^Nu  S`/,O//&.$.//99Nr y9 h4". Ґ҃P nCJf $.&.N^Nu XH@X"S`/,O//&.$.//99Nr y9 h4". Ґ҃P nCJf $.&.N^Nu XH@X S`/,OH0 &.$n$.//99Nr y9 h4 P ÑPJf L N^Nu  S`/,OH0 &.$n$.//99Nr y9 h4 P ÑPJf L N^Nu $S`/,OH0 &.$n$.//99Nr y9 h4 P ÑPJf L N^Nu XH@X S`/,OH0 &.$n$.//99Nr y9 h4 P ÑPJf L N^Nu XH@X$S`/,O/$.//99Nr y9 h4 P P$.N^Nu/,O/$.//99Nr y9 h4 P $.N^Nu/,O//&.$.//99Nr y9 h4" A "HҮҮPAJf $.&.N^Nu00S`/,O//&.$.//99Nr y9 h4". Ґ҃P nCJf $.&.N^Nu02S`/,O//&.$.//99Nr y9 h4". Ґ҃P nCJf $.&.N^Nu00S`/,O//&.$.//99Nr y9 h4". Ґ҃P nCJf $.&.N^Nu0X2S`/,O//&.$.//99Nr y9 h4". Ґ҃P nCJf $.&.N^Nu0X0S`/,OH0 &.$n$.//99Nr y9 h4 P ÑPJf L N^Nu00S`/,OH0 &.$n$.//99Nr y9 h4 P ÑPJf L N^Nu04S`/,OH0 &.$n$.//99Nr y9 h4 P ÑPJf L N^Nu0X0S`/,OH0 &.$n$.//99Nr y9 h4 P ÑPJf L N^Nu0X4S`/,O/$.//99Nr y9 h4 P 0P$.N^Nu/,O/$.//99Nr y9 h4 P 0$.N^Nu/,O/ /$.//99Nr y9 h4" A ‘ҮҮPB$ACf $.$nN^NuR`/,O/$.//99Nr y9 h4 P ‘ ЮPf$.N^Nu`/,O/ /$.$n//99Nr y9 h4". Ґ҂PB Af $.$nN^NuR`/,O/$.//99Nr y9 h4". Ґ҂PB Af$.N^Nu nR`/,O/ /$.$n//99Nr y9 h4 P ‘ ЮPf $.$nN^Nu`/,O/ /$.$n//99Nr y9 h4 P ‘ ЮPf $.$nN^Nu`/,O/$.//99Nr y9 h4 P P$.N^Nu/,O/$.//99Nr y9 h4 P $.N^Nu/,O//&.$.//99Nr y9 h4 P ÑPJf $.&.N^Nu .XH@X S`/,O/$.//99Nr".YHAY y9 h4 P P$.N^Nu/,O/$.//99Nr y9 h4 P XH@X$.N^Nu/,O//&.$.//99Nr y9 h4 P ÑPJf $.&.N^Nu0.X0S`/,O/$.//99Nr2.Y y9 h4 P 0P$.N^Nu/,O/$.//99Nr y9 h4 P 0X$.N^Nu/,O/J9f\Hy)HNQ$XfHy)H"NN`Xp$.N^Nu/Nb#9XfHy)HB/NNzP`J8fHy)H]`.g cHy)HyNN`X n B`/,ON^Nu/,O . Юr N^Nu/,O n N^NuNq/,O/ /$n". *"jA,Jf&t/*/*/Hy)HNOH $.$nN^Nuf(f" //Hy)HNOH pft` ,f <)Mt`/,OHy)Z/.N2PJgJ>sf# ;ʔpN^Nu/,O/". 9;ʄJ9 f#9 й;ʀ$99 b< B#9 c Hy)HNK.Hx@//./NZ B $.N^NuB`NVH<rԹ>rJ>sgJ y;ʌEDrJg 9;ʈr Hp/Hy)HN 9;ʀg /Hy)INPHy+NX$y>rIK2fb L<sJg* f * -@ j$-HB6*-CB*-DB2*z멂j-Azځ-EJfp9Pf9Tf 99Xg""( bt"9;ʐ(Ё-@J>sf>'n`6 9Ɣf,`B9ƔeDD`9Ɣd"+g-ABHyM/ /. /9;ʔN`//NNb P`/,O/"n ip" (g2 (c ("t#A(#@,p$N^Nu (`B`/,O/ n"hpB@ B#bF$/HiN`B@FP$.N^Nu/,O/ $nBBHxHxNT%H8PP-J$nN^`/,O/ $nHjNdX-j8$nN^`/,OH88$n&n pdB@ C#bF$$.Is "*g"*$<e$*B@Fv֫苶l$/ / Ъ8/IxN"ҒxF„$ f8 g0"*g`$l$/ //*8N$ ` JgB@Fp#LN^Nu|4BHy)JQHx/ NJg>B@F`p(`B`/,O/ nB@ B#bF$pA g"(fHh/.N`(PBB@F$.N^Nu/,O/"n n Jf8!|,h!IpB@ B#bF$/HiN`B@FPB$.N^Nup`/,O/.Hy*RN2PJVIDN^Nu/,O//"9>yD 9;ʠ$vv}fu( ( ( ቂd$&N^Nu y;ʘ(((g(Sቂ`/,OH00EE"GlN$N&Nf 9;ʨ"o";ʤdnR#;ʨ#;ʤL9;ʠ ЃL N^Nu/,OH08$.gHy)J\NDrXEI-&LN&HxNNXcL<B@"9;ʠL9:LAL99r #9N&HxNNXcL<B@"9;ʠL9:LAL99r #9Jg/Hy)JwNDrPL N^Nu/,OH?*. J;ʜf # ;ʜ$9;ʜ 9>yD"vv}f2 crLA((<)J 9:"L@,jR↼nR#;ʠJg8///Hy)JNDr#9#9[I#9Hy9N  9;ʠ cN y>u@ @ -ELN^`XJg#>s ;ʘ(<)J`b#>s;ʘB(<)J`L y;ʘ(A| ( S@@H@(@`/,O/ 9>yD"tt}f0 cP 9;ʠ y>u@ @ B( ($N^Nu y;ʘ| (@ y>y1|` y;ʘ| (@Jg y>u`/,ON^Nu/,O/ /$. /Nb$H 9;ʐ!@8!|)B<8%HHjBHxB/ y)BNJg-|)J -R$.$nN^`@-J$.$nN^` C/,O//.Hy)JN2PJf B$.N^NuJ9fN3JfN4Jf 9>yD"tt}ffp#9`Nq/,OH00 n"n (4!@4 (" A ( "( A ("( A (@ ( "( A (("($ A (0"(,@ t‚&@E l#J[I" (4r !@4 ")B&<eBvdցՀ"#C ) b, ) b$ ) b ) b ")B&<c pL N^NuB`/,OH8&n n/Nb$h0 *4%@4B@+ "*D%AB@+ 2 A"$B@+ "* D%A B@+ 2 A"*%AB@+ "*D%AB@+ 2 A"*%A+  *%@B@+ "* D%A B@+ 2 A"*%AB@+"*(D%A(B@+2 A"*$%A$Hx B/+/N(I(Hx B//N *0%@0Hx B/+/N *,%@, *4r%@4+ *,%@, *4r %@4BLN^Nu/,O/$. n/NbX-B -h0$.N^`/,O/ /$. /Nb$HHy+NDr$ 9;ʐ%@0%B%|[ %|X$PP-J$.$nN^`NV/tԎpĀ/.Hy)JN2PJf B$.N^NuJ9 fN3Jg$/ 9;ʐ/NPJfp#9 `N4Jf`Nq/,O . n f~gFb f|gV f}g@ @kg(p` k g$ tvgT kfpg p-N^Nup B`#;ʰ`JVD;`  y;"D"hgа`VID`"y;"i"iV`/,OHy,/.N2PJVIDN^Nu/,OB;ʰHy;ʸNQDB;BN^Nu/,O .-n-@ -|;ʸN^`X/,O .-n-@ -|;ʸN^`B/,O-n -|;ʸN^`p/,ON^Nu/,O y>u(Dj(B(N^Nu/,O/ y>u <a(t‚g Sfp$N^NuB`/,OH80. y>u( y>u(HxE]NXJfvBBN y>uXJfg( HxNXJfSfBN y>uXJfxgj(HxN&y>uXJfZBNXJfP+HxNXJf>BN&y>uXJf.HxNXJf"B+L N^NuR(`n(` y>u( y>uB(p`/,OH 0B. G]E]\/NXJf N g VIDL N^Nup`/,OH00.B. G]E]\/NXJg pL N^NuN g fB/NXJfN g VID`/,OH00B@F'J9PgB@FL N^Nup#9P 9>yD"tt}fg y>u(HxN- y>uB(HxE^NPJftG]\N$N f\HxHxN_ PJfHHxNXJfu( y>s | (@`(B9; y>u y>s | ` y>y1| y>s | (@B;ʰB;`/,ON_vJ9;g-|)JN^`-|)J`/,ON_vJ;f n#;Hy;ʸNQXBN^Nup`/,OH< 9>yD"tt}fgzJ9;grC,B@ B#bF$ y>u(Dj(B( f>(Dj(B(pB@F b1 gLs B( Dj`( F(@@P HxN- y>s (@E B@FXJg/BN7PB`v`NVH 0".G t&@J;ʰfBpF/NPL N^Nu$9;ʼ $y; R$Jl SpFR;ʸfHy)KHxNGN`0@4 A%A/ N%k%k #;ʼBBHy;N`J9;gB9;Hy;ʸNuXJ9;gJHx/9;N@`4/,O/ y>s ( F(@@HxN- y>s (@X-B$.N^`/,O y>u(B( g:rF b0 ,9;/Nb:XB;N^Nup`Nq/,O . y;"h-n-@ -H"iN^N/,O . y;"h-n-@ -H"i N^N/,O . y;"h-n-@ -H"i4N^N/,O y; N^Nu/,OH8$. 0 n"(@&( g&Jg*@B4J0)9ǔg@ g @`@Jf g@ y>y1@0LN^Nu@`/,OH 0$. /Nb&H y>y0(XJ9 f/<N-X#in;BHxHy;N]` J9 fB;N$H!|fVl!|np!|et/N#;&XJg$p -@-| -|)K/L N^`L N^Nu/,O y>sJ g@pN^Nu`/,O/.Hy,N2PJg 9>sgJ9Ljf&p#9LjpN^Nu"99 9DŽfp#9DŽ`B`/,OB@ @#bF$N^Nu/,O .B@FN^Nu/,OH0 $n*gN& *ft$*|/ NhXJgb*fZ*Agb"p lr /Hy;HjhN Jo.r;#9nj#;9ǐB9;// N~P-CL N^`Dr`L N^Nu/,O/ /$nN"*Df ft %B-@$.$nN^`/,O/ y>y4(g1|09; @f Ry;$N^Nu y9"T#90 ;"f #;"9R@3; @c y>s@`/,OH0 ".$y;*gf>J9ǀfp#9ǀ 99 :>$<JfVJ:|gtL N^`tFāB9ǀ *@ g*vƁ099ǔ C6ЈgJAjHy)KOHxNGNP j/ / h(NPL N^Nu/,OH8<&y;N$EIg(<;"KGNJy; gJ+j8B@F%Jy; fJ+k y>s/N/NPL<N^Nu 99"T#9 @B0/NB@F%Sy; X ;"9f#969;g"By;/N?BgHy)KdHxN`V/NX`L/,OH0 $y;JgrNh y>s9;;9;g j  @ // h0NPg, *g"*Agf@%@ y>y1|L N^Nu/,O/ /$y;N"$Jg< y>y0(g,1| 99ǐ9njf6p jJg/ h,NX/NX$.$nN^Nu/ NfV` y>sf"R#9ǐ @B// NP`9;`/,O//".&.AzpfN y>sF`R$ Df@gg JjgNrgprgZJf y>sF/N$ЀXgrgr gr@DfrFDj@$.&.N^Nu y>s`J y>sF`8/,O/ / n$PB@F% y>y1|1|1|*Bg2HxHx/*/*Nj/9:Hy3 Hx/ Ns #\>u-B$.$nN^` tzgvb txg tygpLy1|B` y>y1|`HxHx-C-D//Nj`Hx`Hx`HxB-C-D//Nj$`/ B-|Hx/./,NBJfp#;`rp`p`/,OH0 $n n ((o^rml$<6L@(S"($gf9;fJ9 f&(C?C!C&(`f@fBL N^NuB` WD;%A\%h(`%C@#>u"y>y3|"y>s;CjJ(f4BB/*/*N j9; // h0NP`pBHx/*/*N y>y1B2`p`PNVH>8&. (.$p p/Hy;N;&HPJg$P/ B-|Hx/. n/(NBJfdN*I*fJf%D%CB@F% y>s;/NB-|%-|K 9;Xg-|DfDjB`Hn/ Nn%|+8p%@<%|D/ N/ N&B@F%BHx-D-C//Nj#;"9#;"9By; .NX/Np/pF// N$f j/ -D-C// hN$ g*fJf / NkX L|N^Nut`t`/,O/ $nHy,NB %@$XJ9 gp%@($nN^Nup`/,O/".B@F%pml" <6LAS@ y>y1@2-B$N^`B@`/,O/ n$($/99Nq.p#9 p#;X$.N^Nu/,O/B@F% y>y4(g1|/NzB$.N^Nu/,O//$.B@F'J;f/99Nq.p#;X y>y <P2( fSfBB1B0 <`2( fSf1|-C$.&.N^`/,ON^Nu/,O".B@AdFN^Nu/,O/". t Jf y;(h= y>s | B$N^NuA`/,OHy)K/.N2PJgJ9Tf p#9TN^NuB`/,O/$. /Nb#;( y;(p!@Hy+NDrBpй;(/NLB p<й;(-@$.N^`/,O npN^`@/,O npN^`*/,OH8". $. v Jf y;("(gppfjvƂWgfgPtB!A!|x!D $9:r LL|Jf "<LB!A y>s | LN^Nuv}F`p`p`p`/,O .B@FN^Nu/,O/Hx&N$B;$Hyt@NuP-B$.N^`/,O .oL<Ly:N^Nu/,O/ .o "9:LL|Jf <LA$N^Nu/,OH08$. ".&n v Jf$y;( @ Pg Pg6p`(E`&/* ItpN'@.NX'@BL N^Nu "S b u0b%@/+ItN%@ .NX%@`/,OH8 (.Hx&N&XEs$9;$f& y>s Cf y>s Dp#;$`.B;$/9:Hy)KHxHyt@N$p#gJg/ND LN^Nu/,OH00$. y>s(@ y>s P$n& ւGulgB/NXJgm$D L N^Nut`NVH?<". &n t Jf$y;(AJWDf8 +g6,*d,B/NT*"*p%@ * Po t %B/ Hysh/HjNBBBA<-H +KhI.gd (pgH.Hx!N" *tĀXDgDjHj-AN pX"./NX`E`$/ //Nx$ gHx!N,X*gHjN pX*gHjy0("y>s Jfrx7AzЀЃąԀ BJfZ6( BA*,0@A @lH@BD*-2ID Al@A[5C,0@%H00A%H4B.*/AJ@fg(*@ *D"&jxIAI, K,""AfJ0gV$R"Jl SzFRg6'j0/ NX n B0J4g $R"Jl S|FRfC/%@DBBHjHN` J*tgB*tHj@NuXJ*ugHx/*pN@P`v x`6( ` @m@` AmA`.R"Jl S|FRg4I6lVID'@/ NX n 0|`&jxB`&jxB`J4gD$R"Jl SzFRg&6'j4/ NVX oBB4 `Jf *8g$/ HyyHxHjNLy0+"<婀A7@4&n"Hp8@NQ/ N~pPBL N^Nup`p`/,O/ nB@F'B8BHy)KHx/NsB@F$.N^Nu/,OH 0 . $r  /Hy;ƸN;$HpĀG(/ N,Hr(@NQDBpBL N^NuNq/,O n"n "i grWIDN^Nup`/,O/.Hy)KN2PJg*J9ȴf"HxNb#;8XfHy)KNDrXBN^Nup#9ȴ`NV". ./.Hy/<-@-A//BHyN N^NuNV". ./.HyB-@-A//BHyN N^Nu/,O/ /$n"*, t /Hy;xN;PJf Hy)KNK.$(/[I//*"9;0g6 y>s| y>yJ;,VIDt娀@1@$1@$B;0$N^Nu/,OH 0&n$n $.HxB/ N(%|(p%@0 k"(%A4 +%@,Ѐ%@85| L%A<%|,H%| T'| BB %< % % RB5B%|VEW$VEW/ N(_\5@L N^Nu/,OH8(n$n ,f pLN^Nu&l (f *,,fp0f *44f *88f *<s(x@HxE-N y>s(@HxN y>s(F@HxN y>s(@HxN y>s(@HxN y>s(@HxN y>s(@HxNv (<B y>s(@HxN y>s Xg y>s(@HxNHxNSPf"99s(x@HxG-N y>s(@HxN y>s(*F@HxN *g| *r%A&jR$JlSrR**fT;sfL(`HHxNSXg y>s f`$<`Jgr%A. y>s(JoJgN@HxNXBB y>s(@(@/*NRXf`Br%A`L@HxNX*< y>s gQXBESdPjzgHxFPNX%E%C;s(@(@/*NX`p(@HxNX-|L N^`x/,O/ / &n y>s(x@HxE-NX y>s+g@(@HxN y>s(+F@Xp-@$n&nN^`(`/,O". .c @ XDf @cT PDg N^Nu `A`/,OH>8*.$n "n$.ԅxȪ& E&J(He4 Wedr҂p€ J&CeTAJgUUUU L|N^NuX"UUUU, UUUU ܆JgxȀJg&`B`X,UUUU* UUUU څJgxȀJg `pNVH?<*n$y;8B mej(-$-p᪄B*<*,8&n y;8"k$)ԂԈ&+B"ke&B*Q([Eּm fjL|N^Nu0TX1|TR`B1Trf1|D1|D1|DC 1|UT"+ jR@ JlSrR@R@ + o o np@/Hx// N0.2IA@|NBHx//N B1TTr*fC*IB2f1|DB1|DD1|DF1|UEH//+/HhJN֫0.2IA@BHx//N B1TT fR`B`@p`:p`40T`/,O npfN^`2N^`/,OH80$n&n vƪg~/ N@ j$((*Xv%K#;4/// N$ y>yCJfH1|1|1|D~/9;8N y>y!@ XB1B$1B$B;0`p j$(( `1|f&j"<e"< eA@1A/9;8N y>y!@ X&<@pf#;0#;, y>s| L N^Nu/,O/ / $nG$J;Tf. *#;4rlB€// N | 9;T"R#;T jgJB// N 9:Ar;Tm0/ HypJl^/HjXN$n&nN^NuBHh`B;TB;4/ Hy rL jR/HjN/*/ N``/,OH?<$nJ;4fr/*IaFN&HXJg\HjN4/ N^ y>s  y>s(*@HxN- DgdHy)L/NDrpX$<a,K "/*"BN&Hp!@/*NPJg/ NX`/ /*NaP-JLs Dkt'B`I$+8&+<.**[I////N(,gzp ᯾$f,Jg(////N($f *Dj$r@%A// N`PLyBh$X*gHxN-pX*f(/ Hy pL9: jR//N *DjXr€%AJgHy)LM/NNzP *gr€%A-JL N^`Z-j -JL N^`Jf/ NXJfBj`0*ڰjm Bjp%@`R@5@/NX-JL N^`/,O/N$ 9;4g B/NPB@F$.N^Nu/,OH 0$nNP$"*g y;4fHx/NPB@FL N^NuDjpB%@Jf/*/ N``Jg p%@`p%@ y>s(x@HxG-N y>s(@HxN y>s(*F@HxN y>s(*@HxNHxN*g@Hy NuX`./,OH 8$. &n/Nb$H HxHy+̏HhN_BHjXILNBHjNp%@%@%@ S%H +%@$Vr%A5|%| %|. /(Hx/(/($/Hy)LnNDr/N$ P.9//Nz/NBB/ G$NB j/(/ N$BB/ N/ N BP ;XR fBA;XC,B1RrfA;XB2A!4B!A$!A0R f y>y1|1| y>s| LN^Nu/,OH<$n/ N^ y>s XI K-Dg^BB/ G$Np%@pBHx/ NBB/ N y>s $Dg"/ N y>s(*@HxNPp`B y>s(*@HxN/ N/*N&%H gpf ( %@BL<N^Nu (`/,OH 0$n"*, t /Hy;xN;&HP(fp%@%j$-JL N^` ^H/(/ HhN JoJ$g%j8@%j<DN^$/ /+Na/ N`B@F L N^Nu/,OH<<(n*.(. $ltą,gB2* Rg"*l&</B/ G(NHxB/ N%|(p%@0 l (%@4",%A,ҁ%A8L%@<2RA5A"% % % p /*(N!&H!D(!E,B8B/ / N(PJf.$*p%@-E-D/// N%B `g%S`rƒ// / N^ `zp`Nq/,Op p ;Jg (DgrWIDN^Nup`/,OH?". .tĮ p-;$(*[I,.Jml (Ё~ LN^Num&(ւ[I,.o ( `p`/,O/ $n /.Nb *XHf#;p$nN^NuB`NVH<0$. /.Nb$H (H! ;Hy,NrFªH*[IĀ"*Hv %DX%@\PJg./*,/*(Hy)LGDrN0* @fPHy)LNXHxBHnN(p-@-|)LHnHyV/ //9;N2f L ` G3g0 pG)fBB-Kp-@ `Hx8`.-H-AL sg*Jf6"p -A -|;8$.N^`JJf Hy)MNK.A; $.N^NuNV//". .$.&.-@-A//N8 PP"h-C-B -H"i$.&.N^NNV//". .$.&.-@-A//N8 PP"h-C-B -H"i $.&.N^NNV//". .$.&.-@-A//N8 PP"h-C-B -H"i4$.&.N^NNV". .-@-A//N8 P N^NuNVH>8,. .&.$n(.*.-@-F//N8&H(P l/// // h$N$pf/// // Nh$rf ZygbJ @ Zvgp CZqg @Zxg r Jfb/// // NpJmJ$`F ZwgJ ZpfJgHx/ Hy;֨N)0 `$9@%y9<%y98B L|N^Nu jCbp"p?eh * b\#9@#9<#98`Jg>HxHy;֨/ `$9L%y9H` rml#9L#9H`|t`xt`r/,O n"y;JfB(N^Nu!il("y; )P")T!@ !A$`/,OJ;֤f6HxNb#;֤Xf Hy)MNK.HxHy,@/N)0 N^Nu/,O/ 99<"L998L|/Hx"99@/rL"<6L@?Bg 9;֤>r/Hx N`$.N^Nu/,OJ;tfp#;tN^Nu/,ON^NuNVH0 ". .$.-@-A//N8$HvƂPgp *g&frYf j/ htNXJfpL N^NuNVH0 &. $.-B-C//N8$P j/./ hN/ NB-B-C//NTBL N^Nu/,O/ $nB`BhBXBdBlB\A%H 0* S@5@NBPBjTB*Hy9GIBjJBjLB*<|A0j"/B/*N( B0j"m$nN^Nu jCWDR`NV/ ". .-@-A//N8$HP(fJ9f"HxHy9Hy;֨N)0p#9 BHy;|NLB j hpPJg@/ N jHx/ hN JfBHxNT%HP/ N$pX$nN^Nu/,OH 0 . &ng/Nb$HNv$ y;XJg. hHHf$HxhHy;HjN)0B;#; %K/NF/+T/+PN0j"/0j /Hy)M3GDrN/99H/99LHy)MEN 9;$f#;Hy)MlNX`gHy+Np@XL N^Nu y;Jg hlln#;#;;`/,OH 0&n/+$/+ N8$H/+$/+ Np" 9>yD"tt}ffL N^`L N^NuNVH8$. &.(.-C-B//N8Pgpr !A (f0 (r !Af,-C-B-C-B LN^`dr€!AfLN^NuNVH<0$. (. r ;Pmv L b B009B9;zDj ?cH/NBX`LJg`v20;֩DfpDfj``V;z`  ft `/,OH 0N_vGaE`NHxrF€/N"PRgL N^Nu/,OH>0$.,. y;Jg&PJgN( p$@rҀpe,p9;{JgF;{-DL |N^``9;xJg JgHy;|N B9;xB9;yX`Jg"9;ygHy;|N B9;xB9;yX9;{ Pf6 PfHxHy9Hy;֨N)0 `n YfBN"`\0A;֨g JgJ  0 0 ;֩J9;xfLJf< y;J(Ag:;x;yBHzj 99LL9:|dLF/Hy;|N9;zgfB9;z9;zJgrJgB9;zJgh y;Jg\J(KgT/ Hy9N)/$ k/ Hx h(N k/ HxO h(N k/ 90))MzI/ h(N `*Jg 0 ;֨`00;֩DfDfC`00;֩`Uf y;J(Ag;x;yBHz( 99H`;z` >cPB9;zJg y;JgJ(Kf9;{Dj ?c k/ / h(NP`N B0 09`Jg`;٨ bR y;J(JgFHxHy)M/N)1 Jf, BB(/Hy)MN)/PJg BB(9$BBJg k/ B/ h(NSP`L |N^Nu/,OB9;x9;ygHx/NPN^Nu/,OH80$.$n y;Jg*"*?g. #gb gn gtB*?`B` ?g frxmv?mpgXr҂vepftf j B|??C%I `HpPmJr6mv#gRmp fx| ?J*rԁve2Ԃ0;(Nv & &&&&&&&&&&&&v|gp}fjFC`B*?-JL N^`BB*?B``B*? *`0j"o^ j`PB*? *h"S%Ah0jLJmf%@h"jHxHxB// iN/ N`pjEC`RjFB`HjGB`>jGC`4|#?`/ N$ jHx/ hNB*? `%j`d%jhl%jX\`%jd`%jlh%j\X jHx/ hNB*?P`p|K`B*K`A jTfHy)MNX`Hy)M`rFgvGf5|R`xBjR`pp8fhB`&B//HxE/ i|NR"j0j"nR0j n jHx`VB`pЂr8eЀ0;N&zB|h><FFF * " c8&R(08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x !!!!! !(!0!8!@!H!P!X!`!h!p!x!!!!!!!!!!!!!!!!""""" "("0"8"@"H"P"X"`"h"p"x""""""""""""""""##### %C @`( *`S%@`jB` *`S%@`j NB`` jHx/ hNP` j B$ XHxHy)M/G($N Jf 5|T`HxHy)M/N Jf 5|T`HxHy)M/N Jg5|T` j B *>fHy)MN`/ NXJfAv jTf Hy)M`Hy)M`/ NXrg:]ft&*`R/ *hR/Hy)MHx$ X/NE/N`@Hy)M`z/ NXJgSf$Hy)M`^Hy)M`T/ N\XJg WfB`$ *`0j"o jB0` jB0R0j"m`/ NXvgrfphWDBH`vhWDB<`/ N jh2jLXn~2jNmtGȰd&@ȳm"jHx/ BHp/ iN"j0j"// B0jNHh/ ixN jHx/ hN`/ N "*h0jLXn0jNm$Rd$m jHx/B// hN j2j"/ /B/*h/ hx`/ N"j`0j""&AXd&@l jHx/ Hq/*h/ hN$ S"jJnHx/ i`B0j"Hh/*hHx / i|N&B`/ N>// N(` j BHjNXJgS0j""Sd"%A`B*? jHx/ hNpX` j BHjNXJgSJjPg0jLЈ0j "Sd"%AhB*?/ Nr jHx/ hNrêX`p j B& X/GRN$p;./N)/PJghHhNXJgSJgSJjPg0jLԈ0j "Sd"%Ah0j""Sd"%A`B*?/ N jHx/ hNtŪX`B`/ N"*hXJfpjB0jLJjPgc "` Sg%AhB*? jHx/ hNvǪX`/ N"*hXJfp0j Ё"Sd"0jNJjPg d %@h`j "Rf `/ N^XJfp0j"Ъ`"Sd"%A`B*? jHx/ hNrêX`B/ NXJfp` *`jB%@`B*? jHx/ hNtŪX` j B/ NXJf2/ NL"jh0j SXo j6j"/ /BHi`rf$/ Nb *hXot j2j"/ /BB`UfZ j2j"/ 6j / `/ NXJf / N`rf / N `Uf/ NH`v/ N$0j"$SS`Xd$Jm jB&֪`//*hHx / h|NS` j B( X/GNX&fv4* Hx;/N)/PJfZ0B2j rm Iv SSd&25CLSd @5HNJjPg`0A%HhB` jHx/ hNP`@HhNX @Jf0j ` j BA fC%I "* "|"dg* b&Ѐ01N"^fjpXR`tX`( 5g*n 2g 4fpXT` 7fv`vǪX`tŪX`pX`t`vX`Hy)NNyD"tv}ffHL N^`TjEB`0jDB`&|?`|?A%H ` |?`|?`|?`|?`p`g`Hx/ hNP`$NVH8 &. $.(.-B-C//N8$HPJ?g6J;pf.p0r g"Hx-B-C//Np#;p -J I-DLN^`^NVH08&n&. ". .-@-A//N8$Hp0Pr fN hHx/ hNPBIʶn jp -@ -J"hL N^N3(g / I/NPR`L N^NuNVH0<$n/*/*N8IN$ *"PGffr%AHx@K/ HjhN&/N/*/*// Np N$p/ NhXJgjHxHjNP/NXL< N^NuNqNV/ $n J>sfp9g B$nN^Nu/.Hy)N'N2PJgJ>sg *9fp`N(JgNxBBBBBB/. y,TNJfJ>sf *#9#;0`/,O . g/ n/(HHy)N-NOH pN^NuNV/ / $n&y,hBHxHn/<@VBBB/.N%|ޭ`%|%| %n 2.B0.L%ABHxHn/<@VBBB/.N0Jg-|-|p-@".p5@5A".%A .%@B B$%A(%@,B0B4%|ޭ+:+4+2|gn| ghB< F< *F,Lh F, Jf>Sk> b`B`zfJf Hx/ NBPR L+҇HL, L pH2HJgSkb`bSj`~/,OH< .r€ҁtvg *S(묂Rx fFL< n (n&.$.(."nB<)"HB4E( Rf8LGKLE/NX fL<|N^NuX""J``/,OH>< n (n&.$.(."nB<)"HBB4E( Rf4LGKLE/N~XF fL<|N^NuFX""J`BF`/,O//"n n$Ԯ f$&N^NuBA0HA".&.c`/,O//"n n".&֮ f$&N^NuBB0HBF$.b`/,OH>< n (n&.$.(."nB<)"HBB@4:M@E( Rf8LGKLEpF/NdX fL<|N^NuX""J`BA0HA`/,OH><"n *n&.$.(. nB<( IBBE50HEE(*Rf6LGIXLXEX/NXF" Ү fL<|N^NuF" J`BE0HEF`/,O/"n iB.B)-B),ml B2(/2(//("h"./1/0 "h ./1 / . p 9N$.N^NuNVH?<&n$. (k T$P(خJf0k"K(g@g@ l.0,:+20E-H".L. .SjHR` l*0,B0k0mRfL n,. *.".08(4J( gJAg(0JAnv h"PB60AB2L* ځ( ؂ЈL&ք$|,"D EQBFSd$E DCf$ t‚$ CQ BBSd CQ BASd`B`JAg~nJDfX`p"#h#h#h#h#h#h#h#h#h#h#h#h#h#h#h`!Y`BBBB BBBBB B$B(B,B0B4B8@B`B`JDg h(B:&ւ0AB2҈LL*$?,܂ A؈$r""D FQBASdrL($F DCQ.B@Sd& tʂ$ CQ"BBSd CQVBESdNL|N^Nu"#h#h#h #h#h#h#h#h #h$$#h((#h,,#h00#h44#h88@@#h`!X`BBBB BBBBB B$B(B,B0B4B8@B`/,OH?8$n&. *.$."."j Q&P i(p<ApfLHx/ N2*0PDB0B-H0jN R-@-A -KLN^`fpfHx/ N2*0P`8*20HYfp<*"2F" &L8Hx/ N0j0"SP"BJl LN^Nu0j" S,*JlB0+B:ЅS`>*20G)g)S`&L8(LHHx/ N2j0SPJm0j" S,$JlB0+B2ЁS`2*2xy0AԈ܈S`/,OpN^Nu/,O n!|!|Ԃ|!|x!|!|܊p!|ϰtN^NuNVH08&n n $k-P-h-h-h -hBHxHn/<VBBB/. y,hN$ y;T$0+2H"( L@7A" R0+0H"(L@7A R#9P R# 9X R#9` R#9\ R PB0(#9T *g /NbX *g /NbX0+ H/IbN%H0+"H/N%H"jPJgJf Hy)N9NK. R(P0H5@0+4R@5@(PB2B0,Ҁ%A5k25k00+0HL%@ P h"r0k eB jBr0k"eJB+,%$ B+, PRB+-c> L N^Nu j &0֪!R` j B6*ְ!R` 0k0Ј$`NV/ $nJf%|9$y9,y9-B@995@2BA995A0BA995A45y96 @o Hy)NSNK.Hx NbXJfHy)Nr`%HB BBB-y9`-y9\-y9X-y9P-y9THn/ NڔBBBHx/*N\$nN^NuNVH 0$n . n$.&j @Zrg`b Ztg ZugpL N^Nu Zsgf Vg Vf/Hx//BBB/. y,hN`"S "S!i"S!i "S!i "S"QB0)!@B`// NڔPJft=j =j" S=h S=h/ N$/BHn/<tgBBB/. y,N`BBBHx/*N\`BBBHx`p `Nq/,OH<". &.$.kP x z(L p ;T P0B2(L"[I(*o (Ѓz L< . $r peI;@r(L(E(G$vƓf);8(, X F ;4 99l* P"E"-@ 99hx AH -@ 99dK*rF€/HnBN%H gV)("F""E" CH""PB0)*p/NL%H/N%HP L<|N^Nuv`v`v `/,OH0 $nB@ B#bF$A;dB"Df&(fvƁ R(rfv$ jJg.!R j!j/*N j$%hp$XB@FL N^Nu/,O/ $n *$gXr€%A$Df&A;@B('g.g*"(f /N.Xp$-j$nN^`.R(rf`$nN^Nu/,OH 8". t r(L$@;@I$*'g / NTG/Ny0(2(H@IA @ b"n"i"i >r!@BhN^Nu/,O y>y0(2(H@IA @ b&2("n"i"i 9>rDJAlБ!@BhN^NuЩ`/,O/ "y>y0)2) y;޼H@IA @ bB0( $h 2>r#@Bi0( R@@1@ $_N^Nu/,O/ "y>y0)2) y;H@IA @bB0( $h 2>r#@Bi0( R@@1@ $_N^Nu/,OH8 t .  @Hh NbXJgR Bh1BC !IBE9Dp82 B0"h&vȃ#Rf LN^Nu/,OH8 v .  @Hh NbXJgX Bh1CC !IBE9Dp82 B2"h rȁrL#,Rf LN^Nu/,OH8 t .  @Hh NbXJgJ0Bh1BC !IE9r%@ J Lrr1@09;ᖐy>r1@&B y;޼ h 0(XЃ!( y;޼ h 0("/99//N rf y;޼1|!|<P y;p h  y; y;pg"h "Q#y; h ; y;"y;p!i  y; L N^Nu/,O/ /J;ݨf y>y0(| f997g$99#;;ݨ#;ݴ;ݤB;B; HxPBHy;ݸN(#)OK;#;#;A;ݴ#;#;#@;#;#;#;#j;(#:; #~;$#;#f;#x;# ; ;p#;ݬ;ݼ 99Ѐ/Nb#;ݬ y;ݤ"h f Hy)NNK.Ђ#@ h ($<9/99//E)0N y;ݤ h /99//N y;ݤ!|P1|A!|@+1| y;p h  y;ݨ  y;pg"h "Q#y;ݨ h ;ݨ y;ݨ"y;p!i  y;ݨ $.$nN^Nu/,O/ /J;f: y>y0(| f($99#;݀;#;,;B;݀B;݄HxPBHy;0N(#)OY;݈# ;݌#X;ݐ#;,;ݔ#j;ݠ#:;ݘ#~;ݜ#;l#f;p#x;t#;x#;p;,#P;T#f;X#@;\#;`#;dp#;h#;;4 99/Nb#; y;"h"f Hy)NNK. Ҁ#A"h")Ҁ#A"hЩ#@ h ($<9/99//E)0N y; h ( /99//N y; h /99//N y; h ( .9//N y;1|E!|P1|[ y;p h  y; y;pg"h "Q#y; h ; y;"y;p!i  y; $.$nN^Nu/,O/ /J;`f$99#;;`#;l;\B;B;HxPBHy;pN(#)Ow;#;#;A;l#;ߔ#!;ߘ#@;ߜ#;ߠ#;ߤ#;#j;#:;#~;# ;߬#f;߰#;ߴ#l;߸ ;p#;d;t 99Ѐ/Nb#;d y;\"h f Hy)NNK.Ђ#@ h ($<9/99//E)0N y;\ h /99//N y;\!|P1|!|,1|  y;p h  y;`  y;pg"h "Q#y;` h ;` y;`"y;p!i  y;` $.$nN^Nu/,O/ /J;f0$99#;P;#;;B;PB;THxPBHy;N(#)O;X#;\#;`#;;d#j;p#:;h#~;l# ;<#f;@#;D#;H#;p;#;$#B;(#@;,#;0#;4p#;8#;; 99/Nb#; y;"h"f Hy)NNK. Ҁ#A"h")Ҁ#A"hЩ#@ h ($<9/99//E)0N y; h ( /99//N y; h /99//N y; h ( .9//N y;!|P1|!|,1|  y;p h  y; y;pg"h "Q#y; h ; y;"y;p!i  y; $.$nN^Nu/,O/ /J;f0$99#;h;#;;B;hB;lHxPBHy;N(#)O;p#;t#;x#;;|#j;#:;#~;#$@;T#;X#;\#/;`#;p;#;<#;@#@;D#;H#;Lp#;P#;; 99/Nb#; y;"h"f Hy)NNK. Ҁ#A"h")Ҁ#A"hЩ#@ h ($<9 /99//E)0N y; h ( /99//N y; h /99//N y; h ( .9//N y;!|P1|!|,1|  y;p h  y; y;pg"h "Q#y; h ; y;"y;p!i  y; $.$nN^Nu/,OH0 J;fh$99ؘ#; ;#;;B; B;HxPBHy;N(#)O;#;#;#;; #j;,#:;$#~;(#$@;#;#3;#;#;p;#;#;#;#;#;p#;#;; 99ؔ/EbN#; y; hJf Hy)NNK.HxN#;XpJfHy)O` y;PR f y; y; h /99ؔHy9؜/E)0NHx y; h/N_ 9;ᔐ>rr1@09;ᖐy>r1@&B y; h 0(XЃ!( y; h 0("/99ؔ//N rf y;1|!|P y;p h  y; y;pg"h "Q#y; h ; y;"y;p!i  y; L N^Nu/,O/ /J;xf y>y0(| f997g$99#;;x#;;tB;B;HxPBHy;N(#)O;#;#;A;#;#4;#@;#;#;#;#j;#:;#~;#;#f;#x;# f; ;p#;|; 99Ѐ/Nb#;| y;t"h f Hy)NNK.Ђ#@ h ($<9/99//E)0N y;t h /99//N y;t!|P1|A!|O+1| y;p h  y;x  y;pg"h "Q#y;x h ;x y;x"y;p!i  y;x $.$nN^Nu/,O/ y;hBE_zNN y>y 9;0>r!@Bh$nN^Nu/,O/ / $n j&P y;p h f kfN kfB jp$n&nN^Nu/,O .g y;h!@N^NuN^`T/,O/ E9 ZJf B$nN^NuN`/,O y;lJf*#;@;l#;@;p y>y1| BhDBhF#98;H#;4;L#;4;h#;P#;T#;X#;\#~;`#;dB;8B;4HxNb#;0Xf Hy)ONK. !|!|!| y>y 9;0>r!@Bh1|N y;  y;l y;g "P#y;l ;l y;l!y; N^Nu/,O"n n .gFgX0)hcJheDf> g f6 "WIDN^Nu()W`2)hchT`B`p`/,OH 0$n n h&hB/ / N Jgd g< fkkkB0*B2*B4*҂mBL N^Nuk`""k j!R`p`/,ON^`d/,OH>8&n(n k$hHx/ / N JgfB@ C#c k( gz P htĨrr1@"y;&i6k>r1K i   y; h!@x/,/ N -y;Lrx0"R"i2q(>r1IRP`,NVH?<$n y;܄"hg(j&RB0+*@** ,*>OUGO=GB4(Ԫ 䀔B8(ت p䀘gSfSڂ܄vւ>"B0.Ҁ o(AҁGB6փr҂0H6C@A=CJg "iré!J h&(Hx/G_N1| Hx/NBhHx/N"y;܄1iHx/N"A0@@ @ @0H@ @1A Hx/N" p Ap"y;܄i1AHx/N1nHx/NBD1BHx/NEF1E Hx/N1GHx/Nn1GHx/NTBnrr1@"9;܄ A"h0)y>r B1@"A i ( "(/99//N)0 y;܄ h&( Hx/NT$BnHx/N"y;܄"i )>rr1@"y;܄&i6k >r1K i   y;܄"h#@"h )#i  h!@ x/,/ N -y;܈Lrx0"R"i2q(>r1IRP`"R(0i"i">rұHz0"R"i>r2qH1IRP`NVH?<$n y;\"hg@(j&RB0+-@** *<NUFNB4(Ԫ"䁔B8(ت"⁘gSfSڂ.ހvւ0"*AB2&A" ҋ o(Aҁ@:@B6փr҂H6C@A=CJg "ip!J h&(Hx/G_NBhHx/N"y;\1iHx/N"A0@@ @ @0H@ @1AHx/N".p Ap"y;\i1A Hx/N1nHx/NBD1BHx/NEG1EHx/N1M Hx/NM1FHx/NTBmHx/N"R1i"R1iHx/N"y;\"i )>rr1@"y;\&i6k>r1K i   y;\ h!@x/,/ N -y;`Lrx0"R"i2q(>r1IRP`,NVH?<$n y;"hg(j&RB0+*@** ,*>OUGO=GB4(Ԫ 䀔B8(ت 䀘gSfSڂ܄vւ>"B0.Ҁ o(AҁGB6փr҂0H6C@A=CJg "iré!J h&(Hx/G_NBhHx/N"y;1iHx/N"A0@@ @ @0H@ @1AHx/N" p Ap"y;i1A Hx/N1nHx/NBD1BHx/NEF1EHx/N1G Hx/Nn1GHx/NTBnrr1@"9; A"h0)y>r B1@"A i ( "(/99//N)0 y; h&( Hx/NT$BnHx/N"y;"i )>rr1@"y;&i6k >r1K i   y;"h#@"h )#i  h!@ x/,/ N -y;Lrx0"R"i2q(>r1IRP`"R(0i"i">rұHz0"R"i>r2qH1IRP`NVH?<(n&n l$hHx/ / N JgPfzB@ D#c l( gP P hpGQG=GB6(֭ 怖B8(ح p‘gSfS܃&D*QE B2.Ё o(@ЀEB2ҁpЃ4J2AB@=AJg $jrê!M h$(gh BBE_HxHhNPJgN2p i0@ 1@HxHh-ANP".Jg&A1ARrfHxHhNPJg1| Hx/E_N1|Hx/N1y9Hx/N1y9Hx/N1y9 Hx/N1y9Hx/N1y9Hx/N1y9Hx/N1y9 Hx/N1y9Hx/N1y9Hx/N1y9Hx/N1y9 Hx/N"y;ݤ1iHx/N @2 AA"A A2IA A1@Hx/N".p Ap .Ѐ@A"y;ݤi1@Hx/N1n Hx/NCD1CHx/N F@1FHx/N1EHx/Nn1E Hx/NTPBmHx/N&U1k&U1kHx/N$y;ݤ$j *>rr1@$y;ݤ&j6k>r1K j   y;ݤ h!@x/,/ N-y;ݨLrx0&U&k6s8>r1KRP`,NVH?<&n y;"hg(k$SB>*$k (+&+ֹ9ר 怖*+ڹ9פ 䀚, ܃؅2IYA0@@4 B?BBJ=BH:@$E($ #9$R#9#9״ U#9װ$$y9Եl Ԃ$y9m $R&"鉄A=BJg "iré!K h$(Hx/E_N1|Hx/N1y9Hx/N1y9Hx/N1y9 Hx/N1y9Hx/N1y9Hx/N1y9׮Hx/N1y9׶ Hx/N1y9׾Hx/N1y9׺Hx/N1y9ײHx/N1y9 Hx/N"y;1iHx/N0H@ "A @0@@ @@1AHx/N r @p"ҁA@"y;i1AHx/N1n Hx/NCE1CHx/NFD1FHx/N1MHx/N1M Hx/NTPBn4Hx/N"S:i1E"S0i1@Hx/N"y;"i ) >rr1@*y;"m2i>r1I m ( "(/99//N)0 y; h&( Hx/NT$BnHx/N"y;"i )>rr1@"y;$i4j >r1J i   y;"h#@"h )#i  h!@ x/,/ N-y;Lrx0"S"i2q8>r1IRP`"S(0i"i">rұHz0"S"i>r2qH1IRP`NVH?<*n y;t$hgt(m&UB0+-@,- "->GQG=GB6(֭ 怖B8(ح ‘gSfS܃&D*QE B2.Ё o(@ЀEB2ҁpЃ4J2AB@=AJg $jrê!M h$(gh BBE_HxHhNPJgN2p i0@ 1@HxHh-ANP".Jg&A1ARrfHxHhNPJg1| Hx/E_N1|Hx/N1y9עHx/N1y9׊Hx/N1y9ג Hx/N1y9׎Hx/N1y9׎Hx/N1y9זHx/N1y9z Hx/N1y9ׂHx/N1y9~Hx/N1y9ךHx/N1y9מ Hx/N"y;t1iHx/N @2 AA"A A2IA A1@Hx/N".p Ap .Ѐ@A"y;ti1@Hx/N1n Hx/NCD1CHx/N F@1FHx/N1EHx/Nn1E Hx/NTPBmHx/N&U1k&U1kHx/N$y;t$j *>rr1@$y;t&j6k>r1K j   y;t h!@x/,/ N-y;xLrx0&U&k6s8>r1KRP`,NVH?<&n(n k$hHx/ / N Jg(fB@ E#c k( g lfv P h(?gp-@BI_K9؄(<9،Hx k P h h/0lNPB".t΂'t"jı|.t‚tĀtı>5z"Dq*"tG RfRfB@FBLrr1@.9>r(D*D"R"i2i1IB8 "R"i"Q. 1G "R"i2i1IrfJ"R"i"i. r1G"R"i2i1I"R"i")Ҁ~1A"R"i2i1IHx/NB1C1CHx/N"y;,"i ) >rr1@*y;,"m2i>r1I m ( "(/99//N)0 y;, h&( Hx/N"R"i >rБ~1@"9>r "R"i2i1IԄ"R"i"҂1A "R"i2i1I$UfD"R"i")Ҁ1A"R"i2i1I"R"i )Ђ1@"R"i2i1IHx/N"y;,"i )>rx1@"y;,&i6k >r1K i   y;,"h#@"h )#i  h!@ ~/,/ N$@-y;0Lr D-@ "~!A"<@!A.-Gބ r!@ <G!@Prg  *y;޼ 9>rD"m")Ҁ~!A"mЩ"<@!A~!G !GHx m/(N:|@>r"ҍ.p!G.<A!GCX-I. ބ"!A <G!@Prgh  *y;޼ 9>rD"m")Ҁ~!A"mЩ"<@!A~!G !GHx m/(N"y>r*C Ѝ.r!G.<@!Gڃ -@.ބ !@ "<G!AP~g  *y;޼ 9>rD"m")Ҁ~!A"mЩ"<@!A~!G !GHx m/(Np@>r"C"҉.v!G.<A!Gڀ؅ !@ <D!@PUg  "y;޼ 9>rD(i",Ҁt!A"iЩ&<@!C~!G !GA"y;޼*iI C((y;޼(l)Xpf y;޼!Jr/+/ N$@P-y;Lrr1@.9>r(D*D"R"i2i1IB8 "R"i"Q. 1G "R"i2i1IrfJ"R"i"i. r1G"R"i2i1I"R"i")Ҁ~1A"R"i2i1IHx/NB1C1CHx/N"y;"i ) >rr1@*y;"m2i>r1I m ( "(/99//N)0 y; h&( Hx/N"R"i >rБ~1@"9>r "R"i2i1IԄ"R"i"҂1A "R"i2i1I$UfD"R"i")Ҁ1A"R"i2i1I"R"i )Ђ1@"R"i2i1IHx/N"y;"i )>rx1@"y;&i6k >r1K i   y;"h#@"h )#i  h!@ ~/,/ N$@-y;Lr D-@ "~!A"<@!A.-Gބ r!@ <G!@Prg !*y; 9>rD"m")Ҁ~!A"mЩ"<@!A~!G !GHx m/(N:|@>r"ҍ.p!G.<A!GCX-I. ބ"!A <G!@Prgh !*y; 9>rD"m")Ҁ~!A"mЩ"<@!A~!G !GHx m/(N"y>r*C Ѝ.r!G.<@!Gڃ -@.ބ !@ "<G!AP~g !*y; 9>rD"m")Ҁ~!A"mЩ"<@!A~!G !GHx m/(Np@>r"C"҉.v!G.<A!Gڀ؅ !@ <D!@PUg !"y; 9>rD(i",Ҁt!A"iЩ&<@!C~!G !GA"y;*iI C((y;(l)Xpf y;!Jr/+/ N$@P-y;LNVH?<(n&n A,rgSAf$l<*l@ kfv0+*4YB B b (Ԃ0{(N  6:>BFJNRvB4+ @A($L@(`.v`v`v`v`v`v`v `v `B4+V#BC0+S@B5p|C|B*C||CGA 0C|'CC ACB*C|CA A|C||CB*|C|B*C|| CB*|CB*|CB*|CB*|CB*|CB*|CB*|C|W kfb| CB*|!CB*|"C||$C||%CB*|&CB*|(C|@|-CB*|#C| |C+ AB*C2+A|CSA|C2+ A|C+A|C2+ A|C +A|C2+A|C6+8+ UU E B+zȅ 5 5 A|CB* kf,| C + +-S@A| C+-UA| C+-SA| CB*| CB*|CB*|CB*|C2+A|C+A|C@ kf|C2viBAA|C+-SA|C2+A|C2+A|C||CP|0C0B&SE +A B+ zȅ B+ ȅ  A kf|1C2xi҂ A|2C ! !   B 5 A|3CAA  A +@B*CB*|CB*|CB*|CB*|CB*|CB* kf&|C||CP|CP*CB*CB*C|C|C|C|C|C|C|C|C|C|C|C|C|C|C|C|C| C| C| C| C| C| C| C| C| C| C|C|C|C|C*C kfH|C|C|CB*C|C|C|CB*C|CB*C*C| C kf| C+ +-S@@p B2p k C0ppVpf kf|C||C|BAfrUR f|C||C|BAfrUR fB0+4Ѝ.+0|C||C|4+48+*k6c^ Dc8|C||C|B0+4Ѝ(+0Rk6b2+,SA"D,6+,@*R ETCfR&փ؃B6+,0| ҈Ё`BC`bv`\| C||!C|`| C + `|C2+$I`r|1C$`|C|`|C| C`| C+ `ppppRf kg&|CB* kfv|C|| C| C*@ kfL0+( M0 XQB4+$]ԍvHx Hy,Hv8N)0 BA8"B22Xrf)K` <;ʐ)J)|Ѝ)@ )|B2+p9@9kB0+)@0+)@B B$6+$*)C(8+&,)D,B0B4pLPJgB`NV`/ /$. grJfE;$ @!J@ n (%@<%@@p%@H%@D%|NhNS %@l/ NS2/9; / N JfXBHyF/ //9;N2f$.X$n\N^Nu/Nb$H XJ;gtHxHy;HhN)0 Hy+NDrX`/,O . g/ n/(HHy)N-NOH pN^Nu/,O n hf0(* @g_@ @ SIDN^Nup`/,O/ /$n n$9>sg4 GTgB$.$nN^Nupf *9f p`r9f GTfpf 99(9,dr8L p 9NfB9(p8L99(90#; /NFXJgpJf *#9#;`zNVH<8$n jJg  b"<d%A n"h<p"*8 G &(C$ BB1p1p1pRDf//*/ GN Jf(/*/* ֒/N Jf/*/*Ԓ/N Lb G9gh G2f-H N^` G3f-H N^`-H N^`-H N^`-H N^`*0 1|B`|-H N^`p`j/,OH 0 .&n n". St e ҁ2;N:.HB"99$R//N BL N^NuB$99(R/`g9,op` 9; 90L<mR KBA8$A9HxP/0 ,/N('RT7jX7jZ0*7@\ @gB2* L@7A^B0* B2*LA7@`B0*B2*LA7@bB0*B2*LA7@dBkn*g7|np*gknpB2*L7AfB2*L7AhB2*L7AjB2*L7@l`0* *7@^2* *7A`4**7Bb0**`dp`xr-A-S -@L N^`T&9,`J-K-H -@L N^` p`,Nq/,O n"h"i`!I1i$"1i& N^Nu/,O"n i h0 n$n "h<&h`B0*L<#p#pB00 ,l#p80j<*0+$B86B2ց2J0,\g2*:*B4Ђ爲HdB2* SЁց |4<@ºFdBB2* SLЁց XH@X#pD XH@X#pH[HC[#p@r#p4B0* 㨀j XH@X#p0 n$n "h<&h`B0*L<#p#p#p#pB00 ,l#p80j:*0+$B86B2ց2J0,\g2*<*B4Ђ鈲HdB2* Ёց |4<@¼EdBB2* SLЁց@XH@X#pD XH@X#pH[HC[#p@r#p4B0* 㨀j XH@X#pЇ~LCd4) Ђ؂&<4<@²FdBB2) SLzLЁ؁~`ևXH@X!pD[HC[!pH\HD\!p@p!p4B0) r㨀i XH@X!pO0GzLXB@t"|,L|`6 ;b"L<zdLBjDo0U@>GHUFF"ARڃrf`/,O n0( @g2b @gBN^Nu@ @WID`0(* @g _@ @ S`p`/,O/ /$n n$9>sg8 GTgB$.$nN^Nu (rf *9f"p`p9f GTf (rft 99,90dr8L p 9RfB9,p8L99,94#;/N]XJgjJf *#9#;`xrfF`\rg`8NVH<<(n&n $l<$,@)K`/ KN)@)|/N)@ )|@B2+p9@9kPB kf0+)@B0+)@B B$0+$*)@(0+&,)@,B0B40+ @f82+*0Y@ @ b Ѐ0;N. B4 0+$)@B0+&)@B B$0+)@(0+`tB0+ AA LA2+SA|B*B*B*B*||1A C|||B*||B*|B*|||| B*|B*|B*||J|B*|B*|B*||W|B| |4+ Bf|!B*|"||$||%B*|&B*|'|Q|(|@|)B*|*B*|+B*|-B*|#||1B*|2|0|3B*|0||+ BB*4+B|SB|4+ B|+B|4+ B|  +B|4+B|6+8+% UU E B+zȅ 5 5 B|B* kf| ! + +-S@B| +-UB| +-SB| B*| B*|B*|B*|4+B|+B|A4+| Bf4vj@BB|+-SB|4+B|4+B|||P|00@&S+E A B+ zȅ B+ ȅ  B4+|1 Bf4xjЂ@|2 ! !   B 5 @|3AA  A +@|4B*/K]NppHp.9NX ppHpp"pB2pB*B*|B*|B*|B*|B*|B* kf|||||P*B*B*||||||||||||||||| | | | | | | | | | ||||* kf|||B*|||B*|B**| P0+ @bbB2pB* kb,HxB/+ / NZp AAARf0+ @f=|BnBnBnBn0+$H=@0+&H=@=| Hn/ NV.4+4B0C 0(k0Pk6c%p%p||B0+$E 0BA9C22XrfpL<"St8L p9Rfr8L9#;//.N^PJgB`Sf"St8L p9Rf`NVH<8$n jJg  b"<d%A n"h<@(*: RG &I8$B) ) ) R2@JAn//*/ GN Jf(/*/* ֒/N Jf/*/*Ԓ/N Lsg p`t#;l`"(SgB$N^Nur#;lt`b"hrmtlt#;lr#;h`^ret #;lr #;ht#9`8f`6rf ("`#9 f.#9#@;|`< (#9`(`а;lf #9` ;hf$#9#;|`# ;p`/,O . g/Hy)SNOHPpN^Nu/,O n 99 gD g2 wfJ9f p;-| @N^`p9f Op`0pp`/,O n 99 g@ g. wfJ9fPpB9;-| @N^`,p9f op`0p p`/,OH 0&n$k< 99A- wfHp9fP|QB*/< @N|/B*|3B*|1B*#;|;XB*pF"<0|"A w9f J9f"HC"A w9f J9f"HC"A w9f J9f"HCQB@Sd#;z;#;z;#;x;#;v;#;t;J9f8 k@| |@ 4Vx  4Vxgj||0#;| B*L N^Nu g g/< @N/ N|F||F 99Ptg|"9;|#;t#;||!|| |||Ŵfp|B*| dJr8AB*||P|B*||| w9fr!A|B*r|IJf|Z|||||||B*| B*| || B*| B*|B*|B*|||||P||"Sf|B*||@||<B*B*|B*|B*|B*|B*|||||P| |(B*@@Rrf*||*|B**||*|B**|B**|4B*P||1||1B*`@r9fp`:2pp`"r`||`r`| ||||||"`# ;`/,O/ $n  fPHxpHy9,/ N)05y9\ 0*^H5@^0*`H5@`0*bH5@b0*dH5@dB$nN^NuJf 999L<mRS b&@p9D @JgHxp// N)0`|p`/,O/ . "Ste(tpLJ09gL9D#9B$N^Nup`/,O n . "h<|Jfr! h<AJWID#;BN^Nur`/,O 9;N^Nu/,O n 0;1y;BN^Nu/,O/ n". . BAA2AAt hA@1@$N^Nu/,OH?<(.$.&y;(y;.jBJlBI$$D,IK(Ԕp?l @nPp@ @JfHLcT// /+$N///+(N3 ;3";=y;=y;p#;BB EHpI N*Hn/.N+g#;+gHxHn/+KhNHxHn/+NHxHn/+N y;n y;n y;n||B*$ w9f."<J9f"<A."< w9fJ9f"<A."< w9fJ9f"<A|. w9f*"<J9f"<A."< w9fJ9f"<A."< w9fJ9f"<AJy;g||+g kf||3;+fB`d./,//+$N/.//+(NB"G Fg+(C)P`.@.@.@`. A. A@`0||`6||By;`Fp#;Hk/.NP`4/,OH8< n&h`$h<(h@||||Hx B/ KFN2+|B0A$+x k~cd||||0+tvrL/Hx/ N|B*||0+tvtL(/Hx / NB0+tGHy)S/ N)/L| B* BAI9 2|6|g ASTtL4A(( w9f IJ9f KA  I w9f J9f KA  I w9f J9f KARA AfjL<N^Nu"BR2krBCIeԀRAB0 2| `B`B`: I`dNVH?<*n&n =k\/ N$XfHy)SNDrX L+j4+l8SD=DB0+X nfTB2+p"AC LA:SE8+ZSD0+\"y9 @g>b,@ @bz8|p`BB0+X+@(0+Z`ZV` @ WID(@` w9fDp8|f< BcJ+of0||r+ogrLH-DL8-CLh-FLx-GB6.L8-C-CL(-B| ng k\g|rf k\ft/F|B*2||B|B*| k\frA|B*L+Tx @f  AbBBB.Bt`I`8|p`||`||+ofr`|tgHr/FtFetā`<|vg k\grOF`tGFdt8`P`&vBBB.CB$RL<(zdLC(jDcRA B.|RtfRx ft  c/Hy)SNDrP*2+nDfg@Jg8>.O=GM0.H=@2.I=A6.K=C8.L=D8||n|FB*n|.neLSA|@|.@|n|B0.".A|n|..(.4..4 4 (.4 ..4  (. @C| B6+n..  @ ng`A| B*| B*|n|. A|n|n|n|P|2.IA|&.1o0@| ng k\g|@||| k\VID`& Ln8ؖjDc CnR.zd .f g"RRDBC-D"|zd|`Jf~t`B`@`B`F`+sSC| B*| +sA|+sSA|B*|B*`PB*|||B w9fr 8 @B**/< @I-N*/< @N*/< @N*/< @N*/< @N0+\ @g$b0 @g @g @f4B*0+X:M`&B*`Vr`p @g @ g @g*P|E~9f|B*||@| ERD ng"@*|p@*|2 k\fp@ nf / NX||||B;/ NXt`Jg|J0+X:M`0B*`|0+X:M`|`|0+XH:`|` @TcrbA*|p `0r"`p`@NV`/ / &n grJf`E;$ @!J@%y9<%y9@p%@H%|phN%@lr%AD/ Nz/ N.Hy9,/ N`./ Nb$H XJ;gHxHy;HhN)0 BHyy/ //9;pN2fJg"9 9;jr/Hy)SGDrN 99P g g wf|p9fHy)SN# A9X`\Hy)SNX n f Hy*NX j<|' j<( &g6 'g8 $f Hy)SNX# A9Hy)VNX$nX&n\N^NuHy)T `Hy)T`Hy)T1N#]J9`fp9fHy)T:`Hy)TG`J99fHy)TONDr`/,O//$. &.Hy+NDrXJ9gJ9g-C -B$.&.N^`$.&.N^Nu/,OH 0$n&n / NXJgA)0 f$<9,Hxp/ /N099H39099H39099H39099H390+Z9390+X939 *Gf // NP/*T/*PNPBL N^Nu@p$@9DHxp/ / N0*^H5@^0*`H5@`0*bH5@b0*dH5@d `p`/,O"n . n G:gb@ @G8gb G,g @G5gZpN^Nu @,G7g` G4f-H N^` pG-gxb G2gV ,G6f-H N^`x G3f-H N^`0;09;1@B`-H N^`$ ig80@p@`-H N^`B N^`x-H N^`-P N^`p`D/,O/ /$n n". . St eЀ0;N0@Nf/99/ NPJfp`Hy9,/ NPB$.$nN^Nu-H -J$.$nN^`// NDPJf*Gg/99`p `-H-A -J$.$nN^`6p`/,O n"h"i`!I1it"1iv N^Nu/,O np [f:"h"i<0("HL(hШ`|@|@1hb1hjN^Nu/,O npN^Nu/,O/ n".(frfrpgpDfDj$h"j<0h""L. A@|B)||||||$_N^Nupp`/,OH< n$. ". .(.(f|"h$i<6(":HL(ԁԩ@ ւ|B*||LH///N)0|||| -D-C -BLsg fJg"B`r98f fJgN^Nu")98gD"999cr#9rpL999L#;LJf )#98#;Hp`/,O/ / nJg>$h5|BR0*@5@Bj0*@5@C9A" @5@)@@5@)@@5@fHx Hy9HkN)00*@?5@/9;L/ N/ NJfBHy\/ //9;HN2fL<<@N^Nu/Nb&H$H XJ;g X$"/Hy;/N)0p'@'| 'K/NHy;0NMHy+NDrX`jHy, DN05Z5@4"BS Ѐ @9X05@SfI`|/,O . g9cpN^NurpL9L#;L//.NPJgB`/,OpN^Nu/,OH 8&n$n .g~$< jJgt cn"d%A/*/*HsIN JfH/*/* ВHsN Jf.-j-j ԂԒԋ-BLN^`t`BLN^NuNVH0<(n$n .gG$< jJfBL< N^NuGt` c"d%A/*Hs/*KhN Jf/* ВHs/* N Jf/* ЀВHs/*N Jf(l=GBn=AHxHn/ N20j"// B/`n2*20:@:*080j"-HCA2Ip=|=M=Df< .쐋>=G=E Ћ=A=DHx/ /N/ Hx/// N`0=@=E=A=DHx/ /N/ Hx0j"/`/,OJ9gJ;Pfpr#;PN^Nup`/,O n!|>p!|Lt!|x!|t|!|!|^N^NuNq/,O n00pNq fN^Nu/,O"n n 9>sf r:f4 !@f.r"f&#;Jf )#:#;pN^NuB`/,O".9:JAl: n pN^NuFA`/,O .XN^Nu/,OH> $. AC M3c2L| B@/Hy)TEDrNHy)TNHy)TN$<}x@#: ;dA: BB"|*f&Jg#;dJg#;` y;`0L|N^Nu(TL<7r†TLAfBL<"jDo*" T&"Ar`x`/,O . g/Hy)SNOHPpN^Nu/,OH0<&n$k+lUG DfB*JB0+pB2+X @A$L@(SB<+ZSF2+ng,N6.K=C6.K=C6.K=C6.K=CO*DfBg>@|EB*|UB*| Dg k\fp@|B*| k\fp@|B*/+TN|2IA|@|]B0 -@4 0.  5 .&[@ C|^B0B2-AB6.-C2.-A6.4 CA"A6 2C46 C6..@CB*2 A|;6 [C|XBbSC|E|.C|n|. .C|G|5..&.>.. *.@@| B0+n". @ Dg&A||| B*| B*|n|.@|F|n|n|P|<0 H@|BB0+n @| Dg k\g|@||| k\gp`B0+X)@(0+Z`p`|1JB4+XVL(`z@``p`P``+sS@||| +sU@| +sS@|+sS@|B*|B*`~B*|||p@P|3*|3 @|j.pFƀ|*r€-A|g* ,9;/Hx@KN/Hx N0+\ @gbR @gt @gv @gdBB|gԊE|C|n|B|: Dgp5@|Qj.v0F|QJz0ąB0+X @gbR @g^ @ g^|PA/<$<- BN*|X DgLpA@/< BN*|X k\f,p@/< BN 9:"L|&%:+\X&+T Eb Eb EgL|z``B*`2 @gl @ gf @f//< N4+XJPpP`B4+XJ` ĴTctnp4+XJ`xB`//< N4+XJPp0r`\//<@N4+XJPp/Fr0`@p`v @g @@fp~F`p@`tF`v?F`z`p`p` Eg E fL|zL`L|z0`L|L<L|0LCrl0| jR|TvFzop@|`PHx' BNX Df / N X .f&B*A:BPhhRVrf*|3B*|j|.t F@|2*|2@|*|r€Av|@|z@/ NHrp/<N t`B`NV`H 8$. grIMLJfG;h& @!K@$K 9;"%A<@%@@p%@H%|hN%@lr%ADp'@'|'JHkN/ N/ N4Hy:,/ N`h/Nb$H&H XJ;grHy+NDr XG" /Hy;l/N)0p%@%|%J/ NHy;NMBHy/ //9;N2fJg&Jg" 9; jr/Hy)UNDrPLPN^Nu/,OH8(n&n / N4XJg fE:,Hxp/ / N)009:H3:09:H3:09:H3:09:H3:0+Z:3:0+X:3: ,Gf / / NP/,T/,PNPB`0@p$@:@,Gg":fHy)V(NDrXpLN^NuHxp/ / N)00*^H5@^0*`H5@`0*bH5@b0*dH5@d `NVH?<(n "n4)&i<,g l@"c9|@"0, @@c9|@ BHxNT-H(0," ///,$EhN0," ///,(N nBCE;Kl"eP Bo C?bBR5|Bj5|Bj5| Bj 5|RC` @b\9| `R"D20F@=@P<)0F@=@h l b0XX=|=|BEBG Bn< Bn BgRC`V>)0F@=@h:)0F@=@hPP` Bg B f2A/ -HN42n.N5@2F.N5@2n.N5@2G.N5@2n.N5@ 2E.N5@ 2n`45A5n5F5n5G 5n 5E`F2n/ -A-HN4".2A.N5@2n.N5@2F.N5@2n.N5@2G.N5@ 2n.N5@ 2E.NX5@ n`4Bj5|Bj5|Bj 5| BjRC C?c/.NU& : :Hl/.N23: ,g8|E+Nq Bgn BgB Bc|E+Nq,gJlg:/.NX,gHl/.N2P,g  : :Hl/.N2PBL $n n (.".&."j*)@C;B01$ԅ|g\mxglUgL|N^NuYf,܁*ڂ y;Є2j"& $ԁԂԈ"ҁЀ/Hp/N)0 B""E"ҁ Bo22R`814jN& RB<1:&9;ЀЃoF21ҁЁ"ҁ///N)0 B""E"ҁ Co<22R`*B21ҁց`B61ւ4jN" RB81$y;B41ԂԊ"ҁЀ/Hr/N)0 B""C"ҁ Bo22R`&ւ y;Є2j"* $ԂԈ"ҁЀ/Hp/N)0 B""C"ҁ Bof22R`/,OJ;fpr#;N^Nup`/,O n!|!|,|!|Բx!|&!|6p!|$tN^Nu/,O/ n"9:| (Jf wg` g EgnB$N^Nu"(fB=+#=+#:| :|fn ("( fP#:hJ>sgp`"(Ste#=+r#:8r`"(Wfr#=+r`fx`#:l#=/` (=+g:8f #:h`=+f@#:l#=/`n# =+`l/,O . g/Hy)SNOHPpN^Nu/,O n 9:| wgF g Ef9:p:p@`B0p=+\-| @N^`TB0p`/,O n 9:| wgF g Ef 9:p:p@` pB9=+\-| @N^`TpB0p`/,O n((((N^Nu/,OH 0$n/ GN|| *B| *| *| */ NB*P S:Af6/ N|||B9:q/ NB*PPpL N^Nu/ N||*X f:qPp`/ NP|/ N*P fB9:qPp`/ NB*:qPXB`/,OH 8&n$k< 9:| wg fB2p/< @I-N/ NP E:|fXB*HxN N|HxN NB*HxN N|B*P || ||B |B* B* < w:|f <A||c"9:| wf|6*@B*|||!|||B*|||B*|||B*| B*| || B*| B*|B*|B*||g|||P|2|(|3B*|4| Ef|0||1B*|6||7||?B*B*B*B*|B*|B*|B*|B*||@|||||PB*@@Rrf*||*|B**||*|B**|B**|B*P/< @N|X E:|fB*pF@@@QB@Sd#=-=+T#=+=+X#=+=+D#=+=+H#=+=+L 9:| wg g EfB*** ` $f|7|p@H@#=//+@ENX ?b @=/f# =/`B2p`F|6|`B*pF"<0|"A w:|f"HC"A w:|f"HC"A w:|f"HCQB@Sd` k<"k@B E:|fj|6||!z|!{Bp|8Pp|!zB(!{|6| WID#:x/+<$n jJgH  b<"<d%A n h<(*,*F&(C$&B*9:| Efv@B(((R2@JAn/*/*ܒ/GN Jf(/*/* ֒/N Jf/*/*Ԓ/N L<|N^Nu"< wf"<҈"A < w:|f <9:qIBR2@JAn`>B`|NVH8<$n jJf BL<N^Nu  b"<d%A/*GHs/*IhN Jf/*& В//* N Jf/*( В//*N Jf| n h<$* (C*D E:|f&@BstuR2@JAn`0@B(<4|B39:qI& w:|f& ֈ"CB49:qI& w:|f& ֈ"CB59:qI& w:|f& ֈ"CR2@JAn`/,O n (+\G Gb0y,|I4 =B4 =B4.=B4.=BG=B0kn$gLRA$gLKN4.J=B4.J=BI| Eg k\f0|4B|B*| k\f0|4B|B*L+xTC,ARct f0p,/:B0p,0B>+nDg2|g4 2B>  4 G|4$ Dfv~ G|*4 gb^Jf|||G`DB0+X)@(0+Z`V`l~`0|`0|`2|`b~` gB*n|԰ne.SG|n|.G|n|. .B|A|B4 BB>4"B%B$.B$ .B$ .B$ .  $ @A| B4+n  @ Ef+sSB||| B*| +sA|B*|B*|+sSB`~||`2|||`|||``fA| k\gr||+sS k\gt`B| B*| B*|F|.0A|D|C|n|P|5B2+n$ 5A"t G|?6. 6.$ 6.%A| Eg~ k\g|@|rAP****2+\ AgZbV Ag Ag AfZ 9:trgmtd0+XH`8|`B*|r`B*`~ Ag~ A g Ag&*| EgrA*|2 k\frA|@|?*@ Ef / NX||/ NpXt`\Yf:|`0B*`(*@` 9:trg$mtd0+XH`:Yf|`B*`*@` 9:trgmte |`Yg0+XH`*@`p:te 9:tЀ0;N  B*`|`|`*`r:te 9:tЀ0;N $,$B*0+XH``|`|`*@`t:te 9:tЀ0;N  B*0+XH`|a`*@`r `r`NV`/ /$. grJf`E=+`$ @!J@%y:h<%y:l@p%@H%|JhNN%@lr%AD/ Nژ/ NtHy:/ N`./Nb$H XJ=+gHxHy=+dHhN)0 BHy؄/ //9=+N2fJg:4 9=/jr/Hy)VEDrN 9:|P wgf g EfHy)W`Hy)VNXHy)WN 9:xXg:SgBHy)W.NXp:te@ 9:tЀ0;N&FNV^Hy)W`Hy)WNX`Hy)W"`Hy)W4NXHy)VNX$.X$n\N^NuHy)WG`Hy)WZ`Hy)Wd`Hy)Wx`J9:4fHy)WNDr`/,O/$. Hy+NDrXJ:hgJ:lg-B$.N^`$.N^Nu/,OH 0$n&n / NXJgA)0 f$<:Hxp/ /N09:H3:09:H3:09:H3:09:H3:0+Z:3:0+X:3: *Gf // NP/*T/*PNPBL N^Nu@p$@:Hxp/ / N0*^H5@^0*`H5@`0*bH5@b0*dH5@d `p`/,O". n G:gb8 @G5gbb G,gp` G4g\bp @G8g @,G7fN^Nu pG-g`b G2g>p ,G6g` G3f-H N^`0=+41y=+6B`-H N^`l-H N^`B N^`h-H N^`-P N^`/,O/ /$n n". . St eЀ0;N0@Nf/9: / NPJfp`Hy:/ NPB$.$nN^Nu-H -J$.$nN^`F// NPJf*Gg/9: `p `-H-A -J$.$nN^``p`Nq/,O n"h"i`!I1it"1iv N^Nu/,O np [fN"h"i<0("HL(hШ`|@|"A|3r @1hb1hjN^Nu/,O npN^Nu/,O/ n".(frfrpgpDfDj$h"j<0h""L. A@|B)||||||$_N^Nupp`/,OH00 .". "ngsfp:gBN^Nu @^ID#:h !@fpCf#=0Jgp` )#:#=0`/,OH> $. AC M3c2L| B@/Hy)WEDrNHy)WNHy)WN$<}x@#:=0A:BB"|*f&Jg#=0Jg#=0 y=0 0L|N^Nu(TL<7r†TLAfBL<"jDo*" T&"Ar`x`/,O . g/Hy)SNOHPpN^Nu/,O/ / &n$k< y=0J:hgBpp!p y=0pJ:hf y=0|Nq|||8|H|9||f||fB*|| y=0p!p |B*||||||B*||| B*| *| @|B*|||*"9: G;o|@/N|A|@||||A|*"|@* @||B*|_||O||P||||T|||||||B*| |@| B*| B*| B*| B*|B*|B*||||||||P|B*|||||||P|@|!|1||2B*|3||4||:|5|;|Z|T||Z|@|f||:||6|B*B*|B*|B*|B*|B*||@|||||PXB*@@Rrf*||A*||*||*|B**|B*J:hf y=0|Nq y=0PpJ:hf$ y=0|NqJ:hf y=0|Nq y=0B(J:hf y=0|NqpFJ:hf y=0|Nq y=0@CJ:hf$ y=0|NqJ:hf y=0|Nq y=0ACJ:hf$ y=0|NqJ:hf y=0|Nq y=0ACJ:hf y=0|NqQZB@SdR|EB*|X|#@=0|X| y=0 0pNq g y=0!8p!p!p!8p!p!p!8p!p!p*|3B*/ EN'@'|/+@N'@ 'y=0P$n&nN^NuBh!| y=0|Nq`/,O/ $n  fPHxpHy:/ N)05y:Z\ 0*^H5@^0*`H5@`0*bH5@b0*dH5@dB$nN^NuJf 9:l:pL<mRS b&@p: @JgHxp// N)0`|p`/,O/ . "Ste(tpLJ0:pgL:#:lB$N^Nup`NV/ n h<|h|J _ID.t F‚@B$N^Nu/,O n h<|(N^NuNVH<8$n "*g Rb <d%@J:hf y=0|Nq  y=0@J:hf y=0|Nq(*: RG &I8$"y=0B)C )C )C R2@JAn//*/ GN Jf(/*/* ֒/N Jf/*/*Ԓ/N L+lUG|fj y=0 Dfp!p |f.rF@B0+pB2+X @A$L@(SB<+ZSF2+ng,N6.K=C6.K=C6.K=C6.K=CO*DfXgT@|EB*|UB*| Dg k\f*p@|B*| k\fp@|B*/+TNn|2IA|@|]B0 -@4 0.  5 .&[@ C|^B0B2-AB6.-C2.-A6.4 CA"A6 2C46 C6..@CB*2 A|;6 [C|XBb SC|E|.C|n|. .C|G|5..&.>.. *.@@| B0+n". @ Dg<A||| B*| B*|n|.@|F|n|n|P|<0 H@|BB0+n @| Dg k\g|@||| k\gp`B0+X)@(0+Z`p`.t!p |fAB4+XVL(`d@``p`P``+sS@||| +sU@| +sS@|+sS@|B*|B*`hB*|||p@J:hf y=0|Nq y=0PpJ:hf y=0|Nq|3*|3 @|j.|FƆ|*r€-A|g* 0+\ @gbX @gr @gt @gbpBJ:hg|й=0)@@|g׊E|C|n|B|: Dgfp5@|Qj.r0F|QJv0ăB/<K-N*|X DgpA@/<N*|X k\fp@/<NX Df / NX .g*|3B*|j|.| F@ y=0BPt`B*` @gZ @ gT @f4+XJprP`4+XJ` ĴTctnr4+XJp`zB`4+XJpr0`h4+XJBr/F`X y=0@Nq`dp`p`p`J:hf y=0|Nq y=0B(J:hf y=0|NqA:BJ:hf"y=0|Nq"y=0PC"y=0J:hf|NqJ:hf"y=0|Nq"y=0hC"y=0J:hf|NqJ:hf"y=0|Nq"y=0hCJ:hf"y=0|NqRVrfP`6NV`H00&. $gpĀHy+GDrNXJfE=0$ B!J@ 9=0$J:hg""@ @ %@@#=0#=0#=0#=0%A"<"@: @<`/,OH8(n&n / NXJg fE:Hxp/ / N)009:FH3:F09:HH3:H09:JH3:J09:LH3:L0+Z:Z3:^0+X:X3:\ ,Gf / / NP/,T/,PNPB`0@p$@:,Gg":lfHy)Y?NDrXpLN^NuHxp/ / N)00*^H5@^0*`H5@`0*bH5@b0*dH5@d `/,O . n G2g4b G,g6 G:gBpN^Nu pG-g( G3f-H N^`-H N^` N^`-H N^`X-P N^`/,O/ /$n n". . St eЀ0;N0P^v/9:l/ NPJf$p`"Hy:/ N/*T/*PNB$.$nN^Nu-H -J$.$nN^`// N,PJf*Gg/9:l/ NP`p `-H-A -J$.$nN^`p`/,O npN^Nu/,OH 0"n i$(@ h`#H3ht"0hv3H 0H Ѐ @=0#=0E=0B2)"6i m$BJ9:&g42) "mB9:&L N^Nu4R`0 R`242*R"$B2) "m`/,O np [f:"h"i<0("HL(hШ`|@|@1hb1hjN^Nu/,OH8 $. &."n . n h((@fXrgrDfDjE=0B02:A  @AB02:ЉЀ y=0ALN^Nurp`/,O//"n . &. i2)"HL҃ h@".L.$Jn&0i"$L @ Ѐ @=0Jn$&N^Nu0 XS`0 S`/,OH> $n n (.".&."j*)@C=0B01$ԅ|g\mxglUgL|N^NuYf,܁*ڂ y=0Є2j"& $ԁԂԈ"ҁЀ/Hp/N)0 B""E"ҁ Bo22R`814jN& RB<1:&9=0ЀЃoF21ҁЁ"ҁ///N)0 B""E"ҁ Co<22R`*B21ҁց`B61ւ4jN" RB81$y=0B41ԂԊ"ҁЀ/Hr/N)0 B""C"ҁ Bo22R`&ւ y=0Є2j"* $ԂԈ"ҁЀ/Hp/N)0 B""C"ҁ Bof22R`/,OJ=0fpr#=0N^Nup`/,O n!|!||!|nx!|!|p!|tN^Nu/,O . n h". Y1AX0N^Nu/,O n h . X1@0XN^Nu/,O . n h1n0N^Nu/,O n h1n0N^NuNV n hB0(-@ .N^Nu/,O n ( frpWIDN^Nu fr` wf W`B`/,O/ /$n n"h .BAJn$$_N^Nu42Z0ST`/,O//"n n&(֮ .B CJn$&N^Nu4Z3ST`/,OH0 "n .". n hog0(@BBB1@SR &BE(Jn,gJlBЀ2B10@B0L N^Nu4(ST`/,OH0 n ."."n"iog 0)SR &BE(Jn gJlBЀ2IL N^Nu4R1(ST`/,O/ . ". n hog0(@1@SR $"HJngJlBЀ0@0$N^NuBYS`/,OH 0$. &n/Nb$H 1| +X g wg f!|1|| +@%@$+%B%|%| |%| %| %| %| %|%|lBB +"tA"A@/ N %| ń%Jp%@X-JL N^`0v!|Bh|`<(n$n &n&.4*l*,,,8B0Њl08J m// / / h\NJ4F$l@ m// / / h\Ng( mHxHnB6Hr8/ h\N8RBB0ЊL<|N^NuNVH<8$n(n &.BDB*UJf@B4Jfpp6|(<` j"hHjBHx@// QNJg -|)Z` `B4%|@< j hB/*(/* hN j hHx/*/* hN j27A`B7|-JL<N^`NHx// y?t h `/,OH00$n . &n$B@ C#bF$ i2b$ i0b ig\/ // N$[ `2 Xifj0"SA. )f$/N/ / N&n BB@FL N^Nu/NX`/ // N# Jf2*00@@fJ@g/N.hj0`J@f /N.`/N.h/N.P`/ // N$[ r4fx`rNVH?<$n&j7|00+X7|28+4+\Z fb]BB6 @cZ:+/N?Bg/?Bg?Bg/Hy)[NDr7|60fHxHjN,PLd.8)G",///N)0ևG&&L `b/,OpѮN^`T/,O//&.B@ B#bF$/N.h/N.B@FP$.&.N^Nu/,OH?<&nIB@ C#bF$$k* * BDfB@FBLgH/N//Hy)[[KDrN| * /Hy)[pNHx/ N Df$| kBkF* gBDgz!KBj0*25|<**4*JB5| 0*Af4Bj0@45|Hx/ NkPG5F| 0*kSg 0*HBfgHx/ N*/ N4 / N/n0+@ B@FXp`t/ NX`Bj4* Bc8/+Nr jrā"Ҁ[IӨ$$( Հ!B /+N*P5|`* DfB4kBkF`0/,O/ / &n$S/N/Hy)[xHxNGNHx/ NX-J$n&nN^`>/,O n frWIDN^NuB`/,OH0 $n$. /*hN Btհ&0ׁ!X-jhL N^`NVH><$n*1g<&RJ+f2(jJg( ,%@fBBS *(g jJg2Hx/ /N ,+p"LBBB")o\ iAJfpgF `(Hx/ / y?t h `X*F: Srl"6(QҁrrfPp"QJfJg B. F0 B;bRBp;lxtjJg"h-A-@ -H"i$N^Np$N^Nu/,O/ .".t~Į p->jJg"h-A-@ -H"i $N^Np$N^Nu/,O/ .".t~Į p->jJg"h-A-@ -H"i4$N^Np$N^Nu/,Op~ p >j N^Nu/,O n fpШrTIDN^NuB`/,OB@ @#bF$N^Nu/,O .B@FN^NuNVH?<$n*g2$*N( *f*j|/ NhXJg~Ϊf&FI>k$L<(B@4( &t(+B+ jrFn*A~&>k4/ /HjhN Jo\rA(B( TҴ(B+(CR$R-B"A(tFĮ-BRE Cf nJfp-DL0&.(. FpmG>k$L<(E(J*gN"@zgX rƒ|gzgJfxȀ$ s(E(* B,*" g| LXEX D |g f|$3(/ NX L |N^NuF€$``t`NVH88&. (. r FtmA>k$L<EJ*gv(p* r~&p >j k/./ hNBB-D-C//NC/ N*g|BLN^Nup L(A(`p`NVH?<$."^-Azl~-GE>k$&L<8 r8(X(Yg<&CN\*@ r8(Z-K >j-@ Sf6CZ SDY/ N@X L<(@>k$mLj,, BA &FJg*gxJfpN-@+g4,B, ~ Ї*ڀ-@RRKDrSfA *r$€gD++Df Jm2r€%A jJg/ h,NX *g Jfzʀ%E/.N:XJ,g,f,|B,R`B ngZ frЅ @ f j/ /< h(NPR`<S E/B, /Hy)]N `J*kЅ @ j/ /`/B, /Hy)]"`/ NA`+g&~ Ї&*FB @R f,Ѝ @SA/Hy)]?NDrPfD`++fBB/*/*NCB,`NVH?<$. (n(.$n*p fFrmG>k$LjJg"m/././ // "i$NrfP/././ // Nhrf2 @tjg,bH tzgb txg tygLj/+(N("j&* r FPtmK>k$L<J5gJm k$Jg(f(u5 %H\%k(`%E@J(f.g BL<k$Lj&tlJfN&H/N)lBm>jX'|Al'|KZp'E'C'|O"tCHJgB.p LhKhB/.N/ B-|Hx/. n/(NBJf/ NX+fJf/ NXJ\f,'|+8p'@<'|K@'|D 9:)'@`'@\2H gkB2H gA2H gAHk8/ NKZ/ N&BHx-E-C//ICNFHgbrDgE(I+fJ+Bjh f'E'C/ N X"k-K-E-C-E-C "iLjB*Z&"L< A>k$ "@>j ЃrlJl^L<8B09>k2pL @>j!|E0 !B-Bp-@ -HL N^` F*V////Hy)^N <,<`J D BB|B B(BBRP`H/,OJ WIDN^NuNVH80$. &nHy+NDr/Nb$H /N&"k%I pf|$ <` <J*$f%@B)|B)B) |B) |||| |0|@||| |0|@||||%|Uh %Jp%@HjNMLEHx/ / N)0-|)^B DBHyQ/ /GCNRDBHyQ/ /N-|)^GCBHyQ/ /N L N^Nu/,OHy)^B n/(N)/`PJWIDN^Nu/,OH08&.$. (n/GbN$H /N&HHxHxHy)K/NDr, Ip威>rA(%H %H%K k%H g%H/ HyXHxNZ%H%|aH%B -Bp-@ -JL N^` z/,O//$.&.p /Hy;8N; hPJg "h-C-B -H"i$.&.N^Np$.&.N^Nu/,O//$.&.p /Hy;8N; hPJg "h-C-B -H"i $.&.N^Np$.&.N^Nu/,O//$.&.p /Hy;8N; hPJg "h-C-B -H"i4$.&.N^Np$.&.N^Nu/,Op /Hy;8N; h N^Nu/,O/ $np/Hy;8N;rªP h pJ g@p$nN^Nu@`/,OH0<&n$k* +#g/NЀ(@Xg|/Hy;8N;PC(*2IgZ*@A h$fRh& g|@`"( &T!C *A: fK(!M 2($RA1A$ Ac|`g~HlHy;8N;PC(*2IgZ*@A h$fRh& g|@`"( &T!C *A: fK(!M 2($RA1A$ Ac|`g@/ Hy;8N;"h ((P,fzp+#@#@ /(N_XgBHlHy;8N;"h ((P,fDp+#@#@ /(N_XJm0pL< N^Nu"R!A( @@`"R!A( @@`*/N//Hy)^LNDr`B`/,O n ,fpШrTIDN^NuB`/,O/ nB@F& (Df ft !BB@F$N^Nu/,OH88$np/Hy;8N;&HP*g(h&*B@F& *f$*|/ NhXJgr*fj*Agr  opF$ 0//HjhN Jo6rԀ'B,A1'H( kk0pƀ稀,#@# k @ B@FLN^Nup`/,O n h"h-HJg"i,N^NN^`/,OH<$. *.(.p/Hy;8N;rāvPpfB@F&"h )F`Fr…g"Dfp娀B@F&rgnrg\Jf"h @"h r婱AB@FBfLpƁg@vƒgr@ h B(grFLr g$hJfN$H'H/NX%|Wl%|\$p%C%B%|U t/ B-|Hx/./,NBJf/ NX*fJf/ NXJ\f,%|+8p%@<%|K@%|D 9:1%@`%@\+gjB+gA+gAHj8/ N\$/ N&BHx-C-B//IXN "z멀 @gbpDgI(K*fJ*Bjh f%C%B/ N X j-J-C-B-C-B "hL<<$./Hy;8N;$H&hB@P C#bF$I_( (K*<GNpFJj$gJgB@FL<|N^Nu *"T%A @B0//NB@F&Sj$PfA(%H<*&g*Bj&B@F/N?Bg/Hy)^mHx EN`zB@F`pJf~ j p@`n/,OH<0$./Hy;8N;$H&hPJg+f Jf(%H %HBj$L uB(N^Nu/,O/ 9>yD"tt}g B$.N^NugHy)^/.N2PJgJ:1xfp#:1x`NVH 8$. /Nb$HXJgHy+NDrX 9>u$%|)B-Jp-@E:1|GIC f,BNb y>u(@XLN^Nu-@-j-jBHyc8/ /N `/,O n . g /(//(Hy)^NOHpN^NuB`NqNVH8<$. &n/Nb$H&+XJg/0?:2Hy)^NDrP +а?:2$%|)B-Jx-DE:1vIKC"f L<N^Nu (+ g"-A-j-jBHydP/ /N`/,O n f (reJ:2VIDN^NuB`/,O n . g /(//(Hy)^NOHpN^NuB`Nq/,O n gfrWIDN^NuB`/,O nN^NuNVH <$. &n/Nb$HXJgHy+NDrX$%|)F0-Jp-@E:2IKC f0$kHjHydN*@PL<N^Nu-@-j *g 9:2-@BHyez/ /N `/,O n . g /(//(Hy)^NOHpN^NuB`/,OHy*h n/(N)/`PJWIDN^NuNVH08&. &n/Nb$H $+(S/+ /Hy)^NOH lHnBHx// PN$Jg Hy)^NK.//./ HjtN  +jV%@p/ N 5d 9:;$+ B Xo//Hy)^/NOb#:;%| *%J%k  HjNMLHy =Hy >$Hy =/NJfHy)_//NNzPL N^Nu/,O n fr WIDN^NuB`NVH88(. (nGHx/ / N)0 EDrp gv l0prF€-A$r@ā//Hy)_[N . gbbr@ge,r gr0g /Hy)_uNHy+N `&B`rpg gr`fHy+NXLN^Nu gb$ g fvHy+Np` g fxv Hy+Nr`DHy+NXtr-ABHyh/ /NC`xvp#:3Hy+NrXp-@BHyh/ /NCg8`vHy+Np`vHy+Nr`& CVHy+Ntă`& CN`Hy+NX`R/,O"n . g,AOH f/Hy)_NPpN^Nu/Hy)_`B`/,OHy)^ n/(N)/`PJWIDN^Nu/,O/ /$n/ N $ jhXJg/ NX $.$nN^Nu/,OH08$. &n/Nb$H &+(S!LD!kh/+ /Hy)_NOH lHjHBHx// PN$Jg-|)_ -BL N^`v/ N%|i^\%J`%k dXT-JL N^`Nq/,OB@ @#bF$N^Nu/,O .B@FN^Nu/,ON^`#/,OH0<$nJgJ*l(n *nN&&jlg$/Hy)_NDrP-CL< N^`0f7j@/ jN*BBB *Đѫ( +$Ђ'@$ *Đѫ0 *Đ∑,%B'B4X`|L< N^Nu/,OH88&n$klJ$gN(A,'H'H *4'@7j@JfH/*(IN%@0"*($< X&j(X&X$m$"*$l"%A4%A,-DLN^`tHs(NX"҂f `LN^Nu/,OH<0*..$nJf*<B@BIG- f,f4 n ///.Hy)_NDr L r f-JL N^`Hy)`NK."9>rtFP#>rBv$Āg >rRtf`/,O/ n$."h);f8/N/Hy)NDr pF-@ -|)a$.N^`v$.N^Nu/,O/ .$."n n bPrtEāf4t}F‚g8@"t"p$N^Nu`BBB`/,O/ /$n n"n "9:4 f .JnB$$_N^NuJmSkgS`/,O/ /$n n"n $9:4 f .Jn$$_N^NuJmSkfgS`/,OH <(n&n $nN$BBBFKl-K -JHx(BHx/ / N Ag g f, `f@-BL<N^`j//./. / No`/,OH8 &.$. g.E/N("< Xd"fցfBLN^Nup`/,OH08&n$n J:3g BL N^Nu *\gf"*Xf+g/+//Nr Jg| j@pL(@I Jff/<N#(Xg y;ʌ"j@$)@pL 3 Jgr//Hy)a;NDr `/,O/ . n B nTL<' n$(ԂLBtmpL$N^Nu/,OH0 n&."n B$nTL<'$"(ҁLAL@  9:4e // / /NsToRpe L N^NuB`NVH?<(n-lH-lL$lH&lL9|B,Y/,X// / / Njp@BBB& |Kl(<v* fS-J-KHxBHx/ / N C$HxBHx/./.N(Jf$, fPHy)a^NDrXpL,gf`|fB,`jf-J-KHxPBHx/ / NfHxTBHx/./.N C@HxWBHx/./.N$T CB((` lf ,fB,-J-K// / / NsB,XvL8A8@AlB|@B,XrLA(Ap(BB,B,B,X/N////Hy)aNDr(`.f`NVH><$n . &.-jH-jL(jH*jL&jlB Ob bjpF//Hy)bNDrN"/ jN //././ No.)b/././ NmJ*k>p` 7bҁ2;Nzz\,>zzzzzzzzz\,zzzzzzzzzzzzzzzzzzzzzzzzz\, bҁ2;NHBB B*Y/*X//././ Njp/9:4Hx/+ /./.Np(Jg$HxHk/+ /./.NpJfhp`B*X//././ NqP/ jN+gf/+8INXHg*/+8N$&+H/N///Hy)aNDr"+8B*XtL 2 /+rgJfB(By:4A j(;f*f J:4ffHxDBHx/./. NHxhBHx/./. N Bg*``BJfvB|5|/9:4/./. / NsT@y:4/9:4HxHx/./. Np$JgHxHjHx/./. Np8@`DfHxFBHx/./. N` jp!@drB`BNVH?<$n-jH-jL&jH*jL"jlI,%L%LB4BB,#n(#n $ PP*tB.B.IDr&<"*f:B*-K-M//// / / N~Jg*pLr//Hy)a;NDr `PB-XrL 5 ///N)0 `ZBm`rfn ?b`/,OH <&n$k\Jf L<N^Nu j h@"RpL(@03 "(Df *Jg#@"j"'JlrL(@p$(D威s %jD0(j'L*l@$,8 g / Nl~XPmCXmGYgB/*$/*(/* Hj/-D/-@/ N// NP`.'@``j$I`J:3f/ / NrXPJg/ / NfPJf pdfB+`/,O nJlfN^`N^Nu/,OH <&n$. (k*l@ m h/Nb$HBB`XJdfpgQft)BdlfxBlBrL-@p$-DF@r J\VIDB jT&g!K%KTAT'HpL-@R / NNXJg-JL<N^`$ S`f +Jg!@ k B`%@``"jdJfJgF"k!I"`޷f2 +Jg$!@ k rL-@p$-DF@r `%@h`"Q`/N/Hy)d6NDrN" `%KX`&L<N^Nu/,OH <&n$kHjH(kLKw/// N ftf ?bL<N^NuB`p`NVH><(n-lH-lL$lH&lL*<wKDr,<"(<l/// EN$ fBf&gV//Hy)dN SgpL<|N^Nug//Hy)dSN FN g`Sf-J-KHxy/9:4Hx/ / DN`D/,OH><$. (n n h/Nb&HXJf~&,@$,8 g Hy)dNK.xȂJlg JgHy)d`K݈N$kTJg R"*Jg!A j /NxX fp%@ %LtԊ/,T/,P/N)0%lT %lX(%l\$ ,X g /NX%@DJgN*@+(<*<bJlfv'JlP'L C (@@X"(DAY/*$/*(/* /|F́/rF€// DNlf// NP-ML<|N^`ܜ'AX`p!`$/ ENX`zN(@B k`%H 'J`Jlg-L`/ NtX`L<|N^Nu/,O nA#N^Nu/,O n"hP(@3|@N^Nu/,OH 0$n&jP.g0|5H*@7H@"j )"*$āg?BgF€//Hy)dNDr'|p0*g j"(tA7@h7|v 9:4Td%@ j (g/*Hy)eNDrP *L N^Nu0|`X'@p`/,OH8<$. *n/Nb$HI\& (-!DP DBh@X-#fBhh%|6%|%|V%|Bj* 9:4Pf "- <Dk <f <%@F/Hy)eGDrNP-#f *Fr@5@J:4Tf #:4T/- Hy)e"N/9:4THy)e,NpaЄ%@Hrc҄%AL 9:4HfppF-#fpH%@x LD//Hy)e8NHx8B/ G(N%B\p%@`r%Ah%@l%|Xt%|jdxHxB/N%L%|,\Bx%D%Dp%@ .Nn%| %Jr%AHjNMLBHy//NCL<N^Nu/,O n"hP0)@g(g/NXJVIDN^NuB`/,O nJhg."hPB@ A#bF$0)@@3@@3|xBhB@FN^Nu/,O/ /$n jP *аc$Hy)eQNDr/ NPB$.$nN^Nu0(@@1@@1|x1j@"j )!@p0*g"j")tA1@h1|v j Ѐ%@"9:4Td%A *`Nq/,O n"hP(@3| N^Nu/,O/ n"hP.g,p 1@(@3@ $h *#@ 3| ($_N^Nup`/,ON3JgHy)eo/.N2PJVIDN^Nu/,OH0<$. /Nb$HG\& y>rpDL9>rЈXb$"y;ʐ%IP3| 3|%|%|%|%|jBjBKCIDrc%MHG%ILHy)etNX 9:4fppF%@Hx8B/ I(N%B\p%@`p%@hp%@l%|Xt%|jdxHxB/N%K%|,\Bp%@%@p%@/ Nn%| %Jp%@HjNMLBHy//NCL< N^Nu h""f (#gD`A%IH%MLHy+`/,O/ n"hP0)2Ag6g,3|t(gg /NԀX $.N^NuB`B`NV nJhgJ"hPB@ @#bF$2(A"f3|2)=A2.g3|3|>BhB@FN^NuNV/ $n jP *аc Hy)eNDr/ NjPB$nN^Nu0*@"f1|0(=@0.g1|1|>1j "j )!@ 1| j Ѐ%@`Nq/,O n f (UrTIDN^NuB`/,O n"hP(@3|0BN^Nu/,O/ n"hP.g,p01@(@3@B$h *#@3| ($_N^Nup8`/,OH08$. /Nb$HG\& n (%@P @1| B1|%|~%|%|%|Bj*%|"%AH%@L 9:4XfpM%@/<Hy)eNDrHx8B/ I(N%B\p%@`r%Ah%@l%|Xt%|jdxHxB/N%K%|,\Bp%@%@r%A.Nn%|. %Jp%@HjNMLBHy//NCL N^Nu/,O/ n"hP0)@2Ag6g,3|t(gg /NԀX $.N^NuB`B`NV nJhgJ"hPB@ @#bF$2(Af3|2)@=A2.g3|3|BhB@FN^NuNV/ $n jP *аc Hy)eNDr/ NPB$nN^Nu0*@f1|0(@=@0.g1|1|1jB"j )!@1| j Ѐ%@`Nq/,ON^`/,O . n h@JfB`-HN^`rrg Qg r!Ad`B`p!@d`/,O .g0#:4>r#:4>rJo#:4#:4N^Nu 9:4`#>r:4#>r:4`/,OH 0$n*DADgHy*!/ NP/N/Hy)GDrNB@ B#bF$ j@ jHxN- jB jB jB j BB@FHxHy)eN*D L N^Nu/,OH8 $n(. j j$/N////Hy)eNDr*DDf@D-JLN^`LN^Nu/,O/ n$. "h);f8/N/Hy)NDr pF-@ -|)f$.N^`$.N^Nu/,OH 0$n". *Df jBgBgBfd jB j p j$< G- jg jBJg *DBL N^NuSgHxdNX`p`/,OH08$n&n&9:4 j j$. I-Jo jg j$Dk(B L N^NugSkHxN jX` j  j jf jS`/,OH<<$n$9:4(j(**j jB&n& ֮ *<- Jn L<dHx/././ N,JgHy*١/ NP`TJoHx/// N`JoB//`PbHxHjbHx/ N*D jfB*``&HxHj`Hx`/HxHy)fNDr `j/,OH88$n&n k@((@$+\&+XJ:4g.:////+T/+P// NRpLN^NuB*_/pF// N Jf,P`Pb(|> j` @gg<Ѐ04Nz@Hx/+P/+T/ N,JgHy+^l/ NP`^Jo m j@?@@@A@B@C@D@E@F@G@H@I@J@K@L@M@N@O@P@Q@R@S@T@U@V@W@X@Y@Z@[@\@]@^@_@`@a@b@c@d@e@f@g@h@i@j@k@l@m@n@o@p@q@r@s@t@u@v@w@x@y@z@{@|@}@~@`Dj*jgSj jBBL<N^NuDj*jgSj`/,OH 8 n&h$h$"h"h"h"h(B"n$ Ԯ 9:4"JnBH fSf"hB h`Dj(hgSj hBBLN^NuH Hf`/,OH<$n&n n"j,(j$*j*j*jB*j8B-l$G Jn, j8B jBBL<N^Nu,g0)00)1@0)1@0)1@0)1@0)1@ 0)1@ 0)1@0)1@0)1@0)1@0)1@0)1@0)1@0)1@0)1@0)1@ 0)1@"0)1@$0)1@&0)1@(0)1@*0)1@,0)1@.0)1@00)1@20)1@40)1@60)1@80)1@:0)1@<0)1@>0)1@@0)1@B0)1@D0)1@F0)1@H0)1@J0)1@L0)1@N0)1@P0)1@R0)1@T0)1@V0)1@X0)1@Z0)1@\0)1@^0)1@`0)1@b0)1@d0)1@f0)1@h0)1@j0)1@l0)1@n0)1@p0)1@r0)1@t0)1@v0)1@x0)1@z0)1@|0)1@`,g0)0`/,OH<"n&n n$i*i(i(i(i(i(Bp@m6G Jn i8B i iB iBBL<N^Nu(iB(ig(i(i(B5P5h5h5h5h5h 5h 5h5h5h5h5h5h5h5h 5h-`0(iB(ig(i(i(B05@-`/,O n"h$)g h4(pN^NuB`/,OH <$. /Nb$HIGP Hy+NDr n (%@%@ "T%AT%AT%AT%A%A 0| %H$%H(0| %H,%H00|%H4%H8 9:4Prf%|<%|@%| %Jp%@HjNML/ NHx8B/ K(N%Br%Ap%@$%A(%|0%|l4HxB/ N%LX%|,\PBr%A%Ap%@BHy/ /NCL<N^NuSfV%|<%|`@`B/,O/ n @f (r€t0g WID$N^NuB`p`/,OH<$n&n n"j,(j$*j*j*j8Bl*G JoT"9:4H HfV) `"9:4H Hf ) ) @) @) @) @) @) @) @) @) @ ) @ ) @ ) @ ) @ ) @) @) @) @) @) @) @) @) @) @) @) @) @) @) @) @) @) @) @ ) @!) @") @#) @$) @%) @&) @') @() @)) @*) @+) @,) @-) @.) @/) @0) @1) @2) @3) @4) @5) @6) @7) @8) @9) @:) @;) @<) @=) @>) @?) @@) @A) @B) @C) @D) @E) @F) @G) @H) @I) @J) @K) @L) @M) @N) @O) @P) @Q) @R) @S) @T) @U) @V) @W) @X) @Y) @Z) @[) @\) @]) @^) @_) @`) @a) @b) @c) @d) @e) @f) @g) @h) @i) @j) @k) @l) @m) @n) @o) @p) @q) @r) @s) @t) @u) @v) @w) @x) @y) @z) @{) @|) @}) @~) @`Dj*jgSj jBL<N^NuDj*jgSj`/,OH08 n&h$h$"h"h"h"h(B 9:4"n& ֮ "Jn>H fSf`Dj(hgSj hBL N^Nu$H HfA `/,O n"h$g h4pN^NuB`/,OH <$. /Nb$HIGP Hy+NDr n hC@%I%I CB%ICD%ICF%ICH%I%I CJ%I$%I(CL%I,%I0N%H4%H8Pp:5f%|<%|`@%| %Jp%@HjNML/ NHx8B/ K(N%Bp%@p%@$p%@(%|0%|l4HxB/ N%LX%|,\PBp%@%@p%@BHy/ /NCL<N^NuNq/,O n frWIDN^NuB`/,OH<$n&n n"j(j$*j*j*j*jB*j8Bn*G JoT"9:4H HfV)`"9:4H Hf ))@)@)@)@)@)@)@)@)@ )@ )@ )@ )@ )@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@ )@!)@")@#)@$)@%)@&)@')@()@))@*)@+)@,)@-)@.)@/)@0)@1)@2)@3)@4)@5)@6)@7)@8)@9)@:)@;)@<)@=)@>)@?)@@)@A)@B)@C)@D)@E)@F)@G)@H)@I)@J)@K)@L)@M)@N)@O)@P)@Q)@R)@S)@T)@U)@V)@W)@X)@Y)@Z)@[)@\)@])@^)@_)@`)@a)@b)@c)@d)@e)@f)@g)@h)@i)@j)@k)@l)@m)@n)@o)@p)@q)@r)@s)@t)@u)@v)@w)@x)@y)@z)@{)@|)@})@~)@`Dj*jgSj jBL<N^NuDj*jgSj`/,OH <$n&n n"j(j$*j*j*j*j*j(B 9:4r@mLG" Jn H fSf`Dj*jgSj jBL<N^Nu$H HfPhhhhhhhhh h h h h hhhhhhhhhhhhhhhhhhh h!h"h#h$h%h&h'h(h)h*h+h,h-h.h/h0h1h2h3h4h5h6h7h8h9h:h;h<h=h>@h`DjL*jg>Sk8H HfA`$`/,OH <$. /Nb$HIGP Hy+NDr n h R%@%@ C%IC%IC%IC %I%I C %I$%I(C %I,%I0%H4%H8%|<%|v@/ NHx8B/ K(N%Bp%@p%@$p%@(%|0%|l4HxB/ N%LX%|,\PBp%@%@p%@ BHy/ /NCL<N^Nu/,O n "frWIDN^NuB`/,OH 8 n&h$h$"h"h"hB"h8B"n$ Ԯ Jo0"9:4H Hf+`Dj(hgSj hBLN^Nu/,OH08 n&h$h$"h"h"h"h(B 9:4"n& ֮ "Jn>H fSf`Dj(hgSj hBL N^Nu$H HfA`/,OH <$. /Nb$HIGP Hy+NDr n (" %A%A " %A" %A" 0%A" @%A%A " P%A$%A(" `%A,%A0 p%@4%@8%|*<%|@%| %Jp%@HjNML/ NHx8B/ K(N%Br%Ap%@$%A(%|0%|l4HxB/ N%LX%|,\PBr%A%Ap%@$BHy/ /NCL<N^Nu/,O n"h$g "h4 hBpN^NuNq/,OB@ @#bF$N^Nu/,O .B@FN^Nu/,ON^`Z/,OH8 n ((( n/N////./Hy)fvNDrLN^NuNVH?<&n&. .*.$. (k$k4A09:5fJg Jf@5|P|LhCh(  DBpH@稂%A p%@$HjK-IN%@(%n,/.N%@0r%A4HjN%@8p%@rg4"9>rtFP#>rBv$Āg :5Rtf-JL*g8B*/N////Hy)gNDr// NƂ A8h h fpxЬ'@,`+8@8BLrgRgR"+$Ҁ%A*+(%EHx/ NP+k""+,+//Hy)gNDr +rrFfF ,P`Pg,v"n" jp!@dJ,g< ,0'@,`*Jg8 j h@$(@Df,r"n"J,g ,0'@,JVID`t`Jg +0 g +0 fJf/N/Hy)gNDr `Jgx +gr(*&+Jg4**\g,.*`,*/N//////Hy)hNDr Gn CHJl&0| %r%rJgA\B(*gP"* (eЅb>RPp fHy)hXKDrN//*/*Hy)h{NN"``J>\g%j`%j\Adp"҃ze"0>fB\`!p> RP`r f/N/Ng PvL(R) @,E l,$g8!J)J,A,%HB4 ,0'@,J$g2/ NX`$)J0` +0 fX$+4pĀ+ +@$l4JgF l$$gn!l4 l4)H$C$!I l4 h h@rL(@p&(DF@t LS&,,$CJf./N///Hy)hNDrHy)hNK.)l4(`2j Rf *Cg$H` *Jg!@ j )J4*,B*HjKN/Ng Hj N'@ j h@pL(@4  @ j h@pL(@4 @Hx/ NB+8@8`)@0`n +0 f^ l4Jf+8@8` h h@$(@Bp Ь4/N'@rL(A(h (@ ,'@,`( +0KDr f,<Jf/"FN/Hy)hN ( Hx/N+B*+ /"FN////Hy)iN.N/Ng pxЬ'@,P` +0 f:+ +/N///Hy)iIN+ gJgKDrDj Hy)iNXgHy)iNX`JfgHy)iNDrXC / /Hy)j KDr-IN*+$$+,/ A-HN,"n/ nN/////,Hy)j)N+ +$+ k0,/B*/*/*////pF/rF„/vFƮ/Hy)jSN,N"/ Nz"n"`6HxHj$< BNHxHj"BN+"+0/B*/*/*//Hy)iN$.Np"n"`NVH?<$n*n &j(mN$&,LL|8J,g/N/Hy)jNDr (<-*Y,<.<P+"gz++///// FNJg04gt/N/Hy)jNDr /./*4NRP ,<g-BL/,O nJ(m2"h)"g$)A@)@/NNXpN^NuB`/,OB@ @#bF$N^Nu/,O .B@FN^Nu/,ON^`NVH?<&n(. .,.$. (k$k8A0I:6fJg Jf@5|PzLXKXB-CBv穀"v穀%@ p%@$Hj&<-I CN%@(%n,/. CN%@0p%@4Hj CN%@8p%@(B<(@((/N/?Bg?Bg////Hy)n@NDr$-JLN^`/,OH0<&n$k+gHy*!/ / N /N/Hy)IDrNN &*@*@@*@BjB*@HxK-N*@*N@NHxN*L @L*N@N*L@L|k8|;BjBB*:+`@p"+5@HB*9| KHx0BHk$<("BN* g2*@g*/N< 9:6L</N0*Z@P @f2Hy)nNB+>BkB+BjB+@:XL< N^Nu0*Z@ @f.Hy)nNr'AXBA:6B0 :60Rrf**E//+/0 ,Hy)nN+fB(A('H,B0C0'I4B A 'H$B8(krg6"9>rtԁ#>rBv$Āg :6Rtf-JLx2`+8@8`FBJjJgP0 p€gRgRgRgR +$Ё%@*+(%EHx/ NP+k""+,+//Hy)gNDr +rrFfH ,P` g(v* jz!EdJ0g ,X'@,`Jg4 j h@$(@Df(p*J0g ,X'@,JVID`@t`Jg"+0 g"+0 fJf/N/Hy)gNDr `Jgx +gr(*&+Jg4**\g,.*`,*/N//////Hy)hNDr on C Jl&0| %r%rJgA\B("PJgP"* (eЉb>RPr fHy)hXKDrN//*/*Hy)h{NN"``J>\g%j`%j\Adp"҃ze"0>fB\`!p> RP`r f/N/Ng PvL(R) D,E l0$g8!J)J0A0%HB8 ,X'@,J(gv/ NX`h)J4`"+0 fX$+4pĀ+ +@"l8JgF l("gn!l8 l8)H(C(!I l8 h h@rL(@p&(DF@t PS&,0$CJf./N///Hy)hNDrHy)hNK.)l8,`B*! Rf *Cg$H` *Jg!@ j )J8*,B*HjKN/Ng Hj N'@ j h@pL(@4 @ j h@pL(@4 Hx/ NB+8@8`)@4`p"+0 f\ l8Jf+8@8` h h@$(@Bp Ь8/N'@rL(A(h( ,'@,`*"+0*<Dr fKJf/N/Hy)h EN ( Hx/N+B*+ /N////Hy)i"EN.N/Ng ,'@,P`"+0 f8>+Z+/N?Bg//Hy)iI EN+ gJng*<DrDj Hy)i ENXgHy)i"ENX`JnfgHy)iNDrXC / /Hy)oq$<Dr-I BN.+$,+,/ A-HN*"n/ nN/////,Hy)j)"BN+ +"k k0,/B*/*/*/// /?BgpF/rF®/Hy)o BN,N"`RHxHj$<"BNHxHj BN+"+0/B*/*/*//Hy)i"EN(/ Np*`NVH0 $nN$$*Bf-BL N^` j*2j BDf (0%@$B**g?@1jBj:Hn? Bg/// NJg fHy)oNDrX* gp j8JgB(//NP`Rp`NVH?<$n*n &j(mND$&,LL|8J0g/N/Hy)p NDr (<-*Y,<.<P+gv0k@+/?Bg/// FNJg08gt/N/Hy)p:NDr /./*8NP ,<g-BLr"9>r fB%|| j(@@ r€%A/NV 9>r"9>r$⪅h0|$䨁y:sp Ё#>r%| %Jr%AHjNML jj@%| @%|fDP-JL N^` /,OH?0$n j(@f$B*P/*Q/* /Hy)pNDrJfHy)qNDrXpL N^Nu jJf*@"j@@"jB)"jB"j)Ҁ)8tЁJf)t‚Ё| "*$J*!g &jn B*! jՐ j"PЉ BB`V"j&SR`*Pf BB`$* j&P&*tB*Q j,<Jg(pf| RSJg,Jg((j(B(B&fvƁf *reJg//Hy)q/NDr %CtEQDP j j Ђ %B jJf*Q`,B`jJgrf@"j)p€pl "K. ހ"JnJlB| `,A`B`/,OH8$n j`&jhJg h h@ (@Jgl j(B+/+///* j/Hy)qaIDrN j((//B+/Hy)qN(N"*@ j@@ jB( jBBBLN^Nu@`TNVH><$n*n ,.(n%M%n%F %@ j` hvƨ8gFr%AJf rlpJn BL<|N^Nu j"j"QA jS jRSS` K>uo"9:6gd%A*/GN(" *$< Xd$B*!B*@ j@@ jB( jBJfxpeD *e&r%A%A j j *ѐ(B`( j"EqhnR`r…g(p"Ҁ j"E* Ff؀`fg/*N(X c$<|!%B(%Dp9f.J*!g j8R f//*NP jB( Ъ @ *Jgp@ j@@p%@`6 *reH/*N(|!Xd\"҂/NX"҄fH *" c  $`r€%ApĀ`/ j/`Lp `x/,O n"h`"i);g p!@N^NuJf(Jgp@ h@@`p `/,O . Ѐ nШ @N^Nu/,O . Ѐ nШ @N^Nu/,O n h(N^Nu/,O nBN^Nu/,ON^Nu/,O n (N^Nu/,O/ $n !@g B$nN^Nup fN4Jg$jHrpNLXJfB2ppHxN-2pX WID`/,OH 0$. &n/Nb$H !|:70@"+ !@!!Ar(!A/Hy)pNOHp%@5|HH|8J%@ <Lj%@/NV 9>r"y>r"$ 䩃hA"$䩃y:s #>r"  fB%|%| %Jt%BHjNML%| @%|fDX-JL N^`/,OH8 $nJfHy)qNDrXpLN^Nu j(Ё(rԀJf(rԀ|&*(J*(g j /Hj/N)0B*( jِ j Ђ BB`r/,OH><$n&n (.,.*n%K%D%F"%A K>uo 9:7,gd%@*/IN$" *&< Xd&B*(pJfJgRS j"E@R:7$d Ѓ/NX"҃g Df%C*%Bp9fAJ*(gHxHjNPJf j r@ j r j  jp%@BL<|N^NuJg^HjN$X c&<%C|(`8 *" c  R:7&`R:7 `2/"j/`P/,ON^NuNq/,O . nШ @N^Nu/,O . nШ @N^Nu/,O n h(N^Nu/,O nBN^Nu/,ON^Nu/,O n (N^Nu/,O/ $n !@g B$nN^Nu *r grfN4Jg$jHrpNLXJfB2p p HxN-2p X WID`/,OH 0$. &n/Nb$H !|:7@"+ !@!Ar(!A/Hy)pNOHp%@5|HH|8J%@ <Lj%@/NV 9>r"y>r"$ 䩃hA"$䩃y:s #>r"  fB%|%| %Jt%BHjNML%| @%|fDX-JL N^`"/,OH8 $nJfHy)qNDrXpLN^Nu j(Ё(8rԀJf(rԀ| &*(J*(g j /Hj/N)0B*( jِ j Ђ BB`r/,OH><$n&n (.,.*n%K%D%F"%A K>uo 9:7gd%@*/IN$" *&< Xd&B*(pJfJgRS j"E@R:7d Ѓ/NX"҃g Df%C*%Bp9fAJ*(gHxHjNPJf j rp j j r j  jp%@BL<|N^NuJgTHjN$X c&<%C|(`. *" c  R:7&`R:7`(/"j/`F/,ON^Nu/,O . nШ @N^Nu/,O . nШ @N^Nu/,O"n i(j )|f B(pN^Nu|`B`/,O nBN^Nu/,ON^Nu/,O n (N^Nu/,O/ n !@g B$nN^Nupf$hHrpNLXJfB2p p HxN-2p X WID`/,OH 0$. &n/Nb$H !|:8@"+ !@!Ar(!A/Hy)pNOHp%@5|HH|8J%@ <Lj%@/NV 9>r"y>r"$ 䩃hA"$䩃y:s #>r"  fB%| j|%| %Jt%BHjNML%| @%|fDX-JL N^`/,OH8 $nJfHy)qNDrXpLN^Nu j(Ё(8rԀJf(rԀ| &*(J*(g j /Hj/N)0B*( jِ j Ђ BB`r/,OH><$n&n (.,.*n%K%D%F"%A K>uo 9:7gd%@*/IN$" *&< Xd&B*(pJfJgRS j"E@R:7d Ѓ/NX"҃g Df%C*%Bp9fAJ*(gHxHjNPJf jB j @ j r@ jpr%ABL<|N^NuJg\HjN$X c&<%C|(`6 *" c  R:7&`R:7`0/"j/`N/,ON^Nu/,O . nШ @N^Nu/,O . nШ @N^Nu/,O n"h)j.(' (|f@'@ h(N^Nu`B`/,O nBN^Nu/,ON^Nu/,O n (N^Nu/,O/ n !@g B$nN^Nu"hEpep f  @c$hHrpNLXJfB2p p HxN-2p X WID`/,OH 0$. &n/Nb$H !|:8h@"+ !@!Ar(!A/Hy)pNOHp%@5|HH|8J%@ <Lj%@/NV 9>r"y>r"$ 䩃hA"$䩃y:s #>r"  fB%|%| %Jt%BHjNML%| @%|fDX-JL N^`/,OH8 $nJfHy)qNDrXpLN^Nu j(Ё(8rԀJf(rԀ| &*(J*(g j /Hj/N)0B*( jِ j Ђ BB`r/,OH><$n&n (.,.*n%K%D%F"%A K>uo 9:8dgd%@*/IN$" *&< Xd&B*(pJfJgRS j"E@R:8\d Ѓ/NX"҃g Df%C*%Bp9fAJ*(gHxHjNPJgrā j r j r@ j @ jBJg*'@' j@p%@BL<|N^NuJg>HjN$X c&<%C|(` *" c  R:8T&`R:8X`/"j/`0p`8*'@`j/,ON^Nu/,O . nШ @N^Nu/,O . nШ @N^Nu/,O"n i(j )|f |@pN^NuB(@`B`/,O nBN^Nu/,ON^Nu/,O n (N^Nu/,O/ n !@g B$nN^Nupf$hHrpNLXJfB2p#p#HxN-2p#X WID`/,OH 0$. &n/Nb$H !|:8@"+ !@!Ar(!A/Hy)pNOHp%@5|HH|8J%@ <Lj%@/NV 9>r"y>r"$ 䩃hA"$䩃y:s #>r"  fB%|%| %Jt%BHjNML%| @%|fDX-JL N^`|/,OH8 $nJfHy)rNDrXpLN^Nu j(Ё(8rԀJf(rԀ| &*(J*(g j /Hj/N)0B*( jِ j Ђ BB`r/,OH><$n&n (.,.*n%K%D%F"%A K>uo 9:8gd%@*/IN$" *&< Xd&B*(pJfJgRS j"E@R:8Ķd Ѓ/NX"҃g Df%C*%Bp9fAJ*(gHxHjNPJgrā j r j r@ j @ jB p%@BL<|N^NuJgZHjN$X c&<%C|(`4 *" c  R:8&`R:8`./"j/`Lp`T/,ON^Nu/,O n {f (rgr WIDN^NuB`p`/,O n"h$g h4pN^NuB`/,OH <$. /Nb$HIGPHy+NDr n ("P$%A%A "P%A"P %A"P0%A"P@%A%A "PP%A$%A("P`%A,%A0Pp%@4%@8%|~ %Jp%@HjNML/ NHx8B/ K(N%Br%Ap%@$%A(%|0%|l4HxB/ N%LX%|,\PBr%A%Ap%@$BHy/ /NCL<N^NuNq/,O/ 9>yD"tt}g B$.N^NugHy)r./.N2PJgJ:9Pfp#:9P`/,OH <$. /Nb$HI$G\Hy+NDr$ 9>u%@5|2|/ HyNBNZ%HHx8B/ K(N%B$p%@(p%@0p%@4%|4<%|@ HxB/ N%Ld%|,\\Bp%@%@p%@/ N#>r y>u y>uBHy/ /NC L<N^Nu/,O y>rJ(mD"h)"g6)A@)@BB):("y>u/(N_XN^NuNq/,OH0 $nBB/* RN娆RXpfL N^Nu/,OH0 $n&. tp//* jNSPfL N^Nu/,O n(fB((f(rN^Nu/,O n(fJ gB(N^NuB(`/,O nB(N^Nu/,OpN^Nu/,OH88&n n/Nb$H/( h N$ XHx/E0NHx/NHx/N Hx/N/IN/N/N$@/Nr/NrA 0 ?'HBL<8B@'CBLN^Nu/,O/ 9>yD"tt}g B$.N^NugHy)r3/.N2PJgJ:9fp#:9`NVH?0&. /Nb$H !|!|.!|T y>u%HB(( XHx3/N BG/N(RXpfB.B.B.B."~ ~Ҁ ЁЂ#?t/B.////./././/Hy)r9NDr%C%|n(%|d,(-JL N^`NqNVH? *. (.&p |eHy>rN y>rXJg ( "($|~f Hy)rvNK.,.fHy)r`E>rJ=>rf$Hp)>r-@-A//.N!z$ g(Hy)rNDrXHy>rN6X LN^NuHx/2<N"!N9|//./2<N"{ $/2<N"`B`t`/,O// . $r pe|Hy>rNXJ>rgb&0->rB->rHx/N"!N9|//./N"{n$/N"/N" Hy>rN6X $.&.N^NuB`t`NVH0<&n*n(n&+p*BNRd$ 9>r-@$n y>rJgZ"p JfHJgp(gr-@ .XG6f*Hy?8NXHnHnBHnNJfV$.`D/B-|Hx/./*NB$-@fB .#>rHy?8NX L N^Nu/ /././". .-@-A//N~$/.N`NV/-n-n HnHnBHnNHJg:/./.". .-@-A//N$/.N $.N^Nut`NV/-n-n HnHnBHnNJf$. $.N^Nu/.". .-@-A//NX$/.NF`/,O .g Sg pN^NuBHxHy>rN{4 B`Hy>rN{VX`/,O#>rN^Nu/,O/ /J>rg>B@F'E( y>r/($/( hNPJmB@F$.$nN^NuN`B`/,O/$. y>rJg@Jg

r//($/( h N $.N^Nu/,O/$.J>rg 9:9Jg JgR:9` S#:9g$.N^NuNv4 y>r//($/( hN Jf$.N^`[Z/,OH<<*.HxG!NX$EBI KDrN$pgTm(p gtp gnQf:JgSSHy)rNDrX`p@g$pgp#g(R lpmHy)r`Hy+NX$EB`/Hy+NDrP&`|Hy+NDrBBN L<rJg""hJg/./. /./($/( NN^Nu/,O y>rJg"hJg /($/( NPN^Nu/,O y>rJg"hJg /($/( NPN^Nu/,O/ / G::hE SJf.Jg&y>r/ jNX>rf#>r$n&nN^Nu/ N +(Xo Jg(o$K0`/,O 9>r䐮gS#>r䰹>rd Hy)rNK. @N^Nu/,O".J:9g y>s Jg >rd -AN^`=#>s N^NuNVH?<"n .". n(! p>r!p>r!p>r!p>yD!p>r!p?t!p>s!$p>sg tp94tāg 7B!p>y`DjBp9 ! p>rJf <?x&H>r"0&&>r(X!p>rzDL"@E!p>rC"p LE-JSte*H:9JgvX" Ҁcl0)@ @f  g$H>s Щ$"L<*H>r!p>r$;ʈx (B( )"d ( *$H;ʀB(C"T(Jf .@$. Ԯ-B!p>{"n C @" @&H9-Ktf|"H>}$"&H>} -K&t І҆!p>} *A &.z-C&H;ʈ-K*t}fxv t ԓڂt ڰp:;$v Ђԍ-B!p>}&ց. tA-Qt&nf$.܂b($&B,چ-E$ z etԋ(Q-L*ڌ-EGz , -E,.ؼe-Q* Wbzڮ| ڮ&n'E*| &E| *چ fTx!p>{$e$Wb6|$ ԃvă&A$btA&A'Bt &MB"< &ւ )BXeCtx(nfD(:9(DJgt!&ց(n첔etƂz@$ԁb|Ć(DJgv &ցbe"x G(H>s z}f*H>u*,!p>sJf"@!p;ʄ$ "<A*B*X@ Af'|A  JfВ".| !p>y@! p?p".!p?Z!p>{!p:;!p:;! p>s!p>sJgp$nfJ. jNz@N{"Q IN{Lr$ rA*B*X Af Jfv(H>s(&AK'|A&H;ʐ(@!p;ʐ"<A* Af @!p;ʄ*!p>y`($!p;ʌ*n"t Ҁ!p;ʄtp>r"eЁv}fR`& `&@$ $@ e`.B`:;H`D/,OH< /9>s/9>sNQNi@ y>sC#>s #>s 9>y#>y$9>yD&rPx}fg"9>u*R#>u( #>u@#>u@#>u#>u"9>rӹ>rӹ>rJ>s g(9;ʌ"9;ʈz ҄#>s #>rr}f8g0 y>uB y>uB y>uB y>s | y>s| y>u(@ y>u(@ y>uB y>uB y>u(@ y>uN3Jg y;ʐ y>rpDL9>rЈc$ h!@f( dg nfx#9"9>yDJk~Dk~p\FDgpF#9Lr"#>r`$@5|5|5|| | rҀ#>r#>r`*D`Rp `pL`/,OB@F' y>y <1n SfB@FN^Nu/,OpN^NuNq/,OBN^Nu/,OpN^Nu/,O//p#>s 9>yD"tv}f<g6 y>uB@F'BHy)s"NDPJfHy)rNK. y>y1|@` 9>yD"vv}f&g y>uB@F$.&.N^Nu y>y1|1|`NVH?sfVI:9J?tgzLsfJ?tf"n#,?t#?tR`Hy)sNDrX`B&<;G;b.<K\`$(S,<-$.<,Jl \Jf` l &h g/N/NP$HPJg hdJg gK,,gK,f*G-$f*F,fK,/ N\" T&x xF*[IĀ&Hy:BHx-D-C// UNJfDHy:BHx-D-C// mN jJg (f#?tB?t`pS`/,OH8 &.(. /E)/sg(//.// NCJVID L yD"vv}ffBBHy)N'B/NBBHy)ZB/NL N^Nu/,O . g//.Hy)s*NOH pN^Nu/,O//0y>yD g\Jf~ >ro^$9>r&9>rBA2An y:9`B0D"C0) @g @@g2RA`) igb b0|` g f $&N^Nu )f`A`/,O/"9>yD t gL gHtt}fJf: y>y0(| WID$N^Nu y>y2(| g Jf 9:9`p`B`/,O y>yDWIDN^Nu/,O yX>yDWIDN^Nu/,OH8<$. Hy+NDrBHy.Hy*R/ECNK3NG4JgBHy.Hy)J/N 9>yD"vx}fgBHy.Hy)r3/NBHy.Hy,/NBHy.Hy)r./NBHy.Hy)^/N NI4&<5JfNJf CNJgBHy.Hy)s@/NNJgBHy.Hy)kW/NNJgBHy.Hy)eo/N CNJfNJg2BHy.Hy)sD/NNJgBHy.Hy)sK/N 9>yD"xx}ffBHy.Hy)sR/N CNJf2NJf,NJf&NJf N JgBHy.Hy)/NBHy.Hy)Z/NL<N^NuNJfB 9>yD"vx}ff>BHy.Hy)J`$BHy.Hy,/NBHy.Hy)K/NBHy.Hy,/NBHy.Hy, /NBHy.Hy)N'/NBHy.Hy)s3/NBHy.Hy)K/N`/,ON^Nu/,ON^Nu/,O/ E::JfE::4f$nN^Nu". €g / jNXP`/,O y>s ( /BN7PN^Nu/,O y>s( /HxN7PN^NuNq/,OH <$. (n*n&n npf/+(N!$H!L(!B,B8ByD"tt}ffNaN3,N#P 9?t/Hy?x?/N. 9?_ g $.N^`$.N^NuNVH0 9>yD"tt}fg/Hy)u HxtԎ/NE 9>yDJjNz& <)tf <*Ѱ//Hy)uHxE/ NE#:;(f9:;f9>yGgrA)t <)t#9///9:;(/Hy)u:NjrNj/Hy+NDrL N^NuN4$<)toJf6N3$<)tzJf$N4$<)tJfN5$<)tJg$<)t`Dj#)u%:;(`PDf0#)u,:;(A)t 9>yDfJr€fL <)t`*#)u3:;(A)t`BA)t <)t`BA)t <)t`r <)t`r <)t`/,OJ:;lB:;N^`6N^Nu/,OH 0$<>sXHx(B/N(Hy:; /N)/L# >shB>sl#9>spp#>st#>sxr#>s|#>st#>s#>sp#>s#>sr #>s#>st#>sp#>s#>s y,# >s 9?p#>s#?x>s"9?Z#:;#>sB>s t #>sB>s y>rC $BgH)f R`t L (t Ё#:;B>sB>s#>sB>sG;L/E;H/NPJf#;H#;LL N^Nu//N\PJo( y:; "t t $9:;o#:;pй:; tl#:; `Jfr r ⢐#:; `p`/,O .#>yPN^NuNVH?< 9;H"9;Ltvgh-@-A//N*HPJgNJgHJ:;fND` y:; G;L "v  EDrJn//Hy)uJN LsXHx(/ HnN)0 9:;| -@-y>s&9:; [I*m//-B-C//.//NBzڃق-D-E0BB,.ܼdJg0ADrrgmTtg]gVHy)uNDr`N$.f z/Hy)ND6P" crHAJf( Bv׮(.ق-D-| $.ԁHx//./9>yP-ANN".//9>yP-n-n/././/N(".Jf-B$z -BB$.&.׮(.ق-D-n[I-E("D$1`&1d*2HhֲHlՅ(.*.蚃eR$-r(d$*2(h(lgӮ`xfHy)u`Hy)uN.+NDr/<LK@N-P`~Hy)u`Hy)u`/,O/ y:, ( g /N*X#?_. gB@F'. gNF~ .g$Hy)uNQXJg/Nb.NX. g8Hy+EDrN.)uN.)vNp.E!NXN BNXHy)uNDr.B@N-XN+NDB`R/,O/ 9>yDJj8g9:;g p>yD"9:; N{#!<9#!9 #-9#-9,#-9#. 9#9#9#9#9#9# 9## 9pp>yDf#"9,Hy)vANDrX 9>yD"tt}fPgF bf"<% <$<#9d#9h#%9l#%9p#%9t#%9x$.N^NuDjp#!9#!9 `X"<$ <%`NV/ /HxHx/9>yH/9>yL/9,NFHx /9>yLNBBBB/<HnHn/9:LN#:;,8NVNB^ y>r Srd>NJv$.$nN^Nup L/(/(/Hy)vfNR y>rдe`BEDr`/,O . /."//Hy)vNDrHy)vNK.NVA#>sPHnN&XJf n2B>sPN^Nup`NVA#>sPHnN&XJf nB>sPN^Nup`/,O/ n (UC>s@re"p ,ư f:B" 9>yD"tt}f4g. (rg]f y>u$N^Nu"@` y>u`0<rf0< y>y1@`/,O//"n )UA>s@re p ,ư gf )vf A>sD` @`vm>rgFvgHJf""9>yD$vv}fRgLrg.]g6$.&.N^NurfA>s@`A>sL`A>sH` y>u` y>u`]f0< y>y1@`p`Hy)vNK./,OH< &.C"9>yD(tz}f6g0tf y>uJB y>u(DjNc` y>y4(SzejЀ0;NfR(4 E>s@$RJg/* jNXJg y>u`xE>sD$RJgl/* jNXJg`ZE>sL$RJf\N84`dp}ffVgNigBN y>y1|XDf y>y1|LyD"tz}fg y>u` y>y1|`gN^gN_gLyD"tz}fgL0(.$9>y@p #>yH# ?NNH"v B////GN$y>rz LXڊJ>y`gb 9?Zr #>{#>{#>{#>{$9>{#>y\& #>yX,@#>yT `#>yLNf` BHppNFf#>{XL |N^Nu* gh& *e"ҀeVJgR$Ԁ 9>rఃed$"| SID/ ////N ѹ?Zp>y`g `Nq/,ON^Nu/,OH80$n&. (.&j *R%@ R (L$*P  *S%@ *g BN{XJg / NPX+Wg( +䐄L9?_-@-C -JL N^`L N^NuNV n -n-nB0(Fr㨀hH-@ N^`@/,O 9:;4"R#:;4Jf*/./. /.Hy)wNDrHx/.NVpFAK.:;\d /0 :;`NHy)x\`/,O n "n"i J1p :;<BBhJ1i<F1i>H N^Nu/,OH? $.&. *.$n,.x`ȃpƀr@f R" bLWgh  y9rfJyDrf:gJdgJgg*9:LR-@t".A-Ap GByGkp9fJfJ*WjHy)wB`Dp9f*p[g2*p9fF  VD`L  f*9:L`*9:LJg`"*`*`gp?Fr@g r-At` r`0*TJjL>G Gg@//*d/*h?BgHxNSJfB0*TCg/ /.//NS>0*RJkB:Lf*Qgb-nlx-nh|/.h/.lB0*Fr㨀jH// N8`0>G Gfr.9:L//*\/*`?BgHxNSJgpfJdf//.t/.p/Hy)wbGDrN/HxHy)wN././Hx`4.`Jg8rg'n p grgp fj ,g/N4X/Hm/-`Hy)wNDrr 'A/ / NBpPJjB`".p Fe// NP`'n p '@r`&// / NS L<wL&9>wH׀#>wHHxtBHjN(p$rF‚%A$ ,Df6vF&-(-'L$pf$/ HxNPJgL GJydB@F +g,r€'A$k j(/($/( / NP j(B$ -Cx-D|//B0,Fv稀lH// N`H-Cx-D|/// / ///NV`$Nq/,O .B@FN^Nu/,O n0( f @1@ `N^Nu/,O nh N^Nu/,O/ / nB@F#$y>y&JCJfJf `$2+hl(Jf* g%H#>y!|>y-@$_&_N^`b"K&S`$Q g%H"!I`/,O nB@F#"PJg#h"h"-@N^`/,O/ $y>yJf y>y1| $nN^Nu0* g@@5@ $R`/* j NX`/,OB>y y>y1| N^Nu/,ON^Nu/,O y>y0(2(AAN^Nu/,O/ E^nNJf$nN^Nu/,O y>y1|@N^Nu/,O y>y1n XN^Nu/,O . y>y1n @1@BN^Nu/,O"n ". . y>y1n d1Ib1A`1@fN^Nu/,O . y>y1n D1@FN^Nu/,O". . y>y1n t1Ar1@pN^Nu/,O y>y!nP!n L!nH!nTN^Nu/,O y>y0(Cg0(Cf0(jN^Nu/,O2. n  f A N^NuPgX`/,O/ E_zNN y>y!n$nN^Nu/,ON^Nu/,O y>y1|N^Nu/,O y>y1|A>y|pBPBhBSPfN^Nu/,OH8 y>y2(p1@f 1|0(r@1@LN^NuC>y|Bx"6($ăg64JJCgSC21BRPrf`1A1B ifBi`/,OH> 8. :.<.6.CA>y~BB2gJPfd0RPtf"y>y3CE>y|B g A1D!n 1E04RPpfA3AC3CL|N^Nu/,O/ /B@F' 9>r䐹>r"#>y @HhN#!y>yBC>y#>y"!IBC>yE#>y"!I /N>P$.$nN^Nu/,ONanN^LN^`/,OH00".g&B@F'gp€X$y>yJf/NXA L N^NucV$j`#>y`hvր%CG'A R&g*!K$'J|pй>y#>y/NA`H#>y` *Cnve j * Jg!@ j |&*>y/NAX`T/,OH 8 nJgB@F'G"h$h$j$RJ)fj!i !I(i (I#L B((Q )Jg)@(i((iJg)i (i ((hpй>yЌ#>y!L(J*fpй>yJgPШ#>y"h (Jgb#@"h"pШѪ-ALN^`D#>y`h# >y`r&h"hJg'I "h"|`#>y`#>y`JgJgJf"EJfB"y>y!I"#>y`J)f*!i !I$i $E#J B( (ѹ>y`PJ*f&"j!IIg#L %KP!J`#>y`$j$j$R"Q`lC>y(Q!Lg )J "!I`#>y`LN^Nu/,O nJg (N^NuB`/,O/Jf$9>y $.N^NuB@F' y>yBJf /NX` (c$ h`Nq/,O 99 rg"rgSg$N^Nu <9$N{``/,O 99 rg"rg Sg4N^Nu <90N{``Nz@N{`/,O 99 rg"rg Sg4N^Nu <90N{``Nz N{`/,O/ 99 rgWg"<1N{$N^Nu`/,ON^`/,O 99 rgWgN^Nux`/,ON^`/,ON^`/,O/ 99 rgWg"<9N{$N^Nux`/,O n 99 rg"rg.Sg<N^Nu <98N{`pN{pN{`pN{pN{Nz@N{`/,O n 99 rgWgN^Nuh`Nq/,O/ n". "npf"$_N^Nupf2`REf`B`/,OH>8 n(. (n& Є cGf)BXepf L|N^Nu*$ Bd$ r $y>},f-C -|)xL|N^`|pr@$/NXB"Jn$JlBւ$/NXJfL|N^` CR`rf0`XRCf`FB`Nq /A:;!@$L <9N{Nu oX NuNz N{ /N{Nu o N{ N{ N{ N{NuNq/,O"y>}TN^NNVBHn .r /N/NpL. P N^Nu/,OB@ @#bF$N^Nu/,O .B@FN^Nu/,OB>}4p#>}8#>}H#>}DB>}}LB>}@B>}P#>}$>}d#>} >}\#>}>}Xp9f #>{>}`p#>}lHx@B/9>{N(/9>{Hy:NL#::,#:9N^Nu/,O n >{ n >{N^Nu/,O n!y>}!y>} p9f!y>{p!@N^Nu/,O/HxHy>zN$Hx$B/N(/Nj B $.N^Nu/,OpѮN^`%/,O n h h0 P>}Xg -h N^`$N^Nu/,ON^Nu/,OH88".&֮ E>}XGfb LN^Nu"y>}\p9f^  @Jgn d $x$1,g.B>}dAԄ1,g$ x (R b,"`  @ Jgd $x` `( LX(gS>}tS>}pB/NX `/,O"n . r Q g @ SN^Nu/,O/ / n". $n"hp9fR t 1 gJ@ !Ђ1 g2 t P 0 g$Jg@$p$$_N^Nu t`B`NVHn/.Hy>}XNk Jg .N^Nup`/,ON^Nu/,O .r9g*r y>{ /9>y\NfX-y>y\N^`Zr!`/,O/ / .$. r9gPrr y>{ /9>y\EfN y>{ /9>yXNP-y>yX -y>y\$.$nN^`Yr%r!`/,O .r N^Nu/,OH8 $. /.N$HN6*"ƒXJAg/NXpLN^NuJg JJf /NXB`"h"(x "Q"1‚gB5C` P`/,O/.NTHx/NmPN^Nu/,O/.NTHx/NmPN^Nu/,OH?8(n(. &./ N$HN,0*$FĀXJBVDC5@Jg ~GfJf/NLN^Nu"* j z "P* gPJg"t9fzg t`Ąft`ăf LpB" * >}Xg y:, h h0f/NXt$R`vNVH?<"9>}X 9>y\t Ё#>{ 9>yXҀ#>{B>{KN$IEG(<Z/NXJfBHxBpL9>{?@//9:LEfN$-@f2Hy)xNK./N&/Nֹ>{#>{/ DN$ `#>}Hy>}/Hy>}XGkN #>{pL9>{Ђ-@N& K*<,<.<Z/NXJfvֹ:tp@dv@(r t L8$BԄB/< B-|-|Hx/.B/*Q//9:LN  Jf ."҂>}e8Hy)x`/N(/"EN/"FN pLHԄ/ GN&`BB///9:LN,HxB//9:LN-@ f Hy)y `؀-Dք#>}(B>}0 9>}(rҀ#>}( @!y>}0 y>}(#>}0$.!BHh/Hy>}XN fHy>|pBB 9:tr /$Y///9:LEN#>} -y:; 9:t c#:t {HxB////9:LN#>}t9frpv$F‚Rt f#>{BHy;jlHy)y6BBBHx$Hy>zEzNBHy;jHHy)y=BBBHxHy>yN p9 f2$y>}0GnJfb$9>}En 9>} e\Nf` 99 rgm`tJglgpJ>}Tf/99/Hy)yBNK.r`HxHx@/*N$R `HxHx@/N `|rf#h>}T`9f#:;#hh>}T`z#h>}T`l:;L}Xg y:, h h0gx$ B/NsŕXftC>}X r Q,0 FBHxB// NtFHx y?N/NZ/N.NZ y?N/NP`/NfX>}XfvJ9:;g/NaXJg/.<h"GN&H-HN,X$S nff$+ (kJgHx/ / N)0 Jgp9fB BBX f>}Xgj0,S@9@f^HxHx /,/9>} N)y>} 9>})@ r9f)y>{ y:, hJg h0f/NXkS pʀk/NXJgH*LyL}Xg4 y:, h h0WID*<|HFGtFbLN^Nux`p9f. "Ё. Jgd.&r ֒"Cb.$` "` jp9fJ r 0 g@ Ё0 gX)gB// // N ` r`/,O/ $n RJgDHpp /Hy>}XNv RHpp /NHx/< //9>}N$$nN^Nu/,O/ $nHjN):xXJf/ Nw/ Hy>zN P $nN^NuNVH?<(n". &. .tĀ-BfL}4>}Xg y:, h h0WID-@-M[I-Fb L}f <@Jfp/BHx /9>} Nf&%@f%y>}p L}XNk r9f p y>}Xpr@ %y>{ y:, hJg>}Xg h0f /* NX&jp9f8*rIXJg j 0X@ ЁЈrF€&A` rp ԒB>}XflI|N-@ y>}0JfN.N&IK/NXJfv/NX y>}0XJfvHy)y`"&*"DƒpJgrf Hy)yoNK.rƒ%A&r HxBHs8N(֪ p ( `/N*r /N(r Pe/NZ&X`T/NhX >}Xf(gJ g >}Xg PJf `Jg,("F YbJg`Hn/Hy>}X-HNk nJf" h ///Hy)yNDrHy)yNK.BHxB/Hy>}XNtF y>}, .C>},Jf" >}0#>}0`\"g"H A`#>}0 >},#>},(( (Hx B/N(HxHx//Hy>}XNF.NXr9fHxHx@/Nn JgNf`/N&N>*XJfA!K !Jp9f6B`RjHx y?N/KZNP*<\&<,<qBBHxB y:L @B-@/B/9?N"EN(H y?NJg6/ CNp / NT(HxHx//Hy>}XNF`/ CNXJgSj` Hy)y"FNHx y?N/N `\ Ch  >}Xfg PJf`r '(X Є f>}Xf$Ne~R /NXB`Dp&`Ne`NVH?<$n&. ..*.Bt ąJg jp9f r 0 g@ Ё0 g|̅(.D t &R "AfJgJg $ B"}>}4zʀBJf| y9JfJftg|@& g>}Xg y:, h h0f/NfX` <@Jf </B/< /9>}Nf$fp `( |`JVID/// Nzj JgL}Xg @/NsX(nJ9:;g/NaXg/N*HN-@XJfL+C+JBB BBmgdm/.NXRJff "}>}4zʀ`vJgB)C)J(B B*`HxHy>yN(HP`Cgm`9:; `R "}>}4zʀA` t``|ftDāg f& .fB`t ` Dp&`/Hy>yN PP`/,OH0 $. &.EF Ѓe L N^NuB/.//Hy>}XN `/,OH<$.(. &. y>}\p9f r 0 g@>}dЁ0 f N.*B/Hy>}XNzj/N,D r й>}XR>}pR>}t"=>}4&Cz9fDg&C! Dp @ -BL*. .r й>}(. D".t B&| քf L|N^`چ| @!(X`/,O .r y>} . ЈfN^`ߘB`/,ON^`dNqNVH?0$.(. .$nr9f&BJgv9 fDg"Sg @b,܀ bpȀzB.YGk`:D*< ` g fZJfb npflhۮ؅dRJgf// j0/N  g:brgPrgrg&Jgv` BxNf8 L N^Nup`Jgx` nrfH`|P`vJf npfh`bp`\ b( b reJgNflB`YfNf` fpNfl` gbpgrgpgpv` gz g` g.B g` gbrgvgSfB`/,OpNN^Nu/,OH8 . r9fB(.؀ n@tĮvBEJgf/NXr @f(hЃԃeBLN^Nu$.B&< `p`Nq/,O"n n !iN^NuNV/ / n-h "n -i #h((:,f/99N*XHx/./.G)0N/. N<$@? n !J$HxL"n/)$/ N Jg .Ю%@<%|+ n!n$!n(!n ,Y!J81| $n&nN^Nu/,ON^Nu/,ON^NuNVH?8$n*f Hy)zNK.$*0%BL*E n A) &C/<B//9:;,Nf(Ԁ%B0 jH h0.BGIkE,/ //N Jf Hy)z`|BHx/./N ЂfLN^Nu/,OH0 $n*f Hy)z'NK. *0&C n A $B//NjHx///9:;,N%jL0BLL N^Nu/,O nHN^Nu/,O nhN^Nu/,OH<*.(.$.&.p @Hh Sr L @Hh0NPJgF !E!D"n )gd$!B p!@!DBB "n "BL<$n &nBB $+B(SrBB(Y*QKtmJgDL<|N^NuJgJf&,d&////./+/// /.NRP$B`%k".R%A `/,OH0<$n &.&nI$BK)0n%C %nBL< N^NuHx / / NR `/,O n !hBB pN^NuNVH?<(n &n*.,.p9 dB,f:pg4Br†-Ap̀E lJgp L(4(eR mL. e" f6  d`. d\bRG`\/ NX`/ NHkNHk NHk0NHk@NHkPNHk`NHkpN &G` Kp&@`/ NHkNHk NHk0NHk@NHkPNHk`NHkpN &G`b/ NX``Jg`g p/NfX6|" p€*A~΂G@c" GfG0`H/ NX`/ -@NHmNHm NHm0NHm@NHmPNHm`NHmpN .*@ e" f  d*G d"GbXc/ NX` MP*@`/ -@NHmNHm NHm0NHm@NHmPNHm`NHmpN .*@`/ NX`NVH<8$n . ".$Ftā//.Hn/./."9>{//9>{@/N& f.&n/ ITN$$%| &SXB(RJf n L}|:;A>}| 9;ʐ #)F>}#>}Hy>}BHxB/ y)FNN4 y:;Jg> 9;ʐ0 !@!|)EC!IHhBHxB/ y)ENN^Nu"h"iHhHxHx/( iN y:;!P!h!h`/,O y:;"h"iB/( iNN^Nu/,O y:;"h"iHx/( iNN^Nu/,O y:;"h"iB. /Hx/( iN N^Nu/,O/$.N^-@$.N^`/,O y:;"h"iB. /Hx/( iN N^Nu/,O y:;"h"iB/( iNN^Nu/,O y:;"h"iB. /B/( iN N^Nu/,O y:;"h"iB. /Hx/( iN N^Nu/,O y:;"h"iHx/( iNN^NuNq/,O n"n "P "@!iBN^Nu/,ON^Nu/,ON^Nu/,O n"n"Q !QBN^Nu/,O/ n P"n"$h/ B/././ RN nBB$nN^Nu/,O n JgBBN^Nu/,ON^Nu/,O . r€grFAЮ @N^Nu/,O . r€grFAЮ @N^Nu/,O". n"npgpF@ ЮfN^Nu`/,O". n"npgpF@ ЮfN^Nu`/,O/ . "n @g " Үf$N^Nu `$T @ `/,O/ . "n @g " Үf$N^Nu `$T @ `/,OHy)zMNK./,OHy)zNK./,ON5JgHy)sD/.N2PJVIDN^NuN4Jf`/,O/ np rg rgN/Hy)zNDrPp$nN^Nu PP"n"$h/ B/././ RN nB n BB` P`/,O/ $nN<gHxNp(Xp$nN^NuB`/,O/ $n*f"N g/* NeXJfp$nN^NuNVH><&. /Nb$HHy+IDrNN\/<@B/< /9:LNf$f-|){+L<|N^`:GKFHxHxHspHs( y:L/N  f(<>}HxHy)DD/N)0#T>}#x>}#>}#>}# >}#T>}#>}#>} #>}$%D%B%|)E %B%|)E%JBB B(B*<, ENBKNBNZHx,< FN-|*-|:;x؊-DBHy.Hn/NC%H$,f@Hy){NN BHpp / y:L/Nv/ //9:LN0L<|N^Nu%|h4%J8p%@}BHxN y>}@.Hx EN/NX`/,O/ $n *(g:r€%A(HxNHxN,BNZHjNB$nN^NuN<,g @/NX*+g jJg/* NXJVID`/,ON^Nu/,O/ nB@F'Jf!n!nB@F $.N^NuHy){NDrXA`/,ON^Nu/,ON^Nu/,ON^Nu/,OH<<$nGI&<,(<Z*<KsB@F" *(g,r€%A(HxNHxNHx CNB DN/ ENB@F/9:Hy){Hx / N`/,ON4JgHy)s@/.N2PJVIDN^NuN4JfN5Jf`/,OH80&. /Nb$HHy+NOH$G(%KhN\N4P"9;ʐJgl "B%A@%|)BX%|)BX %@(A%H\HkBHx@B/ y)BXN$g$-|)J -CL N^`dp`( 4 j( h hJg0r////*,N j(Jg hHx@/*, hNP`r`RXpf hHk8HxHx/*, hNJfzp%@B*$ %BA%H %@p%@lB%J/ N %| %Jp%@HjNMLPJ*g HxNX-BL N^`"L N^Nu/,O/$.N/N&HX (g,HxHx"DN !k B"j|!I "P%H|PRR fL<N^Nu/,ON^Nu/,OH 0$nNݖ$/<BB/GN *p"*t//Hx/N HxB/Hj NB/NݮpL N^Nu/,O/ np!@pBt"hx (tJf("(p//r /Hy)}NOH$.N^Nu"$ԩd!Btpd!Ap"i`/,O/ $n/</<NNb%H%|)E P%@`HjdB/<B/ y)ENJWD$nN^Nu/,O/ / $n/</<GNbN%H%|)DD *p"*t//N%H%|)Dp$n&nN^NuNVH 0$. &n/Nb$H !K/N.PJf-|)~ -BL N^`X/ NXJg,GOH g j ( f|lHy)~`/ NNXJgF|lHy)~?NOHX *lfl%|p%|t/ NXJfZ-|)~ `d-|)~`L N^`/ NXJgn|lHy)~{N`|lHy)~`/ NX`*l"< g"< g"<xG %A(%K %|p,%|0%|j4%|8%|<%|nT%|$%|D%|6H%|L%| P g / N^XA-H-J-|:=`B-Kp-@BBBHyHHn/NCL N^NuNq/,O n GfrWIDN^NuB`NV/ / $n&nbFHnHnHn/. / jN j@ h .r Hs/*D hlN$n&nN^Nup`NV/ / $n&nb>HnHnHn/. / jN j@ h/. .r Hs/*D hpN $n&nN^Nu/,OpN^Nu/,ON^Nu/,O n p BN^NuNVH08&. /Nb$HG n%hHy) NOH *"%A%|)DD %A%|)E%@%|)E P%@`HjdBHx`B/ y)DDNJgHy)*/NNzP%K %|(%|p,%|0%|4%|n8%|$%|D%|6H%|L%| P%|b<%|nTNݖ$/<BB/IN/</<Hx/N HxB// NB/NݮA-H-JBB-Kp-@BBBHyHHn/NC$L N^Nu/,OABN^NuNq/,OpN^Nu/,OH 0$. &n/Nb$H Hy)UNOH S%H"hHjBHxHx@/ QNJg-|) -BL N^`pL N^Nu/,O/ $nHy)/NOb j hBB/* hN$nN^NuNq/,O n frҨpe < rN^NuB`/,O n"h"iB./Hx/( iN N^Nu/,OpN^Nu/,ON^Nu/,O n p BN^Nu/,OpFN^Nu/,O . g/Hy)NOHPpN^Nu/,OH00$. &n/Nb$H &+ +1@XAOH @0gvb @ g" @(g`Hy)d` @1gb @/ N %| <X%J\p%@`HjPNML/ N $.$nN^Nu/,O n"h"i"i (r f-|@ -@N^N-| `Nq/,O n"h "iB.r//( i4NN^Nu/,OBN^Nu/,OHy)/.N2PJVIDN^NuNVH8<$. /Nb$H /<@B/</9:LNf$f-|)D -RL<N^`GIFHxHxHspHs( y:L/N f0%B%|)E X%@ HjBHxB/ y)ENHx/ GNHx/ N$Hx/ NHx/ N  /Hy)fIOHNHy)/NObB/ NPJg Hy)NXHx/ NPJg Hy)NXHy+N-|Hy)G/ K)/LNBHz`/ /GCN-|Hy)I/ N BHz4/ /NL<N^NuNV/ //<@BHx /9:LNf$@HxHx/</ y:L/NF-J-|)E$HnBHx BHn y)ENHx/. n hlN$Hj / y:L/Nv$.@Hx / /9:LN WD$.$nN^Nu/,OJ.f p-@ N^`p`/,OHy)/.N)/`PJWIDN^Nu/,OH?<&.$. /GbN$HHy)NOH/N%HN\ 9;ʐ%@%|)BX$p%@B*A%H p%@%@l%|p/ N GIB& (HxB/ N(&'J(p\L*jh M "j/BHx@"p // QN* grHy)/NNzP kp\LШh/N / N 4PJg4%|%Jp%@HjxNMLX-|L U h (."0|`/,OH00$nN<jfHx/*GNP fJHjN r$XB/*NP fHjN r$Xpƀp|/NX L N^NuB`B`Nq / gv/ y9!|< o"o "g  Sg@" f""gS "QdgS QdB y9B<$Nu` / gv/ y9!|f< o"o "g (Sg@" f""gS$(QdgS(QdB y9B<$Nu` y9!|ź< o"oB"/ gSWg dp?Jg "o" y9B0$n(. ". .$vԀJfHy)NDrXpL |N^Nu *oҪBGиl |́g  AB"Sg ///N Jg"zЁԀ Ԁ$RJn2 rԀ ЂF`ZJg$R`:Jg8 *f$R`"*`V/,O/ n"n "( R!@$AfS$_N^Nu/,OH><$n .*.2Jf0t gvBBAvFg(䤂DRxfG,(`tG,(KBBB8Kv"|́gJf(// NPJg *"R%A @/B`t`rf *"R%A @-pRXfrl /3~DG36$L@ R8"A"d"jSfB`~G%K`/,OH00"n". .t g* iE#J0tg )$R#B @xpA>~PG36$L@ R8$A"d$iSf BL N^NuG#K`/,O/ /$n . f0 j0 jB($*/N)/ jB`lHx// N> `/,OH 0$n$. 0@ @`f`Hy)#/ NP0@ jCJf\&R0+HRrw%I"*$R%B A "TҀ-A -JL N^` @afHy)'`Hy)l/ N0` @f&R +Trl`Jjrb`/,O/ / n . "nj"($R!B$A-D-I-@ -H$$_N^`/,O/ /$n . "nf0 j0 jB($*/N)/Jk/0-,h/ NP *"R%A @@ *"R%A @(plnrgp// / N Jg<0@2ADf"*$R%B A,J@f:gP *DfL *"R%A @)`V%A*X`"K` DfpT(Px` I*@rIBGg_f$ j R%@Jjz *"R%A @p *"R%A @c`xI`B`G`p`J@g8 *"R%A @) *"R%A @@ *"R%A @(pf*gH` *"R%A @,`JfHx/ / N *"R%A @, peAJCl/0},h/ NP *"R%A @: frw *$R%B @Jgn *"R%A @:"* R%@p0 A``\Hy)H`\Hy)R` RЀ60.*"R%AEBdCF"j" RgA<F @gT @fDT%G>H Fgz Ff:R6P0|%A("*,R%F"A[(K&H`0V%G.`B` FfT&P0|`I%A(IKp/// .< GN *"R%A @, JgVJjP *"R%A @z_g/0-,h/ NPJg *Dg\ *"R%A @,JgVgN *"R%A @0JgDg *"R%A @] *"R%A @,pg rf6|/ / / GN`%A(I @g @g*@`0|`:|p`:|p` *"R%A @p *"R%A @c` *"R%A @,gl *"R%A @0`]f/0-,h/ NPJf` *"R%A @p *"R%A @c`"R%A @]`B.AjJClr/0m,h/ NP *"R%A @. fVrw *$R%B @Jg| *"R%A @*"* R%@p0 A`H/0m,H`rl`6|`r/,OH88$n$. n *"R%A"@Jj"j R%@Df^d// IN0r h@6KCP j&Lg4"R @bЀ0; %ANs`lp"*(R%D A Hx/HxHx/ N Cf *"R%A @,I,(p/4 / N *"R%A @:P%-t, -JLN^`sp`txp`jpp``wp`Vdp`Lbp`BB`<0@? @:g *"R%A @,%-p-,( `~C%Ix"*(R%D A G,(/3 / NP Cf@ *"R%A @,p/3 / N *"R%A @:P%-s, `0@? @:g *"R%A @,`LN^Nu/,OH<0$n&. 4B8D Bgb Bgb Bg <) Bg0H@ @f%B j"RzgRzg,z%Aga"*$R%B As jCJDfJrr%I j"R%A @gf,b *"R%A @ `. <) Bg20H@&`` BgL <)u Bg <){ Bf*// GvN *"R%A @ R6(RP Bf$C/0 ,H/ N *"R%A @,PHxBHxHx/ N *"R%A @{E g/0 ,H/ NP *"R%A @:0@g/0,H/ NP *"R%A @} jJDg BgC%I,4C-p=,H -JL 8$n&. 2I0@G4x jgJ @gd @gdgzlx0@ @fHy+/ NP *"R%A @a|`8zbx0@0 @g @fHy)`zwx`zlx`Hy)/ NP *"R%A @ *"R%A @ prāDj~I,h/4 / N *(R%D @@ *"R%A @- *"R%A @,/4,/ N *"R%A @@ *"R%A @-L|N^NuI,H/4 / N *"R%A @,P-t, -JL|N^`B0@ @fxHy+/ NPB *"R%A @ *"R%A @ pĀIgTJfP/0-,H/ N *"R%A @,B/HxHx/ N`Hy)F/ NPI,Hp/4 / N *"R%A @:p/4 / N *"R%A @,/4 / N *"R%A @:/4 / N *"R%A @,0r h JDlt/0 ,h/ NP *"R%A @@ *"R%A @:0r hJClzt/0 ,h/ NP *"R%A @@`"<)// N֐Hx/ N6 *"R%A @,Hx`j"<)`Hy)M`/4 `T/4 `0@ @g` @g0@ @b @g"<) @g "<) J@f// NJBPAݘG Bg BgJBf *"R%A"@b *"R%A"@ t// N *"R%A @,Hx/` R6(RHy)T/ GpNp j2AP jflC%Ibt *"R%A @ I,Hp/4 / N *"R%A @,5/4</ N *"R%A @,Hx/` R%@ Afwt`lt`Hy)]`rbp`(rwp` -p ,H `0@ @fp"<)` @ gD @g"<) @ gr`zHy)b/ G\NJ2AP K"jf~G%Kb8| *"R%A"@ "R6)RG4p j gxJCldrā/0-,h/ NP *$R%B @,Hx/ HxHx/ N` R%@ Af w8|`zl8|`n/0-,H`Hx/ HxHx/ N *"R%A @,JClpĀ-p-,h ``N"<)`D"<) `: *"R%A"@w *"R%A"@ t`d *"R%A"@l *"R%A"@ Hx/ N *"R%A @,HxHxHxHx/ N`t`/,OH00$n$. 0r hAҐ @gbD6K @g @gHy)/ NJBP Bf *"R%A @aB` @fHy)g/ NBPJjrFHx// NN *"R%A @, %-p-,H -JL N^`Hy)/ NCP Cf *"R%A @at *"R%A @l`|Hy)/ NJBP Bf *"R%A @a *"R%A @wt`0@ @ bЀ0;N <+2c-@ -JL *"R%A @{ g6C/0=,H/ NP *"R%A @}Lp o GbXB0Ѐ0; GN  8r l4:E? Bf$Hy)/ NHxHxHxHx/ Nǎ`JCf^Hy)/ NP * g8$R%B @r *"R%A @ 2E/ / N:P-|) `"R%A @w`Hy)/ NP0S@ @bЀ0;Ntt<*<* *"R%A @a jB`L *"R%A @s *"R%A @ 2E/ / Nœ *"R%A @, *"R%A @#Hx%// Ng *"R%A @,HxHxHxHx/ N@`<F:p mDHy)/ NPg$ *"R%A @f *"R%A @d * Gg8 Gg&<) Dg&<) Dg&<,'"R%A @lx`>SD Db؄2;HN&<,b"R%A @bx *"R%A @ JFfHx/HxHx/ NJ *"R%A @,// N GfEgHx&// N JFgz`&<)"R%A @dx`r&<,' Db&0M,"R%A @wx`D&<*&`*&<)u` &<)`&<)K`&<)y`&<)}`// NP GfEfP *"R%A @,Hx/`Hy)/ NP *"R%A @ gr *"R%A @ p?// N *"R%A @,HxBHxHx/ N *"R%A @, *"R%A @#Hx// N8(g *"R%A @,&-p-,h `w`RHy)I/ GNpĀ/0-,Lj/ N *A–"R%A"@ Cf.w *"R%A"@ HxHx"R2i/ / N`l *"R%A"@ HxHx"R/)/ N`>6(R0H@r?ƁGI @f Hy)` @fH0@g@Hy)` Bf *"R%A @l *"R%A @ THx`Hy+`Hy)`NHy)`DGbgdHy)/ NP *"R%A @g>r *"R%A @ pĀ/0-,h/ N *"R%A @@P`w`Hy)/ N2IAP * Ag Ag Ag"R%A @n`"R%A @a *"R%A @n`Hy)/ GNvƂPI,hg8/4</ NHy)/ N RC/4 / NHy)/ NR `JB Bgl Bgv Bg,/4</ NHy)/ Np-@ -JL\-|>\-|>~\-|>~\-J. -@B9>\B9>~\0r-A?BgHn p,ȈNHy>\Hy+i+GC&NJ9>~\g$Hy>~\Hy)NP .ЀЊ$n&nN^NuHy+NX`/,OH80$.&. Rre "<fXHy)EDrNX:;\lJl,/Hy, NX.)NXBJ?pgpHy)NF/0-:;`Hy+i+`(<>\HxL//E)0NR:>HxG!NB/N4BNS:>HxL//NB@F'(pL N^Nu/,OJ:>f(9?_ gHy)NDr/.HxN N^Nu/,ONON^Nu/,O"n n hJf 0P"BN^Nu0`/,OH88$nBHx *X/GN(@ Jf%| B%BLN^Nu$]BHx/N&( YBHx/N"BC Nf %@%A BHx/ N" fTBHx/ N " PfBfrԁTBHx/ N" Pg POgJlV` af ҄`fB@ Nf `PA af 2AA"`6 Nf ҈` $ afIҌ`"<` POg:"BA fBHxHlN$ `P g Of $`4t`lNVH?<$.,. n$n.BBxf*y:,JfB">\-Xr8fBHxHy>GN-@BHxHy>N-@BHnNBJg>S . f-|,'B-@&./Hy)x\I)/`NP&nJf BHxHk\IN  gBHxHk^N$ /.Hy+i+N(nPgJJgDHnHx/ NBHn/N .gg ng /Hy)NPHy* N&.Xg* XS.<XBHx/ GN/Hy*NJgHy*-jNSX` ag tg ufdB`^vr`VJgJgz*B m/(`Hy)NP/-Hy)N m $(4-BBHx/(8N-@/Hy,NBB-|BBXr@fHnNX`4/Hy)N/N Jf-|+"JLSA>C3%tā(QB@Sd$N^NuNVH8< .&C$@BGDrI(YK| l4Cf@Hx/ NHy>Hy)Npf*// NPJg&Hy+NL<N^NuHy+NX`εl-RHx/.NHy>Hy+i+NRX`~/,OH<8(. $9:?f~B@F'p#:?Hx nB0(Fr㨀hH/GN y:,PJgL"( hJgD (`Hy>//Hy)EDrNHx nB0(D/NHy>Hy):NNz r€/Hy)DNNzr€/Hy)ONHy)YNB/Hy)jNRPpfHy)uNXHx n/0,NHy>Hy)2NRrfHy)|NXtHx n/0,NHy>Hy)2NRpfJo6 nI(DgHHx$X/NHy>Hy)NB//NB:?B@FLHy)NHx/ n/(<`Nq/,O . f f f fgp`pN^Nup`p`p`/,O/ / n"n$h$pf0 . &hЫ4&@+gp""hx| I $_&_N^NuB j<`/,O/ . n h$!n<"t1AF1@H$N^Nu/,OH0<*n$n (n&m$ J$%k%k%k %k%k%k%k%k %k$$%k((%k,,%k00%k44%k88%k<0+J"%A&<:;< C0p*/HkLHjN)0 C60*kBBkJ J9g.&m :,f Hk@N+"X%k@p9fJ+BfL< N^NuJ+@gHxHkDHjK)0NHx`HkHjTN%kxH%k|L%kPr`NVdH><*n or€$A&y:,(k,,4&-Hnd// N!f*"E(1h$pHxB/ N( F$X%CpЂ%@"%A Hx`HmHjK)0N$Hx/. HjN%k pH@+gpH@r%A// NJP/,N6HjHj/ N!Hx// N& .NXJg Hx/ NK\ k$!B< r1@F1DHJdgpL<|@N^Nu/,O n (D@JgpN^Nu/,OH<<(n$n $.&l$ *zʂDg>fre 99g:&l "@vg @gB@`"*DAJfgr&'j'j'j 'j'j'j'j'j 'j$$'j(('j,,'j00'j44'j88'j<<7jFD7j@F7jBH`Lvdr e.60 :;<0CJCk8+Bf // NJ2+J * 7AJ/HjHkLN)0C7DB Jf,`'j@YfrJ+Bfr:,f Hk@N+fXg/*/ NNlP l/(NXgvgp l/(N6XBL<@HxHy>`p`Nq oH!W0pNu oL.pNuNqNVH<<&. $n C(("D i *(&h(jX`HnHlN|PJf&P`nrL`~// / Nh Jgr"D i h Jg 0$jD`rB-j C!K// / kN"CB rgDJg&vfB2*Fx驂jHU&5CF5AH` y:, h".$%njD :< f%A `NVH0<$. $n B*h m &(&h(jwD$9>w@Հ#>w@.Pg Hy)NK.$y:, j&($(C %I$&I/ / /. hN-C-B/// / NSL N^Nu/,O/ $n/ NX"<'Jf"<(%A$nN^Nu/,ON^`NV"n i$BhD(JBBBB// NSN^NuNVH8(n&y:,$k$BjD*J/Hl$/ N$Hx/ NBBB/./ / NS$LN^NuNV nBBBB/($/NSN^NuNq/,OH00&n$.p(// N3$HPJgz&//. /N)0%CP%BT%nX%n\%nD%n L%n$h kp0Ш/N/ NO$@ kp0Ш/N6 L N^Nu4| `/,OJ:? fHxHy)NpPN^Nu/,O//$.&. N, j/-HN. n//+-@ CN ".Jf"GAh Јo(( `N/,O .reЀ0;N@LT\dlt|A+( N^NuA)`A*=`A)`A)`A)`A)`A)`A)`A)`A)`A))`A)<`A)N`A)_`Hy)tNK.A,O`vA)`l/,O/ nBrB(t婂B(ሀ($N^Nu/,O n"hpPg (ToS!@TpN^Nu") oS#A `B`NV/-n-n -n-nB <L<B6ЂRtfL<BL<B6ЂRtfr$N^NuNVH80&n$. &..\l~`lx"[I//"[I-@-A//.NR$@Jgp0Ы/NX$s Jf"Jgp0Ы/N6X J L N^Nu@fDg$j`E`/,OJ>fHp#>HxBHy)BBBHxHy>Nz HxHy>N%PN^`%0N^Nu/,O/ / $n&jN0B|A|%HBA%HA CLBf/*Hy+i+Hjp/ Hz BBHxN( Jg/*LHy)/NNzHy)NK.$n&nN^Nu/,OH 0$np0Ъ/NptHjNPP$ GMLp0ЪJpf-@L N^`//NP`NVH 0&n$n "*D[I//"*@[I-@-A//.Nv$p0Ы/N T s %HXgC!I ' Vԋ%B p0Ы-@L N^`~/,O n "hJg#h "h "N^Nu/,OB/./. /.NV N^Nu/,OHx/./. /.N8 N^Nu/,OH>8$n$. xȂf jp0Ш/NX,*IGML& *"*Jgxm *8 gXJgzGJgHxHy>N&HPJf jJgnfLj: j P/ h NXJf<`Vf @%@8`ovFƪ8fR%@`JgG K L|N^Nup8 jp0Ш// NP`4 jp0Ш/I6NHxHy>N&H JgpHxB/ N(BHkNL'J@'B8B<$ PJf jp0Ш/NB jx'H %Bx jp0Ш/N6P`> jp0Ш/NXJg4fj: jp0Ш/NX` P/ h NX <)`S`S P/ h NX <*Ѱ/Hy)NDrP`B jx'H %Bx`/,OH 0&n$k@$+8 k + Jg!@ k HkN/ Hy>N P g^fj:Jf *8gr€%A8HjNPX *8Df,r€%A8-JL N^`%@x`zS` jJg$/NXJg j-J"hL N^NL N^Nu/,O/ /$n$. j (4nժx$.$nN^NuHh0NժxXp0Ъ-@$.$nN^`/,O n . ѨLN^Nu/,O n (L !@Lf(;g-HN^`N^Nu/,OH8 n(h@"l (8gJ|gp!@dp#LN^Nug*$i| g%H#H||!I(9fHB`#H` (Hg$i|JfB$i!J$#H`&R@fHn"$K`'H$!J`Hx/(@N6P` f#H`/,O/ /$n$. jp0Ш/NժLX jp0Ш-@$.$nN^`T/,O/ /$n$. jp0Ш/N// N6 jp0Ш-@$.$nN^`/,OH 8$n&jp0Ы/NX$ IMLJfp0Ы-@LN^`p8p0Ы//NP`/,OH 8$n&j S/ hNX$ IMLJf LN^Nup8p0Ы//NP`/,OH00&nB/Hy,yEDrNSP b 0 ,Ipm L N^NuvtB3(/Hy)^TNRPf`/,OH<0$n&j@ k PJf*l %g:b| g g0Jg& k P/ h N*lr€/Hy)GDrN J*ll$B*mrB*nቀ*o/Hy)NPHy+NX`$ pg2 qf k P/ h N*nr€/Hy)NDr J*llHjoN2X(*n  bBЀ0;NNzj/ N$Xpg L <*n-4f-, g g/ N@$HxHx@ETN&Hx BHnN(|| ||@xGI+Hx B/<`BHx@/Hx / / N$$pfSf/NU&XL<|N^NuJf/(</t DN&@(CXp.HxN$HPJfh/ NU&X`* Q, PBr%,g@p d:Hl DNX&@ FHh DNX" o"6||܌Bo%R(FpmJg+JP`L/,OH 0$np0Ъ/NXG6*Sfp0Ъ/NXt L N^NutĪtgp0Ъ/NXt`Hx/ N6F%n %nptHjNPp0Ъ/N`/,OH88$n$. &n j&(4oNHh0NXpg|pgJfT$+pfb(*`SBI2`0/// N Jg +"(o!@` l(;fRlJop0Ъ-@LN^`R(` R hJg/ / NP`-K LN^N j|Jf$HjNPXBI2޴\ldfnR`"PJ(9j0 (Jg,#@&h&p!@d(;gB&j!K&%H I`%@`/ // N Jg hJgp!@dR`m`G`pf R"hJfFLN^NupgBJf`NVH8<$n(j@&lp0Ы/KNX&<6rdf *fJ*9jp l P/ h NHy)KDrNHx/ N6p0Ы/ CN *`"*\o/Hy)NB/*X y:?$Nt L<N^Nup0Ы/ CN$*@"Bi:xȪ8XgpHxBHnN(|| /BHxBHx HjlHxHn/N+( Bh:B0pgrg\Jf\p%@d`r%Ad *8tĀgzp0Ы/NXJdgHx/ N6Pr0ҫ/ CN/ NVPB`p`r%Ad h P/ h N/Hy)NDr `p0Ы/ CNX`zr de"*dҁ2;Nj L`p0Ы/NXJdgHx/ N6Pp0Ы/ CN l h XJg// NPp0Ы/NX*;g / N5ZXr0ҫ/ CNX`6 S/ hN$r0ҫ/NPpf|BdB* *r0ҫ/N`* *DglS%@Dp0Ы/NX*;f+Sfp gN$y>XJfHy>N6 J $nN^Nu Pg$R`/,OH8 $n/ NXJfHy)rNDrXp`,"hH&($g( i P/ h NHy)NDrPp%j$`((g( c i P/ h NHy)NDrPp`"(gjJgx <ffg@@g@r// /B//*0/Hh/ N+$Jfj%@-JLN^`g BJg@ `B`/,OHxHxHy>N{4 N^Nu/,OH8&n(k@/+hNl$HB(CkBXpde +dЀ0;N^ +\`!@ +;g lp0Ш/N/ N5ZP lp0Ш-@LN^`| AHx HklHhN)0|C `|AHxHklHhN)0|C` l P/ h NHy)NDr|CP`V|C`L|C`B l P/ h N/+dHy) NDr`LN^NuNVH?<*n(.*. .$nJg @Qg@ `Qg @ Qg.fv `pr®g&* oJgg|HxHxPNT&H$P/N Hy>IN y>&g!K#>'|>Hy>C6-IN. Hx`/ /,<)0(FN'MH"n(IJg'j'CA'Hp'@'CBB Fr€'A& Jm"n i'h0/ m h/( r/-E-D///Hz N &Hx`// "FNHy>N SJg!k k Hy>N/N / NU& L#:?$>|#[:?("<[`p#:?$#:? BN^Nu#>:?("9>|B`p`p`/,O/ / $n j@"h"Q/ i NHy)1GDrN/*PN8Hy+N/. Hjl y:?$Np$n&nN^Nu/,OH88$n$. Hx*/0 ,Hy>I(ydNHy>Hy)KGDrN*IrFgPHy)^NXJ*lHx Hy)nNPp,*gI/Hy)NPp,*gI/Hy)NPB*vB*v穂B*ሀ*Jg /Hy)NP *b-|+LN^`p `|B*rB* v穂B* ሀ* Jg//Hy)N * * A,ʈ (f2BAE @g2//Hy) HxHy>N`,f(gP`Jg/Hy)HxHy>NHy>Hy)"N*Pg/Hy)6NP* *c(*j" b> b g gHy+NXJgt&J28fRr f`p fB*ቂ*@AEDjXpƀ <)Jg <)R///Hy)LHxHy>NHy>Hy)NHy+N JfvLN^Nu <)Jg <)R//Hy)kHxHy>N`B*ሀ*/Hy)HxHy>NE`B*ሀ*/Hy)`t`/Hy)NPpfN `NVHx BHnN(|@|/. B/<HxBBHx Hn/.N+N^Nu/,O n"h@pHm hP )D눁(N^Nu/,OH<0$n j**D(*@&(L h/GN$ XA+g/NX/////Hy)NDrL +0zFʀJj0*+ k ",8|@g f$f(f)F8R`A`)@ )E$)H()F8 l"h gHy*Ѱ/ DNP , g/,$ CN/,(zdLE//Hy)%N , DjHy)@NX , g<&n$k&*(k 4+ Ԫ L<|N^NuLL|`/ HzHxHjN/ N` . g6J,9j ",`\f&r)Ad)Al l@(6fbp)@d| +g9:?3g/Hy)NDrP9:?3g/,l/,dHy)+NDr / N/ / N `6 CCg + r€//N(^p)@d/ N/ / N<`0/,O//&./N5:$/N8B/N$.&.N^NuNVH?<&n$n $.&+*p\L C*hh(j 8* ث<9:?3g$"DB/N///Hy)nNDr/ N8X DJ( f2B8*$"C/NB///Hy)NDrHy)NK. * r Uf / N8$p)@d/ / N6 p`"C iJgB0*// NP U hB0*r_F/B/-$ hN JfJ ,LHnHx/BB/ N RfK8$Jg * f/ NXBLHy)NDr * XDj * ~΀//N(^Pp)@d/ N8$`l *"%A(o//Hy)NDr$* /.*ު/ DB0(// "C iN *(o// N P`9:?3gHy)*NDrX * Dj.,\)j`/./ NP`SgFHxdN- U hB/- hN U hB/-, hNኄ-B`/Hy);NDr .Pgr)Adt)Gl`b * Dj * r€//N(^P~`/,OH 0$.&n .$k rgNrg rf(p`@p%@d/ /NP-JL N^`݆/Hy)NDrHy)NK.p%@d/ /N\P`/,OH <&n$n j tĨ8HxI-NB/ / KNJg: + g" j /(L/ / N + r'@ j (<g BL<N^NuHxNB/ / N`/,OH08(n$. $n l/Nb&HXJfh$,L j@&(@9:?3g/N///Hy)NDr/NXJfp%@d-JL N^`@B k /0(NPJfr%Ad`*;g ( r!@ "k "q("i< L< 01@gJ\o ( r!@ 1C ( r!@ "jP] c f ( r!@ [g ( r!@ *\rlg ( r!@ !jX!j\!|,(h!J B$B@ C#bF$/ k /0(NXB@FPL N^NuNVH?<(.$. D&("C i/EbN"C )L h p *(BN,$HB!C!|,!B@BD!|42.@,XJk2 fB@ @#bF$lB@F-JB0."A-@HxaHx( EHh6Hx)./G(tlNHxaHx"EHiHx,/N(HxaHx EHh.Hx &/N-G-F-C0.2A Afj2r`0Hn/ //N)Hg/ N,XLB#>BHxHy>N{4Hy) Hy>NM.BN^Nu/,OH 8$. $n/Nb&HBBB/NJfHy)/NNzP&'J/N%HHy)5NM` j`PC*ѰpgC+i, *\"<*Ѱtg"<+i,/ ///Hy)ANOH*Sg Xo%|Xp4Ъ/N):XXSfHxHxt0Ԫ/N{4 Hy)eHjIM.NHy)lHjNHy)sHjN/*NT|Jf y:?fgHzHy:?`NPBBBHx NT B"y>!I"X#>/N5j/ N1BJg6-|)y -SLN^` j o !|`/*Hy)Hjl/ Hz fBBHxN( Jg -jL-|) -SLN^`ήLN^Nu/,O/ /". t /Hy;ØN;$H h/(NTpB$.$nN^Nu/,O/ /". t /Hy;ØN;$HPJg.( f* h/(NT|XJfr$.$nN^Nup`p`NVH><$n . IOHg /Hy+i+NP R*(@,(D*r€/N.~$HxaHx/* Hx!K/ G(tlNHxaHx/*HxAv֎/N,HxaHx/*Hxx؎/N R"<*ѰJPg"<) <)Jg <)////// //Hy)NpL<|hN^NuNVPH><(n(. &.&l/// N2 Jf\BN,$H!K!|,!D@!CD!kh4zڎHxJB/K(NpR rfRB6|3fB.B.p5R rEfHx$// N=$ fX.F,J.lr8.|́%FH  g"bJg, k h,Jg6B` @fB/ N-rX` k h,Jf *,g-Jn-@A-HA-HA-Hn-EHnPHxHxHy,THnN-"*HJfpl.fDjj2g fj2g Dg|0g Dgz0gj2Jl|0pg:f. gB g@.gj@2.gj 2gj2gz04p f|%B4WID-DT-CXHxBHndNp-@\-|3`AT-HlHn\x؎//N4&g/ / N24PpHl / N@JXHxBHn|Nr-AxAT-HHnxHz*///NC L<|,N^Nu|Hn/ NPJfJf`$(zl.gdDk^j2`Tjg2j2`/N//NHy,)NOH`B`x/,O n"PJ)f"n "i LgrWIDN^NuB`p`NVH?<$. .. n*hpfh"-\S-ABzfj.-`SB y:,/(BB/< U/ NTJ/-NT|(fo@/-NTX L<\N^NuJm\l-B`Jm쾭`l-G`dgh n$hHx BHnN(BN,&H!J!|,!B@BD!jh4Hx$Hn/N=Jg./ N-rX&.n///.N JgR`.r€'AH cvI,<Hx/N$H|B.B. z@ @CHx$BHx'Hx//Hx Hn/ N+-@,fBpB*먀B*ፊ* Pc c*P// NP&``*QHx Ѐ/N,I"HPBRg @g/ -IN_B,p AB,r"B,ቂ,-ABp-AB,pᩂB,ሀ,-@-n/./Hy)NDrB@"n2PfZHnHzHx//N(s`Jfn/ N-rX$F&JBfjփ// NPHx// NS R`HBሀ,@?`B@,`BJf/ N-rXJg`B// NP$F`B0mn///.N R`px`/,O// n&($/.NbX-C-B -H$.&.N^`:/,OH0<&n$+ B(Sf0HxHy)#/NObB 9:Ѐ/BHy)PNtHy>KNX&<>IML C$PgHy>Hy>NP`Hy>I6NHxHx/ N4Hy>N jJgN!j j Hy>NPHy>N/ NU& B/(NT/N6 kBlBN#>`/,OH80". $.$n&.&n x /Hy;ØN; (r‚P Ug Uf f"p L N^Nug Ug, Ug@-k-C-J-B -@L N^`ɨ-j-R -HL N^`vB-j-R -@L N^`Nq/,OpeBN^Nup`/,O/ / $n . &jg/Hy*NNOHPpg/*LHy*\NOHPp$n&nN^Nu/,O nJg P (WIDN^NuB`/,OH08&. /.Nb&hp0Ы/NPBI2޴\l0B// N$H JggR`// N2/ N-r p0Ы-@L N^`P/,OH 0&n/ Nb$h/. HxHx/ NH$fZ/ N/ N1HjGMDNHjNHjNN(p4Ъ/N):xJfN(p0Ъ/N{VX L N^Nu/,OH 0". n "n$Q&h tg@f-I-H -AL N^`vBL N^Nu/,O/ / $n . GOHg /Hy+i+NP*r€/N.~X <)Jg <)///*/*/* R/(@Hy*rNp$n&nN^Nu/,OH <$. $n/Nb&H!J /N%Hp%@dr%A`Hy+NM`/*\Hy*NOHp4Ъ/N):XSfHxHxp0Ъ/N{4 Hy)eHjIM.NHy)lHjNHy)sHjNBB/ N1BBBB/N,JfHy)/NNzP(k$,\/,NT|$@XJf,*lm-lL<N^`p/ / m8NRP`L<N^Nu/,O . g/Hy*NOHPpN^NuNVH08(n$n&n&,HnHxHxHy,tHkN-Jgl (4HxBHnN(p-@-|Hn/ /N4$g4/ /N24BHz/ //NC$ B L N^NuB`/N// NzHy,)NOH/ N-r`/,O/ . n "t"tA"A@$N^Nu/,O/ nBrB(t婂B(ሀ($N^Nu/,OpN^Nu/,OpN^Nu/,OH?<&./Nb$H hL(hG/. /Hz:/ NF$fHy,N\,Hy,|N*PBK!/N.ބHx///NHx///NR$pf( \B/NX/ N# p0Ь/N/*LN8p0Ь/N6/*Na/ N.N/ N#/N/N L-|) -BLN^`JHgp`,pH`p ` h (`LN^Nu/,O/ /$n$. j@/Nb"jhXJg,#B#j`Jg#i$-I -H$.$nN^`D$.$nN^Nu/,O/ /$n/Nb$$jp0Ъ/N6B/N#Hp0Ъ-@$.$nN^`n/,OB/.N#HPN^Nu/,OH8$n&j@*l~ pf<*n f& *xf *yfI|/ N^XJfHx/ N7P/ HyMzpL9:// Np*n fT *xfL *yfDI|/ N^XJfHx/ N7P/ HyMz 9:jR// Np*n fT *xfL *yfDE|/ N^XJfHx/ N7P/ HyMz 9:jR// NpLN^Nup`.p`NVH8<$n&. &n*6fjHx BHn$<("BNxHxBHvH"BN|%HxBHxu0HxHxHvHHx Hn/ K+NHx BHn"DN|F|HxBHxu0HxHxHnHx Hn/N$0fnB0.rflBHxNT&HKHxBHn"DN|C||||Hx BHxu0HxHx/ Hx / /N$8fBሀ+ njR(@DHx BHxu0Hx// Hx / /N$$fCW-DB|cBBIBBBJn&Jf Jg ( AƸexF(`)J)fQg fxiBC)B2-ABKBBJn:B@.@f* 5G5|5C%FB Br%A%EB`HlN6X @,B"@AAf," Rfzڈg M fCDgDkCgCQP*H`ZC`t7`nHx B/ "DN n bBnB.BA.ނ@4B.BA.߂@5A.@.DgzgxgzgxJlz .gx@gzF f@DgDkb@g@5@HnGNX%@HnNX%@ HnNX%@HnNX%@HnNX%@HnNX%@`R@`t`F/,OH<(n$lT&Rf, ,%@ f +0",0Ҫ/*//N)0 Bf* ,%@f +0Ъ/*/,0/N)0 B/,0KU&N/ N!hPJf>Jf8'j * g'@BJg'k$/ NX-KL<N^`ZJL<N^NuNVHnHxHxHy, .X/N- .N^NuNV". ./.HzB-@-A//BHz%~N N^NuNV". ./.Hzl/<-@-A//BHz%HN N^Nu/,OH80&n&.(. $.BBN $HPJgHx/NT%H0Pf/ N!hXp L N^NuB +("+,%@(%A,%kHH%B$%B %D8%C<"+%A%k%k%| %nT%k n B`NV/$.Hx BHnN(|B p f||@nn @BHx BHxu0Hx//.Hx Hn n/(LN+$.N^NuNV/$.HxBHnN(|C p f|n @BnHxBHxu0Hx//.Hx Hn n/(LN+$.N^Nu/,OH 8(n&n $nB0+"Q bB @Hh/ B+/// NBJf g lL(6fPLN^NuB*B* AC"TAtJm &lL+6g "YHAY SQ`2Y4`p`/,O/ / n$n &hLHx@Hx / BB/NJf4+6g"*YHAY%A2Y4 R c *c"* n $n&nN^NuB`NVH8$n /.Nb&H(hLBHxHy* (HjN(5|,H *Xr%AX,;gr!%AXHnHn/ N& B *<%@%n| B%@|LN^Nu/,OH 8 n"n$n".&nB.(hLJ,6j0t&HxN HxBHj/ ///(LN? LN^NuBHxN HxBHj/ ///(LN>`/,O/ "n n $nJg0BB(HxN HxBHj/Hx/)LN?$nN^NuBHxN HxBHj/Hx/)LN?n`NVH 8$.I/ HxHxE/ Hx/GNJg/ HxHx/ B/NJfD .BJgD2.Ann n n/B( @Hh/ /N LN^Nu.A`NVH08$.I/ HxHxE/ Hx/GJNJg/ HxHx/ B/NJfB".BJgB0.A(@g./B( @Hh/ /NfL N^Nu.A`B`NVH<<*./.Nb$H&hL k(h/ NT|&Pf\pʀrf gT(.@Ap HHx/ N<$Prf/Hx/ N>: rg$JgUf, L<B(|B(/ Hx// N"Jf -|// /*LN Jg(<BB`NVH><&n /.Nb(H$hL*jp0Э/NP"*l *8Df0r€%A8HjNPXt#r0ҭ/N6 L<|N^NugV&+$ ,P CA$L@ (+@*+DBr HAc bJ*6kB.+gzp@ r@ @EBt|܎ < +g < *+0r// N3$HPJfp/ Hz 9:jR/Hl\N`p `Hx BHnN( +g&p(@Hn/N~ @BPt |`fp*`(///N)0%DP%BT%EX%C\p%@D%|u0L%Kh/ NO$`t`NVHx BHnN(|SHn/. NHx BHxu0HxBBHx Hn/.N+N^NuNVH?<*n *.$.$n,...& p 2  /Hy;XN;(H&hLpƀP+;f rgx`` @xcgbB cb c bT QgZ/// /-E-M/ // N#&:(pf /// /-E-M/ // NW`veԂ0;(N$. @c gbb dpgV @cfbBHx$/BB/ N(fr lL(6g 0.X=@Hx// N)0 `0 @df Hx / N<(PWID$zgpfB` cgb dpgfb@ c gb> cg, cf/ N(XfB*BJgTox` c fn&/HxHxG/ Hx/ $<"BNJg/HxHx/ B/ BN(fR/HxNHxK/ // "BN(f0 .BJg2.AB2.C) A *) C *) E *)A|| /B( @Hh/ / N(` cgb( dqg dvfdB -KL:( f4p H`*BB -KLN$,gHy* )/NNzP L< N^NuB0.%@@0.%@P0.%@D0.%@T0.%@H0.%@X0.%@L0.%@\HxB/ NHxpHx/Hx/ HxHx/*N$,g Hy* O`pG`HxB/ NdHxB/ NCif`FNVH?<$. /Nb$H(n&\ HhNc%K&'|,LHy+GDrNBhHnHxHxHy,4/ N- Jg%hh$*hIg(/N//Hy* rN *hL<B@/N-Hx/ N6PJg"/N/Hy* N %j@Hx@/ NB*xሀ*y@ @(f("hp8J*;kpBBHhN` p$n&nN^NuNVH8(. &.$.Hx BHnN(| .g| @D @C r@ @BHxB/<Hx//.Hx Hn n/(N+LN^NuNVhH?<&. (.$.&n*. r /Hy;8N;$HP @cg cgH @cgg 6 cgbZ @cb4 cg/.// /-D|-C///*NW$`N cf Pl"Ш@!@<`. cgb cg c f"pm 0Pg kl"kЈm(j-lx/+ HxHn/ @// I.N$fB.rB.ሄ.P~dtB/NT*H/+ ///+pГ 2 Ы// N$ fBቂ-pГ r n"k ЉoB-ሀ-JgnC-IlB- ዆- B<-ApIBBЁ-@hlVHxlBHnN( pmlhldC-It-|( ,?"A-All,fH,g@n@ .J,l6rF-A,gr@Jl:"ntB) ሀ) A@B"Xnl. ި o`-A-@n"nl) g~ gB @g0| (Xd~ -@ kJgtHxHn HpNh Jfd/./."ntHqHN Jg4`@ 0c f rmV$+ Plp BHx BHnK(N|@B +r€ tg4~g8Jgt`"tm +m&+Pl$+ PlB0`g|pBp BHx BHnN(| *<"A@@C@B +g|BB/<HxBBHx Hn/*N+$$`\ S~m8 +m."+m$(+Pl&+ Pl$+PlB2dgB2dgrBr BrBHx BHnN(| *<"A@@D@C@B + g|g.` rmb$+ Pl p BHx BHnN(|+ *<"A@@B + g|BB/<HxBBHx `$(<@&B L<@N^Nu.(<@&'hP'hT'hX 'h\`HxBHnN(| *PЪTЪXЪ\L<HxB @Hpp 'HxBBHxHn/*N+$0fp jp8`b I ,Pg8&+BHxHn//,@/GN$f,B.rB.ሄ.P~dB/NT*HB///,P/,@/ N$ fLB- ፊ- B-ገ-Pg/N/Hy* NDr IBEG輄mJg/ NU&X`T/ CHph/ N Jf$R`Hxl.+ޅ/HnN Jg$`l@!-@`` `fB."nx\lB.`l/// N2 Jg g/NHx/HnN(ydn`fR~f`Hn/ NxnPx$،~0Hn/N`n0|$P`Hn/ NDnP0|0`~ `JfHxl"+҅/HnN~lڇ JfR`8t`t`W @Hx$Hx I/ N B`jW `W @BIB/B/<Hx// Hx Hn`J  c c _fRr g3 f0+.A@|$p$"< `t`bt `\/,O//". . n$&v$&&BCHCC$&B@$vB$&6HCC$&CA$&N^Nu/,O/ nBrB(t婂B(ሀ($N^NuNVH?<&./Nb$H*hL(mG/. /Hzv/ NF$fHy,N\*Hy,N.PB,<!/NЄHx///-@ FNHx ./// FNR$pf( B/NX/ N# p0Ь/N/ N8p0Ь/N6/*Na/ N#E.N/ N/ N#/N/N L *$xf6J*yf0*;f k P/ h NHy* NDrPj:t`*l~ pf*n f, *xf"*y f~HlHy* NDrI|/ N^ JfHx/ N7P/ HyMzpL9:// Nt*n f *1xfJ*yftO L<N^Nu fHlHy* NDrp0 CШ/(< DNk:p0 CШ/K6N/<9Hx/ N>:$g6Hy* /NNzPp0 CШ/ DNk:p0 CШ/NP`Dt`t`:NV//$. &. r /Hy;N;/././.-C-B///N#V$.&.N^NuNVH< &. (.*.$p  /Hy;N;$HPJgX/NXJgN jLp 8QfpĀUf< f4/.//.-D-C/// N#+L<&n*kLB+xBkzkJBHx NT$HPJgzڎHxBHnI(N||| Hx B/ N,.F (<+pHl/BHxN HxHx / Hx// DN$JfHjNX n B*rB*t婂B*ሀ&*BxB*婂B*ሀ$** @xB*ሀ*@?7@zJ*kBRՁ/ NU&X "L<|N^NukJ`HxBHnN|%HxB/ N/BHxN HxHx/ Hx // DN`NVH<<&n tvEI(x K*<DHx0B/ N Jf4p(/ /Hx// B/. ENJgBSf L<LN^NuNVH0 $. &. r /Hy;N;$HPJf pL N^Nu/NXJg-C-B/// N#" `NVH< $. &.*.(. r /Hy;N;$HPJf pL<&n xvEI(z K,<DHx0B/ N Jf6p / /Hx// //. FN$gBSf L<|N^Nux`p`BJg0.Prd t`.X`? fB*&B*vB*ዂ*'AJgJgL/B/+/+N('AB*ቂ*JAf2<'A`TNVH?<$n&n (nA *f'| / Hn/ N$& f pL Jf .'@ /BIFNPJfB.ሀ.'@ /+ /*LNPJf'| r@&x 'D"z x騀'@B.-EB .B.x驂.B.BHFHG<BG.BB "'@'ABze4(*g*//-@-A//.Hy* NDr'B'C-k B/+/+/./.N(4$zv 橂'A$'@ Hx8BHj N(%jh %jl$ *\%@(%jX,%jP0%jT4B*x%@LB0*z%@PHjHj/N,B`@/ Hn/ N$&'B'C K((fHx BHnNxHx BHvHN|#| * E /BHxN HxHx HvHHx Hn/*LN+: Hx/ N:$ pf/NTX$`nt `$Jfpzʪ8f6*;fNBHkP/ N| Sf4JgHxB/ N= v`HxHx/ N=& g`p8r8 L 9:jR/HlN`t`NVH?8&.$n$./.Nb&hL.+,((( * (@XE(BreHx BHnN|* r@ r@ @C0 @B x I&<>HxB/N# >B>#>r#>#'>#>#>L(#># >#>BHy>NL/B/NJ 9> gJ>g`pLN^NuHxBHnN|Hn-D-E//.Nަ r@ r@0 @BxI`B`/,OpN^NuNVH? $n$. kg pf *gr@%@HxBHnN(| jD"h"Q )f|J*k |@ @B/.B/< BBBHxHn/N+$Jf((*(**,|~g&[I,.ޅ݄%F(%G,LN^Nu@`Hj `Fp`NV/ /$nHx BHnN(|+ J g| n "tA"tA"A@BB/<ۺHxBBHx Hn/*DN+%|0%|4%|(%|,$.$nN^NuNV//$. &. r /Hy;N;/. hD h h/(B-C-B//BHzNN $.&.N^NuNV//$. &. r /Hy;N;/. hD h h/(/<-C-B//BHzN $.&.N^Nu/,OH<8(n&. l@/Nb$H&lhXJg'C ,`'@"+$mJl'AI/ NX+f|p%@//+$/*Nݲ$* JBk$JgT%|0%|4%|(%|,/ N6/+`p Jf` j&+\"JAkV *0"*4|~gBLj8-C[I-G,...ށ݀%F0%G4.G%G`Jg%D8+ng.g .@@%@JgJf gBfB/ y:?(N*Pf m P/ h N~΂/Hy**EDrN J+llU  bԂ0;(N%D<`F +`g/Hy)n`Hy)NXB+slB3Xt/Hy)^TNRP`)@`:NVH 8$n$. fnHx BHnI(NGHxB/ N|4JftHx BHxu0HxHx/ Hx Hn/*DN+$Jf<.fF n `** gHx B/ N re "<gjLN^Nu|`p`NVH?<$n$. &.(.pgrgbJfR *"B0gBJo @%@p`Jf BL&[I,.ޅ݄%F0%G4`$ *gJov`Jg|̀%F *g ~΀%GS * gJl @%@RJg` *g @%@`gr`g|̀%F`~fT *("*,vxg~*[I,.ށ݀%F(%G,Jo B0B4`XJgR%|0%|4`>Wf8HxBHnK(NIHx B/ N|4|Hx BHxu0HxHx / Hx Hn/*DN b b8BA` c"B", Eb6 b$ b` Gfv)C lXJn0|` b` Gg`p@)@r G8B(B,B0B4%B*fHx@Hx/ N= `|`|,`vNVH?<(. *n$.&n..(n r & /Hy;N;$H*((P @8mgbV @mgb4 g./ // /-M-D// /*DNW` @mf-Kp-@ `l mgr mg mf-KB -JL<vt^ V8B-B -HLBHxB/N$Jf E.( @ g6| ̇g|G E!G`p!@p0 CШ/N/NP`HxBHnN( *f| G E!G2| E,( *$Dj|Lh At2AG@F E!F-j$.*0p" // N3PJfT/ Hz 9:jR/ EHhNp0 CШ/N/N`|2| `Zr G`r,HxHn/-HN)0"n#FPp#@T#GX#n\BD#| L#Jh/ NO,p0 CШJf/N/N/N /NX`/N%F%j$/ N "P`/,OH <$n"*, t /Hy;N;&H*hD(m *$Pg J8lp%@%j$-JL<N^`t( g("(LAJgN/Hy*/NNzt%B ` hH"+LnJg"l//Hy*/NNzp%@`t0Ԭ/N/ /+Na/ Np0Ь-@L<N^`/,O/ / &n$kp0Ъ/N/ NPp0Ъ-@$n&nN^`NVH>0 . $.&r  /Hy;N;$H&hD k*((*|̂PgLBBHnB/ N\$*fHx@B/ N= pUgvfB/ NrP`BB`+;gJf2Jg.pȀ * fBHxHx/ NF$/ N84/NTrë8 L |N^NuHx`NVH<<&. /Nb$H&n$ !BD B !|,BBHy+HjI_NBHy+HjNBHjNL$HxHxHjN{4HnHxLHxHy,/ N- JgC%IP (%@`%@ %hGId( *D*<(Hx B/ "EN ` g )k-+g @-  fHy+NM`Hy+GOHNP <*ѰJPg <*/Hy+i+/NObHx/N<JgNHy*NX/GN//.HxNٲ%H/NHxpHx/HjN$L<HxB/ NHxu0Hx/Hx/ ///.N.,gfQfTpfttB`$*DHxBHnN(|C/BHxu0HxHx/ HxHn/N+.0f&B0.%@HB.rB.ቀ.%@L L. fB.rB.ቀ.%@TB.zB.ቀ.%@Xn\-jJ.l6pF-@%n *g/HnHjN)0 z8`JrF®-A`-C L/*ګ/NPJfdB0.r%@/ TЫ/NPJf@X8.j zl/ Ы/NPJfB0.r%@ / TЫ/NPJfX4.j`v8x(gpmzgTr gXtfB`v0gbx8ft$vgm` XATJfdz %E/Hx/ N `z%E`:p%@`0r%AHjHx/ N`t%B/ / /N`Wg"pLD&fxȆfp?̀zʆDk"Ap~gp~gxJg "fjJWIDJgJg g&CJCjrF#>D y>@!Cp#>I><(#>@#<>D#8>HB0*Fr㨀jH*B>*J @f *P*"t5AF5@Hv֎//$<| BNPJgp '@r'AB0*Ft`*8.B02A Ag,v'Cz'EB0*F|jH'@ v L>G/&T/ BN&Pff<.B:#>p#>JGfJFl"9>p?$9>@8D (TgD~ #> gVC*4\|0†JDg*Jg"Wgr9l*p'@BB0*F~`Jg"Yg~;m/Hy>Hy>/ N&Jf~ι>gFp~|rF…-AzFK(\".…f*ކ rdB0*F~切jHй>`B|`r LЂJDgL/Hy>Hy>/ N)Jg|f,B2*Ft婂jHҹ>$v5BF5AH`/Hy>Hy>/ N`TJDg|9mJgr|gg~grg|"#>/Hy>/ / N&Jfb9>g~>mtSfxJDgxpg B-h8Ag"B <g"B @HnHy>Hy>/ N)Jf`~`z`X|`TrfJDfK/ Hy>Hy>/ N(\Jfpgf . B!@8Ag "B#@<"9>f6B0*Ft娀jHЁ"|5AF5@H`A`A` M`"B#P@`0@ @`f(/ Hy>@y>F(~ t%p L(Ԉ/HxHy>L/ IA-HN nfr LxHpxHxHy>hHy>p?>(Sgz/ /.N&JfTp>f r>mnK/ Hy>Hy>/.N(\zf>". JAk&-@B/ /`p`dp`^p`Xp`R`pfpFJ.jrF-A`Hy><-HNL~ n`Hy>lA>h`Hy>lWID#>l`Hy>J>lWID#>lHy>h`B0*F|jHй>"~5AF5@Hp`jD Df9>gvHn X/ BNPJgp `:pᭊnT>/9>N"9>D y>@!A<¹>HXfprf(T#>B0*Ft娀jHЅ`PJFl`JfB0*Fz`N G@f(T/N-@Xo~fv'C$B0*Fz` y>@!y>D<"9>x8ȁzg6|8gp#>/Hy>/ / N&Jgrf8`Jg ~#>`\p€ 48SDJ@gPHn"ҭ/ BNPJf2.B0jй>#>p>Bt p>t `p`tāgXt‚zg|gUfr`rT#>Jg`HnHy>/ / N)tgJff`Nq/,O .". gHx//N)0 N^NuNVH?<(nG,/ x؎/EN/ v֎/NtԌHx2/NB/ *< "EN/K/ N$p,<A.<--@ c/ / N K L<|N^Nu//N// N/ NY//NHnB/ / FN(."GNXJg .r?m//-HN n// N/ /N/ "EN// N .R$`hNVH<<&n +,E,kUf"J0gHx/ NBP J L<<&n$n **k&* r $xg@rg>xgpfp %@ k p?"Sf x L<|N^Nup`p`pB`p`r9mI// / /N&(fp lr(g|H5p L8Hu9 HxHsh/ NAK/ /Hsh/ NL~./ / /N)`dx`^Nq/,OH 0$n"*A%A *,tf / Nc&Hj X K L N^NutfGHHj4B/ / NA`TfA@%AG,`/,O/ /$n"*A%A *,tf/ Ncj X $.$nN^Nutf B4A,`TfA@%A`Nq/,O .". gHx//N)0 N^NuNVH<<$n *,jG, K L<rP// NbP/ / NK$*"cJgD(L<\GN 9>dP,<>\IrfD >lbL-@B4B>dp#>B>B>$9>lB#>B>B>B>r v~ăHy>/ N~%G/ (< "DN// N%G,B8B0*<,|p L @%pX4 E"( v %@< (~&~ %A@r%@D/ &<Y"CN/Hy>$N HnB/ / .<A GNHx0/ NB/ "CN/Hy>N .>$/ NHy>$/ N/ "CN/Hy>@-HN n// N .:CHx/ / GN/ "CN// NHy:BHx/ / GN(."DN// NHy>@/ N/ "CN// N.:BHx/ / GN/ "DN// NHy>@/ N ."CN// NHy>$/ N/ "DN//N.>@/ NHy:CHx/ / GN/ "CN// N .:CHx/ / GN/ "DN// NHy>@/ N ."CN// NHy:BHx/ / GN/ "DN./ NHy>@/ N/ "CN// NHy>$/ N ."CN// NRp%@,B8B0r L( B%pX4 E"( t %@< (v$~ %A@%@D/ "DN// N// N."DN// NHy>/ N/ "DN LlJf BbHx2/ $<B"BN/ &< "CN/Hy>@NHy>\/ NHx2/ "BNp%@0 ."CN// NRHy>@/ N/ N-$/Hy>$N./ N// N/ $<Y"BN(/Hy>@N// N ./ N/ "BN(/Hy>N// NHy:BHx/ / (<A DN(."BN// NHy:BHx/ / DN/ "CN./ NHy>/ N/ "BN// NHy:BHx/ / DN(."CN/Hy>\NHy>/ NHy:BHx/ / DN ."BN// NHy:BHx/ / DN/ "CN./ NHy>@/ N/ "BN// NHy>\/ N ."CN// NHy>@/ N/ "BN// N.>$/ N/ "BN// NHy>$/ N-JL K $n&nN^NuNqNVH?<$nCA, *,b  I"@"k" Uf(Jf-JLn(m*pE>x"p"2beXrfB$_N^Nup`p`/,OH?<$n*. *kJ,n-JLIRNK,/ Hy>xNA>&9>$9>|B>|B>,gzp>xg (9>>// NPJm4. B/N XJg8o&// NHy>x/ Nr%A0/ N .RJgJS܆ GR`R GB&Gr†r *%B j!B< K L S#>/NpX#>JnfgR// NHy>x/ NJWID%C0/ N &HX`fB``/,OB/.N^ N^Nu/,OHx/.NH N^NuNqNVH?<&n +,oNJ0g L*r" |ҁ$ԂDڅ$ԂDЀ4|&<@-|-DB( "D-@B-DB(.*.,.Ț̙B~fRI[I-E-F-BB,...(.*.ޮ݅BzfR.I*؅k$* Er®, (F"ҁ(؄DԂ(؄DЀ(S-CJf8'HD'A8A, L n(. pRml&("($( ( z?lH$BBzʄgx ,鮀,鮄,鮂!C!A!B!@ L|N^Nuzl$"`BBBp`/,OH< n"h ("(*(JfJg@ "B eD v xԄ*(嬂!I!@!A!E`Jg `BLJfn0@Nu nTa JfP0@Nu nTaJf20@Nu/ nTaJf" vgH<*&`/"YA"6 fH$ZIЁ$Nu| nNu nTazJf0@Nu nXavJf @Nu nTaFJfv0@UNu nTa&JfV nUgH<*&`0/"YA"6 fH$ZIЁ$NugB`$$6$ fHBgB m4g nXaJf` nTa~JfHրgj m4g nXajJf` nTa  K`.fHDBfCBJf6.=44.=$.V Q na Q naNuDfBJf6.-44.-$.V P na P naNu .`.fpad-HQ`paT-HP0."H@$6A(6=A.V$H" a(Jf J`.f,DDBJf6.=4 nQ.VaNuDBJf6.-4 nP.VaNuN{`N{` .g$ n.V`@N{`N{`$H/ad XQQrAC"Q=|@ -J -@L?N^`BCpmCpmNupNuJfp`pJg$H&I(H*IVV" @|Nz`N{N{jlkm$AV(A$|&|(| g g`QN{``ffX``N{HN{`4`N{N{``NqNqNqNqNqNqNq`N{`N{`FQ`BN{`N{`FP`0QQQQQQN{``f,f(X``HDXHN{HD``PHN{`Nq`H@XN{H@``PN{`vNq`NqNqNqNqNqNqNq`N{``f.T o n aJf`jAa`\0.T o n anJf`<Aa`. .T o n aVJfh`Aa0`NV@.lH.`.-nhD nDXDa-@@ f*Ala..`LnlN^`d.A0{NtZB.p o n avJf`Aa`0.p o n aZJft`nAa`` .p o n a>JfP`<Aa`. o. .l".p n aJf` .l/".p"Aa` .l".p-@p ੃".p-A".t੃A"n paJf`zB.J=nlBn .p-@-nt.f8Nh-H-Va"H-H nN`,Ap alJfJ`-Va`"H-H , .Jf..`Lnl,n/o/o/o/oD/oH/oL`4NV@.lH.`.-nhD nDXDa-@@ ff" n@lf<.@p.hl=|nAlad<<B gAla@N.Cg..Cf&BaAxaZ fa@OB.c.CAAlCx";0YN0YBa..`LnlN^`B.c.CaC`|NB.cdAla`NV@.lH.`.-nhD nDXDa-@@Ala..`LnlN^` o ,g o@,gNV@H-nD nDXDa8 Afd fZNzg*LN^Q>/o ?|@,/o X`@LN^/X//o| `LN^`NV@H.`..fNh-H` A-H-H-nhD nDXDav-@@<<B.JfB.Sd gaB.c.CA?I.NCxAl2; N .bfBa..`L .Jg* .Jg"N^gX'/_?| $`4.f / nN` _`/ .ؐ--=@ N^`B.c.CaAP`Z.ff.fgN.bgD`> f.ff*.ff0/a ={n`*a=|n` a=|n..`Lnl` gV fxC mlax .Jg .Jf-nh =|  ..`LN^` nDTDaRJf|Ha~` .Jg|`ab .Jgh.f nN`` .Jf..`LN^fU./o`~U.?o?| $/`R=|-nh =n=|n..`LnlN^X`..`LN^f`/|$`J(KKLOL)O<5KKOL7O<$KKOL'fO<)KKOL*O<KKOLO<KGDOLO<7 KGDOL7O<hKGDOLLO<*KGDOLO<"KKzOL$O<=KKzOL=O<=KKzOL?*O<3G2KOL58O<7G2KOL7O<8G2KOL8rO<'KKROL(O<KGDOL@O<rKGDOLRO<'lKGDOL'O<'KGDOL'O<LLMNLNMMNNMNNNNNNNNN`KL L0L@`KL L0L@`KL L0L@`KL L0L@`KL L0L@`KL L0L@`KL L0L@`KL L0L@L.`.-nhN^/?o?|@/o/| B g `2jwɔ= zZE*>41*Y?Y=*㽩9oE>!r~O># ` a8?^-|\`-|\H.h"2( ?׀l`x @~m`h:T~Cpf.`X".XH(D(".XҮ\ m' .h#:U:U#:U:U"#:U:I" #:H.H##0.H"`Cd' #:U:U.h#?-AT:U"t:Uv#:U"p:Iz# :I"|:D#".H#0.D"T`B ?n".\ n<.H`BT'Y򺥨O4oY_?sJ?<ք_B;~ K?nND*@ڢ?ڢ!h5![]|#~R66^"F!HM; `x0c!\᣻%!bΪ׹X!e$K :Ovgzes!SJ Ӡf!81e{0ՠLCNXڢ!h5!~R6hM;\᣻% !`:OvSJ1e{ڢ!h5 M;  SJڢ!h5  `ڢ!h5ڢ!h5?ڢ!h5@ڢ!h5@`@ڢ!h5@SJŸ@@M; @ڢ!h5@1e{ @SJŸ@:Ov!@`@\᣻%ˠ@M; @~R6!h@ڢ!h5@ՠLCNX@1e{!0@Ӡf8@SJ @gzes@:Ov!@e$K@@bΪ׹!X@\᣻%ˡ@`x0cݡ@M;! @6^"FH@~R6!@[]|# @ڢ!h5H"2( ?׀l`4 @~m`D:TC`H(D(' mr:U:U#:U:I"#:I:I" #:I # "UUUUU6?ڢ!h5ڢ!h5?R zQ?TEeI?@`bk ?5?R]?CbvV?Řb?y~Ck ?g9F?TLa??b$S>?(ځb@Lw?O??񔝾y?Xa~>?F! Y?#*0B?pҚ?Go\?v0IT??hЊR0?-S?E>?_^>?](? -?شk^z?W*k#5?*pꜪ?2d? (ff?/҈3-2?ѱ!Md??#?l?I8'?rD6?zr'?,7?0: ?!?3!?Ƀ0 p?րz,[?#1%*?㲨Uk?-vOd1Y?[Ѣ? \?0f?E?ۏdP?s 6^S?核ͺ?(2ڮ ?Fݷ`"?>}֢?hoj?ĐYİ?D}px/?AD?Jf(? L?IqY?ԄWN?۔;?8Ui j?w)52Y?Wn 7 ?|7y?uA?d_?UI{h]?5I?vQrK?.1?s/ѕWd?8*5?0?F.R?-ב?џRA?:DҠ?o ?w?2?U2V$?ulq?|l?&Yc ??_aҒ?~?*Qsg?:QS V?: u9Tn?rE;&?LoՏ?JJ`k?*-͍&<?eo"e?eqIj?o5?{D7f?Xc3?%RV"F?̩_?z?6X8?ϫ(~{6?^f!5?Z ?AJ?+{?Gv7}?Go?+hy?0j9G͆?1j?1 p?\1? 1(?kzw?Fc?ދT?efϿd9?4_V4 ?"H"2(.h ?l` @o`L-|.H.H(wF>h?*?Vlp??UUUUUU?H70??dt?͆+؟չ?:(ì@Hri?gH{\?a\?څ()?uIn{? ?[~[ Zc?9ESQ?1Cfn)?s8x?Z+/,? ` E}?-7 Z7?7QpR?E d0?9NU8?>٧,PIM?2` PH?QqOĠsi?pC Ihz?5 怠yq&?֩Q8q@?͓e5h Ob?Z|(8?X>BJȠ[??;xi Ct&?#Ҭ%p_?$ g?3d2?(w 0?Gb ?Z>E*?X 6+p?zs ?,LfpXAA?F$d{?g*U h?Ǎtȫ\:.?ɹn/'??r|\}?$nS?c3+%\?Ҩ*\v?Z !?D֝j/?ٝx״ C?7T ?`^$u?* ,K??rZP ?|Hrz?9jP t?:" ?l`2( @ gm` H<"` @ n<:T(:T(/B'Aa| <:H#Z` <` `H.h"2(-A ?׀mt ?nj".-A\-A\.H/B'Aa I?`=f?=H?H+e?ˍ?.4R8?)uC?뽲a?90I?e{v?.?%* ?z:?xǀ?dUQ?\L7W?V{=H?aќYX?{?d?7/ ?++,?8ΐk?h 6h ?)H?жX ??w% ?3lfP?ˇ'eÓ? Z}܊?NF?n^ɲ?Ƙ iƘ ?,?7/]L?,_rV?ՕG?D L?/ ?JО5?iGf?>ꦲ?>!M ?!45??!C6.??Z6Y?*b? 抛?d<{?cR ?uQ]a?Ӹ <?*=?:ƀ:?XJ?`+X ?Lj9;?iY?V]?JGV8?B-Q`? ?׉I;X?U9-{s?Ĵ?7Q?>mjk?^?|? x\/[?k1.7}?9,Qy? ?$@a0?L#_: ?Β4f?`? ӁEc ?Lo:<?pB­?"ڽ?^I60?h ?zz?.\ ?"L.d_?%h ZW?{}?EEF?U??%? ?f挕[l?Z8c>;?tǾY?yâ?VC?R7iH ?# B?e#?XȐ뉐?p4JZ?:=/?BpViF?"O|?:遛P?&z??s;?Dz4?TF?7a,<?3~gq͋?J?H` CZ^?0R?3h?Y#<̤I? ?emkI?w?m`$h??q٧,Q?2`?QqO?n?pC Ih ?5 怞??֩Q8??͓e5jt?Z|?7??X>BJ??;xi Cug?#Ҭ%_?$?E??X 6?zsQ?,LfpV??F$d??g*U??Ǎtȫ]?ɹn/' uЀ"2(.h ?l` @ o`|R l`B.@Nu.@NuNuNuNuNuNuNu.Og g g g g@`J.Ogd gZ gP gF g`.OgN g( g g0 g`()AeJj`B.e/()Ae .Of A `)HJ)kNu|dNu.Og g g g gH`2.Og\ gR gH g> g`.OgF g" g g, g`.Og g g g g`.Og g g g gl`V.Og gR g8`f.O g4 g`X.O g g `6@d`)HdNu)HJ)k|dNu| dNu(HdNu(HJ(k|dNu| dNu.Ng6 g g g g`.Ng gn g gV g~`h.Ng g6 g gj gF`0.Ngr g gj gڼ g`.Ngj g gn g̊ g`.Ngv g g g g`.Ngb gV gr g gf`P.Ngr g g: g8 g.`.Ng g g gB g`.Ngz g* g g g`.Ngd g g g g`p.Ng$ g g g6 gN`8.Ngx g g` g g`.Ng g g( g g`.Ng g g g g`.Ng0 g g gն gn`X.Ng g gB g4 g6` .NgL gj g g g`.Ng g g g g`.Ng g~ g g g`x.Ng g g> g g:`D.Ng g g g g`.Ngn g g gP g|`.Ng g g4 g gD`P /g>|N|O.xACx g gaNuaNuaNu|N`Jmnl#N.fF~ &^T>vLV##   r|:D@0@`0-@\BA.O .Nf=i-i-i=h-h-ha$/a%rї2.^ gmbgnJ.Ѐ.\<.H#<d./2.$BB=A$.ЀNu.Ѐ.\<.H#<dHd.bf.dV .\aÓ.dЀNu".\f4./2.4`ABB=A$.@`.Ѐ".\0.H#<`.Ѐ.\<.H#<dD@@`2.A@A=@.@Nu @f~=h-h-ha* l gpm<.\.H<d/.2.$BA=B$.ЀNu=h-h-ha l gmp`f.b fA".\a?:.d.ЀNu-n-n2./$B`AB=A.@$`<.\.H<dHd.bf.dV .\a?.dЀNu/2.$B`AB=A.@$`<.\.H<dП gmd @gn".Ѐ.\<.H'<d./2.$BB=A$.ЀNu.Ѐ.\<.H'<dHd.bf .dV .\0a<.dЀNu./2.$`ABB=A$.@`.Ѐ.\<.H'<dЀ$NuNu@C?<Hd.bf$ .dV .\a6j.dЀ$Nu.\f2A`BB>@`.Ѐ".\0.H"< '`f .Ѐ<<.H"<d.b f".A".\a4.d.Ѐ$Nu.@".\fN.\<.H<.@2.$B`AB=A.@`".\0`".\gt"/ ffJf^.fgT.@".\<.H<8`2; NJ0`fl`f00 `0f`````f`fffffff` |` v()kJk.Ѐ$NuNu@C?<Hd.bf$ .dV .\a2.dЀ$Nu.\f2A`BB>@`.Ѐ".\0.H(< '`f .Ѐ<<.H(<d.b f".A".\a0.d.Ѐ$Nu.@".\fN.\<.H<.@2.$B`AB=A.@`".\0`".\gt"/ ffJf^.fgT.@".\<.H<8`2; NJ0`fl`f00 `0f`````f`fffffff``()jJk. @f=h-h-ha ~gn gm <.\.H<d/.2.$BA=B$.ЀNu=h-h-ha gn g$m`~.ftf<<.H<d.b f .A".\a-(.d.ЀNu-n-n2./$B`AB=A.@$`<.\.H<dHd.bf.dV .\a-.dЀNu/2.$B`AB=A.@$`.fx<.\.H<d .Ngp@dAl`BdAl`4@d|Ax` Ax .Nf @dd(gdЀNu d;ЀpNu-@T0.BB.d2;N4@  4H\fR>*J8:vTL(zZ`*Nu` Nu".dgd.bf,`Nu`.dgd.bfNu".dgd.bf`.dgd.bfNu`.dgd.bfNu".dgbd.bf~`LNu`B.dgd.bfVNu".dgd.bf4`.dgd.bfNu`.dgd.bfNu".dgd.bf`Nu`.dgd.bfNud.bf`\Nu`Rd.bfnNu`:Nu.dg.d.bfJ`.dgd.bf,Nu".dgd.bf `.dgd.bfNu".dgd.bf`.dgd.bfNu`rNu`hNu`^Nu`TNu`JNu`@Nu`6Nu`,Nu`"Nu`Nu`Nu`Nu.AAafS@a @fNu .TЮhX-@Nu|JNu0.BB.d2;N@ &F $`L>~l@NuNu.dgd.bfNuNu.dgd.bf`.dgd.bfNu.dgrd.bfh`\Nu.dgLd.bfB`62.dgd.bf NuNu.dgd.bf`.dgd.bfNu.dgd.bf`Nu.dgd.bf`.dgd.bftNuNu.dgZd.bfP`D@d.bf6NuNud.bf`Nu` .dgd.bfNu.dgd.bf` .dgd.bfNu.dgd.bf` .dgd.bftNu.dg`d.bfV`JFNu@Nu:Nu4Nu.Nu(Nu"NuNuNuNu NuNu|JNu|JNu0.BB.d2;N@ ,L\<PD`>rx,B`.P`(B`P`B.dgd`P`B`P.dgd`B.dgd`P.dgd`B`P.dgd`tB.dgnd`XP`\B`RP.dgFd`0B.dg*d`P.dgd`B`P.dgd`B.dgd`P`B`P.dgd`Bd`P`B`~Pd`fB`jP`dB.dgXd`BP.dg@d`*B.dg$d`P.dg d`B.dgd`P.dgd`B`P`B`P`B`P`B`P`B`P`|B`rP`lB`bP`\B`RP`LB`BP`<B`2P`,B`"P`B`P` .bf @.A 8f"A a*Nu g  g8  n aZ|JfTNu  n aZhJf@.AApa"Nu  n aZDJf.AApaNNu|JNu=| `+.CAp a/; H/a@ "g4.Bg.Bf; .g .JfNu"HAJj j j  j  j  j  j  j  -ITA/aX JfNu-HTC//aX~ Jf"AJj -X-X-X j -X-X-X j j j j j jNuNu  $ $$$0 $$$0$$0$00< $$$0$$0$00<$$0$00<$00<0<~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_? @0.@2@?0; NJ@&4>HR\fz &B```````` nNu nNu JNu KNu LNu MNu VNu nNu ."҈-A @Nu ."҈-A @Nu "҈$A @Nu "҈&A @Nu "҈(A @Nu "҈*A @Nu "҈, @Nu|J ."҈-A @Nu .-@ @Nu .-@ @Nu $@ @Nu &@ @Nu (@ @Nu *@ @Nu , @Nu|J .ؐ-@ @Nu nDTDaTJfh 0@Nu nDTDaTJfh0@Nu nDTDaTfJfg0@Nu nDTDaTJJfg0@Nu nDTDaT.Jfg0@Nu nDTDaTJfg0@Nu nDTDaSJfgt0@Nu nDTDaSJfgX0@NuPa/ nDTDaSJfg0 _f-@T"YAa/$.T fH"YIЂ$Nu nDTDaS\Jff0@Nu nDXDaSXJff @Nu nDTDaS(Jff0@DUNu nDTDaSJff nDUf8-@T"YAa/$.T fH"YIЂ$Nug H<*&B`(-@TaH<$*.T& fHBgB m4g nDXDaRvJf` nDTDaRHJfHրgn m4g nDXDaR4Jfn` nDTDaRJfVH`B(g CaR@Jf(ЂЄ`ւ CaR*JfЄ`ւ  @LP.lNu|NNua X.lNu|NNua -@TATa@N g g^D.lNuB.N0; NJrVpa" .Jg&aMJf@.lNu|NNuaMvJfn`pa .Jg&aMJfP.lNu|NNuaMJfnD`pa .Jg&aM&JfBX.lNu|NNuaLJfm`paP .Jg>aM -@TJfATa@N g( g^.DT.lNuaLJfm`BnlW-@pBtBnlglAlax2Nu2;N $(,0@Nu@NuNuNuNuNuNuNu2;N $(,0ѮNuѮNuNuNuNuNuіNu|J gѮNuTNu2;N $(,0NuNuNuNuNuNuNu|J gNuUNu0;N(@LXdp|-nl-np-ntAlNu-nl-np-ntAlNu. lAlNu.lAlNu.lAlNu.lAlNu.lAlNu.lAlNu0;N(@LXdp|-nx-n|-nAxNu-nx-n|-nAxNu. xAxNu.xAxNu.xAxNu.xAxNu.xAxNu.xAxNu0;N *4>HR.Nu.Nu' Nu'Nu'Nu'Nu'Nu'Nu?<2;0h @BjB.fgaNu < 1ABBNu-hT-@X ho A m A@mP` .XNu/1@p A Am.X.W T!B!Ag$Nu/1@A p A.X.W f Tf ` B!B$Nu1@ AAmg$BB < Nu ("?` (fJfJ.Xf BBNuBBNuaJgnf2{N@$J(kpHA g>n`dJ(jpHA g"nx`HdHA g n``0d RhJfhBNuRdRd RhJf( NudRd RhJfh NuHA gnNuHAJfHANuH0 f"6t$(?f(Jf"Jf` 5Bt$(fJf` L HANu// ("( g0"!@!A &$Nu  !AB &$Nufgt@ B2(AAn@0(@@1Aa<Nu  n @!@ (!@h<NuA (!@Bh<Nuh<Nu0(@ @gH(g<NuJ@fJf Jf<Nu<NuJfJf h<Nu<NuJf (f<Nu(g<Nu<Nu ("g g(<NufJf <Nu<NufJf <Nuf <Nu<Nu ("g g<Nuf <Nu<Nuf <Nuf <Nu<Nu/(V2(A@1A/ /@Ha W2/AIHA2/A0Ia" _J(g B(BJf Jf.fggXNu/(V2(A@1A/Bad W2<HA2/A0Ia _J(g B(BJf Jf.fggXNuA0 `AH@0 ;A Nu      @~@~CC~~p a,Clp a8fJf Ol @fNu.ofJpfJtfNuAla.lNu-h-h-hAH<'tv(BL< ҀXQgDlD@@/rHGRGQHGOLNupa=|! `~pa=|A `npa=| ``pa=|a `Rp a=|a `Dpa=| `6pa=| `(par=| `pad=| ` p aV=| -nh..`LN^//o/o /| ?o ?|@g `-.A8 g  g`Nu.AA2;N $(,0NuNuNuNuNuNuNu .0 f.f NzN{NuD`/,O n / n/N)/`PJWIDN^Nu/,O//&./. /NP$Pf /NX $.&.N^NuNVH><$./Nb&HXJh,f$h0JgI K&<(x؎zڎ,<CJgh"n rgfXJ$fR-R-k$-k(-L-JHxB/ "CNp-@-|3A-H/Hyc//"FN%H$$jJfBL<|N^Nup`/,OH 0$. &n/Nb$HHy+NM`Hy+NOH$%k%kB8BBB/NJf-|) -BL N^`pL N^Nu/,O//$.&. /Nb h0XJf/N/Hy*/NNz`Jg$fB$$.&.N^Nu h`/,O n"h,"i . ЀШD//(0 iNN^Nu/,O n". pg "h,"iҁҨD-A -h0"iN^NN^Nu/,OH<B*J g SUg/+/+Hy*/HjNE`NVH80&n$. k x ب EOHJg /Hy+i+NPHx&/JVID//Nb/ k /Hy*NpL N^Nu/,OH8<*n&n(.$n &<)/`JfE`< "*tfJfHJfS`ذf *tgభfJfJf J L<N^Nu(m ,gt` (m ,gB// CNPJfP * gJ", gD// CNPJf6 *g",g*// CNPJf *g",g// CNPJgvJf JgL`nB// / N$ `t`/,O/$. /.NbX"h-B -h"i0$.N^N/,O n([g Hy*1NK.!n (N^Nu/,O/.Nb (<"R!AJfHx / & P/N)0)C `tt`T`  g4b4Jg g grbvJg0 @g.RR$`^ 0f j h * TЂL*//* hN@ j h * VЂL*//* hN j h * XЂL*//* hNr㨎. j h * ZЂL*//* hNr㨀+@X `B` j h * TЂL*//* hN+@RP` j h * TЂL*//* hN j h * VЂL*//* hNሀ+@T` f j h * TЂL*//* hN@ j h * VЂL*//* hN j h * XЂL*//* hNr㨎. j h * ZЂL*//* hNr㨀*X `B` j h * TЂL*//* hN*RP` j h * TЂL*//* hN j h * VЂL*//* hNሀ*T`Ht'B Bp'@$ `~r7A$`Rp'@ j h * TЂL*//* hN j h * VЂL*//* hNሀ'@TBBJl󈴪d j h * TЂL*//* hNBR&+CPgC'CgkDjkvƀ'CxF„g j h * TЂL*//* hNBRP`r'A j h * TЂL*//* hN j h * VЂL*//* hNሀ'@*T j h * TЅL*//* hN j h * VЅL*//* hNሀ'@X'@ `FVBJmBJf lRh RKB"nljJg j h h"* T҂L* *~f//NP*ԄJf lRh Jg j h h"* T҂L* *~f(//NPԅ+@Jg~ j h h"* T҂L* *~f//NPԆ+@R,`,`~f>//N j h * VЂL*//* hNሀ`//N@ j h * VЂL*//* hN j h * XЂL*//* hNB~懲.`B`~f>//N j h * VЂL*//* hNሀ`//N@ j h * VЂL*//* hN j h * XЂL*//* hNB~懲.`6B`2~f>//N j h * VЂL*//* hNሀ`.//N@ j h * VЂL*//* hN j h * XЂL*//* hNB~懲.`B`NVH?`|Hy*J`rHy*\`h/Hy*gNP`\*&/"BN///Hy*N +gSgTHy*`Hy*NXB0+/Hy*NPJ f2JgHy* N& XBm\ +g /Hy*NPHy,NX+g Hy*)NX+g Hy*9NX+g Hy*HNX+g Hy*SNX+g Hy*_NX+g Hy*dNX+g Hy*jNXJ+j Hy*tNX+g Hy*~NX+g Hy*NX+g Hy*NX+g Hy*NXHy+N&kX`Hy*`/+Hy*Nv֋PB l C/Hy*N"C )Pg @HhHy*NPRp$ր` C/(Hy*N"C Pg @HhHy*NP C (g /Hy*NPRp,ր`XNVH?<&nI-BEBB,<)0C0-I.<)/` +$frg +(ff@ +g",g// GNPJf +g", g//"GNPJfJfHJ:CDg4/N/Hy*$<Dr BNK JfHy+"BNX/.NoJX$,gHy+͘"BN/-Hy+i+ BNR pf`/,O n"h pf(BHx HxHy-/NcJVIDN^NuB`/,OH0 $n&* / Hy Hx/Nj8%Hgp/Nf$Xg/*/NjBP L N^Nu j h (( bg rr5fB/NazPDjr€/B/Na `t`/,O/ $n/* Nh/*/* NjB $nN^NuNVH0<$. (n/Nb$H l %H &hX& JfHy*U/NNz`Jg&k`p f l "h i h"+ ) bf::| l h +"h//// /( iNJg"f`////+/NJf%j%j/ /, Ne.Hj/ + @ //, NijJg4Hy)ZK/NNzP j h "h//( iNPp%@`/ NXJg/*/* Ni`r%A ,re("<@gG/ Hy/.N JfGBHx HxHy-/ NcJf Hy*NK.|F%h@%|%|&/ B0(// N JgHy*6/NNzPB/ N&XL< N^Nu/,O/ /$./Nb$HXpg>/. /N PJf./*/* Ni j h "hHj/( iNB$.$nN^Nu/,OH 0$n&n fnpdfB j h * VЂL*//* hN( j h * TЂL*//* hN(TpfpL N^NuB`/,O npf ( Sf BBN^Nup`/,OH <$n *G-t(L.()-frg *(ff> jJgDK( -gF//I)/`NPJf4 * g. m Jg//NPJfA(". f L<N^NuA`/,OH8 n"h &((BEL///N JfRpHfBLN^Nup`/,OH0 $./Nb$HXpXf*&(T/N/. / N b Jf /NnXBL N^Nu/,O/ /$n/ Hy ކHx/*TNj8%HPg2/*TNf$Xg/*P/*TNjBPP $.$nN^Nut`/,O/ $n/*TNh/*P/*TNjBP $nN^NuNVH 8&n$. $nk6 kT h "hI/ Hx /( QN Jg Hy*}/NNzPA LN^Nu kT h "hHnHn/ Hx /Hx/( iN$g2Hy*/NNzPE kT h "h/ /( iNP J` n h ЀЮ//. hN(RPpf kT h "h/./( i NP`/,OH 8&n(n 4|B k8 h/ /+< hNRPp f f6E k8 hHj/+< hNRPpf L LN^NuI`NVH><&. (n/Nb$HHy+NM`$ , %@THyx/NnVJg-@-|* -CL<|N^`2 l h("h%I ( %@r fB%I8 iHj j hHx /* hNP pf %| p ,%| p40%| p%| rL$// N _PJfBHy bbHy b/GNJfHy*/NNzPBHy bbHy b/NJfHy*4/NNzPp%@X/ N6XL<|N^Nup`/,O npf (fr fBN^Nup`/,O/ /$./Nb$HXpf/. /N LlPJf/*NnXB$.$nN^Nu/,O/ //.Nb$HXJ gb/Hy OHx/(Nj8%Hgd/*Nf$Xg"/*/*NjBP $.$nN^NuB/ N LxPB`/(Nh/*/*NjB `t`/,OH 8$. &n/Nb$H&k !KHz/ NnV Jg-@-|* -BLN^` k(%h%h Hx/INPJf,/*/*N KPJf*Hy*//NNzB/N-KLN^`ӂ%L0p%@/ N NHj NTp%@PLN^Nu/,OBHxHxHy-/.NcJVIDN^Nu/,O npf f BBN^Nup`/,O"n i pgv hBJf.rgfBHxHxHy-`/ NcJVIDN^Nu"( g*b g$ g h` fr`r`r`r`p`/,O/ /$./Nb$HXJg&/. /N PJf/N/*NnPB$.$nN^Nu/,OH0 $n&*/ Hy *Hx/Nj8%HfHy*R/NNzPt L N^Nu/Nf$Xg/*/NjBP` j h (( bg rr5fB/NazPDjr€/B/Na `/,O/ $n/*Nh/*/*NjB $nN^Nu/,OH 8$. &n/Nb$H + !@Hy/NnV Jg-@-|* -BLN^` k h(Hx/( /(HjtN / INJg-k LN^`Тp%@X%| p%LP%|FT/N/Hy+i+NOH/ N 5dHy =Hy >$Hy =/N JfHy)/NNzPBXp%@-JLN^`Nq/,O npf ( Sf BBN^Nup`/,O n (frm cB N^Nup`/,OH> n(.&."hp\L$ih*<|̮ Jf L|N^Nu$ c$ j@ h *D"Jg f//B/ hN؂`//B/ h\`/,OH> n(.&."hp\L$ih*<|̮ Jf L|N^Nu$ c$ j@ h *D"Jg f//B/ hN؂`//B/ h``/,O/ /$./Nb$HXpf(/N/. /N Jf/*NnXB$.$nN^Nu/,O n"h pf )\rg&BHxHx Hy-/NcJVIDЀN^Nu/,O/ //.Nb$HXJ?gt $.$nN^Nu (J gT(g*/*Nf$Xg^ *g//*NjBP`HhHy rHx/Nj8%Hf`/Nh *Xg//*NjBPB`n/,OH<<$. (n/Nb$HHy+NM`$ , %@Hz/GnVNJg.Hz"/, NPJg-@-|* -BL</ / NPJf&-|* -B`NL<N^Nu/,O n/N/NbHx/N\N^Nu/,O n/N/NbHx/N\N^Nu/,OH0 $n HxB/ N( BB n0(  b&gD"BRr fpL N^Nu b` b ``B`NVH 0$n f\p fTBG *Sb/. / NPL N^Nu j h * TЂL*//* hN(RP`B`/,O/ /.Nb$HXpf/N XJf/*NnXB$nN^Nu/,OH0 $n&*/ Hy Hx/Nj8%Hg,/Nf$Xg/*/NjBP L N^Nut`/,O/ /$n$*/Nh/*/NjB $.$nN^Nu/,OH0<$. &n/Nb$H + !@Hz^/NnV Jg-@-|* -BL< N^` k h(p%@%h%h IC 4Jo%h %hHx/ NX.KNXJfz*@ x jHx &  8/Hx/ hNHx Hy*4/N)1IJf,%M X%L \* x/ N *XJg6Hy*A/NNzP* x/ NX-k L< N^`B`Z* x/ Np%@XL< N^Nu/,OBHxHxHy-"/.NcJVIDN^Nu/,O npf4J o.pd&Jn!|BBBN^Nu bp`Nq/,O/"nBA  @1  bAR f $N^Nu b A` b A`p`/,O n fp@fp N^NuB`/,O/ /.Nb$H ((Xg/N B(Xp$nN^Nu/,O/ /$./Nb$HHx/Hy-#N %H(VD$.$nN^Nu/,OH08$. (n/Nb$H !l Bhh%HlBpAp%HtBxAx%H| l &hX& PJfHy*/NNzP`Jg&k`p f l h "h/B/+/+/( iNJf/ /, Ne.Hj /B/, NijJg:Hy*~/NNz l h "h//( iNp%@ L N^NuHx/Hy-#N %H( fHy*/NNzPBHzHzP/NJf-|) -BL N^`/,O/ /$n$. HxHxB/* /*NM| j hpF/Hx/* hN j h/Hx/* hN $.$nN^Nu/,O/ /$n$. HxHxB/* /*NM| j hpF/B/* hN j h/Hx/* hN $.$nN^Nu/,O//$.&.B0.//NP-C -B$.&.N^`R/,OH88$n&jdJfp$LN^`$+Hxp/ NPBBIm\&SJfN jdBdJ f(/N "X/Hxp/ NXתL LN^Nu//*(N PJfR,`$+B` o// N P` BB$// NRRP`r/,O/ n"hhJg2 )!@hf"Eh!JlR4!Idp$-H$_N^`B`"hxJg )!@xfEx!J|RD`B`"hpJg )!@pfEp!JtR<`B`$_N^Nu/,O/ $nHxHxB/* /*NM| j hHx/* hN$nN^Nu/,O/ /$nHxHxB/* /*NM| j hB/* hN j hHx/* hNHBB$.$nN^Nu/,O/ /$n$. HxHxB/* /*NM| j hpF/Hx/* hN $.$nN^Nu/,OB@ @#bF$N^Nu/,O .B@FN^NuNVH?$,Hx(/ /N)0JgHx(B/ N( -BLN^`/,OH 0/.Nb$HX('gN$/*Nh *TXg//*NjBTP/*`G "NB`/*dNBdP jhJf>Ah%Hl jpJf*@ f -g f mHpLe,(Pܨ\ -ЭHxp/ N/ N8Hxt/ NJDg6JfLJfHxHxN b(HPJfjHy* 1/NNzR0PBHxp/ N g/ NXBHxp/ N// Np` -Э, `V%H`BB(BXr%A\|GF/ N"l.,*R)ExSDS"j`R(RP"j\S%I\Xn.*Xzeއ2{xNbB`HxHxN (H*Pg B|F \ozHx/N P,gb,<`X(M`R g g& f.p%@Xr%A\*L`z%EXp%@\`r%AXz%E\`rF€/Hy* @/NNzR0/*`N "B``rz%EX"lB)ሀ)X`p%@X"lB)`r%AX"lB)`x/*`/*(N PJfR0R@B`JDf`/*`/*(N PJfR0RH`/*`/*(N PJfR0R8`/N//Hy* ZNK./,O npf ( SgpN^NuB`/,O/ $n j hHx0/* hNP j hgHx(Hx0/* hN $nN^NuB`/,O/ /.Nb$H ($Xg/N B$Xp$nN^Nu/,O/ /.Nb$HB/Hy-#N %H$VD$nN^Nu/,OH 0$. &n/Nb$H !k Bhh%HlBpAp%HtBxAx%H|Hz/+ NnV Jg-@-|* -BL N^`" k pШ(Hx/HjN)0B/Hy-#N %H$fHy*/NNzPBHzHz/NJfHy)/NNzP$ B/NLP-J-|( -BL N^`*/,OH 0$n j hHx0/* hN$ P jG hg2HxPHx0/* hN 9:jV//NL N^NuHx(Hx0/* hN 9:jR`/,O n df("(p e < N^Nup`B`NVH?<$n(n *j\/ NXJfB`>*@ f -g f mHpLe$(PԨ\ -Э j hBHx /* hN j h/ /* hNBB6|lNrf" j hHxHx /* hN G j hHs/* hN8RRPp fBI *<ϊ,< o6Jf JfHxHxN b&HPJf2Hy* 1/NNzR,PLHy*!`Hy*!.`Hy*!@NDr// N `/Hy*!INK.B:ELN^Nu/,O/ /.Nb$H/NPJg B/ N#HP$nN^NuNVH?<&n(n $n*k(2* g B Hx8BHj -AN( ".-l@-lD%n(%n, l$%HD%l0HB0B4%LT *o.%HD, LF-@B,... .ޮ݀%F(%G, AcF,f<5| +Zg< *D$ LB&B(*(֪,Մ*+pB,.n c 0* @5@ J+lgX kP(gL Ac,g>0* @5@ * @%@ J+mg kP(g~f 0* @5@ +[g 0* @5@ ,g~0* @ 5@ ,g" * f 0* @5@ 0* @5@ Jj fRp$ H/N6 kT/ /+P hN -BL0+0@7@0*g 0+0@7@0*g 0+0@ 7@00+0@7@0'j4j,B0*ሀ*B*t'@$[I'A B@*7@(B@*7@*7|@@.'j08'j$< j"hT/ /(P iN/ j hP/(N*t0+0@ jg0+0Jjp|k*`r"<11`* ab _c` <"< brSg j"(t`g0+0@`0+0 g*|/ hP/(NBP-JLN^`j|`B**gk,k*k)k'+$+-A + "+$5A`/ j hP/(Nt%BP`r/ j hP/(Np%@`/ j hP/(Nr%A`/,OH 0$n"*, t /Hy;xN;&HP([fp%@%j$-JL N^`p/NXJg/ / N# PL N^Nu/,OH<<&n /.Nb$H(9:EXg-K hP-hL<-"BHFHG<BG+D` m +@dB0-r㨀mX bl+@p`z8|`/ //-H\N(} n\UgP`+hL`gHy*#-NB0-vB2-,+Fp X c <+@p+@dB`2-,0@ @@f < gB0-Dv稀mBЀ+@t g|†x6-0@ @@f?-mtdB`/-d/-`/.d/.`N(4*~,~ +Fl*+Eh-@t-Ax//Hx G/ N,-`.-d(mt0-dB2-Ah2-^B:-[g&/[I///N(-Ft-Gx/// /.h/// Hy*#O/GObN$|g8L-Ht/Hy*#NPJgBt-Cx/BHy*#N Hy+2NXHy+N -t"X b €g/Hy*#/N Hy*"N0-Z^B2-dL+@d[I+G`X o+|p` +|txB`VB2-Z`p`|lHxHx n|/(HxBHmlBtBxB/.tBHy*$#Hy*$8HxHxpBBB/NDJg //Hy*#Hy*$@/NNz`bB-mHxHx n|/(HxBHmmBtBxB/.tBHy*$rHy*$HxHxpBBB/NDJg //Hy*#Hy*$`NVH?$. &.*.(...,. r /Hy;xN;////-C-B///N#!>LN^NuNVH0 $. &. r /Hy;xN;$HPJf pL N^Nu/NXJg-C-B/// N#" `NV". ./.HzB-@-A//BHzN N^NuNV". ./.Hz/<-@-A//BHzxN N^NuNVH?<*. $.&.&n(.,."p /Hy;xN;(HP([g4 dvgb: @dtg dug/// /-B-E/// N#&:$`X Qfr“pȀgHxHxC-IN$H!L&P/N ( Hx/ /N)0"+K"ngZgP.  b +fHxHxN(H%H%|/NvX A%Hp%@%kBB"p%A/Hz"/-B-E///HzN $Jg"Jf/+/+ / N$Hx/ NHx// N)0/N Hx/ N Lp) g(p$t g /Hy*%NK. gp5 f$.N^Nup9`p4`p%`/,OH 0&n$n .4*2* A5A rgTrg rfLp%@L|P/ / N\P` r%AL|P k<-J -h"hL N^Np`/Hy)NDrHy)NK./,OH 0&n$n 4*/ / N0PJfH%jD/ / N\0* @5@  k<&n$n $.(k0* *kNB y>'H #>Hy>N6/N5j/ N8 * @%@ HjNP/ N8$ BLN^Nu j<$L<( J(fR`fp`/,OH 0/.Nb$h/ N8/ N $ PGM jJ(n/ N8$pL N^NuHx/pЪ/N `/,OHxBHy*'BBBHxpHy>NzA>B#>BHxHy>N{4Hy*'Hy>NM.BN^Nu/,OB@ @#bF$N^NuNV/ $n * JkF/ N6HxBHnN(p-@-|)qHnHy/ j/NC%H@ $nN^Nu/,O/ $n * Jk/ N7" * %@ X$nN^Nu/,O n h:,fNP N^NuB`/,O/ $n *N^`4/,OH8$n&n (j/ N8 +  Xg* + r@'@ Hl4NPX-JLN^` j h`Jg/ NX/ N8$ + X f-K -|>LN^`LN^Nu/,OH 8&n$n %K/ N8 * X frBX k h kCX!I * rf$ PIML kJ(nZfT * @r@fn/ N8$X-J -KLN^` k (%@Xf kCX!I k!J` * r %@ /p4Ы/N * r%@ P`t/ N8$X-KLN^`/,OH <(n$n &l/ N8KX +f / N X/ NXJg * @%@ j\ *`Jgp!@` j` \$+( ?b^I/HxBN(Ԕ Fā'B(S+B// N8 * Pg HkNB y>'H #>Hy>N6/N5j/N/Hy+i+Hl/ HzBBHxN(8Jg/Hy*(c/NNz BHz6Hz/NJf-|) -BLN^`,.LN^Nu/,O/ /". t /Hy;8N;$HPJg*( f&/(N XJfr$.$nN^Nup`p`/,O/ / n$hN$ * "S%A Sf j$< BNX(<>KML"D&QgHy>Hy>NP`Hy>K6N/ N8 j BN SP +Jg!@ k Hy>NPHy>NHx / N/ N"-TL<N^` J(gf * f/ N8$ C/N/Hy*(Hy>/ Hz\BBHxN((Jg/Hy*("C/NNz L<N^NuR`#>`>NVH?< n*h(m/ G8NXB8m/ E8$N/.$<# BN/ N A-H* &<,<ML.< - fJ,gJ f /./ FNP - fv -  g - @+@ / N/. BN/ N - ( g8HxHxHx/ CN`<"L< mNX0*@g Hy*)pNX0* g|"<*Ѱ g"<*( l( cXS//Hy*)}N Hy+NXR` fHy*)J` f Hy*)V`z fvHy*)c`hp`gHy*)NX`/,OH0<$n/*K84N* R@ X c b&j(k$*/NV&(/*N2*PDjbJdg\fTDfd* cZS@/Hy*)/NIFP. ldN/ N&HxHx/. / N| BL< N^Nu0@gA5A*@/Hy*)` c| p%@`/,O//$. . nr®vfL<-@$&N^`*"9: e0L|LP-BJnp-@B -H$&N^`KLL|`/,O/ / n$n "n&n ( f0( g 5f=$_&_N^Nu0( Va$n4HH22(  g@20( g`/,OH <$n(n &j/ N8X$ PN$HPJgRHxHxN$HxB/ N(- g fzB <'E,A.|/%@4C5C0%B8%|<"D i/ / hN/ / N*t0*0@f0*0gHx// N)0 -fL0+6 @ENgR @XFgL @iPgFBHx/N/ / N L<N$HPJgj|,Bh.1|*C1C(B1B0!|4 m/ / hN/ / N*t4*0BVID/ / NP L< N^Nut`NVH?<$n&j(k,*(/Hx/ .<* GN& fpWfZ/ $<8 BNj/ K8$N*/Hx/ GNHx//N)1 Jg/ BNj/ NP *f|>.j GgRgJBK*ѰtB.xȀgJpmTJdgHxV// N,R JfJf BHhHy**/NL K*-jJdgB, TlVBB/ (<8 DNj/ *<8$ ENPAtB.r€-Ag,gDJdgDHx I// -HN,R nJfvJf// Hy**.NL K*-j,gJdgB, oS n`lHy**/NL`z*QBBSdJf LNXK*-j,gnJdgJB, o>S&`Jf`Jg`BNVH?<&n$k*jHy>&< CN(y>Hy>$<6&BNPp8f j< (=fHy**t&n/NNzP"*8Bl*JDf$ j<$L<( 0(f/. mTNXBx؎*<(|܎.<C8m mdJg/ N/ N&PNߐB8mB@FHy>N TX ,Jg2!@ l Hy>NPHy>N6Hx / N/ N"&n/N6BNR`"&L<8 "j<) frJflBB-m-R-IHxB/-I&ENp-@-|**/Hy6Hn&n/&GN"n#H j<Jg/N,XR`N| j`Nq/,O/ / n$h$P/N$j XJf/N6 J $.$nN^NuI g$j\`/,O n h h Jg ( gA N^Nu/,O//$.&P/N/N5$/N6 B $.&.N^Nu/,O/ /$n$ P/N j$h XJf/N6 J $.$nN^NuB0* g$j\`/,OH 0.  ct HxHxDN$HBBX%HB A %H$B B*B(/HxBN(Ԕ S%A,Hy**HjGM.NHy**HjNHy**Hj4N.**Hj+g4HxpB& /.<("GN$ ,</B/"GN *%@B0%|45|8%|/@@@<DD`5D@%|D%BH%FL"E i// hN./ N*t0*@@Pg pL8$n(. *.,./ N9/ N84/ N94HjN $L<( Ԫ +"5AD5@F +"5AH5@J +"5AL5@NL N^NuNVH0 $n $gpĀ/Hx@/N!ר Jf$&//N`Hx`/*/NL N^NuNVH0 $n $gpĀ//NԘPJf$&//N Hx`/*/NL N^NuNVH0 $n $gpĀ/B/N!ר Jf$&//NHx`/*/NL N^NuNV/ /$n $gpĀ/Hx//.N!jJfHn/NVHx/*/N$.$nN^Nu/,O .g SgpN^Nup-@ -|:nN^`rr-A -|:nN^`/,OpN^Nu/,O//$.&. /NX-C -B$.&.N^` /,OH8 &. $n/N(Hx/ N)T$/Hy*-/N) t/N)2B/*/*/*/*/*/Hy*-Hy*-+NL8.+NOHBBB/NJf-|) -CLN^` LN^Nu/,OH0 $.&. E) g,Hy*-S/N/N("/Hy*-S/Hy*-_NOHHy*-l/N/N)B/(/(/(/(/(/Hy*-lHy*-+NLpL N^NuNVH?t0`8t`>Nq/,O"n n f:)(f0)(f&)(f)(f)(WIDN^NuB`/,O n"n iiiiiN^Nu/,ON^Nu/,ON^Nu/,ON^Nu/,OH <(n/ Nb$H/9>GNBjPJ@gHj@N >B@XJ4gHj4N >B4X *HjB< *0gB/N >Hj0N >B0 /9>tdHr(NXHr(N/9>$<6 BN/ NILKPJXg*/ Np%@\/ NP/ BN/*XN jBXGCp j`JfN/ /+N6`t9`B`|t `v/,OH><$nIL/ KNX, $<6&< "(<NzJ\g/ N6BN&jDJf/ HjPNMLP` +%@DfxAD%HH/ "BNX Rfz*k(oHy*-/* DNP"k"+*A  fJzlD j`*AB-Jf"Hi/Hy*-/*NNz`B`g. h` g/ CN/ "FN`THi*AHm/ h` fHi"AHi/ hN `NV/ /$n$. HnHjN D .PgHfBHy*-/*NNzP *P *0g B/N >P$.$nN^NugfHy*.`DfDgHy*. `/,O/ /$nHj .T/NPJgT4 *0 j<*f BfLJgxJg <*Ѱ"<*.A*.6"@//// Hy*.O/*NLA $.$nN^NuJfJg <*Ѱ"A*Ѱ"H`Jg <*Ѱ"<*.`"<*ѰJg"<*. <*.(A*.6C*Ѱ`~"<*ѰJg"<*.JfZ <*.(A*Ѱ BfA*.6C*.A`H/ Hy-&tHjB0/Hy*./*NNz`H/,OH 0$n$. Rg-BL N^`GL/ N BB jH X%BHHjPNPP-KL N^`D/,O n Pf Bh0Hy,/(NObPN^Nu/,O/ $n/. Hy*./*NOb0*2A5A g"pL9:-@ d-J$nN^`f4$nN^Nu/,O/ /$n$. JBB0XBRJNHjdNPJRf *P-y>$nN^`Ȕ *0f0*g@5@/ NX`NVLH?<$. &./Nb$H!BB`BDD%HHGdB/ NL/ HzR/ Np$5|,5|8IBHxHx/ N $BHxHjLN{4/,<"FN/HjPNM.Hy*-/G) N.K)NC-IT// (<G DNHy*-l/N/N/Hj"DN.*/>/N/*<(z EN-APHy*/H/N/"EN-ALHy*/S/N(.N)3*X stngfHy+ /.<(ܾ GNPJgxHx/ N P/N("/Hy*/SHy*NLHy*/q/N(/N)3* nmbrf/"EN5A,AX Agt-|*/q -|*/}`DHy+ʌ/"GNPJgHx`tHy*/]/ GNPJgHx`Z-|*/S -|*/dL<$N^`|B/ N P`VHy*//N(/N)3* nmbrf"/ EN5A8AX Ag -|*/ `THy*//N*/.<)3*"GN dataf/N)(/N*Hy*//N&/*GN boolf/N)XJfjBHx//N& ~KGH/ /NPJf4/NXpf0Hy*/NN`X`r-|*/ -|*/` .o.`Hy+NOH/"FN/Hy+i+HjX/ HzBHxHxN(&(GJgHy*//NNzPL<$N^Nu|F̃/Hx//NJfZ/B//NJfF/Hx//NJf0RoBBB/N/9>N*fG\ABB =|\/.THkN/ Hy-&Hj4*< N6`-nPx-nL|-E-D-|GX-|GX-|IJ-C-CXHxBHndN(p-@\-|3`-|*/hAX-HlHn\HzHnx/NC,gT/Nb !B!C!n!n"j`!IXgK#M%H`C`!I`/Hy*//NNz `/,OpN^Nu/,OpN^Nu/,OH<<*n$mxJ*g&jHJf(&jLJg| +%@LflAL%HPR%KH|D(kBBxh؍*<m&SJf jHBHJ f/N "Xת0J|gj mlJgb/ NX`ZB`&j\Jg +%@\fA\%H`R(`zB`&jTJg +%@TfAT%HXR `RB`B*DBL<p%@8 kB(ሀ(X%@<`r%A8 kB(`p%@8 kB(`/*@/* N PJfRR$B@`/*@/* N PJfRR,`/*@/* N PJfRR`/N//Hy* ZNK./,O/ /$. /Nb$H BLL%HPBTAT%HXB\A\%H`B/Hy-&N %H f-|* -B$.$nN^`h$.$nN^Nu/,OB@ @#bF$N^Nu/,O .B@FN^NuNVH<<&nBBBHxB-| Hx /. y:,/(NA$f N( :o fJxg/NXt L<"* hP g.Y%AXJf8-|* 1 -SL N^`AH`HxHx/ N "$H `*gX((jHxB/ N(!/+HkNB@F'B k A'H/N'|eh +Rr€'ASHxHxB/ N +<(Jf"Hy* 1/NNzP-JL N^`B"k"X'H-KL N^`/,OH0 $. /.Nb$HHx/N N:& BB jL X%BL *7f/ NX-CL N^`/,OH 0&n /.Nb$HHx/ N B N$B jD X%KD *7f/ NX-BL N^`/,OH 0&n /.Nb$HHx/ N B Nt$B j< X%K< *7f/ N0X-BL N^`T/,OH00$n *g$rg@/Hy*1_/NNz L N^Nu$9:&<-&J*g/HjNP`$9:&<-&HxHxN b&HPJfHy* 1/NNzP`BB(/HxB/N "THx/ / NHJfHy*1`/,OH<&n$kxHjN |qHxHxN b(H JfHy* 1/NNzPN0(@K " jJfA%H/ N8/ NHx/ NZ/ N /+NFN 'HJg*Bxf /NV&HB/NCp/ NU&/ NBL<N^NuBB(Hy-&HxB/N "THx/ / N.Jf8Hy*1`$%h/NX`*/,O/ / $n|qJ*fZHxBN b&HBB(Hy-&HxB/N "THx/ / N$JfHy*1/NNzP$n&nN^Nu/9:HjNB`NVH<<$nBBBHxB-| Hx /. y:,/(NA&f N( :oxfJxg/NXv L<A8%H< j@Jf*k=|r&+(-C CYb-V-B-72|fff0(kSrB@F'"**AJg("m mf (< "f/N&B X"jf/N XHjxNXCffB,0f/ N "X`B5// GNRP Ќ"Dle* D(JfFHnHx/ BN &6.rB@H8DDKSAfnfHx/ N P`I`( IB,].<bH`*I` jJg (%@fC%I/ DNR"*X`B`/*/NP` YA &Jl/HxB/ N.Hx/ N g/ N "/ N&P`V. gP gn f k/ /*N PJfRR *Rv%@%@|pB\`, k/ /*N PJfRR ` k/ /*N PJfRR(`r€/Hy*2!/NNz/ N "`v/HxB/ N. g, gvƀ/Hy*2/NNz/ N "`DHx/ N (kPpA-&Ȱg*Hy*2W/NNz/ N " ` P"ig"HJf`"*I "vgvgJf fB*/ NX&<-&`, fN/9:HjNp%@/ N &<-&HxHxN b&HPJfHy* 1/NNz`Hy*2p/NNz/ N`@ g~ g ޭfB*qHjN r%A/ N`Hy*2` gL"ANz f&Hy*2/N/ N2B/ N&<-&`DHy*2/N`n/ N`0/ NX&<-&`BB(/HxB/N "THx/ / NdJfzHy*1`Hx/ N  k/ /*N JfRR(`< dfb`r f l ,&R)C` l ,"R)A `/,OHy:oxN˒XJg//9;Hy*0&NN` N^NuHy:o/9;N+PJg//9;Hy*0ZNN`Hy;N'-|:oxN^`P(/,OpN^Nu/,O 9:pg nB(!|,pN^Nu/,O/.Nb hXJgJ`gB`eN^Nu""hd". fBR`/,O/.NbXJ f |$BN^Nup-`/,OH<&n$SI6KJ*HgJ+$g L<N^NuB*H S/($N j("h\/ QN/*$N `/,O/ $n/*$N j/ hNP-j$$nN^`/,OHxHxN N^Nu/,OH00&. &n/Nb$H $+Hy*3MHk@GM.NHy*3Tp0В/NB*%Hy+NM`/0--'Hy*3^GOHNU pdHy*3pNN`|$XL N^NuHy+N&R/ HzHxNZ'H` RJ`f"/N/Hy*3NN`|$ `"hHh$/ iNP y:ogHzHy:oNP-|: -CL N^`V/,OH0<&n$SpmHx/ NP/*$$< BN S|H/ KN/*$I6N/*LN6/*$ BN$ @&<MJ+$gB/NP/*$NBN/ Np-@ .XgHx/N@P-|:N^`^/,OH<<&n$ P/KNXI (<6&<P*<ML$SJf// EN$SPJg R *Jg8!@ j p%@'J/ DN/* jN/NB/ CN`'@`/,OHNcBHxHy>I{4NHy*3Hy>GM.NE>B>#>HxHxHy>N .*3Hy> N#*3>B>Hy*3Hy+i+Hy>/ HzBHxHxK(N(JfB> #> >$HxHxHy>(NHy*3Hy>,N#*3>8B>4Hy> HzdBHxHxN4Jg$p/2Hy*3NDrHy*3NK.B`BHzHxNZ#>Hy-'tHxNBL<N^Nu/,O/ / $nJ.f -|-'A -|*4$n&nN^`/*/*// Hy*4GC&N/*$/* B0*//*/*Hy*4EN*,,B*/*/*-///*(Hy*4vN$n&nN^Nu/,O/". t J:p f p$.N^Nu f4J:pfJp#:pHy:NB>Hy:N6PB`/Hy;N;PJgJ($gp`p`NVH<<". $.$n*nG v&@ v  fP f}g f~g.t`,Hy:NXJg& -#>Hy:N6XB L<N/Hy>N` -|>$.N^`/,O/". t  f&Hy:NB>Hy:N6B:pPB$.N^Nu/,OH80$nJ.f-|-'M -|*4L N^`/ Hy*4GC&N$jPB&<*Ѱ(<+Jf L N^NuJgf // Hy*4NR$j\ ` `/,O/". t  fJHy>NtAĮXgJ:pnHy>/.N`(PBHy>N6X $.N^NuB`/,O/ /". $nJfZ t  fH%|-'`hBpHy>N/ Hy>N`Hy>N6B$.$nN^Nup`p`/,O/ / .J:poRG:p$SJgHx/ /N)0 *&f #:p:pHx/ NS:pPp$n&nN^NuB`NV/ / $n G r&@/N$ "+%@%A "+L<%AHy>N 9:pR#:pPrclBN.XB y:p #:pHy>NPBBHy>N` 9>-@ .gNv4/9>N_N}PXHy>N6X$n&nN^Nu/,OH0<$./Nb$HXJfJ*%g /NX|$GIPKM&<6 RJfx (`g/N[ RB`XN&H/N'@/ HxN @/GMDNp0В/NB`/. /HhN& Jg^L< N^Nu/($N @/N Rp8". $n t  fD * g gt L|N^NuHx/N&PzN(Hy>NXI,.GM/NXJfJfHy>Hy>N$PgHy>N6XJf\JgHy:Hy:NuPJgv/ // y:N$Hy:NuTpNgdJf/ Hx/Nx$ Hx/ENPJgHx/NP`BB`B`bt#`\N`$`/ Hx/`t`t`/,OH 0$.J:4fFEGJf BL N^NuHy*5m/NPJf/N$X`ְ WID`p`/Nb 9:,Xfp`/,OH8 $n (.$&>/N/HxHjN(Uf$B B>"P%I" Hp)> NPX-CLN^` /,OH88$n IG6$*pfB`<(&>/N *Xf6 R *Jg"!@ j p%@/NXpLN^Nu!I>`/NX`/,OH<8$n &.$.(>/GN *XUfDJg /N6X*> >IML Bg/N6XJfHB`0//NP` R *Jg&!@ j p%@/N6XpL`/NX`/,O n (rVDN^Nu/,O . g/Hy*5qNOHPpN^Nu/,O/ $n R/($N R|H @/NPP R-h$$nN^`n/,O/ $n R/($N j| R|H @/NPP R-h$$nN^` /,OH0 $.&. N$HBHh/N -J -BL N^`/,OH00$.&n &.NB$H!k/NHx/HjN(-J -BL N^`/,O/ $nJ`g4J*Ig j"h$nN^NNv4/*`N_X$nN^`j$nN^NuNq/,O/ $n *f B* $nN^Nu jP/ h NXSf`/,OH<$n%y:,LB*45| IDKML&jJfGDIMLJ@fPBLL<N^Nup$f +\%@fA%H` jP/ hNX@f j P/($/ NP` j P/($/ NP`/,OH 0$n&jD k/ hNXJgBjBL N^NuJ*gHB* * gFJ+If@"9: eL|L/Hj|NP`LL|`p$gB*`/,OH 0$n&jD R$(/+$N/ NNPJgBHjd/N Hj|NX-k$L N^`/,O/ $n *Pg"*TBPBT//NP jD/($NB* jD/($Hj|NX jD/($BHjd R/(N jD/($N6 Hj NMD jD"h/ / iN $nN^Nu/,O n(Xg(.N^Nu P h P(`/,O/ / $nJ*gB*G|/ N XJfB*$n&nN^Nu/ NXJfHjd R/(NPJf`/,OH8<&n$SB+,(+6+Jg2$+PJf'B(kg/ N:XJf// /N)0 j PJ(If /($NXJ* g j P/($N6Xt L<N^NuB\ j A\%HJ* g.J*g( j P4BJ(If /($N6XJBft`| jP/ hN$ j PXJ(If /($N6XpdZ j PJ(If /($NX j (\%@fA%HJ*g/ NX j PJ(If2/($N6X`"gSf j PJ(If /($NXI CKML$<M`: ($JCg*// BNPJg$+,f jP/ hNX$+$`v// NP+, j P(IJfJgHy*5NK.B`/,O nhN^`/,O nhN^`/,O n hP N^Nu/,O n h N^Nu/,OH88&n&. (.(k T"h// i N$HPJg!TDHxt|Hp(NL/ HzHr(NHy*5{Hj NM.%|l%Jpp%@t%|x$5n%D<%kP@Jg4BTHx/N%HP%CTPJf/ NXt LN^Nu j@ PJg/ N$Xg / NX` n B`/,O/ $n j@ hJg/ NX-J$nN^`d/,O/ $n j P/($NXJg" jB(/Hy*5NDr/ N jP/ hN j P/($N6HjDNMD *0 g /N&XBHxHj/*N/*/*ND g /NX j P/(/ NP$nN^NuNVH8 $n&..B/ N$XfN jB(BBmNgrFƒ/Hn/.// /N~$fB n LN^Nu .g/NPX`p LЪ"@ QJg8(gR` .g /NPX/ N` .g /NPXt` .g /NPXt `/,OHx/.B././/.NN^NuNVH80&.(. /.(Hnr/B.//.N$f&nHnBpF/// N0$fp$n%n%n%DBC5CB r%A$%n$(*XB<'J0|4/ N& n XpgB0B+4/ N&X$/ NPX L N^Nu/,O n!n !n!nB1n!n p!@$!n ((XBP-k$$n&nN^`zNVH 8&n $.(nHnBB/. n/(N0JfB+ሀ+X$nB%n%@B5B%n p%@$B(Hx/ Hj.N)0*XB|| jhB.hB.B.B.BHn/Nf / -@N~X .$nN^NuNV n|| B.B."hiB.|B./. Hn/NfN^Nu/,O n hX N^Nu/,O n P P"h-H"iN^N/,O/ /$n$. J:>f R/($NX R(IJg>R@I R (If"h/ iNXJ:>f4 R-h$$.$nN^`xF f"h/ iNX RS(I`$.$nN^Nu/,O//"n. iB(BmA $&N^Nu iv L8 p8(gR`/,OHy:p(/.N N^Nu/,O/4.2n nB f A $N^NuPf2(Ig AgR`NVH88&n&. $n kX$BJg kX(f(I kf"/HnBB/ NJfpmPBk/Hn0k/// NJf(Jg"rā".jR"ASATGnBLN^Nu0.X7@`B(BACJgY Ac.6x k5C?ArRT`8DgI?Cr`r`p`vp`p/,OHx/./. /.NN^Nu/,O np$f/NZXpN^NuB`/,O/ / $np$f2&jD/ N0p%@$ k/ hNP-J$n&nN^`$n&nN^Nu/,O/ /$n jDJ*g|$.$nN^Nu * gJ(If"9: e"L|L/Hj|N|P`LL|`NqNVH0 n". $. ."nvg$hX*gL N^`0||BAB.B.@@/ Hn/Nf L N^Nu/,O/ $n/ Hx /. Hx/.NJf *VID$nN^Nu/,O/././. Hx/.NN^Nu/,O/ $n/ Hx/. Hx/.NJf *VID$nN^Nu/,O/. HxBHx/.NN^NuNV/ /||B.|B.B.|B.HxHnHxE/ Hn/.N($fpl"Hx/ /. N)0 $.$nN^Nut`NVH08$. .$n||n|@@|B.HxI/ Hx/ Hx&Q//GhNJf>pl@ g<@B.Hx/ Hx/ Hx//NJf n L N^Nup`p`NV|B.B.B.B.B.|B./. Hn/.NfN^NuNV|B.B.B.B.B.|B./. Hn/.NfN^NuNV . |B.B.B.@@|B./.Hn/.NfN^NuNV . |B.|B.@@|B./.Hn/.NfN^NuNV . | |@@B.B.B.B.BHn/.NfN^NuNV . | |@@B.B.B.B.BHn/.NfN^NuNV . ".|#|AA@@B.B.BHn/.NfN^NuNV . ".|#|AA@@B.B.BHn/.NfN^NuNV|#||B.nnB.B.BHn/.NfN^NuNV|#||B.nnB.B.BHn/.NfN^NuNV . ".||AA@@B.B.BHn/.NfN^NuNV||B.B.B.B.|B./. Hn/.NfN^NuNV . B.| @@B.B.B.B.BHn/.NfN^NuNV . B.|@@B.B.B.B.BHn/.NfN^NuNV/ /$./Nj$HXJgVHn/Nb|!| nnjB.B.B.BHn/.Nf$.$nN^Nup `NV/ /$./Nj$HXJgVHn/Nb||B.B.jB.|B./. Hn/.Nf$.$nN^Nup `NVH0 &.$. /Nj$HXJgRHn/Nb|!| BBjB.B.B.BHn/.NfL N^Nup `NVH0 &.$./Nj$HXJgXHn/Nb|!| nnjB.BB/.Hn/.NfL N^Nup `NVH0 &.$./Nj$HXJgXHn/Nb||nnjB.BB/.Hn/.NfL N^Nup `NV". .||B.|"AA@@/.Hn/.NfN^NuNV/ /$./Nj$HXJfA $.$nN^NuHn/Nb/.NX"HBA)ሀ)X " pd cm( !g g`NVH 8$.$n &nHn/Nb/Nj(H Jft LN^Nu/NXJgTB(ሀ(X&gHx/N$//B,//.N~$g//NBP`t `/,OH0 &.$nB/.B0.///.B/N/N$B/ BB/NJg /. NlX L N^Nu/,ON^`/,O/$.p/N/Hy*/H/N *t$g/Hy*6/N( *xg/Hy*6/N( *pg/Hy*6/N( L@NEA>@`/,O/ / $nHjtB*J// GNHjxB*K// NHjpB*L// N$$n&nN^Nu/,OH8<$n(n &.&n$. .(. JgBBJg// B*J// KNJf/ NX// B*K// NJf/ NXJf B*Dሀ*EX?Bg// N^ JfxB*Fሀ*GX-@B*Dሀ*EX-@-B -KL<N^` *tg/// N(yd *xgv/// N(yd `bL<N^Nu/,O .rF€//Hy*7/. /.NEN^Nu/,OH><&n&. $.HxHxN(,*HxBHx/Hx// N$B+Fሀ+GX?Bg/B+Dሀ+EX?Bg/Hy*7Hx/IENԀJg(B+A/+@/Hy*76"<//NԀB+>ᎌ+?^B+H዆+I[Hy*7D //NԀ/"//KN$B// // N$B+/Hy*7K// NB2-| -DL<|N^`0/,OH0 $n&. gF * gRHxHxN$/Hx/*Nn//Hy+\NOH Hx/NP/Hy*6NOHPpL N^Nu/,O/HxHxN$//. /.N B $.N^Nu/,OHx/.NPN^Nu/,O n . ".J(IfJ:4gRL<-@N^`oV/L9:L| @HhBHy*7UNtN^Nu/,OB/. /.NL N^Nu/,O n-PN^`l/,OB/. n/NL N^NuNVH8&.(. $n|#||B.D @B.B.BHn/Nf Jf:z GIHx2/N/ //NJfg*fSfpL8N^NuHx//NHx/-@N .`/,OH< nB(ሀ(XЈBz2|(teA L f8 + f)gB < g8BBBR `(MpeFHy-(Hy*7`Jp@B)Ꮞ)_g@.G`NVH?<$n$. ,.B*Me$pgHy*7NDrXv LplHx/KN&HPx*<I/ //Hx/ EN&gHx/ NSPfB* 5||// NBP`8 j|fB -JLB,ሀ,X?Bg/ NBTP`$Hp(Nh//*8NԪ8/N~`zRm `v` ,fB,ሀ,nf%LT+B+փ jB8(ovJg2B+B* R/(LN/////Hy*7NDrv ` +fVB.ቂ.B+ሀ+Af:* Y bHn// N Jf6.[pmB* 5||// NBPP`NVH88$n&. (.JfXp-@ LN^`/ // N JfB.f/// N" LN^NuRB*Mmp`BGIz`/,OH 0$n&n R/($N +X g,.gJf R'@B R/($N6 L N^Nut`/,O/ / $n&n R/($NSX R-h$$n&nN^`Q/,OH88&n&.(.p/// N$ fHx S/(N$H!K !CB0Bh |B(4!n8D"Dg6+ Y brF grF`rFg `/,OH<<$n *g /NʞXJ8g: jP(BBGvIK~ j8n//NP jPGJgB(ሀ(X?Bg/NP jTJgB(ሀ(X?Bg/NP *`g//*dNB`P *tg Hx/NP *xg Hx/NP *pg Hx/NPHx/ NPL<p `8/,OH 0$n $.pf-j L N^`JJfvG/ NX *(bLJ*,f4|,//* /*$N)0/*(B/* N(/*N-KL N^`<* j "j1(R`L N^NuNVH?<&. (n/Nb$H&l/N5j$%K%lHx/ N$Hy+NM`/Hy+D%NOH/N4 J+ g4 *"Ste&fd"<*Ѱ <+//Hy*:/NObHxB/ N" Jf + c2HxHy*:/NNz /N6X`"<+i, <*:`|܎Hx(B/N(+ I*<fJ+ gY bzKHx B/ N(||B.|*B.B.| B./ / / EN(@.BJ+ gplr^ npP@/HnHnN)0nBnnnn .BJfIpl&A*J+ gA+H <+i,~f <*Ѱ// //Hy*:/NLJfHy*; /NKPI *$g/*(/NP * g/*(/NP *g/*(/NPJgSpL( BHhH/ NPB\`8||B.|)B.B.| B.// / EN. JfBplR BB.// / EN(@`"B6r€fRR`Hx SrL @HhHKN(H'H\!J ٔHx(/HhN)0+ Y|܎ b|+ gv"@HiHy*;7/NK+ | | SAS@B.B.B.B.B// ENJgHy*;M/NNzP`P/B/ Nt JgHy*;^` .rf"Hx/NPJgHy*;s/NNzPB/.N*PfHy*;`( g Hy*;`x P%@(Hx/N%HHx/*(N%H Hx/*(N%H$HxHxHjN{4 .*;HjNM./*(Hx/*$N(|,HxHzl/*(/*/ Hj Hx"EB)//.N(8Jg Hy*;` kJgHx/ NP// HxNV *"S ze&gHx/NPC4p8<B#K @2J+ frd2B)B)"**S|e企g"*AYK#M*Rl k\( zIPKR,<NzHx// N Jg/N//Hy*;/ FNRl kJg؄"DHi/ NP|.|-BBB/NJfHy)/NNzPLH>IHxHy>HHxHx/+N`RrCgư>g`B>H>IHxHy>HHxHx/+N-|$<-0I fT +$r]gBrGfD (f:r`pu-@$<-.`& +$r(f-|$<-/I`p(gHx/.N-H/.//N)0K  f(rfHxHy:qBHx/+N m fB . n f f (Vfz (Wfr (*Xfj (YfbB(W L fT hfJ||||B.B.|B.HxHnHx/ Hn/*N( .%@".%A-KBHx//N* xGH/ /N$PfL/NXpg* ozFJg/Hy*B+@f2%@D/ N6/*PN/ NB+%@DHj,NP-LL<N^`)b/,OH8<(n$TG(/ KNB,XDf*/ N6/*PN/ Np%@DHj,NP *t,Ԋ&<MLJ8ft%y:,8"*< S&<Px%@0$n*. ,.$.GJ*f"//B/ R/(N$ L |N^Nu(RHx/N&///N)0//B*// R/(N$$./NP`/,O n/./.B(//. P/(NN^Nu/,OH0<*n$UJPgG(/ INXv,֊$<M-fJ4fpDg/ / BNPJgt`R%y:,4B-%@@/ N6Hn/. BB/*P/*TNr$/ Np%@@B4.NPX/ N6X L< N^Nut`t`/,OH 8&n$SJPgI(/ NX+fJ4fpDfp%@4B+%@@%nX%n \HzP/.?.Bg/./. / /*TN/*TN$ g:pgB4p%@@BXB\Hj,NPX/ N6X LN^NuHy*"*( *J|g///N Jgt`//Hx/NL`t L N^NuNV|H?<". *. t /Hy;xN;&H (x-@| .|Pg^J( VD Ш b*/E/ Hx/(NJfr//+Hr(Nx$ LHx/N(/Hy*>kN`NVH08$n&. &n(nHx// jN gHx // jN"tGt~‚ gbUfZp/// jNB Jg@ fr?e:HnHnHn// jN/././.Hy*>vNDr$B`.p4`/// jNrF€ fJg&Jg(pL N^Nu$`zNVH08$./N/Nb&HBHxNT$HB/IJN&Hx/N k%Hh.//+/ h N%@l jhHx// hN%@| jhHx/*l/ hN%@(HnHnHx/*l/*hNpJgP|p .%@t%nx//*l/*h/NHzXHzHz bHz/ /NIL N^NuB*pp%@t`NVH88$n&. &n(nBHnHx// NpJfBLN^Nu-A$.g/// jN"x xex„fJg&Jg(p`NV/ /$n$. BHnHx// NpJg./.// jNp r lHy*>NN`XB$.$nN^NuNV/ /$n$. BHnHx// NpJg/.// jNKR $.$nN^Nu/,OH08$n&. &n(nBBHx// NpJgdHx// jN"S teH$<"fJg&Jf pL N^Nu(`$rg/// jN `B`NVH<<$n&. HnHnHx// NpJf pL</NNzB`rNVH?<$n$. &nv-Cpf B(Y/Hx// KpNJg/+@/.// jNB/Hx// NJg(n/ // jN&RB0+D/Hl// jN|܅.peJfp fB0+J/Hl// jN e8B0+L/Hl(// jNgB0+N/Hl0// jNB/Hx// NJg(n/ // jN// // jN*+P&+P/+THl// jN, jJg/+XHl//N j +\2| /Ht//NJg""j +`Jg0|/Ht//N/+P/ // jNB/Hx// NJg/+d/.// jNL/NNzPB$.$nN^Nu/*t/*l/*h/N/ /*l/*hN p`NV/ /$n$. HnHnHx// NpJg. .X/// jN nr€ B$.$nN^Nup-`NVpH?<$n&. &jHnHnHn// kN .ЮL<J0gJfB LA-H/ANHn/././N0JgAN}IJg/ /. nN$PgBJg8&.$. &n/Nb$H k/ // hNHy+NM`Hy+NOH +|̀zʀxȀvƀfFJfxHy*?/NNzPBBB/NJf-|) -BL|N^`4Hy*Ѱ/NLHy*?-Hy*ѰHy) NLJg6 <+͘`Hy*Ѱ/NLP <*ѰHy*?7/Hy) NL Hy+ ILNXJfJgHy*?DHy+͘Hy) N Jg`Jg"Hy*?LHy+͘Hy) N Hy*?[NXHy+N%k%k%k %k%k%k%k$ k/+/ hN%@%k($%k,(%k,Hz/NGHy-1DHy*г/N `Hy*?SHy+͘Hy) N Jg8`L|N^NuNV//$.&. HnHnHx//NpJfHy*?_NDrXp-$.&.N^Nu/./././/Nr`/,OH00$. /.Nb$HB/GJN&Hx/N$Ԁ j///*/ h N&L<(A($J(4g/(8//*N Hr(<*n&n Hy*XEDrN XXjV$5 ,p6?BgHy*XNp/Hy*XN <*`f <+S/Hy*XHy*BN <*`f <+S/Hy*YHy*BN <*`Jk <+S/Hy*Y5Hy*BN/Hy*YWN <*` f <+S/Hy*YrHy*BN/Hy*YN <*X1|g 0-1/Hy*YNP <*X=f <*XU/Hy*YNP <*`f <+S/Hy*Z Hy*BN <*`f <+S/Hy*Z!Hy*BN <*`f <+S/Hy*Z4Hy*BN <*`f <+S/Hy*ZXHy*BN <+Sg <*`/Hy*ZmHy*BN P jp Ћ$5 ,p?BgHy*ZNP <*`f <+S/Hy*ZHy*BNp*B("S <*Xize 0-1/Hy*ZNP <*`Dk <+S/Hy*ZHy*BN Jf0JfrHy*ZHy*[NP-F -|*[kL<|N^` <*`f <+S/Hy*[0Hy*BN Jf4Hy*ZHy*[NP$/Hy*[N/Hy*[kNA JlA $5 /Hy*[N/IHy*BNB fHy)FHy*`]NPB Pjp Ћ&4 /Hy*`NHy*`Np rgrgJfHy*`N.*a!N5XpgprgrJfvHy*a>NX gLN^Nu/0 -2Hy*`]NP fd!KR/Hy*`zNP`PHy*``Hy*``Hy*a`|Hy*aM`Hy*ag`Hy*a` ЋjV(4 ?Bg/Hy*a|Np/ CHhHy*a|NTm`VB `/,OH08(n&n Hy*aEDrN XXjV$4 /Hy*UiNvƂ/Hy*aNHy*aNrg*rg,Jf0Hy*aN.*b NXrg&rg(SgHy*b+NX/Hy*bENr/Hy*bkN Pjp Ћ/4 Hy*bNA JlA $4 ?BgHy*bNp/Hy*bN <*`f <+S/Hy*bHy*BN r/Hy*cN"/Hy*c,NB r‚ 4 @rF€//Hy*cLNR cL N^NuHy*`Hy*a`Hy*b`Hy*b2`Hy*b8`Hy*b>`/,OH08(n&n Hy*cEDrN XXjV$4 &p?BgHy*cNP <*`f <+S/Hy*Hy*BN <*`f <+S/Hy)Hy*BN/Hy*cN <*`f <+S/Hy*cHy*BN <*`f <+S/Hy*cHy*BN <*`f <+S/Hy*dHy*BN <+SJl <*`/Hy*dHy*BN Pjp Ћ/4 Hy*d$NA JlA -t -|*dOL N^`.NVH>8(n&n Hy*d|EDrN XXjV(4 *p?BgHy*JNp? @HhHy*dN ?&B ",gSp/Hy*dNP <*`JDk <+S/Hy*dHy*BN/Hy*cN @HhHy*dN <+SJl <*`/Hy*Hy*BN P jp Ћ$4 A JlA &4 /Hy*dN/Hy*eNp?/Hy*e;NB-C-B//Hy*LgNA$JlA $4 AJlA /4 Hy*eUN/Hy*euNAJlA $4 AJlA /4 Hy*eN/Hy*eNA$JlA' $4 A JlA# /4 Hy*eN/Hy*fNA(JlA+ $4 A,JlA/ &4 /Hy*f/N/Hy*fJNx?ȂHy*feN|d4/Hy+pKNP vă-@-B//Hy*fzN L|N^NuHy*.NX`/,OH0 Hy*fEDrN . XXj . ^ n$0 &p?BgHy*fNpPfp /Hy*fNP <*`f <+S/Hy*fHy*BN <*`f <+S/Hy*gHy*BN <*`Jk <+S/Hy*}MHy*BN/Hy*cN/Hy*g#N <+SJl <*`/Hy*Hy*BN L N^Nu/,OH00&n$. Hy*gHEDrN XXjV$3 &p?BgHy*UiNP <*`f <+S/Hy*g{Hy*BN <*`f <+S/Hy*gHy*BN/Hy*gN/Hy*gN <*`f <+S/Hy*gHy*BN <*`f <+S/Hy*hHy*BN "C-B -|*h/L N^`x/,OH<8(nHy*hIEDrN . XXj . ^$4 (p?BgHy*heNP <*`f <+S/Hy*hHy*BN <*`f <+S/Hy*hHy*BN <*`Dg <+S/Hy*hHy*BN <*`Dk <+S/Hy*hHy*BN <*`f <+S/Hy*hHy*BNz ʂ <*`f <+S/Hy*iHy*BN <*`f <+S/Hy*iHy*BN4 f&</Hy*i3N/Hy*iYNHy+SHy*i{Hy*BNHy+SHy*iHy*BN$.+SHy*iHy*BNHy+SHy*iHy*BNHy+SHy*iHy*BN .+SHy*jHy*BNHy+SHy*j4Hy*BNJg4G$. P Ђr/4/ HkHy*jUN eLR oLN <*`f <+S/Hy*fHy*BN <*`f <+S/Hy*uHy*BN <*`f <+S/Hy*Hy*BN <*`f <+S/Hy*Hy*BN <*`f <+S/Hy*Hy*BN <+SJl <*`/Hy*Hy*BN JfYgxdA$JlA' $4 /Hy*NHy*NxȂ f Hy*3rNX <*`f <+S/Hy* Hy*BN <*`f <+S/Hy*EHy*BN <*`f <+S/Hy*^Hy*BN <*`Jk <+S/Hy*yHy*BN <*`f <+S/Hy*Hy*BN <*` f <+S/Hy*Hy*BN <*` f <+S/Hy*Hy*BN <*` f <+S/Hy*Hy*BNHy*NrgxgJfHy*3N.*XNXzg|gSgHy*nNX <*`f <+S/Hy*Hy*BN <*`f <+S/Hy*Hy*BNHy*NxgzgSgHy*3NX <*`f <+S/Hy*>Hy*BN <*`f <+S/Hy*[Hy*BN fp/Hy*xNHy*N rg&xg(SgHy*3NX <*`f <+S/Hy*Hy*BN <+SJl <*`/Hy*)Hy*BNA( JlA+ $4 ?BgHy*7NHy*UNp | e "ҁ2;N Hy*[`Hy*r`~Hy*j`tHy*y`Hy*`Hy*`Hy*`Hy*`Hy*b`AJlA $4 /Hy*NP <*`f <+S/Hy*|Hy*BN <*`f <+S/Hy*'Hy*BN <*`Dg <+S/Hy*@Hy*BNzʂ <*`Dk <+S/Hy*|*Hy*BNxȂ <*`f <+S/Hy*|FHy*BN <*`f <+S/Hy*SHy*BN <*`f <+S/Hy*eHy*BNHy*vN/dH/Nt <*`f <+S/Hy*Hy*BN <*`f <+S/Hy*Hy*BNp/Hy*NAJlA $4 ?BgHy*N-BBP <*`f <+S/Hy*Hy*BN <*`f <+S/Hy*:Hy*BN <*`Dg <+S/Hy*WHy*BN <*`Dk <+S/Hy*rHy*BN <*`f <+S/Hy*Hy*BN <*`f <+S/Hy*Hy*BN Jg@Hy*NBBXB|gB|gB|gdHy*bNXJgLHy*N(.*.BBr…XBzgTB|gRBzg2Hy*bNX <+S f <*`/Hy*NP <*` f <+S/Hy*FHy*BN <*` f <+S/Hy*jHy*BN <*` f <+S/Hy*Hy*BN z/Hy*N <*`f <+S/Hy*Hy*BN <*`f <+S/Hy*Hy*BN <*`f <+S/Hy*Hy*BN <*`f <+S/Hy*Hy*BN <*`f <+S/Hy*(Hy*BN <*`f <+S/Hy*:Hy*BN <*`f <+S/Hy*CHy*BKDrN <*`f <+S/Hy*XHy*BN <+Sg <*`/Hy*|Hy*BN |g`~Hy*A`Hy*`Hy*.`Hy*A`Hy*`Hy*.`Bg CHhAHy+NPRpfHy+`Hy*S`Hy*B` Hy*a`Hy*`$Hy*`Hy*D`Hy*`~Hy*,`tHy*8`jHy*`Hy*`Hy*D`Hy*vNX <*`f <+S/Hy*Hy*BN <*`f <+S/Hy*Hy*BN <*`f <+S/Hy*Hy*BN <*`Jk <+S/Hy*Hy*BN <*`f <+S/Hy*6Hy*BN <*` f <+S/Hy*JHy*BEDrN <*` f <+S/Hy*aHy*BN <*` f <+S/Hy*wHy*BN <*` f <+S/Hy*Hy*BNHy*NBrgxgSgHy*NX <+SJBj <*`/Hy*DHy*BN gA,JlA/ $4 vFƂg/Hy*cNHy*N-CB ."./KFNHy+N <*`f <+S/Hy*Hy*BNHy*N/NHy+NHy*NG/N.+NX <*`f <+S/Hy*'Hy*BN <*`Jm <+S/Hy*IHy*BN0 A0JlA3 $4 ?BgHy*WNHy*sNxȂ/Hx0Nn <*`f <+S/Hy*Hy*BN <*`f <+S/Hy*Hy*BNHy*NVA/GNHy+Ne/Hy*N <*` f <+S/Hy*Hy*BN <*` f <+S/Hy*Hy*BNHy*&N/NHy+N r/Hy*LN.*gNC/NHy+N <*`f <+S/Hy*Hy*BN <*`f <+S/Hy*Hy*BN <*`f <+S/Hy*Hy*BN <*`f <+S/Hy*Hy*BN <*`f <+S/Hy*Hy*BN <*`f <+S/Hy*Hy*BN JgHy*3NXCzeЀ0;NhHy*`Hy*`Hy*`Hy*`/Hy*NP`Hy*`<(n&n Hn/ NPJg .jV` Hy*EDrN XXjV(4 /Hy*N/KDN P jp Ћ(4 /Hy*+N/NA JlA (4 /Hy*ZN/NA JlA (4 /Hy*N/K՚NA JlA (4 /Hy*N/NA JlA *4 /Hy*Np/Hy*'N <*`f <+S/Hy*JHy*BN <*`f <+S/Hy*bHy*BN <*`Jk <+S/Hy*yHy*BN <*`f <+S/Hy*Hy*BN <*` f <+S/Hy*Hy*BN <*` f <+S/Hy*Hy*BN <*` f <+S/Hy*Hy*BN <+S g <*`/Hy*Hy*BNUHy*%NK,/ Hk/ NBR < f jp/Ћ(4 /Hy*?NP <*`f <+S/Hy*|Hy*BN <*`f <+S/Hy*hHy*BN <+SDf <*`/Hy*}Hy*BNA0 JlA3 (4 /Hy*NP <*`f <+S/Hy*Hy*BN <*`f <+S/Hy*Hy*BN <*`Dg <+S/Hy*Hy*BN <*`Dk <+S/Hy*Hy*BN <*`f <+S/Hy*Hy*BN <*`f <+S/Hy*Hy*BN <*`f <+S/Hy*Hy*BNp/Hy*0NA4JlA7 (4 /Hy*gN?BgHy*NBD&B6HC/Hy*NJg2A8JlA; -t -|*L<|N^`|`xL<|N^NuNVH88(n&n Hy*EDrN XXjV$4 /Hy*2NP <*`f <+S/Hy*WHy*BN <*`f <+S/Hy*lHy*BNHy*N$/NHy+N Pjp Ћ/4 Hy*N Hn/ NPJg,p ЮjV(4  Bn LN^Nu-|*LN^` jV$4 gVp//Hy*Np/Hy*GNC/Hy*tN/Hy*N$$C/Hy*NRTP`v`NVH<<(n&n Hy*EDrN XjV/4 Hy*UiN Pjp Ћ/4 Hy*gNA JlA $4 /Hy*UNP <*`f <+S/Hy*Hy*BN <*`f <+S/Hy*.Hy*BN <*`Dg <+S/Hy*XHy*BN <+SDj <*`/Hy*Hy*BNAJlA /4 Hy*NAJlA /4 Hy*NAJlA /4 Hy*$N$Hn/ NfPJg&p ЮjV&4 B Kb L<8(.*. &nHy*mHx/ //IHN,+EDr+g0pF/Hy*NPBF&B6HC/N>$+pF/Hy*N/Hy*N/Hy* Np/Hy*-N .*PN/+Hy*nN/+ Hy*NHy*N/+$Hy*nN.(Hy*NHy*N/+,Hy*nN/+0Hy*NHy*N.4Hy*nN/+8Hy*N&+<(n&n Hy*EDrN XXjV,4 /Hy*NP <*`f <+S/Hy*Hy*BN <*`f <+S/Hy**Hy*BN <*`Dg <+S/Hy*@Hy*BN <*`Dk <+S/Hy*THy*BN <*`f <+S/Hy*hHy*BNHn/ NJg< .jVr´ Yf& <*`f <+S/Hy*Hy*BN /Hy*N &B6BBHCHBPBrfHy*NXHy*zNX Pjp Ћ$4 /Hy*NP <*`f <+S/Hy*Hy*BN <*`f <+S/Hy*"Hy*BN <*`Dg <+S/Hy*5Hy*BN <*`Dk <+S/Hy*FHy*BN <*`f <+S/Hy*WHy*BN <*`f <+S/Hy*xHy*BN/Hy*NrrL(/Hy*NK JlK rK$/Hy*NpPrfHy*NXHy*zNX jV04 rg4$/Hy*NP <+Sg <*`/Hy*FHy*BN L<|N^NuB0 -2IbHy*NXrgLh/Hy*NP` 0 -2IpFĀ*BHy*NXrg8L8/Hy*NP`./,OH>8(n&n B2, xȁ <*f <*]/Hy*EDrN PjV$4 r,&* XJg/Hy*BQNP <*`Jf <+S/Hy*Hy*BN <*`Jf <+S/Hy*Hy*BN <*`f <+S/Hy*Hy*BN <*`f <+S/Hy*Hy*BN <*`f <+S/Hy* Hy*BN <*`f <+S/Hy*#Hy*BN&pHy*9NDkHy*FNX"<+p g"<*h/Hy*|NpƀSPre 0=-1&0=-1/Hy*N/Hy*N/Hy*N <*`f <+S/Hy*Hy*BN <+SJl <*`/Hy*Hy*BN  j ^$4 <*p//Hy*fNr‚/Hy*N/Hy*N/Hy*N$ <*`f <+S/Hy*Hy*BN <*`f <+S/Hy*Hy*BN <*`f <+S/Hy*Hy*BN <*`f <+S/Hy*Hy*BN" Jg <*`Jf <+S/Hy* Hy*BN <*`f <+S/Hy*#Hy*BN <*`f <+S/Hy*Hy*BN <+SJl <*`/Hy*Hy*BN Jg Pjp Ћ$4 /Hy*uHy*~N?BgHy*Np/Hy*NA JlA $4 /Hy*Hy*~N?BgHy*Nr-B -|*L|N^`^pr eHy*TNX`,Hy*h`&<*l `H/Hy*ONP <*`Jf <+S/Hy*Hy*BN <*`Jf <+S/Hy*}FHy*BN </Hy*N"C/0--2Hy*@N j ^$4 <*Ѱ`6 <*xJf <*/Hy*Hy*BNB </Hy*N/0 -2Hy*Np/Hy*1N$ <*`f <+S/Hy*U`L|N^Nu/,O/. Hx/.NF< N^Nu/,O n-h(N^`/,O/"n$. iHx,/)$/ hN -B -@$.N^`/,O/. /.N~PJVIDN^Nu/,O/. /.NPJVIDN^Nu/,OH8$.&. (.NHy:rHy:rNuPJg./// y:r N$Hy:rNuT B LN^Nu/Hy*6//NEB`/,OH8$.&. (.N4Hy:qHy:qNuPJg2//.// y:qN$Hy:qNuT B LN^Nu/Hy*7//NEB`NV@H?<$.(. .p*r,&/Hx@I@/ Np//HxK/ N&<-7 C$PJfG`8 CgJp ր`Ⱚg Jf`Jg&jJg pFJf/ / Hy*tԎ/K/ I*NJgHy* // N C  fpF//Hy*// NJg fJgpF/Hy*// NJgrF„/Hy*1// NHy+2// N L<N^NugB `4Jg"frF…//Hy* `p//Hy*`bHxHy*Ѱ/N($ Jgv/Hy+^``$hJgpF`NVH00&n$. .EOHgP/Hy,=NPJgpF,/Hy*CNPHy+NXAM`JgN/Hy+D%NPL N^NuHx&/B/+,/+(NpF,//Hy*RN `Hy+NX`NV4H?<(n-n 8-n4HxHxN&HHy*uEDrN BvƂ֋//.8/ lN C X fHy*NHxB/ NzHy+N,+.pR&$(/Hx@Hn@N Jgf//Hy*N r//HxHnNJgF//Hy*N $+?BgHy*ONP <*`f <+S/Hy*Hy*BN <*`f <+S/Hy* Hy*BN <*`Dg <+S/Hy*!Hy*BN <*`Dk <+S/Hy*/Hy*BN <*`f <+S/Hy*>Hy*BN <*`f <+S/Hy*OHy*BN <*`f <+S/Hy*`Hy*BN <*`Jk <+S/Hy*vHy*BN <*`f <+S/Hy*Hy*BN <*` f <+S/Hy*Hy*BN <*` f <+S/Hy*Hy*BN r/Hy*bN <*`f <+S/Hy*Hy*BN <*f <,c7/Hy*Hy*BN <*`f <+S/Hy*Hy*BN <*`f <+S/Hy*BxHy*BN <*`f <+S/Hy*BHy*BN <*`f <+S/Hy*BHy*BN <*`f <+S/Hy*BHy*BNHy*BN( gd gdJfhHy*CNXp/Hy)NP <*`f <+S/Hy*Hy*BN <*`f <+S/Hy**Hy*BN <*`f <+S/Hy*GHy*BN <*`f <+S/Hy*dHy*BN <+SJl <*`/Hy*Hy*BN(+ K-7$UJfrf4 f.Hn8&n +"E &. BI)0Jo(S**,*eA  L|N^NuHx / Hj N `/,O/ $n g/N/NnPHxB/ N( $nN^Nu/,OB/.BBBBHx/./. /.N N^NuNV nHnHnHn/. / hN/././.Hy*NDr$N^NuNVHnHx HxBBB/././.N$Jf".N^Nupr`NVH?,$n"n (nJgA L4N^Nu*i"j/ / /"iN$"jHx/ / /"iN"j/ / /"iN&"j$./ / /"iNgzpĀ-BBD-@B y:r$.&.".֮ՁJg^xf6 ("( (*b$-hB*.Үх(.*.c& h`pYf"jX/ / /"iN*"jHx/ / /"iN"j/ / /"iN( j$./ / / hN,~΂ rƒD@Ȁ*ʃ y:rڇنJgpf2 ("( $&b -hB&.Үу$&cd h`xĄ.BpD*B`NVH?<$nBLBBp%@ %@%@B %|B,Hx Hn//*N-@B,.nB`".6-A jB/// h N$J:rg //*N P jB// hN &J:rg"x///Hy**NDr fR`d jHx // hN g`z-EB j/./.// h N$ jB// hN&( g~LmJ:rg$//*N4 r//Hy*HNDr j//./.// hN&@Jg(jL, v$LhAhP."jAh!Ih!BdBl!@`BpHx// iN* jHx// hN( jHx // hN& BHrhpHx//*NpJg/-/-/Hy*@NDrRJ g$۪ -"-**H[IĚdB%AH`:۪ -"-**D[IĚd%AD`ת ,",**D[I,.d%AD`. G&G r$Lrb`NVH?<&n$+LfJ:rg/Hy*ŒNDrPp`pJ g xB&L+8 JlV"+, = o//Hy*ūNDr p^r"^ @ o0|'H$t‚o"  opF'@(E*<Dr,<.<n +ЋbK$MC -IC-I +A رbT +A رbEP&<Ü*<DrK 9:rr$L+LAPbzJf :B`^x!` <= "+LBl LJlV`&*g(R/*/ / N*H + fBBp)@J:rg./,/,N/*/*/*/*/*Hy*; EN lpr//*/,/ hNJg *"*$-&- g-@-A///- mN `/*/*/*/ FN @ %@%Atvf>/,/,N/*/*Hy*NDrHy*!NDrXpL N^Nu/,O/ / $n j h h&hB/* hN/B/*N$n&nN^Nu/,OH0 $n$. 9:rgHy*+NDrX j h&(Bp E) / hNP-@B -R"CL N^N/,OH>8$n(. *.$. j hB,p /2i  hNP9:rgB/Hy*=NDrPJfDf j h(hBGi / hNrF€/B/N j(h$ "҅2 gfrЅG "S//)B/ /N j// h NBg2Ug/N////Hy*]NN`DfFp`2r`Dg>UgPB/N////Hy*ȊNN`pfL|N^Nut`gUg Br`p`B`/,OH08&nEBBI rm L N^NuJf r A  f R$`HjtNXJgrgJf`/,OB0. n J f A N^Nug`/,OH 8$n&n n(k$+$%k(Jf"%|1lHx/Hy*/ N`&%H hJfHy*NM`Hy+NOHP +%@"+$%A%|%|9:rgB//N j/ / h NPJg&Hx// lNr/Hx// lN9:rg,Hx// lN -@ -|*LN^`_LN^Nu/,O/ /$n n tĨf Hy*/NObPB $.$nN^Nu jHx/*/ hN fHy*.`/,OH0<&.&n $.(kp\L$lhp'@"C Q"J"*h*U"<Jg"<p/ BHx//NJg/+Hy*M/NNz `hp%@"C Q%H4"h"QK8"<vJf"</ BHx//N$g:/+Hy*o/NNz R h/*/* hN + rF'@ `np%@RXrg R h*h"B Cr`/ N %R@%j DXL< N^NuNVH <*n&n (kp\L$lhBJf mHn/ h$NPJg"Hy*/NNzP + rF'@ ` mHx@Hn/./( h(N$/N// /.Hx/./-NF)H,glJf$<*ɹ/Hy*/NOb 'lHjBHj/ BHx T// $<(v BN JgN/+Hy*M/NNz `<&n,. $n&. k"hzʃ"< f"< /B/./.("Ҋ/3 /N$g2/N// Hy*//Hy1|NN` L<|N^Nu k*h$Jfz؊EHI"T//)B/ /NBK,<Dr "@ i m>" jh k"jHx/)B/ / h$N%C`rr L @ ($"((*g8B/B-@/B/Hy*/NL k// h N$t`XH@X* U!XYHAY U!X9:rg* U"YHAY (XH@X///Hy*F FNR`/,OH<<&n$. *.&.//././// N(f~ k h*hB r EI/ hN/B/N k hԅ"s) /)$B/* hpN k hpƀ*/B/* hN L</NNzPHy*,/N/ / NHy+NLB0+( 1g @fpF,f%| %| Hx/ / N *r%A| Jgt%B%|| | %|d%| PXA%H p%@r%Al/ N +,XxzFSfD& BI&KmTL<N^Nur%A`Hy*i/N kHx@/+$/ hN kt/Hx@/+$/ hN$`/// N JgHy/// NR`z/,OH00$n&j/ NXBBB"L< j -RLSg&//Hy*+/NNz`"Yf/Hy*+~`/Hy*+=/NNz -JL<N^`4p\L(&D S hHxB/+$ hNHx N S hB/+ hN S hB/+ hN Hx/ NPJfB@ @#bF$ j< f4 VTBB@F/N *. (. 9:4B@F'E>Jg y> 9>r:sm// NPg/9>/ y>NB/9>/ y>N y>rJgN ( "($f@A> "y>01 2ABAf rfJ:|gN"B> 9:s"R#:s! >L$<I/9>/ y>NPfSfpF//9>/ y>NHx/9>B/9>/NM|B@F L|N^Nu/,OH8 $n(. &.$.HxlBHj N($%C%Bp%@%| l%| p%| t pL-@-|1ӈ -JLN^` /,O/ /$n$./././. / N A Cl  f *%@$.$nN^Nu/,OH0 $n&.$./././. / N A Cl  f *%@pgpf"%| l%| >p%| dtL N^Nu/Hy*NK./,OH? ,. . rf nJgm~&LG8փLF8$R$jRJo~HxB/[I/N(4E(/[I///NҁрLh/[I///NBRф,܆D*B҅ф jDrm o t`~ `^B LN^Nu/,O/ $nHx/*H/ jpNB/*4/ jpN/*H/ jlN f /*4/ jlN8PWID$nN^NuB`NV/ B/. /.E/ N / N :$nN^Nu/,O/ / $nGtpHf|@=*=//*/ jN/*/ jNrHf jt hHxHx/* hN jt hHxHx/* hN jt hHxHx/* hN$ jt hHxHx/* hN jt hHxHx/* hN jt hHx Hx/* hN$ jt hHxHx/* hN jt hBHx/* hN jt hHxHx/* hN$ jt hBHx/* hN p?Fg\|= *Hrf`*=P@=*=//*/ jN*:@:*://*/ jN$n&nN^NuB*=`F]f*=`/,OH80$./Nb$H (xFȀXJkg .f jTJgJXg / NBXX*g B>B>rHy1N&/N$Hx///G!NHx///N *(GJf/*NX L N^Nu/NU&/*N/*N * g /N[X *g /NXHj NHjN{VP`x`/,O/ n(: Ѐtgr(7tHft@`Jmgt g@DgrF(=gt$N^Nu/,OH 0$nGt$<P/*/ jNPgSfDpЪHfJ/*/ jNr//*/ jNpd-@L N^`,/*/ jNP`L N^Nu/,O/ / $nGt/ N 8X jpHflHx@/*/ N pHfHx/*/ jN *g,Hx/*/ jN*A//*/ jN*g0Hx/*/ jN*A//*/ jNpHf*?*@ jt h"@Hq/*/*x h8N *<//*/ jN j*:@;//*/ N*>//*/ jN$*gDHx/*/ jN*A//*/ jN*<//*/ jN$pHf< jt hHx#Hx/* hN jt hB*F/Hx/* hNpHf*:@//*/ jNHx/*/ jNHx//*/ jN*:$//*/ jN"j j `oHx/*/ N *=//*/ jN $n&nN^NuB`*<//*/ jN*?//*/ jN*@//*/ jN$`B`n/,O nJ g,(<@@<(6f(1g!h(,B(|6N^Nu(<`-HN^`/,O n". (Bg*Jg*(:@:(6f(1g!h(,B(|6N^Nu(:F`-HN^`l/,O/ n". $. Df tlgJ tmg6 tkf (:F@:(6f(1g*!h(,B(|6$N^Nu(:A:(:`-H$N^`NVH8<". $.&n(.(n v /Hy;N;$HPJgJXfv L<N^Nu/NXJg*j m/ // // h$N&pf/ // // Nh&rf t\f:/ B-|Hx/./,NB&fv/ NF%SX`/ N6X @t]gbx tzgb, txg tyg g/ N&X` t{g @1fHy?wN{hHj`/ /N&Hy?wN|` @tXgb @tjf/ N &`N tmb tjbP @(1g`x (1g 01g`dHx/ N PB`PB`Hx/ N `B`&`/// N \ `Hy?wN{h *"*&'A *L|'@Hy?wN|`v`/,O n(Cg>(0g8(:FA:(;@;(;//(Hht hN N^Nu(:A:(;`/,OH 0$n&j/ Nf*0@0/ N 0B/ N +Bg*B/ N Hj`NBrӪd$*`Հ%B` *H*g6|=rg]f,*=@=`*=@=*=@`B*=Ug*=//*Hjt jN/ N jTJg / NBXXL N^Nu/,OH 0". t /Hy;N;$H&h +PgNfH k/./ hN/ N JXg&/NXJg+fJf / N XBL N^Nu/,OH<<(n&n ", t /Hy;N;$HPJXf pL< +()@\)@`)k@*6f*1g%j(,B(|6 +f~BB *0g*0@0/ NX*0g*0@0/ N 0X/ NX lpHf6Hx/ h0NP +f>*3g6B*3/ N X`$g$5|B|DJg *:`B*A`5|BB*DJg"*:A:*:g*:`B*A`*:`xJ`f*:*B`rf |>`g@"+( n|>]f*>@>`t n|>`|A>`B*>`/ N X`x%y:s%y:s  `*7rF€/`NVH?<$. ..G r&@ z , /Hy;N;(HPJfv LB@ C#bF$`/ Nr)AX/ N P*,`dfJhgF/ KNXA-H(*+ l`"ld " f"+hmBhB`Bd|=J*Bk ,=@= ,HrfR,=P@=,=//,xtHtH lN/,HtH lN@7Hy?wN{hHxB( `/N(p)@ .N\Hy?wN|/ G$N ,g-y> "9>,-A-n ,gA-ADfDjB`Hn/ N  %|+8r%A<%|D/ N/ N&/ NjHx/ N  ,)@)@)y:s/ N 8,0@0.N 0/ NPB@Fzʮ/// N& f" j/ -G-B// hN& g*fJf/ N X`/ NX`LL|`X " o " (,hj BSB@ L<L|HЄ"9: eL|L/.Jfp/BHy3 Nt/ N`\]f,=`-|%"<K`*/,O/ / n"( t /Hy;N;$HPJXfB$.$nN^Nu/NXJgJ*Cg/ NXJ g,*0f*0@0/ N 0X/ NXp`*0g*0@0/ NX*0g*0`/,O/Hy?/*/ jNPg*"y>rJg j,(.( ) ")$f  y>00 2A Af*rfJ:|gN"B>/*/ jNPf  fd/*/ jNPgN*6g/ N B*6%j,(B,X *(g$*d$//*$/*/ jN(ժ$/*/ jNPg/ Nۖ*5*4*2Xf~p`6B>|HfDfg*0DkJg/*/ jNE"y>rPJg j"($(*) ,)$f" y>20$f`*|fXJ:|gN"B>/*/ jNPff%L%C*0f|5*0Dgd*0@0/ N 0XJfF*0@0 *H~g]f*=@=*=//*/ jN /*/ jN*7@7PgDJl@Hy?wN{h, `/NPJmp//N Hy?wN| *9g*8@8*9FĀJgB(B,|4`\B>Te(jS`*=`" j f2/*/ NP`p`j*=g(*=@=*=//*/ jN *1g`B*1|2`R*gBHj/*N8 `f/*N_X`V/,O/ $n/ N */*LHj4N $nN^Nu/,OH< *. (.$nB@F'"9:so8A>L 2|XfS#:sB@FrFLfX y>rJgN ( "($f@A> "y>01 8DBADf rfJ:|gN"B>B@FB`FNV". .Hy>-@-A//N 1N^Nu/,OH<0$n$. *.&. J"X&i/B/*/*/ SN(fG ZpfHx/*X/ jpNHx//N$rft&jp/.Nf./*H/ NHx/*L/ jpN jppfHx/*8/ N B/*0/ jp`.///N $pgrf R h//*(/* h8N `n [g"Hx/*H/ jpNB/*@/ jpNHx/*H/ jpNpF//*(/ jpN//*,/ jpN$`Hx/*8/ N jprf`HxC/*L/ NHx/*D/ jpNHx//*(. ,.*.&.$<>Hxx/./N)0/////N 2$ f<#:s>rHy>NڐHy*ѮNڸ#>$#>(#> #>,P L|N^NuNVH<<$nGt|B.B.Hy+NM`/N$HnHy*Ҟ/I(NHnHy*ҩ/N HnHy*ҷ/NBHj KLN( I{4*g:HxHx/N pHfN|@=*=//*/ jNI>//*tNa:Jg "*|>gJ.gp#>J.gHxx/ / N)0 J>rf,/9>(/9>$/9> / N 4Jg/9>Hy*NDrPpЪHf/9>,NX@r!D !@$'D'@Hy+m/NOb*gH/NHxHxHx/ Hz/HjNz Jg/Hy*/NNz BJPfp%@X/ N "*p %@ *LXg f/Hj4NPL<g B$nN^Nu/9>/.Na:PJg . >fJfp`$>`/,O/.NbX(gB/(Hht hN pN^Nu/,O/ / /.Nb$HGtB/(/ hN/*/ jNp$n&nN^Nu/,O//.Nb$/N/N /Np$.N^Nu/,OH 8$nB&n J$.UI(y fBfE J LN^Nu/ nHp/ N" d"A B(`/,OH>"."n ,. n&.$. *.$Bb"/// /NEABL|N^Nu(RHf -I-AAH-H -FL|N^`&(RgJ f`/,OH?"n$. ,. n(... &.$*.(Bb"//// NEABLN^Nu"剾f&f -B-IA-H -FLN^`T"RdJ f`Nq/,OH 0&n$k$+ jBHx/ hN jBHx/ hN jHx2Hx/ hN$ jHxHx/ hN jBHx/ hN jBB/ hN$ jBHx/ hN jBHx/ hN jHxHx / hN$ jBHx/ hN jHxHx / hN jBHx/ hN$ jHxHx/ hN j +/Hx/ hN jHxHx/ hN$L N^Nu/,O/ /$n$. J*f* j h*/Hx/* hN *$.$nN^Nu/,OH> n,. &.$h$(9:sKgB jHx / hN jHx/ hN//Hy*9NDr jHx Hx/ hN jHxHx/ hN jHxHx/ hN$ jHx.Hx/ hN BBJn. jJf HxHx/ hN jHx/ hNPg jBHx/ hN 9:sKgHy*INDrXg| jHx/ hN jHx / hNvƀքgH jHx Hx/ hN jHx"Hx/ hN9:sKg/Hy*NDrP jHx/Hx/ hN jHx Hx/ hN jBHx/ hN L|N^Nu jHx/ hN(Pgf m.pր jHx@/Hx/ hHN`x9:sKg/Hy*DNDrP jpl //Hx/ hHNxȃgFp܀ jHxHx/ hN j//Hx/ h N jHxHx/ hN(ڃ jHx/ hNPf- g/N//Hy*թNDr9:sKgN" jHxHx/ hN ` hDj,Hx Hx /N- gb& g gP jHxHx / hN` fJf$/NHx/Hy*NDrN"&m`Jf$/NHxk/Hy*NDrN"&m-f.Hy*/NNzP9:sKgN"/ / NP` k(r!Ad`Jf$/NHx/Hy*NDrN" m!m!m&m!K I g'L$+HC!I$B`d+L ` g f-W b&m&-9:sKgHy*BNDrX(  -f,-ȜI kHx / hN Pg g9:sKgB-//Hy*NNDr`r-W bp&m&-9:sKgHy*NDrX kHxHx/ hN kHx(Hx/ hN -fJ(- f9:sKgHy* NDrX-- kHxHx/ hN B-B--D@FD- gb g g gHy*/NNzP9:sKgN"p` kHx / hN Pg k h gJ-fHx@Hx /N kHx Hx/ hN E` g fl-p`>Jf$/NHx/Hy*NDrN" m h( h@(G@A+Hx`:-p `p`p `p`pfJ-fHx@Hx /N k h -"S+A"@B)/Hx/NSm kHx/ hNPfJfJ-g`D-+DB`2Df-Hx/ NP k h-fplrHx/N-Hx/ N kHx(Hx/ hN kHx/ hN kHx Hx/ hN kHx/ hNPf`.-"R+AHx/N GRPpf- gz _b Uff9:sKgB-//Hy*NNDr - g fJf$/NHx!/Hy*NDrN"(m l("h@ )@ - bzB-ҁ2;N`6&hhrrf- f`Hpl -fB-Tf`$Hx/NP`z -)@!@`| kHx(Hx/ hN kHx/ hN kHx Hx/ hN kHx/ hNPf`B-// NP`-9:sKg/Hy*bNDrP -fjHx `rLR |`N)m)m`>/N/Hy*zNDr 9:sKgN"Hx`l/N/Hy*֭`-k2/N/Hy*NDr 9:sKgN"Hx`"p,-F-,S̀g/Hy*ߵ/NNz`.D΀p|Jf|(m~΁Jf4/N///Hy*INDr9:sKgN"` l("h@ l @fDg(H`!@$ l$ |+LpLhp度ui  ,,Jj&Hx/ NP+l+l+L+l`gHx `Hy*,/NNzP` -f9:sKgJGDrJf /NHx/Hy*NN" m"(S/B/Hy* N /-/-/ Nѭ`> -f@9:sKg/-Hy*NDrP/-/-/ NFѭ` -f9:sKg/-Hy*(NDrP(m(-&m&-9:sKgB kHx / hN kHx/ hN//Hy*9NDr kHxHx/ hN kHxHx/ hN kHxHx/ hN$ kHx.Hx/ hN BJnfJf kHxHx/ hN kHx/ hNPg kBHx/ hN 9:sKglHy*INDrX`\ kHx/ hN@0Pg k.g|Hx@/Hx/ hDN.g< kHx/Hx/ hN kHx Hx/ hN kBHx/ hNݭ$`Hx/ hN" Pd".9:sKg/Hy*׮-ANDrP".܁pd. k //Hx/ hD-AN".p؀~΁Jg. kHxHx/ hN k//Hx/ hN؇ kHxHx/ hN(` -fPJf$/NHx/Hy*NDrN"&m jHx(Hx/ hN jHx/ hN@ jHx Hx/ hN 9:sKgB+/Hy*4NDrP`B`( ,$Jfx+@ `t/,OH0<$n$.&j&*9:sKgHy*׊NDrXI OK-Jf pL< N^Nu kHx/ hNPg/ NX n (<f HxNSX`B`NVH0<$. &n n h/Nb(HX9:sKgHy*וNDrXJgUg~L< N^Nu9:sKg& k@/(@/+T kPB/Hy*ףNDr/NXJfr'Ad-KL< N^`B&+8B@ @#bF$$lJg j "*$Jg!A$ j$ r,B@F%K(%kL0+:gj.BB%@B*B@ B#bF$B l%H$ A )H ,f/ NXB@Fg/*0/ / KN Jg/ N/*0/ / NJg-JL< N^`l)A`:/+T/+P/ N)0%kT%kX +\ `FpLA(B(B( -@BBBrLA(g-|B(-B-A4  g& fpHnHxHlDNB> `r`/,OH0 n$h$( jHx/ hN jHx/ hN jHx/ hN jB/ hN ////Hy*GDrN jHx/ hN jHx/ hN$ jHx / hN jHx / hN jHx / hN/////Hy* N0 jHx/ hN jHx/ hN jHx/ hN jHx/ hN jHx/ hN/////Hy*IN jHx/ hN jHx/ hN//Hy*؎NL |N^Nu/,OH 0$nB*//*Hy*رGDrNB*/*/*/*/*/*/Hy*N(B/*/*//Hy*NB*//*Hy*3NR pfL N^Nu/,OH8"n$i G ) ". ҋd&i n Ic i (n(&n& ) ddbB`dp7LN^Nu/,O n"hBHxHh QN N^Nu/,O np@g h P"h hN^NN^Nu/,O np@g h P"h lN^NBN^Nu/,OH 0$n n&P$ pp%@p fp%@%|p fhrp fb k (D0 ///N f%@"+ tgJtgLJf+ xg2%@L N^Nur`"k pg Ћ1 7`B`@``@`/,OH80$nx $ XG-&<' jHx/ hNPJg"HxNSXfHj4Hy*HNDrPp`F jHxHx/ PN jHx/ hNJg jBHx/ PNS f`BL N^Nu/,OH8 $n( X jHx/ hNPgR* B* / Nu jBHx/ PN g2//Hj4Hy*fNDrB LN^NuJ gHx/* |Hjp j N `/,OH0<$nBG& XI-KsJ* g/NXJg4 jHx/ hNP* g(Hj4Hy*ـNDr/NQ" pL< N^Nu* xg,R 9:Ѐ/Hy*ٟHx / NS Jg~` jHx/ hNPJg / NXB`  ?nRHx NX`Dp#`/,OH< $n(. D * X jBHx/ PN j/Hx/ PNpgj/ N$XfR jHx/ hN jBHx/ PN g& g0//Hj4Hy*fNDrt LBHxHx/ NJf(BHxHx/ NJfBHxHx/ NL<<(n$T&j * xgBB/ NTPB "* %A p ej * Ѐ0;NR\\\\ j XJg/ NX*@ x/ N$Xg j \Jg/ NX* x L<|N^Nu| B* Hx"BHj(<("DN * 4@*  8//HjK)0Np fPCv * rfHBABlH1j vƒo R`%A B* `~| | `rCV`1rL@@/ N$XgHx/ NP` * %@ %@ & X jB// hN jB * X// hN jB"* P// hN$ jBp Ъ // PN jBr Ҫ // hN jBpЪ // hN$ jBr Ҫ // PN j/* Hx/ hN jBHx/ hN$ jBHx/ hN jBHx/ hN jBHx/ hN BHx/ ,< kl FN$ fBHx/ "FN$ f, p jHx/ hN%@ jHx/ hN%@ 0,0@@@9@0B * rg]f &* 'C07j B+BHxBHk"DN//N rЁHxHr vHkN& 0 Hx/HkN  r f~Hx//N * 4@vFƀ//HkN7|p f 7|4|6* gkp gj r%A B HxHx/ j N `7|HxB/"DNB+ `B* A 'H0HxHx`t`Z/,OH08&n$S(j ,rF€t fB"g>r f:t/N ÄXJg"B2 6A 7Bmf$p`fr`t`f> g<%A 0|4 ," fbg"J f"fNB`R`A`g@p f !A xg4%A A x* xg(-KL N^`Br`Br`Br`t4gBL N^Nu/,OH00&n$SBk.* xgj/NXJg\* x&@ x * gVS%@ fHHkHy)[xNDr&* / N f$Hx/ N*/ N( xL N^Nu7|. * " pJg(S%@ fp fHxHx/ j N`7|./N pX`NVH<&n(. *.$SB@ C#bF$* xJ:,gjIKs* xfp * xπ@ x ig of/// N$[ r4f+1g`gX/NXJfp/-@Nb .L<8N^Nu/NXJgR BHy*ںHx / NS JgH`B`L/// N# Jf0* x@+1gJg`/ NX`Jg Hx/ NPB* xJ gd/ -@NuX .`N//HjpN G6 r4f* xg/ N>`p#` NVH?<$nB@ G#bF$$ XHx(/N x jHxHx/ PN* xA@ x/ NtXJf jHx/ hN jBHx/ PN jBHx/ PN jHx/ hN:MCC jBHx/ PNHx N-/ NߺJ* fEJEggNCp-IC -I(j C -I j/ / hNPkf8J fgHx/.NP@ jB//./ PN , X j// hN(Pk j// hNPf j//./ PN(D `L jHl/ hN8 jHl/ hN@ jHl / hN@ jHl/ hN, jHl / hN-@ j -HPghB B0Ѩ("H PJf )g: iH&h\*I )B2d&A j/ Щ/// hN܋K`6|g6|`K&nJDfzJgg~* fp f r %A 5|N0*P@@ @@f*B./B@.r//+/+N *Pf * xgp%eHx&/ N #\&HPJg,+Hx/Hn(<)0"DN F fHxHhHn"DNHx/ N  * gWfHxHnHnN)0 +HxHn/N)0 k|||B(B(B(nn /+/.N (/.B./// /.N R/N V `(JfHxHxN bPJg1jL B0!@(!|h Dc,Hx/-HN P n(g "hH!i\JfR&hC# r"@ !I`0HxHxN PJf/ N "X`l!| DbB0l!@"j/(/(//"i-HN n (܀@**H`nHx/ N #\&HPJg `%K `%L Df/ NXg/ N"XDjp fJ fHjpN 8$n(j,* *FfHxN-XBL|N^Nu jDf`:<(< vcG- l// h4N4EPg@HxdNXQBCSd jDgg/N/Hy*ۦNDr`&:<x `JfHy+NOHHy*ۉ/NNz p``/,OH 8&n n$P(j$*Jfp"'@BLN^Nu*BgHjXN b'j'jX` jd'hBB0*DSf j hHxHx/* h8Np'@ lHx / h4N gr j hHxHx/* h8N `Z/,OH0 $n$. /*hN Btհ&0ׁ!X-jhL N^`f/,O/ /$./Nb$H h hHxHx/* h8N/././. Hy1d/N$$ j hHxHx/* h8N $.$nN^Nu/,OH0 $.&./Nb$H h hHxHx/* h8N?Bg/./. Hy1d/NH$$ j hHxHx/* h8N L N^Nu/,O/ / n$h$( j/. Hx/ h8N -B -J$.$nN^`:/,O . n g n frЁN^Nur f`/,O .B@FN^Nu/,OH80$nHx$N&$*4XG (JLfHxHxNPJg"%L R$JlSpR0f%B40gHxHjNP-CL N^`d/,O/ /$n/NXJg.Hx$NL$HjXN /N0/9:HjN$.$nN^NuNVH80$n&j$*HxHy1THnN)0 kHxHx/ h8N kB/ h4N6 kHx/ h4N4 j hHxHx/* h8NxȃpĀ&v,$<*1Dj$<*ۿ jB(HpN$UF/ /p//Hy*/NObL N^Nu/,OH?<$n&j(*& X kHxHx/ h8N kHx/ h4N4 kHx/ h4N8B< j hHxHx/* h8N&C$.*Ѱ/NObPGfHy*NN`BBHx"/N$Hx"/N$^L<&n$. *k&+ +0"$sBJf(HxHxN b$HPJfhE J L<|N^Nu4fHxHkNP"+0R JlSrR'@0AH%Hp%@Hx(BHj N( 5k4 %B( V cx c`(\rȁHx/NT%HPPg.%JHp%@L%H *%@%D\BTBX*f/ N X`Hx/ N P`zڪrʁ8|%L%BB?+DUNP(Hx&N,XJ+Bj m /Hx/ h8N +FgplJ mHx/ // hN8|Url( m // // hNppĀJg m// // hN// NPJ+Bj mBHx/ h8N /NHX`rl m // // hLNpg m// hNP`/,OH8 $n(. j ./B/ h8NHxN-vBB jB/ h4NJ@@SPf0LN^Nu/,OH<0$n*. 0*D @gfv x 4< @g4</ G,NXJfT j hE?Bg//* h8N/ NJf. j h-C -j"h4L `K*-`K* `// N PJgz//*N#/ N Jg k*h4Hx?*DUNX./NB8Pj*9g/N/Hy*`NDr -JLB<Pk /N X?BgHjPNPx` l-h8Hx ?*DUNFXB// nN  g<&n+1gr$S$*(Q*<K6,< *䰪lH&֪Hx/// jNJ.l4(*&*/N///Hy*)NDr%BL<|N^Nu/+ EN(kXJf /+NX` ,'@fBBS/+N +(Xg kJglHx/ /N / j/0,/ FN7|.|D@@=@BnHx/// j|NHxHB/ jNR(fBR`Hx/ / y?t h `/,O/ $n%| %| Ü/ N ˂BHjN#Bp %@ *0| %H *Ј BmBm$nN^Nu j!R` j!R`NVH?<$nB/ jN4jBjPJj _@/B/ jN JBl\gHxHjN~P gHxHjNjP g./N/Hy*WNDr/ N pLL N^Nu/,OH08$n&j$*HxHxB// IM|N k*0//*/ hN HxHxB// N&<I- k/*/ hNPJmSf L N^NuHxNX`/,OH0 $n$. /*hN Btհ&0ׁ!X-jhL N^`./,OH8<&n$S+1gK$<6&< "0*DjFg/+N(kXJf-kL<N^`Dt ,'@fBBS/+ BN +(Xg kJgpHx/ /N 0*HЪ4// / jN(/ CN0*HB25 LR@5@HjDfBjH0*F2RA5AFJ@f@/ NX`4Hx/ / y?t h `L<N^Nu/,O/$.`Hy THy 4B/N$FBBHx!/N$ Hx!/N$^P$.N^Nu/,OH88$nJf%| J f%| ҆ Jf%| Jf%| Jf%| ӄ"*< ?o<* f2 _o.p5@D$*4&5C\8C5D^(D5C`Ђ%@@҂%A8/ jN$Xf/ NBHjNL/IN/Hj$N)/L%J%| l%| 4Jf%| <G5|@& d/N$UF/Hy*i/NObA`%HH/ j$Np0/ N#B/ N#./ N$Ud/NHxpHx/HjpNp@ LN^Nup`p`t`/,O/ $n/ N"jXJg -J$nN^N$nN^Nu/,OH<<$n(n 0*0g @5@0BPRrfL<BjFBHHxHxB// IM|N k*0//*/ hN HxHxB// N*2 kDj//*$/ hN kB/*/ hN kB/*/ hN k*1 //*/ hN$ kHx/* / hN J,g kB/*/ hN kB0*^//*/ hN kB0*^//*/ hN kB0*`//*/ hN$ kHx/*(/ hN kHx/*/ hNHxHxB// N, k*0A//*/ hNHxHxB// N(  K jB(R"k0I/ D/(/ iN pfK/ /N ٪(  * ,P kB/"D/( / hN f0*^R@5@b k?Bg/*/ hNHxHxB// N k*0//*/ hNHxHxB// N*1 *@f k//*/ hN kB/* / hN jJg/ NXHxHxB// N k*0//*/ hNj@@ -CL<Jg&-EB .".Ӭ$*, ۀ)E `z`BrӬ.,߀)GBj>Jf/*xN*0*FS@5@FXg/ N&X`/*/"iNBrӬ.,߀)GP`Df Hx/ FNP/ jNX`/,OH<<(n*. $.6HxHxN b$HPJg1l< !B(JCg&H4<K (<  CcHx/ NP+gr4<f"kA r @ @'HB0d$'B//+// lN*Bg,HxHx"DNPJg &&H4<`x/ N "XE J L<*b @b~A>XG GbzSJA Bbrj^elj`dfYB?Bg FHh/ NB@.5@b.SBA j^ex k//*/ hN jbfP`*a*_`xU`/N?Bg/Hy*~HxNGNHxHjN/ N L $n...*J.gB(*$L(L|("L<LDlR*g 2b*KrffS*g j@/Hx / hN j@/Hx/ hN j@-Bp-@ -J"hL|N^NB`NVH<8$n&.(.*~p gtt *F SgF/N//Hy*߱NDr j@HxHx/ hN*@}jL/N/Hy*PNDr j@B*H/Hx/ hN j@B*N/Hx / hN$ j@BHx/ hN j@B*O/Hx/ hN`/,O/ n B@ B#bF$B /Hy>0N PB@FP$.N^Nu/,O/B@ B#bF$/<Hy>0NPJgp B@F $.N^NuNV"n".  ih-ABBB(Dj-|B(-A(-AJ(gr` @fnHnHxHi`NB> N^NuNVH?8$nJf/N/Hy*|NDr `&*xpg8*| g./N///Hy*NDr*}B*}gB j@HxHx/ hN j *0/Hy*NDrLN^Nu *rd< j@HxHx/ hNj*A} j@HxHx/ hN`(*| j f^CStfV g _b UfB g` gb f(Bj@5@BB/`"H`tf ff`tl\ fTB)"BTfD`(j`"l"i@$)@ &jh b"Ѐ0;N^jzN brJjg j@HxHx/ hN j@HxHx/ hN*}B`Jpl4 i P/ h N$*pD/N//Hy*NDrBp", f *p)@0Dg l!@`||``B`0* @gb: @gN @@f>/N//Hy*TNDr+{B+` @f /N//Hy*NDr j@HxHx/ hNHxN-+ l h@ (D rm s Jf"[I-@-A///+Nr J,5gB,6PJ gB S(B,6B,5!L|`b/N//Hy*-NDr*}+@kk k@/ N$ l h@/(@/ N &P` j@HxHx/ hN*@}j  `R||Jpfl`)jl()jp0`%l(l%l0p`( gT g~ i P/ h N/N/Hy*zNDr j@HxHx/ hN*@}j`` (f(B j(E+FJg Jg |c|D*}f(B+ j@HxHx/ hN*@}j l h@/(@/ N &*}kk kk/ NN`"* LL|&L<8LA8lRL<LA@*}f*"*tFlA c|D`,F`D+ (fd+@@@k kA/ N+f$ j@HxHx/ hN*@}j@ +{`B+` i P/ h N jB/N//Hy*{NDr`  f0*fF/N//Hy*NDr j@HxHx/ hN*@}j`0B(/Hx ?Bg/ N`/N//Hy*`/N/Hy*(NDr `NVH0<&n$n &* C(h@ ,@*kh$,DHxBHjN(| ,D@| p%@,plЃ%@(p %@0p %|R pm(u, Jf &[I-B-C///-N (HJ,gB,/ / N)J|P`f-J -KL< N^`\ kX$g.!J'JXAX%Hp +|f-KL< N^`R'J\`L< N^NuNVH8<$n$. B&h k@ (@*jh&(Dpm(u< Jf "[I-@-A///-N (H+;f HkN XJdf. B(4@"( gr'Ad (g fp'@d// NP`fB` *|g||/ NzXrdf6Jf0J,f*pmB< lJg!l l / NU&X// N R/ N6/ NN-JL<N^`Dfr`D"(0>'A` f2-B -JL<N^`j/,OH8<&n&. ||Bk k`Jg"h#Cd// N\PBKTdm L<N^Nu kh $pJfR` jJgBB*"h#Cd// NPI (  "\JgB i!Cd/ / NPfB*$j`/,OH00$nHjN XJhf, *fb *fx *g /NU&XHjN{VXB`NHx/ NPBGU&dl jh  pJfR`&(/NX C`/. /NCpPJgL N^Nu/NU&X`|/,OH<0$n&. J:sf@HxBHy*YBBBHx8Hy>0Nz HxHy>0N%p#:sPJ*|fBXAX%H\B`Hx@B/*hN( Bdmr/ N B*}BjB%|x%|tXBG &dm`Jg| | j@HxHx/ hNBHxHj`NB>L *-jp-jx-jt j@Hx/ PN-j`B*|B+4-k0-k /N/ /.//./././/.///././ /Hy*KDrN$ D.NX+g*Hy*NHx/ N  -BL// N &P`.`/,OH 0 n$P&j$* kBHx/ h8N kB/ h4N*gB@ k/B/ h8N j hHxHx/* h8NL N^Nu`/,OH 8&n n$P(j$* *fp"'@BLN^NuDfHjXN b'j'jX` lHxHx/ h8N lB/ h4Ngp%'@`p#`/,OH80$n *grF® t f$&j(*Dg&B&. rg*pg$t L N^NuHjXN $Xpf` j hHxHx/* h8N kB/ h4N[f&@ k?BgB/ h8NHxN N-`@`B`~/,O n P/(`/NN^Nu/,O/.Nb"h"i/. Hx/( i8NN^Nu/,O/.Nb"h"iHx/( i4NN^Nu/,OH0 $.&./Nb$H h hHxHx/* h8N?Bg/./. Hy1լ/NH$$ j hHxHx/* h8N L N^Nu/,O/ /$./Nb$H h hHxHx/* h8N/././. Hy1լ/N$$ j hHxHx/* h8N $.$nN^Nu/,OH0 $n$. /*hN Btհ&0ׁ!X-jhL N^`/,O/ $n*g jJg / NpX$nN^Nu/,O n . B.-Ar -A -@"hN^N/,O/ $n*f, jJg$/ NXJgHy*%/NNzPp$nN^NupB`/,O n . B.-Ar -A -@"hN^NNVH?<$n&R(k&+0*0@@ @@fX/*N*j/*N6PJg8BЭ*UJf c|/N/Hy*NDrHx/ N|/*N*jJg -%@fBBS/*N6/ N "P lHx/ h4NPJ@mV`r;ez k hHxHx/+ h8N lp\r /B/ h8N$<J+m^| lHx/ hNPJmJff+@///,Nn5|.j0 L Hy>(N Jg/N/Hy*NDr  g Hx/NP* j hBHx/* h8N kHxB/ h8N j hHxHx/* h8N$ kB/ h4NPf kHxB/ h8NBj6 DfHx//+N\* j hBHx/* h8N kHx/ h4NB<:E g:/*pN-EB .".Ө$*( ۀ!E /*pN*PVg*/*pN"[IӨ$*( ۀ!E /*pN*P j hHxHx/* h8NBj6 * f&J*g JlHx//+NfHjXN bg/ N/ NP/N#Ծ*///+N/HjNp`Z l/<Hx/ h8NHxN- lHx/ hlNQK2A AcHx/NHP`v"f f]EHxHxN b*HPJgL1j4 B2-A!A(Hx/N P-f\/ N "Hx/NHy*/NNz lB/ h4NPf lHxB/ h8N B`[E`h"m*f r"@+I l// Hx/ hL-IN"ng"zʮډ lHx/ hN EP"n*8g jB(A) (f) (f) (f)(fz)(fp)fh/ N "X`V r"@+@ l// Hx/ h-IN"ngbzʮډ lHx/ htN E `<+n+n(/ /*N#`Hx/NBP`/,O/.NbXJ fHhN#PXBN^Nup-`/,O/ //.Nb$HX(g2$P/N.HjN/N$V/N#xHjXN$B$.$nN^NuNq/,O n P"h\Jg-HN^NBN^Nu/,O"n n P(Sfp"#@BN^Nu"h`Jg-HN^N/,O n"h|"iHxHx/( iN N^Nu/,O n"h| (2RA1A6!@B!h"irF/Hx /( iN N^Nu/,OH, $n$. *.(./*hN ۰"0ӄ!X-jhL4N^`v/,OH0 $n$. /*hN Btհ&0ׁ!X-jhL N^`0/,OH 0$n&j|$*5|B* *g|frZB*ADf* k*/Hx/ hNHxN-Hx/. HjN)0 kBHx/ hN( kBHx/ hN L N^Nurz`x/,OH 8$n&j|$* kBHx/ hN kBHx/ hNHxI-N k*/Hx/ hN(HxN kHxB/ hN kHxHx/ hNHxN kB*/Hx/ hNHxNB"jJg-JLN^NLN^Nu/,OH8<$n&. /NV&H( P/ N :/INHx/HjN(yd%J%| C>|%| S%| K5|8 +Jj@* "< g"<  g f"<%A$ X%B@Hy 8Hy 8B/N$FJg&CBK$m/./N$^P/N#B/N#$ //N$Ud/NHxpHx/HjN$.N$UF/Hy*i/NObpPL<N^Nu@`0BB//NR`\BBHx!/N$Hx!/N$^`NNVH<8$n . &j|$*g kHx / hNB/*pNBrӨ$*( ۀ!E BrӨ*(ۀ!E *"[IӨ*(ۀ!E/*pN* kHxB/ hN kHxHx / hNS%C(Jl& P kB/ hNPILDfN kHxB/ hN kHx/ hNgf"[I-@-A//Hx/N"*[I-@-A//Hx/NBj8Bj6Jo-JL<$n&j|$*& Pg Hx/NP(<*< >IK0 kHx/ hNPfR k*gPHx/ hNB kHx/ hNf:*8f2Hx/N/ N SfL<|N^NuHx/ h4NB<P` k*gdHx/ hNB kHx/ hNሀ0|b// ENPJfHx/NP-JL<|N^`8Hx/ h4NP`NVH?8&n$n (k|*+*f Hy*NK.(*(0|İcL$<*p l$<+/N///Hy*HxNGNr-A P-KLN^`V$p<$n(n K(*0ftHxB/ N/*HN&jJg*+$<)1&<$WnxJf/*HN6j0XL<|N^NuHxHk/ BN Jg$/*HN6Xj0HxHx/ N `Hx/ CN"|,ᮍ4PJg E (&E*`xB`/,OH 0$n&j|$* k*/Hx/ hN k*$/Hx/ hN kHxHjHx/ h(N( k*(/Hx/ hN kB*/Hx/ hNBL N^NuNVH?<$n&j|(**Sf BL8$n$. (nBG-| jBHx/ hN jBHx/ hN jHx Hx/ hN$ jHxHx/ hNHxN jHx`Hx/ hNHxN jHx Hx/ hNzF xS j rF€/Hx/ hNHxN jHx`Hx/ hNHxN jHx Hx/ hN Jf jBHx/ hN zHxN jHx`Hx/ hNHxN jHx/ hNSJl 먈@ jHx Hx/ hN Jf0HDRTpf jBHx/ hN jBr-A -B"hL|N^NNVH?<*n n $h|$( jHx/ hN@ jHx/ hN8@ jHx/ hN6@ jHx/ hN jHx/ hN jHx/ hN jHx/ hN jHx/ hN jB/ hN2 /2 ///////Hy*y/ GGNNB.0 jvƁ(C/Hx/ h-AN jHx/ hN jHx/ hN jHx / hN$ jHx / hN jHx / hN jHx / hN@ jHx / hN@ jHx/ hN/////B././/Hy*/ N0 j v/Hx/ hN jHx/ hN jHx/ hN jHx / hN$ jHx / hN jHx / hN jHx / hN@ jHx / hN@ jHx/ hN/////B././/Hy*/ N0 j v/Hx/ hN jHx/ hN8@ jHx/ hN jHx/ hN$ jHx/ hN jHx/ hN jHx / hN@ jHx / hN@ jHx / hN@ jHx / hN6 /////B./././/Hy* / N< j"./Hx/ hN L/,ON^`/,O///.Nb$B@X C#bF$/N |/N B@Fp$.&.N^Nu/,O/ //.Nb$HB@X B#bF$*Ag/ N XJf / N ڠXB@Fp$.$nN^NuNq/,O n P"h ("iHxHx/( 0 iN N^Nu/,OH0 $n$. /*hN Btհ&0ׁ!X-jhL N^`/,O/ $np pd"B p/N/Hy*HxNGNB p$nN^Nu/,OB@ @#bF$N^Nu/,O .B@FN^NuNVH?<(n&T-k (*+ 0(+ ,&+ 4,1gTN*@ + |c-ML<(n(. &lp\L$khJfvL98:+rfBBK-Jo kJgB/ NP R hHxB/*$ hNHx N R hB/*, hN kJg Hx/ NP R hHxB/*$ hNHx N R hB/*, hNSJml g g g f(t kJgB/ NP R hHxB/*$ hN R hHxB/* hN R hB/* hN g R hHxB/* hN R hB/* hN g R hHxB/* hN R hB/* hN g R hHxB/* hN R hB/* hN g R hB/* hNP gfJgHx/ kNHxK-N R hB/* hN+rf j4 hHxB/*8 hN /// N*$ JgTBvFƀBlmg< R hHxB/*$ hN R hB/*, hN`B`T fB L<|N^Nu gt kJg Hx/ NP R hHxB/*$ hN R hHxB/* hN R hB/* hN g R hHxB/* hN R hB/* hN g R hHxB/* hN R hB/* hN g R hHxB/* hN R hB/* hN g R hB/* hNP g `t`t` g kJg// NP R h r_F/B/*$ hNHx N R hB/* hN R hB/* hN R hB/* hN R hB/* hN",<gL*($* &*$B*,gB*-xFȀ/?Bg?Bg-B-C//./// N 0*0f + x'@ / Hy *4L|L9:/HkNB`0*0@5@0pLHx / NrF€/Hx / NHxFNRp fHy*,/NNzPB`pL<N^Nu/,O/$.Hx /NrF€/Hx /N$.N^Nu/,OH<0$n n/Nb$/N vPJgHx/GNB/N @ Hx/NHx/N @ Hx/NHx/N @ Hx/NHx/N @ Hx /NHx/N @Hx /NBC Hx /NЃ%@[I$ Hx /N@ Hx/NDgHx/NPDgr * fjB* /N $&*B"<l҃тXB*<e B"<҃т$%A * b * b * bB&<c4p`&Hx/NPDf* g @ `xpL >>>  gn  gnp g gpt'L,J+If /+$N6X k// / / h$N$J+If /+$NXB,Hk0NPXJm)BB` g" fp )@$/ N>BL<N^Nu fn CcB*t`Z g fDB4 C(ct(/Hy1``JDg9t` BgnF BgR Bg^ Bgp Bf +B4A)0rlpdt/Hy1ֲ`d Bg Bg BfpfB4 C ct /Hy1/ N)0`( +B4 CctA)0rl/Hy1/ N `^Yf /Hy1`/Hy11`rdtYf /Hy1`/Hy1`rfB4 Cctx/Hy1HvH&<)0"CN|/HvH/ "CN`plBB4 C*ct*/Hy1ֈ`&?Bg/N $P`Hy3k?Bg/ N $`,Hy*n` BdB8B`v BbB9`/,O n P-hN^`8/,O/ n"P$h$#J!H $_N^Nu/,OH8$n n "Pg(R&h)K&$#J!H LN^Nu/,O"n n h N^Nu/,O n P"hP-h"i N^N/,O n"hD"Q#Hpp!@$N^Nu/,O nptN^Nu/,ON^Nu/,OH8 n(.&(@$h$( jB./B/ hN jpF-@-C -B"hLN^N/,OH0 n&(@$h$( jB./B/ hN j-C -B"hL N^N/,OH<$n&n (nTf" +f&pfBpp$gBTB+4BL<N^NuHkdKFNHklNPtfBt*f5|`xfBx*f5|`/,OH<$n%|5| jtGpJg(jClK!Ml!Lp(%IBt5| jxJg(jClK!Ml!Lp(%IBxHk /*INHk/*NHk$/*N jI4g"rB(|"hJgp#@$ P`, K"H P#I"fpr %AL<N^Nu/,OH8"n n p`f(wg $hTp%@$$hTGl pr$f"* g2ҩ!Ax$i8|,gbN(j!Jd!Lhrd҈(%AJ8g:"i4|$g )|c$i!Il!Jp$#KLN^Nu$R`"Q`$ir Ҁ!Al!Jp$#K`$irҀ!Al!Jp$#K`/,OH 8$n$ IG *̴g/NHh/ N `LN^Nu/,Op-@ -|N^`@l/,O-n -| N^`@^/,O/ / $n *g`rlfZHx/ N @ *Pg&jtJf:r€%A5| *g&jxJfPr€%A5|$n&nN^NuB2+n@r%AB+/B/ N B0+%@`B2+n@r%AB+/Hx`/,OH?<&nIpK$ 0+ @g kfN$kg "*c $k|g20kA B*Ё nHjlNlX kg*Fv@B@*7; *gh* gZ.*X*B*<  GB0H/// ENR f*rҫ&@ 'AJ*WD*ڂ,< 2) 3Y g$Y /B0Y1// FN RRpf'= tR/ NX`pB`LB4*G*gB/ NP * @@@%@p`B/ NHx / N `gvRIpHl/*N *P gr €g/N/Hy*U`F g@ "f%@K,&jg +c/ NXg(* f4p gL/N///Hy*}NDr*f%| *gDfBr€%A/ N &rM tXJgBM t(kTCd-I/ NB0M1// EN f/N/Hy* NDr/ / / N/ NzX`@`rF%A` kp!@$/+Hk/ N P jC'I'H %@ ``$<)JDjxr`$<)J/N//Hy*NDrBB/ N:`~lދJg8J*MgJlbp)@$BKB/.NXp$fB$|`B0M1// -A"ENB+P".fd*l-l/-@N/ /./ .//Hy*"NDrB+Jgd+ fT*kX++ fPkJgk7k'lPX|++ f@@Ai |(h'Hl'Lp(!GJg/ NXBfpЪr L⊐%@`r`

HxNZ%H0* $<*e g$<* f$<*o/N//Hy*IOHNB*Ԃ/N//Hy*Np%@%|1ר%|B* JfjjBHyhHj/NC%HWI`/,OH 0$n$PGs *fV n/(0N[ .h/E{VN .l/N n ( g2/. /NCpPL N^Nu/9:Hy*9Hx(/N`B`/,OH8 $.(. &l/E6Nh/N/N>/N-CLN^`Yd/,OH 8$n$ I&G j *Jj:rF€%A jpJg( hP jpp!@ jpB$ *p// NP` *g/N (BX`LN^Nu/,OH8<$n$ l/NX&< ( KbIG/ CNXg/ N/ NB/ N`j-BL<N^`X/,OH0<$nGIK(& $ Hx/ N *PJkgJ*Mfr`g/ NXg/ N/ N P`/ N`L< N^Nu/,OH8&.(l/N/././ n N$/N °/N6 LN^Nu/,OH 8 n&h(S$T"h"Q,8BtB|BBTBXI\!L`!L\Id!Lh!LdIl!Lp!LlB)ሀ)XtF + ft!Bt(k,f>tb+f~)gN fTp2|"<1h@!I8!APBLN^Nut !BtJ:sfB/Hz/ N (`C"<1D`/N/Hy*FNDr p`)G ( gR g g6|B8`|p8f B)!@8!|1׈PB/Hz`B/HzL/ N`l|`/,O/.NbXJ fBBHzh/N (BN^Nup-`/,O/ $n g/ /Hz* jD/N (p%@$-J$nN^`/,O nB/Hz h P/N (N^Nu/,OBBHz n/N (N^Nu/,OH 8$n&n $ l/Np Xf,/ / N / N@/ N °-BLN^`U8$n jD"P R&h&SB+ሀ+XBr%A$!JTB(!i||(hl+JlrAA$*L@ D$*d$B(*(t[ bg|CCg"*P!AX")!A fҨ8!A|*gB(f( WDBDfDj(rmB@(P@$1@BAPA$1AB@P@$1@`\r`B`fB|G.!KX|AJgJ*.l A`B`B`\t%B$( g(// N ŨpL|N^Nu n(@ A@r1@@BA A@r1@B@ A@r`$/,OH<0(.*l/NXBGE °/N$/NPJf/N6 L LBBB/.BHy*tHy*6HxHxpB/B/ND/B/NH//.$/. /.//././. /.N0JfJg".>Hm#>H$.&.N^Nup`/,OH 0$.fE J L N^Nu$y:sG(sJg//NPJg$j`/,O nJg/9> * Gg j/(/NP *g /*/NP/ NRHx/ N $n&nN^Nu/,O/9>@/.N N^Nu/,O/ $nJg"Hx/ NZB* P-J$nN^`S$nN^NuNV8H?<(n ,.$n*_pʀ j-h@Hx/.@N&HPK"|vrg n/(// N$ JfHx j/(KN-H8HxHx N( j/.8 h NrWID-@Ll@Hy*EDrNHy*NPBeHy* NXBeHy+NX/,/ / N)1 JW nT/.@/ N L<N^NuHx/ N"! n/(// N$/ N"` B ݁`bB58/Hy)^UNRP`TB38/Hy)^UNRP`P/,OH8 n(. $.$n&.Jg (fJf LN^Nu$B>LnFg(JfL-B-D-|* p-@LN^`x//Hy*HxNGNDjHy*YNK./*N4&/*N4 j///(`Hh//Hy*&HxNGN(`RNVH<8(.(n &.*.&nBpfp/ N*$H&XGf>Hx//Hy*xBN 9>Hrmf6pVID LHl,/ NXt`:B/ NP`n / NX`* g& gHo`h/ NHx B/Hy*/ N`/,OH <$n$. *I(G) tg/N/Hy+ʻ/NB*/Hy*'/K(NB* /Hy*T;/N j/N/Hy*2/N( j/(/* N)T/Hy+l/NL<N^Nu/,OH8 (.$nJfRJ fP&9:sf&<*Ѱ/N)/Ho Hy*:HxNGNPp$.&.N^Nup`/,O/ $nJg /*NS:sHx/ N $nN^NuNVH8". . $.BxgBvgpLN^Nuvg/N"XJgx>Hlp`Hn/N!j2Prg n/(NXJgt>HeHxHy>8NZBHz\/9>@ n/(N*Hy>8N`dv>Hm`V/,OH0 $n&. Jg(N)@$// NjP-B -CL N^`QL N^Nu/,OH<<$./NXJf.HxHx N !n !n!n !n!n"y:s!IPgE#J#:s!|:sJ:sfp@#:sHxHx@N#:sPI)/@HzHy*kN Jg/Hy*rNK.BHzbHy*E;N Jf Hy*NK.HzHy>8NDHy(Hy(Hy(hHxhHx Hy*FE |NHy(Hy(Hy(THxHx0Hy*MN0.(Hy(Hy(HxHx@Hy*TN$nN^Nu/,O/.NPXJVDN^NuNVH 0$nJ:sg$9>Hg^BHy>8NZHnHx/././. /.N$.>8GNXJf .g/NXJg JVD L N^Nu/,O/ / $nBHy>8GZN/ N$H JgHx/NB* / N -|>8$n&nN^`GNVH<<&n HnHy+ʻ/ N( Jft L<8NZHjHy*'/ N(KJfB**Cf@B* Hy*3/ "CN/*<) EN JgHxHj/.NR %HHy*A/ "CN/ EN Jf *gHn/ Hx/./.Nj&gjHy>8N/.N/ N $`*gD/./Hy*HxNGNHy>8N/.N/ N\`tA`Rn /.NXJghG40(jgHy>8N/.N/ N t`0"jf/)/( /* N)1 JfHy>8N/.N/ N ` n/(N&HXJfP n*(HxHx"DN&H//9>DBB&< CN@/.NV& fBrӫ&׀&HxB/.Hy*lBNVB:sHy>8N/.N`2/,O/$. /NXJg2/N8B/9>@ -B$.N^`xp$.N^Nu/,OH00&n /+N$HXJgNHxHy>8NZ/9>@/ N$Hy>8NJfprӪ&׀$ L N^Nut`/,OH<&.(. *.J:sg 9>Hg8BHy>8NZ/Nr$Hy>8NJfr>H]IDLHn-D -CL8$n(.&.*.J:sgJ>Hg~BHy>8NZPp>Hl> j$(`/*N4////Hy*HxNGNHy>8N p`(/. IN&HXJf JfHy>8NXBL|N^Nu/N$XJf2Jgp>Hm8 j,(`/*N4X"<*A*`p>Hl^&<,RJf&<+ʻ j$(`/*N4/////Hy*HxNGN.>8NX`2p>HmBI Hy>8NXJg +g//+NPBBHy>8N j,(`/*N4P"<*Jf"<*A*Jg$//////Hy*PHxNGN.>8NXJg// N (P`/,OH 0BHy>8GZN/.N$ EfHy>8NXpL N^NuB/N/. /N2/NHy>8NB`/,O/ /$nJ:sg$9>Hg>$9?fBHy>8NZ 9>HPrg&rgFJfrHy>8NX $.$nN^Nu/ NXJgHjXHy*HxNGN `/ NXJg gHjXHy*HxNGN t`HjXHy*`B`NVH<0*.$n (.&.BJ:sg$9>Hg6Jf>$ g$p>Hl/Hy*8NZHnHxHx// /N$ gHy>8NX`$nJgg@Hx//Hy*m/ Np>Hm*G / NXJgB* / NX/ NX`t`B`TNV/ / HnN!l&XE!lG*/.NXJf/.N!lB$n&nN^Nu/. Hzf/9>@/N`NVH 0HnN!l&XBE!lG /.NXJf/.N!l L N^Nu//.Nr€Pf $`Nq/,O 9:sgS#:sBN^NuNVBBBHxB-|Hx/. n/(N@$JfJ:sfr#:sN^Nup`p`NVH80&.(. .$n Xb( Xb4 Xg, @Xgt L N^Nu Xff t`gBB/HxB-|Hx/./*N@$$f Xg Xg @Xg* XgZ Xf~-JL N^`jgN)!&g// N $Pf//<@X/N(~$ /`Hn//N($ f/./ N $/.N)2 `Hn//N($ fHnHy+ʻ/.N( JgfHn/93,/.N!^$ f( n (rf*// N ($P/.N" X/.N)2X`pUf/(/ N `t`HnHy+ʻ/.N( Jft/ N/.NP`,Hn/93,/.N!^$ f/ /.N >$/.N" Jf/ //N(~$ `Hn//N($ fN)@$HG)2JfX/.NXt `/,OB:sN^Nu/,OH <$.$n &j B, +%@0%@4 +Ы %@8%kH/*$N"XJfKBHxHx /*$/*,/+Hy/ INBHx"+ //*$/*4/+Hy/ N + g$BHxBB"*4ҫ//Hyd/ N jl-J -B"h$L<N^NL<N^Nu/,OH <$.$n &j B, +%@0@%@4 +Ы %@8%kHKBHxHx /*$B/+Hy*/ INBHxp Ы//*$/*4/+Hy*/ N *4"ҫAЪ8 JoBHxBB//Hyd/ N jl-J -B"h$L<N^N/,OH0<$.$n &j B, +%@0%@4 +Ы %@8%kHKBHxHx /*$B&+֫/Hy*/ IN *4"ҫAЪ8 JoBHxBB//Hyd/ N +"Ҫ8@&%C8"jB%A8 jl-J -B"h$L< N^NNq/,OpeBN^Nup`/,O// n$. "nB"fJg"$&N^Nu&ƂfFā `/,O/$. n hHhXHhX/Hy*HxNGN-B -|*$.N^`YNVH80&n(. gJtfHy*/E)/`NPJgHy*/NPJfxHxHxN&/./Hy*Hx/EENHn/93,/N!^$(f'nt/Hy+i+Hx/NHx/NP L N^NuB`/,O/N $f N N $.N^Nu/,O/N N *N ,$g N N $.N^Nu/,O .g SgpN^NuN^`N^`NV n HnBB/( /(/(B//.N!`N^Nu/,OHy1TBNN^Nu/,OHy1TBNN^NuNqNVH?< . ig i$f n ,(g&PJm(Fv֎Hx B/N( y:, ((!@*<Rd EN$ 9?-@$n JgJfN/NR y:, (!DXJg n  n B L<|N^NuIG`^Hn/ N#/NRHxHj/N(J.f *-@ .grDf^HxBHnN( plHx / /N$ f EN$Hn/ N#H *-@$nP` EN$ *-@*nJgJf /NRX`.Hn/ N#*/NR G B bl//HnN)0 plHx / /N$ Jg|Hn/ N#NPHn/ N#H y:, (!@P`rl:Hx/ /N$ f GB// /N$ GB`~ EN$Hn/ N#N -H-@*nP` D` t?`^t`tN`/,O# D:Hy:Hy:NtPN^Nu/,OHy:Hy:NtB:PN^Nu/,O n"n !n!i gr-A-@ X-HN^`N^Nu/,O# L: Hy:Hy:NtPN^Nu/,OHy:Hy:NtB: PN^Nu/,O/N D$fnN $f N T$fN $b$gN jN N Z`P/NHxHxHxHxHy>PBBB/.BHy*.Hy*?HxHxBBB/.NL$.N^NuNVH <(n&n E r$@BBBHxB-|Hx/./,N@$Jft g&HxK/ /Nh JfVHj/ NFP", +g SJgA///N,$+ g(G/ / NHx// NL<N^NuB`/,OHy1ؘBNN^Nu/,OHy1ؘBNN^NuNq/,O n Hy1 /(/(/( /(/(//.N@N^Nu/,OH80(.&Hx/N$HPBG)0n./ .Ю// N$// N L N^Nu "Hx n HpHrNR `/,OH>8,.*Hx/N$H// .Ю /Nh&gD// N L|N^Nu(خHx@B/N Hx Hr/NRn`BG(I)0`NV/ /$n HxHn/.Nh$ f&HxBHj N(%n[I$%n $.$nN^NuNV/ / $n G r&@ *g>HxHn/Nh JfF . B?bF'n[I&L<'@ B//* /*/*//.NY$n&nN^Nup`NVH 0&n E r$@$+g0HxHn/Nh JfRB %n[I$%n$ + gHxE/ /Nh Jf ///+//.N^nL N^NuNVH 0$n G r&@$*g0HxHn/Nh JfZB 'n[I&'n$ *gHxG/ /Nh Jf" ///* /*/*//.NYL N^Nu/,OHy10BNN^Nu/,OHy10BNN^NuNVH8<(n . $n \N^Nu/,OpЮr eTЀ0;N"".:NNJJ"***pgFN^NuJ9:gp`J9:PgpT`poFJ9:fp`pL`p`/,Op-N^Nu/,Op-N^Nu/,Op-N^Nu/,OBN^Nu/,Op-N^Nu/,Op-N^Nu/,OHy*INK./,OHy*WNK./,OHy*cNK./,O/ /. E "N/.Np-$nN^NuNV/Hn/.HxN&'`$ f n"h0B0)"n "/N&X $.N^NuNVH0\/Hy:t// N`/,O n hJ g/. /N&(PBN^Nup9`/,O n hJ g/. /N&NPBN^Nup9`/,OH80 .$nr"f"Jgtf n &h *g UgHx/N'H$Pf.B(p7`HSgU ~bTStA`B$ *'@(g"+$//*/N)0 BL N^Nupf pV`pT`p`/,O#:t:tBHzHxNZ#:tHxHxN}#:tN^NuNVpH <*n(n $. wr€&A$lB// N#5m, B0-0%@5Sk%k +"+ %@%A +"+%@ %A$ +"+%@(%A, + "+$%@0%A4 +("+,%@8%A< +0"+4%@@%AD +8"+<%@H%AL +@"+D%@P%AT +H"+L%@X%A\ +P"+T%@`%Ad +X"+\%@h%Al +`"+d%@p%At +h"+l%@x%A| +p"+t%@%A%k| +L|%@ n%P//,/ NJfլL<\N^Nu/,O/". . ѹ:ttgt!gUfѹ:t$N^Nuѹ:t`ѹ:t`NV,H<<&n n (n r€$A P"fJ fJ(gpep`Hn/HxHx/ K &N./ b", gBgx$,(g f(l$rM(d/ HxHxL/ NU ~bN(b~& ւ/ /HxL/ NBG)1efp`f// / N Jf BL<< N^NuJgSpR`t`p*`/,Op-N^NuNVH?<&n $nB/.NPX(@pgJg$ ԌKBz.<("]JgZ&gBSrRJg<(// /-IN)0"nBԀ Jo/B/"GNԄ Rp fJg|n 4Jg"n"BL\/. / N& $g$B@FHx,/ NBP L N^NuHxB0*/N%|:t%|:t %| B@F/ N Dk@ `/,Op-N^NuNVH?<&n(n &pƀBn=|BBB y:, ((-D!@Jf(v7 y:,(."(!D L\Hy:tHy:tHn/ N& `\Hn,HxLB/ K &NB:.,fHx/NT$HPJfB*nJfXv7`//B/ N *gBBv+%C nJg(*nJf,g<*JE/ B0/B/ N "T +(B2IU&o^/ N "/ NPJg8BjJgB=B5|`p y:, h%h`$Hx4B/K(N,* -F" ҅ALj dX.CB g"G#Hg>SxR"HRp gXep .fxJgBv`p`CB`ֱg"WfJgBg DxЅf-j nJg ($b nJg ($bBB/ BB-|Hx/./,PNARJfJgD nB(/N , nBXd"///N)0/B CHpXN-C* gfb gBv-`p`6 c fBHn/HxN&'`& f*n - *g nB///N)1 JfHJfJfB* g g f/ //.N&#& f n * F\BX!@\"* ª$!A\`b nJg8 (fJ(fB(ሀ(JgnB0(-@fLHn/NPJfR/./ *0B-@//./*B*/N$ &JgB` n (f(g`Hn/B*/N&'`& f*n * Dj +j4tBpg +j8|Bxg +j<Bg +j@BJj +jDBg +j,lBhg +j(dB`Df($*0gRNt-BB$.&.+B+C/.N&XBBx@ nJg(JfB`BB` nJgF (f> * g4B2(//"*0B-A//./HxN$ &p`Hn/HxN&'`& f n-H-h-h0-h/N&2>-HHn/ //.N&f .fz`&"*Sg8/./N PJgD*n n*(HB E/(NZ-P,<"E g g/) FNXKA`: i$ P/ B/ hN*H E/("FNX Sre-agA"EB)5//BB)4/0),/Hx HnN G JgB6-`Hm FNXC-IHn/ //.NJf .g" $@ r "*AC%CB` i| h`0 n-h-h0-h/N&2>-HHn/ //.N&f".g $A`Bv `Tz`NBv`FBv;`>&`" $@ `>B`v/NU&X`nB`&Jg/ N&X`EBv/ N&X,gFJfJgNB=B`BBv7`Bp:tm Jg / NU&X/ N "X`*J`$lJfJgBjJfRHy>\Hy:tHy:tHn/ N& `JgNB=B`Bl// N P/ NX`B=B`/,O/N$Hz/./././. /.N&tB@F$.N^Nu/,O/N$/.N B@FB$.N^Nu/,OH0 $n&*N$/ N V/N& B@FBL N^Nu/,OH 0&n$kNR$ *(g//*$NPHxB0*/N/ N& B@F L N^NuNVH?<(.*n &.HxHxN b$HPJgH/N:X$pg, oHy1٥Hy*pNK. oHxHxN $Pg%B(%|"H!AB /./B/ G "TNl *Ѓ"/B/N( (j* XB|"E Y* JgR 度Bgx&SpR//// -HN nBgHy1X"/ @Hp(/ NԃRp f(f*8|D J LXN&]($nN^Nu/,O/ Hy>XN@Hy:Hy:EtNB:Hy:Hy:NB: Hy:Hy:NB:Hy:@Hy:PNB:L .:Hy:NB: Hy:Hy:NB:Hy:Hy:NB:Hy:@Hy:PNB:L.:Hy:NB: P$nN^Nu/,OpNN^Nu/,O"n n BB !iN^Nu/,OH8$n&n HxhB/ N($ +"+%@%A %k%k%k%k %k,Hj Hk0INHj(Hk@NHj0HkPN$Hj8Hk`N +p"+t%@@%AD +x"+|%@H%AL%kP%kT%kX\BBPLN^NuNV/ /$n $pĀ/Hx@/N!ר Jf"//NHxh/*/N$.$nN^NuNV/ /$n $pĀ/B/N!ר Jf"//NHxh/*/N$.$nN^NuNV/ /$n $pĀ//NԘPJf"//NNHxh/*/N$.$nN^NuNV/ /$n $pĀ//*//.N!jJf"//NHxh/*/N$.$nN^NuNV n B (B-@//./(//.N!τN^NuNV/ / .E" t‚$AJgHHxHn/Nh JfPB %n[I$%nB%n[I%A%n Hx//././. /.N!$.$nN^Nu/,O n /(Hx@/B/.NVN^Nu/,O n /(B/B/.N8N^NuNV/ /$n Hn/Np$$Pf&/*BB n/(/.N$/No$ $.$nN^Nu/,OHy10BNN^Nu/,OHy10BNN^NuNqNVhH08(n&. &n wr€$A ?of/ N#$Xg igBB/ /N#Hxx/ HkN)0'j| *L|'@BL TN^NuJfHx`B//HxBh-|lHx/.h/,NARJg`p`pN`/,O# $:Hy:Hy:NtPN^Nu/,OHy:Hy:NtB:PN^NuNq/,OH 0$n&n Ff:/ /./ /. nNJf%k"+ $+$%A%B L N^Nup`/,O# %:LHy:@Hy:PNtPN^Nu/,OHy:@Hy:PNtB:LPN^NuNVH<8&. (.$.&n*.(nE r$@-D-C//N PJg"hJg Cgb CgN Cgp` CfJ:g-L-E-K-|C-D-C-D-C L0&.$n $.G r&@ g f/ N~HxHn/N $ftB .*[I&'E".'AJm B?b*LyX:(9:$<LD(ntLЅ-@f Jgp-@ . g%@B L |N^Nu%@`Hn/N D$/ N Jf0*Jg @5@`@`t`t!`NV/ . n ". gR"@te` f8 (Ly:-@L9(:-BHxHn/N 6 $.N^Nu (`A-@ -A$.N^`T0p`/,O/ # *:Hy:Hy:EtN# +:LHy:@Hy:PN# *: Hy:Hy:N$nN^Nu/,O/ Hy:Hy:EtNB:Hy:@Hy:PNB:LHy:Hy:NB: $nN^NuNq/,O/N 0$fN . JgN 0 $.N^NuN /N 1`/,O/N 1N /N ."$gN /N 1 $.N^NuN 0$gN . `/,O .g SgpN^NuN^`lN^`/,ON^`2/,ON^`2/,ON^`2/,ON^`2/,ON^`2/,ON^`2/,OHy1ڔBNN^Nu/,OHy1ڔBNN^NuNVH0<&. $.$n&n-B-C//N (HPJgJgԵ@(tFg*|HtH@(tHg t`*|HtFHxHxN$H/./.// -B-C// lN$ f`Hx(B/ N(&'jHxI/ HkK(ydN& Hx/HkN .G)/$ Hx /N L N^Nu/,OH0 $n HxHx N&//*//.N!2$fHx/*/N$ Hx /N L N^Nu/,OH0 $n HxHx N&/* //*//.N!\$fHx/*/Nv$ Hx /N L N^Nu/,OHy14BNN^Nu/,OHy14BNN^NuNq/,ON ?JfN^`N^Nu/,ON ?JfN^`N^Nu/,O .g SgpN^NuN^`N^`/,O n Hy1p/(/(/( /(/(//.N@N^Nu/,OH80(.&Hx/N$HPBG)0n./ .Ю// N$// N L N^Nu "Hx n HpHrNR `/,OH>8,.*Hx/N$H// .Ю /Nh&gD// N L|N^Nu(خHx@B/N Hx Hr/NRn`BG(I)0`/,OHy1ۀBNN^Nu/,OHy1ۀBNN^NuNq/,O n /./(/(//.N N^Nu/,OHy1ېBNN^Nu/,OHy1ېBNN^Nu/,OpeBN^Nup`/,OBN^Nu/,OBN^NuNq/,OH80&n$n "n n"&փD$ԂD ЀxxF(؄& ЀҁD$ Ѐ" Ѐ L N^NuNVH8N//.N//.N//.N-C HxHn/N)0HxBHn E(NHx BHnN$L8$n&. *.$., X8 *0$n*. &.$., X8 *NHx/.4Hk/N"Y-AD./.0Hk/N"S-AX҆-A@Hx/ nXHs/N Hn`/N Ud.*Jf-E -DL 8,.$n $.&.d,( &JI Y<$n/./. / N f& g$-r(-r(-r(-r( IGx*K b,< lfV - - - - 6|Hs(Hn/ N)0Hs(BHnN( L<|N^Nu-T-l-l-l B BBB/N/ FN/N&'n'n'n R `LNq/,O n"n B"1Xr fN^Nu/,O/ nC " $$$$? f$N^NuNVH?< n-P-h&h-h -h ("h&.$." -A(.-D,.(F." *(( -D,-F(.ౄ*D((,.轄$D,.( ( HF( ,.((HF-F,( (.乆!F,.(.ๆ-F,( ( (.(HD*D,.( (.乆( !F,.$F( ,(*D( , ,.,.,.佄, ,.,.佃, HC!D &.( -C(.채,.& &, ,.佃$C& ,(&.䷂HB, !F& $.$., ,., $B,.$.赆HF& !C$.,.콂&(,.& HB!@ $ &(H@!AL<$.gSg8pL<|N^NuE1(I fG)1K gb,/Hy1/N& f*R//*/N Jf/Hy1/N f//* /N JfxRpf 9:ug$/N /9:tHy*NN`P y:uJf,Hy*`Hy*NK.#:u:u`#:t:u`/Hy*NKPB`/,O#:uN^Nu/,OHx /. /.Np N^Nu/,OHx /. /.Np N^Nu/,OHx/. /.NpN^Nu/,OHx /. /.Np N^Nu/,OHx /. /.Np N^Nu/,OHx/. /.NpN^Nu/,O y:u"hN^N/,O y:u"hN^N/,O y:u"hN^N/,O y:u"hN^N/,O y:u"h N^N/,O y:u"h$N^N/,O y:u"h(N^N/,O y:u"h,N^N/,O y:u"h0N^NNqNVH?<*n&pƀEHxHy1X/ N)0 B. @xRr fBIB4RrfG1H-|1xB,$ R nX(/// mN/// m N/// / mN(Hx/ /N)1 JgN/0]1/Hy*EDrNHx/Hy*/ I(gNHx/ Hy*/ N,pL/ /0]1/Hy*EDrNHx/Hy*/ G(gN Hx/ `bfRrf~ .~gH/Hy*%EDrNHxHn~Hy*/ G(gN|HxHnHy*/ N(` .g/Hy*UEDrNHxHn`NVH?<$n(pȀHx Hy1X/ jN$HxB/.<("GN*,<1Hx//K)0N$Hx /HxG/ Hy1(/ j,NHx Hy:ul/I)1N&$gJ/Hy*&<Dr CNHx /Hy*/A(g-HNHx Hy:ulHy*/ nN(vHx /Hx HkHy18/ j,NHx Hy:uL/N$JgJ/Hy*&<Dr"CNHx /Hy*/A(g-HNHx Hy:uLHy*/ nN(vHx Hy:u/ N JgJ/Hy*&<Dr CNHx0/ Hy*/A(g-HNHx0Hy:uHy*/ nN(vHxB/"GNHx//NHx /Hx/ Hy:u/ j0N0Hx Hy:ul/N JgD/Hy*"KDrNHx /Hy*/ &<(g CNHx Hy:ulHy*/ "CN(vHx /Hx HkHy:u,/ j0NHx Hy:uL/N$JgD/Hy*ZKDrNHx /Hy*/ $<(g BNHx Hy:uLHy*/ "BN(vHx Hy1(/ N Jg@/Hy*EDrNHx0/ Hy*/ G(gNHx0Hy1(Hy*/ N(v L<&.,. G r&@/9:uN$HB@X E#bF$$*4Npg/9:uN_X *,$<d$/Hr/I)0N( f&(ت,%D,B@F-y:uL<|N^`[0ւHx$  // N/+/K(NPBRц-@-A//.NP&'AHx/ /NHxHj/BHx/ N ,./ /N `j/,OBBHzHx8N#:uBHz*HxNZ#:uN^NuNVHxHnN .N^NuNV/tԎpĀHx/Nv B "($.N^NuNVH00&.$. GR b//NP L N^NuBnBnHxBHnN(Hx E/ NHx/ HnB//N ,Hx B/ N( `NqNVhH?<$n&.$. -R-j-j-j -j-j-j-j QR h(. ٫BIG)0Hx nHpX/ N .XH@X-XX p@fA1@-n-n .".-np-nh.."n-|[-|O:-|0$nB*i*hBB"*`֪dՁ%B`%Cdr?dZ/ Hx-B-C//.Hj@N&*B,YG)0 n ºf$f@HxB/ N(L |N^NuB2R` 2(@XH@X-@Hx//NX `"2<@ . Єf`NV/tԎpĀ/././. /N L/././N H/./N v$$.N^NuNVH?"G. | hR." `fp`/,O .g Sf,BN^NuN Jg Hy+nNK.Hy+NKX`p`/,Op4N^Nu/,O/ n ("(|A#tetIgB/NP$.N^NuHx`/,O".B@ @#bF$ y:uJf B@F N^Nug P`/,OH> $n$*B@ A#bF$ y:u f #:u * c/Hy+NK."H Pf"`&A>p08zʀB f /Hy+`pF8B@F/ N f/ N P/ N v/ N 8 jJg!j j HjPN$HjN{V/ y?t hN -BL|N^`/,O/ .". Jj gR b4tLB`6gx` g& c b0tLBrЁ$N^Nup`/,O"n n 6eF" 2e N^NupF@2gB0(/0/Hy+/)N fB`pF@2gJfHy+/)N fP`/,O/". . Jj& < tgp eBtL  g$N^NugtL ` < tgp dtepL `/,OH 0B@ B#bF$$y:uG)1JfB@F J L N^NuHxHj/.N Jg$R`/,O/ /$n *JfJg j1|.$.$nN^NuJgS%@fBHx/ jN $*4f *(f&Jf`S%B4f Hj jDNX$*4 *(gS%@(f Hj j8NXԪ(f|`/,OH<0$n$. B0*tf.Jg//Hy2 Hy+/ N pL p 0 >pg0 *f"j^tt᪅0$:u#:uB@F/ N cXJf%| <-JL<DA1,Bf. 010$N^Nu`Jgrxf``RPtfB`NVH?<(n-lGK:ut,<+(<*ѰB0,tg@/- nHhHy+EKNA-H B.<*Bm"Hy+NXRXpfLHR^htp|f kxB0+v/ (D0 `~j`j``"`` ```NVH?<$n-j/ N ,$ P/././. B/N$HxBHnN(IK2`$BBG$B0*txȀg&BBpF//N*rgBB"A//N*rgBB @//N*rgBB"//N*qgBB @//NJf X,`VA-HBBn (RX]fBI fG$` nR/B// N f JgxFBB //N*rgBB @//N*rgBB @//N*rgBB //N*qgBB @//Nrʁ.0@BBmf2RA`6fⅺo.R`R`BB6H// N &gpFr fBBrF//N*rgBB @//N*rgBB"A//N*rgBB //N*qgBBC//NRB.ȸmDHn/.N /./N$^Jg&/<B@B/[I/N(4 n!@P!ATL $./N$HXJf$Hy2IHy+/N f pL|N^Nu h\$(  gbjJg f gvB<*t zʀgpFr f VDf  g fx`X g* f^ fVv`& fB`~ gv`r f*v`dv`^v`XV`z/N ÄXJgJf:C g IBBmRrf`gR`"B2 "A BlgbR`Jff Rrgg&xt`^xt`XB`Tt`PB`ji/ N / N ҄/ N p4`4&  g ff ftB0*vg// N PJfp4g%Dp4|g%B|p"Jfpgni`dNq/,O n BBBB "n!QN^Nu/,OH8 "n n $n"* * $x LD cdp R$eVB(SDgHp%@B (DR!@D"P)g0/*/* 0 r€/Hy+ / N `BBB ` vLCeLN^Nu$xLD er e`BJDfB`BJDgdJgX *Ѐ%@")d%A (DS!@D"P)g/*/* 0 tĀ/Hy+=/ N B`R%Q`Bv eJ`ZNq/,O n ". e . b0(@g B`" n0 n0pN^Nu/,OpN^Nu/,OpN^Nu/,ON^Nu/,OH 0&n$n j8Jf Hy+mNK.+gG $  '|26Hk/ "y2N'H:7|7|6@Pf%| Ǵ %| %|  %|  %|  L N^Nu/,O n (rd//Hy2UHy+NDrN^NuC>"1 gg/Hy2UHy+NDr `# `/,O n (rd//Hy29Hy+NDrN^Nu"0 >gg/Hy29Hy+NDr `B >`/,O .reJ >VIDN^NuB`NVH<<$n&. &npl2*g/Hy2!Hy+?/ N R$BL<(u<Jf *rd JffR(`$0=2pJg//Hy2!Hy+V/ N /N j(u<XJf.*g//Hy2!Hy+/ N `$<+5`B:+tĮppf&*g/Hy2!Hy+/ N prf,*qf$*gHy2!Hy+/ N p 8f B0+gX7B/ / lN(Pf.*g/Hy2!Hy+/ N 7ER,`"k8/ iN'L8'DR0Jg/Hy2!Hy+8/ N B:+rgp`6r0`.R4Jg/Hy2!Hy+q/ N `7n7n`Z/,O/ /$n/ j N/. / N$/ j N $.$nN^Nu/,O/ / $n/ j NHj / GNHj / NHj / NHj `/ N$-J"j $n&nN^N/,ON^`NVH?8&n$n $.(j8Jf Hy+mNK.+gXB,*0(*4**(&*,/N$UF///-E-C///B0*/0*//Hy2Hy+/ N 4/ lNXJfF+g.B0*/B/0*//Hy2Hy+/ N RBLN^Nu jf&+gHy2Hy+/ N R`-B-J -K"k LN^N/,OH0<(n&n $n j(f 2f0, @fH,g*HhN$UF/<Hy2/Hy+'/ N RG K L< N^NuG *k8 fHy2Hy+VNK.`( gt fT,igVpĀ *g f"jHrLe"iP" -e%H -ѪJg:*g"-Ӫ( Эc// N #\$HPJg */"ҭ//N)/p?F// / m NJf`t`*gCH`dC `\B`ZHx// N "$H `ZNVH <&n(n $. n$P *(re$Jg/Hy2Hy+h/ N `f*jHnHx BHh/ N &-f 2fLI *l8 Эc// N #\$H n PJfR I L L<N^Nu` *("-ҭ ҂bH// / m$N Jf`Nq/,OpN^NuNVH00$n &.$.HxHj HnG)0N "@B r@ "2HAA "AC@*AHxHjHnN*@B. fhHxHjHnN fj*@B.r@/./HnHx HnHxHx/.Hx /.N V(L N^Nu f*@B.r`rB`r`NVH88 n$n (."h<&i"j fHy2Hy+VNK.) gp fT+igVr$(0&(4BRՁ!B0!C4h6B) Dh5h4h3h2(gr"h<&iR$P&*(I/ //(4/(0/*/ NG/ /// / N ^(.Hx/ N k JVIDLN^Nup`*p`/,O n"h< g6 i(g$Hx/Hy2Hy+/N BN^Nu(fp`Hh/ N qP`/,OHx n/(<$n&n n .4r5@Bሀ(X5@B(ሀ(X5@B(ሀ(X5@BI|tăԂ8*K(A(*BB@A@?BgNX2R4B3(B@3(F@?BgNX2j5AB3( B@3(F@?BgNX2j5AB3( B@3( F@?BgNX2j5A EBB@B@?BgNXDC5@Rpf0&n"n (. nB R fEBBtā3(BԅЂtF  R f$i&)rBBG28*d*Bf"QJfnJgv/Hy+NK.R-@pF6 ) ) 6 69 2HH&3<R`$i&)`rFA&C&xC|AR-@pF6 ) ) 6 6 0 2fRxfBL |N^Nup`NVH<<"n (. n$nB R fGBBtā(n4(BԅЂtF  R f(i&)rBBK28*d*Gf"QJfpJgx/Hy+NK.4&5<R-@pF6 ) ) 6 69 R`(i&)`nF&C&xCvAR-@pF6 ) ) 6 6 2RxfL<A5G?UG-AN@?BgKNX@5F?,UN@?BgNX@5E?,UN@?BgNX@5D?,UN@?BgNX@5B ?,UN@?BgNX@5C ?, UN@?BgNX@5G?, UN@X@5F?,UNF^0E5@XD5@X@5B ZC5B ZG5B".0H @A ?UNBJBAX0X0fL(g$Hk N$UFHy2/Hy+)/N  BR BL< N^Nu/ /NP$ *0"*4 @j7 Cj5j4j3j2*g&L [R& PJf( *0"*42HA/p Э/// Nr)AB0*6// /G/ NZP&Y/ -(/// / N .Hx/ N k Jg *0"*4BRт%@0%A4JAfBp`BrӪ4$*0Հ%B0`NVH?<*...(.*n"n $i*v֎G)0I g g"t Ԋ gHxHj/NHx// NJl*@B.B.B./INX$ EHhN*.N&p໻ԃ.*< ENXԃ 瘷Ԁ&䛱ԃHnN r⸱ԃ. ENXԃ 瘷Ԁ&䛱ԃHnN r⸱ԃ. ENXԃ 瘷Ԁ&䛱ԃHnN r⸱ԃ. ENXԃ 瘷Ԁ&䛱ԃ"n iB~ގ,d,Jgf2|d"F/ / GHp-@-IN ."nЉ rftɜ/N r⸱ԃ. ENXԃ 瘷Ԁ&䛱ԃ FCh-I .萈rep @pg/Hr/-@N .䘀 Jg"n -Q "n $i i`.HxHj`HxHj/NHxHj`HxHj/NHxHj`B`/-HN r⸱ԃ."ENXԀ&盷Ԁ&䛱ԃ nY`.B`b"RZApl/N$r⺷&ւ. EN$Ԁ"癱ԁ 䘳Ԁ&r⻱ԃ. ENX"҃$皷҂ 䘵Ҁ$B$vBtA@"A"A@L<*n$n &.&m< SR(j*HxHt8/(<)0"DNB/Hm EHh"DNB R f(VABB,LD`6Y "EBЉzF  R f XtԪ(A"j(JrBBK2|d"BBfB(TJfJg S(g$p Ъ/N$UF//Hy+^/N B`R-@pF6 9 9 6 6I 0XX(5LR`^ l"l`HFA(D(zD|AR-@pF6 9 9 6 6 6) 0(f"RzfpL<|N^Nu/,OH08 n$n &.&h<(j(gL// /N$ f: S(gHl N$UF/Hy+/N  SR, L N^Nu j//HhN)/Hx/ G NHx/ Nt`NVH><*n$n $.&m< SR(j*HxHt(/(<)0"DNB/Hm EHh"DNB R f(VABB,LD`6Y "EBЉzF  R f X**(C j(JrBBK2|d EBfH(TJfJg S(g$p Ъ/N$UF//Hy+^/N BL<|N^Nu1h&5<R-@pF6 ) ) 6 69 hR`V"l l`@FA&C&xCzAA&X"HR-@pF6 ) ) 6 6 f/ Hx/ N k `/,OH88"n&n &.$i<(R k fHy2hHy+VNK.( gr fT,igVp€ *$ f"Wx e$R%B$Bx@C)g&// / N& JVIDLN^Nur`tp`/,OHx n/(t,g.HjHxHnN$T/B//Hy+/ N R@B*B/HmHs"DN* -E -JLJg/Hy+Hy+/ / N(R`|@g\~Pf"C iJ*kk *|rfvJl$gtCz ex*g"Hy+Hy+i+/0-:v\/ / NRL`> g g"p fX h *Urd#PR4`JgR4L *g 0gD*g"//Hy+Hy+/ / NRP` f/ NXJgp-M`-MB-K`-M`-M` b2*g"Hy+Hy+i+/0-:v\/ / NRL`8rxfB-ሀ-X=@-P-Am`vJf2*g"Hy+Hy+i+/0-:v\/ / NLRL`|xg6m`, b2*g"Hy+Hy+i+/0-:v\/ / NRL`|-M2M C =I`-M` g**g/Hy+Hy+/ / NRH`m` c4B-rB-|B-ሀ- Pf -g/ NXJgV-M`N( c4*g$/Hy+/0-:v\/ / NRH` nJf2*g"Hy+ Hy+i+/0-:v\/ / NRD`^( c4*g$/Hy+ /0-:v\/ / NRH` .B6B29 VvƁvƅf2"* g/Hy+ -/0-:v\/ / NNRT`ʲ.g:~xg2"* g/Hy+ @/0-:v\/ / NRX`2.:E Ec4 * g ?BgHy+ S/0-:v\/ / NRd`F*jxg/Hr 6/ / N ^*H fR, gd g^*g"/Hy+ Hy+ Hl/ NRp "*|tfZRz먆/HxHk / / N2`@C Ѝd+B"Rn:*g(T/B+/Hy+ Hy+ Hl/ N\Rp`x"U +g2gRA *|ze"ҁ2;Nbbbf g*g/Hy+ ` Uf*gHy+ Hy+i+Hy+ Hl/ N`j*gL/Hy+ Hy+ Hl/ N`, *|g*g/Hy+ &`J Bg6 Bg*g/Hy+ Hy+ Hl/ NHRp`dxfHk HjN ||(HPJgxl "n)n/ / NPJgHx/,,N gh *@@Pg8$<*qJg$<*ѰHlHxHnN$T//Hy+ 3/ N  CHhHx/ / jN`,#f HlN):PXB`V$*xf,gHy+ SHy+i+Hy+ cHl/ N>` ,,fgHy+ wHy+i+Hy+ c`BB(/Hh/N)1 Jg.g Hy+ Hy+i+Hy+ cHl/ NRh`v@@g&HlHxHnN$T/Hy+ / N / N y:X`pf Bg Bf ,,g/NU&B,XJDgR *@@g4/ /*|NX.HxHnN$T?Bg/Hy+ / N xgR WIDЀXSJf0B.fgHy+ }`8p`"HB`vzE cB0ሀ0X=@ *gpB>.B.B.B.B.B.-@$<+ 0g$<+Hk HxHnN$T//////.//Hy+ / N 4 ,,g/NU&B,X2.fnJg@$<+Jg$<+Hk HxHnN$T?.Bg//Hy+ / N Hx /./ / jN/ / N Rx`Hx/././ N Jm*kgn /bhJg:$<+Jg$<+Hk HxHnN$T//Hy+ / N Hx/./ / jN/ / N R|``n)n9n9n jx)h00 jx9h44 jxh66JgTHx HnHlN)0/ Hl0N 0JgB/.Hl4N 0l"P/./ / N ` ,0g/NU&B0X` ,4g/NU&B4l"X`"C ip|frgR4`Cve2*g"Hy+Hy+i+/0-:v\/ / NRL`F(jx8+\6+[JCgZJ*jL(<*Ѱz0f(<*qHk HxHnN$T///Hy+5/ N xgR c8B(p-AB(pᩂB(ሀ( Pf,`.AX`) c4*g$/Hy+ /0-:v\/ / NRH`ߖHx// / N JldJ*j:&<*Ѱr0f&<*qHk HxHnN$T//Hy+V/ N xgRO8L DfT GfR*g:/p/vƁ/ /"/Hy+Hy+// Nf$RR`Cc7 Z g N ghJf &*-L*l-RlJg *gr€/Hy+Hy+(/ / NRHx/NP(n`-j-L l(P// NXP*@o// N #\-HPf R (n` n$( *|xgeBB( EA `B*/Hj/.*GNB*"n J.g\ j0Jg.B(*@Hm// -I*GN j0B("nC J.g j4JgB(*@Hm// "GN B0./// N Jf"B0.ր$j`0NVH 8$n jb pLN^NuHxG/ /*Nh Jf/ ./N }$(HPJg$</BHkN( l0 Jg&B( T f //HkN)0 / N VX jc5|B0*//*/ N `F/,O/ / n$n &RJj$g&"kB0(r_F fr?F/// / N-J -K$n&nN^`_V/,O/ $n j0(0@A @Af$Hx /. HjVN)0B B$nN^Nup`NVH8<&n$n I r(@ kx0*2_A ABbZҁ2;NHHHHH@HHHl@",6XRHHHHHHHHHHHHHHHHH +hg 5|B`B@( 5@`5k`5k`+rg5k`B@(`B@(`Bjr pvG2 B(Āg"@Ste3I(嬉jЀSf`t`B@(`B@(`zB@(`p5h`Z +h g g f5|`.5|`$5|`Bj`B0*v dp //*HkVN$ L<N^Nu5k`k`h`Ah`5kp5kr`j`h` +hr @@`Jg*0+jd5@B0*//*/+`b j@gt``Hx@/ /*Nh$ fFB0, fHlHkN }$$PgK(-8 DCU-@2+ mf@&+N9|BB/HxB-|Hx/./NARG Jf m("m,)H)I -0"-4)@)AB/Hm/ &<)0"CN p DfBHxHmHs"CN, Jg /N VXHx@/*/ `&teK Hx&+x/HlN)0 B`BBBBHx B/ N(`JxWIDHxHxNT(H A 6P B3 6pg 9 9 R(RX f RB2*刲d //*/ N$/ NU&`V-J -KL<N^`-J -KL<N^` jcHxI/ /*Nh$ f/ HkN }$&HPJg jc5|B0* @Hh *P/HkhN$/ N V`Z5h&` jf>HxI/ /*Nh$ f/ HkN }$&HPJg h'Hx/*/ ` j cBv֎/Hz/ K NB0* d-@$.gFB/NT(H-H/Hz/ Nn5B?Bg/*/ N$.NU&X`Bj`t`+pgZ4*2Af<"vLJBl.A N@ @b&Ѐ0;N *4>JB`A 5`B@(`XB@(`NB@(`DB@(`:B@3 N`.J3 :WHD@`B@+N`5h`k`5k`5k` k Jg-J -K"h(L<N^NNVH8<(n*lBHxNT$HHx/"n/)Nh$f:BR2* Ab@ Ab\ A b Abr Ag AgFt`A Abҁ0;NBzA~ Abjҁ0;NRA A bҁ0;N`DL2j A*gb A%f2Bj4` A-g AFfRRHx"n/)/ N$ / NU& L<N^Nu AOb~ A@b AgbP AfN9|BB/ HxB-|Hx/./NARJgHxDB/ N(` Ag A gZ A gR`d Af\/,`XHxHy?uHjN(ydHy?uI)/&jxHkN):PHxHk/N)1Jg./ N VX|1 L<$N^Nu/HjN }$&HPJgK/ j N/ B,/// N ʈJg, cp l"l+H(+I,B0B4Hx B& P/N(B,/Hl /N)0Jg` // / N ͂ JgNJ,l5B / j NXJg*/ N VX` BbB0K G`& \`|`|`|` kfHx$x//+Nh, fj.x f`Rp|f,$jxHjN):PHxHj/N)1Jg/ `v/HjN }$$HPJg4/ N / N VP`b bXHr / N `|`2 k*f2Hx*Ix/ /+Nh, f.x b bgH|`Y bp|fHlHjN }$$Pg .xf/N y:.N V`r|f.y" XJgBHn// /N H$Jg~// N PJfn/N VX`^/ /N }$$P` *|tgN]f>Hx j/($ X/N)1 Jg>// N }$$Pg// Nt/N V`B0.z/B/ jN `/ HzJ/ N `/N yT`r|f0+ @bB?BgNT$Pg B0+///+Nh, * g /NU&X%B5kp4gF`L *hJkg"g@`` kn& *h%@h2+ Ag Ag Af%@h```Jkg*pgj j`jj` *hJkg`` *hJkf``"*p0kte&0p2 Igk *hfN``/N dXJf`L0+2SA Ab<@`tI dx*<2 0+H&Rg0"*ppm< E0(Ig 娌$`/NXJg 娌$p fJgF`d/NXJf`-2+0Ate0p2 gA`0+2SA Ab@`B0+v稀k%@p`tk`;k` k fTHx HnX/+Nh, f&xHx B/N( JxWIDBr(B6I XxȂ g(zʀB2I 6 g .믏6I xRR f *|f.xgAi 6%H|`*// G $NB6 x/*|/ NrgHx /HjVN)0 j0(0@A @AfdpfZ`@ B6 xpf~R f`0r|g(Hj6/ N,PfHxHx/ jN, `(j kfHx$x//+Nh, fjJf*Hy+HxHy+@NpHy:Hy:NuJg / // y: N,Hy:NuT`tL<$N^`| `NVH0 &.HxHxHxBBBBB/.BHy+JHy,cHxHx$Y/BB/EN@JfRHxHxBBBBB/.BHy+mHy+HxHx//B/NN$-HXgHxHxBBBBB/.HzHy+Hy+HxHxB$Y/BHy>ENNN 2Xp?ep #?E3m3m$e(B$.$nN^Nu/Hy2 KHy+NDr ` ZN`NVH0 &.$n(tԎpĀHx`/ /N)0 j4pL-@C B!I4//.$/. /.//././. /.N0JfJg j4".vLC L N^NuNV/ / E r$@Hx`/.(/N)0Hx j4pШ/G/ N(yd%K4/ /.$/. /././././. /.N$n&nN^NuNVdH?< n . &n-nlrfvzfnL<]fJg"nl-Qd&( f$(g*(k,B@-Ap n#rbF$8Hx BHnN(=F$y:u-J BJfJgB-Btpldrl-AtJg*B-K|BBBx(n l:h,B0 xgR-@xBJgxgB"*Af~dbHxXBHn-@hN(=M=j .h-@HxHjHnK)0NHxHjHnN j0$2g=P=h6 =@jjHx HjHnI)0Nj7=j$>*@-G-jHxHjHnN=jF=jHxHjHnN=j8=jZ=j4j6j? .t/.|HnN Jfծ|d؂ gS`Bd`JDg jh,fRJg$Jg-JA-H nJf>$jx-J`"JgJg-JC-I`Jxg Jg-J`$jp`$h`Jg ,xJg*f$ .gL n$h-J n:nBJg6> JfJg-H`|p`Afr`E`IEf $h 2|`f I$hx`BGMgN: Jf6Jg-H".pB@FJfL.(zL(؂"nl" L< JfB`BB`I$hr`l-JJg-H-@`BB`x&`rv`/,O y:ugHzHy:uNPN^NuNVH <&nBN-HXg/+Hy+HxE/ NE$ HxHxBBBBB/.BHy+/ HxHxE/ / B/INLJfFHxHxHx/ BBB/.HzHy+)Hy+HxHxK/ / B/NHxHxp/ / B/N--m(*-, m8-PHk N$UF//-n//.-C-B///./Hy+/ N ,JgnHxHkHjI)0NHxHk / N m8h 0- @f0-@ -("-,%@%A%C%BHx / Hxj/N&[4L<(n(. *. L$H PJf *g f jHpLe$(PԨ\ *ЪJo~l$// *Ъ/N)/ժڂ& K tF,<)/Jo0j/HxN&HPJf2,fXJWIDL<|N^Nu *Ъ$ `~&`  c '@///+"FN +ڀ$ $K`٬(`Nq/,O n(N^Nu/,OH< n*. $P *|rgJg/Hy+ NK.6($4B?0*@@e?Bg ?/Hy+NNK.( /N$ jHtƂBtXgpJg&0*FR@5@Fi-DLS@5@@f6-g$(*HjN$UF//Hy+/ N / / CNP$B`/ N6p'@XL<N^Nu/,OH88$n $*HjI$UFN/// Hy+GDrNB0*"/B* //*Hy+2N$B0*(/0*&/0*$/Hy+VN0*Z/*|r€/ /B0*8/Hy+xN$B0*/0*/B*//*Hy+N j0B8(B6B*HjN//Hj//Hy+N,.D0j@//*f <*Ѱ/Hy+NP L< .0f4,g6*g0f$/HjHlN Jf po$&J$j`|p`/,OH8<$n*n $.(.&J&/ NHxHy2/ I)1NJf~$jJf/ N6 J L<N^NuB*f//HjN JfHjN):PX C(g$*HjN$UF/// Hy2 Hy+/N `-$r JgtHx/ HjN JfB*f//HjN Jgt$j`/,OH08$n&jI fJg& X/N/ NPJg/ NnX-CL N^`pf kJgB4*l劵(f R(g&HjN$UF// Hy2 Hy+/N  kB(HjN):p/ NP`~/ NXJg-JL N^`L N^Nu/,O/ / $n *xg/N VBxXHjG8NHjN *rPgJ*f2@Hx B& /N( kB(/Hh/N%l0Hx nHhHjNn%nHx/+HjN5k5SB+I 6%L05k4k6k7 k Jg h;h:5k 8 +(fvB4 +$f~B0Hx/+ /+/ N Jf-JL<&n(. *.$ /IN&+R'C/K6NP, X/NXg*/Hy2 Hy+bNDr -BL<|N^`/N/N$kPJf-F`ڶg(%CHjN):P/N/ / DN/ N V`$j`/,O ./Hy o/N N^Nu/,OH00$n&n &+ *@g*B4+$B?HkN$UF//Hy+w/ N  *|rerg/Hy+NK.Jk$g| j hJg/ / NP2+$ j*g HmN$UF//Hy+/ N ۭJPf B/ jNP0-@n\ *g/-Hy++Hm/ N ,/NXJm$gHxHx/ / jN/ / N RP` 0@ nL *gHy+ Hy+i+Hm/ N ,HmN):P/N/ N `J@oR*m`/,OH?<$n&n &.Jk$f2j@rz0Ie*Hx// / jN-K -JL4*RB5BJ*j"HkN$UF?Bg/Hy+[/ N B/ N PHk/ N ψPJf4*RB5BJ*j"HkN$UF?Bg/Hy+/ N Jg$J*jHy2 Hy+/ N i *+f@gHkN$UF/Hy+/ N  *h%@h`k"`B`/,OH00$n$*|pgNpgnJf&jBJfJg LBL N^Nu+gR/ jNրX&k`&jBBJgR/ jNր&kX`&jBBJgB0+$gR/ jNրX&k` *xg/ jNBXt`^B`/,O/ /$n R(g/*Hy2 bHy+6/N $ X/NB/ NՔP-B$.$nN^`/,OH8(nE/ G *NHlNHl/ N {X$HJf Hy+BNK.&lxHhN):P)JxXJg@k 5k&&5k((Hx HkHjN)05l -KLN^`8LN^Nu/,OH <$n j@c5|@HxB0*@rЁ?/ITN%H*hx0B+|B+-" X&<)0Jf - cHxHy2/"CN B+B+ I -g|HxHy2/ "CNI -gR+HxHy2/ "CNX BB,E-gHxHy2/ "CNE -gRHxHy2/ "CNX mI0 2 @$@Tpdl,Hxd/ Hy+NK.HxHp 2`(K BJ(ijB*hxHxHy2/ $<)0"BN- " PJf - cHxHy2/"BN B, B, G-g| HxHy2/ "BNG -gR, HxHy2/ "BNX BB+E-gHxHy2/ "BNE -gRHxHy2/ "BNX 0- @c mT U@Trdl*Hxd/Hy+`HxHp 2{`$L J L< N^Nu/,O/ $nHx Hy2r/ N)0A $nN^NuNVH0<(n&. $.$&T+g2$lRHlN$UF/ // Hx?Hy2ZHy+/ N HlN):PX0|5Jg/HnN f$HPJfR/ N VXp L< N^Nu/././.N -H/+/ N K / /.N <-H/ /N -H$Jg///N)0ծ $*".%A%A( *g f jHpLe hP vdpЂ%@vց%C*gpѪ(%L *j/././. Hx@/ / / N RR +`g./+/ N $(@HmN$UF/ /Hy+(/ N B kLJfR'JH'JLRP/+NXB`gAH`:A `2HxHx/ N "$H Jf2`T!J`NVH?<$n(n $.(.Jf Hy+NK.*g2&,RHlN$UF/// HxHy2FHy+/ N HlN):PXpPgm(r gmFJgzg@Jg HlN$UF//Hy+/ N Rt/ N VX`|0fHx3HnN f&HPJg^"*hgpg jJ(j@  g@X n0".,T-F0X A1@ nC-IJf0,$X1@R& / .T/N !K` /,OH <*n $.HxHxN b$HPJgBp!@!@(&hB+Z7BHxHmHkI)0NHxHm Hk N J L<N^Nu/,O/ /$. HxHxN b$HPJg:p !@!@( hB(Z1BHx ./HhN)0 J $.$nN^NuNVH<<$n(n *n(*& B0*L @B,"A- *p"grgp7F҈$Ԁ/HnN f&HPJf2Jg/Hy2Hy+ / N R K L<HxHx/ N "&H Jf>Hy+ 8$n(n( /NXJ|fp"*hg@g n h0J(j@  g@X T0*jg8 * "* * gezB%@ *hgHj /,NިhPp|f&l*igJjFgB0*LBd jHJ0(grā fHy+ NK.p`4*g/Hy2Hy+ X/ N p / N D * X`Pe6*g/Hy2Hy+ / N r / N DX` * `R`PJ0fScvր, ZB0,gB0,//, *ڃ/N)/)E )E9CV@B zB0,/"*H҂//N)0i *g$//B0*F/Hy2Hy+ / N +f+S@Jg@ g +f2+@/N6 L|N^NuBv`"B`bB`+`B`NVH08(n$n &n *PTm$*X&*\BRՀ%BX%C\JgRHjN$UFHx2-B-C//./Hy+ / N ,gHxHx/+/+N -KL N^`_0*$gp B jLJg`0!K'B0%KL&jPR%KP,g"HjN$UF/ //Hy+!/ N pf-@ -J"lL N^N%KH`L N^NuNq/,O nHxHx/. / hNN^Nu/,O/ / $n&n Jk$g.HxHx/ / jN-K -J$n&nN^`$n&nN^Nu/,O n"h| 6p!@p!@p!@!| * *p!@!@p!@ !| Ƃ!| !| 6N^Nu/,O/ $n j hJg/ NXHjHN fH j XJg-J"h$nN^N$nN^Nu/,O/$.J:uf&#2|>#2|>#2|>p#:upm,J->f/0-2N jX p-> $.N^NuA`/,O .rm ! >N^Nu/,O .rmB >N^Nu/,O/ $n/Hy+!DNDr#:uP$nN^Nu/,O n:ufB:u/Hy+!dNDrPN^Nu/,O/ J:ufHy+!N jX$y:uJg/./N)/`PJgE J $nN^Nu/,OH00&n$. p lt Bn.f:Hy,EDrNXBnH-|,L N^`~R3 ^c Hy)MEDrNXBn$L N^NuR`B38/Hy+NRP`B38/Hy)^UNRP`/,OH8<$n(. &.(j$**g&A:v/0L/0,Hy2Hy+!/ N %D&jxpe<؄0;HN 8rge*pgUg0 j hJg/ NXBL<N^NuYf *|rg]grevJf *|rerf * 2g// N ~P`Yf *gHkN$UF/Hy*٪/ N / / N zjjP *x/HjN }$PJgR<(n&. $.(.,|܌* XK G$UFEDr gF g` g/ N/Hy+"'N/N/Hy+"/N/N/Hy+N$ gd fvHy+(NX,gLHy+"_NB,/Hy+"hNB,/Hy+"hNB,/Hy+"hN/Hy+"oN$Jm/Hy+"xNPJm /Hy+"}NPHy+NXJoBf Hy+NXB4(/Hy)^UNRPf-|+L<|N^`x,/ N/Hy+"4N/N/Hy+"/N/`/N/Hy+"<(n,pgG 5&<:uBK B0,vrg*rg8r @fB2 $Hp|fBPhh0(@,g8/B+/+/+// C/Hy2JHy+#/ N$*@A*D*E<*F,g@///// C/Hy2JHy+#O/ N$R\Xpf lxJg|B0(t LB)@ -LL<|N^`X @2$@2,` @2$@2`2D$@2d`Rjj0*`L<|N^Nu/,O/ $nJ*kk *@gHy+#Hy+/ N p|fVpfN*R@l@ jx B2*//*B(/Hh//Hj/N  $nN^NuB*BHx/ jN `NqNVH08&.&n(tԎpĀHx`/ /E)0NIHx/+4/ N B!L4//.$/. /.//././. /.N$10(HjN$UF//B@| LF/VF////Hy+%|NDr$ LN^NuB`hB`xB0(ʀfJ ft<s*bj*`^/,O/ n (Шr LШ !@ BBLJfp"<L@ d"<L|B@!AT[I!BP!@X$N^Nu/,OH8 $n&.$9:v"9:v (LB8L(ЂLA4J:voXHxHy:vHy>N Jg:B4 . /N$UF//// npШ/Hy+%NDrLN^Nu/,OH><&n(n *n$nR"j y:vB,b`Jo0HxHy:vHy>N JgB,S&*HlN$UFX-B-C-H -|+%L<|N^`j  c ctC((9:v"9:vB* &LB65LHЄLA;JoHxHy:vHy>N Jgb jC(B<54 (B* HlN$UF//B@v LC/&F////pЫ/Hy+&NDr(L<|N^NuB`6t`0/,OH><$.$n *n(mRHjPHj@N PJg  c c bv *- ER"9:vB,c&&@C CX82r d 4 JopHxHy:vHy>N JgR Э02 /0@z LE/FF/|L8pF/p BШ/Hy+&8NDr"-"ARA 62A82f8*9:v"9:vA LL8ЃLA5J:voHxHy:vHy>N JgB02/Hy+&1NDrPJ:voHxHy:vHy>N JgfHlN$UF/p BШ/Hy+&[GDrNBxF /Hy*.NP*JBB,m4Hy+NVXp fL<|N^NuB`$v`pv`49 B0/B@| LF/F/Hy+&rNR`Nq/,O/ Hy2HxE NHy2HxN$nN^Nu/,O nB(/0/Hy+&/. /.NEN^NuNVH00$.&. $n XJ*f-@L N^`/Hx G/ N B*// Hy+&//NE L N^NuNq/,ON^Nu/,ON^`/,ON^`]6/,ON^`./,ON^`3J/,O .g SgpN^NuBHxN}#>PB`p`NV/ /$.HxHxHxBBBBB/.BHy+&Hy*"HxHxBBB/EN@HxHxHxHxBBBBB/.BHy+&Hy,HxHxBBB/NDHxHxHxHxHxHxHy:wTBBB/.BHy+&Hy+&HxHxpBBB/NHHxHxHxHxHxHxHy:wPBBB/.BHy+&Hy+' HxHxpBBB/NHHxHxHxHxHxHxHy:wHBBB/.BHy+'Hy+'/HxHxpBBB/NHHxHxHxHxHxHxHy:wLBBB/.BHy+':Hy+'KHxHxpBBB/NHHxHxHxHxHxHxHy:wdBBB/.BHy+'WHy+'nHxHxpBBB/NHHxHxHxHxHxHxHy:w`BBB/.BHy+'yHy+'HxHxpBBB/NHHxHxHxHxHxHxHy:w\BBB/.BHy+'Hy+'HxHxpBBB/NHHxHxHxHxBBBBB/.BHy+'Hy+'HxHxBBB/NDHxHxHxHxHxHxHy:wBBB/.BHy+&Hy+&HxHxpBBB/NHHxHxHxHxHxHxHy:wBBB/.BHy+&Hy+' HxHxpBBB/NHHxHxHxHxHxHxHy:wtBBB/.BHy+'Hy+( HxHxpBBB/NHHxHxHxHxHxHxHy:wpBBB/.BHy+'Hy+( HxHxpBBB/NHHxHxHxHxBBBBB/.BHy+(Hy+(&HxHxBBB/NDHxHxHxHxHxHxHy:wBBB/.BHy+&Hy+&HxHxpBBB/NHHxHxHxHxHxHxHy:wBBB/.BHy+&Hy+' HxHxpBBB/NHHxHxHxHxHxHxHy:wBBB/.BHy+(-Hy+(9HxHxpBBB/NHHxHxHxHxHxHxHy:wBBB/.BHy+(EHy+([HxHxpBBB/NHHxHxHxHxHxHxHy:wBBB/.BHy+(gHy+(HxHxpBBB/NHHxHxHxHxBBBBB/.BHy+(Hy+(HxHxBBB/NDHxHxHxHxHxHxHy:wBBB/.BHy+&Hy+&HxHxpBBB/NHHxHxHxHxHxHxHy:wBBB/.BHy+&Hy+' HxHxpBBB/NH$.$nN^NuNV/ / $n (cZG/ HxB/ N &Hx/ N  .f.Hk/.N PJgnB(B. ሀ.1@$n&nN^NuNVH?<$n*n p(dHnHxB/ G &NHx/ I N *(B.fr. "b` cbU  bZҁ2;N  " J `$JJJJ&^JJJJJJJJJJJJJJJJ /g / N "XLN)0HmNP`@1@ h f1| / N Xr$f`VHx5/NP` mG JfdBmBmBBHx / G NJfBBHx/ NJfBBHx/ NJfBBHx/ N`$(Hx5/NP B`JgHnHxB/ NHx/ NB.(bBB*< ,<Nz(<+i,.< .SAJf:mm mG JgPJmfJmg@$( (f B`HnHxB/ NHx/ N0.X=@HnHxB/ N(Hx/ N0.X=@B0.// "ENJg,B0. (fր//N HP`>Ԁ// GN`0."<*Ѱ @g"/?BgB0./Hy+)%/"FN`$( (fJ,o0/N ^X`"JmgJ,o/N`Jg6HnHxB/ NHx/ Nv֎$< .SAJgp (d/HxB/ NHx/ N// "BN Jgnn1n`JgHnHxB/ NHx/ Nv֎$< .SAJgp (dx/HxB/ NHx/ N// "BN JgnB(B.ሀ.1@`/ / NP`*r l"HnHx B/ NHx / NB./Hn/ N |&H.$g2JgY b 0 2I// N P`p=`B.ሀ.Jf&=@|HxHnHx/ N `1| 2YA1A .f=@0-"X=@HxtԎ/Hx / I NJgHy+)^/NNzPHx/Hx/ NJgHy+)/NNzP/ N Xr$g/ N X` hh"h/( iNX`rlHnHxB/ NHx/ NB.ሀ.XA@"// N  JgxHx_/N P`fr l^tԎ/Hx B/ NHx / N .ff// N P......IG Jf@EDCBA@|Hx/ Hx / N`// N `B.EDCBA@-f|Hx/ Hx / N`rlHnHxB/ NHx/ NB.ሀ.XA@"// N &H Jg2 (f(J.g/ N X`h h f1| / N Xr$f`rlHnHxB/ NHx/ NB.ሀ.X"// N &H Jg (fJ.f J.fh/ N X`x-Rg HxHnHx/ N Jf`Ph h f1| / N Xr$f`(rl HnHxB/ NHx/ NB.ሀ.XA@"// N &H Jg (f0(@1@J.g/ N X`@(1@ h f1| / N Xr$f`~rlvHnHxB/ NHx/ NB.ሀ.XA@"// N  Jg* (f J.fB.ሀ.1@ `NqNVH <&n $.?ǝp ep Ѐ0;NF:FFFFFbbbbFFHkN 0$HXJfRpL<N^NuJf$y:wh`$y:whIK($Jg/NHx/ /NJg$j`$j`Hx8B/ N(/NHx// N(ydj j jjjj7jB@*7@7j7j7j~B@*7@ 7j&7j(7j$7j""B`N9|B/ /<8b/ B-|Hx/./NAJf*g+f/ N jX2*A5A0+@A5@f+g/ N dXJfj7j`\N9|B/ /<8b / B-|Hx/./NAJfD2+"j$5A"7A"`0N9|B/ /<8b / B-|Hx/./NAJf2+$j5A7A$` jBHk/ hN `N9|B/ /<8b / B-|Hx/./NAJf jHxHk/ h-@N .`nN9|B/ /<8b/ B-|Hx/./NAJf6k!`,Hx8B/ N(/NHx// N(ydHxHj&HkI)0N(HxHj.HkNHxHj6Hk N`p`p`p eԂ0;(N8F/,O"n n f:)(f0)(f&)(f)(f)(WIDN^NuB`/,O n"n iiiiiN^NuNV n h fB0(g>Dk:1| 0(XA@HxHnHx/N Jfp$N^Nug2f,1| 0(XA@|HxHnHx`Df.@1@1| 0(XA@HxHnHx`B`/,OH8<$n(R j fJ,gJlg&j$JgJgXK "&< Jlg kJg ('@f8C'I (4*BDj&B f""(ffC `4&k `B`B` fF"hHpLe:"("iP xd([!AZJf,"jJfL<N^NuCH`HxHx/N `(gZ("hZ@B0(*[@XA@S,R// CNPJfJg5| /N 5| X&k Jf`^ j#H B l%H X)J`D/,OH<0&n0+'grgp$y:w|Jf7| -KL N$HPJg BB&X!C$+( TB:(~BAK Jn(B l(%H )J(٬,/ N ^XB`lN PP`0*JfpB"j"X%KR&H`p/ N "Xp `%h/`/,OH <(n$. K PJo&$l$Jf(B0,//Hy+) T/NNzL<N^Nu *mhBJf j *JgJ!@ j &RJg(S+f kpHx/+t hNPJ+ff / N X/ Hy>NP`d)@(`%@`~/,ON^Nu/,O n"hhS hh"h-h "iN^N/,OH 0&n$.HxHxtNT$HPJg| BBh /. HhNBt4Hr(NL/ Hy Hr(NB$A$%H(B\A\%H`%|BlAl%HpB k%H A'H J L N^Nu/,OH <$n$. JjfG " *\f I "K P&j$Jf/*0G "NB0 *dXg//N BdP jhJgBBh"h//( iNP jlJfAl%HpBj G4/ N / NPJf/ NXJj gHj/N PJg1j  j *Jg!@ j -JL<N^`S6 y:w|G pJg(hxf//NP L`/NX` k +Jg8!@ k kJf*A'H +g Rh/ Hy>NP`%@(`'h/NX`%hl/NX` R!@`FL<N^Nu/,O n0(S@1@f2Jh fN^`, 9:wHoL9:-@ 4-HN^`N^NuNV/ $n/9>NHj4NPJjf0* @cU@ @c&/9>N6X$nN^NuHx6/ N P`0*XA@|HxHnHx/N `/,OH 0. n$hGJf J L N^Nu*fJfJjf/. HjNPJf$j`NVH 8&n$. Hx// N | $HJfHx// N :$H Jg0* @b J@g Rj` @gE J LN^NuIHxBHnN(// N0+XA@// N Jghhhh+#g|Hx / Hx/ N Jg// N P``j@5| `BHj4N X`2/,OH <&n$. $y:wxI KJfE J L<N^NuHj/ NPJf*J*fJ*fJ*fJ*f J*fJ*g$jx`Hx// N | JfHx// N :$H Jg1| 9:wHo~L9:/Hh4NP`dNVH<<(n$. BB=|v ֌/HnKNBB=|/HnNHx// N |Jgt h fl$y:wx؎zڎJgZ*g j///* h N&H-H gn/HhN/HkNB// N :$HJfHnN rvXE`(// N %Hd n%Hh B, n!@P J L<&*"9:wL[I(Ҫф B(*(o / NX$C`Hj/. NPJg J L)fzR\v5f`pF g4Yf vF8 3gr3m6tgvWIDЀLN^Nu0A2BPg R\t5f`\x;gT W`B`/,Op-N^Nu/,O/ $nHy2pЪ/NjB$nN^Nu/,OBN^Nu/,Op-N^Nu/,Op-N^Nu/,OH 0$n n&h$ THxB/N(4Hk /NbBL N^Nu/,OH 0$n n&h$ THxB/N(4Hk/N"BL N^Nu/,O/ /. E "N/.Np-$nN^Nu/,O/ / &n$kJf: *f\B jXJg!j\\ j\ XHx`/ NP$n&nN^Nu"y:whJg iJf"i` fB h`/N>X`/,O/$./N V/NfB$.N^Nu/,ON^`R/,O/.N BN^Nu/,Op-N^NuNVH <$n &n n*h/.I "NXJg f +fp(e t(/ NX`$Y/HxB/ N & .XA@ .fB.X(fJg2T/ N 0&HXJg -fHx/ N .PJf>t `|G`BB//B-|Hx/./NAJgt`D/pXЕ/N %U PJ+fB k X'JB L<N^Nu/ / N P`t`t/`t2`/,O//9>N/./. N T$/9>N6 $.N^Nu/,OH 0$n n f@ (f<&j$T/N 0XJg*/HkNT/ N D BL N^Nup`p/`p1`/,O/ / $n fd *f` n&hHjHk NPJ*f8 +J*f.J*f(J*f"J*fJ*fr'@B$n&nN^Nup`p`p/`NVH 0&n f@/9>N~b&> -@$./N -@ .Pg // N

<$n/9>KNX$ I6(< "*< &< *,< /NXJjgF&jJg +%@f.A%HSj/Nk/ / CN/ / N `B`JjgB&jJg +%@f*A%HSj/Nk/ / CN/ / N x`B`JjgB&jJg +%@f*A%HSj/Nk/ / CN/ / FN`lB`&jJf/NX-y>L<|N^`j +%@f8A%H/N jXJg f"Hx/ ENPRj/ DNX`B` h`/,OH 0&n$.HxHxNT$H !K1B/+HxHhN{4Hy+*HHjNM.BA%HBA%HBA%HBA%HBA%HBA%HB/9>NB y:wl A#:wl.>N6 J L N^Nu/,OH 0$n$*g,B/9>N6Hx/NCp/9>N *g/N[BX j/ hNj jXG Jg$( (f B`Hx5/NP` jG JfG l *fG " jJfA%HBjG " jJfA%HBjG " jJfA%HBjG " jJfvA%HG " jJfpA%HL N^Nu$(Hx5/NP B`P/NX`R%h/NX`P%h/NX`\%h/NX`h%h/NX`t%h/NX`z/,O/ $n/9>N/ N C:wh QPfB *"f#:wl/9>N6HjNMDHjN{V -J$nN^`;  hеf"* @!Af#:wl`/,O"n y:whJf N^Nu(g:( f2( )f(()f()f()f ()g h`/,OH0 $n$. & /N0*B2X:wdnJf /N "XB/N6L N^NuR@5@ BB j X%B/*N_Xt`/,OH0 $n$. & /N0*B2X:w`nJf /N "XB/N6L N^NuR@5@ BB j X%B/*N_Xt`/,OH0 $n$. & /N0*B2X:w\nJf /N "XB/N6L N^NuR@5@ BB j X%B/*N_Xt`/,O/ / $n&n / / N *S* + Pg /N X j-K -R"h$n&nN^N/,O/ / $nnG J*g jJf $n&nN^Nu (%@fC%I// NP`B`/,OH80&n&. $.HxHxN b$HPJgV h[ACBp%@%@(Jg2/./Hx/ N "TX(g/ N "Xp `J+fB k X'JBL N^Nu/ / N P`NVH 8$n*F@BjBj%|Hx@Hy2FHj>N)0/ HzHxNZ%Hg j/ PN$XfjBBHx / N $fxGIN,0*@fDHxBHnN(p-@-|+*QHnBHj /NC%H LN^NupL9://9>/ N Jg$ j/ hNjX/*N[BX`t`/,O/ /$n$. / /N *SjP j-B -R"h $.$nN^N/,O/ /$n$. / /N *SjP j-B -R"h$.$nN^N/,OH0 $n$. Jf/N "XBL N^Nu& /N BB j X%B/*N_/N6 p`/,OH00$n$. Jjgl R h$JfB R h\G "Jf>B*fBj//N BP jp-B -jt"hL N^NѵfB h `&(4f/NX C`L N^NuNV/ /$n$. HnHxB/ N &Hx/ N 2.Y=A0.X=@(f$ @f// N (P$.$nN^Nu @f / N "X`?BgN $8XJg䴐f0.h4b hf"hp/ /(t iN`/,O/ /$n jf jhJf@*fB $.$nN^NuJ*ff5|/ N (@$Xg// N pP` (%@hf Ch%IlR*f/ //N *$ `B`Nq/,O/ HxBHy+*WBBBHxEzN HxBHy+*aBBBHxHy>N $nN^Nu/,O n(3g"Pi(3g"Pi(3g"Pi-PN^`ؼ/,OH08(n&. &TJgB+$R ft k\Jg B( gHxHy>N$HPJgvBB C!L I B/ NL/ Hy #B/ N 9:wtL9:// NB4 k`%H8 4'J`BL N^Nup2`p`p `/,O. n h\Jf N^Nu( g h4`/,OH8$n(RG / N / NPJf2/ N j4X *8Jg&!@8 j8 4/ Hy>N PPLN^Nu)@``/,O/ / &n/9>NHk N$k/ N " JgJjgHx$n&nN^`/,O/ / nJh fzJhft&y:w|$Kp@CJgj d$1@ Jf,!KxgCx'I|#:w|C:w|`*R@ @g4"J$jx`$ix!JxgGx%K|#Hxx!I|B$_&_N^Nup8`p`/,O0. y:w|Jf N^Nu2( Age hx`A`Nq/,O/ n"n iB)rB)t婂B)ሀ)XH@X"tAAA@B)B)t婂B)ሀ) XH@X"tAAA@ B) B) t婂B) ሀ) XH@X"tA A A @ B)B)t婂B)ሀ)XH@X"tAAA@B)B)t婂B)ሀ)XH@X"tAAA@$N^NuNV n0.X@N^Nu/,OH?0&.*. (.$.,.HxHxN b$HPJg&h!|(!|JBg/?BgHx/N "TED0XA@0X@X@|B+PB0 Bd0<(g/ N "Xp L N^NuB0%@( Bc4<%BB-C -JL N^`4NV/$. ".0X=@Uf80.X=@ .X=@pHn/pF/Hx/.N$.N^Nup`NV/ $nHx/ N !PJf40*&X=@0* X=@ RHnHxB(/Hx/Nf$nN^NuNV/ $nHx/ N !PJfn0*X=@Bn0*4 @g^||X=@A0*8 @g|X1@X"RE/ ?BgB)/Hx/ N$nN^NuA`NV/ $nHx/ N !PJf40*X=@0* X=@ RHnHxB(/Hx/Nv$nN^NuNVBn0.X=@0.X=@0.X=@HnHxpF /Hx/.N&N^NuNVH?<$n&n pЎr€-AI &v(d HnHxB/ N0.X=@B2X(b .S  b Ԃ0{(N 2 b V b @b hHnHxB/ NHx/ K N0.X=@Hn?BgB/ N(B0.// NP ncBB.// N "PJg*0.X @g @g.J@fBHh NP` nf0.X7@`*h/N "XJgJmgHx5/ N p` @f zHnHxB/ NHx/ K NHnHxB/ N(Hx/ N0.X=@4.Z=BHxBHnK(N=|=B Sh h hhhhHxBHnN=|=Bkkkkkk*9:wx tԎv֎Jf&HxB0./BB.// N (`<. Ehf(.f2.(f(.(f.(f.(f .(g0Jf EJ(fJ(fJ(f~J(fvJ(fn"E ip///)t h N*H JgN/N #(Xg6HxB0./BB.// N ( mp//-t hN`Hk/N *;nnHx/Hm &<)0"CNHx/Hm"CN E+h00.N !$Xp$f;| mp/-t PN`H&< (JgDBm// N BHxB0./BB.// CN mp//-t hN$`BB0-/0- /B.// "CNJg/`&;|m/ N 'XJg` E*(x` @f HnHxB/ NHx/ K NHnHxB/ N(Hx/ N0.X=@0.X=@0.X=@B.// N "JgP (fF*hJg0.°m f2 mg/N "X`0.g$ @g/N "Hx=/ N p `/N ";n;|m/ N '`HnHxB/ NHx/ (<  DN4.ZplHnHxB/ NHx/ DNY0.X=@2.Y=A?BgN $8*HJgf hf(f,B0./BHxB.// N// DN`:(]BC~Jnd[=EBn=CHn/B./Hx/ N0.@CJ@f0-2A;ADg;| mp/-t h`6pgHnHxB/ NHx/ DNU.Bn. g g f2 Cgd fHnHxB/ N0.X=@ @/b6 Xr0eXxx&<0=|0AxB(.v`;@6B.// DNB.P` Cg gBB.// N ` Cg fHnHxB/ N.g0 gJvև|0exxHm:HvxN.P`fHxHy2Hm:N)0B-; `NHnHm:NP`Jmg4B`f @fHnHxB/ NHx/ K NHnHxB/ N(Hx/ N0.X=@0.X=@B.// N "Jg (f*hJg0.°m f2.mf/N "X mf`L// N BBB./Hx / N\`| @fHnHxB/ NHx/ K NHnHxB/ N(Hx/ N0.X=@PK&< &$< %x؎ @g6 @gn?Bg/ "BNHx/ BN/ HxB./Hx / "CN`Hx/ BNB/"BN-|-|/ HxB./Hx / CN`bHx/ "BNB/ BN"n"B-|B/ Hx `// N `/ N VHjN >B$nN^Nup`/,OpѮN^`/,O/.N BN^Nu/,O/ /$n$*g(/ N B0*//N > $.$nN^Nup`/,ON^`R/,OH 0$n&n k("*$*dD *"jd8l d./Hy2Hy+*kNDr -KL N^`B`$ / /N *4PgHx// N L N^NuNVH 0&n$. BHxHxE/ N / /+N B&Hn/ N D.N  .XggggDfDgB/+N >PL N^Nu/,OH 8$n$. GXI Jn* *4gHxHjX/ N LN^Nu/ NSX`/,O/ B/.N $HPJg/N $jX J $nN^Nu/,ON^`T"/,OH <*n&n (m/.E "NXJgF$+(gBB0,6mJHx/ N .$PgN~b$> -@$./N -@ .Pg // N

f$. p/Ā$y:wIBJf2Jf(nJf/. Hx/ N Ld J LNGD/ NPJjg&Hx$n&nN^`ո*g/ N/ NU&`NVH 0&n + tĀgrDfpBHxHxE/ N // N / S/N At$.N  L N^NuNV/ /$nHxBHnN(*@@0* 2Y=A|"*8L@ pdr%A4AHxHnHx Hx/N RT$f"5| 9:wL9:/HjDNP $.$nN^NuNV/ /$nB*@*0@|HxHnHx8Hx/N RT$f2 9:wL9:/HjDN5| jp/*t hN $.$nN^Nu/,OH><$n(RK xF*< PB4* 0,gL,*8LB` *4"& c&gSJNz N^NuNVH<(n*n HxHxHNT$HPJgRBhBG/ NL/ Hz/ NB A %HB/ Hy2/ NP-JLN^` (%@ fC %I/Hy>NP`LN^Nu/,OH 0$n$. ft6BjG D~ *f-JL N^` //NP`/,O/ / $n/9>NHjNP jf(Jf / N IX-y>$n&nN^`BjG D~ *gHxfP0,nf// CNPJg J L<N&HPJg$HxHxN bPJf/ Hy>N PPp L N^Nu0*rcgrfF@"hB|I2J@f85|B*/HxC/ N Ld 9:wL9:/HjDN k ('@ fA 'H/ Hy>NSP` L<N^NuNV/ / $nBHxHxG/ N / /N B&HxHj/ N  .N 0*]@5@X @bHx/ N>P$n&nN^Nu*gBHx// N Ld Jg // N P 9:wL9:/HjN`NVH8<(n(. &.&nJg"$+(HxHy>N$HPJg$1B HxHxN b*HPJg>Hx/N  mPJg"DB) B0,ЀC2N PP`BI "N/ N`/,OH> (.,. $.*.&.HxHxN b$HPJgt"h ܆ l` Ѐ@T$ Jo%|%|(//// N "T Ђ dpGF(gp/ N "Xp `X ?n Ѐ@ @V$ ` n Ѐ@ @|X`/N "Xp(L|N^Nuւ%C( cvGF%C-JBB -DL|N^`NVH?<$n&n p(lR|܎/HxB/ I &NHx/ K N.F0 2`HjN 5|$jXI FJgf jf/ NX$jx`// N BPJg0( @gN @f0B/N D~PJf5|BHxC/ N Ld 9:wL9:/HjN`&/N FX`// N BPJgC D~ hfHx=/NP`Hx6` frJgjBBHx`< (g 8g: $fBJgj||B.||pfHnHxB/ N2.Y0@g. f@Df .f@Dj .f@g .f@ g .f@@A?g J.f@?X=@HxHnHx$`ZJgHx/NT$Pg//B/ N//HxB/ N RT .NU&`Jg\jBBHx(B/ N RT`|Jg:(Q/HxB/ NHx/ N// N B$ JfJgHhDN `Jf/Hx/ N Ld`J(gHnHxB/ NHx/ N. B@1f0J(gHnHxB/ NHx/ Np//Hx8`*p`SflHnHxB/ N2/,O n (g -@N^`$pN^Nu/,O n1nHN^`0l/,O/ $n *g*B/N f/ N VHjN fB$nN^Nup`/,OpѮN^`/,O/.N BN^Nu/,O/ /$n$*g(/ N B0*//N f $.$nN^Nup`/,OH00$n&n &+($ /N@Xd*/Hy2XHy+*NDr -KL N^`/ /N n *4PgHx// N L N^NuNVH 0&n$. BHxHxE/ N / /+N iHn/ N D.N  .XggggDfDgB/+N fPL N^Nu/,O/ / $nGX/. / N *4PgHx/ / N $n&nN^Nu/,O/ B/.N $HPJg/N $jX J $nN^Nu/,ON^`-"/,OH80&n&. (+/.E "NXJg6Hx/N .$Pg8/HkXN nP-B -DL N^`6t/NX L N^Nut `/,O/ n$(gHhN@X-@ -B$.N^`>p$.N^Nu/,O/ / n$n $(g0 f* *f0/N X-J -B$.$nN^`\p$.$nN^Nup/`/,O n (g -@N^`pN^Nu/,O n "n )g f (f-@N^`pN^Nup/`NVH 0$n f@/9>N~b$> -@$./N -@ .Pg // N

2+FAA@I// N BPJf^/ /N =D$5| k%HxPgCx!I|'JA%H| kf*-JL< N^`8t8`Zt'`Tt `Nt`HB`B/,OHxp Ю//. N)0BN^Nu/,O/ /$n" jbpB0*Ѐ0;NJJJ"dNt% $.$nN^NuB*/Hx/N Ld$ B/ N D~P`B`JlgJ g jB`5|B*/HxC/N Ld$ 9:wL9:/HjDN`tt`n/,O/ / &n$SJjg B/ N D~P/*lN "BlBtBGD/ NPJgj$n&nN^Nu/ NHx/ N `NVH <$nJjfJ *ct1 L<N^Nu0*f65|&y:wIK =DJf4HjHy:wN H&HPJfrt ` @g @c@ @g`/ /NP0*nf<*.f2*.f(*.f*.f*.f *.g*&k@`t7|/N ?f$Xg/ N IX`*J*f"+ ApJf0@$5| k%HxgCx!I|'J%K|B`B(f"@Rtg A ` hx"@`t8`/,O/ $n n "jlJg2 ((ѩ(//*lN P jf / N GFXB$nN^Nu%Hl`/,O n!n 8 hf"P)g /N GFXBN^NuNV/ $n n (rgWg@p*$nN^NuHxHn/N  Jf0.2A Ab^Jjf^5@ B`Hn/N DPJf".pDfr-@gr-A%n jf/ N EX`tp`np`hNV n"n )rg$rgtSfHxHh / N 6 N^NuBnh0h1 (< dpF@ (4 dpF@ PJg(g|HxHn`-h -IN^`p*`/,ON^Nu/,O nJgp-N^Nup`/,Op-N^Nu/,OBN^Nu/,Op-N^Nu/,Op-N^Nu/,Op-N^Nu/,O/ /. E "N/.Np-$nN^Nu/,O n-hN^`/,O n-hN^`/,O n (g -@N^`lpN^Nu/,O n1nHN^`#/,O/ $n *g*B/N r/ N VHjN rvB$nN^Nup`/,OpѮN^`/,O/.N BN^Nu/,O/ /$n$*g(/ N B0*//N r $.$nN^Nup`/,ON^`/,OH08$n&n $ I &+("*"jdV * jdJl e4/ /N *4PgHx// N L N^Nu/NX`B`/,OH 8$n$. GXI Jn* *4gHxHjX/ N LN^Nu/ NSX`/,O/ B/.N $HPJg/N $jX J $nN^Nu/,ON^`!/,OH <*n&n (m/.E "NXJgB$+(g>bJHx/ N .$PgN~b$> -@$./N -@ .Pg // N

!n !n "y:w!I$gE$#J(#:w!|:w("n"B$nN^Nup `/,O n"n Jf2(f*ii i i i i BN^Nup`/,O/ / &n$n HxBHjN(4kk k k k k B$n&nN^NuNVH0<$n n *fv֊hhhhhh/INXJfG/ NXJf/ N 0&HXJf t2`// N $Pg L< N^NuHx//N |*H Jg h fB// N :(H Jgp// N )Hd0-X=@=|HxHnHx/ N $g// N P`r)Jh$B+%@`^t`Xt'`RtA`Lt `F/,O/ / &n$n HxBHjN(4kkkkkkB$n&nN^NuNVH 0&n$SJgX0*XA@|HxHnHx/N $fJ fBhB// N P L N^Nut`/,O/ n$PBJgB/ N rBP j$Jg!j(( j( $-J$nN^` n/,O nJf pBN^Nup`/,OH00$n n Jf/N "XpL N^Nu$((g/N "Xp(` (f"(fC `" fx"hHpLel"("iP g\Y!AXJgd(gX("h&R0+XA@BR"R!I //N PB`DCH`HxHx/N " `p `"/,Op*N^Nu/,O"n n (rg Ugp*N^NuHxHi/N 6 `"QJg HxHi`p9`/,O/.(/.$/. /././././. /.Hx /9:wN%N^NuNVH 8(nHxHxN b$HPJg h?%Hp%@%@(B(1|Bh1|!y> !l&jA%HpѪnB+'lBkHx/ N&|7@rӪtժ l PJg\0(,=@=|BHnHx@BB/ N/9:wNBrӨL$(HՀ!BH/9:wN* LN^NuB@`NV/ HxBHy++BBBHxHy:x@Nz HxPNL#:wHxHxHxBBBBB/.BBHy++HxHxBBBBENDHxHxHxHxBBBBB/.BHy++#Hy++FHxHxBBBBNDHxHxHxHxHxBBBBB/.HzHy++KHy,liHxHxBBBBNB:xH$nN^NuNVH?<$n&. -n*j/9:wINBrӨ $(Հ!B/9:wG*N PB:-P$ c6/9:wNBx٨*(ۃ!E/9:wNP-JL<*n&. $n&n$-/*/ NTP(HJgHxHhNZP`TxȃDgJgF +4r€gFJg4 kHJg, (4f$J(1kHxHj +0T/N)1 Jg6 L L<|N^NuJf$Hg kJg&kBҊBCe**HxN$B$HXJg!Ep!@x!| XH*/NDHxHjNL5C` Jg,"B iB)5B(/HpHjN)0j ` / / N$Hx/NZ(J`,320RJgB`Hy++[HxNGN`/,O n "n !QPBBN^NuNV/ / $n *af0HjG/ N/ /./ /.N$$n&nN^NuB`NVH0<&n+/gr k 0(0@g&+NRd$HxHy>N$HPIJfj/NR k 0(0@VID/Hx/ N&. +,r€'A,gHx/ HzHxN&2`&+ƫ`v j 0(02Ag"*ff*/fN&I/ / N#*/NR k 2(0AVID/Hx/ K&.Np, j 0(0@g`p/Hx/ N Jfr,+/g/ / HzHxN&3/ / N/Nx L< N^Nu"*ª`2p`HxHjN$HP`/,O n"( ". SN^Nu/,O n"hlJg#hpp"hp"l"hJg""h"BN^Nu/,OH 0 n$y>"(L|"r !IlgGl#Kp"(L|% "(L|"9>Ҁ!Ap$B$y>!J"R!Ig X"N($L N^NuNV/ HxBHy++~BBBHx Hy>NzA>B#>B>.>HxBHxE$N#>NQ#>Hy>HxHxHxN#>BHxHy>N{4Hy>HxBHxN#>Hy>ND HxHxHxBBBBB/.BHy++Hy++HxHxBBBBEN@HxHxHxHxBBBBB/.HzHy++Hy+. HxHxBBBBNDHxBHxHxBBBBB/.BHy++Hy* HxHxBBBBNDHxHxBHxHxBHy:y4BBB/.BHy++Hy++HxHxpBBBBNHHxHxBHxHxBHy:y0BBB/.BHy+,Hy+,0HxHxpBBBBNH$nN^Nu/,OH0 &.NRd$A*J:y4gJHxHy>NPE0JfB` \Xfv/NR L N^NuHxHhNP`HxHy>NPEJg d`gHxHhNP`/,OH0 &.NRd$ . AJ:y4gPHxD/NPEJfB`"P )f" \Xfv/NR L N^NuHxDHhDNP`HxD/NPE@Jg"P )f d`gHxDHhDNP`/,O ." g Jmg VIDN^Nup`B`/,O"nBA Vg"SJg 0RN^Nu A`/,OH? NRd&HxHy>NpPBEJfJg#>/NRXLN^Nu"h Jg&0)0@ @f )@")D*B,.c$HxHhNP`/,OH0 $n$. HxB/ N(" Bf vƂCg <L N^NuPR`/,O/$.Hy>N/NP-|>$.N^`\/,O/ $nHy>N/ N&Hy>N6p%@ $nN^Nu/,O/ $n/*NHy HHx/ N#/ N ~-j$nN^`/,OH0 $.$n Srev*1g(NRd&HxDHjNPEJf/NRXB`D"P )fDg>g"hgJ:y0g*pdg"`gXf/NRXpL N^NuHxDHhDNP`NVH?<&np8g0+0@A @AfN&IRdN$HxDHkN$HPK(<#**<R,<#N.< Jf/NRX-CL<$nN&GRdN$HxDHjN$HPIK#*(<R*<#N,< Jf/NRX-CL<|N^` R (fN/ / N/ DN j Jg/ NX"*Dgp€p%@/ HxN&ZPN$/ / ENPHxDHjD"FN$HP`x/,O/ $n/ N 8X j$-P$nN^`/,Op fN^`N^`/,O/"."n B0),L| y> p,Jf $N^Nuf g P`/,OH0 $.&. E N.f8BHy>NZ//NJVDHy>NXL N^Nu//NPJVD`NVH <$.(n HxHy>NZ/ B/N N&HKJgRHy>NX K L<N^NuHxHy>N$HPJg B%P%L p%@/tHv(NZHv(/N/ Hy>N P `/ N |XJf y>"*B0,,L| 0,$gB0,,L|"p#JB0,,"*L|!B0,,"*L|҈%AR>Hy>NX&J`NV/ / $nHxHy>NZ *S%@Pg-|>$n&nN^`/ N }~HjG/ N:/ /Hy>N/ Hy>N P $n&nN^NuNVH<0$n jJg/ NX/ N,N* j X(1g/ HxN&ZP`hNRd(HxHy>N PBBG"JfARJgplG/ /N#*/NR// N&1&/ /N#N/NHy>N *Pg/N LBX-|>L N/ N jt Jgb!jxx jx t jJg j B/ /N#ښHy>N6p%@%@/ N#ْ$.$nN^`#x>`NVH?<$n*n &.$...I|Jf& ( Jf$Hx/ HnG)0NHx/HnN*-Hx// N$Hx//N. fT"-VIDJf-f@ mVI.Dg.p+@&*8rg$/ N$XJfv`v`~`p8fppr+AB@ F bF!Hx/ / N$l$B@F|̭+F JgHHxHn/ NHxHn/N+E LNPIJf/NR m X(1f/Hx/ N&.$ f|p,`A*A+H+EJf/ Nz`p`ʀ+E\`F`+@ -\FX+@h`,DjHx/ /N x`g -f ` -g gg/ N&0^X`*-ʭ`&h 0+02Ag"(ff(/g/NRXBHy>NXJj0l Jf-|/ HnN +HPHy>N6XJgX-gN/ N$XJg>/ mNX`0"(¨`bHxHhNP`Rrfn`hNVH?<*.&. &n(n igZb^p ig~ igN*Jf ic i%b @ig?opdre>E` i g ifFJgJfHy+,BNK.JgJg if +f +f+f+f$+r e ig ic~ ig ifnABBJ+j //N X"+ -@PfXtNRd(HxDHlN$HPKJf/NRXt1` ig6t-`J+k($+p dzt`J+kKvHx BHv8N(Hx/ / E)0NHxHkHnN$Jg/HkHv8N =|/HnN X/ / /<@i/N$ L<|N^Nu igHx /N X-kP`B` R (fJg  (g HxDHjDN$HP`HxB/N(` 2 BBzFJl Rpg  f` v֎|Hx0BHvhN(Hx/ /NB*|//HvhN$G,1gB*/Hj/ N B*/Hj/ N/NR/ //NBt y>%Hx At#>(y>$ Jf%|>BN(#>/ Nz/ N#ْHy>N6 Jg/ N HX$ `6,1gHj/ /%| X!`Z(@ ,g(fA%H l%Hg X N()B`0$ `Jg/ //9;}N% `nt/`t`zt`tt/`dt/`Xt7`Rt`L ibL i b @ig6t`2 or eЀ0;N,~ @ig ?oreЀ0;NFx i b @ifT +fNNRd$(+Hx"L|й>/Nנ$HPK׸Jf/NRX ig^ @igT i'gJ +f iftJf0` or eЀ0;N: i%f(` i'g?opd6`nHn/ N#*/NR if,`t|ԊK)0 ifNB*|//HkN  ,1gB*/Hj/N B 2 fRpfB҂'AB/NRXB`>/,ON^`/,O/ "n$y> iJf  o $_N^NuR"#r `#P`/,O nB"y>!QN^`/,O/.Hy>NZPN^Nu/,OHy>NXN^Nu/,OHy>N!(N^NuNVH<<(n(. *n$..gj/N&"XG6,Bl// N#$H9CPJffNRd&HxHy>N:$HP*< Jf/NRp1"n"X`HlE/ NڂHnHx/ /N&"&HJgv hH(1flNRd&HxD +H/NԾ$HP*< Jf/NRX`4LgHxDHjD"EN$HP` j (1gzHxHj"EN$HP`:p g4/N// "EN p1"n"E// N&! J L<N,PGFJf/NRXp`""h )1g * f/NRXBL N^NuHxHhNP`/,O/ / HxHxN&HHx N$$Hp!@!n!| !| D!| !| (!| ,!| D!| ,4!| 0/N$D& K $n&nN^Nu/,O/ $n /N$Xp-@ -J$nN^`@dNVH?<&nB,$+(0| o// N #\&HPJg n pʀ=h(n Ao// N #\&HPJg k-h . ށ&+4Hx// -AN $H ".Jg"B n 0EA1@ ((( $| B(0\@AЈ(Є o=@$ LC(( KE<.B=F҃-A<.B=FJn J L$BBBHxBHy+,{BB/9:\HxN#>B$nN^NuNV/".$L| й> @ -@ nJg0Jf A $N^Nug (-@ n`/,OH00$n$. &.B%JHjHxB/G$N%HHjHxB/N%H HjHxB/N%H5|"5y:yJ  y:y>g-| -|:y8L N^`IL N^Nu/,OH0 $n *fjNRd& *" gJJgF/NXJf2/ N#*XJf$ n(ff t1/NRX L N^Nu(fB`t/`/,O"n n pf&0)b01@!iHxBHhN( N^Nu/,O"n n pf&0)`01@!iHxBHhN( N^Nu/,OH>0 n$. .&.".&n JgjJgf8:"B҉Ё h$p BJf L |N^Nupf$fj`fjbff /./ NRP$R`B`/,OH 0$. &ngJg n$PJf L N^Nupff /./ NP$j`/,OH0<$n(n Jg*0,,RfBRG BBK L0* B2mB5@ L< N^Nu [ f /NRXR`Jg % `NVH0<$. n$PK G Jf L< N^Nupf/*(NXJg//*pNP$j`(j( -@&./N -@ .Xf//*pNP j( /N6X`// N ЁC QJf" LN^Nuxf hbfg P`pf hbfg P`±g$PJg%h$h$$Q g%H"!I`/,O/ / n". pf $$_N^`\J o"PJg#h"h"pgpgt!A $$_N^Nu"h,B0(bШ$ĩ$i $2, g"i "q #H"h,B0(bШ"i # "h,B0(bШЩ !@`"h, (ШB4(`ԀB0(bЂ$ĩ$i$2, g"i"q #H$h,"hB0(`0(bЉ"j# $h,"hB0(`0(bЉЪ`p/,OH 8(n&n l"hA3pfBHx/9>N$H Jg. l"hA(rfHxB/ N l h %@%K,%L(%|$B*lUfp%@B)JB@ B bF! S%HCg!I&%KB0*b"« k"0%Ag k p C!I B0*b k! B0*bЫ%@ B/ N ~B@FPBLN^NuBHx/9>`Hx`r%AJ:~g>jf`4'I`Pp7`NVH<<$n&n (.(j,*j(4- + f&<0@f&0+AARfBn*gg4t"ԌpB/ / /B-|Hx/./NJgp `4t Ԍp `// HnN/ Jfp@d0. B05@bHx/ N ~P jJg!j j B0*b"¬ l"0%Ag l p C!I B0*b l! B0*bЬ%@ B` @bpB/ / /B-|Hx/./NJfBWIDzHvXHkNx؎//B0+/HvX/ N2Jg h(0(Hf&p0L<<$n&n $.pfj fb +f^Jkgb +" f j( h g@I>"-A".g& gJf -@ nJg('hKJf y:, (*!@/ Hn/*p j(0h/Hj8/ N (H(< Jfp/ DNXJfp1-@ .L<||N^NuRfNRd"-A nJg(Jg"h )1g'h/NRX`J"(-A n`NRd&/,N&XCR,<#NJf$*ff/N/ / FN/ DNp1`d/N&,/ / FN/ DN/ B0*b//0+//+/*,N JfJ.mJf Jjbgv%C%k5k`J*lgD j( h h (LGHx// N)0-jBn B/(/ / NFJfHx/ N ~PB`&*`N/B/ N  Jgv`|p`vp/`pp0`j/,OH 0$n&j(BB@ B bF!B/ N ~ jPJg!j j  j *Jg!@ j B@F *hg /N XHj8N&"/*pNPpf, *gHx/N60/*NU& /*N?X/ N zXA4Vpf4Hx/ /9>N -y?|L N^`V j,!@`NHx/ /9>`/,O/ $npf6%y>Bj`Hx/ N ~ j(P(g-J$nN^`$nN^NuNV n (rfN^`dUf6-|-hBBHnHxHnHh8N&" N^NuA`/,Op8Ѯ N^`\/,O n rF€///r/Hy+,/. /.NEN^NuNVH00$.&. $n XJjf-@L N^`/HxG/ N B0*// Hy+,//NE L N^NuNq/,ON^`/,ON^`/,ON^`]/,ON^`\/,ON^`l/,ON^`iP/,O/ n"n JgB"tdr"rdp"X $N^Nu/,O/ n"n JgB"tdr"rdp"X $N^Nu/,OH0 n"n d c* cr$AHjHiHhN)1 Jf BL N^NuNqNV/ /$n *4r€tfBHn//*/*0/*HxN&./.HxN&(.N&/.N&P$.$nN^NuNV/ /$n *4r€tfNHn//*/*0/*HxN&./.HxN&(.N&/.N&P$.$nN^NuBBrª\$fB`Bd`/,O/.(/.$/. /././././. /.Hxb/9>N%N^NuNV//&.tԎpĀHx`/.(/N)0C B!I4-y:z//.$/. /.//././. /.N0JfJg". AQb#:z$.&.N^Nup`NV//&.tԎpĀHy:z@NHx`/.(/N)0C B!I4-y:y//.$/. /.//././. /.N$4f:Jg6".k^#:y 9:ygHzHy+_N'("#>$$nN^Nu/,OHy:z@NXN^Nu/,OHy:z@N6XN^Nu/,O/ /$.HxHx N$HHy:z@N 9:z @Jf8%B$g y:z!J#:z%|:z-|:z@$.$nN^`MĴf(Hy:z@N6Hx / N $.$nN^Nu P`/,O/./. /./9>N'*N^NuNVtH?<&nzڎpʀ*krƁx؃ y:, ($!@/- N jXJf6 -  g$/ N " y:, (!BX`~.-+m ,<Rd FN(@ L|ҹ> A -@|$n|Jg0Jf$/ NRHnB0+ /N#(H `gR *-@$n`/ B0+ /N(Hz|ڊPJf E+h PHn/ N#NPJoI-Lt/ N $HXJf&HxHxN b$HPJg2p!@ h >,"nt.<)/BJf"*fmp k'H+g(HhHu8/.tN)/ / N  +"A'AXgB, kpƀI8'LBlB0(// N&|9@׫BBBB/ / N y:,"(!B Jg/ N ` R (ff r ªg"*H-A$n`(f gB"*-A$n`/ / NP(FN, 9>-@$nJg(Jf2/NR/ N " y:, (!BPLB)d2e,rgrDg f"// *Ъ/-Ix(GN۪ "nxJn`z` JlSrR jBRRrf`E`// N#*/.tNRz|ڊHn/ N#H`Hn/ -@xN#* .x/NRz|ڊ Hn/ N#H`fC/ / -IxN#*/ NRp IA#"nxg/ / -HxN#N/ B0+ / nxN(HJg,1g( FN",-A$nJg Jf/NRX-|-mBBHx(B/N(B~ގ/HnBB/HnN $H .N&"XJgP**// N#N FN-@t L|ҹ> A"-A$nPJg 0Jf*/.tNRX/Hx/ N#6$H CA#HJgz|ڊ/ / NP`pNV/ /E r$@/N/<QB/*/N(L< *L|Ё$.$nN^NuNVH><$n(. (jHxBHnG(N||HxBHnN||B4,pm8/9>NBtը$&( ׁ!C /9>N*P/ N "X`v z$dp$"҄n$ *gb f jH|LdH// N #\$HPJf6/9>NBrӨ$$( Հ!B /9>N*PL<|N^Nu&*&C%K// N&|PJg"/9>NB|ݨ, ((х!@(`&٪ (bv/9>KNBr9ЁB|ݰ"0Ӆ!/9>I*N+BPW b(ҁ2;N$Nz: b0 2,I|#l+z2|o bJ/9>NBrӨ4$(0Հ!B0/9>N`Jvmvր`zmv`Jfv`"@AHo// N #\$HPJg"j ) gR#:yB)0 >r,L p 2XJgHiHy:y/N /.// N*`/9>NBvר*(ۂ!E/9>NP`J:z f( *g/9>NBrӨL$(HՀ!BH`B/9>NBrӨ<$(8Հ!B8BvЃB|ݰ"0Ӆ!/9>N/ N `zvm/9>NB|ݨ4 (0х!@0`RJ:z f* *g/9>NBtըT&(Pׁ!CP` N v'@ '@`HJ:zgz m/9>NBrӨ4$(0Հ!B0` C (Srd`-h $<Rd"BN* BN,B0* /N#X$<RJg6/HnN#/-H"BN nJf/"BNX`B-h`/ BNX`'h"CJ f"h 0)0g "C#h `f/ BNX`^zmJ:yg|#l+z0|o c C-h -k#:yBHnHnHxBHnHy:yN&,\Hy:z@N .gNJ:ygF/9:yHz/N& $ g,HkHxG/ N // Hy+.iHxNGNHy:z@N6 .Xg /N&XHy:yHxN X`/,O//$./9>N Btհ&0ׁ!X-y>$.&.N^`+(NVH?<(n,. >,HxHy:yN&$HPJg:(7fjHnHxB/(0Hy:yHxN&.G&Jg/ NXL *`"*d(-DB(.*.c*g,zȅ匞f.A2<"<2t bf "jX"*\BBzʁ.f* 'c&B jH((@*(Dd\%IXz%E\Jg / N&XHy:z@N$y:zXJf~-|:z@LNBrӨD((@ـ!D@/9>N*%B`%CdP`b/ jN$R`p/,O//$. . C2N JWIDN^NuNVH?<(n&. (.-n*.*l'pg(/9>NB~ߨ ц /9>N*P , ftB0-@Jff - fhrgb PbX5( b"<g>/9>NB~ߨ (ц!@/9>N*P-LLNpЃBtհ,0݁!/9>N*P*f/*/ N P&jCpfz'nDHk/B/ N &0@@67jBk| 'm 'mHx / N '$g// N ,// N / N `Br f DB`zWft|flJgf7E`^/,O/.(/.$/. /././././. /.Hx)/9:zN%N^NuNV//&.tԎpĀN Hx`/.(/N)0-y:zLC B!I4//.$/. /.//././. /.N$0f Jg .k*#:zL//9:zDN&PN $.&.N^Nut`NVH0 &.$n$tԎpĀHx`/.(/N)0-y:z\C B!I4// /. /.//././. /.N$0f:Jg6BBBBB-|Hx/./*NARJf#:z\ L N^Nu$`NVH?<(n.. &.&lB,",-AKE*g6/9:zNBvר\*(Xۂ!EX/9:zNP-LLӨd*(`ۀ!E`/9:zNXJgp/////N ܴ/9:zN`/9:zNXJgl/N "X`^p(gr7gTBvp`/N&!XJg"hH-iD//NP/9:zNBrӨ&(׀!C/9:zNP..v`/N "/9:zNP`^NVH 0-|-nBB/9:zN$HnHxHn/N&"E*Jf/9:zNXpL N^Nu"n &hL"//N&!/9:zN B`NVH? -@". 9:zJg f2/NBrӨ$$( Հ!B /9:z CNP/.N "X` r/NBrӨ$Հ /9:z CN nPpeHx/N #\-HP nJf/9:zNBtը (с!@`$h @g/9:zNBrӨ$(Հ!B`XpĀrm/9:zNBrӨ$$( Հ!B `,o//N #\-HPg$h * " f/9:zNBrӨ$(Հ!B` *g rrf D(1g np@"DrF,r@gF f/9:zNBrӨ $(Հ!B`)1gJ:zg//N&|PJfB0*l/9:zNBrӨ,$((Հ!B(`8 n"((l/9:zNBrӨ$(Հ!B`ofb!@!@( nh-jHx/Hn/9:zN%Ѷ-@f nJf2B/9:zNBrӨ$(Հ!B`//N P`peHx/N #\-HPg n-h"nr-@tl ".o//N #\-HPg-h"n-ipg-n"n&i-kEr2|-IBBBBIJnTJgJ:z\gzE/ "nB0) /N#*Pg\/Hx/.N/ /N#HB`Bgrgf$ R`*B-A c"nn Dgb g".`P g fHxBHnN(|| J:zTgJg$ ` gxB*pm $ Tp `8-kNRd.HnN#*(HXJf\/NRX fptBB///.N ܴ/9:zNBrӨ$(Հ!B/9:zN*`/NRX Vc`,+ B*r+eFHxHx4HxN . g,// HhN)0W G!E!F //.N r-A`Ch, Hx/ Hn$<)0"BN ffNRd*HnN#f(HXJg>HxHh/"BN/NR'nX*$+ VID`z/NRX`zHvX/.NPJfHxHvX/"BN `pt `HxBHnN(|| Jf pgB*rl VbTSHxHkHn.<)0"GNNRd,HnN#*(HJg*HxHhHrX"GN/NRX*r-A`@/NR|܎//.N Jgpt`Hx/HrX"GN `JfHY $b* cJ* nYd"R@Jgr-A`A. g: gJfjN v-@HxHnB*HrN)/X* `HxBHnN(||B*^B* e-n,<Rd"FN* FN,"nB0) /N#XJf/NRXJf*/NRX`V/HnN#(H/NR `HxHl/N)0/NRX*`HxBHnN(||B*^B* eHx/HnN)0NRd*HnN#*(HARJf /NX`~/NX*`@$ V`r-A`tp`NRd$9:zgJ:zhfl D4(0 B'"n"),L|`ڹ>"E Q-H nJg0Jf0 D4(0gp"D i-H nJgB`NB`f"*(| ̅f"h Jgf )1fR h-H n`Df "D)1g/NRX"nB0)g2HnN!XJf^ nJgT-h"nr-@/9:zNBrӨt$(pՀ!Bp/9:zN*"nB) B0>t,L//./. p 2TN`^"P )f:*(| ̅f0DfJBg(g2hg*`g"XgJg hH-H nJgJf/NR"n )"X fFB//)N Jf/9:zNBrӨ\$(XՀ!BX/9:zN*`SreJ:zhf:/9:zNBrӨ\$(XՀ!BX/9:zN*/.N " `L".JgTBBHxHx/N ܴ/9:zNBrӨ\$(XՀ!BX/9:zN*Hn/N#HP`/"nVID//N`NV/ /BHzjHxN%#:zN HxHxHxBBBBB/.BHy++Hy++HxHxBBBBENLHxBHxHxBBBBB/.BHy++Hy* HxHxHnBBBNDHxHxBHxHxBHy:zhBBB/.BHy+.Hy*HxHxpBBBBNHHxHxBHxHxBHy:zdBBB/.BHy+.Hy+PHxHxpBBBBNHHxHxBHxHxBHy:z`BBB/.BHy+/Hy+_HxHxpBBBBNHHxHxBHxHxBHy:z\BBB/.HzHy+/'Hy+/THxHxpBBBBNHHxHxBHxHxBHy:zXBBB/.BHy+/^Hy+/HxHxpBBBBNHHxHxBHxHxBHy:zTBBB/.BHy+/Hy+/HxHxpBBBBNHHxHx BHxHxBHy:zPBBB/.BHy+/Hy+/HxHxpBBBBNHHxHx BHxHxBHy:yLBBB/.Hy*Hy+/Hy+0HxHxpBBBBNHHxHx BHxHxBHy:yHBBB/.Hy*Hy+0Hy+0FHxHxpBBBBNHHxHx BHxHxBHy:zLBBB/.HzHy+0RHy+0zHxHxpBBBBNHHxHxBHxHxBHy:yDBBB/.Hy*Hy+0Hy+0HxHxpBBBBNHHxHxBHxHxBHy:y@BBB/.Hy*Hy+0Hy+0HxHxpBBBBNHHxHxBHxHxBHy:zBBB/.BHy+1Hy+18HxHxpBBBBNHHx/.B/9:zN%&HxHxBHxHxBHy:zHBBB/.BHy+1GHy+1bHxHxpBBBBNXHxHxBHxHxBHy:zBBB/.BHy+1lHy+1HxHxpBBBBNHHxHxBHxHxBBBBB/.HzHy+1Hy,liHxHxBBBBNHHxHxBHxHxBHy; BBB/.BHy+1Hy+1HxHxpBBBBNHHxHxBHxHxBBBBB/.BHy+1Hy+2HxHx$Y/BBBNHHxHxHxBBBB/.Hy1Hy+2&Hy,]HxHxB/BBNR f y:yd$9:yhedN XN3>HxHxN%#:zHxHNL#:zN&##:z/9:zLN&#:zD$.$nN^Nu$hpf"2(g Ag 2HL<.,`f/,O/9?|NN!/9?|N6PN^Nu/,ON^`'Z/,OH <$.Hx/N '$HPJfG K L<N^NuJgHxHxN &HPJg *T!@ *"I h ||HxHj +X/N)/"kPA*I pЊc," SpЊe&p쐊Ќr# / /N ZP`R*Y`B`/,OJ>g N B>N^Nu/,Op#>N^NuNVH < n$n (n$(d h(0(2A$g/ 0@/N $HPDfBHxHxHlN $g$H gBHxHxHlN $g$HK/ nB0( /N#&HPJg g.-lB0(,-@BHxHxHnN $g$HJjBBBBBBB0+,/Hx I/ N GBHxB.// N $/ / N#HPL<N^Nu/,O//$./9:zN Btհ&0ׁ!X-y:z$.&.N^` "/,O y:, ("!AN^Nu/,O y:, ."(!@N^Nu/,O//NRd&Hx/.N#$Pg/. /N#*P/NR B $.&.N^Nu/,O".J:zHgN J@fpN^Nu09>0@Hc3>09>0@3>`/,OJgN^`^N^NuNV nJfpN^Nu (rgYfHxHn/N `HxHn/N B.-A Jf".b n `/,O n "n !QHxBHhN( N^NuNVH 0 n&n JgB$Jf*/N#$HXJfE J L N^NuJg&`"L|й> @ -@"nJg0Jgf$i Jj0l/ N#XJg` )-@"n`NVH<0$n (.&n.v֎pƀHxHn/.N $ f ." f&JfJfBB$`THx(B/N(/ G/ N/ /N&"@Jf/N&!&HXJf$B// N&!/N&" L nphp f np|D(m EBhJgJfB.gJ`g"Ei@Hx/ Hnp/9:zN%Ѷ$f npJf/9:zNBrӨ &(׀!C/9:zN*PI` nph`Z(.fHxN"E3@X`Z"(4 EB0(d"AC LA/N E1@`Hn/ NP`**("Ep̀ r㨁02| / I/ -IPNHn/ / N#N(H"nPJgtĮ.fJg (fxgvJ;g> y:, h((`/ HxE/ N // Hy2Hy+2oHxNGN /9:zNB~ߨ (ц!@/9:zN*PA "Sf4/.pNX`Nv`rx np*1gJ:zgt@,$(, *"EB2)hcNfHf E(g*.g n!nh/9:zNBrӨ$(Հ!B`^FĀ"EBi (.fdg//N&| E1@ npp,Pg:*1ggJ:}fgJ:}4g /.pN X nprè, np(g&tg/ /// N $`J/ /// NN`*1ggJ:}fgJ:}4g /N X nptŨ,`/.h/ /.pN|$ fJ.<N,< " npJf>Jf/9:zNBrӨ&(׀!C/9:zN*P`Bp`P*(BJg/ FNX-Ep`(g t/ /// "GN$` `/.pNXt1`/.pN "Xt1`8NVH8<$n*n $.(n&.+lp Jf // NPJfBL<N^Nu`Jg2p`&jp l gbJg VrѪ V"*n`"+xg:xf\rf(QHxHk /N)0/// // N4 Jg`nxf|B-k /// Hn/ N`p*`@NVH<<(n&n $TJf(HxHx\N,$HPJgvBPB!|(pЫreRЀ0;N HxK/ / N $ fJf0BRJRf jfJj fHx\/ N BP L< nJgrJh0llB0* ".C BnFrgZ//N %< PgLRj / /.N#H/N`fHx// // N=V`&Y fgR`t1`t0`t;`t7`BBN(AKCpffB/ / // N$fF".B0* *.A BnLgh/2< N L R2* B:VA8XXn:SA5A / /.`4Hx/ / // N=V`"XJg fgR`!PR`t1`t-`t7`NVH 0$n&n +r gr gr fJgJRf&-y>HxHn/ N 6 L N^NuJg-j`NRd$B0/N#XJg$Hx/N#PJg-h/NRX`-y>`Jg*@Hx`~Jg* `p`p-`zNVH?< .(n &n$l$*dB"g f  g`p*`JgSfJ +SveЀ0;N6jjjjjHHHHHZjjjjj *hg /N XBh(+g(kfHxHxN &HPJf p7Ldt~TTTTTTTTTTTTNTFTnB*-@`B*`B*`-j/./ N `vƂ-C``-A`7A```4` +rgQg -@/`B-jHxHn/ N 6 Jf^`/ /*pN$`(gfp`D *$`/,OH 8$nJg$G BI LB0* mHx\/ N PLN^Nu/NRX`Nq/,OH<$n RJg!j j B0*> S>I "K4V&jJf-JL<N^` 6 S +Jg$!@ k /+ NHx/ /9>N`%@ `/,OH?<$.E> HxB/ N(*<>&<> ,<I*K8 E&X*JfHf 9> $jR" y>dC>pEN@HxBHxHxBBBBB/.BHy++Hy* HxHxBBBHy>NDHxHxBHxHxBHy>BBB/.BHy+2Hy+2HxHxpBBBHy>NH$nN^Nu/,OBBBHxBHy+2BB/9:\HxN-#>(HxHxHy>N{4A> B>f#> 9:X"jV#>#>N^`/,O/ Hy>N}VXJgBEvN/NHy>N6 $nN^Nu/,OH 0Hy>NHxEg$jV#>#>"9> >o/NXJ>m*$9:zBE>G^"9>>oJg$#:zHy>N6XL N^Nu/NX 2,fRp?dB:zWID`NVH?<"n*Q(mr6,B:&m4,B<"g. @vCe/9:zNBrӨ$(Հ!B` CCcؚ6C =C g JgCfHy>N", 4, vFvƁx?Ȁ$pM>XJf"9:z$<&<*Jg. p0΀ g/"BNBrӨ$(Հ!B/9:z CNHy>N6 `6҅HAJAcH/9:zNBrӨ$(Հ!B/9:zN*Pp`jff.,f , *gJ$R`>*,f^/"BNBrӨ4.(0߀!G0/9:z CNBHx/9>N3&HJfB/9:z"BNBrӨ$(Հ!B/9:z CNHy>N6 p L Jf."9>k >oHxHx$NT$HPJgpR>BP%H 5||<l 5llp0%@ %l %l pM>$g!J!M> >%@ j&g!K%K. P'G(j LBJf j h PJ(f,, FrЄG6H@J@o/9:z"BNBrӨ$(Հ!B/9:z CN/ NHy>N"nB`Rj(jJf j `2+le(T` GB:(B0(ڀ0+Jo B0+o //+ N kkP"GJ)fpSjS> /9:z"BNBrӨ<$(8Հ!B8/9:z CNHy>N6Hx/ /9>N4V/ N ""nB`2lB0+B2+Ё2 Jo(0l", B<o$9I9H//N PJ+f`P,/ DN TX ,Jg.!@ l Hx/ /9>"ENSjS> (F`%@ `%K ` %K `B0(gHy>N6"nBXB`B0(؀ P`"RJg#j"j"B0*> S>Hy>N&l B// K N"THx/ /9>I4V-IN"nJf F@HD1@Bh!j !j/ NU&"Frѫ刑X KBJfj'@(B,"n"g*/9:z"BNBrӨ$(Հ!B/9:z CNP`*) .Hx/ /9>N/N // N"G`HШ P` l h.fP(< "*<4VJfJgz"G Q&gt!K G `zNq/,Op-N^Nu/,OBN^Nu/,Op-N^Nu/,Op-N^Nu/,O/ /. E "N/.Np-$nN^NuNV/ /$n$.B*fg/./N P *df j(0(@$g//. Hn/ N /.//. *(/N Jf*/*(N /E "N/.N $.$nN^Nu j( (4gHxHh/N `/,ON^`/,OHy+2NK./,OHy+3NK./,O n-hN^`/,O/ $n/ N BXJg"JgHy>/ N PJg"$nN^NuHx Hx / N B Jg` jn`NVH08(n$l-|-j BBpĀ劕j&y>BJf$Jg/ /Hn/ /N@L N^Nurf0+g f +gf +g fJf& &k`Hx/ N .PJg//Hn/ /N`B* 0 >t,L * 2TfXBBHxHx/ N ܴ/9:zNBrӨl$(hՀ!BhprӨt$(pՀ!Bp/9:zN*`/ N "X`/,OB@ @ bF!N^Nu/,O .B@FN^NuNVH00$n f n&hN& 9?-@ .g@ g8 *f^NRd$/ N#*XCRJf*+ff*Jg$/NXt1/NvX L N^Nu(f/N'jXB`t/`t`/,O//&. N"$/9?|N/Hy>N l/N /Hy>N /9?|N6/NB$.&.N^Nu/,OH 0$n&jN$/ N V'y>/NBL N^Nu/,O/N$/.N /NB$.N^Nu/,O/Nh$/. n/(N /NdB$.N^Nu/,O/N:$/. n/(N /N6B$.N^Nu/,Op-N^NuNV n 9?-@ .g& g (f f"n#hBN^Nup1`p/`p`/,OH0 $n$*N&/. /N$Pf / N DX/N L N^NuNV/ HxHxHxBBBBB/.BBHy++HxHxBBBBEN@HxHxHxHxBBBBB/.BHy+3Hy,4HxHxBBBBNDHxHxHxHxHxBHy>BBB/.Hy&Hy+3#Hy+3?HxHxBBBBNHHxHxHy>N $nN^Nu/,O/ / n$PBJf $.$nN^Nupf6*g f$ n f .f/./ nNRP$j`/,O/ / "n n $n (fT fNpeH 02tGrdHrgBJg,Jg:Hy /B* //* /(Hy>N.AB$n&nN^NuHy //(Hy>N `NVH0<$n&n &.(n k(0(@@$0@-HJg(lKHxpB/ N(/ / Hn/ /Nz$.I "NXJf j(+gfb *f"*fA `& f jHpLe"* hP tdpЁ%@rӪJgR*gtժ( jkBhk 1j*!n !k+fP@ +h/ /./.Hk8// N$ L< tN^NuAH`lHxHx/ N "$H `lnpd j *gH f "jHrLd. 9?VtĀ/r<€// N #$H Jgl h *(B2(f^JhftDmpr/9:zNBrӨ$(Հ!B/9:zN*PB`t7/ NX`t(`t `t`NVH>0&n(. $.&.,.$kN*0+@JgVJ@ff// NPJf/// /N/%y>BB/E "-@N/N/N .L |N^NuJ@g/// /N/`p8`p9`NV/ ."n n$i" fl  ffJf" *dA-@HxHn/N 6 `.Sf(Hn/N DPJf *dJgr@%@dB$nN^Nu@`Jg-H-I -@$nN^`hJg8SfpfHn/N DPJf *dJg r%Ad`r€`pfrªd-A`BNq/,O n"n (fJ:}|g) g r!AN^Nur!A/Hy/9:}HhN`/,O/ n". "n0(B4l A1@$N^NupB@`/,O n (4gHxHhX/N N^Nu/,O n (4gHxHh/N N^Nu/,OH0 $nv8֪/N&!$Xgpf /NjX//N&!PL N^Nu/,O nB@ @#bF$"( g B@FN^NuA!A`/,O nB@ @#bF$hB@FN^Nu/,OHxBHy+3GBBBHx Hy>PNz N^Nu/,O/B@ B#bF$HxHy>PN B@F$.N^Nu/,O/B@ B#bF$/.Hy>PN PB@FP$.N^NuNVH?<&n"n &. . k-h(Jg~*$)B) k h*PJg m"ҭfЈ+@//-N  m P -Jg!@ m k+H C g!I'MA+H ko6$kJg, + f Ъ'@ tĪ/ N RX *Jg!@ j j *Jg!@ j S "n)gv/*N "X/ N5/ N/.Nb LPNBrӨ((ـ!D-EB .".Ө$(( ـ!D /9>PN*/// N|p/N "Jg / N5X/ N^XB`TJfܮ/,N "X`JoJg&"-A//N ڮܮ(.ٮP ,"҅fڬ/,/N  TP ,Jg!@ l l ,Jg!@ l S Jg/ N5X(<I* k :zo/9>P"DNBrӨ $(Հ!B/9>PN/N " `/./N ܮ//,N &, Ь*ڂծ$,`'@`:'@`JJn*L`'@`'@`$L`-@(JBEK`-@BE` -@KB`$L` JfN5$HJgR/9>P"DNBrӨ<((8ـ!D8-nB .".ӨD((@ـ!D@XJg0BrӨ,(((ـ!D(-FB .".Ө4((0ـ!D0/9>PN%C%B%E%GXJf& k$g!J'JK%MR `P'J` U$g!J*`'J`'I`'@`d'@`t/*"nHiN nP`/,OH<<(.&n &.$n*nNRd$B0+ /N#XIRJgpgrg/NXBL<PNBvר((ق!D/9>PN*Pp`px ,zgrg+g J:}4gHu/Hx/ N`NVH><$n&n &.(n*n Jg(<=*<|Jn BL<|N^NuBgrgdgB+lشnU bJЀ @00HN@L|88pf$, g jnAPk;n `xrf, g jnp@+@g c"n i|܎ g gRHx.Hy+3Q/N(yd`Hh Hx./N Pp./B*g/Hy+3[HxNGN|g`bHhHx./N`p fH Mr HxHk/,<)0"FNHxHkHm"FN, g jnj%mh%y>Tl`pf, g jnJ:}gj `// / / EN`/,O/ $n n B0(ЮSkN"*l>"*Ҁ n h"h AXa)`"jHi//N)/S$nN^Nu$RJfHy+3NK./,OH0 $n$. /9>PNBrӨ<&(8׀!C8/9>PN*"*PP Jg&惐ҀJnr%APJlD"*T&䃐ЁJnp%@TJ:}gHJ:}g@ 9:}Pl4 y:} c("9:jR <LA jR‱l %@BHBj *PЪT%@"*XTc$c%B c%|BjbL N^Nu%@P %@T`NVH?<.../9>PKNBrӨ$(Հ!B/9>PG*NHxBHnPN( G&( -C$f80| "Gb4$n Jfd/9>PNBrӨ$(Հ!B/9>PNP`Hn`Hx/. /N +~Jg$n`Cc Hy+3NK.` G&("C g g/N "` ) g~"GB0) /N#/ C/(N \ JfX"CB4) ir-A4x-D( -@Dzlon/9>PNBrӨ$(Հ!B/9>PNPK`JfJ f JfJg"C )g G$(( @r-A4x(`zDxDg . ЮD Gn:$n JgpxخD-D$C-I,p Dg r ddJ* f^KHx/.,/ G)0N  f:* f2x-DPHxHj/ N-nTHxHj/ N-nXB,B* -@L//.D/. / //.4N;-@8fIB0*z4fpHn/ C/(B0//( Hy>XN (fJ.m /9>PKNBrӨ((ـ!D/9>PG*NB0*/ C/(Hy>XN (f*J.m(`/| ܃/A-HNzHvX"CHi nNHnBB0*/HvX0//Hy>XNN(,fJ.mN/9>PNBrӨ((ـ!D/9>PNBB0*/HvXHy>XN(fzJ.l\* B-A *&.얀Jog"xȁ-DR%@HnHx/ NS .r€n fjfbJfzʀ-E/9>PNBrӨ&(׀!C"[IӨ$(( ـ!D /9>PN*P&xתHn// N JgP/9>PNBrӨ\&(X׀!CX/9>PN*P".DgA g^Hx/*B/ //BN`Hn/.D/. /N +~Jg($n ЮDo`d/9>PNBrӨ((ـ!D/9>PNPJ>Hg`pLUfV(`GJgp/Hx/K N CHhHx/ NB0//0*// Hy+3HxNGN/9:}PN Jg~K`HxHy+3Q/K(ydNHxHy+3Q`6|*PHnB// B0//Hy>XNN(fJ.m/9>P,<"FNBrӨ((ـ!D/9>PK*NBB0*// Hy>XN(fJ.m>/9>P"FNBrӨ((ـ!D/9>PNPJ>HgpLUf(`KJgPNBrӨ,(((ـ!D("[IӨ4*(0ۀ!E0/9>PN*PB`B` .Ю&*Jo/9>PKNBzۨL (Hф!@H/9>PG*N/9>PN/9>PN.g *JntJf~"*ft/9>PNBzۨd (`ф!@`/9>PN$D//N rîx .Df&&*ff/./.N P/N "X`2f6Jg.fHx/*Ԫ// //BN KB`RHnN`X`/9:}8Hy:zHy>@N Jf`gRHxBԪ/`HxHxN b*HPJg!n(/(/.(B/N & -gZ ff mHpLeZ (PШ\"-ҭrTDf>pѭ .(ЭHx/ /N)0 `"-ҭ zT`/ N "X`=|`Hx"CHiHnh(<)0"DN=Rb=|Hx CHhHn"DN=j`r€zgzgr// / HnHn`N2&HJgRpgp(( D(hJg:B,d)y>TD lo 9:jRL,/Hl`NPJ,f*,g / / N~P ,gvJ.Oj)@. g f2/9>PNBrӨT*(Pۀ!EP/9>PN*P.Og ,k l/ hNX"nPJg$-nX@g 9>TR@p-@@ ?HcB@:, EfpFLrfJg .Thk l fJgf~",0frJg tJn)y>Tl)nTh *-lPNBx٨*(ۃ!E٨| (xу!@x"[IӨ&(׀!C/9>PN*/ N , oB/HkXN 蕬 ,Pg"*Jo@)@Ĵc)B *)@)@",j)@)@/E "NX(,0f8HlN X/ NXJg / NeX/ NX` p4fJ:~fNRd( GB0( /N#X*<RJf>/"ENX".LDgA gJHx/*B/ /// N.`"CHi/NPJg(g/ ENXI`/"ENX0*RgR6+DkBm.HnP/.$/.,// /. / HnHn`N\$Jf/ E "N/N`2*RfHx CHhHhN)1 JW`4*Rf C"h WIDgv/9>PNBrӨ$(Հ!B/9>PN*P`~/9>PNBzۨ (ф!@/9>PN*P`HnP/. // /.$/.,/ N=6Jl`$/9>PNBrӨ\*(Xۀ!EX`",HgLJo 9>T/`Hl8N,XJf 9:jRL,/HlNP`"+-k0PNBrӨ((ـ!DӨ*(ۀ!E"[IӨ((ـ!D/9>PN*/ NL (< "J:zg .Xg+f@+g/ DNX/ N/ / N* ,g / NeX/ DN` l@",Tl ?Hc Bh *(Jo".Lg"zʁ-ELR%@HnLHx/ NS .Lr€n fNfFJfr€-ALx/9>PNBrӨ((ـ!D"[IӨ$*( ۀ!E /9>PN*P(|H//*/ N|pٮ<٪HnL// NF+g loJg/ N(H/9>PNBrӨ\&(X׀!CX/9>PN* `zB`h".LvƁg * @ JoT @0JnHJfg)@",j)@",j)@HlN X.OgP ,J:}xgD)@/9>PNBrӨL&(H׀!CH/9>PN*P`Jfjgb *)@(R)@ )@,zB0.\// N.P,gLB0,)@4/ NX.Og/9>PNBrӨ&(׀!C/9>PN*/ N/ N Dp`x`f 0,fX9@d/ NP/BB/ N4 ,Hg*9>T// N?PR ,c\&//N $,pL/9>PNBzۨL (Hф!@H"[IӨT&(P׀!CP/9>PN*(*S)D)j$.Og4", * AJm f", * AJm fb &.Lg P0*g H2, Ag < Ao A f ."ҫ;rXc Bjxȃ-DLpL&< "Jg Z0, @g N @o @ f @/ NX** f Jf lf / / N۞լ * r€-AL/9>PNBzۨ (ф!@"[IӨ$(Հ!B/9>PN*/ N(+g b/ CNX/ N܆/ NP.OgH0, @o> @g8 @o @ f/ N rR X0, @g n ` @g J8f,g / NeX/ CNX l f*+g Jf p4f 9:}gJf/ /.4N`Hx=/ NT`b&9:}Hp Df/(N XJg&9:}D`p DfHhN8XJfB2,(؄ 0=:}Lc LdZ `T9|`.Og * @ Jo0Jo`/9>PNBrӨ&(׀!C"[IӨ$(( ـ!D BrӨ&(׀!C/9>PN*//*/ N|p.Of/E "Nt/ Ne/ N `Jg j f :/9>PNBrӨ,*((ۀ!E("[IӨ4*(0ۀ!E0/9>PN*PB.H`B.H`-j (, ج-D0 . (؂Jo/9>PC-INBrӨL*(Hۀ!EH/9>PN*P"nmB/9>PN"[IӨT*(Pۀ!EP/9>PN*P.Og, l f$ * Jo/ N(H/ N "P`Jf j fp/9>PNBtըd&(`ׁ!C`/9>PN*PD//N $.0 pLP".LJPg0 j ,t&Jn VIÑÐJn)y>Tl)nThDf&* f0,W@ @bЀ0; ENl000pp0p/9>PN"[IӨT*(Pۀ!EP`8p67@HBl/9>PNBzۨ (ф!@/9>PN*/ N`p=`/ NX`PvƁ-C8g>(, fHx**S/B/ /// N / N " LPNBrӨl&(h׀!Ch/9>PN*HlN, Jg &,gBlB8`P *",Jn񪐬0Jn/9>PNBrӨ&(׀!C/9>PN*/ N D/ Np`x`f 0,fX9@d/ Nֈ/BB/ Nl**S)E`0,"9:zJllBR@9@0@g,g. ,B6,L8Jo l/ / PNPJf`~0ll B0,Ѭ4/ Ne` (* g@Ь\j6`` l/ / hN** 0PJo0/9>PNBrӨt$(pՀ!Bp/9>PN*P`-lD&D/9>PNBrӨ|((xـ!Dx"[IӨ((ـ!D/9>PN*PJ@g"n@Hi/ N?P(*0fHlN Xp-@H l/ / h N/ NԲ +AX d/+/N Pr-A8/ N* ,Xg"*Jo@)@Ķc)C *)@"Jo)@",j)@",j)@0, @grn @g @g-nH8` ,Hg"*LJo"9>T/`Hl8N,XJf 9:jRL,/HlNPBH` ,oB//N 藬 ,Pc(.D؀)D`B` @ fX 9:jRL,Ѐ/HlN`J8g,+g./ N V",Xg 9:jRL/HlNP9| `J8g9| / NL 9:jRL,Ѐ/HlN/ N V`J8g/ N`Jf<&,f2c,/9>PNBzۨ (ф!@/9>PN*P)F)j)j\b r-A8`)F\`Ъ"$Jo*)@$SЫ '@Tfk@/ N J,`Xje+f/.@N Jft`JgRHxBԪ/`Jg`$/,O/ n P(gnp'eLHx(/N #\PJf:/9>PNBtը (с!@/9>PN*P <$.N^NuHxHxHx/Nr`/."n //N@ `Nq/,O nB@ @#bF$hB@FN^Nu/,O/ /$n *PЪT$HjN,XJg Hy+4NK. *Xd$0jL0(2Lpxl*d.B0*-@d-BJg"n )∰d.օmlB0*g2l,"*4L@Lc"%A4"*8L@Lc"%A85G-j0-j j (rgtgbBJ:zg j L9:z"*4Јd %@48-Kr-A *f&.B@ @#bF$"* gB@F/ N&*@XJgXm*|gB$-B*g *0j / NX,*&j ***4d*0jB0p2+B*gJjln-FBBBJ*gJf"ndpȀz`Jg$9:}v(`$`j-1fx~f/+N XJf`rfBJfZJfT fJHxHkHnN)0 Jf&/.N XJfB`h-1fpf$-D`v$<Jgh`B`FHh8K&!NXJf jvfHh8NXJgB`l"hHBBvFƩ |8ܪ//N&! jPpf Hh8NXJf&"g -D`Hh8N&!`VD"hH&) p8Ъ//N&!PJfBB"$f`V&.fz 9>TDeh$9:}H jxf/(N XJg$9:}D` j|fHhN8XJf"*4 Ld &փ"0-:}Lc"`B`A%A`"-G`N-GK`BHn/ Nz-HPg"* *4d jB"n$) j")"BJo "AJlH$d$ *,-F l"F±dЈ$J^ID-@` Hj8N BjXJf$,*gJjm *cd$rȁJn\f-y:zf-l ,djB*,"ld n̑l*"EJgNl,f".g*g .ЂdnJ*fh *\∴d^ *0kTJfNJoB*e CpF@稳d ,*, jB"&&A"桲l&.փl Ѐmxvg|gBfBA,*pwF fdp&@DgZr„pggJC8" |†UfR r(eb|  9>Tp!@!jhJ@g* & Jgt, B"n r&@pfGhr(eF&TT@*|gS!jC !j@| jJf C& gRr)f/ NXx5Jg"n*g/ Hy/9:}HjN L<`N^Nu` *4ЪԐjBotȂ$J:zfjoJg ctFB"LnȔ^ID|Ȇ-Cr-A``c$|ȆJlpȀJf.HjN Bj%jHj8N,PJf / NeXJ:zf-nBBJg"*Ҭ"n )ЂjpȀ-l ,eJf*B"*pvƄfz * jJnj g"*0JoG/ K,NXJfHj8NXJf 9:jRL*// NP/ NXB`h`B,g ,"*,rLhbx"l,rLhbd"9:zcX jɺeH/ й:zd /HlXN B Jf$l`$.`@-nB`CB`B`Jg:HjG,NXJf&Hj8NXJfBj/ NeX`r(-A`&v<-C`/*N Ĭ&H%j XJg (H/./N>5@/*/ N  *Dk||2*6KCAgBgg6,<*f-FvAJ:}gT|T`B`tvA`R`,g%@@`ȑ`"nR`"C`S ("P"ҨpЁ#@ h ``R|)gBf/ N".҃-AXAJgx/9>PNXJ*g|fBrӨ,(݀!F/9>PN*HxHxN b&H Jg6 .й? oHx/N P+f/ N "X/9>PNBx٨4,(0݃!F0/9>PN*/*N B`$-B[I-@"j0Jl0RBrӨ,(݀!F .".Ө,(݀!F`"BrӨ,(݀!F .".Ө,(݀!F` 9?ѫ'nJgJg *"Ҫg%l .%@`(Ъ`Jf Hy+4+NK. (m%A%P"* jn%n%B +g f"kH|Le~ )PЩ\"knl,.ܫ////N &ի .ЂfpB rg6|gRCBK`("k `B`Hx///N +<&f`/9>PNX*gpBrӨ,(݀!F/9>PN*HxHxN b&H Jg .й? cxHx/N P+fb/ N "XB`CgBrӨ,(݀!F` *JoBrӨ,(݀!F`hBrӨ,(݀!F`R 9?ѫ'n`*kCB jJf$Hy2 Hy+4?NK.-k2|(` (l/./Hy2 Hy+4ONK. +"(/.//-IN)0 "n jf(J:}xg *g8*SAJg|?F*g0Jo$ *0kJ*grg /9>P-INBrӨ\,(X݀!FX/9>PN*P|"n *grF%@*gp@*gJg n (#@Ђ!@#j Jg(/HnHi-IN)0pЃ"n D ,䈺llBB*e j, pF@㨺l *o* 3@fR *JoF cpF@3@) pg0rgxJ*f"*fv֊Jf Ъ%@ @0Jo%@0JHf%y>TH%AL/9>PNBrӨ4((0ـ!D0/9>PN*/N, Jf jf`JfJgHj8N,XJfBj/ NeX`np?Fy:}`B`*B`Hpg #j`ZHj8-IN,X"nJf#j0`8%j`p'@0Jg'n4'|,`r'A, ЂgBB0)ր o3C`p'@0Jg'n4'|,`nr`Hj8N,XJg` Ъ"0Joz%@0`t&R%C`J/N,X`/N,XJfL"j0gx8HrHN,XJgHrHN BjX 9:jRL*//NP&.ւ'C(pgrgx/`0;C&+( j (xfh j(@ jrf"(h/BJVIDx 8,D0D,//.// N(Jgp7gN~Agp2gr@f jo5Db``rf~B/N\@FP`f"n|pf/*N"n@Xp"n̍ jpg2BB/B2,A0A//.// NP~(`HB` (`ʶc%C/9>PNBrӨ$(Հ!BX*gӨD&(@׀!C@/9>PN*XJoڪ ,Jo%E,%j t *f(xȀ%DJg8 2gdSf\` |̀%FHjN X`x/`px`jx(`d/,OH 0$n"n $) SS:} &i )Jg('@ i / Hy>`N P B L N^Nu%@`/,OH8$n(n &n *:}(mA LN^Nu 9:} :}$lHxHy>`NPJgRR:} !L !nC Jg"(k !L g)I'H !K`%I`B &j!K&%I`|/,OHxBHy+4[BBBHxHy>`Nz N^Nu/,O n . (g!@Ю!@(|N^NuNVH?<$n(n $.*g, g Ufx lJ:}$gJ:}(g ,,*"k.*0 @JnJg,&nTBK)0Hx/ HnNHxHkHnN". Jo> Jn6"n j, A Jg*S-E((* k4--`SSRPm&jKB,<{fL/ / N&HP *"jB/// "FN&HJgT *kRP`@& +"Jn '@`Jm'D +"k '@&k `jZ JoP/ /// NJg"+ "AJo !@'D +"k '@&H`H/,OH 0$n n ($*"Jo$ jG*Jg( (Jn // NP` j (j!BL N^Nu/,O/ / $nG *f $n&nN^Nu// NP`/,O/ $n"n *f A $_N^NuB jJg ("j"kБ"`Б" h `/,O/ /"n iJg )")$k$$_N^NuJm$$@Jl#B`$H h $JfJm#A`/,O n(g (|Ш grlpN^NuB`/,O/ / $n/*0/*Hy+4fGDrN/*/*Hy+4~N/*Hy+4N$j Jf $n&nN^Nu/*/*/Hy+4N$j `/,O/ / $n"n j$j(0( @fGpdp3fr$n&nN^Nu @n` hoXJhbgR5IHHjNP *4XgHxHj/ N *4gHxHjX/ N `1Ib`/,OH8<&n$. $kJg/ K ĬNXJgfI (7f/ /N// N / NJgZ$(`&(d g&"9:}H(؄ 0:}Lc Ld %@4/ /NP *%@%@-JL<N^`L<N^Nu/,OH8<&n$. $kJg/ K&NXJgfI<(7f/ /N// Nj/ NJgZ$(`&(d g&"9:}H(؄ 0:}Lc Ld %@4/ /NP *%@%@-JL<N^`L<N^Nu/,OBHxHy>/9;cPNgbBN^Nu/,O nB@ @#bF$hB@FN^Nu/,O nB@ @#bF$"( g B@FBN^NuA!AB@Fp`/,O/ /tԮ й?E( cHy+4NK.//Hy?N 9?e y:zgHz Hy:zNP$.$nN^Nu/,OHzN HxNlPN^Nu/,OH0<$. B$h rgvgTG K L< N^Nu *rg2vfJfJf fJfJf f8|`Jg8|( B&hJg Ag4/ N ""BBHxHxN b&H JgjA'H'H( +/+B/N( kK"B  rg*tg:b;j`BB+|P Bm`p k (k| 9| *vfX)j )j ,", $v BA"$҂Ё"Ё o;@`\rfHxHjHl $<)0"BNHxHjHl"BN`p(k|9|HxHjHl$<)0"BNHxHjHl"BN *"(J:~g(N `B2** f* fB0*B4* @0*0*0*0*0*ЈҀ* ff* flB4*B0*"BA0*0*0*0*ЈЁ"t` f* gnB0*Ҁ`b f* gB0*Ҁ`NVH?<&n(n ,.*n-n-n*. JgDg k h( (&(d|$("(dpl$JfJg l gP fp-@v(HxHxN b$HPJg Hx/N P*f/ N Xp7`dB`r-Av` *й?%@/,/,/N)0 *jpf-M2|Iz#n#n) @ fJgB+e otFB3Bp t(؃%D%D(B E Bipf|Hx B/.-IN(*n;B "nBi// -IN&|"n3@C;By:zcJfAB-KB-@-HB -JLXN HxBHy+4BBBHx Hy>Nz,N|N@NzNNTN5nN|BHx`NL#>PNNBN^Nu/,OH><$.&n HxHy>N$HPJgHx Hy:z/N)0BA%HBA%H$BA%HBI&<2*  ( KL,<Hx/ N/ C/&/ FN(fIHx/ NPpgJpg|/GNHj8NHj`NHjN/ N/ Hy>N PE J L<|N^Nuy:zc'J%K 9:zP%@ 9>TS%@pHy>/ NP`/ N@'J%KXp`/,OH<&nBI "K5$kJfB L<N^Nu R *Jg2!@ j j *Jg"!@ j /*N/ NPp`'@`'@`NVH?<$n&j(k(K8"* 0 ,ЁkA/ /N&!/ N2/ NF/ N/ NN/ N/ N * g/N BXj B/ N V/ N D/9>PNB~ߨ, ((ц!@(/9>PN*G$ KXI/9?|/ N/ N( f$ /9?|/N/N/ Hy>N PABLP"BNBrӨ$(Հ!B/9>PN pP"BNBrӨ$$( Հ!B /9>PNP`ABL<N^Nu/,Op#>N^Nu/,OH0XXGIFKJf/9?|N6XL< N^Nu$*gF/NXJgPNBrӨ&(׀!C/9>PN*P/NX$j`/,OJ>g N&B>N^NuNVH8<$n*n (n -fn fhpebvg\Apd0vgpgPJ2p2"jg8Jg@&(, &lJg60|"C(c"pf B/ NwbPABL<N^NutԎHxB/N(/Hx//N &B2.B0.vf4BB/Hk/HmHy>XNNJVID// Nwb$`HyB/ // // Hy>XN Jf^J>gT2p2"j c 3f8// / N `$ <jG2/B/ B/ B/ Hy>XN ` <` <`/,O n hJgB0(!@4BxN^NuNVHxBHnN(=|Hx/.HnN)0Hz^BHxBHy2BHnHy>XN8N^NuNV/ HyvHx(/.Hy>XN E/ HnN/ N$nN^Nu/,O n . Jf J:}@gXB`rg rg,BJ:}@gT 9:}c N^Nu"(DJ:}@g*0|`"(DJ:}@g40|(cƒ`rfB 9>c"`A`rfB 9>c"`/,OH <(n lpf&h(/N Ĭ$HXJ:}gv l f> 9:}fp)@"9:jR <LA jR",′d )@ ltfJ&h(/N&$HXJ:}gJ*lHxHy2LHmN)1 Jf 9:}fp)@"9:jR <LA jR l‱d )@9|L,/Hl`NPJg *p"*t$g AB0,c,A"L@/ L"9;rXd"/HkN B /,/ N PL<N^NuJ:}g 9:}fp`/(N XJf 9:} fp<`EG`J:}g 9:}fp`HmN8XJf 9:} fp<` k`0/,OH00$n/*N Ĭ&HXJgJPf (gBBv@ƨ\"g"L| te|v%CX$L|(= %BP +"+&gvHxzB//N(%AT Ё%@"*Xc%A c%|/*/ N PL N^Nu b%AX`|%|X`p"`NVH 0$.=n=nJ:}g y:zgHzHy:zNPE/ N(P//./ G(NHxHn/ N//. / N(HxHn/ NHxHy>/ N/ E/ N(&-R .й:zL N^NuN -@`/,O n h (Crf$HxB0(`/0(b/HhHhNN^NurfHxB0(`/0(b/HhHh`Hy+4NK./,O n ( gBN^Nup `/,OH08$n&. j(h(/N Ĭ&H$9:}XJg$ b$<5B/ N X jpf /NؔX jvf /Nf"XJgF +x"+|&g("AcV$5A +"+&g*Ԃc$%B8`"lc,$ 5I`"lc5I-j -KL N^`(C( LB/ L"9;rXd"/HlXN B5B Jf|`/,O"n rg&rg&A ) g N^Nu0|`0|(` `NVH < n*n $n -f. f&pe(p2trgCpdrfDJfJg <` @fr€IK/ Hj $< BNG/ Hj BNBB0//* 0,//*Hy>XN (Jf(BBB0// 0,// Hy>XNNJgX&hJgP(l kD 0Jn:B4*d./ NRX"+Ы̴e(A'A/*HjN PABL<N^Nug* +Ԑk'LB0*'@7j2A7A`A@'A`pgJgJg < @fr€GHy/ B0//* 0+//-Hy>XN (JfTJ>gJApdr3f8HxBHnN(=|=S-j / / HnN` < // /-Hy>XN `/,O//$./9>PN Btհ&0ׁ!X-y>P$.&.N^`e/,OH,$.*.(. /9>PN ۰"0ӄ!X-y>PL4N^`e/,O/ n$P (C>JgJ%@$h$B$hJg%h$h$p L(\SqHhN S>X$nN^Nur L(\#`/,O/ $n *g /N XHj0N&"jP/ NPJfHx/ NP$nN^Nu/,O nB0(rL0 2L!ArL0 2L  c4pF!@/Hz^ 9:jRL(/HhNN^Nurcp`NVH?<$n*m gd f t(68D+@Cp`n Јr€Uf| "9>Th#A#jd x Є`T @`B" Ҁf<FAB>'G('GpҀ *gJg n (0kx-@ /9>PC-INBrӨL((Hـ!DH/9>P(<* DN*mP"n gj gn/9>PNBrӨ\((Xـ!DX/9>PN*P*m gD gvt0Ԋ*j*m g gHy26Hy+4` E(``0C E1@Bm//Hx/ N&܀;@ E1Fy:zc`C9FBm//Hx/ N;@`9F`Jg*m/ BJ:zPVIr D///*/ NLPNBrӨ,&((׀!C(/9>PNP/N/ Hy>N P `r"y>P j gz&*֪%C 9:jR(9:}"<L@d"cH/ NBrӨ$$( Հ!B /9>PN/ NRj/ N|-y?|L N^`u@/ NBrӨ&(׀!C/9>PN/ N| * g /N XHj0N&"X`/,OB@ @ bF!N^Nu/,O .B@FN^Nu/,OH8<(n&n ,B g g L|%p LH n"> N&$pI>K)1Jg6`fB// HjlN JfB// HjN Jfx/NXX J L<N^Nu4+pB0,Ԁ"9> ,"9>L(`T4+pB0,Ԁ"9> ,","9>L(`$R`J/,OHxBHy+5 BBBHxHy>NzA> BB!HR %fN^Nu/,OH?<&n$n J>fI N#>N#>+m g g0B'@`L|%'B\N(&I>~ L(K(B0-*<(<*:}m$/9>P"ENBrӨ,(݀!F/9>P DN,4(/N /NBBk/ N j'HXgC!I%K'JBA"P'I" RlR>/9>P"ENBrӨ$(Հ!B/9>P DNP-CL"+p,9>L`B0+~B2+nЁ"9>"+t$+,9>L`"y>:}e , /9>P"ENBrӨ.(߀!G/9>P DNPJ)>fA f"F*Q/ N/ NDP`>DeA>Jf `,`/,OH0<&nNJ$$kIKJfB-BL< N^`:&*/ N/ NP$C`NVH?<(n$. (.*n.<B GN*Hn// N $H &<XJf/"CNX J LP"FNBrӨ$(Հ!B/9>P EN`( +rf@ B'h7hb/ N 'HhHx/ N ~ Jhf<'jhB`.rf&HxBHkN(7|Hx BHhHkN)0"B7ib kp "D i +dJ(fj@'@dHx/ N ~P`@`pfHx BHhHkN)0"B7ibHx/ N ~`~tf8tԎB// /N)0 ,f // N,PB// N ` *)@ "*)A()@)@)@)@)@0)@)@ R)@ )@,9| 9:jRL,/Hl`KN/9>P"FNBrӨ $(Հ!B/9>P EN*gJ:}gl*gJ:}xg9jB0*// N.PJjgB0,)@4/ N *)@R)@$)l , R)@)@0 9:jRL,/HlN *X oЬ ",Jo)@,)l t)|/9>P"FNBrӨ$(Հ!B/9>P EN"GN$/ N/ CN$n`$9:}Hpf/+N XJg$9:}D`rfHkN8XJfB2,(؄ 0-:}Lc Ld `Hx"n/)B/ / / BN JgbHx/.N /.N }/9?|N`6NVH00$n&. &nN$Hn// N$H Jf-BL N^` +f/N/9>PNBrӨ&(׀!C/9>PN*/ NX`NVH00$n&. &nNr$Hn// N$H Jf-BL N^``&kf0(g hb @5@`/Nt/9>PNBrӨ&(׀!C/9>PN*/ N`NVH?<&n(n n(.". "h.) ("hdd$( hdXl$JgNp_FJ:}fB-@=|/.(/.//./.$/HnN=6JlBLPINBrӨ $(Հ!B/9>PG*NPJg *g /N X%C%n\d/N "/ NLPJf2/9>PNBrӨ$(Հ!BӨ$(Հ!B/9>PNPp`(B`J,<B FN*HxHy>N*H/Np JfJg/N X`HxB/ N(HxHmNLB// Hml*<)0"ENB./ Hm"ENBm+C"n+i+ gX g|"n(;i B-m D(gB0( /N#$HX// N>;@P otFB+BX 9>TS+@h+n\d . fmp`r`f&.[B y;rXzFE- bB$窱b.gJ:}gm"n )? cJ:}xgm+G/N "/ N`PGE*Jf/9>PNBrӨ$(Հ!BӨ$(Հ!B/9>PN// N`HxB0+/0,/HkHlN+@`HxB0+/0,/HkHl`R@`P` FN$/ N*/ N/N/9>PNBrӨ$(Հ!B/9>PN`TNVH <$n/9?|NX*g-y?|L<N^`eG/ NXJg"*g jJg *ԐkvB4*jlA%A=j=j0*#:y/9:yHnN HyvHx(/9:yHy>XN /9?|N6L<N^Nu/ NN%j0*R@5@XKI* @ oD5| /9>PNBrӨL$(HՀ!BH/9>PN0*bPfp<0@// NTP`/9>PNBrӨT$(PՀ!BP/9>PN"*X *PЪTPc 0jL02Lc %@ c%| 9:jRL*// NPJg0 jo(/9>PNBrӨ$(Հ!B/9>PNBP jo/*N  *PѪTBPX%j%j0BH jfj j/ hN/ Ne`/,OH 0$n/9?|NX*g-y?|L N^`cTD:}dЂ䀳c L<b6/9>PNBrӨ|$(xՀ!Bx/9>PNHxPNBrӨ\$(XՀ!BX/9>PN/ Ne|/ NeB*`/,OH <$n/9?|NX*g-y?|L<N^`b6K`/ NXJg/9>PINBrӨd$(`Հ!B`/9>PG*N0*P @o j h((g @n~ *g"9>TDЪ찁cz/9>PNBrӨl$(hՀ!Bh/9>PNB *S//* BB/*/ N $ 9:jRL*// NP` 9:jRL*`/9>PNBtըt (pс!@p/9>PNHxTDb 9:jRL*//NP`/ NX`z/,O/9?|NN "9:zҀ#:zR>T/9?|N6 9:jR/Hy>DNN^Nu/,O/J:}f #:}J:}f #8@:}J:}f #:}J:}fp#:}J:}f #8@:}J:}f 9:tLB#:}$N^Nu/,OHxHy>DNLBHzHxHy>DNN^Nu/,O/ $n/9?|N * XUg-y?|$nN^`_HjNXJgp/ NeX`/,O/ / $nHjG NHj8NHj`N -J$n&nN^`:/,O nJgp-N^Nup`/,OBN^Nu/,OH0<&n$n $*"9:jR <LA"*LBd L%@I`/ K N$ /N2*6UCP 9:A jR CbBL*// NP j fJ"*gD 9:jRL-@ -BL< N^`9x+g AnL*`L*`L< N^NuNVH 0$.&n(E r$@ k4-PHx`/ /N)0A%H4p%@D/ /.$/. /.//././. /.N0JfJg".t e k4 L N^Nup`NV`H?<&n(n wr€$A y:,/(NѬXp fJgz f rf"n*,+ (,-ld& n(&h4/9?|N&SX-n`BJfHJf2"n"/9?|N6XI`Fpfp&,-ld,<BB`fvBB/+(HxBh-|lHx/.h"n$/)NARJf@HxB/ N(%C%nd pg&rgB cJn&k`2(k(*l m%P%U l0h%H %kd$8l%L(%k ,pdf k2h%I0%h4JgpB%K%k B%k(B k(%hPN%N^NuNV/ /$. $ngF n (Pg8/N4-@ rdp//HnNJg$.$nN^Nup`p$B`NVH8 $.&.$n (.$B/././. /.Hy>XN Jg|"h(JgtJgX&(gj)fbB// HxB-|Hx/./*NAR$fHx5/NTP LN^Nu-C-B -ILN^`t`NVH?< n"n (.&n .".(n$$vƂ$C*(t!WIDf&Jgt LXNN Jg~"h(Jgvt!f^&(gj)fbB// HxB-|Hx/./,NAR$fHx5/NTP/9?|N6X`/ // N$ `t`JfJf gnJfJf WIDf/ KtNHjNP f/9?|N// / /B0*//*0*//*`Jft`t`~t `xt+`rNVH0 &.$n(tԎpĀHx`/ /N)0 j4-PC B!I4//.$/. /.//././. /.N$0fLJgH".gN 9:jR&<L@8e4/9?|N j4 NT/9?|N6P L N^Nut`NV//&.tԎpĀ-y:}Hx`/.(/N)0C B!I4//.$/. /.//././. /.N$0f4Jg0 .rl4#:}/9?|NNT/9?|N6P $.&.N^Nut`NVH0 &.$n(tԎpĀ j4-PHx`/ /N)0C B!I4//.$/. /.//././. /.N$0f0Jg, .k2 j4 /9?|NNT/9?|N6P L N^Nut`NVH00&.E r$@Hx Hy>G/ N(ydHx`/.(/ N)0%K4p %@D/ /.$/. /.//././. /.N$/ N($ Jg(/9?|N/ BN$/9?|N6 L |N^Nu/,O n h h rg rgp/N^NuN^`߈N^`քNVH08$.Hx/HxBBBBB/.BB/. HxHxBBBBEN@HxHx/HxBBBBB/.BHy+5/.HxHxBBBBNDHxHxHx/HxBHy:}BBB/.HzHy+5&Hy+5DHxHxpBBBBNHHxHxHx/HxBHy:}BBB/.BHy+5LHy+&HxHxpBBBBNHHxHxHx/HxBHy:}BBB/.BHy+5iHy+' HxHxpBBBBNHHxHxHx/HxBHy:}BBB/.HzHy+5Hy+5HxHxpBBBBNHHxHxHx/HxBHy:}BBB/.BHy+5Hy+5HxHxpBBBBNHHxHx"Hx/HxBHy:zBBB/.BHy+5Hy+5HxHxpBBBBNHHxHxHx/HxBHy:}BBB/.BHy+5Hy+64HxHxpBBBBNHHxHxHx/HxBHy:}BBB/.BHy+6DHy+6HxHxpBBBBNHHxHxHx/HxBHy:}HBBB/.HzHy+6Hy+6HxHxpBBBBNHHxHx Hx/HxBHy:}@BBB/.BHy+6Hy+6HxHxpBBBBNHHxHx Hx/HxBBBBB/.BHy+6Hy+7$HxHxG/ BBBNHHxHxHx/HxBBBBB/.BHy+7)Hy+7@HxHxI/ BBBNHHxHxBHy>lBBB/.BHy+7HHy,]HxHxB/ BBNHy+7Hy+7HxHxpBBBBNHHxHxHx/HxBHy:zBBB/.BHy+7Hy+8HxHxpBBBBNHHxHxHx/HxBHy:zBBB/.BHy+8#Hy+8_HxHxpBBBBNHHxHxHx/HxBHy:}|BBB/.BHy+8mHy+8HxHxpBBBBNHHxHxHx/HxBHy:}BBB/.HzHy+8Hy+8HxHxpBBBBNHHxHxHx/HxBHy:}BBB/.HzRHy+8Hy+9HxHxpBBBBNHHxHxHx/HxBHy:}BBB/.HzHy+9!Hy+9DHxHxpBBBBNHHxHxHx/HxBBB-|Hx/.BHy+9LHy+9gHxHx BBBBNHHxHxHx/HxBHy>HBBB/.BHy+9nHy+9HxHxpBBBBNHHxHxHx/HxBHy:}XBBB/.Hy&Hy+:Hy+3?HxHxBBBBNHHxHxHx/HxBHy:}BBB/.HzNHy+:Hy+:HxHxpBBBBNHHxHxHx/HxBHy:zBBB/.BHy+:Hy+;HxHxpBBBBNHHxHxHx/HxBHy:zBBB/.BHy+; Hy+;RHxHxpBBBBNHHxHxHx/HxBHy:zBBB/.BHy+;^Hy+;HxHxpBBBBNHHxHxHx/HxBHy:zBBB/.BHy+;Hy+;HxHxpBBBBNHHxHxHx/HxBHy:zBBB/.BHy+;Hy+;HxHxpBBBBNHHxHxHx/HxBHy:zBBB/.BHy+< Hy+<,HxHxpBBBBNHHxHxHx/HxBBBBB/.BHy+<8Hy,tHxHxI/ BBBNHHxHxBHy:}xBBB/.BHy+Hy+>>HxHxpBBBBNHHxHxHx/HxBBBBB/.BHy+>GHy+>oHxHxG/ BBBNHHxHxBHy:}0BBB/.BHy+>sHy*HxHxpB/ BBNHy+>HxHxpB/ BBNHy+>HxHx&Q/BBBNHHxHxBHy:}BBB/.BHy+>Hy*HxHxpB/BBNX/ N $PfT(*//NPJfR4*0@5@/N DBjXt7`/9:}/9:}/ N B$ g/ND LJkbgJ/// N JfJfDJf< f0v$/ N%HXg""9;rXzFE*f bB&髲b*/ N /9>PNBrӨ&׀ /9>PN*5| 9:jRL*/Hj`N/ N%@ %@%@%@%@%@0%@%@/ Ne`XN l/N /Hy>XN B`/Hy>XN¤/N/Hy>XN`/,O// n hJg.&(N$Hx5/NT/N B$.&.N^Nup`/,OH8$n(n jJg2&hNAJTf*g*f +`g/NXpLN^Nuf /NXp#`r)A"la.f +`j/NXB`/,ON^`NVH><(.*n (n&T$, m h*N& mEJf/NXp6L<|N^Nupg>rg|g$B/-@NX .`/ / /N `/ / /N@2`&hJgSfSre^Ԃ0;(NBtRJHn/ N DPJf +Jg x'D`x|̀'F`lHn/ N DPJfZ .np`NB2+m7@`:HxHn / N  Jf"". g 9:jR$<L@(e'A/ / NזP`HxHn / N  Jf". g| 9:jR$<L@(e`'A`HxHn / N  Jf". g8 9:jR$<L@(e'A`jHxHn / N  JfL". g 9:jR$<L@(e'A`$SpeԂ0;(N(0p-@HxHn`\B0+`$HxB/N(k +" f| g.r`€x`f.+e+d Dg.,+L9h:-FNE"(9:DL-@H*[I"+P[IK(4////N|쉀-@X"+T[I////Nxꉀ-@\-k8`B0+"+4L@-Ad"+L@-Ax-kt-k B|-k-@$-@( +-@-@8@-k-kHx// N 6` +` +`| +`t +`lp*`X/,O/ $n0* @n @n4c Jf` @g.Jf2E J $nN^NuBj/ N$HX`5|`5|` jo j ((g /N VX0* @ f&"*g 9:jRL/HjNP` @ f jpg2 jpfh9:|g\/ HxNPJgH`@9:}g8/ HxNPJg`/,OH 0$n j&h( jnL N^`J+j"JkfB/ NT$P B L N^Nu/ N HkN / N$ g/NeX`/,O// n hJg(&(N\$/N/NbPB$.&.N^Nup`/,O// n hJg&&(N$/NX-B$.&.N^`$.&.N^Nu/,OH0 $n jJgD$(N&/ N /NPJg /Ne$X/NX L N^NuB`t`NVH?0&n..$n(tԎpĀJ f +rgrgpL tN^Nu*9:yL,9:yH&9:yD(9:y@Hx`/ /N)0 j4-PC B!I4//.$/. /.//./.B/ N0JfJg". btԪ~evԂ0{(NHbjjjjjjjjjjjjjjjHbj*9:~,9:~&9:~(9:~`Ho o j4 ` m`o Ac`춁m`/,O/ Hy+@(Hy++HxENHy+@,Hy+@1HxN$nN^NuNq/,O/ nB2("h (4d LAtcpL!@8!h0!@4 (g!@$N^Nu/,O/ nB2("h (4d LAtcp!A4L!A8!|Bx (g!@$N^Nu/,O// n"(44(B0&(8J:}0gb"n "ib6xc&!IxBB(dЁrFA婰d"!A4$&N^Nu!Ix`J:},g $(0fЀd `b LA`/,O nJhlN^`ZN^Nu/,O/ / B9>l$y:}G(yJf $n&nN^NuHxwHjHy>lN JgHxwHy+Hy>lN $R`/,O/ /$n$*BjHjN BHXB0*Ae*g&5y:z%j%@4/ NXB$.$nN^Nu"n %i%@4/ NB0*2*HLЪ8%@4 XJo%B`/,O//$.&. /NX-C -B$.&.N^`:/,O n"n )kN^`BhpN^NuNVH08$n&n 2*jBjL N^Nu + @Jl&*$*4BRA5AHjN BHXB0*Ie"+*gNL@pegXJ fR R *Jg<(n*. JgJWID&y:}BBEK)/`JgJgZJfHk/NPJfJgHy>NXJgS )kR Hy>N6XBL<|N^Nut`, $K&C *f&JfHj/N)/`PJg2, t & $F&@`hJfHj/NPJg8$RJfp`&C`f&J``#>Hx HkHy>N(yd `rB&Jx`, $K&C`/,OH 0$.$y:}G)/`JfbHxHxNT$HHx /HhN(yd%n B y:}%H #:}N:}f /BNPBL N^NuHj/NPJg$R`p`/,O/ BHxHy>N{4Hy2Hy+@:ENHy2Hy+@7NHy2Hy+@?N .+@7BNP$nN^Nu/,O"n y:}Jg (fS N^Nu P`/,O . y:}Jg f  N^Nu P`Nq/,O n g  n h N^NuA`/,O . g nRN^NuB`/,O/ n"n ")")") ""("("( B2.B4.҂Ё$N^Nu/,O/B0. "t 婱 爳"Ҁ 鈳"tҀ t娳"Ё$N^Nu/,O/ / $n&n Jg /* / N6P"&%K RS$n&nN^Nu/,O n(%g VDN^NuB`/,O n . (%c h($j"(b0 b*N^Nug"(b bL<.`p`/,OH8"n&. )%c"i  )$x?ȁ$骄f:tg4Jl") Ae" b LN^Nug ")tXL`A`/,O/$<>@Hx$B/N( J>gNHx/./N)0# >P JVD>T#>>XBrӹ>$9>Հ#>A>@ $.N^Nu/,O/ /E>dHx$B/ N( J>0g>$# >tJVD>x#>0>|Brӹ>$9>Հ#>A>d $.$nN^Nu/,O .rlUg 9:}f p` 9:} gN^Nu 9:}fp`p<`/,OH0 ". n J:}g 9:}fpl 9:}fpmtpg~vfE>A> hJgH jJg@J:|f.p#:| 9:vLC/Hy>N#:}>|Pp(L(A( L N^NuB`t`t`~E>0A>`A`NVH?<(n&n *lJf&BHx@B/ N( $LL.9>H߀#>HR F 0\"0]2// NpP$HJg/NXJg.*//NP鈀fp2.j0fdBrӹ>,$9>(Հ#>(RE9E -nB(.*. 9>h"9>lc#>h#>l-nB".$.(9>x*9>|c#>x#>|-CB".$.&9>(9>c#>#>Jg(lHx@B/ N( Jg ,%b *?%c%x(L+$?E$&8'j47j2 7j0"'J8'L<%@$%@$'j 4'j,'j0'j((`Brӹ>\.9>X߀#>XRR`BBrӹ><$9>8Հ#>8E`z/,OH<< .rg&xfE>I>JgBL<0I>`$9:|rLA(x L(r LA(J*$lNz@HxHxGN&(Hx/N*HHxL9X:|/N&H)C)M)C )|KH)MBԂ)B$<$d$9:|%KJ*$l Ћ%@ %K%B%Jp $p%@ (S"* *$6*ʄgҁx%D R6@$$(rLA (9:}I(vK)0*SHx(/ / N0%)K)K Bnl)K J*$l@ c&j)BR(pf`vzX`/ / BNP`pXLA%H ` %A S6@$`*Jg0%J*$l@ c&jR`nX`X`tp/`NVH?< . $.$n=@=B(y>0Jf"Hx@B/ N( $L*9>ۃ#>".ҮЁԀ  l&p BBBJg Sc64RBJfJ fBBtչ>4&9>0ׁ#>0K`Brӹ>T*9>Pۀ#>PRR`pgp"ƒg챃RBrӹ>D*9>@ۀ#>@ 3|"0}2/Hy>0N&P*HJg/NXJg*-/ / NP鈀fn*.8fb".4fV:.m2fJ2.m0f>Bv׹>$*9> ۂ#> -FB$.&. 9>`"9>dc#>`#>d-nB$.&. 9>p"9>tc#>p#>t-DB".$.&9>(9>c#>#>Hx@B/ N( Jg"<>0 9>Ub -?%c%x(L>0*$?E$$8%m45m2 5m0"%M8%A<%@$%@$%m 4%m,%m0%m((`H/ / NP&H`NVH?< . ".$n=@=ABv׹>(9>ق#>(y>Jf"Hx@B/ N( $L4&9>0ׁ#>0K`Brӹ>T,9>P݀#>PRR`pgp"ƒg챃RBrӹ>D,9>@݀#>@ 3,"0-2/Hy>NP*HJg/NXJg,-/ / NP鈀fn<.m0fb2.m2fVHx/.HmDA)1-HN A)1Jf.Hx/.Hm4N JfBv׹>$(9> ق#> -GB".$.&9>`(9>dc#>`#>d-nB".$.&9>p(9>tc#>p#>t-EB".$.&9>(9>c#>#>Hx@B/ N( Jg$<> 9>b -?%c %x(L(>*$HxHmD/ G)0NHxHm4HjN5m2 5m0"%M8%B<*$%@$%@$%@$%m 4%m,%m0%m((`/ / NpP&H`HNVH?<(n&n *lJf&BHx@B/ N( $LL.9>H߀#>HR F 0L"0M2// NP$HJg/NlXJg.*//NjP鈀f2.j0fBv׹>,.9>(߂#>(RD9D -EB$.&. 9>h"9>lc#>h#>l-nB$.&. 9>x"9>|c#>x#>|-nB$.&. 9>"9>c#>#>Jg(lHx@B/ N( Jg ,%b *?%c%r(L+$HxHjD/ K)0NHxHj4HkN7j2 7j0"'J8'L<+$%@$%@$%@$'j 4'j,'j0'j((`dBrӹ>\.9>X߀#>XR`Brӹ>\.9>X߀#>XR`BBrӹ><$9>8Հ#>8E`@/,OH><(n$n *%gxBrӹ>$9>Հ#>*T U($j *4Ъ8B2*0ҀB4*2ԁ"*vƁg&m0Dg/ / NP,$r?ʁ"멂 0=2<fbp稱D0D6B< SbF(ȭح D&*C,<@JgfzJg" "/ / NPF U($jB0*0/NX$`g$B0*0/Hj40*2/HjDNH$`B`G`// "FNP"E*`l*<@Jgj// "ENP&gzf`r gf/ / NP"D"`DfZ"*vƁg&m0Dg/ / NP,$r?ʁ"멂 0=2<f|p稱D0D6B< Sb` (- ؀ D$C&<@Jg ,9>݀#>/ / N$mP` .".䒇l`>B`0NԀ/Hrp>NԀ(fJg4 9:tLB/Hy>NP/9?|N6XL N^NuB:|B>|`NVH><$n&. (.Jg**  E&p K<$<vJfJ,*g(j Jg/ / NP%H S%FRB/ / BNP"(  E! &L02.=AA Ac tQ BBSd`fp娀A26 R($p?€ 㨀"0-2',/ / NP鈀L<|N^Nu**`"B/N  E&p P`/,OH08&n$n / / NP$Brӹ>&9>׀#>B0*0/Hj40*2/HjDNX B///IN%@B0*0/Nr.///N%@*% L N^Nu/,OH08&n$n / / NP$Brӹ>&9>׀#>B"*4Ҫ8B0*0 A0*2Hp//IN%@B0*0/Nr.///N%@*% L N^Nu/,OH <&n(n /,/ Nh$Pf BL<N^Nu/N$HXJg!l !l pgpgv/ NL/ NPp`"l!i8!i41i`21ib0 i(% i(A*%@% i( h@%h(/ /NP`&lHxHkHhDK)0NHxHkHj4N5k`25kb0 k(*%@%"k(A@%f@% k( h@%h(/ /N `NVH?<(nE r$@Jg,$j"l8-i-i )%VF&)(<)0>)2&Kg&i4$i8/N.HxN$/N"*H JgN/,8/,.f j4 L N^NuA :}fHxNXJg$`Hx`t`/,OBHy>NLBHznHy>N9>T9@>9>|9@>9>9@>9>9@>,9:}fp:|gHxN&X`HxNXJgN^Nu/,O//". . $v BЈ$ЂҀ Ё o$&N^Nu/,Op-N^Nu/,OBN^Nu/,Op-N^Nu/,Op-N^Nu/,O 9:}//Hy>N HxHNL#>BN^Nu/,O/.(/.$/. /././././. /.Hx /9>N%N^Nu/,OHy+@ENK./,OHy+@ONK./,O/ /. E "N/.Np-$nN^Nu/,ON^`/,O n-hN^`/,O n (4gHxHh/N N^NuNVH 8&nB(kHx/.N .$HPJg ,df 0+@$g/ /*Hn/ N /. / N /./ /.HkN JfP/ E "N/.N/9>NBrӨ4$(0Հ!B0/9>N*/ N LN^Nu/ NX`/,O/ $n j(1nH/*(N j( (4XgHxHhX/N $nN^Nu/,O/ $n/ N BXJg"JgHy>/ N PJg&$nN^Nu/9:}/9:}/ N B Jg` jy:zc`/,OB@ @ bF!N^Nu/,O .B@FN^Nu/,O//&. N$/9?|N/Hy>N l/N /Hy>N /9?|N6/NB$.&.N^Nu/,OH0 $n$*Nd&/./. /N $ f / N DX/NP L N^Nu/,O// n$(N&/./. /N $/N $.&.N^Nu/,O/N$/.N /NB$.N^Nu/,O/N$/. n/(N /NB$.N^Nu/,O/N$/. n/(N /NB$.N^Nu/,OH 0&n$kN\$k/ N \%y>Hx/ N ~/NHBL N^Nu/,Op-N^Nu/,OH00$n$.Jng2&*,B0* /G#Npr XrgLr gUfrBL N^Nu *0J,l$ jB@?Bg/(/( N  g/9>NBrӨ$(Հ!B/9>N*Pp`B0* /NX(1g J:}gr//.Hx/ N&܀JgV`/,O y:}gHzHy:}NPN^NuNV/ HxHxHxBBBBB/.BBHy++HxHxBBBBEN@HxHxHxHxBBBBB/.BHy+@ZHy+@qHxHxBBBBNDHxHxHxHxHxBHy:~BBB/.BHy+@uHy)s_HxHxpBBBBNHHxHxHxHxHxBHy:}BBB/.BHy+@Hy+&HxHxpBBBBNHHxHxHxHxHxBHy:}BBB/.BHy+@Hy+' HxHxpBBBBNHHxHxHxHxHxBHy:}BBB/.BHy+@Hy+1HxHxpBBBBNHHxHxHxHxHxBHy>BBB/.Hy&Hy+@Hy+3?HxHxBBBBNHHxHxHxHxHxBBBBB/.HzfHy+A Hy,liHxHxBBBBNH$nN^`n/,O//$. . n"."nvgvg&p$&N^Nu-I-A=h-@$&N^`(-I-A-H -@$&N^`NVH<<$. /9>INBrӨ&׀ /9>G*N n*h&PPb&E(JfZ/9>NBrӨ $(Հ!B`HnHx//N +~Jg$n Pc Hy+3NK.`Jjg60-2*B8 Ab4/9>NBx٨ (у!@/9>NP/.N "X`"҄g.o/9>NBtը&(ׁ!C`//.N P//?*U/.N(f=R=|-m BB=|=j-mBB*n . f$y>Jf nJgZ*hbXE(Jg - gJfHxBHn*<("EN=|HnHm &< CN=RHxBHn"EN=| HnHm CN=j/HnHnHnHxNЄf 9> n"(g/NBrӨ,$((Հ!B(`VB0- /N#//.N \ JfBB0.//.0.//.Hy>N $HJf/9>NBrӨ<((8ـ!D8/9>NB0.//.Hy>N $HJfhB`~pfR2.jbfH *gf< *gf00.j`f&/*(Hn// N.R j(0(@g$$j` jtJg&/*xHn/*(/HnNrg2Sg(*n m(*e\/*(Hn// Nx`/9>NBtը &(ׁ!C/9>NPL<NBBHxHx/.N ܴB``/,OH 0 n"n $n )fb f\peV 02tGrdTtgnJg:JgftāA(Hz/B0//* 0(//)Hy>N (ABL N^Nu"< ///)Hy>N `"<`NVH80$.&n $n k h(N&pgrg.t//N L N^Nupg(/ / /N$ `rg/ / /N@2`Sf(rdf<&kHn/ N D$Pf .gUgt` +d@'@d` +d@`t*`tNVH8<$n(n &.&n$*(B *f"*fA `& f jHpLer"* hP xd^pЁ%@rӪK "Jgf*gx٪(0|±bXJg&kxHxpBHvHN(/ / HnHvH/Nz&@ Jf/N&j| 'n 'l7lb7l`0P@7@K8XJ:~g@?Bg/+/+ N 7@r%A,x%D0B7Bll/9>NBrӨD$(@Հ!B@/9>N* l(0(@0H-@/ /.// /,h/ N&@ L<pN^NuAH`HxHx/ N "$H `Bk`\6|7/N/ NP`6|(`NVH>0&n(. $.&.,.$kBN*0+@Jgr-jJ@f/// N $ f2/// /N$,$/ N \%nHx/ N ~BB/E "N/N/N L |N^NuJ@g/// /N$,$`t8`t9`/,ON^`./,O//$./9>N Btհ&0ׁ!X-y>$.&.N^`/,OH00$n"n n&j(0+ 2A Ag( @fB&j, *rgvg|p/L N^Nut`p dgR2:yF0:yB6+"BB$n 464PJc20vL(ԮvL҂t LЁЀ n> B`2:yN0:yJ6+ r`*dg2:~0:~6+"Bp`2:~0:~6+ r`p.`PNVH<8$.$n &.(*, *rgrgB` zʂp>$f-jHnHx?Bg/./N JfJ.m*ggDp=BBHn/*(/B-|Hx/./NARJfzpL$fRIHxHj/ N)0&j(0+2A f k( g @B2*.Af| fr////./N JfJ.m*dfXp =BBHn/ /B-|Hx/./NARJWD`B`zp`t//// /N2`p`NVH?8,./.HnHnHnHn/N$&fd$nG JRfN4:.8.RDE>I4NL| A2RAH4 H@4E/./?BgN Jg n 0 LN^NuSGfv`NVH>8,./.HnHnHnHn/N~&fF:.4.RBEG NB8$nLD0A4IF/./B0/N Jg n 0 L|N^NuNLD0A4SBfv`NVH>0,./.HnHnHnHn/N&fH:.8.4RBDN $nB2LA0A4G/./B0/N 2Jg n 0 L |N^NuEg RA4SBfv`2`NVH? ../.HnHnHnHn/NT$fD:.<.6RCFE4 n08FeEd80S@0/./?BgN Jg n 0 LN^NuSCft#`/,O/ $n *rg rgB`Jy>f&J$<>I N6f<.4.RBF/GN:/Nr€(APB>G<2rB2 ҅LG:FRI5/./? BgN JfSBfv LE n8PB2 ҅LG6FRL0/./? BgN Jg n 0 LN^Nu`SBfv`NVH0<&.*n,G r&@HxE2 /2I/ N(ydHx`/.(/ N)0'L4p'@D/ /.$/. /.//././. /.N$$4%| D/ /.$/. /././././. /.N$nN^Nu/,OHy:~/.(/.$/. /././././. /.N|N^NuNV/ E r$@Hx`/.(/N)0%|>$4%| D/ /.$/. /././././. /.N$nN^NuNV8H88E r$@B.8G2B&8I(yHx`//N( pgHx`Hy+/NRP `Hx`/.(/ N)0%C4%DD/ /.$/. /././././. /.NL N^NuNqNVH8<&n n$P*S Tb jJgB(R& ւnJgUI(<pJg԰gB,"@Rn/9>NBtը (с!@/9>N*/ N " `VHnHx/ / N +~Jg< ."Tc Hy+3NK. h`HxL/N S>P$nN^NuNVH?<&n$k&< "x؋$<)0z(ڋ,<r.< f-JLP>#>P>BHxHy:~@N{4 N^NuNVH?<"n$Q"n &-j*j"P-AвbI8Jg-|BHxHmHnN)0BHnHxHnHy>(N&"(g hL-h 0-f/BHx/ NrJg"n i| PBrӨ$(Հ!BHy>(/N&!P&<`2HnHx// N +~Jg(n Pc Hy+3NK.`B`ft Ԁz຀g,gCgHx`H/9>GNBrӨ*(ۀ!E/9>,<* FNPJg"n i| PBrӨ|*(xۀ!Ex:,0@fp/9>NBrӨl$(hՀ!Bh/9> FNPJg"n i| PBrӨ$(Հ!B"n "Hy>(/N&!BP Lc:&y>A-H,<)1~ލ>Pf|0̮Է>PgHgHy:~@N6XJg"n i| PBrӨ$(Հ!B/9>NBrӨ$$( Հ!B /9>N*/ N " `"lf0HxHk/. FN JfHxHk(/"FN JgF&k8`4"9: 9>Jmd@R#>HxHxLN&HPJg !|>P< y>'H8!K<#>'K 'K'l|xHxHmHk.<)0"GNHxHmHk("GNp'@@BD'FHr-AEB<g"+@k҆҂HAJAnHxHx$NPJg| 1mmml ( !F!B!n!JJf(kfL*l gR"-ҭlDHx$/N P`B`V0|'H@TJm±oRHy:~@N6"CHi` o6Hy:~@N6 CHhBHx/ Nr`"҆HAJAo `"kA-HA(-Hijg&) k@or*)-i i !C C!i Hx$/ N "E.)Hx/. GHhN)0Hx/."GHiN)0 "nHiBHx/Nr"C`lm(l`g Ԇn$l !J (j!L)H %HR>RD"k IEfr k J( fn(i*i i !M+i , *< $< &< f^*i$ QHx$/ N APEc/ NX$L`4(K``gHy:~@N6X`h h`h.- m !G G!m F, PJf"- F /-/-I EN F/ BNHx$/ CN*G"n`L*,"E3H,PHxHk/&<)0"CNHxHk( EHh"CN+b///N)/PQ / NX LBJf)@(// N"RPb lJg/9>NBrӨl*(hۀ!Eh/9>N*PJg"n i| PBrӨ*(ۀ!EHy>(/N&!Hy:~@N6"n""n " `:Hx// N * gHHx/N // N `Ш P`HnHx// N +~$HJg@ n Rb`/,O/ $nHx)Hn / N5 f Bp$nN^NuB`/,OH PJgGI*K\>PfHEG*ID 9>砰:cJ>fdHy:~@E6N/9?|NPL<N^NuS*$j8 jNBrӨ,$((Հ!B(/9>N/*NBrӨ4$(0Հ!B0/9>N/9>N `V/,Op#>N^Nu/,OH 8Hy:~@N}VXJg*EG*I^ >P>fHy:~@N6XLN^Nu/9>NBrӨ$$( Հ!B /9>N/9>N `/,O/9?|NXJ>g N>B>/9?|N6XN^NuNq/,OJgN^`N^Nu/,O/ /$n NRd$ nB0( /N#$Xf /NRX B $.$nN^NuNV/ /$n *4r€tfBHn//*/*0/*HxN&./.HxN&(.N&/.N&P$.$nN^NuNV/ /$n *4r€tfNHn//*/*0/*HxN&./.HxN&(.N&/.N&P$.$nN^NuBBrª\$fB`Bd`NV//&.tԎpĀHy:~NHx`/.(/N)0C B!I4-y:~//.$/. /.//././. /.N$4f4Jg0".kX#:~ 9:~Hg6Jf /N&X` //N&PHy:~N6 $.&.N^NuJg/N&#:~H`t`/,O/.(/.$/. /././././. /.Hx/9>N%N^Nu/,O n (4gHxHh/N N^Nu/,OH<<$.*. A f HxHxN$HP(<JfZE`p(RHxHxN$HPJg n4B%D j *R/Hy?u/N)0 J L<eL&H b81X bЉ Kf.d .fR"L`l  c/ N "XE` c c1  c -f` ` ЃdBSgB(%@`vNVtH08$./.Hx.I/ EN/.Hx.G/ N/. Hx.&v/N ./ /Hy+ADHx/NE B L `N^Nu/,O/"n". 9>Atgm&tgFrg/NBrӨ$(Հ!B`Vtgf/NBrӨ$(Հ!B`0teҁ2;N 6Nf~/NBrӨL$(HՀ!BHX-y>$.N^`/NBrӨT$(PՀ!BP`/NBrӨ\$(XՀ!BX`/NBrӨd$(`Հ!B``/NBrӨl$(hՀ!Bh`/NBrӨt$(pՀ!Bp`rJg Sf/NBrӨ$(Հ!B`N/NBrӨ|$(xՀ!Bx`4tg&tg:Jf/NBrӨ$(Հ!B`/NBrӨ$(Հ!B`/NBrӨ$(Հ!B`/,O n Jg -PN^` NBrӨ$$( Հ!B /9>N*// NHLNBrӨ$(Հ!B/9>N*/ N "` E( gFJ:Dg/Hx.$/N//Hy2 Hy+B!HxNGN `n-|BHx/HnNBBHnN&,g h0Jg (g@J:Dg*///HnN/Hy2 Hy+BbHxNGN /N&X`P-HHx//N)1 *C&gJ:DgN///Hn-IN$/.Hx.&/N//Hy2 Hy+BHxNGN0"n/N`zJ:Dg`///HnN4/Hy2 Hy+CHxNGN`/NX .@f(J:Dg///HnN/Hy2 Hy+CE`Hx//N)1 .0g.Jg@J:Dg///HnN/Hy2 Hy+C`vJg.1 fB`|Hn"nHiHk(NHnNJl@J:Dg*///HnND/Hy2 Hy+CHxNGN // NP` nJgB(B*5r ЁrfvT  @/Hx//// NZ// NH Jf|BHy:~N/9:~HN& ~"9:~PG6k|exHy:~NX/ N "X`J:Dg///HnNj$B*5/Hx.&/N/ EHh//Hy2 Hy+CHxNGN8`@*dHxB EHhE(N,HxB"FHiNCHxBHi-IN=|=|=|d$Hx/HnNHx/HnlNHx/HnN$Hn"n/ HxB//N&,\ .g /9:~HHz@/N& /.N&Hy:~NX-|BHx/HnNBHnHxN X`NVH?<$n$*( Hn0B0* /N#&HPJgb h| hBrӨ&׀ IK*xeP/9>NB|ݨ$ ( х!@ /9>N k| hݨ "(Ӆ!APHn0/ N/ N "`v'eRHx(/ N #\$HPJf>/9>NBzۨ$,( ݄!F /9>N k| hۨ (ф!@P`(*"n P-Iгb&֮ Jg//. Hx:/ N-@gJ:Dg@ DHhHx.tHv(NHv(/."CB/Hy2CHy+D+HxNGN$/9>NBrӨ,$((Հ!B(`\HnHx/. / N +~Jg"&. Pc Hy+3NK.֨`NBrӨ$$( Հ!B /9>N k| hBx٨ *(ۃ!E`j C(B/9>N"CB"@BrӰ*0ۀ!/9>K*N CP bJm g0b gr gJ:Dg`B:+, DHhHx.~Hvx,<"FN DHhHx.xHvH"FN/HvxHvH CB/Hy2CHy+DOHxNGN4"CJmx`,  bҁ2;N88 $D. fN k| hBx٨,*((ۃ!E( g ffx`8 bHn0/ N*jBDP$.дb. ޮ Jg-||B( PHx/HnN)0B&|/N Jg/ N "X`4 k| hBrӨ&(׀!C bއ0;xN F dxp/e/9>NBtը$&( ׁ!C /9>NP/ N "X` k| hBzۨ,(݄!Fx `x ` k| hBrӨ4&(0׀!C0x` k| hBzۨ$ ( ф!@ Jg g /9>NBvר((ق!D/9>N*` k| hBrӨ<$(8Հ!B8JfHx/ N .$Pg&.жb$ (gF f hHpLd,HxHxB/N +\&f& E/N "X$"n Bbl n "BJg0Jg>/9>NBrӨ<&(8׀!C8Ө$(( ـ!D /9>N/. /NJfE`$ E`HnHx/. /N +~Jgl ."Pb h`h k| hB|ݨD (@х!@@Jg*`xrd k| h f6Bvרt((pق!DpHx/ N .PCoJf /. / N`LB|ݨ| (xх!@x`/. /NP` k| hBx٨*(ۃ!E|e/9>NB|ݨ4 (0х!@0` 9:~gnr ggHx/ N ..PgN(h:| b"n -Ig,-||BHx/ HnN)0BNRd$Hn|N#*CRJf .f. g/NXBI`zfJf2j/ HxN b(HPJgB B (g  f$ hHpLe"hP\ IJl |/ N X`@HnHx/. /N +~Jg""npЉbX`/N"n8) G"h( -Iv։X Dc0U@ @cBz`"n) g`JfpftԎ/Hx/ /N &&D//N*gB//NJ ADJgj//NP`JgrB/9?uN(HPJg$gdB`"n)g g`d DfhJfbzB9:~gHvNBrӨ<$(8Հ!B8Ө|&(x׀!Cx/9>N*Hx(/ N`d CB() l"CBi.B8//9?uNX(Pg"Jf (Ѭ(`p CB()p8)@)@( ,g f lHrLe"(PҨ\p8Ь-A"n=i2|8-IJf8.gpNRd-@ 9?-@ (. fBB:.E@=E<.F=FJg D"(-A*nJg-@:.E =E<.F=FJfZJf D (-@ .g( .` -@`,B`$NRd-@(`V`L U (fH-gJfJf4-D`.Jf(C`-I/ NȺXrg*zgvUfJnf -H-@*nJgD`8Jng-gJngpe> Ch./.NRXHn/N#H0|8)H)H(P`lJnf`-m-m .Āg,A-HN n*.,.Ȝo,-N-F`j-|``B`HxHn`/.C)0-IN,.XHx/./"nN/Nx|ݮpѮݮ`-@`< .JfJg-@x-D`8`*y?uܱl*H$,Hx(//(<)0"DNHx/ BHh("DNHxB BHh0N( .Hy?u"BHi4"DN/ / N (4)M)M( B1|(`$ k| hBzۨL,(H݄!FH C f k| hBrӨT((Pـ!DPJfb C g2Hx/ N .P"CBCJf///. / N`Fpe`8///. /N`4 k| hBx٨\*(Xۃ!EXJf|dHx/ N .PCVJfP//. / N ` k| hBrӨd&(`׀!C`JfxdHx/ N .PC|`//. /N ` k| hB|ݨl (hх!@hJfLr'd^Hx/ N .PCJf /. / N`B/. /N` bf`x`\x`Vx`Pz0ڮ bF n Jfn/9>NBzۨ$,( ݄!F /9>NPHn0/ NbPL<|N^NuHnHx0/. / N +~"HJg np0Јbf`($P * ,g@bHJgP +gB-F亪b.*ޮ Jf/9>NBvר$(( ق!D `N 3g NBrӨ$$( Հ!B `Hn Hx// N +~Jg . "Tb h`B( 3ftTԀ`&"Xe( jJfP/9>NBx٨$*( ۃ!E `Hn$Hx// N +~Jg .$"Xb h`B(R`,Pe jJg hb:$`lHn(Hx// N +~Jg .("Pb h`r,-A`zHn,Hx0/. / N +~Jgr"n,p0Љb~.(މ`R,,// N<*Pg"P-A2| -I-|`BdHx/ HnhI)0NBxB/HnhKJNJg //Nݔ`-|DBHHx GHhHnLNB\B/IDHlNAZJg //N`T//N G (-@H-J|-G-n-B-n-LCP .f-h(C(-I"nB1p> r,L p 2Jg Hn|Hn`/N`Hn`Hx/. / N +~Jg(n` Pb.(ތ`(y?G*<)1|܍JfJg +df k(0(@$g/ / HnD/ N /. / N /.D/ /$+(/N Jf`/+(N / E "N/.DN `pf ,:fJfJf JfJgHx/Hl EN JfdJfJf JfJgHx/Hl"EN Jf6 lJg"G&p€p,gJgHx/ N .$Pf &L(l` +df k(0(@$g// HnD/ N /. /N /.D//"+(/N Jf&/+(N /G "N/.DN BD`v/+(NJX`/+(N>`L/ N "/9>Nvx٨T*(Pۃ!EP/9>N*`|Jf`NV/ HxHxHxBBBBB/.BBHy+@1HxHxBBBBEN@HxHx:HxHxBBBBB/.BHy+D}Hy+DHxHxBBBBNDHxHxHx:HxHxBBBBB/.HzHy+DHy,liHxHxBBBBNHHxHxHx:HxHxBHy:~BBB/.BHy+DHy+-HxHxpBBBBNHHxHxHx:HxHxBHy:~BBB/.HzӐHy+DHy+-HxHxpBBBBNHHxHxHx:HxHxBHy:PBBB/.BHy+EHy+E#HxHxpBBBBNHHxHxHx:HxHxBHy:BBB/.BHy+E-Hy+EDHxHxpBBBBNHHxHx Hx:HxHxBHy: BBB/.BHy+ENHy+EuHxHxpBBBBNHHxHx Hx:HxHxBHy:BBB/.BHy+EHy+EHxHxpBBBBNHHxHxHx:HxHxBHy:BBB/.BHy+EHy+EHxHxpBBBBNHHxHxHx:HxHxBHy: B-|Hx/.BHy+EHy+FHxHxpBBBBNHHxHx Hx:HxHxBHy:LBBB/.BHy+F"Hy+FKHxHxpBBBBNHHxHx Hx:HxHxBHy:~BBB/.BHy+F[Hy+FHxHxpBBBBNHHxHxHx:HxHxBHy:~BBB/.BHy+FHy+-_HxHxpBBBBNHHxHxHx:HxHxBHy:~PBBB/.BHy+FHy+FHxHxpBBBBNHHxHxHx:HxHxBHy:~LBBB/.BHy+FHy+FHxHxpBBBBNHHxHxHx:HxHxBHy:DBBB/.BHy+FHy+GHxHxpBBBBNHHxHxHx:HxHxBHy:~DBBB/.BHy+G!Hy+GKHxHxpBBBBNHHxHxHx:HxHxBHy:~\BBB/.BHy+.5Hy+.ZHxHxpBBBBNHNmBHxHy:~N{4Hy:~N/9:~E&N#:~T/9:~N#:~HHy:~N6HxNL#>.QHy+DN'("#>P$nN^Nu/,O/ /$.HxHx N$HHy:~N 9:~X @Jf8%B$g y:~X!J#:~X%|:~X-|:~$.$nN^`f(Hy:~N6Hx / N $.$nN^Nu P`NVH><$n$. &./9>GNBrӨ(ـ /9>K*N//Nj *(Mg2/9>NBrӨ $(Հ!B/9>NP/ N "X`x'd g0 f jHzLdHx(/ N #\$HPJg j *f (fpg rffJfJ fJfJgt (gjx-DHnHx)B/ NJmz:f"Pb8 jJfh/9>NBrӨ$$( Հ!B /9>NPL<|N^NuHnHx// N +~Jg ."Pc Hy+3NK. h`j f&/9>NBx٨ *(ۃ!E/9>N`(*/9:~Hy:~`Hy>N Jg *( o*<К// N P *g f jHpLe"* hP z/drpЁ%@r0ӪJfxJ:DgHxHy2Hy+GXHxNGN`/9>NBrӨ$(Հ!B`"*gAH`A `HxHx0/ N "$H ` *gz0۪(r/d g0 f jHzLdHx0/ N #\$HPJg<*j*PHx/Hm,<)0"FNp؀Hx/Hm"FN/*<x EN/"ENB(C)+n,B .>NVBrӰ(&0(׀!(/9>NHx(/ N`/,OH?8$n(. *.,.&...p'eHx(/ N #\$HPJgr(jB/$ P/GJN JfBB/HlN Jf0Hx//N)0 -F-E-D -JLN^`-JLN^`zLN^Nu/,O/. n / n//9>N'* <N^NuNVH?< n,. *($P h(( bRp7dJgHy:~N/9:~TN& ~P(<"9:~PJm@c<-|:~LNBzۨ (ф!@/9>N*%B`%CdP`r/ jN$R`NVH?<*nBHxNRPJ:g~"n (iH(--|B.PHx/Hn&<)0"CNB/ HnN(Jg4 D (g(/9:~Hy:~`Hy>N JgHxHxN b$HPJgHx/N B B *Pg fh jHpLe\$(PԨ\ c$<B,5 A r @Pe&NRd&@Hx/ N|PCRJf$/ NX/ N "/ N "`6$ `z`ڈ/ N"n ,)0Xg()7g$ F (f(  fP&j&`7|:Hx/Hk"CNHx/Hk"CN7|(B,"n )7gJgZHx/Hk0"CNHx DHhHk@"CNvP֋B/ /N Jg,B,5p Ѕ|̀"2|Pƴd|/NX %@%@(-fverpĀrdf"-( Qc0|Hp(/ N PHxB CHhN("CBP%C%C(֭(%C(/ / N K/ N "/KxN DHhNHk0NHk@N0**@7@Bk*?BgHx(Hx:/ N7@* BBBBBB/ NP~JgJg l| hBrӨ$(Հ!B l| hBrӨ$(Հ!B l| hӨ$(Հ!B`B`|܄Hx/Hk0"CNHx/`B(ag~|P @QB,5/HhCR/ -A-IN)00|B,5HphB"nHqXN(ֆ".`"Cg" JlStRD// N P$-(P`@Jf/9>NBrӨd$(`Հ!B`/9>N*PLN Btհ&0ׁ!X-y>$.&.N^`Nq/,O y:, ("!AN^Nu/,O y:, ."(!@N^NuNV n -@ nJg N^NuNV n (-@ nJg N^Nu/,O n hL WIDN^Nu/,OJgN^`\N^Nu/,O/ $n HxBHjN(4Hx .P/HjN)0$nN^Nu/,O-n N^`/,O//$.&/N/NRP-B$.&.N^`/,O/ $n"n n ("*fJ ( "* f: ("*f* ("*f.f0(` @$_N^NuB`p`/,O/ $nHxBHjN(4p%@ n%h P B/. / NJ$@JgHy2xHy+GwHxNGN $nN^Nu/,OH8 n&n "+ "(S h $p I)1Jf J LN^Nu*afHx/ HjN Jg$R`/,O/ .P//.NP$HJg$HxHhNZ/ N$ B$nN^Nup`/,O/ .P//.NBHxHy>N{4BNvN^Nu/,OH 0$n$PHxHy2\/G)1N Jg$ j (1g0Hx *P//N Jf/ HxN&ZPL N^Nu-JL N^`NVH<<&nNRd(HxHy>Nl$HPBBI)1KzJf&ARplJf\/NB/ N&1& `vHxHj` P/N *JfR * g& pfHxHjN$HP$`JgNj&HP& I)1KtJfJ/NRBHx/ N&. *,r€%A,gHx/ HzZHxN&2`J*gJ+gHx/HkN Jf+/fN&I/ / N#*/NRBHx/ N&.p,/ N*/g/ / HzHxN&3/ / N/NN L< N^Nu +`"*`f2 +d"*df" +h"*hf +l"*l`N&jXJg( kJg!k k Hy>N/ BNP`Hy>NB@X B bF!Hy> DN jXJg  j B/ /N#ښHy>Np%@/ N#ْB@FL<N^NuNVH?<&n(n JgF"n$Q*9:~Jg0Jg,6+0g,- gJf ,H bJfJfz`hE`JgHtHHlPNJP$o,HxHl,/K)0NC gT .fLvHxHn Hv8NHn/ Hv8NJJf".0 .JgffpB/NrPJf^ ,-fl0+0@fBJ:DgBHy2Hy+GHxNGN `$BHjNJP$`<-@0` gJ:DgHy2Hy+G` ,x|eJfJ:Dg4HlHx.$n/N/Hy2Hy+H5HxNGNJfB L&< CNNRd(HxDHkN B,<Jf/NRxX؊HxHl/NJg%kL4*<Jf/ HxN&Z/ "EN* g Hy>N6X`/ N$XJglJ:~obr`XJg*f"`"P )fRHxDHhD"FNP`FHx/ / N$l* gVJg~`20+0g6%|#(/ N/ EN*Pg/ NPX/ NU&X`%| X!`Z @ (gfC%I"h%Ig X"-HN( n!B`(B`Hy>"CN j"G#HXg X!@%G*  G!EHy>"BN-|PBTHxHy2HnXNBh-|4B8HxHy2,Hn CN j+HXgC!I%M+EHy> BNXJgN Ly:Hn4/9?uHy?u/ NBJfb/Hn|F܎// Nv(*HJf J:Dg8../Hx.K/ N/Hk/ Hy2Hy+HUHxNGN$Hx BHn>K(NP<|=|KB/ |F܎/NJ-@fjBHn4N&.Pg,Hx (P//N)1 ,<&Jg/ FNX|Hx4BHvhNA4-H-DCP-I-D-|BHvhHxN&'`-@g\`Hy>"CN j+HXgC!I%M+EHy> BNX`"GHg/ /N& G!KHP/"FNXBHnxF؎// Nv(*HJf$.J:DgZ/`Hy> CN j+HXgC!I%M+EHy> BNX/ NXJg%|((j./ N$XJgrx Ȭdfj*gbp.gDHl/ I/ N4$BNuJgRBNu$9:gN LB؃  @Hh/ N$PJg"n"/./ N#*P`/ / NmPJgp$f&((`z/`z7`Hy>N6X` y>$ Jf%|>BN(#>/ / N#Hy>$<6 BN Jk0lHl/ */N.-@ f|̮.gN Ly:/Hn// Nv(.fd$.J:Dgr/Hx.K/ N/Hk/ Hy2Hy+HUHxNGN$`:JgVfN`/,O/B@ B bF!/.BB/. /.NB@F$.N^Nu/,O/ $n/*N/ NP-j$nN^`/,O/$.Hy>N y>XJgJf-|>$.N^`"hJf h`ҴfB"i`/,O/ / HxD ./NFPEG\Jf J $n&nN^Nu"P )f0 )f()  f . fJg 0(@j@o$HHxDHhDNP`/,O//NRd&/. /.N|$Pg/./N#*P/NR B $.&.N^Nu/,OH08&. NRd$HxHy>Nt$HPG)1IJg$Hx/.Hj`N Jf*Jf / N#ـX/NR J L N^NupgHxHjN$HP`/,OHNVPGpJf/NRXB`J "(`fF *"(df6 *"(hf& * "(lf/NRXpL N^NuHxHhNP`/,OH08NRd$HxHy>N$HP&.PG)1IJf/NRXB`(Hx/Hj`N Jf*g/NRXpL N^NuHxHjN$HP`/,O// n"n B tg1R0gJl$&N^NuR `/,O/ /$n$. c"/Hy+HHxNGN $.$nN^NuHxB/ N("pĀ BfJg)2o`PR`NVDH?<$. $n*n r€&AJgJf Hy+HNK. ig. ig igt-`jJ*k&* c\t`R *f *f*g f*g f&* b ig ic ig if(DHxB/*<("EN J*j(//NI &dHx/ /N)0 .Dd".Hîh .Ll".PîpHx/ /N)1 Jf$~NRd(HxDHmNL(HP&<)0,TJft1/NRX`// Nv/"EN`N(*BI`ZJ*gB*/HjHk,"FN / EN|H/HkPNp'@x'@|"*A'Ad/ / /ߖgDp*@ ig ig ibAݮ i bh ikg bv xig xiFgN`D HiWgB@ C c.Bp ig (ukg`D iMgP >ߖgB`o"<fJg Himb 0iLgpb iVbv iTb\~Ά*G ig ic&`/ /NPB@FL<4N^NuJg/ / //N#` Hikc/ / /N ` ?ߖ~dp*@Aj iPb i%g  i%b6>ߖgN:$BpI ib ikgc* i g ibl xif` 0iNgZ HiWgP if/ / //Nl`( iKg,Nۺ$Bp ifp1`R >ߖ"< gNی$ *fZJ(gxBHjNrPJfHntHj/ NL(H -Lp ifp` ~ߖ"<$fN$I` inf`>ߖ~dz`B/ HjNJ ` xig ikgJ`n icI iIb i"b@ i cJf` ig ic iIfJg%lB` i%gbpHnt/.p-@\NP .\/-@\NlX .\`| iQg ijg iSfx_F/B/ N( k| /// N)0`xJgF jfHnt/ Nz/.pN#ـ/.pN/.p//9;}N%/.pN#ْBp `" jfp.dfH(jh*jlJfJgNt( * %Dh%El(jp*jtJfJgNt( * %Dp%EtB@ D bF!BHntHnp/ / NDB@FJf".pg///9;}-@\N% .\`~ jf Hxx/ HnN)0%nl[I%Gh%nt[I%@p%nx%n| ` JgHxHlHjN)0 , rg\-@dB` l"l <r,,.`..dlV,.`..d މ݀%F%G"g Ntށ݀%F%G np (|g*B"h h,<~  "l"ډف%D%E,g Ntځـ%D%E`>Jg HxHlHjN)0 ` i!gX i"f+1g<HxHl`B iSb iIg iQg` iTg2 ijg`HxHlX/ N)0/ N `(</B/ N( k| (`%|%|`(<z`p/`fp`p`~Ά*G ijcF`NVH?<&n(n r€$A+4 gRbD gJ$+@&+DB"<b|J:DgHHkHy2Hy+I^HxNGN`( b& k| hrè k| ht L<|N^Nu&+@(+DB$<c g( g0+0k,J:DgHkHy2Hy+I`| k| htŨ `Dj&$<2LHx//K)0N// NJfHxB/ N(vHxHs8/ N(HxHy2HjPNB`$Hx/Hj4NBD%|HBL%|BHx/HjNB(%|,B0x%Dx%D|p dB/ / N$Jg.J:Dg/Hs8Hy2Hy+IHxNGN` k| hp( r f y:, ((!@$ /B/ N JfHxB/ ,<("FNKHx/ / N(5|%|BtԊ+1gB p%@$B/ /NJ Jfp%|HBLHxHy2HjPN)0B`p%@x%@|Hx/ / NJg* g6J:Dg Hl/ Hy2lHy+JTHxNGN/NRX` ,-@(n`//N#N`/,O/$.HyHx/N#/NuN/N'B/N$.N^NuNVH?<*n(n B,$-(G(o/ / N #\*HPJgpA<o// N #\*HPJgR m-h0 . ރ*-4Hx// N $H Jg*0E9@օB0,, f,  fB8, B<,؆B2, AB8,؈2, AB8,؈2, A, f, fB8,B0,"DC( 0, ؀0,"ЄB8,$؀B0,&Є""A(rЉЈ(Є o=@LE(( IEJnR J L/,OH< n$PK&!I&!Jf L<N^Nupf,G8/ NXJg$ . Hf/ /NB/ Nj$j`/ /NP`NVH?<(n&n *.*n8Jg-$  l$p tB.<)1JfJg l$Jfz$C`"pfʸjbf"*fJf * f J*fk|`JfJVIDJfJf * f,*dfdJf`JfZ fP j + Jf0Jf* f JgJf2|JfJgl$& `JfJgZR`JggN$j`Jgf|`|`Jf@Jf:JfJf + fJ*fj`JfJ fJf J LHnN#*XJf,J+ek$/NXt1 L< N^Nu *g+df/ N#*XJgpg`JfJg`/NX`Jt/`NV/ / $npfG8 j|f4Jg*dg&Jj`f jbfJ*fkHx/ HjN JgV$R`pfDJg*dg6Jj`f0jbf*Jf fJ*fkHxHy2HjN Jg$R`g RJg!j j S$g!J&%K`/,O/ / n". pf*J o"PJg#h"h"tgpg!A $$_N^Nu"h, ($($($(B4(bЂ$ĩ$i $r, g"i "q #H"h, ($($($(B4(bЂ"i # "h, ($($($(B4(bЂЩ !@`P$h, ($($( ("BB0(`B4(bЂ ($($($(Љ$Ī"j "q, g"j "q #H$h, ($($( ("BB0(`B4(bЂ ($($($(Љ"j # $h, ($($( ("BB0(`B4(bЂ ($($($(ЉЪ `NqNVH8<$.&. $nJfJJfD f:-j HnHxE/ N / Hy+KV//NEL<N^Nu"B BBBK366xfJCf~rf d:R`JR6`JCfd&RJf"JRfJfe Cc:Rr`:`d0e$TRvfcSccB `f|:`r&R@5Hd 0g(C*5HGcf 0f&H@5HIcf 0f(H*5HGcf 0f&HAc>:`6(H`zB)`BNVH00$.&. $n PJjf-@L N^`(/Hx.G/ NB0*// Hy+K`//NE L N^NuNq/,O:N^Nu/,ON^`J/,ON^`V/,OHyNrHx(NlPN^Nu/,ON^` V/,ON^`r/,ON^`/,ON^`V/,ON^`/,ON^`0/,OH0<"y>tAJf JgjBrӨD$(@Հ!B@ L< N^Nu&nPEK BfJf.A$`*R Jm`(J*gRf fP`ʴm"Q`A>`NVH0< n&n *n.Jg (kJg ,gD/9>NBrӨd$(`Հ!B`/9>N*PEt/ n L< N^NuHnHx/ / N&"$HJgtĨ4gPJfd/ / N&!P/ N&"X/9>NBrӨ$(Հ!B/9>N*PEtA`x/(H/ N(PJg*`` jHJg h| PBrӨ\$(XՀ!BX`zEJfJ f f// NPHnHx/ /N&"$HJgFJgn kJgf (g` jH(1fTB2(,gJJgJg h| PBrӨ\$(XՀ!BX// N&!P`Hx// N)0B `rB`zNVH?<*. &n(n(. y:, ("-A!@tԎHx"nHi/E)0N Jg DBJ fC-I -nBJg2"E iJg( (g"/. /N#&HPJgJfB`"n )fJg/. B0/N#&HPJgJfJfJf^(KHn/ /NJ& fbNRd-@-n 9>-@$nJgBB~p-@r-AK`|BJfJfJfJ gHx/ /.$N (KB`BHnHn//.N*&gJfJfJg^G`*n/. mHB0(,/N#&H -4&PgJfLJf/. / N#HP`T mL ( g/N#XJf/. / N#H mL&h /. / N#`v3` DBJfJf@ y:, ."(!@ L<`N^Nu"D"` D `D"D"JfJfJf6` E,(gG FJfJf JfJ g`HxBHnN(=|IHx// NJfDNRd$HnN#**XKRfF/NXv1`0G"E,)fJf(KJf`B/ / NJ& g(KJf`vƨfHx/ /N Jg D Hx"EHi`/.$N/N`$* Hn/HnNJ Jf"nfHxHj`HnN)0 +1f .䀮耮f pgHn/ HnNJ JfHn/HnNJ Jfv".flpfdJ:~gD|`܊Hx/tԎ/N)1 Jfn*JHxHm`/.$N)0/.NR`pgNc *-@$nJg JfJf/.NRXv1`AȺJf,/N$HjXNPHn/-HN.P n`Jl /N-@X/AȺ-HN$X no "nldKXJl/N$/ `l l`@p r ­f*Jf,pf"rg*Nc`Jf`Ncpg@A-HN nc&rg NbJlB/NȺ` * f|fJf/.Nj-HXp"nB#>HxHBHy>N(p#> N^NuNVH88&.$nB@ D bF!JfJgRJg$B-B-C Ђ-@&y>IJfFB".$Jg dJfp B@FLN^NuJgZ$HxBHnN(-B ` nJg$CHbHxH/HkN JfpHѮpHѮ&S`p`p`B`NVH0<&.G r&@ f,HxH/. / K)0N p HumfK)1Jfxp`&<)1Jf:HxHxPNT$HHxH/ HhNB y>%H #>B`dHxHj/ CN JfHxHj,/ CN JgF$R`HxHj/N &RJfHxHj,/ N Jg$K`V'@ j `p-`p` *Jf#>`NqNVH?<&n*. $n/9>NBrӨD$(@Հ!B@XC*Jf/9>NX&9:~[I,9:~ֹ:~ՆIN,.lN#:~#:~Hn/.Hx(/NDB+I,'JgIHkHx.&/KN E,'Jg4|HkHx.$/N/// // /Hy+KsHxNGN,L<|N^NuB~ߨ (ц!@/9>N j| Pߨ<"(8ӆ!A8`NVH?<&. n&hB, (fP +g|JfJ fJf <+KJg0+ b\BBHx/NrBBN&!`* <+K/B// N&/.N "BBN&!LNBrӨ&(׀!C/9>N*PJgBBHx/NrE`/ N&!$HXJf0Hx/ N&!$HPJf/9>NB~ߨ (ц!@`-lzڎ( PHx//N)0r-A-A~ގ//*H/KJNJg:,.*./NL///Hy+K/*H// N Jf2/.`\Hn//N Jf,.̼f|܎zڋHx//N)0p-@-@Hn//NJg ..,./NL///Hy+K`v//*H/N-@ f".̲f jH"n-i([I-F .".,(@.(Dc|/9>NBrӨ &( ׀!C /9>N* jHPJg h| PB~ߨ (ц!@Jg jH/(DBHx/Nr`BHxHx` *4g-j0ȶf&J: gr0 f(1f-|.*H G(1g./GxN/NHx/*HHn/9>N%Ѷ&KG*gv/9>NBrӨ (( ـ!D /9>NPJgNx(gp|7gjBHxHx/Nr`(//,N(PJgLBHx` B`B .f2/9>NB~ߨ ( ц!@ /9>NP/N "X`/ /.///*HN4&g> jHJg h| PB~ߨ\ (Xц!@X/9>NB~ߨD (@ц!@@`/9>NBx٨<,(8݃!F8/9>N jHPJg h| P٨L.(H߃!GHJgL/9>NBrӨL&(H׀!CH/9>NPJf,/ / N&!PJg$/9:N*X`Jf`/ /NyP`Nq/,O/.(/.$/. /././././. /.Hx/9>N%N^NuNVH08(n&. T(brHnHx// G &NB.p3f^T Ѓ(b>HxHxN $HPJg( c8Hx/N P*f"/ N XE J L N^NuR`B *g@ f jHpLe (PШ\c/*/// N%B` `NV/ /NBHzHxN%#:HxHxHxBBBBB/.BHy+KHy+@1HxHxBBBBENLHxHx)HxHxBBBBB/.BHy+LHy+L.HxHxHnBBBNDHxHxHx)HxHxBHy:BBB/.BHy+L2Hy*HxHxpBBBBNHHxHxHx)HxHxBHy: BBB/.BHy+LWHy+PHxHxpBBBBNHHxHxHx)HxHxBHy:BBB/.BHy+LHy,sHxHxpBBBBNHHxHx Hx)HxHxBHy:BBB/.BHy+LHy+2HxHxpBBBBNHHx*/.B/9:N%&HxHx Hx)HxHxBHy:~BBB/.BHy+LHy+LHxHxpBBBBNXHxHxHx)HxHxBHy:~BBB/.BHy+LHy+M.HxHxpBBBBNHHxHxHx)HxHxBHy:~BBB/.BHy+M;Hy+MaHxHxpBBBBNHHxHxHx)HxHxBHy:~BBB/.BHy+1Hy+1HxHxpBBBBNHHxHxHx)HxHxBHy:~BBB/.BHy+MnHy+MHxHxpBBBBNHHxHxHx)HxHxBHy:BBB/.BHy+MHy+MHxHxpBBBBNHHxHxHx)HxHxBHy+MBBB/.BHy+MHy+MHxHxBBBBNHHxHxHx)HxHxBHy:~BBB/.BHy+MHy+N$HxHxpBBBBNHHxHxHx)HxHxBHy:~BBB/.BHy+N3Hy+NpHxHxpBBBBNHHxHxHx)HxHxBHy:~BBB/.Hy*Hy+/Hy+0HxHxpBBBBNHHxHxHx)HxHxBHy:~BBB/.Hy*Hy+0Hy+0FHxHxpBBBBNHHxHxHx)HxHxBHy:~BBB/.Hy*Hy+0Hy+0HxHxpBBBBNHHxHxHx)HxHxBHy:~BBB/.Hy*Hy+0Hy+0HxHxpBBBBNHHxHx#Hx)HxHxBHy:~BBB/.BHy+NwHy+NHxHxpBBBBNHHxHx&Hx)HxHxBBBBB/.HyHy+NHy+OHxHxBBBBNHHxHxHx)HxHxBHy:BBB/.BHy+O#Hy+ONHxHxpBBBBNHHxHx)Hx)HxHxBHy:~BBB/.BHy+O^Hy+OHxHxpBBBBNHHxHxHx)HxHxBBBBB/.Hz`Hy+XHy,liHxHxBBBBNHHxHx'Hx)HxHxBHy:BBB/.BHy+OHy+OHxHxpBBBBNHHxHxHx)HxHxBHy:~BBB/.BHy+OHy+OHxHxpBBBBNHHxHxHx)HxHxBBBBB/.BHy+OHy+2HxHx$Y/BBBNHHxHxHxBBBB/.Hy1Hy+2&Hy,]HxHxB/BBN R f y:($9:,eXN\NN^N4HxHxN%#>Hx NL#>N&##: $.$nN^Nu$hpf"2(g Ag 2L<.,`r/,OHx/.N 'PJgP N^Nu/,OH0 n$n $. g gZJfB(L N^Nu/9>NBrӨ&(׀!C/9>N*/HxHx/ Nrp`/9>NBrӨ&(׀!C/9>N* jP (g *g / N "X`/HxHx/ Nr`NVH?<*n.. G$P"n&p)d~0|(B(R&AA(bցUt*Ԫ(B(<*Y,<)0 gbJg gPpgNA*// / DN rfr`nHnHxHx(/ N +~Jg& ."Tc Hy+3NK. hJfJ/9>NBtը &(ׁ!C/9>N*PpLNBrӨ $(Հ!B`֋UT` fplN ,f jJhg /9>NBrӨ&(׀!C/9>N**`pf:/9>NBtը&(ׁ!C/9>N*P/ N "X`B,T`rpl ,gH/9>NBrӨ&(׀!C/9>N*+/ BHx/ Nr`APlB0."n "pJn"n" G B`tHxHl/"FN . Jg2/9>NBrӨ&(׀!C/9>N*,`f c*p`p`NVTH?NBrӨ $( Հ!B /9> EN/ N " `~ h| h(g@Hnp/ N#H/9>NBrӨ $( Հ!B /9> EN/ N "`.-L`p(-@hr-AlHx/ N 'PJg // N ZP n`"( P 9>gJg/NBvר (( ق!D /9> ENP j| PBrӨ$Հ /9>NBx٨,݃ /9> EN n`Pp'eHx(/N #\-H`P"n`Jf/9>NBtը&(ׁ!C/9> EN j| PBrӨ $(Հ!B`x/NBrӨ $( Հ!B `>Jgbg./N"y?B0),Btհ&0ׁ!` j,b /NB0*,`/NBrӨ$(Հ!B`/NBrӨ$(Հ!B` i `gH/9>NBx٨,(݃!F/9> EN j| P٨ (у!@P/.`N "`x (gJgJfJ g iHxHhHnN)0Hx/ Hn`/9>N%ѶJf n`JfF/9>NBx٨ ,( ݃!F /9> ENPHnp/ N#HP`Jf ( f J$g4JfJ gJg`\JfJ f fh/9>NBrӨ$(Հ!B/9> EN j| PBrӨ$$( Հ!B `Jf` ( gJfre`Jf gJ f\JfTtep`F f`^ gTJ fv$d`>p'eHx(/N #\-H`Pg n`(hHxHlHnN)1 -@X/9>NB,vЃBtհ&0ׁ!/9> ENHxHx(BHn`N "Jg(/9>NBrӨ $( Հ!B /9> EN` n`*h( P/IxNXJg/9>NBrӨ$(Հ!B`tԍ/NXJfB/ /IJN JfB/ /N-@\ f/9:N&X -f j| PBrӨ((ـ!D/ /Nu PJf(y:Jf/9>NBrӨ$(Հ!BӨD((@ـ!D@/9> EN j| PBrӨ<$(8Հ!B8`,-|BHx/HnN)0BHndHxHn/N&"(HJdg/9>NBrӨ t,( p݀!F p/9> ENPJgp4Yf lH (4f.,L G(g n`h"G )r€f Dk G(( zJfB0--@-$<*JfFHnhHn`HnlHnNpJg j| PBrӨ<((8ـ!D8// N&!/9: BN `/9>NBrӨ |,( x݀!F x`JfJ fJfJgNHxBHnN(=|HxHmHnN)0NRd,HnN#**/NR JfJ:DgF/Hx.tHv(*<"EN/Hx.K/ ENHv(/ Hy2"`Hy+PHxNGN,/9>NBrӨ $( Հ!B /9>N*P// N&!/9:N* `JJ:f(/9>NBrӨD$(@Հ!B@`j( zI/.`NhXJf8NRd-@T//N,Pg..`Hx/N '$Pf:HxHxHxN $ gh//N HxB BHhN(.P"BHi F/( /NJ Jg@/9>NBrӨ$(Հ!B/9>N*P/.TNRX`tB( ` Hx FHh`/N)0"B F#h `BB`B n`*hJmfJf/9>NBrӨ((ـ!D/9> BN j| PBrӨ<((8ـ!D8 j| PӨ *(ۀ!EHxBHx/.`Nr// N&!.: BNX` p)dpA(Bplg J:gz"n`&i( npЋc/9>NBzۨ ,(݄!F/9> BN j| Pۨ4 (0ф!@0`HnHxHx(/N +~Jgj ."Tc Hy+3NK. hJfT/9>NBzۨ ,(݄!F/9> BN// N&!/9:"BN`B```(dfv#H#H( -fGJ:gf/.`/ / N(d JgP// N&!/9: BN/9>NBrӨD&(@׀!C@/9> BN`// N P` 9>Jf\/NBrӨD((@ـ!D@/9> BN`@Jf4// N&!/9:"BN/ JXVID//.`Nj` n` hGJfJ f gJfPJfJ f@/9>NBrӨ((ـ!D/9> BN j| PBrӨ$$( Հ!B `/9>NBrӨT*(Pۀ!EP/9> BNPJg"D i| PBrӨD((@ـ!D@Jg // N&!P/9: BNXBBI2K> (h&` 9:~gJR\\l@/9>NBrӨ &( ׀!C /9> BN j| PBrӨ $(Հ!B`" n` h(hlNBx٨ *(ۃ!E/9> BN j| P٨4 (0у!@0`r+f>JgH j| PBx٨ *(ۃ!E/9>N٨,(݃!F/9> B`p,f Jf~`zB5hr,L t ///N, f`NVH?<&n$n *n(n k(0(2A$g/ 0@/N $HP `f+egRtԎHxHm/N)0/NxB0, -@+dgpHx)/Hx/N $g$H +dg2B--AgpHx)/HxHnN $g$H+eg* -@Hx)Hx=HxHnN $g$H+eg lJ(fBHx(/ N0*H Jf./9>NBrӨ $(Հ!BX`Lp.`$p/`X hB(R$< "gNBrӨ $(Հ!BP-y>LN Btհ&0ׁ!X-y>$.&.N^` /,O/.(/.$/. /././././. /.Hx/9?N%N^Nu/,OH>8&<>8XB*< "(<U&JfFRX fBHz 9:jV/Hy?N-y?|L<|N^`H*C$UJg&jJgR *xgLS%@xfD, &k F/ EN/ DNPJfBrӹ?|,9?x݀#?xS,*/ DNX`K`/,OH0 $n$. JgT& B//./N Jg* *4gHx// N BL N^Nu/ N X/N "Xp`/,OB@ @ bF!N^Nu/,O .B@FN^NuNVH0 2. B0$@>8y:dJgN&f$*-|BHxHy2\HnN)0BHn/ JBf<3:/NBXBL N^Nu y:gHy> N#x3:X`J@fSB`p`NVH?<$n$. (n-j&*(2,82y:ʲIdB0A>8gBxٹ?l 9?hу#?h٬t ,pу)@pIdDJ>Pg0J?g&*fHxHx(B/ N +<$HJgr'd$ (g0 f hHvLdHx(/ N #\$HPJg 9:xdg rlg/ N "Xv L<|N^Nu(j9|G0y:B8Hd R"퉴>fHxBHnN(=| 9: tdgnvlgBrӹ?L$9?HՀ#?HHn/ /9:N JlBxٹ? 9?у#?v7`H&j6I`R&`TCHxHlHnN)0 `~7DHxHk`*[IBrJj fӨ,&((׀!C(ۨ< (8ф!@8BrӬd&,`׀)C`۬l ,hф)@hGHx nHh/ N)0KHx nHh/ N)0Hn// GJN&$fHn// N& gV/9>NBrӨ$(Հ!B/9>N*P`,Ө$&( ׀!C ۨ4 (0ф!@0`6 tĆpP UJglB2,80>8f0 >8fHn/Hn$<J BN JgB/9>NBrӨ$(Հ!B/9>N*P@RFy:e^B`bHn/Hn BN Jf .f".fBv׫, +(т'@(۫<"+8ӄ'A8g|$*(/9?NBrӨ4&(0׀!C0/9?N*HxHxN b*HJgR 9?Ѩr(!AHx/ N .*Pf/ N "X`" -g 0| f"mHvLe"- iP0| l // N #\*HPJgp(Ђ!@(-|BHx nHhHnN)0B m0 >81@Brӹ?L$9?HՀ#?HHn/ /9:N2JlVBrӹ?$9?Հ#?`:"-gAH`:A `2*kN`.Hx/ N ."HPJf /NZ`v'd$ (g. f hHpLdHx(/ N #\"HPJgi0* fFJg0-,=@ nh|BBHnHxHy?B/ NP~/N `f-|BHxtԮ/Hn-IN)0B/ /Nu "nJg/9?/ / NP "n$-@&-D-i([I-@ .".cB"<e BHn/ / / N4/N`J:~g/BHx/ Nr`/ N "X`G>8BF`NV/ HxHxHxBBBBB/.BBHy+@1HxHxBBBBEN@HxHxgHxHxBBBBB/.BHy+Q=Hy+QLHxHxBBBBNDHxHxHxgHxHxBBBBB/.HzHy+QQHy,liHxHxBBBBNHHx8NL#?X$nN^Nu/,O n 9:԰f"pkfHxHy?/N 6 N^Nup `p-`/,OH0< .$n (ukg Pujf.Nr$"* * &* *&*$ *(&*, *0vFƒ&p>8Brӹ?<&9?8׀#?8& PI)1K$Jf&Brӹ?D&9?@׀#?@/NXp`Hx/HkN JfHx/ Hk$N JfJgp&k`0y:d\ @>8 ( "($%@%A (("(,%@%A (0"(4%@%A (8"(<%@ %A$BL< N^Nup`/NV +`"+d%@8%A< +h"+l%@@%AD +p"+t%@H%ALX`NVH>8GI2\K)0x؎*<$Py:eHxB/ K(NBy:B?Hy?N I>8( $<U&*< "$\Jf?8fHxB/N y:gHy> N#x3:XB:B:/NXBL<|N^NuB2,2g42f,-|BHx/ / NB//Ѐ0;N8d2 Hn/ N D$Pf k f k h:fvfJ:f#:#:HxBHy>8E(N$</BHy>8NB?/Hy?NLBHz 9:jV/Hy?NB`RL<N^`HxHnt/ N $ f,0.t @?bP$@>8Jf20.xft L<N^Nu?BgN#&HXJg.vg y:f>HxHy+QbHy>4N(ydy>P0.t3>L3:Hy> N#G> Nv%KB B$B(B,B0B4B8B8 .".&.".&.ȷ".̳&.з".ԳvF(r Brӹ?<&9?8׀#?8v֎K)1x؎JfbBrӹ?D&9?@׀#?@N-@@&. .". .".ȳ .̱".г .ԱrFƁ(r<BEx؎`\Hx/HlN JfHx/Hl$N JfJg(l`dHx/HlN)1 JfHxHnHl$N)1 Jf*lJg2RA=A>JEg\B<.HnHx..t/A-H8N/Hx.*D/ n8N/ ///Hy+QoHy+QHxNGN4Hx/ / K)0NHxHnHlN9n8Hx HnHl8*l$,< ".<U&Jf`B:.>(lJfJEfb*r<(<)1zڎI)0|܎~ގJfTHxHxNT(HPJf/.@NXt7` *- -g/ //N / FN/ GNP*E`rHxHnHm DN JflHx/Hm$ DN JfVHx/ / NHx/HmN;n8Hx /Hm8Bx*m`Hx/ /G)0NHxHnHlN9n8Hx HnHl8$p->8PI)1PJf/NXt1`FHxHj/N JfHxHj$/N $fJgvG$j`Hn/ N D$Pf .ve#?`t `t*`t0`t`N8&9n8Hx HnHl8Gy:e(E>8BJ0 >8f,RX fL N^NuB0툶f/NXRB`"RJg iJf"i`fB h`NVH?<$n*. &n* c *f*S cSAJfJ fJfJf/9>NBrӨD$(@Հ!B@/9>N*&9:~[I(9:~ֹ:~ՄINP(*lrN#:~#:~0+ G,'g?BgN#GXB*HjHx.I/ KNHjHx.E/ N/ // / Hy+QHxNGN0BL8Brӹ?<$9?8Հ#?8$ PK)1x؊JfPBrӹ?D$9?@Հ#?@ӹ?T(9?Pـ#?PHxHx NT*HPJfF/NXp7`8, P(<)1~ފJf4HxHxNT(HPJfX/ NU&/ N "/N| `HxHl/ DN JfHxHl$/"DN JfJfz(l`HxHx(B/ N +<(f$/ EU&N/ N "/ N/N`d-|BC-IHx/ Hn,<)0"FNB 9: rdg.~lg/ EU&N/ N "/ N/Np`: D"h3|B=y:B=@nd"R. Gp>f"9:~dgplgHn//9:N JlHy+QHxNGNBrӹ?$9?Հ#?/ EU&N/ N "/ N/N`D"D-i n0C`D `H@`v n1n`hBrӹ?L(9?Hـ#?HHxBHlN(8Hx/.Hl"FN9|HxHjHl$"FNp)@xR0)>89|8)p->8!->8)M$B*+E/NX`Sf6Btչ?t(9?pف#?p/ NU&/ N "/N `~C hJf"`C lp`/NX-L-E -KLPN$-B/./HnN`/,O y:, ."(!@N^Nu/,OH0 &. $.HxHxN $HPJf p7L N^Nu o"Hx/N P*f / N X`%BJg *///N)0 n B`/,OH 0$np(dp$*HxHxN b&HPJf/ N "Xp7L N^Nu/ /N Hx(/ N pѪp(Ѫ&'@ +Hx(//N)0$K n B`/,OH00$n&n &.$%ktt%k%kxx%k||Jg*/HxNT%HPg8Hx/+/N)0 kJg0/B/NT%HPg"kB// /N)0 k8Jg0B(R//NT%H8Pg//+8/N)0 k $n,. &.*.(.gR/ /N&2P$PgB/9>NBrӨ (( ـ!D /9>N*/N " L|N^Nu j| h(g/N "Xt2`*1g -D-E-C-F -JL|N^`-D-E-C-J `NVH 0 .$n nr)ftf&jJgZSf,Hn/N DPJf".tnJn j h:f$pL N^Nuf j h:fUg`'A`"j i:g +-@//N P`p`p*`/,O/ $nHxBHjN(p$%@t%@x%@| $nN^Nu/,OH8$n . rg r.f *g/NU&BX`z *g/NU&BXp$%@tHjG&"N *Xf *8g/NU&B8X * f4-|-nBBHn/N&"@PJg2$ LtN^Nu-|BHx/ /N)0B `/N&!$HXJg@/ hHB0(,/N#P(// N&!/N&" pg/Hn`A`t `v/,OH8$nJgJ jIvJf&-JLN^` 'I"h"/NX K&h"hJfB/NX`LN^Nu/,OH 8$n$. &nJf pLN^NuJg/N5XJfI6Jf *nB`Hx/ /N Jg`r l&j Sdbp)g VrѪ V`/.HxB/./HhHk /+N Jg``NVH>< .$. *n B$h"&mB h8hJg v)g>p*`xeJg Sgp`/ /*pN$P`/ HjpN|`Jg Sf8L YvtNtttbttttttttt *dfHn/ N DPJf .rgtg"Jfd`x *d`H *d`8Hn/ N DPJfF/./ N0`VvmRxl YreЀ0;N     xxxxxxrҋvev(f @~fz f B(fp9`x+l&r9gt@g/./ N `z ljpe Ѐ0;N|^<Jp *d-@` *d`-j`x0*dHvƀ-C`f *dЀD` *d` *d` *dg x-D`2g*z-E` *dA` *d`zI8-|BHxHjHnN)0B|܎/HxHn/ N&"C&!Jf/ BNPpA`: (H$hdJf&@$kD/ /NPc$|`b0/ /NP4|HxB/N(-JHx // N 6`&@$+@&+DBB" (*cBBr¨\*f!B`!Cd/ /NP$C`|pe Ѐ0;N *B60*dHr€-A` *d`@ *dA`4 *d`( *d(VID`$jBt-B-Bveҁ2;N:v`Jg$jJfEHxB/ N( p`,JgJtmtp`Jg$j8Jg B*R// / N 6 `hJg$j@`Jg$j<`Jg$jp`Jg$jJgB`Jg0x`JgA-@pE`Jg|`xpE`pE`pE`x jx g$z g2p fNBx٨d*(`ۃ!E`/9>NBP`j k8JfB kNBrӨd&(`׀!C``B`-n, n$($n0JfHxHxN PJg@z!E*hB--H0||r҄-AHxHnHmN)0 n,P(P BBhE"n n< Jfz n0Jf n4JfF n8Jg h+ n8 "8` ***gF fP jH~LeD (PШ\"*҅r\Df**jP%E(J`"*҅ ~\` n6HxHxN (HPJg Hx/N P,fNBrӨd$(`Հ!B`/9>N*Pt7` P)@ ,"*///N)0*l/ N "-L0B- lR(`^$B5H\ n &<(<*Jg~/"CNBrӨd$(`Հ!B`/9> DNPBtIE` n4Jg(Jg h< n4$h .4"`Z"@` n8JgVJf`"@`"BJfTJ fNJfHr®f DNPEBt-/.N "X`"B )g/"CNBrӨ\*(Xۀ!EX/9> DNPJfHx(B/.N(-n ,.JgJ@gCH-I"+tk.$B *0.fJgzFʁr㭊 B rg B@ n*h-|BHxHmHnN)0B *@ -fJg kJg//(N#$HPJgJgtĮ.g nJf"(JB( * PHx//&<)0"CNHn/ /NJJf:-|hBlHx/Hnp"CNBHnhN Jf .f *rҍHx//-A"CNHn/ /NJ".Jf -|BHx/Hn"CNBHnN Jf .f *1fJf . gHxBHnN(=|Hx/Hn"CNNRd&HnN#*CRJg> (r€f2g&/NXvJ:Dg@ y:, h((`Hn Hx.G/ N// Hy2"Hy+2oHxNGN /9>NBrӨd((`ـ!D`/9>N*PJg l| PBrӨ\((Xـ!DXSgt1`JfT~`@zF`"B )fJJg$nj`6y:`*Jg/"nB0/`jHxHnHn/ HnN*$f / n hHB0(,/N#$HPJfBHn/.N&"@$Pg./9>"CNBrӨd&(`׀!C`/9> DNPB`tĮ.fJg j| PBrӨT$(PՀ!BPB`"hLBzۨD.(@߄!G@Jg(i / N#XJg./9>"CNۨd (`ф!@`/9>N*PBB`DHnT/ N#P~`vDk/NRXx؍"n- nJgr)7gh g-i0hJ g"n "gF-|BHxHnHnN)0BHnHxHn/N&"Jg~Jf (H*(d-nJf"@*)Dg`//N&!P`PHxHnHnN)0HnN#*CRJg/N` /NXv`"n-i (@@!@Jg j| PBrӨ&(׀!CJj0m`/9>NBzۨ (ф!@/9>N*PJg j| Pۨ\"(Xӄ!AXt3`"n-i f`p/ /Nu PJgJg "nJ)g/././ NP J-g"*1f -fJ- f:/.N "XB/./.N&!P(.иf /N&"XHn@/ E#HNPJg HnT/ NP/.N LN%Ѷ$f nJf0/9>NBx٨ *( ۃ!E /9>N*P`-h-h( (,Jg+gJg2/9>NBrӨ$(Հ!B/9>N*Pt(`Jf".[I&*@(*Ddt-EGHx$B/ N(A-H/ "F/)HxN /9>NBrӨ$(Հ!B/9>N* `~JfںdJgNRd$"nHi/ NPJg"n")([IӨ$&( ׀!C /NR n$*FĨ,p0Xg8*1ggJ:}fgJ:}4g /NX nxɨ,". . g//.// / N$`d//.// / N4`Jg2/9>NBrӨ$(Հ!B/9>N*Pt`. bJ/9>NBx٨*(ۃ!E/9>N*PJg0 j| P٨l (hу!@h`"nJifN/9>NBrӨ$(Հ!B/9>N*PJg j| PBx٨l*(hۃ!Eh`:|(N -@ czFEpڀpʀrmJ/9>NBvר((ق!D/9>N*PJg` j| Pרl*(hۂ!Eh`H"nX-I n8Jg h, n (,r0€g8*1ggJ:}fgJ:}4g /NX np,&n& 2 A=AƶmFJg j| PBrӨd&(`׀!C``l n4Jfr n0Jfh"n)|,``HxHxN b-HPf/9>NBvרd((`ق!D`/9>N*Pt7-kB/ G "NXKRd&<(<R*<4 nJfJf/9>NBrӨt&(p׀!Cp`zB +v!@"n""nA-H()ع?#DHx(/./-IN)0"np(#@ d*Hx/.Hx(/ -IN +<"nJg""H "QJf @(f-h"h" Ard|".P @!A0M@"҃m*.3@B)#n2n D1IHx/// N +<Jf^/9>NBrӨd$(`Հ!B```HxHx-@N -HP .Jgr!A"h @ `^@`p"n "QJf"@" nCX!I(B /9>NBrӨ|((xـ!Dx/9>N*PJg j| PBrӨt((pـ!Dpօ`4,(BJf`$(N-@ BHh/ "CNPJg"n")([IӨ$$( Հ!B /. DN/./././ / "EN$-F`/NX`E`v/9>NBrӨ$(Հ!B/9>N*PJg l| PBx٨\*(Xۃ!EXtA`/,O n hJgR"h8BJg)R"h0$nG r&@/N(*("9:$LA(&[I,֫Ն%B0%C4 <B@LALЫ%@8X B@oB|܃ۂ%E0%F4%@8/Hj@NPL |N^Nu/,O/ $np(g2Hy:NBHj@NXHxHy:NZp%@($nN^NuNVH?<(. "n(i y:, (.!@v֎/Hx/ N&H ,<fJf/ FNXLN VBtհ&0ׁ!/9>N*PJg8 l| hBrӨ$(Հ!B l| h gtӨ&(׀!CHy:NBBHnJWID/BHy?/ NP~ HxHy:NZP`HxHy2\`Hx/`B@`BrӨ $(Հ!B`NV/ / $nGHxHy2,/ N)0B/*/ NJJgB(B$Hx/ HjN)1 Jg * fp%@(B$$n&nN^NuBHx/ NN r L9:LA%A(p%@$/ N`/,O/ $nHxHy:NZPp(g%@(p$f/ NX-|:$nN^` BHx/ N `NVH?<(n*np fBHy:NZ y:, ((!@zڎ/ n/N#$HJf /NHy:NPpLNB~ߨ$ ( ц!@ /9>N*P`PHnHx/ / N +~Jg$nCc Hy+3NK.` k (g/ N "XHn/ N#HP`(  ftԎHxHj/*<)0"ENB/ /&<J CNJf gv f+f *fHxHy:NZ/ /Nm$HJg$R /NB$ * S%@ Xf/ NXHy:N/ N "`,1f .g .fx؎HxHy2,/"ENB/ / CNJfB6*HxHy:NZ$lP*<)1Jgt-R. PHx// EN Jgp* gfp$g^ .gHx// EN Jf8Jf-@ n(<RJgIG,<#N.<&Z*<Jf4/ DN y:, (!C/9?|N6PL ENc0 ,fDr)A/ HxN&ZN*@P/ / FNP` ,gr€)A/ Hx GN`N*@`NVH?<$n&. j|&hp+gJfLNRd"*-A nJgJfbB/NRXJgpHjHy+R[HxNGN g + fTr 'A B/ NtP'C LNBtը (с!@/9>N*HxPB/ N(pL N^NuB( JgЈ%@@ef p%@HB@B gb4S b8JgNJ:DgJ/Hy2"Hy+RHxNGN`, c gJ:Dg/Hy2"Hy+RHx`%R:Hod/9>NBtըD (@с!@@/9>N*PJ:DgHy2"Hy+S7HxNGN B`J f%H %HL`JHg`/,O"n n Jf i|Jg (g -@N^`dN^Nu/,O/ /$.$n HyHx/N#/ /Np-@ -j$.$nN^` iNV/ /$n $.-|BHx/.HnN)0BB/*NZ j| hHnp // hN$.N B $.$nN^NuNVH 0&n -|BHx/.HnN)0BBE/ N&$Hx/+NZ k| h// Hx / hN$H(.NXJg /N&XJg5|h J L N^NuNVH 8&n$n +fd+  fVIHx/ / N)0/ N JgB`&Hn/ HnNJ Jf".WIDLN^NuNRd$/ N#*XCRJg f /NXp`/NB/ HkNJg HhN`B/ N&PJgjG&(6gJ"hHg )g *4g )4f(f"/N`"*g )4f )gⰁg/NX`/,O nJg&Hx/(H (P/N -HN^`EN^NuNVH < .$n (n l|&h isgb6 iqgt irg iUg iVgB L<N^Nu HiWgb 0iLg 0iNfGHxHj/ N)0B/ / NJ$fB/ / N&H JgV0hh%H(B0+b%@ 0+j%@$(kX*k\JfJg$Ntҍ%A,HkNX`N Hilgb Himf:*,g$*g(g"'BN "*A€p p ҂'A * g'@/*$/ N8P`B`Hx8BHjN(|-S,%k%k %k $ `S%k%k%k `*g$*g(g"'BN "*A€p p ҂'A *gV'@`N/*`RB`t`NVH?<$n*. &...,.(. j| h(g/N "Xv2 L J LNBtը (с!@/9>N*Hn / N/ N "`L ЍnL"kJfzHn / N/9>NBrӨ$$( Հ!B /9>N*LNBrӨT$(PՀ!BP/9>N*/ GN `*B@`L'|Bp'@ "n'i $P$B/ /NJ Jgf/"GN/ N "P`/N-|BCHx// -IhNBHntBBB/BBHnN*0"nhgNJ:Dg/ Hx.G/ N// Hy2# Hy+AHxNGN `fHxBHnt"DN *t`/ NX,gRB,5p ڀrʁ۪(۪r҅/BHk@-Ah"DN|@EAB,5//HkBN".h`r`/,OH <$n(n &l R0+0@A @Af>B"*tLBrLKDHx/ N R/ BHl`B/ NL<N^NuNVH8&nHy?N$kXJf-|?LN^`z *DfJ6| Hj`Hx.E/ N/ / Hy+UHxNGNHy?N6 LN^Nuf(6| Hj`Hx.E/ N/ / Hy+V$`rlRJ:Dg"pЪ /Hy2"Hy+V]HxNGN/ NHy?N6/ NF/ N#ْ`p"+ lB/ / Np/ Hz j h| h (L9:L|/HkN`r€%A/ HxN&ZPJ:DgnHj`Hx.I/ N/ pЪ /Hy2"Hy+VHxNGN `2NVhH?<(n&.tԎpĀHx(B/.<("GN*tHx/. /K)0NB,5&@ " p€&A@HxHxN b$H Jg,?o*Hx/N P*f/ N XL<@N^NuB .tfjJg.0,,=@l=|nr@%A%A(&j?%K&`7|: .tx|,<&"Jf0-|tBxB|p-@B/ /NJ JfHx/HkN-|BxHx/HvHNBzHvX/N&"@ Jf\HkBBB/BBHvXN* gTJ:Dg2HvHHx.G/ N// Hy2"Hy+AHxNGN /"FN/ N "P`B@`7|(Hx/.z0HsXNHsXNxJgJf/ NX*f*r`p"n )f),5fB)C* B,5r ؁pȀ٪(٪r҄/BHk@-Ah"GN|@DAB,5//HkBN".h7A'C,Bk*/Hx(Hx:/ N7@*BBHnlBBB/ NP~,Jg0 l| hBrӨ&(׀!C l| hӨ&(׀!C/9>NBrӨ\&(X׀!CX/9>N*/ FN `PNVH?<*n&. (n$m(HxHj/,<)0"FNHxHjHn"FN-y:$/B0- /N#$H *<NBrӨ$&( ׀!C /9>N*// ENLNBrӨ$(Հ!B/9>N*HnHx/HnN)1 JflJ:Dg2/Hx.&R/N/Hy2#Hy+WHxNGNHnJf>Hy?Ntԫ Hk`Hx.E/ N// Hy+X HxNGN ` KHx/ NL%K/ N#ـ%y:~ BBBB y?%H #? J:Dg:Hk`Hx.tHv(NHv(pЫ /Hy2"Hy+X=HxNGN $<JfH/ / N/ HzX k h| h (L9:L|// BNHy?NX`D/ Hz// BN`/,O//&.Hy?NBB/N$f-|?$.&.N^`j/NHy?N6/N -C$.&.N^`(NV,H?<$n$. *n(.,**,.PHx//N)0&NX < f <`z gZ gHnNXJlJ:DgHy2#(Hy+UHHxNGN // NP/ N "XL<N^Nu .,048g Ѝn@ jJfn/9>NBrӨ$$( Հ!B /9>N*// N`Hn/ // N +~Jg$. Ѝo Hy+3NK. h`HnHmHhN ` .,f.- gKJ:Dgd/Hx.$R/N/Hy2#(Hy+XZHxNGN/9>N <Btհ(0ف!/9>N*// N/ N "` Ѝn"jJgHnHmHi`6Hn/ // N +~Jg$. Ѝn"h` nBJg(B+5r ҆t‚fTB///// NZ` J:Dg$UK*2 gK* /Hx.*R/N// //Hy2#(Hy+XxHxNGN(`@/9>NX`/,Op-N^Nu/,O/ $n*g0HxHy2\ */N)0j B$nN^Nup9`/,OBN^Nu/,Op-N^Nu/,Op-N^Nu/,O/.(/.$/. /././././. /.Hx/9?N%N^Nu/,O/ /. E "N/.Np-$nN^NuNV/ /$n$.B *df j(0(@$g//. Hn/ N /./N /.//. *(/N JfT/*(N /E "N/.N/9?NBtը, ((с!@(/9?N*$.$nN^Nu j( (4gHxHh/N `/,O/. n/(NBN^Nu/,O/. n/(NnBN^Nu/,ON^`/,O/ n$h:fN *gHx /NBP-J$nN^` /,O/$./N V/NB$.N^Nu/,ON^`/,O/.N BN^Nu/,Op-N^Nu/,O/$. /9?|N/Hy?N¤/N/Hy?N/9?|N6B$.N^NuNVH00$n f n&h 9?-@ .ft1 L N^Nu g *f/9:/ Nr$PfJfJ f gNRd&Jf6J f0Jf*Jf$HxHjHkN)0 /NRX`x/ N#*XJgpgt1`t`X/,Op-N^NuNVH?<$n n&hB 9?-@ .g g *f f(*.9:// Nr$Pf y:, (&!@zڎ/I/ Hn, /Hk8/+/+/ N$ f2 .PfZHx//K)0NHx/ HkN/.N D/ /.N#H y:, (!CP LNprӨT$(PՀ!BP/9>NP`NRd&B0* /N#(X$<*<RJgJ"n // BN$"D i| PBrӨ,(((ـ!D(/ ENP.HxHx/ Nr`f/"EN"n // BN$`/,OH0<(n*n $n -fb f\peVApdpgpfLG2Jg&*&jJfR$CHyj/ / B/ B/ Hy?N ABL< N^NuJ4p2"jgG2Jg&j$j`* BBBHkBHmHy?NNJg(gWID// NwbP`jB`EG2`ZNVDH?<*n(n *wpʀ-m(PBT y:, ("-AD!@$lJg l6hN9|/ //*//.N?v$ff,,f` n((&9://Nr$Pf̈WID l h:f^pe(Hx/ N #\*HPJft7K`,*`B` mBB(-AH -f"-f"A `.BHB` f mHtLe"- hP t'dpЁ+@r(ӭJgr-gt(խ(&m..PHx/HkN)0A8-HLHkHn\HnTHj//*//.N$,f .TfHx/HkN)0 *&`j/.T/ N\@Hn\/.TN#HBT l h:fV+0|`\AH`HxHx(/ N "*H `JgrB//NJ$ g\/ N "X`F jpg+rPdh .PUb\G(BnXHx(X/Hx/ / K #N.g/.PHx(//N=@XHx/Hx/ /N*H$JgBXHnX/ /*B/.L// NP~$"lAE* i:ft"nXJgH&i|&kBrӫ(+ـ'D n& lpg:mrgxg/9>NVBrӰ8(08ـ!8/9>NPJf"Hn\/.TN#H y:, .D((!@ L<N^Nut`n "i|reЀ0; "iN(>Tjxf\"i|"iBrө()ـ#D`>&i|&kBrӫ(+ـ'DpHf"i|"iBrө()ـ#D`"i|"iBrө()ـ#D`"i|"iBrө()ـ#D`"iBrө()ـ#D`Brө()ـ#D`Brө()ـ#D`zBrө()ـ#D`dBrө ()ـ#D`NBrө()ـ#D`8Brө()ـ#D`"Brө()ـ#D` Brө()ـ#D`Brө()ـ#D`/9?NBrӨ4&(0׀!C0/9?`/ N "XHx/N60/.N " `NVH0 $n&. . j*gZJf-|BHxHhHnN)0B /.Hn/ /N$B/N " L N^NuJg,Hx/HnN)0 .f .gt`t8`t9`t/`NV/ .". n"PfT  fPJf"p-@HxHn/N 6 $.N^NuSgB`Hn/N DPJfJfp`t)g-H-A -@$.N^`z""htimtdmtf$.N^`otetf-H -A$.N^`YJf-H -A$.N^`VNVH00$n/ N B j6hN9|/ HxHxHxB-|Hx/./NAR$ f0B@ C bF!/9:~/9:~/ N B$ gB@F L N^NuHy?/ N $PfB@F$jnp%@HxHx N%HHx Hx/N(`/,ON^`NVH 8(n n$P&T Xb> jJfp/9>NBrӨ $(Հ!B/9>N*P <`RHnHx/ / N +~Jg ."Xc Hy+3NK. h`J(fB(RєBLN^Nu/9>NBrӨ$(Հ!B/9>N*HkBHx/ Nr`Z/,OHx@BHy?N( N^Nu/,O/ $nHxHx@NT B2*,!A2*,!A$nN^Nu/,ON^` p/,O/ $n f* gZ gXp`& f(*S b0 2#I$nN^NuHx/ Hy2LN)1 Jf *fp`p`/,O nJfJf (fr g/NȺX 0 ?N^Nu/,OH0 $n$*fJ glHjN*  f6B6* Jg,NRd$/N#XCRJf./NXp` g BL N^Nu* S b`/NBj %CX`/,O/$././. /N  Jg/N XJgB B $.N^Nu/,O n f( f1n` f(S cBN^NuNVH<$n*n (n m|Jg&h Jf*HmHy2#Hy+YHxNGNpL<N^NuJfZJfTJfNp fF-1f4/ Hx.E/ N/ HmHy2#Hy+Y7HxNGN `JgBB`/ NȺXrg@m(rg,Ug.BJg(-@ -JL<N^`Qf + ` +` +` +`/,O/.NȺXSA,Or e p 2# N^Nu/,O n f( gB`$ f(S bJhVIDBhN^NuNq/,O y:, ."(!@N^Nu/,Op-N^Nu/,OBN^Nu/,Op-N^Nu/,Op-N^Nu/,O/.(/.$/. /././././. /.Hx /9?XN%N^Nu/,O/ /. E "N/.Np-$nN^Nu/,O/. n/(NBN^Nu/,O/. n/(NnBN^Nu/,ON^`v/,O n (4gHxHh/N N^Nu/,O/ $n j(1nH/*(N j( (4XgHxHhX/N $nN^NuNVH 8&nB(kHx/.N .$HPJg ,df l(0(@$g/ /*Hn/ N /. / N /./ /.HkN JfP/ E "N/.N/9?XNBrӨ<$(8Հ!B8/9?XN*/ N LN^Nu/ NX`/,Op-N^Nu/,O/$. /9?|N/Hy>N¤/N/Hy>N/9?|N6B$.N^Nu/,OB@ @ bF!N^Nu/,O .B@FN^Nu/,OH0 $n/ N B/9:/9:/ N B$f.N&Hy>/ N $/N Jf jp!@ L N^Nu/,OH00&n$kJfNJfHJfBJfBBB/.Hy&Hy+@Hy+3?HxHxBBBBNHHxHxHxHxHxBBBBB/.HzzHy+YHy,liHxHxBBBBNHHxPNL#?XX$nN^`GZNVH0<$n*n &n -f6 f0pe*Apdpgpg &<J2p2"jfABL< N^Nu&<jJg"S + $+(kJg"X(cpfB/ NwbP`ABB/Hx// N &pfNNJVID// Nwb$/// B0.// 0.// Hy>N `&&<jI2B/// B/ B`&<`BI2`NVH80$.&n $n k h(N &pgrg.t//N L N^Nupg(/ / /N$ `rg/ / /N@2`Sf(rdf<&kHn/ N D$Pf .gUgt` +d@'@d` +d@`t*`tNVH?<..&n $n*n&pgrgB L.<)1Jgzrf4mbf.JfJf JfJgHx/Hm GN Jg"*m`JfJ f fJ-fkJfJf JfJgFHx/ Hm GN Jf2.m`f/-(/ //NR"m(0)@f` .f fJ-fj`dBB//?.Bg/ Hy>NN$HJfH/9>NBrӨ<,(8݀!F8/9>N*B//Hy>N$HJg* jt *(Jg(/*x/ /// N,pgSf|`&/*(/ //N`/,O/ /$n n *gJ:}fB$.$nN^NuJhf0/9?XNBrӨ$(Հ!B/9?XN*Pp`$*,B0* /N#p r Xt gr$f /9?XNBrӨ$(Հ!B`/./.Hx/ NJgT`NVH8< n P-H"n $*h/9?XINBrӨ&׀ /9?XG*N n&(( PPbX$hJgB0*Jf bg/9?XNBrӨ$$( Հ!B /9?XNP/.N "X`dHnHx//N +~Jg"$n Pc Hy+3NK.`tB/9>NBrӨ $(Հ!B/9>NP <L<N^Nu .Jjgt/// /N8Jf\HxBHn(<("DN=|HxHmHn&<)0"CN=RHxBHn"DN=|$HxHmHn"CN=j/HnHnHnHxN Jf 9?X n(g/NBrӨ4$(0Հ!B0`/NBrӨ,$((Հ!B(/9?XNBHxHx/.NrB`nNVH?<$n&n (n(. wr€-A -k(BBJf0Jf,*JfJJfB *fJf2p9` g$t-B/ N "XJfp .LNBrӨD$(@Հ!B@/9>N*B/*p/ Hj8B/ N(`/ N "X/N "X`/,O// n$(N&/./././. /NB$/N $.&.N^Nu/,O//$./9?XN Btհ&0ׁ!X-y?X$.&.N^` !^/,O//"n n B"1$1հ&0ׁ!P f$&N^Nu/,O n BBfN^Nu/,O/$.N N'NeNxh-B$.N^`/,ONNxNf.N'6N^`&/,O/ HxHxN$HN%HHxNL%H%n %n/ N/ N]8/./ N3/ NC.Nx/ N}/ N / N. f / NX J $nN^Nu/,O/ $n/ N/ N/ N / N}/ Nzd/ ND/ N3/ N].N ~/*NHx/*NdHx/ N$nN^Nu/,O//BN'6$//. /< Nf/.NN&/N'K $.&.N^Nu/,ON^`\*/,O n-hN^`/,O/ $n/*NX-j$nN^`/,O n h N^Nu/,O#:N^Nu/,O y: N^Nu/,OH0 $n$. /*N Btհ&0ׁ!X-jL N^` /,OH0 $n$. /*N rtհ&0ׁ!X-jL N^` @/,O/$. HxB/N(HxN/Hzr/ n/(Nf $.N^Nu/,OHxNBHzr/ n/(NfN^NuNq/,OHxHxN N^Nu/,O/ $n g /NX *g /NX *g /N$X * g /N2`XHx/ NP$nN^Nu/,O/ /$nNX$/ NB/ NF /*NB// NEG'II:KHnHn/N* gpg@Hy+Z$Hy+ZC/N'C\B-|EHxE/.Hy+ZO/N'Bx`~//N,PJg///.N `///.N( gtpf/Hy+ZHy+Z|/N'A`(pf //Hy+ZHy+Z|/N'A`NVH>0*.&. ,.Hy+Z/N'@fPJfB n B L |N^NuNX$HnHy+Z/N'Kl$H BGMƸd  n/(///N&gXHy+Z$Hy+ZC/N'C\B-|&Hx&/.Hy+ZO/N'BBHx//NZ(.NYX`VR`NVH< (. $.*.//.N&PfHHy+Z$Hy+ZC/N'C\B-|MHxM/.Hy+ZO/N'Bz L,.(. &.BHnB///N$f*. n BHy+i[/N'3& JfHy+Z/N'?xPJgjHy+Z/N'I//.N(:JfHHy+Z$Hy+ZC/N'C\B-|Hx/.Hy+ZO/N'Bt/N*X``/.//NfD Jf>Hy+Z$Hy+ZC/N'C\B-|Hx/.Hy+ZO/N'Bt `//NP L|N^NuNVH<<$. (.&nHy+Z/N'@fPJghHnHy+Z/N'Kl$H cNHy+Z$Hy+ZC/N'C\B-|Hx/.Hy+ZO/N'BpL<BHy,a/N'2@//./ /NNHx///N,`/ NX`B-|HxBHy,O/N/N&H//N $f//NM $Pf/Hy+[//I>N$fp/Hy+Z/+/N$fX//+ /N(b$ fB//+N#$Pf0//NH$Pf N/Hy*/N'B /N$`BBBBBHy*%/N$BHy+[/N'2BHy+[/N'3&.(g/NX"SJg",(teҁ0;N,|Tl,pehҁ0;N\4LHn/( ////Nv$Jf@*.///NN$ f(/Nj-@-A//Hy+v/NBB/N$ .Xg/N*`HnB///N($`-|-|HxHxHy+v/N-@-A////N$ Jf/NJ/NP`rBBHnHy*/N'3 ."Sf>////N$`////N$` //N$P`t` ///NP"$ `tK`NVHn/.N PJf pN^NuB`NVxH?<$n*n &.G r&@/./zڎ// $< BNIHx8BHn.<("GN-J-E'C BBBBBBB/ ,<: FN  gp-@`lDf(./Nd-H .Xg^J,gXHnN!XJgHx/ -@xNb/.N "HxB/"GN .x-@ .gh/N$J`ZfnB/NXJfnHn// NK\$ gHn/ /NJ JgHx/ NbPp-@/// NlZ-@ `pJ0g/.HnN=hP`( .fHx/ NbPBL<$.$n *.I r(@/./G/ /Nv֎Hx8BHnN(-B-K)E BBBB/N9 Kd g/ N$XvJgr/N "BX`d/ N,XJf/N`(/NHx///N,<v*<bJf,// FNB/ EN/ N$JgbB L<|lN^Nu/ /N4&// FNJgHx/ EN/ N$ `LHx/ EN/ N$ `/ N$X`v `/,O n(g ((N^NuШ PJf`B`/,O n"P!I!iN^Nu/,OH00&n$n &.$.// N5>%k$%B %@P-JL N^`/,O n h N^Nu/,OH 8$n&j/ITN$.NX"*҂ LN^Nu/,O n P N^Nu/,O n . VDN^Nu/,O n . FN^NuNVH00$n j . Ъcv&R-K/ N,$.NX&k n r@҈vƒc"/HnN  nPffJf&A L N^Nu$%HԨ%Br` j`/,O/ /$n$."j *Ю ")d,Щ i%I%HJg"-B -J$$_N^` QJgҨ"H` $$_N^NuNVH00$n&j-K j$"Ү n$ +gL f "kHpLd2&Hx/BHnN "Jg"HxB/ N( A L N^Nu nf$%H h%H`/,O/ p f@ n$P *,g/ N p,X%@,p$nN^Nur0g / Np`B`/,OHxHxHx N  Jg!n//. N PBN^Nup `/,O n/. //N N^Nu/,OHx n/N 'PJg"n "BN^Nup`Nq/,O/ n "h)$t‚ h !i(B2),!A$N^Nu/,O/ /$. n $h/N XfB$.$nN^Nu//N(:PJgFԂD/2,B*$//N. JWID`/,ON##:HxHy2$8/N#>HxHx/9:N#VN^Nu/,O/9:N#&XN^Nu/,OH 8$n&n (n/*NdX(gR ((&'@B'L 'J*$tLt()j(B0*,)@LN^NuЩ"QJf`"HB`/,O"."n 9:Jg -A -@N^N-A-@N^`$/,O/. /./9:N# N^Nu/,O . //./9:N# JVDN^NuNq/,ON^` l/,OHx/.N N^Nu/,O/$. /N)/<./ n h/(Nj" $.N^Nu/,OH>< n&h$SK)/<&<m(<Jf$/+NpHx/ N L<|N^Nu*IB *erL @Hh/ "DNP$E`,/N.//+"CNR `NVH?8,. BE'6N&BN$ n h(PPG'BJgTEB`B**[I j"[I-@-A////N-D-E//.//NR e(T`/Hy+t/E'CN/Hy+[-/NBLN^Nu/,OHx/.N "n". #N^Nu/,O/ /$n/.$. \/2,NB,P$.$nN^Nu/,OH<<$. n(hvL8Hx CHhN&HE//. / N)0'BBK)/<*<jf&(L<<$n ** BING'KKhb,<'FfB`* Z&(//.N$Pg$ `>/,O n ."n2), Ag Ag"Jf` Jf p!@p3` !|BN^NuJfp `p!@`NVH8 $n&. (.J*fTJ*gB/HnHy4/NRgJ/.HjN\PJVDJ*gdJ*g^BJg"`/HnHy4/NRf p9LN^Nu/.HjN\PJVDJ*frJ*fB`BJf `p`p`/,O n"n #P (0"(4"#A(gBN^Nup3`/,OH <&n$kI(&<6Kx؎zڎ|ܮ JfB`"/ CN4*0* Xc/ NXt L<|N^Nu-@HxHj /N)0BHxHth/N$/ NJf$R`/,OBBBBBHy+[BBBHxN-#:(N^Nu/,O/9:N3&XN^Nu/,O/$.Hx  @HhN  $.N^Nu/,OH 0&n$n $*$J,fHj,N):P',XBL N^Nup`/,OH 0&n$n $*$ s,%h,,B,N(-J Rԋ-BL N^`/,OH08&n&BI)/`fE J L N^Nu$[JgHj0/. NPJgR`NV n . d 0 -@ n N^NuA`NVH?<,. $FXBI'6K'C\G'B(<'F*<'K Fe BLHxBBNo$ f(HxP/ NPE`4HxN($XgBHxHxHj(N{4%B %n $ J L N^NuHx/N$Pg//./N)0%CBBB//N([%H f/*/NP`\/N(]&%@X`r/,O n ($N^Nu/,OH?8$n(n &.$.". ..#6F"RA,. cT> JfJ<fDBSB~e8/ N)/ $. . &.*.(. gE/ /rF€//N7$ gE/ /pF//N7& ///N)1 L|N^Nu/,O/ .". tg tgp` B c$N^NuB }b`/,O/ n"h4$n $$n$B0)$n$ (g"h0B0)($_N^Nug"h0B0)2|((Љ`B`/,O/ / $n j&PHx/N"+P <JgHx/Hj N)0 <$n&nN^Nu/,OH?<$n&*I*LG@Hx/N/(<"DN g gBHx/N P`Hx/$<"BNPJg rrd//"BNPJgB4(VID|$C %IC%I r<€%A(B@( 5@,%H0p(fd"*(0*, @gbb @gb @gpHx/NtPJf %@ L<*n&.(.=n m4 $@Jo$-/N/ pЭ(//N@,g"Hf*vHx/NtPJg / N $n&. ,.*.4*,(//// N?Jf pL|N^Nu/// N?2 JgJg Bgb Bg BgpV` B:fB`/// N?^ Jf`/,OH< "n$n .&. n \ q&)g 0bv hgzrCBb(*gp8SDr*D@p*@1*2pB0 B4Ђ$xgB0 R fB1BL<&n(. $.BBBBHy+[/I'2N&BHx/3 @N3$HHxXB/N((HxHxHj0N{4Hx/ NbBBB/.Hy,x/N4$BBBBHy+/Np€%A/ NBHy+[c/N'3& Jf0BBHnHy)/N'3Jf&/ / NFPp`R// N4%@Pf`r$fHx$/Hj4N)0BHy+Z/,<'3n"FNJf/ NT(HBHy+[/"FNJg/ // *<U EN Jgl rr<€// NT*HBHy+[/"FNJg>/ // EN Jg* r制f 制fB/ / /$<Y BNJgHx/ / /"BNJf0/ /NZ.P`/ /.// Np:%H$f`/ /NZvPBL<|N^NuNVH00$.&.BHy*/. N'3n Jft L N^NuE/ //NU JgHn/ /NYB Jg0 (-@ ."(-A".G(rE):pYg / NXt`///N$ .B-@//.Hy)/N'B/ N `\NVH<8$nv֎pƀ/ NT&H rr<€// NT( *-@*.4/N2I4NR// /N^/ C&(,//// Hy+\NDr0.GW8N/N/ N_F *$ g /NrTXL8&n&. n"n".fRp$*x(.|&B81z묈q 'DE p|f'P R'P pL|N^NuBr`//HkI)0N T//HsN R`/,OH 0$n&n $. n rr<€&B0"nrF€"01j rgrf:/Hj/N)0 r€ -@E-J pЂ-@L N^`L N^Nu/,OH8 $n&.$. r"LT//. HrN)0 JCg"JWIDpF@嫀%@LN^NuNVH8< n$n (."P(i*h0(,($Bn&h8Jgb r$RI)0Jg>("+$HA%AT&/Hs8HjN/HkHr8N L<N^Nu// / N ` @g0b @g @g"B` @:ftFĨg"h42)=A` "h4=Q2)=A/HnHh?Bg// NQ$JfJgr -gj`dpJg"-gJgLr`/,O0|X N^Nu/,O . ^0|  n N^NuNVH08&n BN'6$HnI/ HnHn/ NRV .B-@//.Hy,x/E'BN(B2.B-@-A//Hy*/NB0.B-@//.Hy+\I/N&../ Hy,J/I'BJN/HnHy*-t/N "3 g*HxG/ //.N5/ Hy+[c/N'C\JgB-C/BHy)/N B L N^NuNVH88$. $nBBBBHy,x/G'2N& cB LN^NuBBBBHy*/N=ABBB/.Hy+\I/N=ABBHnHy,J/I'3N-HBBHnHy*-t/N-H ."S(fvfnBHnHn/// NQ(gNBHy+[c/N'3& JgH//.N4&Pg"BBBBHy)/Np€JgJgpᩃ`B`NVH00$nHnG/ HnHn/ NRV //Hy+\OEDrNB6.$../ GAN//Hy+\fN6./HnN//Hy+\lN(L N^NuNV/ / $nBHjN(PJf $n&nN^Nu (-@ ."j!IgG#K%HC!I @`NV/$.Hx Hx/N -|+\v-H-|r-A-|-|+\~"X-Ar2-Ar -A-|'-|+\P-@-|-A-|'HxHn/N$.N^Nu/,OHx Hx/.N N^Nu/,O/ HxHxN$HHxBBNo$BB J $nN^Nu/,O/ $n/NpHx/ N $nN^NuNVH08$n&n *<-@(n $rR/ N`&// /Nj"$Gvf// NP B L N^Nu F nr€ pĀ BHh(N):P// N `/,O// n rRJWIDB@ C bF!/// n/NjB@FWD$.&.N^Nu/,O/ n rRB@ B bF!// n/NmB@F r @$.N^NuNVH08&n$n & XI( +-@$.%B/ //N fL N^Nu/,O/ $n/ N j $nN^Nu/,O n Jg hJf n h N^NuNVH?<&n$n .nK r*@/N2I8/ N/ N $<LJf*,- k &*jJf*j%MBJgJg/ / NZP.-E-F/// / NL(Jg2 mJg!m m  j +HgC!I%M A +H/ / NLRPfBf%G*GS`l mJg!m m  j +HgC!I%M A +H/ / "BNP*jJfB%M/ N6/No\&PJ.g&JfJ g/ N/ NJ/ N$ //Nov k "+xPJg> (l "(o '@xIFJ fFLB`8p`Jf6%D.R%G B0 JgRHs(B/ -AN= ".f -s` fJg.g&Jftf(*-DJg *f JoHx /NbPBL,,,$B*l*BHx/9:N3&H JgHx/Nb&'n$ PK$rJg//Nk<$n&. ,.*j *gDjJg/NL&HXJgB0(f PVIDB// N RPJg / NX`Jf&Hx// NGZ& *f/ NXt `B// / N&H Jf/ NXJgt `8/// N/,/ // NI>$g/ /NkHG*"E*, f"[IH@HA0BA`dȓd "F*, f"[I"|鈀"`8BB`4NV|H?<(. &p , R/</</BN(4-@-A$G(Ԕr?„/HxBN .-A-G-A$n-B|$*&*Bxȃ-D*.f *@ r( *D *.-E*.-D(.*. <ـ".F .F„-A-@".fx/Hx-B-C//.N(* gRHy?\N(j*jXA6 " gHy?\NX`%D%EHy?\NXpL<&nI Km$kJf /No\//Nov L<|N^NuB&T 2>"2>Bzʁ,gHx|́/NPB>B>Rp@f jJg!j j /*/ /NHx / N`r/,O/ $n/ Ny/NpHjN{VHx/ N$nN^Nu/,O/ $n/*HNz(BHX$nN^NuNVH> n ( -@(. (-@ .&ReN/./. /N* g8N LC$ԄE4//NPJg 0L|N^NuRLC $ԄfB@`/,O/ /$n$././. / Np Jg( mn-B -H$.$nN^`B$.$nN^NuNVH?<,././. /.N&H Jg$8DB:5p?/HxBN(Ԕ -@-AF-@F-AR/</</BN(4-@-AE(*GI6$*&*Brƒ-A,.茮f "~懲",.ij-F..-G .".,<ц..F,.F†-@-A..gHy?\N *"*X,.gHy?\NX`N//-B-C//.N. @"A%H%I-|?\L8(n*. ,.$T&jL/ N`& + -@(.XBf-C -JL|N^`j TA -@ nJg /// N R`NVH<8(n$T&jL/ N`( + -@*.XBfB`( A, -@ nJfR`/. / N$Pg// Nv B LJg / NX jpJg!jtt jt pBl/ NPX d$$F`Jf / NplXz|ڊ. "E Y* Jf *x 'br cp `/ NXf`/ N6BN/,OH0<$y:Jgl/ N|G/ NP/ N6&*I BK jf8JD"cX$i "iSfx J$IB4B// ?Bg//N Jf// /N Jg h(Jg (Pg/ n N n /9?|N6PB`x20(&<>`~ I2A20 `gT j40*, @g @f>2P0(&<>` 2P0(&<>X j0E"PSg 0I2@0 A" $HB4BB// ? Bg//NNJf@B// /N`&/,OBN^Nu/,OpVN^Nu/,OpVN^Nu/,O0| N^Nu/,O n h N^Nu/,O n !nN^Nu/,O/$. Hy;}@N y?XJgJf-|;}@$.N^`L!B h`/,O-n N^`c/,OH8$. &.(.NR-D-C-B -HLN^`u/,O/ /$. $nNR igb2 ikg i g @if*-j -H$.$nN^`Z i g ig$.$nN^Nu/,OH8(. &.NR$JgSg,LN^Nu//N6P-C -BLN^`//N6nP-C -BLN^`^/,OH8$. &.(.NR-D-C-B -HLN^`x/,OH00. NR$/9?|NXJg2 9:g*/HxBHz"E%ѐN/9:HxBHzN 9:g/Hx/HzJN%К 9:g/Hx/Hz,N%КE?dG%К fB9:-y?|L N^`$/Hx/HzN`NVBBBHxB-|Hx/. n/(NARJVIDN^Nu/,OH8<. NR&/9?|ENXJ:f*BHxN%Ϭ#:Pft/9?|N6 L<N^Nu/HxBHzG%fN/9:HxBHzXN$ JfJ9:f HxHxG%ϬN#:HxHxN#: 9:fJgt 9:g/Hx/HzN%$Hy;}@N$y?XJgI?dK%Jg/ HxN#?`PfL$jJfbHy;}@N6/N:P`B`0/Hx/Hz:N%$`\/Hx/Hz2N(?`Jf`X`xt`/,O/ .rgJrgfJffHxN&XJf(BHy2$BBN|/NBHxNB$.N^NuNR$HxN/N NXP`p`p`NVH<0&.$n&nNR*BBBHxB-|Hx/./+NAR$fh Nhgb$ @ Nig$ Neg @Ndgt` Ngg Nfc Nfg ?re/<@Hn/ N'o$ fHBN'6(//.//NN$f// N'pl$P/E'KN/.NP`p$ L 0&.". $ngG /// N)0 " BAxf L |N^NuJg."A$1ze| *ąE"n#RX``B`/,OH00$n&. $.//N6P R"S€Jg< j$pG)1Jf J L N^Nuf//Hj N Jg$R`E`/,OHxHx(N !nN^Nu/,OH><(n*n &.E* ((<Jg"B  je|// DNBBBP fJg(/,HxHy2%P/N/,HxHy2%P/N HxB/ N( p-@B -LL<|N^`Y&p,JfR`n,Jg/+/+Hk /Np Ы// DNP&F`/,O/$.BB/NFHx(/N$.N^NuNVH?<$n$.&.f %,B`VI/ //. /N.*x LHAH ( Pc^z`څe/ /N,PfpL* <**:jN 4ft?Bg? Bg?BgN65B J, g&g 4B?Bg?Bg?BgN65B d?Bg/?BgN6E 5@ k4JCg+g( gBnHnHn/ N= JgndHnHnHn// N=Jg\ n/( /+N RPJfD&k4B0+E6J.gTB2./2.//NB2./2./?BgN7@pL(HnHn/. Nj/./.B./?BgN7P42.g?Bg?Bg?BgN64 B0.//.B/ N@TJfl.g nB0( /?Bg?BgN64 Dg* DgF/ N< j41BX` n6>(`: nB0(/?Bg?BgN64 `JGg nB0(`NVH 0$nB.*fB B L N^NuG/ / NPJg,J*k .-n-@0. @g8b @g^ @g*B/ N< gr€&AHy+`2Hy+`:Hy+`CHy+`HHy+`NHy+`SEC&NN$Ig,(<+K2&z$ڋ,<Jf L<|HnTHx .L/NHnXHx .L/N .X(fB/Hy*ѰHy+3Q//.T/.HHy+ah DN/Hx .L/N `/Hx/N/.P/.XN/////.T/.HHy+a-HD"DN0 nD tfJg/ Hy*ѸHxHx/N`~/,O-|C& -nN^`/,O-|C&-n N^` v/,O-|C&N^`*/,O-|C& n fWID-@ N^`N/,O-|C& n fWID-@ N^`4/,O-|C& N^`lf/,O-|C& n fWID-@N^`~/,O-|C& n fWID-@ N^`j/,O-|C&-n N^`cNVH>/,O .J.fB-|C& -@N^` >L/,O-n -|C&N^` >/,O-|C&N^`N/,O-|C& n fWID-@ N^`j/,O/$.HyC&/NHyC&/N5HyC&/NHyC&/N" -|C& -B$.N^` /,OB?p#+a?BHxND/,O/ /ErNrf`NWgHy+aNC&X$.$nN^`Hy*THy?N)/`PJfNrFWf -A -|?$.$nN^`0~B`Hy+b`NVH fp`*p`$p`p`/,O/ ErNSf$nN^Nu/,OHy+eN N^Nu/,OHnHx ./Ng, n N^NuNV`H80(.&gpƀNҌ$Eg,GҢJf L LN^Nu/Hx/N C ( r e(">|d/"///Hy+e n N/N$X`/,O 9:Xrl&:TnHx N!4B:TB:PR:dXN^Nu/,OH8 &9:PE!4"9:Tm#:PLN^Nu 9:`$ԃ(L@Hn (` Hx NRXnmւ`B`Hx NRX`/,OH 8$n 9:\rl|S:dnrG+e-I!4f$N rcg"rqgr g< 9:dSB`I/NX`Bt#:dG+e9I!4fJgBNFB`I/NX`Ap]e2NӒGN/ N!4R:TN#:T:PXLN^Nur f,Hx N!4B:TB:PR:dXLN^`p f 9:`"ҹ:T$L@(#:T`r fR:T`pf-@LN^`K/,O 9:TN^Nu/,O 9:T:XmHy+NC&XN^NuNV//"n$. ". .JgA+e[&fA+eaR`A+eaJlD@-@-A-@-A-H-B -I$&N^` o.NVH8$.&. ". ."n y:Dxf-@-ALN^`^xf@A+efJgA+evJl>D@-@-A-@-A-H-C -BLN^` nA+ekJgA+ep`R`/,O n/(/(/Hy+e|NC&N^Nu/,O/ / J:poTEDrJ:hf^p#:hG>u/Hy+eN/ Hy*Ѱ/9:tHx/N/Hy+eNB:h$J:o$n&nN^`=Hy+eNX`$n&nN^Nu/,OH80$.&.(خ Eg,g&C/Hx/NRR JfL N^Nu/,OHy+eN N^Nu/,OHnHx/.Ng, n N^NuNVH 8N~$H$YGg,IהJf J LN^Nu/HxHj`N .g/ N$HX`NVH?< nI+YgXI/Hy+eN)/(HPJf@Hy+eEC&NHy+fNHy+f=NHy+f]N-|+f~L//// Hy?i// Hy+gN.9? g,/9?Hy+gN/Hx/N`>"9?Jg" 9?///Hy?iHy+gN`B`HxHy?i/N(yd`L~`^p-@`lB.`~ `Jgx؎,<//// ////Hy+gN$9?$g/9?Hy+gN/ Hx/N`6Hy?Hx/9?|N JgJ?g 9?gHnHx/NB. *9?pK+ffK(9?9?I/9?N4"y? y?XJg."(`/ Hy?i///// /Hy+gN$`B.`r`B.``~`n2| `NVH<<$.. ngI/Hy+'N)/PJf.Hy+h EC&NHy+h4NP-|+h^L<r㨀y>/NXL<|N^NuHx/ / N-n// CN/.N//.Hy+i"EC&N .Hx/.NB//N .g\".в:lbPgJ/Hy+i*N .Pg8Hx"[I-@-A//.Hx|HvhNHvhHy+i.NHy+NX`Nq/,OH00$n&n B4*Fp᪄jHJgU r5@F5BHjDN(N/N*XJg" ( S!@ f6!h pL N^NuJgB0*Fv稀jHT"5AF5@HB 9?rf v#?B`rgvfD 9?S#?nB?`J9?gHy+i2EC&N/NHy+N `UfBHx/N&B@ Nsg Nufz 9? S#? gJ9?gd/9?Hy+i5EC&N&y? PSJnj/NHy+NP  Ng afR? `J9?g  Ng  agz`Hy+NX`v?fBHx/N" Ng" agB@ Nug Nsg`p/,OH0 $n.B4*Fp᪄jH 9?rgUfBHx/NR? p?f Jgr#?jDL N^Nu/N*XJfNL N^`8/,O np?fp#?hDN^Nu/,O/ .rfp n pWt#?#?D?B?B?B??t$N^Nu/,O n pWr#?D?B?B?B??tN^Nu/,O n pWr#?r#? D?B?B?B??tN^Nu/,O n cg&p#?B?B?B??tN^Nup`Nq/,ON^` JP/,OH 0$n$. // G)/`NPJg$If/HjNPJWDL N^Nup`B`NV|H00Hx/.G/ N(ydHx:/ N)/$g>$HB$ B&|/B/ /G0NJf .| n pL lN^Nu$K`Hx/B/ /NJgB`/,O/$.Hx:/N)/PJg"HB B$ /. //N6~ rf Hy+iFNF$.N^NuNV/$./. /HnHnN3Jf0HxHnB/./.N0 . n $.N^NuBB`NVH 0$.$n &nfB` Hx// HnN3JfJg&L N^NuNVH?<&n&. $nNRd$~// |Hvh*Q/K3NJfHx(Y/B/./.I0N.g4f./HjHvh/NJfHx/B/./.N ." :ldxJgt/./.Hy+i`// NEg>/Hy*/ N(y/ N)/<$n&. &n|// zHvXxHvH$<3 BNJfHxK/ B/./.I0Ng8f2/HjHvXHvH BNJfHx/ B/./.N&.$ :ld\JgX/./.Hy+i`N g6Hx&[I-B-C//.HxE/ N/ Hy+i.NL<|N^Nu/ N/Hy+i+N `/,OBN^NuNVH0 &.$. HnHy+ifENPJg,f&HnHx/Ng,p @L N^NuHnHy+itNPJg(f"HnHx/Ng, . Dfr`B`NqNV/ .#?rWD@ y? JgHxNXHnHy>\NlPJg 9?EC&g/9?/9?/Hy+iNJ.gzHy+iNX"y:, iHh/)/(`Hy+iNB09>r㨀y>#?l/NNBHy>\N y? PJgBNX$nN^NuHy*d`Nq/,O"n n hJf"BN^Nu `NV/ /$.HxHxHx BHy:DBBB/.BHy+iHy+iHxHxpBBB/EN@HxHxHx BHy:lBBB/.BHy+iHy+iHxHxpBBB/N@HxHxHx BHy:XBBB/.BHy+jHy+jHxHxpBBB/N@HxHxHx BHy:\BBB/.BHy+j&Hy+j8HxHxpBBB/N@HxHxHx BHy:`BBB/.BHy+j>Hy+jOHxHxpBBB/N@HxHxHx BHy:BBB/.BHy+jXHy+jHxHxpBBB/N@HxHxHx BHy:|BBB/.BHy+jHy+jHxHxpBBB/N@HxHxHx BHy:xBBB/.BHy+jHy+jHxHxpBBB/N@HxHxHx HxxHy:BBB/.BHy+jHy+kHxHxpBBB/N@HxHxHx BHy:tBBB/.BHy+k*Hy+kSHxHxpBBB/N@HxHxHx BHy:pBBB/.BHy+kdHy+kHxHxpBBB/N@$.$nN^Nu/,O/ / NrWf6E2*LG)/`/Hy?NPJg<2*fE,̵,e Hy+kNF/Hy?NPJg` n p$n&nN^Nu/,O/ n$n "hJf h$$nN^NuB/ /N `NVHnNFXJg/./.NPpN^Nu/,O/ n$n "hJf h $nN^NuHx/ /N `NVHnNXJgHn/.NHPpN^NuNVH8J:f-|+kL|N^` R*Hy+kGC&N$y:XI(<+*<+fJf L|N^Nu&*,*$/NXJg ////Hy+lN$j ` `/,O/ / J9:f$y:GxlJf:$n&nN^NuHx *@/ *@/ R/N$j `/,OB9:N^NuNVH?<&. nB @KCpe pbgmHy+l8`8pbgm Jft`phgpgltplgpqfHy+l'NFHyC&Hx/ FN peXB// GN/N/Hy+kN/.N/Hy+N$/.//Nւ x/NXJfJfJHy+lN`/.N/Hy+lFN `tB*YI ,<xEGC&.<`t`#?`#?dNrL<$..Hy+lNTXJfHy+lNC&XL<|N^NuHy+lN$HHnHx/Gg,N 0af*.Jgl*& ֮BBBIKC& .m JfHy+`" Ҁf& mJ/ Hx/N Jg .>f0BB`*.Jg 0,..B//. /.N& txGEH/ /NPJf$/N B ^XjpЈL ||N^Nufʼf .Jl($.L.(Ԁ`NVH<<(.$n&n .B//. /.N& KIH/ /N$Pf/NXJgRB`Nf$.f .fBfJgHx Hn/ N)0 Jg&/NXt L< n g8$(("BA" ABBخfvăte&tF L|N^Nu"DB18,R` `/,OH8 n $g0//.NP(Sr&髰e v g婐LN^NuB`NVH>0(..B/. /.N& g&tGEHB/ /NPJf/NXB`( .rf.pd fмf2/NXpL ||N^Nu$.`Yff Bgt`$`/,OpN^Nu/,ON^` u/,O/ $nB*M jD hHxHx/*H hNBHjNL/ HzHxNZ%H4|L $nN^Nu/,O/ /.Nb$HB(L/(4N[HjNB$nN^Nu/,O/ n . (PBP(Mg(Fg*/N/Hy* HxNGNB$.N^Nug/N/Hy+m`Dj/N/Hy+m`/,OH08$n&jD$*H kHx/ hN P bJ0fD*M/*4N_X` kHx/ hN/ /NJgB`*O k h *<"R%A<"@B/B/NHxI-N k/Hx/ hNHxNS0 k/Hx/ hNHxN*MJ0g6pL N^Nu/,O/ /$nB@ B#bF$/ N B@F/ Hy 9:jV/HjN$.$nN^Nu/,OH><(. p/Hy;N;$HPJgJ(LgJ(MfH|MENJ:g /NB//Hy+mNDr&jD&*Hf" kHxHx/ hNHxdN- kHx Hx/ hN BIKs kHx/ hN/ /N$fJlp g@O k/Hx/ hNBHxNT%H8B0|MJ*Nm / N XJ:gZ/N/Hy+mNDr `> 9:"鉼mB*Mt`(JlV/Hy+mHx/ N$p#gB*M L<|N^Nu 9:jV܀`p`(t`/,OH><$n&jD&*HJ*NmzG IKDr&<s$*0g*Mf6J:g/N//Hy+nNB@ B#bF$/ NB@FXBHy+nHx/ "CNJg`XKs*OB*OIJ0f<$n&. (.Kpgg4Hy+nkNK./N *4"XSgV-RL<|N^`/N *4XSfBR0I(GML *4Jf@ g*S0Hj(NP`@%@4Hj(NPXt` gr// NP` fp0fB0&j8*<6,<CpJgZ(kpfFrgf@Jg)k k / ENHx/ FN/N`S0@%@4`g&L`A(Jg/NMDX`j6/`./,O n/($/N$jN^Nu/,OH 8$nJ g / N$PXB@p%@D&j8IJfBJ g / N$X LN^NuHx/ / N$ f&k`/,OH8$nJ g / N$PX&j8ITJfJ g&-JLN^`tHx/ / N&k `LN^Nu/,OH8$nJ g / N$PXB@p%@D&j8IJfJ g&-JLN^` Hx/ / N&k `LN^Nu/,OH8$nJ g / N$PX&j8IJfJ g&-JLN^`Hx/ / N&k `LN^Nu/,OH0 B0. 0r/EN.NrሄpF.NX L N^Nu/,OH80$n(. GOHg66* B4/B0*/N (X.rƒ/%//Hy+nN/*Hy+nNpL N^NuNq/,OH80&.$n (*// jNHxG-N t // jNHxN// jNHxNSfL N^Nu/,OH80(.$n $*// jNHxG-N .Sv *".ƒgL// jNHxN // jNHxN// jN HxNXfL N^NuFĀ`/,OH<0$.$n / /NHxHx/ /GDNHxHx/ /N(Hx/./ /NHx/./ /N./ jNHxG-N *// jNHxN/*/ jN HxN/ RN&ƪ *// jNHxN/*/ jNHxN zBDLJf/ RN XgD *// jNHxN/*/ jNHxNSf/*/ jNHxN Jf n0 L J@gfBHx * rr1// N$Hy+o:Hy*ѰHy) N`.$<*ѰJ@g6BHx * rr#// N$Hy*/Hy) N$<+͘*0g:BHx * r#// N$Hy*/Hy) Nx$<+͘*0g6BHx * rr&// N$Hy*/Hy) N$<+͘*0g:BHx * r&// N$Hy*/Hy) Nx$<+͘Jj0l6BHx * rr(// N$Hy*/Hy) N$<+͘0*2 @cgL/ CNp %@8j./NBHx * rr+// N$Hy+oC/Hy) N$$<+͘Jj2lP/ CNp %@8j./NBHx * r+// N$Hy+oN/Hy) N$x$<+͘*2gR/ CNp %@8r@,k/NBHx * rr0// N$Hy+o]/Hy) N$$<+͘*2gx/ CNp %@8r@,k/NBHx * r0// N$Hy+og/Hy) N$*1fb*.gz/ CN@/NP`b*1g0BHx * rr // N$Hy+;/Hy) NJg$`x$<+͘`/,O n/( /((N$PN^Nu/,OJ fBN^Nup-`/,O/ /.Nb$HX<*/g/NMD.NB$nN^Nu/N`/,OH8&n$n I (JfE J LN^NuB0+ /0+/NPfB0+ g `NVH88$n*.g j((hH$*/GNHnHx//N j((hH$*/NHnHx//N(J*/j0.H=@0.H=@4.6C2.8C <@JDfBJCfJBg*A <@ A fLN^NuJBf <@ fB`A g <@ Ag <@`/,O npL( 00 2+:N^Nu/,O n(1fBN^Nu/(4N Xrf`/,O/ / &n n$h4/ N b'jD'j@X$n&nN^NuNVH8<$n&j($+ p'@@r 'AD j(&(H(*/INK/ Hx// CN j(&(H(*/N/ Hx// CN(.gp@ j(*hH&*/NHnB//N0. grDB@L<N^NugD g.ftD` j(*hH$*/NHnHx//N j(*hH$*/NHnHx//N4.6.(*/g0*2@0g j(*hH(*/NHnHx //N j(*hH(*/NHnHx //N(2. +D gd.g\'@DrF€t f"tf.g@'@D+Eg/ NDX`BnBn`g.g `Cg` g `vJj `hg `Xg `Hr`@r€`R B'hD`DNq/,OHy2+t/.N:PJfBN^Nup `/,OH <$. &n/Nb$H(SHy2+t/ N:*HHy+ouNM`0+ @r€//-Hy+oNOH$%l< %k%|2+$%L(%k,/N j$/ hN j(*hH$*/NHj0Hx//N0+ j0/N6-JL<N^`@NVH8<$n4<*/f4<=B j(&hL&*/IN?BgB//NHxG-Ntd&U j(*hH(*/N/B//NJnl HxNSXfJ g4*/f, j(&hL4.B&*/N/B//NL<N^NuNVH8<&n$k(*j p%@@r %AD k(&(H(+/IN$]/Hx// CN k(&(H(+/N/Hx// CN k($(H&+$.NHnHx// BN.gp@ k($(H&+/NHnB// BN0. gpDB@L<N^NugD gR *D.f r%AD`2.g$t%@DDf/ ND%@DX`t`%@D`%mD`NVH08$n"n $. i pg:m&rgpgD/ N// N ` rf/ NX` (r⨰ gBL N^Nu (r⨰ gP j((hH$*/GNHnB//N j((hL4.B&*/N/B//N(` i$(1gR/ NbX`D (r⨰ fl/ NXTf$`XNq/,OpN^NuNVH><*. &n/Nb$H(SB0+ /0+/K (N$6+ Epƀ//HxD|HvhNCOHJgJ.g///HvhHy+p%NHy+ouNM`$%l< %kB0+ /0+/N%@ B0+ %@0+ @r€%A%|2+$%L(p%@,/N j$/ hN j($(H&*/KNHj0Hx// BN0*0k 5@0(g" j(&hH$*/NHj2Hx//N/N6/ NPL<|N^Nu///Hy+pON`NVH08$n"n $. i pg:m&rgpgD/ N// N ` rf/ NX` (r⨰ gBL N^Nu (r⨰ gP j((hH$*/GNHnB//N j((hL4.B&*/N/B//N(` i$(1gR/ NbX`D (r⨰ fl/ NXTf$`XNq/,O-|? dN^` R"/,OB? hHxHxHy? dN{4BHz/.NBN^Nu/,OH?0 n"n ,9:tk ? hoJ gBrӨ,(݀!FJ)@g*Bۨ4.(0߄!G0&)Bר< (8т!@8&iE" $ ըD&(@ׁ!C@,)x.)|ߨ\ (Xц!@X")$)ըT&(Pׁ!CP,)h.)lߨd (`ц!@`Btըl&(hׁ!ChL N^Nu )t B?cR )l B?cR,)h.)lB"<cBtը&(ׁ!C,)p.)tߨ (ц!@"$)ը&(ׁ!C,).) ߨ (ц!@")$)ը&(ׁ!C,).)ߨ (ц!@") $)$ը &(ׁ!C,)(.),ߨ (ц!@")8$)<ը$&( ׁ!C ,)0.)4ߨ (ц!@")H$)Lըt&(pׁ!Cp,)P.)Tߨ| (xц!@x")X$)\ը&(ׁ!C,)`.)dߨ (ц!@")h$)lը&(ׁ!C,)x.)|ߨ (ц!@")$)!A!BBvר,,((݂!F(`@L|R `HL|R `HNq/,O-|? N^` /,OHxBHy+pzBBBHxHy? Nz HxHy? N&THx@Hy? N%BHz/.NBN^Nu/,OH <$n&JKU&Jf(G PJf$L<N^Nu/NRXm&k`(KB`$*/ Hy? NP$B`/,O/<Hy? N N^Nu/,O/ n$H hJfpf N,%H$H *% % PR%@$nN^Nu/,OH 0$n$. /Nuh&H$N,'H RB RB RB8 R!B@ RB R!nDXL N^NuNVH?<"n$Q-iH iD-hBB*nBBBBBIBGB)I-@Jf6JgBJf>GxJfH*nBB .L/ Hj,N@P-j,L< N^`\$(h// NP B`$(h// NP B` "+$*&*o.C jJg $&(n 'Hh"R `Ch hh`C$ j$Jg $&(o'Hh"R(`hCh hh`/,ON^`/,OH<<$n/*,INX j JfJ(g"*( l "Rl "j(*tf&L*8&IBJgn&j$Jf$L*(*KBJgnJgoB&()*)ة ׅ%C%D npS%@ Jg%ih&IrҊ j$ * Jg$&((***mJf*J(f$ j,Jg%h$K*($g$%B,/*,NX K L<8&n&.$. (.$k,/ INXCJfBE`v jh *"*fN fH'H,r%A$%Ih"J$k,` (h*(,(f f%@h|!F$!Ih *h"H J$H @Jf`R&)h/ / NP"CJf/+,NX L|N^NuNqNVH?<&n$n$.HnI(/+4/+0"n /) /)N .d/+`//N-@-A//Hk0N&(&%|+p4*n .-(/ KuN!j8%H8/ -HN(H!j8%H8/ N*!j8%H8/ N&H!j8%H8p%@B %@.Hy+p/ BBBHxBHyk\HymBB/ Kw N0.Hy+p/ BBHxHxBHyk\HymHxB/N0.Hy+p/ BBHxBBHymHymBB/ N n ,(4"nJf/Hy+p/ BHxHxHxHym/9? |/9? BB/ N"n i i*F!m i!D!C i".p!A[I!@4%L l0 i4 p#@8 i0 $E j4 %@8 j0 k4 '@8L*n| m&(BBB|$<w n h ( "($,...bJg8/.Hy+p/ BBHxHxBHyk\HymBB/.Nw 4/N$!j<(%H<"n i*B*,) F ("( &<(././/"CN-@t-Ax F ("( ..tx-@-A"n )") /././/*CN,...ށ݀ B!F!G "n )")!@!AJ|f& D/( //N(ԔP./ /N{(-H| /.Hy+p/ BHxHxHxHym/9? x/9? BB/ ,<w "FN l l!n| l!n!n l .r!@[I!B"n $)4"nBm k |JgB"nB&,Pm k!8 k"n!h k!8 k!8%n"nBmC8Bm k0 *n m4 p+@8 nB$n"j0m".# l4 p)@82|8Bm l0 "E i4!p$.#,8 i0 "n i4 #@8L .!&E k4 r'A8tf"k j0(.!L i4 #A82|8Bl($&n k0 $C j4!(Bxf C$h&n k0!J j4!(B8$n-jR`&n "+`$j n-h&k"n-i~` j",.(##"j&C k,).) !! $jR` j "(#x#x"j&C k )") !x!x $jRrށ`! i4 r#A8"iR`RX$E**&E k0 $C j4!B8tf$ C$h&E k0!J j4!$.A(Bf"C i0 m4 r+A8tf"i i0 m4!I+A<"nB m0m!"n i4 B8rf"i m0&n! i4 B82|8Bm^B"n i0 $n j4!t%8-i ARXfLLN^Nuf&Jg( kHxHj/ /*$/* / h N$j(`$`Jg( kHxHj/ /*$/* / hN$j(`$`NVH?<$n-n ,.(n&n*n-n -n$BBB F$(&( "n() *)$.<(//// GN @"AJfJg//// GN(*$&/* //N(ԔP./ / Ny"n"B/-B-C//.-D-E//./ NƸ&!l S)H h ($ѕ S (( F(7g // N{P"F()*)"n$) &)$//// GN @"AJfJg /* //N(ԔP./ / Ny"n"B/-B-C//.-D-E//./ NƸ'H!l k)H h ($ѕ k (( F(7g-@ -JL"B!i k#H h.((<V*<(Ԕ,<{(Jf k h ($ѕJg*/* /,/,N(ԔP.// N{("n" C$hBBG~\JfJf-|+r;L/ / /.N Jg"n(R`L&Xf/ Hy+sNDrPt LN^Nu/9:,Hn/N"5f$/N!EJg"// Hy+s'NDr rfp%@8`/ /.Nf$PfJ$f'j@$J8ff n"k #H(h"k  ,", #H#H BD h ("( %@X%A\/*L/*H/9:0[I/N(4HxdB//N(%@H%AL`NVH?<&n p`L$k*nZI8B*<(<Dre*t + HBIDreB L<$n*. $.v`L8 *Ѓ/Hy+i+Hx8,@/GEN jx`LHHpHHy+i+Hx8Hp8N.Hy+i+Hx8"*҄/N"j L<$n n $(kXbP& /INX( |GMLppgj%@p/G6N/ N Вr`L j"(8zʁPSg@/Hy+wNDrPt/NBp/NP/N L<|N^Nu//NP`L<"j *B В"j L<BB BDBXB\BHBLp!@8/Hy+xHx8/NEB// NX/NԒ K."* ВSeS%A/N/ NPB`8*R/// N $`t`6/,O n"n )k " hdeN^`dN^`pN^NuNq/,OHy? N 9:pS#:pXf Hy? N{VB:lHy? NPHy? N6XN^Nu/,OH<$nIU&Kb&jJfIU&Kb&jJf L<N^Nu%k/N/ / N `%k/N/ / N `/,OH8$nHj$GMDNHj|NHj4I{VNHj8NHjtNHjNHjN-JLN^`/,O(N^` |/,OJ. g>J:tfLp#:tBHxHy? N{4B:pB:lB? BN^NuHy? N{VB:tX`p`/,OH8<$nJfHy+xNDrXt L<N^Nu$ /INXJg/N6Xt`p%@& GMLJfGDr& tKMLJlf/G6N& /NPIDr( $KML$*fv/NBXJ g / N(XHx/ N/ N/ NHjN/ N,Nj`//NP`P/*Hy+x\N//N`R/*Hy+xN//N`lNVH?<$n&n Hy? NR:pXK{4J:lfHxHxHy? NHy? N,@$gN/Hy+xHy+xNDrHy? NS:pHy? N6Hy? N{V L<$n$ /INX& K6(<,*<"F,<fJgB/NP/NBNJf/ DNXJg //NMLPJ g/N/* EN/N &jJf/N/ N4/N ` k| +Jg6!@ k |/N/+/ /+p FN/+/+, k(N/N`%@`/,O n"h rd(Ug:Hy+|NDrHy+|HxN\ B`Jf"(WIDN^Nupf"(( W`/,O n rg[gHy+|Hx7N\PN^Nu"hN^N(g"h`/,OH <&nJgZ(KKH$L(l j$/ NXJgfTJ,g jR r$Bm*JfEp K&kpSf/NXJfL<N^Nu j4 p R$R`p$`/,OH?<$n$ /INX(<6*<\, JfK8`XB/ DNXBG"G.) i rdUgRHy+|Hx$ ENP` J g@#C& JfJf:/N/NP.*fGMLJf>Jf//NP`Jf#K&I`.+B k/(0 h,NSX&G`BHjNP/N6BN/,OH 8$n BA%HHxHxHjI{4NHy+|HjGM.NHxHxHjN.+|HjNBB 93Ѐt F/*Hy+}Hj/ HztBB/G(N(Jg /*Hy+} NDrPt LN^Nu/*Hy+}3Hj/ HzBB/N$ g /*Hy+}<`/ Hz /.N `NVH?<&n&. kR$ rge.rg,WgHy+}~NDrHy+|HxN\ `_f k$(@(/NXBmn k rdlUgHy+}NDrX-|+| -|kL/ N/ Hz/.NB$n&nN^Nu/,O/< . (/N N^Nu/,O (N^` aJ/,O/< ./N N^Nu/,ON^` a/,O/< ./N N^Nu/,ON^` `/,O/< . /N N^Nu/,O N^` `/,O/< .x/N N^Nu/,OxN^` `r/,O/< .H/N N^Nu/,OH8 BB(.HE궮 m B LN^NuHx/N!B(RP$`/,OHN^` _/,OH8 BB(. E궮 m B LN^NuHx/N!B RP$`/,OH <$.*n mIEJfTJg(BHG P $j(// NPJf m$B G PJf-M  (-BL<N^` _@ (JfR$@&hBJfLJg(@ (Jg)@( "hJf8Jg(K$hJg)J($@&hJf$Jg(I h `P)@(` &k(`&I"i(`"K&k(`(h // NP L`VNVH?<*n&n E r$@$ /N&-/N6PJgN$+&+ -mP-mT mHn-B-C//./ hN mB/ Hn/+ /+/ hN,-`.-d -hޭl݀-F-G(n"n(BBBB,...Ȟg,g m~`Lh ph8S|dBRهBRц`pg pL *. ,.(. $.&.(Jg~/N!$H!F(!E, rr ⬈!D<&n . f BL<|N^Nu/N&/N)/<,PEBI($K#MȺd( ZثHxHy,4/N Jf k/0\/0XN$Pf$///N` Jf / k/(HHy+NK p`dR`NV/ / .gSg>t $.$nN^NuBHxHy?!N{4Hy?!Np-@-@HnHy2B8HnHy2BtHy+N$$E6g*rg$/Hy2AHy+NN`Hy?!N`tHy:/9;ɈN+$Pg6/Hy2AHy+NN`Hy2B8Hy2BtNxHy?!N`&B9:|Hy?!NHxNj$Pf4Hy+NLHzBN8 JgHy+@NN`X`Hy+ NK.Hy?!NXE6J:xgHy?!NXt`Hy:/9;ɈN,X$Pg"Hy2AHy+qNN`Hy?!N `bHy2B8Hy2BtNxBNjHy?!NHy?!N{V`,/,OH08$..JlE J L N^NuHy?!IN$y:xXJfHy?!G6NXJgHxHx!N$H!BHHy+HhXNM.BHxHjTN{4Hy?!N y:x%H! gC!!I!#:x%|:x!Hy?!N`HfHy?!N6X`@$j!`\NV//$. &.B r /NPJg,(Og$-C-B///N#" $.&.N^Nup`NVH<(. *.&.$.B r /NPJgN(OgJHx/./.B@Հ-B-C//.-E-D///N## L(Og/ /N#PJf-B$.$nN^`$.$nN^NuNVH80&. (.B r /N$HPJg/N$Xf^ *LGg\/././.-D-C/// N#V&*OgB/ N/NV&B/NCpJg4$ L N^Nug/ N/ NbP`/ NX$`/ NX`/NU&`t`NV/ / n". $n . d </BB-|@Hx@/.Hx/ /.-A-H//N$$f f / / NbP $.$nN^NuNV//$. &.B r /N(PJg<(Og4/.HyfB-C-B//BHzN $.&.N^Nup`NV//$. &.B r /NPJg@(Og8/.Hyf/<-C-B//BHzVN $.&.N^Nup`NVH?<$n /.Nb*hdXJ g$B( /INXG6JDf/NXp#L *. ,.(.&.$.$/N!$H!F(!E, rr ⬈!D0$n jL*($(0 JBCJf BBBmnr0f~JWIDL |N^Nu&hLJf"k hPJg&hL +o"@ hPp`&hLfgP hPJf 1fg|fB` J`RR`vgB`|4f r\`x|5gp`p 1f`NVH?<$nBJf B LHy+"`Hy2B Hy+NDrR B%LT/ Nj BL0&nBE(<*<e L |N^Nup`L k (8SgR +$" d"&B d /BB"<@҃т-@-A//.Hx/. /(\/(XN R`NVH?<$nxB&G*<I)0:|e L&. $.,.(.*. /. n/(Hy+yHx/NEHxB/BBB//Nz0./N&TP-D -BL|N^` 'p/,O/ $n j(Of p$nN^Nu/N#DXJgJ_ID`NVH? $n tԎpĀHn//.N Jf0%n@ B$&(*9:X[I,.%FH%GL%BP%CTLN^Nu/,OH<0$n(. BBGeBGѶe: L b" r g r!f&/ /N`N rf-K -CLHxHxoNT&Pft `&Hxo//Nh$ g/NU&zLX Lrg^Hy+Hj/HzbBB 93Ѐz F/N($`lEHx0 n ."n &i"P"i h$hR?! K" |†$ ftm 到f\L |N^Nu"$&'CS`Y()&)$) *,,*,* ,* `$0&1,2!X`NVH?<&n . n h"S"i$k$j&k&kR?!"x„,ftm$到fLNVH?<(n". n h"T"i$l$j&l&k(l (lR?! |.f~m(割fLL|L/Hj NPJg/ N,X-LL<N^`,rt`LL|`/ N *Tr%@T/ CN`-K`/,OH?8$n n (f(*H&(f&*L$( SJg" d&p m/ j/(Hy+R`$*P e / j/(Hy+0NDr p`r lJf j/( /(/(N(Ԕ ,.$<p"<e&B"<dT/<B//N($%DH%CLJPf%BPBhBlB`BdBXB\Jf:BLN^Nut` cHx/ j/(Hy+wNDr`.$jBGI6eNBGI6d В jr`L|8f // N!DP!CL!BT В// NR` jp`L 08Sg$// N!DP!CL!BTP| g// NPR`rNVH08$n&n %KBPB/./ I#@N Jf *P"S&B/B +H"+L҃т//N( .T/+P//N(4%@%AG Hx/ NL/ HzD/ NBTHxHxGN$HxHxN%H$HxHxN%H//*N|Hx//*N)0BHxHj G{4N(HxHxHjN BL N^Nur-A-|@BBHn/ N Jgp`/,OH 0$n$. G B/ NX/ N Jf j0(jB0(R f/ NbXHj G{VNHjNHx/GNHx/*N-| -jL N^` ƐNVH?<$nBBBG I6Pe/ N"/ N!P$.`/ N R&08tą-BItĀXg/ N-j-j/././/N(4 @"A .".,҉ц-j*n-m-m,...잁d ."..//-H-I/ /./.N,Jg jJg< L/(/(BBB/./N,N^Nu/,O/ / &n$n kp`Lr8f,/* /* k0/( Nc Jg kp`L$< kp`L 08SrTID$n&nN^Nu/,OH?<&.$. ..$/Nuh$H!C@BBp!@!|+,4!@B XB(<un(j8/"DN*H!j8%H8/"DN&H!j8%H8/"DN&!j8%H8%M/Hy+p/ BBB/BHyk\HymBB/ (<w DN<.Hy+p/ BB/HxBHyk\HymHxB/ "DN"k0",.4Bn`/Hy+p/ BBHxBBHymHymBB/ DN"C i4 p#@8 J L<*n&.$. (.$m0/-[I///N(pL$jt/ ,< FNX* XGMLJ ftp%@ / G6N(jXBJfd/ N8(X ,|Jgn E!@|B|/ FNB / N$lpBpPG5JfH-L 8-ML<|N^` $/ /NP`| ",fg* (l|`~%@`$*/* RN/ / N $B`/,OH?8$n (* HxHxITN&HPJgHx//N- Jf p LN^Nu%K,* *Hx/N(PJg///N- &gB"er(*x**|&B,*0.*4G(4////N .///N%@%A%DH%EL////N%@P%AT%B`%CdBhBlB`N S! R`~/,OH?8(n$. &./,4/,0//N((*.B////N( n ,,0.,4&TE/ / //N( .///N(4(*////N( n$&ցՀ !CLN^Nu/,O nB nBBN^Nu/,O n"h n N^Nu/,O n"nB !nN^Nu/,O n.Jn <Uv rf <S n N^NuB`/,OBN^Nu/,OH8(.&. Hx/NT$PJg///N- B LN^Nu/,OH<0$n rdf/* HxN&HPJf p L /,OH? $n$. &./*4/*0//N((* /B//N(ҁ n ,*0.*4 /B//N( .///N(4(*////N( n$&ցՀ !CLN^Nu/,OH? $n$. &./*4/*0//N((* /B//N(ҁ nR ,*0.*4 /B//N( .///N(4(*////N( n$&ցՀ !CLN^Nu/,OH8$n". . (jG(/*4/*0//N .d/*`//N @"A"/B/ /N("T n LN^Nu/,O n"nB !nN^Nu/,OH08(n$n. *(Ъ,rmJgr&j<$ ,rf@ lp`L( 0(<& j"h(JfZB,B( rf\ <S8 n L N^NuUf/+ /+ l0/( Nc Jf rf <:J(f`f"`f ` <gF`B`NVH?<$n vƀ-C(. *.-jP-jT"n$)&),* HnG(/*4/*0//N .d/*`//N-@-A//Hj0N&-@-AN,-Hgr/ N&HXJgZ///N(Ԕ -A-A-A[I-@$*`&*d"*h֪lՁ/.,.Lh/N-HPfv`NHx/./.Hy)/9? |/9? /./.// N.p(H(Jg$(B/./*T/*P/././/N(-D-E//./ NƸ*H-h n,(*.BB.. *`"*d&.(.Ȓb n&(-D[I-@( *`"*d,*hҪlц,...e:Hx B/.N()n(/ &< CNB / N6/ Hyf/ N."CNX& X(<MLJ g/ N6XJgHy+NDrXJf8/ NvX`|HxB//./ NVB// N- Jf"F#E"B i0 px h i0 px h!E i0 px h!n!n i0 px h .r!@[I!Cڮ F,((BrӮ&.׀-C`tHxB//./ NVB// N-B~߮".ӆ-A Jf C!E"B i0 pH h i0 pH h!E i0 pH h!n!n i0 pH h .r!@[I!Fڮ C&((X`/ / DNP`d(*dL.Hخ-D/. *l/N.P,.BBBB *`"*d(.*.b>Jf$<vJf/ BNX/ / N$P/.N,X L`^ "i Jf"@#H `H/,OBr N^NuNq/,OH?8$n $* HxHxITN&HPJgHx//N- Jf p LN^Nu%K,* &Hx/N$PJg///N- &gB"ex$*x&*|%BH%CLS*B%D`%Ed,*0.*4G(4////N%@P%ATBh%|l////N .///N%@%AB`H S! R`x/,OpN^Nu/,OBrN^Nu/,OH?8$n$. &.I(/*4/*0//N(*G(/*d/*`//N n ,*0.*4/*d/*`//N .///N(4(*////N n$&ցՀ !CLN^Nu/,OH<0$n$. &.G(/*4/*0//N n d(*0**4/*d/*`//N .///N(4$@&A////N( n$ & ցՀ !CL Jg lh)h8h// NSP j0*ht +"+ jJ g/[I/// CNpLHu$< BN*j0/*[I//+ /+ CN mtpLB *j0/*[I//+ /+ CNpLҭt AHh,<P"FN*j0/*[I//+ /+ CNpLҭt/E6N/ BNB\/."FN/N/ Np L`x"K`*I"i Jf+H `^!@ + L< j ("(,(蒨쑆` -@.R+G@+ `/,OH?< n..(n &n,.&. $./(D/(@/(|/(xN((*HxHxXKTN$H !G!F!K !D!E!B !C$ "!@!AB(B,B@!| DB0!|4B8BHjHN{VHjLNMDHjXN"/*PNU&-JL N^` jP p< SrdBRՀ`((/NX D`/,OH? $n". . /*///N(*[I$*(&*,,.mJ,*0.*4m@ *<Ҁ$*@&*D*[I,.m jP~WIDLN^Nup`B`/,O n ("(N^NuNVH?<$n&.$. (nzڎpʀ j0,( *`"*d(*l؁G(4/* *x"*|fZ/ NB\/NPP-KLp!@ *j0/*[I///NLҭt/N6/Hx/.-F-G//. j0/(t/ N6(H g // N8P , r€fNDj/ N5!D!lt )HtX(j0G(/*[I///NtLҬt/N(j0/*[I///N ltLB (j0/*[I///NLҬt AHhNP(j0/*[I///NLҬt/`/ / BNP`"+$+&,x|&$ " l / N5 *"*$+&+HxB//-HN(ցՀ n !C!DB "lJfF)H S PBtըd&(`ׁ!C`/ NB\/NP/ N6 BLHlHHlDHlHj/-@-A//./ N6 Jg&.S%C `BrӪ$*Հ%B/ NXpL j0 hp(L,&p$/+PKPJg/9:,Hn/-HN"5f. n/N!EJfVHn/./.N. glN9|/Hx/.N"//NS/N/N`//NP`~ /֪//*Hy+_NDr/NS/N/N`/N j!8@ j-y:X[I-@"n ")..ܑؒ!8H!8L*n j !h"m j  )") !h!h "m j )") !8X!8\*j/-L/-H/9:0[I/N(4HxdB//N(+@H+AL/N*j~+G8//*Hy+NDrHxHxNT !D!MB !DBx%H,B`BdBhBlBpBtBHBLBPBTBXB\/N}P. fv/N jB88B/N// N*H/N/ / N&B +Dp%@/N./ N6XB/ N/NS/NP/N`/N jr!88/N`/,O n h"h$JgN^NprN^Nu/,O n"h"i(JgN^NpLN^Nu/,OH 0&n/+4/+0/+D/+@N(4 . //N(Ԕ $HxHkN$HHx/NT%H$%n B0%n4BPB8 J L N^NuNVH<<(.&. D&PK(/+D/+@/+<$n*R&m0I@/ NX *HLgHj(N| *0"* XoVB@%@@ *("*,BS&*%@8%A,.&I$&)(*l.(* "l."hh%I *S`,.`(*`Bl` il%H *S`xBh`D/,OH 8$n&j JftJfP *g<(nE r$@*THx0B/G(N/ &<| CN$ Hx0B/N/ CN$ 4.GNX* (<6 -@Df/ DNXBG/ ENX -@Dg&'L'mX+KX/ DNXtHj CN *"*XoB@%@( *"*BS&/<B@B//N(4**([Iځـ۬T ,Pф)@PR( L<|N^Nu/ DN/ N5&HP|`>/ DNXSgB`^/ / N5P`쐁%@( *"*`pNVH<8&nE r$@$Hx0B/N(/ I|NB/+ /+/+/+ /+/NƸ'HD,fHy+Hx]N\PHjN *"*Xo`B@%@( *"*BS(/<B@B//N(4&*([I(*ڃق'DX'E\R(BLp Df4 *4f*r%A4/ Hy/ /NufJft 4$j `"jJg,'f *4Dgt%B4-R jl%|%|%|%| )") %@%A,).)BSށ݀%F%G )(g:*@,-.- %F%G$)("B )")BS,).) ށ݀%F%G B%|%LHj-n-H//. D/(/"ENJgtHkN| +"+XofB@'@( +"+BS,/<B@B//N(4*+([Iځـ۬d ,`ф)@`JfR( L8$nG r&@Hx0B/N(/ I|Nt$// N-(HkN"+ +oB@'A($+&+BS,'B 'C$/<B@B//N(4&+([I*,܃ۂ%Eh%FlB0Jf<|4lpHx R/(Hy+JNDr `,'A($+&+ ` R/(Hy+ NDrPp%@0r%A( jHt!B!h$BL|N^NuGP"j8BB**,*b | $R(` i Jf "i8BRу`!jHH!K( h`/,OH<<&nR($k8BBI(K|*< +"+b pL<<&n&+D$$k8"k JrBfJgJ0fn +(R`V(gB h8R`/* N,*8/ /NBRـ $F +"+bB8//NR4 +(UP'@(BL<|N^NuBBIvKv` *lRfLJoHHx0B$ /N(/N| j "*Bm6R/ HyH/N $j8BRف +"+bp`n hR`BB`NVH?<&nE r$@CP-I,+D*SR(Hx0Hk/*<)0"ENtԊ/I|NBpBtHx0B/ N(/ N.+8 BB +"+&.(.b/N *"*XoB@%@( *"*BS.&<(4/<B@B// CN-@-A"*([I @"A .".(҉ф'@'AHx0B/ N(/ N"F i.<zfJf$/N *"*XojB@%@( *"*BS./<B@B// CN-@-A"*([I @"A .".(҉фӫd.+`߀'G`Hx0B/ N(/ N// N/N *"*oB@%@( *"*BS.%@ %A$/<B@B// CN.*([Iށ݀߫ +ц'@HkN +"+XoB@'@ +"+BS.+'@'AHx0Hk/ "EN/N *"*odB@%@( *"*BS(%@ %A$/<B@B// CN&*([I(*ڃق'D'E/./ N)lz$BL`/ N`/ N:`/ Np`/ N4`-J$n&nN^`zfp'@0R/ NXL<<(n$. &.x؎pȀ/ EN&HX rgtb r#g~t L<|N^Nu ?re"<g/ NXJgF r!gb rg r f// NbHx C/`/ NXJft`/ NXJg / N/Hy+NDr t`Z C$HxHxoGTN$HPJg@Hxo//Nh$ g/ NU&X`HxHxoN&HPJf/ NU&Xt ` !jB A$2&2'' RPv(f@ fHxN Hj Hk K)0NAZCZ [ "$""°fHx/HkZN$*\&*\'B\'C\ j]"j]'H\'I\ *]"*] '@]'A]j]]HxHj]Hk] Njaa HxHjaHka N'joo'joo'joo .NU&X-K -LL<|N^`< r"g` r$fHxHx`ETN(HPJgHxHxpN*HPJf8/ `// NHx"C//N$`// Nh`/ / N$Pf2p*+T+l+l +l08EHGH, 0H*<($<)0xHxpBHsH"ENHx8HjHsH"BN&'j *"*'@'A'j j"j'H 'I$'j ( * "*$'@0'A4( 7HxpB/"EN$Hx8Hj//"BN'j08'j0 8 *0"*0'@8'A8'j08 j0 "j0$'H8('I8,'j080 *0("*0,'@88'A8<`p fHxp C// N$ / EU&N/ NP`$HxHxNT$HPJgHx/"C/Nh$ IU&g/ N`/ / NfP fp$Hx C// N$/ N`"C-i-iHn/ NT$`h/,OpNN^NuNqNVH 8$nBGIx⴮ m BLN^Nu-R-jBB-j -j/.Hx/ N JfR`/,O#4:LHy:@Hy:PNtPN^Nu/,OHy:@Hy:PNtB:LPN^Nu/,OH<0$n&. $.(.&jH*Wg`"*L *p"jPzOFʫ fJf%BL%DPL 0&n$.(.$kHp%@N(*g,*f$*L+Xp&,܄mV +Ln lpTBL |N^`  j/0 j/0/// j NRRpmR`B`/,OH>0&n(. &.*.$kHp%@N(*g4*f,$L+(pԃ,ڃm*Lf +Pn lpTBL |N^` j/0( j/0(/// j NRX`/,OH?8&n*. ,...$kH +p(LH j&L8L$/Hp8Hp(I)/N j/Hp8Hp(Np%@N(*g"*f j h//// h NBLN^`P/,OH?<&n(. *.,...$kH$L+(p *@ j&ւԆ/Hp8Hp(I)/N j/ Hp8Hp(Np%@N(*g$*f j h///// hNBL0&n&. (.*.,.$kHJmll~Jmz +porLЄ"jf\ jVID" j!p%@N(*g<*f4Lf*Pf$pT///// j N` t`B`JfBL |N^`/,OH>0&n$. &.(.*.$kH L+pЃ"DmJp%@N(*g$*f j h///// hNBL |N^`d" j! j| !R`/,OH>0&n$. &.(.$kH*+p L"҃LmHp%@N(*g"*f j h//// hNBL |N^`* j!X j| !XR`/,OH 0&n$.$nHxB/ N(HxHx`N'H& '|B $%|%| %|%|(BLBBP!BT!BXE B/ NL/ Hzd/ NBL N^Nu/,OH0 $n$*lL*(pB /NT%HPg Ј%@Bm L N^Nu" j! jv !R`NVH <&n$n (kJg*g(*Vf tHx? n/K/ N(B.Hx@/ N)/JgFBHnB-|cHxc/.B-|Hx/.Hx B/N(ul JgB * f0|gp///B/B/ N$pgnHn/N֒PJg\*g/*/*lB/ lN kp!@K(N%n/*DN%BDHjHx/ / kN j(g!jl j!jp *g /NU&X/ N)j)j%j )jX <>*f *)@ <ž*f *)@ <J*k *)@%|Ɗ%|%|0%|0%|Ą%| kBN k Jg /+/ NPBL<N^Nut`0|`tp`xp-`p`p`/,ON^`/,ON^`/,OH <(n$n $.*n&l%T%L%LBJf%kX/ // / lN'j'j%j  <>*f *'@ <ž*f *'@ <J*k *'@%|Ɗ%|%|0%|0%|Ą%|%JH/ BBHx/ jNJf\ %@/ N@XJf )Jp *Jg:r%A)J kL%HgC!I'JLL%KBL<N^NuB`r€%A`/,OH <(n&n *lHxHx NT$HPJg~BBB!K/.B// Nʒ$g/ NU&X L<N^Nu+g 'jl'jpJfp)J+KT n n P n L`t `NVH?<*n-m-m"m&ip+@N(-g<-f2-WgF/-/-lB/ "kN,-BBBll (n$n2|B`(|`. r fprf8f8 2|R(pmpg/"// // "kNڂR`g$g/"// // "k-@N ."B`rg /"// // "k-@N .///// "m N`dpT"m"i/-P/-LHx/ "iNBL WggJ Wlgz"UJg-B-H-J-A-K -LL< N^N WVf" *JfJm"+p$L+(lmLA$%AHn* I/B* /* // kN$fx/.B0*//*// Nt`Z" *Jf\Jml"+p$L+(ln\LA$%A +pLЪ k5p k 0A @ B L< N^NuJmpl Jmlmt`JmplJmlm&`&"UJg./// // / N$Jg/ N>/-LNτP`B` k <*ѰJg f <*ѰHn/*//Nż$fX%n`Nt`H/,OH00$n&* y?$(p%@G!4 y?f%C-JL N^` 0(I/NR y?X mB`/,O/ . y?!"®Jf $N^Nu$Ĩg P`/,OH0<&nHxHxITN$HPJ f,!Kp!@B y?!%H #?! J L< N^NuBHx(N%HHx(/ /K)0N&+L+8L+8B/N$//+$/N j!B$$.K)/"9?!#?! )vFƒ #:B:t#:x #?!$&N^Nu/,OH?"n&. ".,.(. . i*)e`.<N  g.<N!tĀg8$Jgf*Jg  f@fJgfJg//N)/`PJgB LN^NutĀg$<N `d'c0|'Jf` 'c"<'Jg`/,OH 8$y?!BGIJf"JgH .鈀rF«LN^Nu/. /././. /./*No$&J$R`p`/,O/ $y?!Jf$nN^Nu/*/. /* nN$R `/,O/ $nHxBB/*/*/*/NJl>/. / N 9?!#?!rF "*鉀!@PB$nN^Nup`/,O/ / Hx/.N(P$HJgh (fbJ f\GU&f h/($N j/N/*N R *Jg!@ j / NXB$n&nN^Nu#?!`p`p`/,OH<0$.Hx/GNP$HJfHx/NP$HJgFvƂJ g8Hx/(N&Hp j///( /(/Hy+NK $KJg2"jg( i$ )L)L)ЈC2I|eB j!DJg j gpf. j!C %BR n BL HxHxBBB/.N@N^Nu/,O .g SgpN^Nu-|:N^` NT-|:N^` N/,OH 8&n Ѐ/B/ N!e"$ f$k j$pg B/N"PHx/*$N"!HxHx/*$N"{n$/*$N" "*,IgpЪ0//NPHx8/ NBkP LN^NuNV/ /$n-n/ HxHn/.N"$f/./N"!$Pg /N" BX $.$nN^NuNV/ $n n P fXHx /HnN)0 jHn/.".[I-@-A//./ h$N Jf". n $nN^NuB`p`NVH?<$nBB * HnB/L*r B-@/B/*$I!NJfP&jx؋v֪0BK no* h0JXf(B".g B/N P".f LN!k@)@)lp)@ * D rJ fr)A r )A$lHnPHx/ N!$fv֪0Hx/N%H,/ Nl ,g//*,NB,P/.PN" ` r @"(gxCgpL%@ BB>(`dp`EHx/ CNHxHx/ N"{n/ NJg *,GgB/NPHx8/ NP`t`/,O//$.&. nBB//(Hx/N!TJf-C -B$.&.N^`$.&.N^NuNVH 8&n$n"nJg~p{dv(y:, +g0 kJgb%hp%ht%h xBp|"B LN^Nug:"gJg2Hn/93,/N!_$ f npg/N" Xt` h/( /(NPJf/.N" Xt`$<+g$<Hx/.N"!//./ Hx&B-|Hx/./,N@$$ .N"XJg/.N" X`/ / /.N$ f k!jp!jt!jx / / k/B/B/. N!t$`t`t`t`t-`/,Op-N^Nu/,OBN^Nu/,O n hBN^Nu/,OH0<*n$m m&h(kP/ N!B%k %k m h%h[I%@"+DL<Qp8$n j&h$*&* "jJg k("(jJgH k(((0"+PB DHh*,܃ۂ//N(Ԕ ()A jJg +L訐SJnBBL|N^NurHA衰mS ` `NVH8<*n&.$. (nE r$@ m&h(/+0//N($ $%A(+,B/ Hn-@-A/// N"JfDHnB//*//.N!Jf$ nJg "+4ƒҨ0("n"L<N^NuA`NVH?< n-h&h +-S-kB"nB(h$l*j(/Hx@/ N"|& f,$.-B J.j" l(g"Ufv LJg B/N PHnB"*8[I-@-A//./ N$f n((0؂"DBJf .8Э,%@8`(p l..ކ-G,n) BG=G-@2| o"D)phgA. g:rf "n .g .g Gf D(!I A..f/ /N%@@%ADPtfN!B/.N PJg Jf%j84(* **$ *@"*Dft/ N" ^X n /+/+/+ // N!`HJglrfB8-j4x-D`/-/."DHi!/./.-HNt nJfj"D)g$/ /N-@-AP**8ݪ8$.` (<"x((8z -Dȃ-@"[I(.*.ځـ-D-E`..䎮g|%n@%nD *8".g$-0(䤸f%E8`gP/ /N @"AP%H@%ID/ Hj@Hn$//N B0.gPBB`( (<"~"A.(8r -G. -@"[I @"A".$..ԉӇ A"B`~-g///.N(s Jf`///.N)1`Jg B/N PHnB"[I-@-A//./ NJfp` .g B/N P/+/+/+ n// N!pSg v`HnHxHj@/,N"Jf .`tvM`&`Nq/,O/ n"Ү Bt LB"@C( f$N^Nu/,OBHy;jlHy+EBBBHxHy?"Nz N^Nu/,ON^Nu/,OHy?"N"XN^Nu/,O"n i hB"iJhWDBN^Nu/,O/ n$h/ N"/ N"/*Hy?"N PBB$nN^NuNV/ "n$n nB0<@)f0<5@5|Jfv j((f(jmBB .g B/N P$nN^NuB)JgHnB"(0D"[I-@-A//./*N nJg h0 (f( fj( fj@(fj (fj(fj(fjCQhB0.%@CQh0.%@Jf`/,OH> "n n B(l oB))p Ѓ| LFЄxԄL<(oxLH䄔SzdLER|LJlV䀔L<8x LD8$BB)E $ zL()Ԁ|p j(B0$BPBL N^NuBB([ Z`Bt`Bt`///*$N)0ժ$ Jfpp`/,OHy+oNDrB n //.NN^NuNVH?<&n$n BA!+ BIfRHn"j/)/ /N$Jng4 jlB܋B&YK(ԔB Xbb ,fN n`HkNx jX`fp`"hJgf,(f/ / NPJg gBJg *g j"j (j.,8[I(* l,,,"[I**Ҫх-F[I-D(.*.욁mb/B/zڬ0// /N -@-A///,N!Jf, n(h0, ܪ`,B cH` .g B/N P(nP T Jf L @@c @ZbA `Jf @;fJg *.fS n0LN^NuJf @;gJoJ:$grF @c4xd^2x iA?@pԀ`J8Dgg$2I?@p`Jgp` gb?R`XtF`P/,OBN^Nu/,OBN^NuNV/ /$.HxHxHxBBBBB/.BHy+Hy+HxHxBBB/EN@HxHxHxHxBHy:$BBB/.BHy+Hy+HxHxpBBB/ND$.$nN^NuNVHx .X/HnN)0 .N^NuNV/ "nA r @$n$jper"p$nN^Nup"BB0 * "*$!@!A Hx//. N)0 B`/,O/ / n$n &h +,%@%@%@ %k8[I%@BBB B$B(B,B0B4B8B$nN^NuNVH<<$n&n (.APhB4.  b~*S&ƅft%B,HkPIZN%@8KHx"/ HjJfBT(M`JfBT. `JgB/N BTPRpdf`pp`gBh+sgp*`r+Ah`Jg\JHfB/ / NB Rg0+FB/ ENP`|`Jf/ /N"P L<N^Nu .Tg B/"ENP(Mv`Jg B/ ENP(MJg B/N PJfx$` .TfvB/ N `B/"ENP` .Tg B/E NPJgB/NPt`rJgB/N `vJg B/ N PJg|K`/ NU&BX`xt`,NVx/ /$y:,/9?NFXUfHnxHy+Hy+N!h$ g/9?_N" X $.p$ntN^NuBBB-|-|Hn|/ /.x/9?_Nn$E!bg/.xN/.xN!ahP`/.xN!q nxHh/N /.xN`zt`tNVpH><(n&n n(9:,$lJf pL<|LN^Nu rtf&,f$|Hxt/ /N)0 gJfBB-|-|&BtăgX gJgHnx/93,/N!_ Jfn nx|gv/N" Xp`R cF&,gJgB'Rpztg'jt'j x'j$|'j( B`-j-j -j$-j(`J h/( /(NPJf/.xN" Xp`Hx/.x&<"! CNHx/.x/ Hx&Bp-|tHx/.p D/(N@$$K"Jf""nx,fHxHx/ N"{ $ f@/.xN/ // /.xN0$Hx/.x CNJg.HxHx/.xN"{n /.xN/.xN" P `/.xNX// l/B/B/. N!t` jg &( i ("( C*(,( fV g "+tf g *+x ft,+|$fh k(f\/ N/.xN" P`h$`Bt` (%@ k((g0 ( %@HxHkXHj8$<)0"BNHxHkhHjH"BNHxHkxHjX"BN +"+%@%A%kL,B($JLfrfBHxNT$-H-|A(p)@BB B)|/ NvX-L C-h-h HnN&Jf <%@,B(/NU&XB|p%@x k(%h,0%kLB$BL< N^Nu"($` +` +`NVH00 n$h h&h (Wf Hy+NK. *"*$*8&*<(n,.&n*nE r$@&. ֬ Υctă/B-B/BN#(** B"<;e~B@*HBA* A2ADx iA F0Jg,d",L|Jg0 x@ /N#*.[I$& .xdLDL<X$%C%AL.RPZE2SG2R  g 2(Jg 3(RfBL N^Nup`rSrf~B`B12(Jg 3(R`nNVH><"n n *.$.B Rr fB( .f"vf.TIDL<|N^Nu ).g$I&I SjB`xf.|.zT`  g .g( R&S(DBG Sj&JfBJnB"Ҁ&A# g .gp`D  g .fJf" `Jg&AB`JgpvBI2Toz fxp" S(CK2T* c0|f f"N ]Jfr S 0 g"tnp~Rbp` "`tK8B3H4X3Hg|gpJfSz pRR`P" `&JI  f|m $K&E  fpR`@58$KgzgpJfS p`_rg$fL`."x LD0g$`z d`$` |gp`Jg f`NVH88". . $n(. AJo  g& .g &St L8GJf/ //NH`S`/ //N\$P./ Nn| B* n Bj ЀHx / HjI)0NHx Hk HjN HxHkHjN0| n@BLN^Nup`NVH<8 .". &n(.B+ fgv LJ@g4@ Bb02R0 2RfTpf`J@V`nNVH<<*n&n?S ct L<<$n&n &."*gJ`gL * j(tĀpLg2"j\B  0 f|(FR0|Jf0|Ԉ%BHnHxB0*(/tԪlB-A/B/*$N!Jg4B*f*f/ N X`(xf~R`l(n$,0/*` BHhKN/* BHhN*g / N X`/ N `֪DBB/+$rҪl B-@/B/*$N-H (0/+$/+0/N$*g6/. ENXJg//Hy2UHy+ FNRB*.m`/. DNX`tI!K)0(< *< ,<Dr`/ N XJg/Hy2UHy+NDr L<|N^NuNVH?0*.$n ,.$.pd\bHnHnHn L*Lj// N&(.HnB/.rҪl B-@/B/*$N!&,f&ng&.* +0Ю f/NX n΀ gf * g g f**+0ڮ/NrXgtr銄?Bg/NP//./ NMBr%At .g B/N P L N^Nu/NX fXgP`J`?Bg +0Ю/`|*+0ڮ/N//N `Vv`~NVH8 &.(. $n//N:BHn//HxNO$g//NP LN^NuJg$`/,OH 0&n$. "n"pĀ$kpg"D€pd L N^Nu0| ³c$+\Rbc 2g"D4| A ` `NVH?<$n&n (n$ Ԍ K0fB8|GQeJg(AR0Jg/./.Hx/// N`l""A jzʀrSzzgT*FR…2|Jf2|K// / N e/./.Hx// `c, .K `Jr Ё`B*"E jr€*A" * SzzgB*FR…2|Jf2|K// / N d~c, .K `r Ё`/./.Hx//`p`hNVH?<$n$. BBv*YGIK,<!rd\c .f,BL<$n&. (n,.&j8JXg@R?&$phfBR?& BHnBHx/ NJ$rg L<|N^Nu*LfbR?&$%jhp%jltK!(<(*< JfB` *Xg *lR-@HnHn/// NT $f .Jg F "jXJf@%@X nC%IhS%Hl.g*Lg ."S-AJf@B`v/B/*l/ HxNO$gB/./ NQR ` "jhR`"+p .$R-B klBB/U"+dЫT"B-@/B/+$N$ (0/($B/"DN BB$Jg (I`F/"ENX`t`NqNV n0.X@N^NuNVH?< npЎtĀ-B&h,($h B-R&**k(m8 FB/*Hx@/ N"|$ fR. JCj k(g "Ug/B/*//*/* / N!Jg FJWIDԂ LzB&<pfJg k(g t`Hz` g/*Hx/ N"|$ f XfJfZ///./ N>$`JXg|&<///./ N>$gj`иXfJg`JtM`t`NVH?<(n.. *npЎr€-A G$h8 R,("G")\$*db`pЩ,Ъp-@HxBB//NX$g$HxB G/(\/NCV L$f n ("n"`B`B`&hf .Jg/N XHnB/. "*d//NJ(fHnHx/.pЪl/"n/)/N(Ԕ -@-A///*$N!(fX h n&h0"G i8p //.// /./.N8rځJgR`/N (Xg>$zڎ/B/. "*d//GJNJfvHnHx/.I(ԔpЪl/"n/)/N -@-A///*$N!Jf,ƪh n h0 -R-@:|&< $< p ЍcN .Jg/N X``|`/N (Xg`JgB`B`hf .Jg/ BNX/B/. "*d//NJfjHnHx/.pЪl/"n/)/N -@-A///*$N!Jf( h n h0R`/"CNXJgz$``/N `NVH?<$n . $.(n&n&*p**d"*l(Jfj,*P Ђ騼d&ƪh ЪLA/ B/*AHm//N(Ԕ -@-A///*$N!JgBL<|N^NuUЪT`Jg TĪhԨ0&`/,O n/./. /($/( /(8NgDN^NuNVH?<(. pЎ|̀"n$i8*n& Rz@ʨ D (4S!@4IfzG:| Hx HuH/ $<)0"BNHx HuH/ "BN-DHx / Hx / D/(/N"z0Hx / HuH"BNHx HuHHx / *D/-/N"H$6| (<(Ԕ.< v֋/ B/ "*d//.NJ$fnHnHx/.pЪl/ F/(/"DN -@-A///*$N!$f,"n h i0 ( g *ngB/ N P L<&ntԎpĀ$k8BvIKJzڎ,<(Ԕ/ B/// NJfp/B/.pЪl/ B/(/ FN -@-A///*$N!Jf2"n i0"ҮeB/ N RP`fB/ N P L<|N^Nu g ( fB/ N Pv`B `Nq/,O/ "n$i j8"<*Lg"<mpf ($_N^Nu (`/,OBN^Nu/,OBN^NuNV n0.X@N^NuNVH 0&n n$n (r !AB/Hn/ N!]$f& .g,/N"X k$,%h0 n L N^Nut`/,O/. n/( n/(Nh JVI n D N^Nu/,O//$. n h&(/N././///. N"NJ$.&.N^Nu/,OH? (.*.,. n h$(Jf:B/E~N&.N.//////.////. N"ƈLN^Nu.`/,O n/(NfXJVDN^Nu/,O/ $n Hx/ N"!PJf jJ\f / N"Xp$nN^NuNVH?<*n$n&n &.$*.( j 4g,*pf (fr!A +J,fx؎///+Ni$ fVt@Ԫ~Hx /HvxI)0NHx //N/B//+/*N`$,gvHx Hvxp@Ъ/N J,fJ/.,/ / / N"ŰUf jrè L*g/ N" XE n `(j*l8"mlHnB/-p ,XU"-dЭT" B-@/B/-$N!(@Jf*. E(h0,+gHx Hy+Hl N)1 JfdA:Pl;8.\ g$B/NP"n iXfN/ N"X`.4Tl2.Ypᩈ`B/NP8|/ N" X$ LJf/./N"!PJg/-@N" BX .`p`NV/ /"n n$i$*pep t $.$nN^Nup $iHxBHnN(=| * -@"*$-AHn///NF*$fHxHn/. N)0 `/,O .g SgpN^Nu-|:N^` -|:N^` B/,OH 8&n Ѐ/B/ N!e"$ ft$k j$pg B/N"PHx/*$N"!PJlNpHx//*$N"{n/*$N" / NHr/*IU&N/ NBk LN^Nup`/,O/ /$n/ /<B n/(N>$f/. /N"!$Pg /N" BX $.$nN^NuNV/ / &n n $k%ht%hp (x%@"(%A%h p?|Djr%@Df(r%ApF*fp '@ B$n&nN^Nuf fr`HnHx/ Nx. Jf n/(NkXJgp/.N" X`p`NVH?<*n(n $npЎr€-A m-h-h Hx/ N"!BB/ /*Hx/ N!T$.N"XJf-lBHn/./ N$ g n(f^-| nBB . cV n(g f@HnB/BBB/./ N!$ nf.&h0HxHxNT$H k Hk $<t0 BN65@(Hk BN=@5@,kn.Hk BN=@5@0Hk BN:5@2Hk BN<B0%@DHk BN>5@8 Hk BN5@:k4XJEfHk$<tL BN%@0EnPJ@f%|p%@r%AHk$Nz%@DXJk.`.pdHk BN%@Jg8Hx/`t .gHx/N PJg *GU&g/NX/ NBX`NVpH0 $y:,/9?NFXUfHnpHy+Hy+DN!h$ g/9?_N" X L dN^Nup-@BB-|r-A-|&t// /.p/9?_Nyb$E!bg/.pN/.pN!ahP`//.pN$Pg0B/.pNw/.pN/.pN!ah/9?_N" `T/.pN!q npHh/Ntp/.pN`,t`&NVH<<$n(n"n&y:,Jft L<HFHGHƞgBHx/NZ/<p.* BG//-D B@-@/// N" Jg&`$.@f r`pHx/NZHx-nB .".҅фBу,F// @-D-@/// N"&~ Jf @fHx/ NA&P`v`v`NV n0.X@N^Nu/,OH00&n k&("k$ipg2Hj,// Nh $ +f/N" X L N^Nut`/N" `/,OH0< n&h*h&( $k(mf/ N" Xt L< N^Nu/ NfXJgf*f^Hl,/ / Nh $ f/ N "X L N^Nu k8xبl///N(Ԕ %@8%A<`B`/ /+ N"T$P`NVH 0 n h$h/*$/* /*XHy+GDrN *"t B/B -@/BHy+N .+NBL N^NuNV n"h"i")\B-@-A//Hi $n(. .,.*.tԎrā"*v%CgJf/NX& BHjTHjV//N3* L * j8(ffDf,JfJfv/NX&(BBHjR//N3*g.JfJJf /NX&HjMHjNHjP//N3pL|N^NuB`XB`p(`&`NV|H <(nE r$@*l l&hJXf k,\dHxxB/ N(Hj@/ / Ni$f lJ([!@LBXB\ +"+%@%A%k %k88r%A$<CfT/ Hn|Hk,/ / N`$f, l"n| /-/-/- l//,N! L<hN^Nu k8/( BBB/ BN`t`/,OH8 n$h&j/*N/ N"jPIrm,/*N6BLN^Nu k8/( BBB/ NCf`NVH?<*n m&h(k8$m0,(>O,<Cf +"+%@%AB6B+Lg +Xg&-@B",dl/ .".BU//N(Ԕ -lTB//$.&.ցՀ//N(4(*%D %E$"<m+Lf"< mxf ,€%A%l %lp%@BB m"( $($%A(%B,tHԊ//, BB0+T/0+V/&<4 CN k8C8xX؊(gDjdr€%A*LfRJ4oJHnHn/ Ng JfHxHj@/.K)0N&nHxHjHHkNjL jM B0*N/HkI>N B0*P/HkNB0*R/HkNB0*T/HkNB0*V/HkN *X/HkNP*Lf$*\ZHBZ-BHxHnHkN j8 fNB0*X// NP .".g6/N XL<N^Nu j8/( B/./. / N`B`/N XB`NVH 0$n&j$* // N!PJf`*g> * gL k ( B y:,/(HxHn/<dv/N""`p/BB/ NJgL N^NuNVpH?<&.E r$@ C(( h$( B*h8 U*("BJXf ),\dBHn|HxB/ NT &@Jf2HxxB/ G(N%M8r%A ICf mlBB/-p .|U"-dЭT""[I-@p-At//.p/-$N!, (0/-pB/N F (0$Hx@Hy2Wx/N)0"F&i0..|?BgHkINB0*P/HkNB0*N/HkNjM $B0*R/HkNB0*V/HkNB0*T/HkN B (X fLfB?BgHk:NB0*P/Hk0NB0*N/Hk.NjM-B0*R/Hk2N B0*V/Hk8NB0*T/Hk6NA4 fp//N BB0(X// Ng/N XHj@//Ni&@ Jf|L%n|XB\ B ("(%@%A%h /HnxHh,// N`&@JfN"C i"nx  L&S 6 9 g&//Hy?uN)0B09?u#?u L N^NuHx/// /N$`t`t`/,O n"h"i )r eN^`Hx-/Hx/N`N^Nu/,OH8&n$n CJf^B y: #:R: *fhR:Jf\BHxNTB!Hp!@!@ PJfG2i!K%H`* kB(h(!IR *f R *gBLN^Nu/,O/ $n Rp(m p$nN^NupeHx/N #\$Pg hpf"n PVI`NVH0<(n*n$. ,fBB/BHxHnHxN {$@Jf/.N$@XJfR .Jf:6|&<`// /. CN$@ p0f0SfHy+NDrX`/N4$@XJgG`Jfv֎Hx/ /N)0HxBN b&H n&(kp<'@Hx8BHlN( 9:R#:(r)A)n )n)np)@r)A K-HfZ'J(B /Hy:HnHnHz^/ B//.N$@$JfB(n l$hJg ( gSg4|H` P`"hJg8 SreEI/ G "N/.N/.N }V L< N^NuJ g,pШr// N  n PJg*B`p`4|I`4|P`4|/`NVH 0&n$. $n f4oBL N^NuHxBN -H"hp!@"#n#nB 7|o/.BHnHxHx/</ N"$Jf npd n"h4/N "X`vHx/N #\-HPfp7`^/,OH0 &. $VpĀX n6HxBN $HP o0B/N P*f/ N XE J L N^Nu%B j //./N)0 `/,OH08$n(n &npmHx/ N #\$HPJg< j$&l&/ /Hx/ N &VpĀ BHh/ N B48& J L N^Nu/,O/ / $nHxBN  "hr!Ar"B#A*#A*#A *#A$n&nN^Nu/,O/ / $n&n peHx/ N #\$HPJg jpg BHx/ N P J $n&nN^Nuh hh`NVH<$n(.&. *. j(hG!,gpBHx/-C-D/// NK'BJg L<8N^Nu/.B/ -HN nJf 9:Ѐ/B/-C-D/// N`BB/-C-D/// N`/,OH?<&n,.*.$k k(h ,gJg&9:փt/+KNX. Kt0(<'B0*f@5@/+.<6 GNBp///./. / K!TN(gJf/B//./. / N$f/+NXJg %D8jJfj0*f@5@/+ GNX`jvƀg &,B| j+H |%MR/ NXBL/ N6Hx/NZ$Bxm /N`8*nX ] R`NVH?<&n*. -n-n-n EJg.+ k-h-y:,pg EJlt L"n)f(E , BBB-l-@//.//./ ND(H GJhl ",$(&(f/ /NC@R?EPB`vxgPrgtfR?EvƮ-CK"EJg(/ N G&((( (E l"l X " e^BJo//$.Ԫ0/Nx$ +vgJxg\rfnJfVJf"EJgJJnH`@tīB//."-lB".$.c-C-D/.// N$g* E&((( G ("( d`Jf /NXB`>Jg Jf8jtԎHx/NZP`ltԎ` Y"SvehR`-l*, Hj0NXtԎ r "[I(@*A/ /-n-E//./ NR>-L-M/ /.-n-E//./ NSXj(Jf`T Y"Sve R`p `-l*, Hj0N}VXJf` lB/.//N p`(Nq/,O n hH WIDN^NuNVdH8 &. (. or€$AHxBHjN(HxpЮ// N)0B/BHxHndHxN {$0g/Hy+NDrP LTN^Nu// / L<(N^Nu$-nd `N,(ݮ` P`jHxHnHnHn// NJfn-Gx.B.sApHnHn/.`/. //./././/./+/.xNT*H .0g /NU&Xp(f -f$"-fA `6rmtl"n iP&( $(/N4XgJ.of//N4//N5//N5 //N52./N5D//N5V-DxJ.sg.BHxB/. N +<-Hd`vgf-GxB.s/.xK5N"+Xd.0|-HAp`/N4XfB`-Gx`/.xN0|X` f mHrLe~"- hP tljY+AXJg -gX( m -(Y %M%n&.J=2kP^ID-@X+g. +<%@$B(B0%nX B R?FB@ B bF!Hy?(@NB y?(H%H #?(HHy?(@N6N%PJ$g"|(f+f k`dlB@F+3g/ / N*PgB@ A bF!B@Fr gv#gB@ B bF!Hy?(@N RX"*Jg !A j Hy?(@N6"* Xgp%@ `B@FJ(gr(g `""n("Jf j*#g LHy+) +X//*4N5$* j-H"j -I (Шr l V& f LA -H") ?GLf t?GDg ^+g X?GHf NJ\f J nB/K "N/*NP$..xv-C\`.AH`BHx/ N "*H `pe`BHxB/*N +#?(H``"*(`$* j-H"j`-j-j&/N>/*G "NHx8/ N/.dN`Hn/Hx HnHnN<`&g /N "X`"n`v-`v `vP` )+gYf/HnHnHn~//.x/ N&fZ n ."(Ҩ|lf"X-A @JfF n ."(Ҩvlf,X-F"@ QJgpd|Gebp;ev` n"("h nJoh҉Vvm Ј-@`P//HnHnN?&g4`Hn/HxHnHnN<`&f .`0Hn/HxHnHnN<`&f .`8pЈr eNЀ0;NBBBBBBv?+gH"n""n ""n$"` SveЀ0;N> "(.v`'gL'f+gF/N "KN&.t[IցՀX*<tNm$.tԂ-BtvXv `v`v`v`v`v`v`v`v`v`vB`vE`HxBB"n/)TN!vF`dvG`^B/9:BHy+8 EN`v`(0 2o$"+( +$$| -kDB-kH-kLB,+PC(m-@[I-AJf$+Dtf:+y?Gp)Gh)nl)np"k -k$lP C$,&,prgB".ܲf( f"f$*X&*\ .".f`g)|)|$%H%n%n%GH%nL%nP%nX%n\%F`%|h%|lr%Ap m%h[I%Bvg|g$Ug&Jg m%h0 +%@%I %n +%k(%@, + %k%@ +8%k4 %@$%k<BHxHxN$@.?&@NXJg"#:4:Hy?&@N6 L< N^NuR:4 9:4:m&<t 9:4:ol$y?&8JfHy?&@/9:BHy+ CN` jJg!j j / N|Hj BN/ NS:4 `/,OBN Hy?&@N{VPN^Nu/,OH<<$n(n *n$& Gs(<'B * g@%@BHxNT"n"%H%|%n"n %Q/.N4%@HjGuNB& (<s*<'B *"g g@%@tP"n/NU&X * f@@%@`<@%@ 9:Ѐ/Hy+Hx/N/,4/ / DN$g j L<Jf\ n "n "Ah`J@@%@HjNX`NVH?<(n(. *nG r&@HxBHkN(/$<4 BNv?LC$t Jf p LXp$-@ -J$n&nN^` jG" JfB/Hy2k Hy+ NDr/*N`/ NL/*NP`/,OH<8$n&. (.*.Hx/NZ&CPBIy̸n(/NX-E-D-C -JLX *g /N>Xpf Hj0N{VX/ N"/ Hy?'HNBBLN^NuNqNV/ /$n -@$./N -@ .Xg // N  fB jHpLe6 (PШ\"*Ҫr \Df(J`0p`"*Ҫ `HxBN (H$B((Pp Ѭ~ ބ D"n P"C/)-H"EN"D#@X( npKgm~rHgXpJgB ,gR fV lHpLeH (PШ\ lr\Df*X&XJg://. NS D P`rLgB fJf F *BLr-AHxHnHxHx)/ BN $fHxBHnN(=|Hy:Hn/ N w$g`*3gj/ NXt9`| 9:Ѐ/B/ CN +gJkHfJg/,4/ / DN$ gk/ NX`&JBfpArL9:Jg 'A'@ *(IxrfB&*tpL8 *p$*xc$Ԃ/// N B$ g/ N`[f,&*tpL8 *p$*xc$rL(`/ NXp(g Hy+NK. k( g&r-AHxHnHx/</ BN  k hf$p-@HxHnHxHx/ BN vL*8ttL*(p/ NX`r@/ N 9:Ly?G(rL%@L%@H%@D%@@B\BXBTBP%|dB`BhX L<N^Nu/,OH><&n$k/ NDX*gx L<|N^NuIN$&,<'KtHy:/ / FN( f>B@ B bF!Hy?(@N y?(DXJfHy?(@N6B@FX`pgVg+#fr*fB/9:BHy+N`vN(* D"E*9:LyX?G((*8LEH*[I " o`f ( f@@!@ B( P`Tx`/,OH><$n&n *v@ƀgn"+4:,gb$9:g $*BX`"n n")ҩVzmVЈ-@ n&n (Шr lV$ fLA -H($+//*N4//*N5//*N5 //*N52./*N5D//*N5V(+pe* n&n"(Ҩ T刲m$ fЋ-@JgH$Hx/N(HPB)XfHxHx// /*N5// N + b"n nJg")ҩVxmЈ-@%n4%nD`//HnHnN?$g`Hn/Hx HnHnN<`$f&n`Hn//HnHnN<`$f&n`//HnHnN?$gd`?G8fj ,g,SfJQgHy+NDr%|@Xz%EHX` ,'@$Vt @X+HP'@ QexBB A*p+@/ NvXA(-H-| -XgHn// HnN?H$f n ."(ҨtlBf<(P-D @ P?G8f r @gFHy+NDr%|@Xp%@H`.Hn/HxHnHnN<`$f~ .` n ."(Ҩtlfx؀-D @Jg0Hy+`Hn/HxHnHnN<`$f" .`Hx HhHkN)0p '@r@Pt `(, n ."(Ҩtl.f(*P-E @ P?G8f r @g2Hy+`Hn/HxHnHnN<`$f .` n". (Шt l@f:z ځ-E k"tLB&p tI4KNJf6%|@Xx%DH`nHn/Hx HnHnN<`$g`/+NXg&k`"*@gA+gVp///N Jg&+[IN(*m + "+$Jn $fJ(oB%|@X`Zp`/+N4~%kz PX`/,O/./. Hy+ BNH^BN9 BN^Nu/,OH<rgvgx#g +3fBlH/ NX`,B`lBB*k4/-` * g@r€%A R( *(vdlpd%@( +d n <'@dR?FB0`x%D ``Brӹ?ET$9?EPՀ#?EP`j/,OBHy;jlHy+/BBBHxHy?DXNz N^Nu/,OHy?DXN"XN^Nu/,OHxHy?DXN BN^Nu/,O/ $n *g /N>X/ Hy?DXN PP$nN^Nu/,OBN^Nu/,O/ $n n pgb"h (JgP#@"h""hJg#h"h"p!@2kg& ((S!@(fp0-@ -H$_N^`%@(`$_N^Nu/,O/ HxBN $HP o B/N PB n  J $nN^Nu/,OH?<&n$.VpĀ n $P(.Kw^JnJo *g f" jH|Le (PШ\"*ҪoHxBN B$P$H jBB0Rf Ђժ n n BL"Bn=@HxHn/ G)0N *L4j/ /HlNBLN^Nu"p`/,OH<8&n$k(. g\/ N/ N6Pz&* Hx/N"!$PfNJf,/N"jXrl/N"Xt L LX/ NU&%K XJfr'Ap/ N" n 9:0"R#:0/Hy+HxG/ NE/ / HxNٲ%H `/ B/ N' Jg/ -@ND/NR/ N{V/GMDN/N/N/NHx/ N .N "X .`p`NVH?<$n*nJg6pGd.(9:,"n&i")gJg *g k4(hB/// N& fdB%@p$%k( %k,BB%k%kt %kp$%kx(%k8,%k<0%k4%k|8B<%kl@BDrH*B LX * '@/N4~X* g" +g /N>X * '@/N4~XB/9:,/* / N<JfB`BdLN^Nup `NVH8<&n(k*l l h&(0-2Ag@;@/ N/+/ N $ g(R?F  fp tԎ//Hx/ N:$H-H"(Jg02m VvXg g:JoX/ /-L/HnN@$gp/ N "X L<N^NupD`| hHrLe"(PҨ\ jm nѪC-I2m B -L2m/ //N)0 Bx؎/v֎/Hn/+ /9:,Hx/ / N$$g jfJf"-LB/+//HnN$g/.`, h" `Ng\ fh hHpLe\ (PШ\"*Ҫr\Df@ . nr Өv ր-C"-LHx //`"(Ҩ v\`HxBN "n"-HB-hP` npf8 k 0n(!|0`NVH?<$n..*.pЎr€-A j h,(B"n ()R?FX0|Jf0|D&VpƀI/ Hp8Hx/N:&H-H"(Jg"D0i VtXgT g0JoN/ D/(L/ HnN@$gh/ N "XB`"kHrLe")Pҩ\"km nѫC-I*D:m B"D )L:i/ //N)0 "j:i-M VrX n"(gB gJo/./)L/ HnN@$f@ cX/ N "XBBt? jhJf"n iB`BdJf jB`BdJgpfB L/// HnN@$gN`"hHpLe )PЩ\"(Ҩm .ר"҃-A @ B8///N)0 HnK/ I/ Hn/./.Hx/ /N$$gj*G "Jg-n n ."(Ҩvlf(X-D @*g"BB/ / HnN&f-n .* n". (ШvmtHn/Hx/ / N<`&g/.NX$B`J"(Ҩ `Hn/Hx/ / N<`&g/.NX$`: .`Jf(X-D n (&( n"A"?G0fZЃrl(&fC-I"n#hB#h -hB#n#n"h n!I G (x"(|fWID-Fpf&.(. (0"(4fԳ8WID~-J n ."(Ҩvlf"X-A @,gBB/ / HnN&f$n(jJfJfJgpXЬPHx/Hl0N)0 `".`Hn/Hx/ / N<`&f0 n`BBB`<~B`4Hn/Hx/ / N<`&f .` .f8/*Hx@/ N"|$ fxfJf/ N" ^*XB`-kP/ B/*/// N!Jg/*Hx@/ N"|$ g g /N" XB`/*// (<"|v DN (UJf( k"G )H")L$(0&(4f )P8gJg / N" BXHxBB/ N! nPB8B0B4".$-A4R?ER?F((*.&fn0|$&VtƂHn8Hp8Hx/.PN:(H-HL"(J4g nP4(H VzXg gJo2//(LHn8HnLN@$gL/ N "X` Jf rgWfJft`$<"!.2f"Hx/ BN*PJg4/ N" BX`/ N"Hx/ "BN*Hx/ BN`/*// "DN$ f0 l"G )X")\&(x((|fR?E/ N"X`HxBB/ N!/ N" B`n0|H`"lHrLe")Pҩ\"lm".8Ѭ$Ԁ-B8"A0h"B nP (L0h/// N)0 o/ N "Xt?`p"l" `g` fl hHzLe` (PШ\",Ҭr\DfD .8 nLz ۨr Ҁ-A8 nP"(LHx //`f"(Ҩ t\`HxBN "nL"-HLB-h8P`X nL (g g^Jo|//* Hn8HnLN@$g/ N "Xpffrg/ B/ N  vgWf@`&"hHtLe )PЩ\"(Ҩm .8ר*ڃ-E8 @ B8 * ///N)0 B*X * )@/N4~B/* B/*/ NLN^Nup`/,O/ $nHx/./9?N4V/ N * S%@ f HjNPX-J$nN^`/,O/ $n j hhHh NX-J 93 y?"p $nN^N/,O/ $n j hhHhNX-J 93 y?"p $nN^N/,O/ $n j hhHh NX-J 93 y?"p $nN^N/,O/ $n j hhHhNX-J 93 y?"p $nN^N/,O/ /$n$. /*N j Xg //NXP-j$.$nN^`NVH80 n&((($h Hx/N"!$Pf6B//-|BB/./*NC"$G"g/NX/ /N"\P``BBBB/./.Hx/*/N"/9:,/*/*/* //N\$4f&B/*/* /N!/N L N^Nu/NX`/,OH?<&n k$k(h"Rpf. **,g*l(Q%FJVID//+ B/ /N(f kJgL.B /NT"k"Pf0܅%FR?EJg kB kp L8&n _r€$A(k/+ // N"|v Jf"+Jj" l(g ,teJgp`x[g/B/*/*/* /+ / N"8(/+NB tgLtIĪVI[ID@*$|/B/ -@P-AT///+ NC"L|0N^NuB$< `NVH?<(n*l m&h(+$m *"*tvfBJgR?F,tԎ/HxHHx/ N:&H-H0j V|X"+gB gJo//*L/HnN@$g/ N "X`N$&**Ȗ̕/ / NP*,lN$*/, N4Xf8$*"*&, Jf gz`f LHn/Hx//N<`(g/. GNX$` .`/"GNXJ, kFJg|**,*prgjfd"* ,JfH%@B`-LL"hHvLe0 )PЩ\"(Ҩx \Df n"n| ݩC -Ip !j<!j@(*H**Lprg N n$&g d (g  f ""hHvLe  )PЩ\"(Ҩx \Df n"n| ݩC -Ip !jL!jP n (g  f ,"hHpLe  )PЩ\"(Ҩr\Df . nX&X-C @ ?G,Bzڎ/E/ Hn/./.Hx/ / N($gj nG "Jg "n*i n". (Шtl f &X-C n ($( n"A"?G0f FЂrl $f C-I)hB)h -hB)n)n ()@$.&.xf|WID-Av"nf $.&.,-0.-4f ư8WIDv-n n ."(Ҩ~l f "X-A @Jg HxB// HnN.f  n$hJf Jf Jg pXЪPHx/Hj0N)0 ` p"k" `pgN fZ hHpLeL (PШ\"+ҫr\Df. . nv רx ؀-D"-LHx //N)0 n ( g f"hHpLe )PЩ\"(Ҩr\Df n"nv שC -I *rf 9?G\ * vf 9?G\!@ *xf 9?G\!@!j, !j< *@zgzL|!@!jL *P|gbL|!@`"(Ҩ t\`HxBN "n"-HB-hP` "(Ҩt\`HHxBN "n"-HB-hP`(JgV fb"hHpLeV )PЩ\"(Ҩr\Df: . nX&X-C @ ?G,` "(Ҩt\`HxBN "n"-HB-hP` "(Ҩz\`HxBN "n"-HB-hP`JgV fb"hHpLeV )PЩ\"(Ҩr\Df: . nX&X-C @ ?G,` "(Ҩt\`HxBN "n"-HB-hP` "(Ҩz\`HxBN "n"-HB-hP`dJgV fb"hHpLeV )PЩ\"(Ҩr\Df: . nX&X-C @ ?G,`* "(Ҩt\`HxBN "n"-HB-hP` "(Ҩr \`,HxBN "n"-HB-hP` JgV fb"hHpLeV )PЩ\"(Ҩr\Df: . nX&X-C @ ?G,` "(Ҩt\`HxBN "n"-HB-hP` "(Ҩz \`HxBN "n"-HB-hP` (gT f`"hHrLeT )PЩ\"(Ҩt\Df8 . nX(X-Dz @ ` "(Ҩv\`HxBN "n"-HB-hP` n (gR f^"hHpLeR )PЩ\"(Ҩr\Df6 . nX&X-C @B` "(Ҩt\`HxBN "n"-HB-hP` "(Ҩz \`HxBN "n"-HB-hP` (gT f`"hHrLeT )PЩ\"(Ҩt\Df8 . nX(X-Dz @ ` "(Ҩv\`HxBN "n"-HB-hP` n (gR f^"hHpLeR )PЩ\"(Ҩr\Df6 . nX&X-C @B` "(Ҩt\`HxBN "n"-HB-hP` "(Ҩt\`HxBN "n"-HB-hP` "(Ҩt\`dHxBN "n"-HB-hP`D"n")tf 3`T3`Hp`p`Hn/Hx// N<`.g/.NX( L/// HnN@$gN`V"hHtLe )PЩ\"(Ҩm .ר"҃-A @ B8///N)0 HnHnK/ Hn/./.Hx // N$$g&k jh`"(Ҩ `I "Jg0.* n". (ШvlRfJ*X-E n (&( n"A"?G0fЃrlV&fLC-I'hB'h -hB'n'n(('D G (x"(|fWID-Epf"*.,. (0"(4f 8WID~-J n ."(Ҩvlf*X-E @,gBBHn/ HnN&fX$n*jJfJfJgpXЭPHx/Hm0N)0 `Hn/HxHn/ N<`&g/.NX jh$`".`Hn/HxHn/ N<`&f n`BBB`~B`Hn/HxHn/ N<`&f .`JWID// Hk/ NJg/.N jhXJgxJg rfB` mP (X"(\+@x+A|`/,O nB/(/( Hh/(NǼN^NuNVH?<,.&n..E r$@"n i h"(-AB()R?FTpoFJfpH&VtƂ*VʂK/ CHpXHx/N:(H-H"(Jg4"D0i VXg  g2JoP/ D/(L/ HnN@$gj/ N "XBB`t"lHrLe")Pҩ\"lm nѬC-I*D:m B"D )L:i/ //N)0 o/ N "XBBt?"n ih khJf iB`BdJf kB`BdJgpfB LJo\//,LHnHnN@$gr/ N "X L n"nvשC-I"n)g@ !j * f8BBC!@ n"xB//Hn/./9:,Hx/ / N$$gj n ( h".JgЈ-nvlf,X-F AJg"BB//HnN&f-nJg/.`X"m" `|g f hHpLe (PШ\"-ҭr\Df . nv ר| ܀-F",LHx //N)0 n ( g f"hHrLe )PЩ\"(Ҩt\Df . nP,P-F"@" `j"(Ҩ t\`JHxBN "n"-HB-hP`* "(ҨtmHxBN "n"-HB-hP`!j  `!l ,` "(Ҩv\`$HxBN "n"-HB-hP`Hn/Hx//N<`&g/.N "X$`d".` n ."(Ҩvlf,P-F @)P)h n ."(Ҩvlf,X-F @ |JgjJg<"n n )ЩJgr l&fC -I-h"P&( S c/.N "XtH`Hn/Hx//N<`&f .`4Hn/Hx//N<`&f .`DHn/Hx //N<`&f n`drl &fC-I-PC&(`JHn/Hx//N<`&f` n`:| r*@ <lN R P/B/-@-IN( .k Rѐ RB>+ *"* 'x'x B"nлb R&P&'n7C 7MB+ ލ fBrӪ Rp ѐ RӨ/// /N?HJg/.-@N "X .$`p&֍ R /B/N( Rא R "n n )ЩJgr l&fC -IJfJf n ."(ҨK "vmTHn/HxHnHnN<`&g/.N` n". (ШV|Ɔm ҃-AB`L////N?&g`Hn/Hx //N<`&fh n`@rl.&f&C-IJfJg*/.N "X`PHn/Hx//N<`&f n`"P (*n-g%@%I B2+''P`4%I%@ B2+''`"C%I%A B0+'' `"f"X-A @& . c|/NXJgJ&< R /B/N(0+C7@ j"j '' Rא R Jg *"* )@)Al` .`t/NXJfJg|*n -xjR‰cB``NV8H?<*n$n m-hH(m-MBLBG&TR?F`HnPHx\Hx/ N:(-Hd4,H VrX"(g  glJo//,LHnPHndN@$g/N "X .Lgf J/ N" X L<N^Nu"nH )xjR‰cNB`"hHrLe")Pҩ\"hmx nP"DѩC-IP2l B ,L2l/ //N)0 nd (g> fH"hHpLe: )PЩ\"(Ҩrl nP"ndpѩC-IP"nH)g" !j * fBB!@ "nH!ix!ipB/,`/Hn\/./9:,Hx// N$$gj-Ml n` .T"(Ҩxlf"X-AT @Jg BB//HnlN(f*nlJg/.\`,"h"`z "(Ҩ|mHxBN "nd"-HdB-hPP`!j  `!l ,`HnX/Hx//N<`(g/.\N "X$` .X`("n` nT )Щr l@(f8C -IT)P)h (~(`JgJf2/.\N "`HnX/Hx //N<`(fr nX`"n` nT )Щr l<,f4C -IT-h@-PD"( S cF/.\N "XtH`HnX/Hx //N<`,g/.\N "X$` nX`2| ||܀ <lN R P/B/-@8-AJgJ&< R /B/N(0+C7@ j"j '' Rא R Jg *"* )@)Al`/N" ` n` .T"(Ҩ,< "xm$HnX/HxHnTHn`N<`(g./.\ FN`NVH?<$n,. (.&n** j h"(-AR?F(Jf0|$&VtƂK/ Hp8Hx/N:(H-H"(Jg"E0i VXg g4JoR/ E/(L/ HnN@$gl/ N "`0|H`v"lHrLe")Pҩ\"lm nѬC-I"E2i B"E )L2i/ //N)0 o/ N "Xt? L/// HnN@$gN`"hHpLe )PЩ\"(Ҩm .ר"҃-A @ B8///N)0 B|܎/K/ Hn/./.Hx/ /N$$fJf,/.`"(Ҩ `JldJgJf n ( h".I "Jg`Јtl(f" X-@ A& Sg>/.NXtH` Hn/Hx// N<`$g /.NX`".`v n(."(Ҩ VtmxfrЄ-@ SJgX-H$hT>(HHx/N* n (L///N)0///// /*N"z$,g/./ N"\Pt- L fJ"hHpLe< )PЩ\"(Ҩr\Df . nX&X-C @ ?G, n (g f$"hHpLe )PЩ\"(Ҩr\Df . nX&X-C @ ?G, n (g f"hHpLe )PЩ\"(Ҩr\Df . nX&X-C @ ?G,$*8&**X-E @ Jg^Jg-GBBHnHnHnN$f..`~Hn/HxHnHnN<`$g /.N`" .`Jg" n". (ШtSlvTց-CHn/9:,/,/,/, / N$gJf,/.N "XJfJgzf/.NX *8"*Jf n ( h".JgЈ|l\fT X-@ A& n ."(ҨJg`tlXfP(X-D @* Sg/.N "XJg /N" XtH`NVH?2|<`^ B"hHrLe")Pҩ\"hm n"BѩC-I"C2i B"C )L2i/ //N)0 "kc/N "X~? jh`  B"h"`g` fd"H hHpLeV (PШ\")ҩr\Df: . nx ٨| ܀-F C"(LHx //`X"(Ҩ `HxBN "n"-HB-hP` VrX n"(gn f$*hHxLe"-Pҭ\((بl f/ /+ HnHnN@.g x/N "XJg8xg*`((ب"` "(Ҩx\` HxBN "n"-HB-hP` dJgV fb"hHpLeV )PЩ\"(Ҩr\Df: . nX,X-F @ ?G,` * "(Ҩx\`HxBN "n"-HB-hP` "(Ҩx\` HxBN "n"-HB-hP` "(Ҩx\` ЉxSl zTځ-E`(/HxT/ / N?.g`-BBB/ / HnN.g /."CN`$.`B`Hn/Hx/ / N<`&g/.N "X.`&.`Hn/Hx/ / N<`&f n`BBB`X|B`PHn/Hx/ / N<`(g/.N "X.`* .`JJWID//."nHi/ NJgT/.N "XJg6rg6Jg2Jg/N" X` lP (X"(\)@x)A|`JfB/+/+ / N!Jf2BHn/9:,/+/+/+ / N.f n$(T"n i /N"XB jhJg LJo\//-L/HnN@$gt/ N "XKB`~0|$2| `v"jH|Le")Pҩ\"jm nѪC-I2m B -L2m/ //N)0 o/ N "XKBt?E` "j" `g\ fh hHpLe\ (PШ\"*Ҫr\Df@ . n| ݨr Ҁ-A"-LHx //``"(Ҩ t\`HxBN "n"-HB-hP`X n (g< g&JoD/"n/) /HnN@$gV`r"hHtLe )PЩ\"(Ҩm .ר*ڃ-E @ B8"n ) ///N)0 n (r€JgJtgJg f"hHvLe )PЩ\"(Ҩz\Df n"nPC-I ?G0!l n (g f""hHpLe )PЩ\"(Ҩr\Df . nX&X-C @ ?G, n (g f"hHpLe )PЩ\"(Ҩr\Df . nX&X-C @ ?G, n (g f"hHpLe )PЩ\"(Ҩr\Df . nX&X-C @ ?G,$,8&, n$hTpf|gd/./ / NL"n i / N"B LHx$/ N`NVXH8<&. _r€&A C$h(((h *j/ $<"j BNXJn Hy+(NK.pg/ BNXSfXHxBB/ N!Hx/9:,/,B/ Nɂ$$pf~B`Bdf/ N" X L<< n&($h((&h(h,( C (K" frJgtgff/ NXt/ N" X`8/ N"jXrlF jJHfHxBB/ ENJgBpf:HxBB/ ENf/ NX`B F/(/( /`/ N" `B/,/, / ENf0/ NXJf/N/N L<|N^Nut`/ N" `/ N" `NVH?<(.*. G r&@"n i$h/ INtĪXf/ N6X`f/ N6R?Fp"n&)K/ HxDHx/N:(H-H"C0i VrX",g g,JoJ/ C/(L/ HnN@$gd/ N "`p"lHrLe")Pҩ\"lm nѬC-I"C2i B"C )L2i/ //N)0 n (g@ f$"hHpLe )PЩ\"(Ҩr m"HxBN "n"-HB-hP n"np ѩC -I !D!nBzڎ/K/ Hn C/(/.Hx/ /N$$gj"n.) n". (ШI "vltfl(X-D n (&( n"A"?G0fЃrlt&fjC-I'hB'h -hB'n'n"h'I G (x"(|fWIDp nf<&.(. G (0"(4f"8WID~-n n ."(Ҩvlf"X-A @Jg,HxB// HnN&ft n hJfJf JgpXШPHx/Hh0N)0 `"l" `x `Hn/Hx// N<`&g/.NX$ L&.`~NV/ / &n$kHx/NZHxBBB/./././ N"2* Dj *8A5A$n&nN^Nu/,O/ "n ipf$h*gp"9:, ) "h"i)g@B/Hx//NGjB`Bd2*Dj A5A *8$nN^NuHx//Hx/Nɂ`B`B`/,O n"hpf$Hx/9:, //(/ NGN^NuB`/,O/ / n "H0. E2xf$$_N^NuBBH22@`NVH>8$n(. $.(n&j0/".[I-@-A//.// N gLL|N^Nuچm/BBB/.// N f܆&+mTLCHxm B`*|`/BBB/.// N fRfBR`/,O/ / n "H .E2tf$$_N^NuBtF‚"2`NVH8 n&n(,". YHAY-AJLgr(A (d g^BnHxHhhHxEpNPr.Hn/NPr./ /NPr.Hn/N HlHk/N XLN^NugFHxHhh/<ENPr.Hn?BgNPr./ ?BgN HlHk ?BgN`B@`/,OH?< n$n"n,.&n&.$$. Jgl>*_0*.Xr㨀GІ>_5G~X5@.JLg@ (dg4Rf0 ((<*^.*BB~ރ݂m CS@X5@Jg&4* Z0*,X~切BЉ4Z5B rX5@,Jg&4*Z0*0X|BЋ2Y5A~X5@0JLg (dg/ /. /N5@ L)_x騀Ge0),X>) _騀Gxgd" @R` ,(",,BS/B//N(`j/.N4Hy+/ /Hy+HxNGN/ Hy+NBr p`RNVH?8$n". . &n(n-jp-jt(.g4,*h.*lBR݅(*f$.&.BRՅ "LN^NuJf@&j0"k(A/ / *("*,BS//N(L+ +RҀ&`SJm 4gXH@XR&B`NVH?<&n&.$. $k0"*B"j$A/ /(*//N((eT/+,/+(-B-C//.Hy2tuHy+"NDrHy+Hj/+Hy+HxNGN,LNDrHy2tuHy+dNK.pFR BBBBBBHxڪ0/// N|.N X`NVH?8&.$. n&h$k0bx e,Hj-B-C//./+$/+ Hy2thHy+{NK.BS"*(B////N((* j0 ($XH@X(h" YHAYHnHx/*-@B n삮/*//N(Ԕ -@-A///+N!Jf.*(B////N($& " n(h0|̃I fHHj-B-C//./+$/+ Hy2thHy+NDrJ*fHy2thHy+NK. RBBBB . @WI/HxBڪ0/// N@|.N XBLN^NuNVH?<$n JLf BLX5@> +@XH@X%@@ +DXH@X%@D +HXH@X%@H +LXH@X%@L0+PX5@P0+RX5@R +TXH@X%@T0+XX5@X0+ZX5@Z +\XH@X%@\ +`XH@X%@` +dXH@X%@d +XH@X%@0+X5@0+^X5@^ $n&nN^Nu/,OH 0&n$n $.// / N)00X40+X5@0+X5@0+X5@ +XH@X%@ +XH@X%@ + XH@X%@ +XH@X%@ +XH@X%@ +XH@X%@ + XH@X%@ +$XH@X%@$ +dXH@X%@d +hXH@X%@h +lXH@X%@l0+tX5@t0+vX5@v0+xX5@x0+zX5@z0+|X5@| g0+X5@2+Y5A c c"+YHAY%A c|"+YHAY%A cf"+YHAY%A cP"+YHAY%A c:"+YHAY%A c$"+YHAY%A c +XH@X%@L N^Nu/,OH?"n$. n ."&x髂&z뫂l$,&Bm"@YJm QJl>LN^Nu1HJg~΄f &ֆR`I`օWfY &` Y`NVH?<$.&n .&.JgLJgD" S b$-|gE#-|ͫ-|Jf(-|2Tvpe Ѐ0;ND"Hx/HnN)0 `Bԋ-BIE/Hx/ / $.Ȕ/N(."n-n..,.-n " |7y$ԮK* **E* Ђ$*B$Ԯ* K* ҂7yIfЄ-@҉-AJndvfp"n"JfBLB .*.ʀ-E|gr-G| n.(0ހ GJhfdHy+T/*X/ N,("...΁ .ѪXҀ-A ..|".XnFxfBX-jTz-E`r-A`J:(g/// NZ Jf"G Qpg0)2YJf>JfT"*X-A G0(XЁ%@X2(YӮJg`-@`XB)"D^( z"DRJom|-jXX-@vJg"GB)f/Hi/, -HN)1 nJf` XH@X+@B G0(X%@\pfN!`Jf2Ӯ|rf-jX(.|mxXЪX-@v`^Jg jJhfJt`\%nX%nL .Юo-@`|/,/,/, n// N!`x/ CN-@-A/// NĎB/.N PJgJfT .DX%@T *("*,&(-f/ N" ^X n /,/,/, // N!`pf"*X .g %@L&*((*, "-f8/ N" ^-KX/.Hx/ N"|& g2/.N" X$`HnHx/ /+N"Jg` n"jg h/(/*/./ N"Ղ// /.B-|Hx/./.NC"(Jgd/.N" Xt`Wf/.Hx/ N"|$ fv"*($*,&(-g\HnHx/ /+N"$fD n `8HnHx/ /+N"Jf .`ht` tM`t`NVH?<(n*n &n,-l l0&( n$$n n A8-H,<)1.<,*SdJjf"Hy+T// N,("‚ ѕԀ `J:(g// /. GN Jf S"pgB0*Jg~B*"A " x„JnjB*f~/.Hj/. FN Jff np BLXH@X-@B(.*., . fY-AB..֮Շ`o8 k h-h C$(BBHnHn"[I-@-A//./ N.Jf؂"C*Q,.*E)1 E4(Z g2XH@XSg("n )B(f//) HhN Jgd eB/.N P`tf` .XH@X*B k (("(,g Hy+` j (,XH@X-@BB/. HxBBB/.Hx// HxN(`ڂ*B` C!E !B .SfK"C"`R|`X|`h/,O/ $n Hx/ N"!/*Nx @"A BJfJf / N"Xp$nN^NuNVH?<(nE r$@$%|/ /.N$PfD/ N" ^XK&<lG" "l,)(.),Brf / N" XI"n" LB-A/BHy+Hx$/N(/Hy+NDrp`,JEg"S‚foHy+`/,OH<8$.$n &. .rf-B -JLBB/./. B/ N!TJg Hy+`*k(-(*-,BS-j(BI(/././/N j0,(^HF^.((_HG_HnB/*/././/N(/*$[I///N-FB*.Үх GC/*(* ځـ//N(Ԕ -@-A///N!(*<" Jg"/ ENX$/.N!cX L<$n*n&nJgZpdR(9:,&*g,Jg4HxB/ N(r& B L<|N^Nu gHn/93,/N!_$ f nJfzf h/( /(NPJg*f$<Hx/.I"!N//./ Hx&B-|Hx/. D/(N@$$ .G"NXJg/.N" X`,&j(kg8"h(l )") *,,, fX/N" +-@/N" ^P*fH$<`DJg j (-@/N" ^X`t`vt`pt`j .JfvƪfvHx/NHx//.N"{ $/.NJf,/ /.N$Pg(Hx/.NHx//.N"{n/.N`(j&l// j/B/B/. N!t$f / / NPJ+gB+Jk:fN'A0Hx/ NP`/N" (j&lXJ+fX *gNf`p// N.$PfHx/ NPJf+;f7|:Hx/ NTP|*fJ+f*Jf"`>p`/ D/(/ N"$ g` *g k:VHHD@7@:7|`HjXHy+NDrP`t`t`/,OH <(n Ѐ// N.$Pf&l$kJ*f.Hx/ NPJf*;f5|:Hx/ NTP kpg B/N"PHx/+N"!PJ*glpHx//+N"{n$/+N" B*, *L* //*0KNHx8/ N Hx/ NBlP L<N^Nup`NVH?< n$. *.(h&lJ+g"J+gHkHy+NDrHy+NK.Hn/N!cPBK!d`,<"!.<" pWIDBHz/.N$H Jf/.N!cXpgRHx/,N"!BBB/././.rWID///,N"$Jg(/,N"XJ+gB+N'A0// NPJf L n"n $.* [IJg8vƂ|g" (* !E!BL|N^NuJlBB`Br`B`NVH8<$n *n&n(*BHnB/+/./ /*N" $f Hx/.N"!$Pg/.N" X L<N^Nu n(hJf" .*/+/+/+ // N!`HxBB/Nx&f/ DHhL/ / N*&g lBhp/.N" X$`t/,O/ / n$hHx/( / /(/(N$f R hp/N"X $.$nN^NuNVH?0 n&h$k$(Jj2 +reJg"k)g p`[g"j)#f*( /B j0@"//*/*// N"8(/NB tgN j4BIVI[ID@,$~/B/ -@-A///NC"L N^NuB$< `p`/,OH0< n(h&l$hK$+ f. + "+$%@%A +("+,%@ %A$ k0@"%A kB0(%@%k %k k ((XH@X%@B , ",$%@(%A,"k0 )L kg"B iXc0( c (//(Hj8KN"k0 )L kg"B iXc0( c` (//(HjHN"k0 )L kg"B iXc0( c& (//( HjXN k0 JLg< hXc4 kB0( c c$(//(HjhN B| kA#%A| k ( t %@| k"( %A| k%hdx", <vgpH@Yg l (%@0/ N8$vv 稀%@%A$ +@"+D%@%ABL< N^NuBBB/ N`B`dB`B`/,OH <(n$l*lpgn&j kp0 f^ m"h)#fN/, HhL/ N|$ f kShp kB0()@f/ N" X L<N^Nut`/ N" `NVH8< n*h$h&( (-Hx/ N"!$Pf8B/ / -|BB/. C/(NC"$I"g/ NX// N"\P`l&j k0( @brr0¨ f^R@1@pHxBB/ Nx$f/ DHhL/ / N*$g kShp/ NX L<N^Nu/ NXt`p/ NXt`dNVH0<*n(m&- $lB/Hn/ /-N$f n&h k1| j0( @gR@1@ j hc(1| j0JLg(gfp d j0|pHxBB/ Nx$fHxBHnN( +,XH@X-@=| |"j0")L g)cg||. *,XH@X-@ l h00(@X=@|Jg)cg|=|..BB C/(HxBBB/.HxHn/.HxNl$(g6 j0( @gS@1@p kBhp/.N" ` l h0 ( lc Hy+NK."[I-@-A/// N$ fp/ Nx-@-A///.NĎ/HjL/ / N*$ fJ/.N" m X L< N^NuNVH0< n(h&(*h &l C$hf/ N" Xt L< N^Nu k0(S@ @ctB/ N" X`/-/*,/*(/ NJg j(#f kp0 f/ HjL/N|$ f j0( @gS@1@pHxBB/E!N kUh/-Hx@BBB/./ NX$$HxBB/+N`:t`4NVH8<&n$kHx/+ / /+/+N.(f$R&+/N)/< n$hJfpf"*$*vxf * "*$fr0f$*&*prfrfƲxf&h(k$( *|f lp0 gp` k(g pL<|N^Nu&<Jgp&< lr0¨ gxȀ//,// N"B/B/ B-C/B/NC"(Jf l|ͨ l"( *|f:v x!A l *||@ p *|g*B`Dp `** rg k(f$(**kf(-///-/-// N"^/B/ B-|Hx/./IC"N0Jf&- - m1D m1E m0"mJLg"|3Az m"1Axfg/ N°pX mgHxB/ B-|/</./NJg mP`(*vg| k(f*k*-`Biz mBhx`n/ N°r mXg2HxB/ B-|/</./NJg mPf8(*(**,prf(k&*8(*B/N P`0 XH@X frHn/ ///HiN$gT L)v,B" (*`L"h0" Ҩ$bJg B/N P jJfHB` XH@X fHn/ / //Hi N$ .g B/N PJfh` `t`Z/,Op-N^NuNVH?<$n". ...(n,. *n$&j0// /-@-A///. / N(* fDj "LHj"[I$.Үт-@-A//.-F-G//Hy2Hy+` z-E.߂R`lLЀЫXA`jT`NVH?<$n&n *n(n-k/*[I// / N($ k.(*( / N",(BB"X(*[I C"D T\f/// /N(4$&HnHx/*"* [I @"ArҪT/ " ҃т//N(Ԕ -@-A/// N!Jf("n i0 UgX UgNB/ N PL nHhTN6Hy+/.$/ NHjHy+NBrpLBB`RLj` jL(録Hb&*[I/B//N(4`DR` jL$銲(b&*[I/B//N(4`R`ܪ8"B`~NVH?<(n&.$. .,."n$l0Dj4Df ,x",|L/*D/*@/[I/N(4HxB//N($*&* o$.(HzB/.(/-n-n/./././ N$& Jo@ k P((8g kpg BHx/rҪT//./.N(Ԕ -@-A///N"WjJgHy+kNK.HnB/-D-E///+N!Jg`L&n$+8&+Btԅӄ-A<-B@///N(Ԕ &.0[I–l .0<ЫD&ƫL0lJo n8HhTN$+0Hl`/./.L-D\-E`//.\/ NHmpHnh/././/-@\-A`//v ֮L/4>/4> F".LF-@\-A`/// N$Pf/+P/.@/.)>p .@g/N X0| -H0-tL-tP(,\-D@[I-@/N `vƮ.g "n "`4 .04f.Hx/N!PJf n8HhTN//. .p/5-F\-G`//.\/ NHmp/././+0//-F\-G`//.\/ N &@f mp"mt(nL()IJ g`/. p//+0rҫT// /-H-IN(ԔP./-F\-G`//.\/.N& n"ngPL` .p 5$D%% .h.g/N X`/N `B/N PJ g +0"l.g\/Hx/-F\-G`//.\/.(EN&Jfr n lB n /N!$PgB"n /N P`/Hx/pЫT//.4/.0N(ԔP./-F\-G`//.\/.N& `Jg HnhB/+0-|\-|`Hx/.\ /5/5/.N Jf0(nhJ,j:*+[I~ޫT//,Jg&JgB*\rA( SB**\tL< n&(\-C[I-@,*.* (.*.-D-E .".D@m .f>'n n'h\B`-mPx/.x//N($ -@-A(.*.BRـ-D-E%D %E$/.x//N(Ԕ @"A-mHnB/* /*/+/+NvJmD jJg /*B/*N L N^Nu"*g///.Nx$ `t]`t-`NVH?<$n*j&m kpg -Wg j Jg"jJg m(f(iJm|-k0& B"n/)PHxBN(Ԕ (*bNHx/*/*/ N"i$gJgJf'B`/*N$Xf/* K)/t L<$n j&h"kpg "j Jg"h)fHx/*/*/N"iJgJg Jf'@L<|N^Nu/*NXJfB/+NT$ +/+//*<)0"EN&+BHn/* /*//N,KU&IRf/N/*B/*Np]` n( Є",///"EN +'B'C/N/*Hx/*N`>p-`8p`2p`,NqNVH?<$n..,. $.*.-n -n&j0 j P-h8B-|BI(4$m .".D@l/./././.N(-@-A(+0(jHnB/-|-|Hx/.-F-G//./ N& fX n (f"y:,RL (@!@"($ oBHy+NK./+t[I//./.N-@-AR`-n-n`B!E8!Bp-p>t .g(***/+P .".BRч//N b(+0 j P*(8grgBB/tԫT//./.N -@-A///N"Wj$f"j jzfB<(~ *[I nۨ$ ( ф!@ prӮ&.׀-C`-p<(B`(+<ȅثDȫL`H/*,/*(/-n-n/././*/ Nr`hB>pB>t`r(.*.-u\(B`&+<ƅ֫DƫL`+n+n` +<ЫDL`>Jo"kT" "[I(.Үф j P((8gzgBB/Hi//N(Ԕ -@-A///N"Wj$f~ "[I nӨ$$( Հ!B %n%n"j jrf#n#n j"n ) ")$"jtfh/ N"x lXJ8g h hBBB/ hN`z/*,/*(/-@-A//./*/ Nrp "[I nӨ$&( ׀!C `#n#n`R&(!C`b|`l|`f/,O"n". i"ipf "0(BN^Nu 0p"0t`/,O/ /$n n ."."j$jtf #($$_N^Nu##`/,O n "."n"ipf "0BN^Nu 0"0`/,O/ / n ."."n$n$jtf ! $$_N^Nu!!`NVH<<(n". . *nE$ vă$B&l&+0Bz m// NP*+AB L< (g2 .S/2/(0/ N *+AHy;sN6X`Xt `HnB C/(0 .S/2/2/ N!$f&(n .S/2/,0/ NV *+AB/ N P`NVH 8(n"n n$l&j0HnJj^IЀD/Hx/+0/+P/ /N(Ԕ -@-A/// N0\$f0 n (0/+0/. /N)0 Jjo/.N $X LN^Nu/.N X`/,O/ "n$n JgF jJg>(f6g.Jhn,/(,/((/)/)N.JWD$nN^Nup`B`/,O/ $n*"gp *`f`*aS bT/*t/*p/*|/*xN(4 @"A/*0[I// /N( @"A " D@m2| $nN^Nu2|`B`/,OH0<(n&.$.&l0HxBN $H!n  +0!@ !@$B!n0K(Ԕ/+`//N tԫT///N %@@%AD%@8%A j^-@BK-n$[I-@,.mB/+8-@NX .L +TIg/NU&BT/ NP``/ N(nB \R/ N6P`h/.NHnHx/N-@gv +TIg/NU&BT/ NP$.v`/ N*nB \R/ N6P$./N""F/)N!Hx/N"!Jg`"n i(h*F m-hB/,0NT-H$,Ĭ<*n m&($h/ INXB(<U&*<6,<" &j Jf.R/ N6XJg/HzǢ/ N! L<|N^Nu$+ k + JgF!@ k  +hfB/+h DNXJkoR/ EN/ FN/ N `v%@`NVH?<&npЎtĀ-B(k$l0 k h((X-D/NX.gn,,.,B"n iJg*"n ()*) "-@-A".$.D@mJB .gHx/N P/.N6 L8"n&. $n )8 p 2B08؄փrpG2I2$)8mL|N^NuząԀfRX`$3*4 @8n,̃f,.ݲԂڅR`/,O/ n ."n")`tg:mJg^tgH/Hy2Hy+NK.tf 0WID$.N^Nu$rār0W`$Ԃrār`tĀr`/,O/ n "."n )`tg8mJghtgJ/Hy2Hy+NK.tfJ0WID$.N^Nu 0t‚tW` 0ҁt‚t` 0t‚Fr`/,O/ n ."n")`tg2mJgPtg( Ȃgrxȁ*DxgԂR`XB(Bt`,̂gCgS`pBStF`YJfS`NV/ /$n$. jpf>(f6 * "g HjXHy+NDrPp$.$nN^NugHjXHy+GNDrP gHjXHy+NDrP *  f HjXHy+`-jJgpF-@%nB`p_F`/,O .g SgHpN^NuHy:N!3*XJfBHzPHy*N;#?H fHy+NDrXB`Hy:N!3XJf 9?Hg/N n (h n$ _c"(0  bf$(4 SfJg&(80$n&n &.(. T\fJ*mJfHxHx N'HPHxHj\/+N)0 k!j!j!j%j[I%@%j[I%A%j[I%B%j [I%F$*0%B\%j 4[I%@0%j$<[I%A8%j(D[I%F@%jL[I%@H%D%C * *%@ rLfv%CP%j|%FB T\f8p,m0%|0B4 *HF%@<[I%A8 *LF%@D[I%C@*[I& |"BS$*0&*4c%@0%A4Jf%|@Jfv@%CL |N^Nu/,O/ 9:"R#:JnBBBBBHy+BBBHxE-N#?H$BBBBBHy+BBBHxN#?H$BBBBBHy+BBBHxN#?H|($nN^`x$nN^Nu/,O/ 9:S#:n(NJb/9?H|E3&N/9?HN/9?HN $nN^NuNV(/$/pĀ//.NTPJf$Hy+ BHhN)/`PJWID$.$N^NuB`NV/ "nA r @per"p$nN^Nu$n$jp"Bh0 *("*,!@!A !jHx//. N)0 B`NVH?<*n n G r&@ PfbHx//N)0(+*+ (m$l Brd j"L*,&B "e pFLNVH8<$n&. *nJ;u|fpƀ&jr/B/ I!e"N$ f/ N/B/ N$fHx/+N"!BBB/././.Hx/-/+N"( .N"Xf"Jf> *8g,r-A -@L<N^` d *8gHx/N"LZP L<N^Nu$`NVH0<&n$kHnB/*h-|-|Hx/. *"*Jl Bт$vv 橂-@-A///+N$ fIT/ N n (0/*h/ /&<)0"CN/ N6(n*l0 $l0 T\fTJ*mN%j4 %j%j%j%j j#Hx/+Hj\"CN k%h%h%h +g+| 8\p f/ N $X L< N^Nu/ N X`NVH?< n$h/. /N, *4&S֪L@8.*LPBBG)0I XK nJf, L<$n*n n&9:,BJgpd&j(* AgJgg Br B`( f,Jg +-@/N" ^X*f$<`Hn/93,/N!_$ f nzf h/( /(NPJg nJgF(kg "h(l )") *,,, f/N" +-@/N" ^P`\Jf +-@/N" ^X*fF$<Hx/.G"!N//./ Hx&B-|Hx/. C/(N@$$ .I"NXJf *"*gDfDj%@// j/B/B/. N!t$f .JfnxȪfxHx/NHx//.N"{ $/.NJf`*f / N!X// /.Nݪ$ *f / N!XJg4Hx/.NHx//.N"{n/.N/.N" X`(j&lHxHjXHkN(rë J+g+gHxHy2m/*8N0 JfVKT/ NX$<6J+g+gN'@0'A4B+/ BNHx/ N /*8NXJlHjXHy+hNDrP`/N" (j&lXJ+f **gfp/// N$ fHxHy2m/*8NT$ fHx/ NPJf(+g Jlp |Hx/ NP/*8NX *gbJ+g~/+ / NB$Pfb*f~J+f/ N($XfDJ*jJf/ /.N)HPJf6`p` // N$Pg L<|N^Nu*gz|B+`l/ C/(/ N$ gj`*gf"+  g6p <+i*g <*Ѱ/HjXHy+NBr t`xB+ +WD@|gZ XADrJfJdftJg/*NXG@IML *JTfh/N6X`^HxHy2/+8Nd Jf/BB/ Ne/+8-@N, .g`hB/+8N"LZPJfT`v// NP`// N!PJf4/BB/ NeJfgp-@N9|/HxHn/<dv j/(N""`NVH?<&nI r(@$k*j(+f +grg/+ / N(P L&.o6 m0 $0B-A-B// 0-@/// "n$NJfp؀`XBR݃R`-p-pSf$.gJg~ހ[I-jDB|$.|&.o&.o m0 /0/0/0/0/ "n$NJgBR݃R`t `/,O/ n"hJg $h$j" (g,Hz/(BB//( /(/(N $nN^NuB`/,OJgN^` HN^Nu/,OJgN^` -BN^Nu/,O/ / $n&jHxHy27 j/(8N Jf, j h hHxBB/ hN j/(8N~ j h hHxBB/ hN +g/N" BXB$n&nN^NuNVH?<$n*.(. -n-npЎr€&A jt&( ,...ޅ݄(F*G j PBHk * "*$o " -@-A/// PN&D"[Iƅ.΄-GC-C,+.+ B݀ "A&.Ԓؑ&|.| 쯎 G& Jnp-@[I-G,. .".Ȓl,...-GHx/N-HSą&[I "-@-A".֮Ձ/ N"ΪHx/*<Z ENHx\BHxBHn/.-n-n/././ N"(8g"/ N"X//.N L,f6/ N*N jXpf jB(5jBj jBPxpg@HxHy2C/,8N Jf( k h hBBB/ hN/,8NB mJjWDJjf j"j~f&$(&( "(h(gzB`. jBpBt`V$(&(,("((*.gL///-B-C//.HlX/*,/*(Hy2CHy+NDr$.2CHy+SNK.JfL<$n*n (n nv֎pƀJfL*( j&h(+,"j - "S€gHy2_Hy+NK. kHnHx//"[I-@-A//./ h -IN*"nf"- ҄[I#@#A,)z if F!@!A p/)/)/ NĎ9D S (S nШ0Xrā BHh/ /N)0 n//(N"y*.N!R j h hHx/// hNJf* L<|N^Nu F!@!A`Z-H-LL<|N^`NVB.//.Hn/./.Hn/. /.Hy2N"^N^Nu/,O/. n h/(,/(( n/(N-~JVDN^Nu/,O nJVIDJgF h"(/</<// n h/( n h/( n h/(N"@N^NuB`/,OH<"n&n(n nJgL$h **l$i///-B0-// k/(/ /*0*// /. N"ƈL<N^NuB`/,O/</< n h/( n h/(N"jN^Nu/,O/ / n$n"h&j/+/ /)B0)///. N"NJ$n&nN^NuNV/ /$n nB (r !AB/Hn/ N!]$f2 .g:/N"XHxpLЪ//.N)0 n $.$nN^Nut`/,OH 0&n$n +8f8B n/(/*/./.N8$ +8f6"j n 2i `Hx Hy2l/N"S$ g L N^Nu/N"BbX`/,O/ $n Hx/ N"! jPB"(f / N"Xp$nN^NuNVH?<*.(nE r$@BB/ /NA$PfL/ N" ^XKl,<"G" .<"!"l&)((),Brf / N" XI"n" L(pd&"n )B(f//) HhN Jg.d eB/.N P`fR`և*`"n#C #G .SfB"n"`z`z`X/,OHzb/.N" N^NuNq/,OBN^NuNV n"hHn/. B-|Hx/./ i$NJf n N^NuNV/ /$n-n -n/ HxHn/.N"$f/./N"!$Pg /N" BX $.$nN^Nu/,Op-N^NuNV/ / n$n "hHn/./* /*/ i$NJgrfpFA"n"$.$nN^Nu n"h2)g$)fA A@f")f/N" XApF`/,O 9:,"R#:,Jn*BBBBBHy+BBBHxN-#?H(N^Nu/,ON^Nu/,O 9:,S#:,n/9?HN3&XN^Nu/,O .g SgpN^NuNJB`NJb`Nq/,OJgN^` N^Nu/,OJgN^` BN^NuNVH0<*n(n &nHnB/+/ / /,N" $f Hx/.N"!$Pg/.N" X L< N^Nu n"n"$hHxHy2 l/(8Nf$ g /.N" `p5|"j3| .*gd""03//*/*/+/N"/B/.B-|@Hx@/./+NC",Jg0*@5@"j2+g p%@"j jrf#@d n"h"i"iHxBB/ iN$fBHx/9?HN3&// / N- B/ //././ N=$0Hx//9?HN4V Jf0 ."n"/+/+/+ // N!`h#@X`RBj jBhr n"hJ8g"i"iBBB/ iN l/(8N/.N" P` /,OH 0$n&j/* /*pLЫ// /*N$f k/(8NJ j/N"P L N^Nu/,OH 0&n$k k/+ / pLШ///+N2$gB L N^Nu R hp R"hJ8g"i"iBBB/ iN k h/(8N/N"P`/,O n"h"i )gp rWIDN^NuB`/,O/ n$h/ N"jXrl j h hBBB/* PNB$nN^NuNVH?8(n$l&j ,-@"Pg$"*teJg j(g p`[g"+f$@g fHnN!XJf*, $./B0+@"//+/+// N"8(/NB tgL4+BIVI[ID@,$~/B/ -@-A///NC"LN^NuB$< `p`/,OH08 n(h&l$h l h hBBB/ PN + "+$%@%A"+($+,%A %B$0+@$%B0k%H%k %k , ",$%@(%A, k ,Wrf첀e k ((B%A%@ k%h<[I%B8 k%h@ k%hL[I%CH k%hP k%h \[I%@X k%h$`BhBlBp k (h"tv %A%@%kx%k|", <tgpH@Yg l (%@0$ +@"+D%@%ABL N^Nurp`(f k (p"(t%@%A k$( &($%B8%C< k%hD@ k (("(,%@H%AL k%h@P k"(0$(4%AX%B\ k%hH` k$(8&(<%Bh%Cl k%hLp k ($v"(v 穂`pr`^NVH?< n*hJfpf"-$-vxf - "-$fxr0fn$-&-prfZrfPxfH$h&j$( -|.<!Ⲁf +gx` j(f"+(f(<@Jf(<H@J@cDzvƅ//+// N"B/B/ B-D/B/NC"((f j (8AJgHx!Hy2/N Jf^ -|'@"k krf#@dp jJ8g h hBBB/ hN j/(8N2 -|Xg kpf kJ\_ID//+/+B0+// GN L< n(h&h(( *,,,Hx/ N"!$Pf$kK" jc/ NXt// N"\`: *fDB/ / -|BB/. D/(NC"$f HxHy2 E/(8N$ f0*R@5@"j3@p k h hHxBB/ hN$fVBHx/9?HN3&/// N- B/// FHhL/ N=$0Hx//9?HN4V Jg>0*S@5@"j3@p kJ8g h hHxBB/ hN E/(8N/ NP L<|N^Nu/ NX`/ NXt`/,OH08"n(i&i l$hvL֬$) pg"pgJfJnt- L N^NuHxHy2/(8NL$ fBHx/9?HN3$Ht k + /+/HhN)0 +r€t/BHrN(| B/ / B// N=$Hx/ /9?HN4V$ l/(8NX`HHxHy2/(8N$ f +'@B/B// N8$`Hy+NK.NVH?<&n(k$l jbB(+ .* G&(/+B"D/)/+/ /,N" $f*Hx k/N"!$Pg k/N" kBX L< n&h(h&( $k*lg(<" Jf jgtB/ DNX L<|N^Nu C/(/-,/-(/ N-~Jg -f$ *fHxHy2 l/(8N`$ fHx"C/)/ HmL/ N8$*<JJg l/(8 ENX`\HxBB/ ,<!"FN0-S@;@ m1@p lJ8g h hHxBB/ hN0*S@5@"j3@p k h h"C/)Hx@BBB/./ hNHxBB/ FN$ l/(8"EN`@t`/ N" Xt`/ "DN`NVH?<$nI r(@&j-k(+*+ ..B$&օՄ-B-Cg*j m h,(D F.[I$Ą&ƅ "®,.l.-G nDZe(؈p dtHx/.<"GN*-H-DA(p)@)B)C )D/ NvXB m h h/* B/ / hN,g//NP L<|N^Nu&"҃-AHx/."GN$".҈-A.*PgB| LF0/NT.P-k-k "E(BBd|0)Jgfb`'n'n |Jfx/./IN//N j"m$+&+ fTID `*J@fPBl/ / /Nx,'n'n j JgJg/NU& jB jBX`pi )BF9F FF9F2AҌb)QB/HiHl -@-IN)0 .0|HphBHt N("nB0)-@B .".Ӯ,.݀-FJg .". G!>!>RB0,0)` j `|`/,OH < n$h"j&j&k )"+mJfT(ir*if:Jhf>"( i"itfF(///Nx BL<N^Nu",g"k/( B/(/ iN`p`NVH00 n$h h&h (Wf Hy+NK. *"*$*8&*#B#C`/,O n". pfJf N^NuJg"prfr h`B`@ `p`NVH<8$.&n .&. (.$(n(E" z…$A-n-@A$r%A%@%n%n %B/ NvXXJgzg@/Hy+VNK. k h h/// / hN"*Jg&(L n&. (.(+fR ( "($B|@ovJVID///N JfD L|N^Nu|ƆX$0<!<g JfRB`JgSJf"PJg#h"h"/Hy:N PP` h,$ `NVH?<$n&.$. (n .(x؎rȁ n.gB/ /Ne BBEgKfo,/r "[I҃т-@-A//./N&HJf./Ne n X .J WID L/NHy+NqHx/NZ/Ne` .`/Hx`Jg/Ne/NHx// N*Hx/NZJgfHx/./ N JoHx/N0P/ NZ /NPJg // N_P/B/ N(/Ne`Jg(Hx/ NgPz˫ )lB ՀR`B`/,OH?0". .(.Bт$v&z ꫆$|̄&Fzʄg#?M#?M~#?Mp#?MtE?MJf/ @/Hy28/ NCJgHy?MNDHy?M/ NC Hy:N y:%H8XgC8!I<#:%|:Hy+j`J  y?MB0"y?M"i!I4""y?M0#HR`@HzNHy+NBPN^Nu/,ON^NuNVH?<..r‡-A n ((*( BE,YGI *@Jg-nr-A/ ///./ -D-E//./.N& Jf/. /./Nx$ gJg/.B/N( /.///Nb .-@B".ڮفJgbJg\ L< n$h0B/ GNBXK$<I0&<x؎JfT-jP ng<-n"( .c -@"(-A-A"(4-AB"h$Jf,JHfj-@`D/ /./ BN Jf n-h `fJHg 2xggd/ "CN/"n NPJf/ NX`Dgd^B hH/NZ*.P,<f n亮d$  /HhD"FNPJg6 .g:-E n hH/NX`xp-@`p-@`f nf-E `/ NXBL<|N^NuNVBHnHz>/.NJ .N^NuNq/,O/ $nHx/NZR P-R$nN^`yL/,OH <$nKZ$<GIt0Hx/N * PrdS%@ -RL<N^`xHy: BN *Xg(r%A/NHy:BHy+Hx/ N` j(Jg!j,, j, (*g / NuXHy:N6/NHx/ NCNHx0/ NL<N^Nu/,OB?NBHxHy:N{4 N^Nu/,O/ / $n&n nJg /NXJg /NXJg / NX-j $n&nN^`?$n&nN^NuNVH?<$n(j&l$,0g/ /,H/ Nz t Lw 9>wх#>w 9>vR g#>vN}P-n<B-B@-| D$v/Hy?NNP`n&(4`"(4-AlJ@g=|h|j-AX@kJ.jg v-C|-CxB.t(0gJfJ$fB/ENPHx/NPJgh nP(0gR"n@Hi/ Hx//.HNw: nP(0g(Hx/NHy+Nq `J.ifT`VHx/NPB,-|0HxBHxNm `zʁ-El$hH&h$JfJg"h *.@J.hfB(2I2| LH"4H v 樲d &"| ,-F\"(z (4HSd"(@I-L`-@d|h(.\,Jg* fpr-A|/.|/NZ/.`Hn/zDڮP/N nP (2g:E`RJg6.[g,|h`"-E\p-@`BdB`|.[f`(2.[f fJf nP-hH$-n\(BBI,.`*.dn K nPvf&(H$rG/ //N, z#gtm^pgJf j&( .kGXJg nP((HJfvzˮlB,-|0HxBHxNm * zd|ͮl// `r-Ax`Jg~ގBKXt"G Y. Jg((hJg ,f/ NYr/ N/ NY RfzڎJgtp-@x-FB nP,..."((ި,݁Hx/NZ kHx r "[I҇ц-@,-A0//.,-F,-G0//.,/ hN Jg ڀ`BJf~ | Є-@\`Bd$E`2J$g*rHJf BHRX`0p)Hg&mJgJf+f*r ڮ(B/ n nP(0fp`v `B`~`pf|`/N4XIZgJg /.|/NP n4$h /.x/N/.4(<Yr DN/.4NX/.4IYN n4(fvJg0Jg. nP .@ /HhDNfPJgB/ / EN B n4 ( f8r€!A / DN/.4NW/.4N Jf:/N`Jg`B,-|0HxBHx'N/.4NZ `&n4`~ k 2f/NFvXJf`/ // /NDJf/ N(Xf8/ //NB,-|0Hx/.,Hx&NHy+Nq`\/NYr/NW/NYv DǨ &D`2 nP&(H/ // /N8,fHlHn8/ B/N$,pgpJf*n8(-AmrB,-|0g.HxBHxN C( g B/ NyP// `HxBHxN `NVH?8 n$. ,Hn//N BJg&ERG.YIkڴd nB`Hy+#NK. h dJg-HgJg/NXHx/.N(.P///N JgB nJ@f //NkP/.N&Xg/NYr/NX/NY  `XJg /.NXLN^Nu/,OH8$.&. (./N///N~-BLN^`"`/,OH? ,.(. *.eXJg~&E຃bB`,~`//.//N$g g///NÄ LN^Nu `t`Nq/,OHx n hX/(/. /9:LNN^Nu/,O/<B n hX/(/9:LNf @N^Nu/,O/$.B/9:LN/. n A)  @///9:LN/9:LN$.N^Nu/,O . B/.".ҀA/@//.NN^Nu/,O . ".ҀA-A@-@ N^`D/,O/ / &n$n J.g(B0/ / N4P-J -K$n&nN^`/+0NT%H0X`/,ON^`/,OBBBBHy:Hy+OHx BBHx@N-#?N(N^Nu/,OBHx/9?NN3 N^Nu/,OBHx/9?NN3 N^Nu/,OHx/./9?NN4V N^Nu/,ON^`/,O n ( N^Nu/,O n!n N^Nu/,OH0 $n&9:,$*0:g8Nv4/Nj%y:0/NjN}PP-BL N^`G|L N^Nu/,O n-h N^`@/,OH>0$n j,B0!| 4 j, 9:"9:!@8!A< j,B !|$ j,"9:$9:!A(!B, j,!|!| j,!|!|BGUN*[I"t$| &XB"<e$BN"tX j,!AP!@TL |N^NuB <`/,OH<$y:,/ N>p%@h 93Ѐr// N@/ N?NK/(Ir*GEtNNNB/9:BHy+UN`/,O/9>vNfXN^Nu/,ONPN^`jNVJ?Nf Hy+YNK.HxPBHy?ON(#?Z HnHnNRNdNN/./.NNNqVNnNNi~NޜHxB-|/</.N(NHN|NŠN/<HxHy+uHy?NNN^NuNVH?<&n $kJgb(+ AHe$ bLc.DAy $B ctHBzʮp ,QI|JfB`///9:L///.N&g*p f cB d$< B`*Bǵd*J/ / ޮ/Nx&؂/9:LN nBHnHp(//9:LN .:LN .XgHx/NPBJg< L<$. ,.EIKZ b L<|N^Nu*BGk Hr//9,N & Jf*e` R*pf //Nj&JPBf$`/N/NRP`/,O n B/. .@Hp//.NFN^Nu/,OH8(.&. .$.Bԃg.//NP-|-B-C -DLN^`Bg///N0 `NVH?<$. n-h@(. Dg"9?Nf4| & @ //.-|-|Hx/.//Hn/.N  Jf&.pf y:L*@ @-@,<g,<gp.G\p-@ITKJf2&.`nB`@4|`DJg Nz<*n$. &<(<b*<t,<6Jn L<|N^Nu$]I0/ CNX j Jfr&jJf"* S%@J fJg *  fU%A@%@ / FNXJfJ fJf / NZ XJg / NXS`l&PHx/ DNPJf/ HxBHy+Q EN`\&S`/,OH?<&n&. .(KBKy*<Yr,<X.<YʶnJg // N_PBL(g6Sf2Jg n/($/(HHnN v`\Hx/NyPR)JRX`@/ n/(H/N JgDrg(~#fVB 9:jR/BHy+ZNtJg~ 𧻓׮ `$jJg"B n/(H/Nf gZv`$JfHx/ NyP/ NYrR/ NX/ NY)J j Jg./NX` nJgR*hH$h$Hx/NZ j hPJf/ / HnN v`p-@B"nHx@BHxBHnHn . -@B ."..)(ҩ,ч-@-A//./ N$JgrfB/ /NP~-G n"jHxBHxBHnHn.. -GB ."..((Ҩ,ч-@-A//./ iN0Jg$r#f"B 9:jR/BHy+`,/NXgJgHx/NZP n$h Hx/NZ nP(fFJgvJgr n .萨 /HhDNfPJgHB/ HnNX n (fB`4Jf n(g /NZ X/NX` n(f./NYr/.NW/.NY nrè JgJfBHxHnNR Jg / / Hn`R/N)n`(0g*hH.<X4Hx D/NZBBB/./"GN$HJf^BBHxBBBB/./N\$HJgjp rF!A /NYr/ NX/ NW/ NYJfK0/ NR/ N6/9?WN)J ` D/NB/ E/ NHy+dNq/ NJg JgHx/NZP`B/+H`NVH?<$n-n-n ,. /B/.I(N BGZK_.<nB`*plz(خ r $[I A"B".$. ԉӀ-A-BHx/NP-E jHxBHxBHn/-n-n/././ hN$$g"r#gxJg //.N,P Lx|&0/>xx׀!/>xxBrӹ>x$9>xՀ#>xN}PBL< N^Nuk/ NXBX`l/NNX`p `Nq/,O n "n ) bSIDN^Nup`/,O n "n  bSIDN^Nup`/,O n ("PJg ")c  hJg "(c N^Nu/,OH<$n / INX%@ ng *r€&Af L<N^Nu"+$jc$A @*s Jg/ NX+@c$@'J$K`/,OXN^`"҃ k b4TIDL N^Nud҈`Jg/ // N `p`B`/,OH 0&nBN$HHxP/. /N)0B*1B@"*Hg"/. * t //*D/N j$Jg"h"iJg/NXR kL%H%h !J j !J/ / N J L N^Nu/,OH8 n&(E0$( JBB"H h g.Jf,(( c"/ /Hy+NDr pLN^NupfrfJfHy+NDrX`BJfHy+`/,OH8<&n$kP"JAK0f +g//Hy+NDr `B )(i ", g:C*ѰfC+/ ///+HhHy+NDrpL<N^Nu"+<@b/Hy+NDrP`R"L`j(,/ CNXg//Hy+.`dJg"B ) ", b//Hy+C`D$ (l f8|tԋ&<)+&(<)(fB`l(JB&<`B/ /"CN Jf M *g/// / Hy+^NDr`&Hx/ /"CN Jf M * g/// / Hy+{`Hj /"DNPg gp/// / Hy+`B`$j R`L/,OH8<$n$ XIZG K&<x؊Hx/N *Pg2:,g*/ N/ CNPJg / /NMLP/ N6X`RL<N^Nu/,O/ /$n$ XHx/NbPJgJg/NXB$.$nN^NuRp`/,OB .X/NZPN^Nu/,O n!y:,N^Nu/,O .X/N XJVDN^Nu/,OHxHxHy:@N{4 N^Nu/,OBBBBBHy+HxB/9:\HxPHy?WN,,N^Nu/,OH 8&n(n $.BN$HHxP/ /N)0B*1// / N:R l%H%h !J j !J-J -KLN^`\/,OH 8(n&n $.BN:$HHxP/ /N)0B*1// / NR%K%k 'J j !J-J -LLN^`/,O/ / "n . &n iE0g ed &p$_&_N^Nu iJf &#JB`氨 ed&#H`$H h` P`NVH<<&n$. &.(n*.Hn// N Jf BL<@0!L$B(B,HlN):PXBHjN L N^NuB`t`NVH8<&n$n $.(.pm Jl p`pf/ N&+J@f4+0f*Dj&+;fJ$f/+/+ B/ / Nw:R@&k `p@g&k `Hx/+8/+/+ / EN$g/ N/ NP K`J4gS@ h f(jPK爹f / DNX`J4g ,@S)@@g/ / NP(l `NVH?<&n&. (./ N$+pe n (S!@Pf/NvX`B`:NVH0 $n$. &.Hn// N Jg n0e L N^Nug e"¨4f $( h `B`/,O/ $n *0/N):P n !j00X$nN^Nu/,ON^`:NVH?<(n$n .JHgB L jHJf l hJg/ NX`~fp/// Ny JfJf`j j "n³ ff`|-BB,... .ޮ݀ (("(,f (HgXr"@fJg(JHf /. * //Ny JgխHmNXJg/ N׶`JJgJHf l hJg8/ NXJf.`JHg$r/,(// Ny JfJf(j %lS l "l!I#l / / NZPJHfխHmNXJg/ NXJfB .g B/NP LBBHx/ / Nw: *HJ@gJg/ / Ns,P`JHg*0f*;g.B/ NRp4//*/* /Nxl/ N*0`NVH?<&n&. *n(D* E/ NX~BIHn// N f/ NXBLt‚b8e2 )") $(&( (*mfR`^IDLBI//N| R` n. /HhDNfPJgJgp` n  -@B ."..((Ҩ,ч-@-A/// NX4 JVD`x`NVH?<(n E r$@&n&k-T-n*l-l(, -D&, ,",tĄWf pL `rg` .怀r"®ಀgxp `Jg"A i/ h-@NX .`p`p`8pT`2p `,NVH8 n "n"i-P-h&( SrebprgXJfp$)0HnHn/N: Jf(.JfR/NHn//NAJf/NXpLN^Nu"n ) -@")-A/NXg(p Dfr"./ Ю///N `p`p `NVH0 n "n"i-P-h&)0HnHn/Nn$ fR$nJg>/N nBHnHr//N/N .g B/NP L N^Nut`NV/ /$n n "j-P-h$(HnHn/)0N Jf, .r‚/"Ү/// N,$.$nN^Nup`NV// n "n"i-P-h&($)0HnHn/Nr Jf( ./"Ү///N$.&.N^Nup`NV// n "n"i-P-h$(&)0HnHn/N Jfpglmrg>Jlp`*]f .Hx`V ./"Ү///Nj$.&.N^Nu ."Ү-A-@ -C$.&.N^`d .Hx"Ү///N `NVH<0 n "n&i-P-h$k0HnHn/ ND Jg p L Jf$. n LN^NupB`Nq/,OH0 $n&. $.J.g.N!\$%CBB%B -JL N^`'|A`/,O//$../NXJg B/N!XpЂ-@$.&.N^`'F/,O/ /$n$. g /N!XJfN!\$$$.$nN^NuNVH?<$n&.$. ..,.Hx/NZPGX4IYrKX*<Y "m-RLw"9>wӆ#>wfJg// // N/N|Xg:p Bxٰ>w<,0>w8݃!>w8ٹ>w.9>w߃#>w*`Hp`RāfT`(/,OH<8$n(. &n/// N Jg8Brӹ>w$9>wՀ#>wӹ>w|$9>wxՀ#>wx L<(.BEGIZN$K/NXJf,N$*<.,<Z/NXJf@Jg L<|N^Nuv`J9?Pg Hy+NK.///N Jf(/N$X`/// EN Jf / FN$X`p`NVH<0J9:f:Hy?Z$Hy?Z(Ni 9?Z(@#?Z(y?Z&:P .(Dr ѹ?O&9?Z( 9?Z$gc Hy+NK.؃#?Z($B*YEQ8Ge L <#:>vNVE:BG{4HxHx/ NR@ pfNRf Hy+NK.GN$BEIK*<Z/NXJfvJ?Nfp#?N$9?N"S#?Np#?PRr L|0 @V 9:\SR ЂЀ/NQ @"(؄؀BXBX?Nl$BR`/N(/Nք/ EN$ `d#?O AB"HBX?NlBR`#?O /B/N(N$N$///NGIK*<,<Z/NXJfJ 9?Z( n@ n 9?Z$@ r#?N#:?N?PL<|N^Nu/N&/N//N// EN؃/ FN$`/,O n (@N^Nu/,OHxHxN!n!n !n ?Z#?ZPN^Nu/,O/9?P/.NPN^Nu/,O/ / <>uf*Hy+*NKHx/9?NN $.$nN^Nu 9>vBreP//9?NN y>vPB""H$i %A"iܳfR h>vfp/Hy+MNKP`R`/,O n-h N^`0*/,OB. /Nn( 9?\XJ?XlBN^NuNVH08&n$n (k %L "+( +,%A(%@,/ $vv 樀-A-@//HlN(k * "+ gg6/ NGPX +  / / NP-K -LL N^`/ NG`NVH<<$n&n $.&. j Jg:"*((p *,z ꨀ-A-@//HhN(k/ /* NbJgRI0/ KN%K %C(%B, +X 2f8j/ / NH/ &<6 CN/ / N$fB L<v$*ꊴfn/ /NPJg^B@FL N^NuB`ZJgd/ Ngx jBB-|-|Hx/. @Hh(Nm`$pЂ&p ?O:/N{h%|@ *r "¹?N"3$Xg?N s !J *x ?N'  *?NRЋ%@RBrӹ>w(9>wـ#>w/N|B@FX`NVH?<,.(.-n (n$...B@ C#bF$$y>vgD r ?N-@ y:,Jg (RgzpmJng/Hy+NK. *`BrfK.<I/.// N&H Jg2Brӹ>w*9>wۀ#>wӹ>w|*9>wxۀ#>wx .R?N%@JgBrӹ>x*9>xۀ#>xB@FE0/ N'n('D,'F 'L)Kk/ N6PgHx/ NgP +@/NlX`f/Hn/. / N&HJfVUf6/*Y/B/ K~N&HJf4//Hx/ N&HJfB@FNr*G K L * grr %A RHy?O GNX * gr€%A / FNXR`r€%A Hj0N/ N/ EN `LuC8/prӰ&0׀!C(/BrӰ$0Հ!L N^`(rf*/ NFvXJg k hJg/ NX/ NGXJf`/ NsH`R4|+`rL N^Nu/,OH0 $n&. rª pgBUf*Jgt// NgPL N^Nu/ NsHX`/ NsHX`B`NV/ 9?NJ?ZJgZR?O *  fP *("*, lHx B*< ځـ-D-E//.-@-A//./ hN`R?O`B/ Ny/ (<gx DN Jf/ NsHXAgJg^Hx/ NP/ DNX(<Ug`,*(**,/ NZ Hy?ONPJg* GB ( Jo Hy?NNX/. DN`bHx`pr ⭌// NtP`BNй?N"9?NXm/ NtXJf(p-@HxHnNPJg|-@-nBp R?O$/ *<Yr EN/ NX/ IYN .Ю"* f\ j!@ .- R-@/. DNBHnNjHy?ON`"R/ NYr/ NX/ NY/. DN`/ *(,~ *,~ //N Rfp R/ EN/ NX/ N/.N`NTHxHnN$9?OBN( ?Nm$B/NBNP?NlNf` 9?N?NmNJfĴf 9?Nܐ`NV/NJgZBNn($9?LԹ?DԹ?T?NHnHnN2".Ү  (o <\D$.N^Nup`/,ON^` Nq/,O n( g"h4 (8JgL#@8"h8"4S:P( f B4"y:L!I8"C4#:LR:Tpr!AN^Nu#:D`/,O n (g0"h4 (8Jg#@8"h8"4S:PpN^Nu#:D`g"h4 (8Jg#@8"h8"4S:T`#:L`/,O/ $n/ NB4 y:D%H8 A4#:DR:Ppr %AX$nN^Nu/,O nprgrg$rg [gBN^Nu/NXp`/N`/N`/,OH0 &.$. E- :\gHy:\NԀX :hgHy:hNԀX :tg Hy:tNԀXp_m BL N^Nup`NVH?v *g jS%@! B@FL< N^NuHy:GNXI6&<{$y>v * g0 j"R%A$pK0/ Np/ CN/ N `Hy:NX`r/,OH<<$nIE" * fN%@$L<y Pf * g j&p v0֋/NXJf j fN%@$B@F-|:L<w$9>wՀ#>wp!@ B BB$i!J$#HL N^Nu/,O/ / $nGZ RJf $n&nN^Nu"P (Jg#@"h"/NX`%@`NVH?< .$.( d(< Jgb2r *@&S-C . SR-@"nB#IN n bJf".v $A".-AB.NMBNU"9?Nҹ?NXl2BN$G/NXf&JgJ.gNMNr*J$gZHy+hNqX`NMBNU"9?Nҹ?NXl ,.v ".-A S-@ .D-@B.BN&/N@Xf0Jg"J.fNMtN L Ѓ e0/ "l "-@-A///.N%@%A "҃т%@%A " Ӫ * cpH@%@`(Jf.օՄ%B%C%B%C %|. p$LN^Nu,*.* "n"jA " ҇цl "҃тf`NVH< $n&.$. (.*.Hx/NZ "BzHElBrHA/-B-C/// N /NBL//NkrPJfz y?_ /(N/ N"t y?_ /(N6 `LJf//NkrP`Hy:@N/. N(H(@.:@N6PJf//NkrP/ N!hX`^"n . ( jpЇЬP @ -@,. JlSrRr?e/HxBN(Ԕ B†-A .gd,r ܃BHx B/.N(// N8Hx/ / /.N rL$Hx/ Hx ///.N rHxB/ N($Rn,`BA-HKA`-HAP-H`NVHxHxHxBHy:BBB/.BHy+aHy+ʇHxHxpBBB/.N@N^Nu/,OH8<$n *Dg>r%AKa,$<&<6(<"T *LDl/*HN&HXJfpL<N^NuRL(h(f/, BNRT/, CNP/ / DNP`NVH?< . "tā$BJg$$9?Ngb$&y?\BKJf n BL n/(Hx/ N"{n `$ n/(Hx/ -IN"{ & "ngHy:@NHx/ NN$Hy:@N6/*HNa/*/*NHxP/ N$$`-F -I/ /N\PrgB%@.[I F"G&~"| ~2Sp.fSzJo/NZ%H0///N[&HxpЃ/N%HPB*@?_f y?( h,(r L(h" Ҁ Ё܀p r ⦼ofHy+x` n/(// -AN"|v& ".JfX G&((.(, l ( %A@rgr|p %AD`///*0N\p g Hy+˜`>/Hy+*<Dr EN/Hy+ EN/ N" ^HnHx //9?\NJg Hy+`pgP 9:"R#:Jf<$n(. &.&j*<)0K * ,<$d$I/// "EN b A( f0Ѫ L<|N^NuHxHxN&%HRB ؂P&H`cB`NVH?<&n$S *gS%@ +*+ *k$ ,<I&<zJg>. c.// / /* CNJg`r‡Cc刔c *"* "k.+,ṽgxDfv-BB&.(.؁׀%C%D RG $v !A!IB !B!E!F!| BL/ y:LN-@Hy:@NuTPHy:Hy:NPJftN L<` / /NHPJg4Hj-@N&X .$nN^Nu/ /NP`/ /NP`jZ`p`Nq/,OHx/.NPN^Nu/,OH?8,... n&n$n*.pf&"($vd S"BD‚f((AvƄvȃ&(h$Ԩ$&֨ c~"(glB <Jfr d&//Ht(/"ғ//Hy*/N SC9 " A Ј@fHBLN^NuB`T`Jg" <*/// /////Npʀ `ntą//BB//Hyd/N$ `p`/,O .g SgpN^Nup-@ -|:<N^`r-A -|:<N^`.NVH<<$n&. &n** E$(DKHxxB/ N("C ih IJgp()(p-@-hp-@-h p-@-hp-@-| p-@-hp-@p -@-Pp -@ E-h-|"D)gv ) -@-|/*N4-@-|X D(gR (-@-|/*N4-@XA"B /g2/NBBX4|hB`h/*N4X`/*N4X`J)g-|/NBBvp֓-C/N)/rfvfHxHy2/N)1 JfHx/HkN)0 pL N^Nu/,OH?<(n Bx n6(,0S@ @dHx/EN(Hx// n/(/,$/.KN$ f8HxHxN*&DPB nB0(,e0Hx/NPJWID//NP Lt`j/,O/ $n /./ /.N Jfr@X$nN^NuNqNVH<<*n$n &* *[gt L<t`8NVH00 n$n &h/B/(HxB *B-@//./*/*/* BN"0 $,fV *vƀDf/*/*/ Np pg0"*B/ Ъ@/A//+0NF$ L N^NuNVH 0&n$n "*gz k$* %BЁ%@/< B-|-|Hx/.B@/Hj/(0N  Jf-J -KL N^`BL N^NuNV .BHn n/(/.HxB-@/B/././. BN"0 ,Jf JVIDN^Nu/,OH?0$n n ([f <"<!@@"j"i,*B$)0&)4,.c$&!CD"j#@*!E<((D$& 9:EGgBBBB.//Hyd/ N S bHxHxBB//Hyd/ N HxHxBB//Hyd/ NBL N^Nu <"<`,NVXH>&gpƀ(9?t*9?t 9?t"gB y?t"9?t//-HX-A\///N#LJg #?tB?tL|DN^Nu/Nd$Xg/N"HxHx//Jo0 ./|f6B6I |($|-XE9?_ gP|sYB.ZHx/</ N Jf:,./N)/HxBBBBB/.BHy+%Hy+LHxHx BBB/N@HxHx?HxBBB-|@Hx@/.BHy+XHy+ւHxHx BBB/N@HxHxHxBBBBB/.BHy+֎Hy+ְHxHx BBB/N@HxHx@HxBBBBB/.HzPHy+ֽHy+YHxHxBBB/N@HxHxAHxBBBBB/.HzHy+Hy+HxHxpBBB/N@HxHxBHxBBB-| /< /.BHy+ Hy+zHxHx BBB/N@HxHxCHxBBB-| /< /.BHy+׈Hy+HxHx BBB/N@HxHxDHxBBB-| /< /.BHy+Hy+QHxHx BBB/N@HxHxEHxBBB-| /< /.BHy+`Hy+عHxHx BBB/N@HxHxFHxBBB-| /< /.BHy+Hy+#HxHx BBB/N@HxHxGHxBBB-| /< /.BHy+4Hy+ٗHxHx BBB/N@HxHxHHxBHy;kBBB/.BHy+ٱHy+HxHxpBBB/N@HxHxJHxBBBBB/.HzHy+Hy+HxHxBBB/N@HxHxKHxBBBBB/.HzHy+Hy+QHxHxBBB/N@HxHxOHxBBBBB/.Hz BHy+YHy+yHxHxBBB/N@HxHxHxBBBBB/.BHy+Hy+ڒHxHx&Y/BB/N@HxHxBBBBB/.BHy+ڛHy+HxHx//B/Nt -@A%H4/ /.$/. /././././. /.N$`p` 9?Z?N"t%A`r %@dA``NVH 0&nE r$@ y>rJg> ( $($%@`%BdHx`/.(/ N)0  rgrgNpL N^Nupt`-BA%H4%@D/ /.$/. /././ /./. /.N$`A``NVH00&.&n$$n(tԎpĀHx`/ /N)0C B!I4 j4-P// /. /.//././. /.N$0f:Jg6BBBBB-| Hx /./+N@$Jf j4 L |N^Nut`NVH<<*.(.$*n(G r&@HxHxN$HHx`/ / I)0N'J4&<//-4/ N.//. /.//././. /.N$$fJJgFBBBBB-| Hx /. D/(N@$Jf.Jg. +4///-4N Hx/ N L<uJg Jn'PB/ /.$/. /./././.B/ N$ .D/*4NP`x$k oXp`xt`bNVH8<(n$. &.*nE r$@Hx`/.(/N)0"9;ch JgSgt L<|N^Nu t(gp(JgLt%@DHx/N&H%H4/*DB/N( <>ug*Jn&BA>v"0$0ճ(3ف'Pr(f/ /.$/. /././ /B/ N$ .D/*4NP`J$koXp(`^t`Xt`.NVH8&.tԎpĀ 9:L<Ly:-@Hx`/.(/N)0C B!I4//.$/. /.//././. /.N0Jf8Jg4$. N b:"L9:&L|0Jg br#:LN^Nu#:`p`NVH<<&n$n I r(@ y:,/(NѬ*kHxB/ N(JgB%K%k Bk:%k p%@$/+(Hy2&< CN$/+PHy3 CN$%kT(%k,p f S (@%@0/ N@@8ks9XJgHx/+Hj@N( +BJg%AH%@L S %@TBP*+8B/<B@B//N(4%k4X%@\%k`%kd%m`h +fvB*lL</.p/ Nn/ N?/*N  cpF///.pN0 Jg/-@hNX .h`/*N j|XJf/*N/NPp#`lg h`ւSt؂&k`4Hy:N6XJg* nl e B`*Hy:N/N"$HPK6JfHy:NXp-@hNr .h`.HB/Nb&Hy:N Jg/*N&j|X&BJf/*N/NP`bnnJtoh/ N>/.p/ N/ N?/*N  cpF///.pN Jf/*N j|XJgıg h`ւSt؂&k`nNrp L<@N^Nu nl `p`NVH?Hy+JHxHxBBBBEN0HxHx N$H/ y?_(/(N!(GgHx / NP L |N^Nu$*&* *("*,*,en 9?_,|gdUf/*/*/9:T[I/N(4HxdB//N(*,d|#?_,Hy+HxNGNP`dBB`/*/*/9:X[I/N(4HxdB//N(*,e |#?_,Hy+`/,O y?_(Jg$pg/9?_$Hx/N"/B?_( 9?_$g/N>B?_$XB?_,N^Nu/,OH00&n(. ,.*. Tgb$k BBJfJf C$Ԃ L |N^Nu/.$/. /././+-E-F/// RN JgSft`v$j `B`/,O/ / $y:\G)/`Jf J $n&nN^Nu/./NPJg$j`/,O/$./N):P B $.N^Nu/,O n (@N^Nu/,O n (DN^Nu/,O n (HN^Nu/,O n (LN^Nu/,O n (PN^Nu/,O n (TN^Nu/,O n!n @N^Nu/,O n!n DN^Nu/,O n!n HN^Nu/,O n!n LN^Nu/,O n!n PN^Nu/,O n!n TN^Nu/,O/ n"nB"(X\Bg $. f p"B$N^NuR`NV n . Pg"Hn//N5h JfJWIN^NuB`/,O n (XN^Nu/,OpЮ n 0 N^Nu/,OH00&n . &.relE\Jg"tf@/// N)0 Bp/Hx HrN('CX L N^Nu// /Nh$ gB`t`/,O n". ."nXb0\Jf-@-HN^`2///N)0 BN^Nup`NV/BHn/9?_8NV$ f HxHxN !n"n "P $.N^Nu/,O/ $n/*/9?_8NWHx/ NB$nN^Nu/,O n /( .//9?_8NX N^Nu/,O/. n /( .//9?_8NYN^Nu/,O/ $n"n j@")@g *Dg")DgWID$_N^Nup`/,O n N^Nu/,O/ n"n p )!@@!@D!iH )!@L!@P!iT4i pd4|!JXHxHx/ Hi/N5$nN^Nu/,O"n n (Xrdp#hD#hP3@ Hx/Hi/N6N^NuNVH0<&n$n +Dg pL< N^Nu +Pf8j XfB&YK5hmB`/// N JfJgR`/,O"n n !iD!iP )Xrdp!@ /Hi\HhN)0 N^Nu/,O"n n B!i@!iH!iL !iT!QN^Nu/,O y:, h N^Nu/,OH00&.$. JgrHxHxGN$HPJglHxHxN&HPHxHy?_0NZ/Nd CJg@Hy?_0NHx/ EN Jg Hx/ NPE J L N^NuG`$%np%@B A %HJg &'JB * '@ fA %H%K B y:` A#:`Hy?_0NX`/,O/ Hy?_0NDBBBBBHy+߆BB/9:\HxN-#?_4,NV#?_8BBHy+ߎE9N#?_@BBHy+ߤN#?_XBBHy*N#?_T BBHy+߽N#?_PBBHy+N#?_LBBHy+N#?_H BBHy*N#?_DBBHy+N#?_<$nN^Nu/,O/ nJg(E:\"R (f $f#:`Hx/NP$nN^Nu" "if"A#@fpЁ#:``/,O/ / HxHxN&HHxHy?_0NZ/.N4$HAJf(Hy?_0NHx/ N J $n&nN^Nu& BB "j"C %IR'JHy?_0NX$K`/,O/ $nJgZHxHy?_0NZ"j i PfD * #@ f *r Ҁ @!A jSHy?_0NHx/ N $nN^Nu  h f"* @!A f jr Ҁ`NV". ./.$/. /./.-@-A///. /.N rgJgNDJVIDN^NuNV". . BB/./.-@-A///./9?_@N= N^NuNVB/. B-|Hx/./.NN^NuNVH 0$n&n /*N$*/N):P'B/*N6/ / B-|Hx/./*ND L N^NuNV/ / $n&n 'j@@'jDD'jHH'jLL'jPP'jTT'jXXHx@Hj\Hk\N)0B/ B-|Hx/./ N $n&nN^NuNV/ $nN(/ N):xXJfJN(BBB-|Hx/./ NzHj/9?_8NXHx/ /9?_4N4V($nN^NuNV/ BHx/9?_4N3$Hp B@BDBHBLBPBTBXHh/9?_8NWBBB-|Hx/./ N J $nN^Nu/,O/N?$//.N>( B $.N^Nu/,O/ /$npg N?$// N>(/ N> $B J $.$nN^NuNV". . BBB/.-@-A///./9?_XN=N^NuNV". . /. /././.-@-A///./9?_TN=N^NuNV". . /. /././.-@-A///./9?_PN=N^NuNVH 8(n&n N l$h'j@@'jDD'jHH'jLL'jPP'jTTB/ B-|Hx/./ NbBBB/,B-|Hx/./ N@`$0AxgB/ / N LN^NuHx/ / `NV". . /. /././.-@-A///./9?_LN=N^NuNV". . /. /././.-@-A///./9?_HN=N^NuNV". . /. /././.-@-A///./9?_DN=N^NuNV". . BBB/.-@-A///./9?_DN=N^NuNVBB/./. B-|Hx/././9?_DN=N^NuNVB/././.B-|Hx/././9?_DN=N^Nu/,O/ ."Pt@ĀHfJf$"<JgB` JfrJgpB$N^NuBp`r`/,O/ .tJjB$N^NuNV/". . $.BB/./.-@-A///./9?_u>vf"B/NP-B$.N^`b$.N^NuNV 9?a -@ .N^Nu/,ON^`NVH 0p#?a$9:NV& 9:g,"<B@L@#:tv8g #>v8#>v4AVSfx/9?_NX&y>y+Sgh,g 9>v4S#>v4n 9:;0f 9?a y:,(fBtչ>v,&9>v(ׁ#>v(#>v4`^/9?_`$k$ D/N{hX,f*Wg8J?_f0B,tB,v穂B,ሀ,// NP,P 9>v4S#>v4oD-J`E`BrӪ$*Հ%B *c(ӹ>v&9>v׀#>v#?a>v4Jg`Brӹ>v $9>vՀ#>v`JgbJ?_fJ*WgB k$B0(Fv稀hH// NP, 9>v4S#>v4PJol-BL N^`2 9>v4S#>v4` 9>v4S#>v4o L N^Nu 9:;0gXBrӹ>v$$9>v Հ#>v #?a>v4`"9:;0 9?af y:,(gv$&9>v ׁ#>v #>v4HkN):PX`Btժ&*ׁ%Cչ>v&9>vׁ#>v`NV/ /$nHy?`N,$9>y @r€//N J?_f / NGXJ?_f$ 9>vS#>vn/NG#?a>vX 9>v0S#>v0nHy>uNXA?a -@ .R N@$.$nN^`NVH?<$n,.*-y:(Hy:@Hy:PEtNB:LHy:Hy:NB:Hy:Hy:NB: Hy:Hy:NB:.:Hy:NB: Hy:Hy:NB:Hy:@Hy:PNB:L`^NVH? $n,. ..&.Jf /B/*Hx//*/*///*HxN"0 $,g\"j"* <+Jf <, R h/-I-A// ///Hh/(`Hy+NDr$ LN^NuB`v*B۪ *ф%@`NVX`/NHy:NP/N!F>*XgBBHnuJgR 9>vDgH$ Hy:N$y:XK>&<?(<*<?Jf-|:L<B`/ N Xf *@g/ CNX$j` *f&// N?P`// DNPJg/ / EN`Jg "9>vDf/ N?Hy:N6B@P A%c +@t'@@B@FL<ufj#:,>y/ N/ N]/ N@/ N / N./ NcV/ N!*B0A0%H4R;chR;cd L N^Nu%jT`/,ON^Nu/,O"y;c\A>uJg . q N^NuNV/ /$n. *@JgRDfR <WD/ B/ /BNj-@-A//N$Jg\ 9;cdR#;cdN%@8%A<`Df(B` 9>vDg" 9>u0fp$.$nN^Nu <>uf <Wt`| *@Df 9;cdS`NVH 0$.$n&nHy;cNX cgb* @cg* ,cg/ // y:N ` ,cf J$Hx(B/N( :`d/NYXJgt (@Dg| (@f|%h<%h8p%@ %h@$B`uJgJfJg$`f$;ch`\/,O". n (@WDN^Nu/,O n (@r`WDN^Nu/,O n (@N^Nu/,O"n n ")@ (@gf JVDN^NuJV`/,Op-N^Nu/,OBN^NuNq/,O/". t  n!@p$N^NuNVH <$y:IK6JgRJLmH&j $ /N kCXBe /N$RX`&YJg"+-A&nJgB$R`$R`L<N^Nu/,OH00$. 4|&GMD/ N@Xf-BL N^`/,O/ $nHxB/ N(Hy)LHjNM.$nN^Nu/,OH<$n HxB/ N(BHxHjN{4p%@%@ %@p%@A%HA %H&jI Kd(/ N@XfBL<N^Nu/,O/ $n Hy:NS: jXJg!j j Hy:N6/*N>P-J$nN^`/,OH< n . &"h"q |""hzʀt(묉"hxf"x "hrƁ窅o!@L&i i$S Jm:J g,0|m BJo$sJgJ*g#HL N^NuS`S`0|`/,O n rҮpЁЁ-@ -HN^`B/,O//"n". ne. vƁgt r䩂 tf R$ꊰmp`,"1 vfR`$FR‚0|Jf0|Ј$&N^NuNV4H?< n . -nT-n@-n$<"tā$BrfxtfL< N^`;Yf8JTg8"n@.$(g&-h dk, Sre-h\fJ\g6x`B`p\nN-BHrxd-AHHy:IN&y:X-nTXBBJgJLm +ZgJ\o "n\`f/+NBBHx/ Bl-|pHx/.l"n (-@(nJg.x،/NX*<6J0g ,$:f/ ENXR`vp?ex" "n"/ EN/"ENHy:N/Nt 9:R#:f N`R:Hy:E6NHy?vN"n"NrP` y:,/(NѬHx@B/ N( ",$%AJg%l%l %l%l%l%l %l$$%l((%l,,%l00%l44%l88Jg%l</N4~%HP*!g(G/ N/Hy+@NDr:IX9:J@.f> 9:reR#:`>J:fJ9:HfHy+PNDr:H`Hy2pHy?a8N PJfJ:4f&Hy:NP/<HxAHy:N`Brӹ:T$9:PՀ#:P$.N^Nup`hNV/ / &n$n HxB/ N(HxHk/ N(yd-khHnHz/+tN%n%kl +p-@ .%@$$n&nN^Nu/,O/ / &n$n Hx,B/ N(/ / Nj%k4B %k\$%j(/ Hzn/+tN $n&nN^Nu/,O/ / $nHxB/*N(p@В/GNp В/N/NHx/*N p`-@ -R$n&nN^`h/,OH 0$n&nHxHx`N$HxHxN%HBB B*$<+fJ+hg$ hHy+/BB/GXNHy+k/BBp В/N$.+|/BBp@В/NL N^NuNVH>8$/pĀ(IG&<:E6BB /Hz/9:N bP  bFHy:NXJ9:0frBrӹ:&9:׀#:&.p dv $y:,GI6JfNh L N^Nu *p g8 f2J:4f Hy:NX/*/ j|NPJ:4f Hy:NX$R`/,O/ / &n/9:N$HB@X @ bF!&|NNV'@ J $n&nN^Nu/,O//$.B@F'/. /.Hy:N(_ 9: f B#:fB@F$.&.N^Nue$B:NBrӹ:$9:Հ#:`"`/,O n"n B) B@F-y:N^`|NV/ /Nv-@$Q/N$HBB HxHn/(N(_/ /N$.$nN^NuNVH <$.BE N-@K/ N&HN-@Hx I/ /+N(aBB N-@/ / N6N-@Hy:NN-@Hx / /K(_N(Hx B/ G(NN-@HxE/ /NHxB/ N .:N6XL<N^NuNVH0<$n 9:-@ .gHy:NG/ N *Pg"9:gȲbHx I/ /*N(aHx / Hy:N(_BB B:B:N&Brӹ:$9:Հ#:`D9:J@.fdN*y:I$ BvJfp/N/N{VHj8NMDHjNdHxH/ NBL<N^Nu k p,Jg Hh / NPR` Ы// NRP +Re`BK`/,O n hh"h N^N/,ON^Nu/,ON^NuNVH80&nE r$@Hx@B/N(%k %k\ %k`BHn/ NR&f&Hy:N):XX cHy:N):pXv L N^NuHxHx(N$PgHx/NL(+P/N{h'j`'j 'Bp . rfB('|,/N|X`/ Hz@//N`/,OHy?a`NDBHzLHy+߽N;N^Nu/,OH<8(n&. &nJgvJgpJgjHxHy?a`NZ/ NJ Jf / NXJgHy?a`NXpL%Cd%S%n@ G%h h%Gl%k \%k`B BBHx@/ HjN)0 jh JgJ2g 2fd"nDJf HiHxBHx@N$"nD#H"* "nD i$ Hj|N"jhX i/ N$XgBHj|K6N/Np@X%y:,0/NB/.D/ NXHy?a`NJg*/No$X`"n@f +g*U`"nDHiN"nD$)Xg:"  i*p JfB`xf"n@f +g*U`B`^(g"nD i * p o#@ `tV` GHhN):PX*JEBB/ NjPJg/ NXHm|N6X+ g$/N{h -XXDg~+GX/N|X+ g.-$P/N{h -XXf`Dfr€+AX -Xr€ ArfDr+AXB G"h+I "P!MR@Hh8NP/<B"GHiN`/`g/N{h -XXg/N|XB`0r@+AX+y:,0Jxg$.D/N6Hx/ NL/N|/NHx/.D/ N BHy?a`NXJg/ N6XJg /No$XJf+ fR0@".<0f\Ӯ4`/N|X`~|HuxN+k0"mhX)fbJg\".@P/-A,N{h"mhHx/ / "iN$".,/N|JgHuxN6X"nDHiN6X`+k \+k``t `t`Jg"n8$i y:,-h@J g$ Hx/. /N)0Hl/N[Rf .x"n"$`/Nat&XnvHxBHlN()J~)GX$ P/N{hBD,. *@?fpg>//Hj8NN,* f2 *@fJmlJ gHlHlN\&PnB`B`trgF~#g/N|X(Jg /./.D/./ "n$/ i N( .`z`z`B j)H C * P%@/N|X&L-E<*.@/N/N{hPB*R mX"g0$n$B(Q*YGh  nH|HF///. nN Jf ".gF////NJgr?fpL |N^NuJ?tg .S// nNPԮR`$ n `NVH8<&n$n $.&. *KgHx//N!G BpT-@B-BN9|-H/ N!Zj$f(n%L$pf/+Hx@/ N"|$ fz/+/*(/ N"|v$ f` l (DgPDj j(h/+Hx/ N"{ $ f*B/ /+HxHxBBB/./*/* / BN"0 $,f/ N"rªXR *Xf B/// / N *@JfH"*%AJ:VIr D%@P%|Tv(<" ?btmHjN&X*CHx/ N"!/+Hx/ N"{n/ N" $ `r/ /*Np$$Pf` n(h%L$/ N" ^/*No$HxHxN"C"/+/ / Hx/N!-\$$g Hx C/N"CBP L<N^Nu C %@Hx//N( PgR$Hx/ N"!P` y: p%Hl/ / hN$Pf4 *HTdhPeb 0b k h,"j8$czv ` *pg / DNBpX *tg /"DNBtXBxpf&*[fR`v`t / N" X` $`NVH8<(.$. &nHxHxN$HP YrfB/Hx//N(z$f /f4JgB/ N!F"n"X L<N^Nu/Hx//Nh` ."R-AT b <Њ-@// /I)/N ."S-A @|/"D i&($:|@B/ NZ/HxHx/ HnB C/N!'&,.NXJfB .& /// NB28 Jg&`t?Hx/ NP`$`NVH?<&n*n$n$kB& HC-ICP-IC-I*NfhHx/IZNPJ.fHxHxNHy,N/N)/L/N!F+H/N!G&+HL*+5BPB+n`HxppЪ,/Hx / B-| Hx /./+N@`Jg`/+N4B/N \"[I j, *(p,(td.t#`Hn/.B/./ N$f2/-N!G&+HL*HxHxN+HP+H|+F Hx/9?axN+H +y?axBBhB||܍Hx B/$<("BNA+H( *Lr +@XBpBtBlBxHx B/."BNBHy:N/./-/ / N$fHxHy?aN+HH-HB`P-[g&(m`*< f/-\/-`NríXPJg4 .-[gXBHy`*Y/.Q//. // I\N$f .ѭ`BdJg,BHy`///. /./ N.f".ӭd(ml .VzHЬ m`d"V A+H\(l "l40+IXp+@TA Dbn+@D L$H`/,OH00$n&. BGf2 *grL//*NPp -@ -JL N^`pL j gWf/(NXR`/,O/ / $nN(HjN):xXJfRN(HjtNMDHj|N{V jhPJg/(/N޲P *lGg Hx0/NPHx/ NP$n&nN^NuNVH><&n$k/+N4(Hy:N):XP:tmHy:N):pXp#L<|N^NuBB// B-|Hx/./+K@`NJfHx/I \N$HxppЪ,/Hx / B-| Hx /./+N$Jg&[I j,B*(p,(tdhHx/NHy:N):p `JNVH?<.. G$hHxHxN&Hp!@*tHy+|/KM.N$ |BHx/N{4/N./.(/.$/. Hx/.Hx/N$, (<6rgJg/ DN/ NP L np'@Hy:N j hXJ g*[g,[ jx)HpgCp!It%LxAx)Htp)@H0*X@` @`f/*l/ N lXP)j`@ jd)HdgCd!Ih%LdAd)Hh y:(g!L#:)|:/ N@\ l / hTN/,N ,((/N/.N>r)A|Z/.N}d/,NHy:N &<MLJ+g,+/N/ NHjHGNHy:N n Jf*YgHy:N0*X@`X @`gPHy:NX`/N ` n/( FN& n/(N4Pf`// CNP`R/*N/Hx HxND`4| / NHjHENHy:N/"DN/ NJg/N`Z|#`NVH?<(n&n B.$l/ Nߠ$Xf$+gN*9:l j,&(HxHx KN$HHx //(<h DN$f *f,Hx / NPE`Hx / NPEB`$"d"ҁcnHx / NPEBtJ.f./,N4Hx/N \Hy:N):pJgHx0/NPJg/*/ N޲P`$rL-@$*Hx/N%H/.// DN$f4HxHxN&PB,<h.<)0eHx/NP&+ g*HxHx0N&Hx0//+ Nh$fHz/+/+// /+Hn(Y// N$$f gHx//N$ n BLN8,Wg$& D/N{h/ NGd/N| ,[gZHy:"BN"lBB,[B)& y:, XWDHiNPHy: DN// N,&+"C )g /N" X/*$N" ^ C!j$XBBBdJgHjN&Hx/*$N"!/+Hx/*$N"{n/*$N" Jf&*gHx//N(RPHx/HlN(yd/,DNHxB/NR)HD&-ĖD-k. 8Hx B/N(%j`<%jdD-C( jl/*HHn// / hN,f."*T *@"n#@*[g-j8-j<-j@-jD~ގ///N, f/ N jl h // / h BNp'@ |ZS/ N?/, DNHy:"DN. BN S/( N{h/ Nw Jg / N1X/ N(X| L$<@&<?$l|(<}dJfERfpmTL<N^Nug0/ NQ/ BN * PrfJ*SjQ/ DNX$j`rgYg/ C`HxBB/ NJg`z/,O/ / n"n $hlgn(Z[ c fJfSR?_f p!@H!i`<$hpJg%htt$ht$p$ix!JpgGp%Kt#HxEx!Jt!Il$_&_N^NuNVxH?<&n,. *.v֎pƀ$k?_f//Hy+NK.j Rpl / N&XBxAx-H|$(<3K*Pg/Hy:/ "DNHy:N}VI6Jf/*NHy:N/*N B jlR|ZHy:N/ .<> GNSp'@ / N?/*N/ GN S/( N{h/ Nw/*N p%@%@%@%@/B/ DN|Z/ NNJxg /N1XJ8gNM( HHx/NZB/ NN8Nx/*$N!`B$/ N4/*4N-/ N0%F5E j hH Jg/ NX/ Nj/ N^P*Wg$$ D/N{h/ NGd/N| Hy:NX*[g"B*[ jBB(HhNPX j(hf J f BB/*/ N/ N!J/ N/ N*Xf$*x(B*<Jf kJg!k k  RJg!j j y:@$g!J#:@%|:@|Z(jlRxg4 jpJg!jtt jt p lx%HpgCp!It)JxAx%Ht ,L *<PJfJVIDJHg(jl// / NB// NA( j(BBHh// N@HkN/*NJg / NfX/+/ N/ NB/ I>N)p'@ / N?|ZSRB/*K6N/Np Ъl/ EN.:NXJgp й?_/ ENXHx/ N^/ N S/( N{h/ NwHy+NK.$,Hy?*Yfg0f r%ASJgB0* '@*Ygp`p`JgUfBx`B nx (p` 9:E.|I-@|/NX-H|f4 9:@.|It-@|/NX-H|g (Zf: n| ` (Zf n| `f/ B///// NJg`f/ B///// NJg`Jg`v`&jl*Yg~gx/*NjX/*I6N&jPJf&y?_/ / NBPJHg/.l/ / NB/.l/ NA(Hk NPHy:NP`$/ / Nj(j|Hl/*(KN j(HhX/N/*(pXЫ(/N Jg, *(HxX//K)0NpXЪ(HxX/ FHhXNBj B|Z RJg!j j S jpJg!jtt jt p/*`NHy:N):p/ N@&,HxB/ NG$*/N4Hx/N \ .,N /*(Nx/G>N/N *g /N" X/*DNHj@G{VN/*N~rHjDNHj GMDNHjNHjHNR/ N `4* Bf pF@ f B0r n `BB`` n `*Z f *"j *PvvF n gHy:N6X`0NVHH8 n(.$OpĀ rgXJlPDrv`JfLCB/ //. ///N&JgHxX//N)0 Lwd*9>w`ۀ#>w`PJgӹ>wl*9>whۀ#>whJgBrӹ>wt*9>wpۀ#>wp +S'@ +g BN{XJ?tgHxN`XJgI6Jg Hy:N/ / NHy: BN/-"BNX-Wg/N{h/ NG"/N| -((/N;|/.N>PJ-QjB|ZBR nr!A /N?XJ$g "n$"`B/-N0*X2AAX AAfhJg @B @Bfh/* BN"n$"0*X@AX @AfZ R//HxNDHy: BN`(z+E|Z/.N}d`n@B @BfJf* ,<ML`p`Hy:/"FNPJ+f0*X@D @Df(Jg$/* BN"n$/HxHxND`Hy:NX`/,O/.BBBBHxB/.N N^Nu/,O/.BBBBHxHx/.N N^Nu/,O/.BBBBHxHx/.N N^Nu/,O/ / n"n " f  gxЀ gt gt gtgtt?FāfBDj$hJgJ*f0/.BBB/)tFā///N $.$nN^Nup`Nq/,OH<<$y:,/ I>N/9>u/9;cTNFHj@N 9>vr#>vp%@ / N?B@F KG$<)r&<2(<{h*<wNNJg/ N R/( DN/ EN ` 9>vDg CNNJf BNNJf 9>y g`NV/ $n/Hy+HnBHy/ HxBN( Jg/Hy+NK./.N> npP 9:Xgp!@ %HT/N?%nB$nN^NuNq/,OH 0&n$. y:*gHzHy:$NPHxHxNT$HPJg<$n$ X/INXJg/N6XpL<|N^Nup%@%y:, &RK6x؊*<PJf&RIJfv`&+g8,+ %KB/N/ CN/NB&* Jf Jf / ENX&S`/N/N/ EN/N/N`'I"h"Hx/NP K&SJf|"hJfBHx/NPB B/N6XB`/,OH 0&nHxHxN$H!n !n $ X/N S$ g!J&%K/N6 J L N^Nu/,OH00&n$n &.$ X/NXJf2 RJg!j j Hx/ NP-BL N^`BB f + :,gEJg$'C/N6X-C -JL N^`/// NML`/,OH0 $n& X/N$/N6PJVDL N^NuNq/,OBHxHy?bN{4Hy+Hy?bNM.N^NuNVH?8*.$. $n&n,. pSgtB/N(Xgh~΂Hy:8Hy:DDZIЀD/Hn/./.BBHx@/Hy:Hy:NI&0g/N0X LN^Nu `Jg2(nHxHxN)HHn$/Hx n/(NDpfJfz`/9:N/.I>N//.N@Jg0 n g/*$/N>/.N n n nghDfr@fpf*/N}d.:N6XJg &`z?`P/N?`v `/,O/ / ".$y:,g$ *f <+//*/Hy+NDr*g:Hy?bNXGML jJg2Hy?bNPHy?bN6P/ NNHy+NK.Hy?bHy?bNP`NV/ B.Hy?bN nC!IHy?bNPPEMLJ.gHy?bN6B$nN^NuHy?bHy?bNP`/,O/ /$y:,/ N> *P$@%@P/ N?PJfN` $.$nN^Nu/,O/ /$.$y:,/ N> *P @%@P/ N?PJf$.$nN^`?$.$nN^Nu/,O/B?bB?b y:4Jf$N^Nu$9?bg$B`""h ՑR"( 艰e!y?b ( ѹ?b ($ѹ?b P`/,O/ Hx*/.Hy?bN)0p4#?bpT#?b3 ?b#(?b#?bp#?bp#?bp#?bp#?c(p#?c,#?c8p#?c<(n&n *k *+(+($DB,<)/`nNoE(/ В/N)/`PJg"Jgtī ԍEHG)/`b@E J L<|N^Nu&֊  Em/ / FNPJl$R& $C` В// NPJg`/,OH?<$n&.$. ,.(n*jG/ NXpg~g\Jg`t`@(**Jm <r,.mօՄkJg()C.g$%CB/ N6 L<(.J9?dg$y:4I(yGC&K2Jf pL<|N^NuJg/*/N)/`PJg$R`**&* Bo,ܪ /.  FА/NPJg:" FҐpFf4( S b 5I//Hy+N R`p `/Hy*;NP`/,O/9>u/9>vHy+ n N N^Nu/,OH8 J?f|ENVN$(9>y&9>vNf궄fJ:4gvgЃ#>vjB@FLN^NupJ:gpJg #>v5C`N((9>u#>uG:I`B@F gLB@ B#bF$pJ:gpJg#>v5CB@F/Hy>uN(PLN^` BNX`/,O/ / .$n y:,4(fJgB$.$nN^NuJfPB0B@ A#bF$"y>vȰf>B>vB9:耑hB@F (g BN{XJg$`rfp`#>vȑhB@F`/,O9: WDN^Nu/,O n ( :gr,-A -@N^`N^Nu/,O/ $n p%@ $>u R ($%@pgp/Hx,N%HPg/NXB$nN^Nup `NV//&.tԎpĀ-y:Hx`/.(/N)0C B!I4//.$/. /.//././. /.N0JfJg". b#:$.&.N^Nup`NVB:NLBHzHzBBHy+R/<BHx@HxN-#:#:(HxHxHxBBBBB/.HzHy+XHy+HxHxpBBBBN@N^Nu/,O/ / y:#:g!|:#::$<:#::HxHy:NL/HyYHy:NHy+Hy: EM.NHy+Hy:N .:N4~#:/NP$.$nN^Nu/,OH00$n&n &*$*p fN(%B/N|B>y kXJ0g / NjXB@F L N^NuNVH 0$. . fpgdEJf2 y:, h-H/(NX n h|JfZ n/(N6`&Hy:N/N"-HPG6fHy:NXA L N^Nu/(NHy:NP`p Sf h`Hn/N|PJgp SgzpgJf"y:,"if^`"n`fP`/,O/. /.NBPJgp SfA N^Nu/,O//$. n&(/N}XJg gJWID$.&.N^Nup`NV/ /$n$*-n N( .%@ B $.$nN^NuNV/ /$n$*-n N( .%@-B$.$nN^`>NNVH 0$nG}V *-@$./NXJg *-@ .g /N|X`pL N^Nu/,O n hB.-@ "hN^NNVH 0&n +-@$./E{hNX +-@ .f L N^Nu/N| +-@$./NP`/,O n (-@N^`=n/,O n (Pg -HN^`"!APr ffN^`>/,O/ / $n&j/ N>Xp g-J$n&nN^`x|ZPJf klSJf-J$n&nN^`=Jk gJ*Skp%@ R`/,O/ $n n * "**gJf fd-J$nN^`Jg%H`"gSreЀ0;N2$`$Jf-h$ -J$nN^`%H R/( N{h HxHx/N`t/,O n (p g h"hN^NN^Nu/,O n h"h N^N/,O/ n"(pp?m (lt?lҀ (|o $N^Nu/,O np f:,gN(p#>ydN^Nu/,OH0 $n n$(Pg/ N?Xt L N^Nu *Pg / N?`b"* Sveҁ2;Nl,Rl%@P/ N@/ N?P`%@P/ N@XJ*Sj/ N}dX`z%@P/ N@/ N}d`/ N?Xt`P/,OH 0$n$. &j/+N/ N>PJjQ/ N@X +ZgJPl(p%@ S/ N?X-kL N^`/ N}d`/,O nR,N^Nu/,O n"( (,S!@,fpЁ-@N^` N^Nu/,O/ / &n$k/*N/ NBP-j$n&nN^`L/,OH<$n&j(BIKMLJ,f L<N^Nu/+/ NPp`/,O n ( rm r]DN^Nu_rT`/,O/ / n$h|GC.Jf J $n&nN^Nu/ NXJf$j`NVH0<*n(y:,&l+[fR lJg ,Ш *B`$k8$<JfTHxHxN$HBHx/N{4BBA%H /+"BNA6J8f'J8/+NX/ BNXJfBB-|/</.N%HB%| k0"k p@//</(/ i\N%@Hx#BBBB/./*/<Hj/+0N $u ,S)@ ,XgBN{X`t`/,OH 0 n"h)[gBL N^Nu&i8$h$( / NR rār婃 "*\XJf%@ kJf, R *Jg4!@ j k$g(!J'JA%H-KL N^`ӆ'@ `'J `NVH?8$n..&j:g"pg/+N4Hx/N I( *-@N .f/ N>r%A $>u R/($/ N> Jf(+*+ *8"*<҅ф'@'A,.cBrӫ&+׀'C,*0.*4߫ +ц'@"*ӫHj/+(N jPJg!j j SSJ*)jS/+I6NHkNPHy:N/*/ NHy:NBA-H&H/BHjN2 Jg / N1XHj`GMDNHjNPJg / NGX *gB/N$BP *gHx/NP/ Nf/ NƾPJfHx/ /9:N4V LN^NuBN`X`6NVH?<(n&n &.(.$*.(/+KNXJg:g/+N4$Hx/E N k,"[I ,(.(dVHx HhHx / B-| Hx /./,N@`Jg"Hx/N/+N6 p#L ,Xg/N%lX/ N?X *P g / N@X/+$<6"BNHy:N"y:%IP BgK#M#:%|:%lHy:N k hLXJfB`B(``/ / NP`/,OH0< y:,BB(h$l8&jK$<,JfFJg jBHpp//,0N,/ N{VHx/ NB8 L< N^Nu& k BHh //9:L BNHx/ N&C`/,O y:, (`ШdN^Nu/,O n!n BN^Nu/,O/ $n j/(N6XJg-J$nN^`*$nN^Nu/,OH<<$n&j*y:,/+IN +"+XSf BB/ N^R'@/ NN k hPXJg/ NXNx/ N!J/ N/*N>HjNHy:N0+X@P&<6 @Pf/+NX+Rgl/+ CNX jJg!j j Hy: CN/+NP$<B/ BNXJfJ*)jH +g>BBB/NG/+N`/*HxHxNDHy:N`~'J$<>(<?*Pfx/ BNp%@ *Xf/ DNS jXJgp /+ CNHkNPB/ N^ft/ BN U/( N{h/ NwHy+NK.J(fJ,g|(k|*<7hJgl/ BN/ EN/ DN(l `Hy+/N)/LP`RL<K?|܋ DN *P-@$.  g(g<.*/+"CN/+"EN%H/ NP/ N/+N6/N>  f>/+NX$<F.<M/ "BNXJf/+N6X``/ GNX`gL/+ CNS/ Np%@ / N/+N6/NP/ N R/( N{h/ Nw `g / NNXg/ N"R j  j (R!@pP/ NP`L<&n&. (n.(+$kR'C$B*Rg/*N6/ NPP *g BBB/NG/*N`Jg// NBPJgZJ()j t` j|BJgpJg$g:gb*HA$-(g(І" A`"(Jf$gg*H A`B`"- RJgJf+D r gpJf`Jg^JfAJgJgHx/*/NM$ Jg// NBPJg  fB SB$HjNPX`>r fB$B SJg(/ N*BB/ NG/*N L<|N^Nu *ft `t/*/NM$Pg\`\t`Vt`T/,O/ /$.$y:Jf $.$nN^Nu * re(">|d/ "///Hy+e n N$j`Nq/,OH8 $.&. pR cV c$< (<//N,$HPJgg/B/N( Ĕ$ J LN^NuXB`/,O/ n"hE cHiHhNP$nN^Nu/ Hh`/,OH0 $n". nJf-H -AL N^`&Jf/ NU&XE J L N^Nu&*Yd//NT$Pg// /N)0/ NU&$B`/,O//". . BvfJ WIDЀ$&N^Nup`/,O/ / nC:$Q!JGg$%K"!IJf0R?dR:$_&_N^Nu#:`"h"q RRe`B`/,O/ / $y:G)/`Jf J $n&nN^Nu/. j/( NPJg$j`/,OH 0$n j bBt Ԉ&jHx /NPBC * e$%HJg// NP%B L N^Nu!RX`/,O/ HxHx@N$H!n$Hh0/9?e8NW J $nN^Nu/,O/ / $nHj0/9?e8NX"*PGg * //NPHx@/ NP$n&nN^NuNVH0 &.$n(tԎpĀ j4-PHx`/ /N)0C B!I4//.$/. /.//././. /.N0JfJg ".k j4 L N^Nup`NVH 0HnHnHy+/.NJf .$$nGQBBSd L N^Nu/"NX`/,O y?eP N^Nu/,O/ Hy+EDrNHn /.NDHy+N$nN^NuNVH?<$. (n$y:K)/`JfG/NXJg"Jg(B`<&j//+ NPJg$j`Jf,/ n h/( Hy+NX x L8&.. <+ZJf <+_//Hy+eG[*N/N$H(KJf/Hy+NXPt L|N^Nu(g//Hy+N t`J$f hpf/Hy+NPt`,9?eL#?eL&y?eTJf0 jBHx hN$Pg(#?eL//Hy+N `v/ k N&SX`J8g Hj8N@XJ$g /* NX#?eLS?d j *Jg!@ j e/Hy+N * Pg /NrXJ$fr"*g * //NBB BPJgpB y:%H #:R?dR:`#:`n j pLSR`f/ NX`/,OH> j *"R%A! E`,*.gJg/.N) &X.<) tJfP/Hy+)NXP`/N) (//.N) 4 Jf /N)4X`/// GN Jg/N)4,Xf/N)4X*9?eL#?eLJ$g./ x؎/Hy+I/* &<"CNJgJ$f k".g-A/.BN&#?eL .Pg/N)2BX$+ Jg//Hy+_NX J8g Hj8N@XJ$g/* NX`..tĮԇ|8܊gj/"G Y. NX`/ /Hy+/* CNJfH&.tĮԃK|g0"C/& NX`/NX-Hg(g$/Hy+NXBHx kNv`@ j *Jg!@ j / NXJg"n"J.g:J:g2N-y:B(.*.ځـ%D(%E,zNf y:#:/+ Hy+N[*&y?eTPJg/ kN&SX`)@`fvK`)@` vƫf#:/./.// N&/Hy+N[*`NVH 8$.BA-HNCG:I$SJg jJgVgP$jJfE:G RJg"hJgg hJf nJfNCLN^Nu*g j *Jf #:`BB/( / NJf`j!@ j B n%H -J`D j`JB/BBBB/) N`J"h`R"h (Jg*#@"h"B"y:!I"#:`.-@`NV//&.NC/NXJg./Hy)Hy+N[* tNC $.&.N^NuN9|BBBBB-|Hx/./N@$$fB/.B/./. B/N$`NVH0<&. y:,$hNCHj/*`/Hy+E[*N*JGCJ9:f/Hy+NNPt L< N^NuHx//I)/NPJg /Hy+3N`Hx@/NPJfHx./NPJfN9|BHxBBB-|Hx/./N@$$g/Hy+SNNP`tHx/. BBBB/N$//Hy+vN(N`FNVH80$.$y:&Q(YGJf L N^Nu * gD///N Jf4 .e,"Үd" j/( "///Hy+ n N$j`NVH<<&nHy+Hy+Hy+Hy+`NHy+N$y:&<,OI2\(Q*YKJf L<-HHXfxHx/ N/Hx Hy+dNt "n/) NrHx/N `t`P cHx/ N/HxHy+dN`Hy+]/ N(`x/ Hy+NBBHnXBHxr//.HBN",$(g2/.HN!EHx/ N //Hy+dN pfF` /.@/.XN"$Pf"n@()p*)tB"<nHxHx "GN. y:,/Hn\/(HxHxBPBTB/.P"n@/)t//.XBN"0 $"n@ )t GB04JfJ\gtHx /NPB`/N)(XftHx /NP/.XN"N9|/Hx/.XN"//.HN!EHx/ NJfJgJHy+/N) PJg6/N)XJg(/Hy+NX/N)2 t`Bt`xJLf Jg*`/N)2X`JgB`y$S#>yJf#>yLy 9>yR#>yfB@F$n&nN^Nu/ N*$HXA(Jf BN .&-K$n&nN^`BN .&B/*Hx/ N|`/,O nJg f r:,WIDN^NuB`p`/,OpN^Nu/,O/ n gBB0"0 ::B@ A&bAdF"9>y$S#>yJg p$.N^Nu#>y`/9:,B/N($N( JWID`/,O/ HxHx@N,$H/./. /./Nz%|Z]p%@ J $nN^Nu/,O/ HxHx@N,$HPJg&/./. /./Nz%|Z]p%@ J $nN^Nu/,OPN^` /,O/ $nN(HjN):xXJf(N(/ N{VHx@/ N p$nN^NuB`/,O n (N^NuNqNV/Hy:@N 9:H"9:LBS#:H#:LX$fB..:PHy:@N6X$.N^Nu/,O/Hz Hy?e`N!gl$Pf"NV#:0BHxHy:@N{4 $.N^Nu/,O/. .X//9:0NX N^Nu/,O/ . n $( g/(/NP-H"B$.N^N$.N^Nu/,OH<$n jJg!j j &y?e\IKJf2&J/N!/ /9:0NXHx/ NL<N^Nu/ / NN&SP`/,OH00$nBG|d&`/NX R 08fR`/*B/NHj/9:0NXHx/ NL N^NuNV9:P@.f A N^NuA:( y:.f Jf/9?e`/.N!ijP`Hz:/NP`NVH<8&n$. /+N$HXJfE J L<,.B/EN&HPJf2Hn/N!ńPJf /./N&HPJg/.N!X"n /)/ NPJfHy:@N 9:H"9:LBvցՀ#:H#:LX&f|.:PBN:XHy:@N6/."n /)Hk/9:0NYR B`j F/(G`N$HXJfl"F$)/N$HXJfZHxHxN$H!|HhHxBHxN$$B Hj/9:0NW./9?e`/N!i nB0(Prcp"Ҁ <L<BЂfL<(RHxHx&<"CN&H //9:0$<W*BN T'HgC!I('L * R%@ fJHxHx*CN(H *Ѐ!@"*Pc!AHlHxB/,N$(B Hl/9:0 BNB&<d$`r iJg!i i  QB0(Pxcp(؀ L<BЅfL<(؀ D #@g A*@+H*D*#DR R"p(JfR`r * ", g//Hy++NK./*B/NHj/9:0NXHx/ N/ /9?e` F/(N!i(JfpL<|N^Nup`/,O/ / &n B/.N6$HPJg8/ /NB/+Hj/9:0NYS NB$n&nN^Nup`/,OH?B?epB?et$9?eh&9?el g <B*<B@m> HkHjP/ N4 Jg(HkHj/ N JgHkHj/ N / NHHx/ N L<N^Nu/,OH08$n&n J?eg/ N/Hy+NDr / NF`XJfBL N^Nu/ NHXg// NHjPHy+b/ INJg0/ NHXJ?eg/ N/Hy+'NDr `HjHy,/ N JfHjHy*/ N fp?el/ N/Hy+NDr / / NIJPJgrp?el/ N/Hy+NDr / / NFPJg/ /N0f/NOL N^NuNVH88(. v֎pƀB/NOx$PEGIMJft`$/NXg /N$X`//NPJfB/NOLN^Nu//NPJf`NV/ /$.$n //Nz-RBHn/N0$.$nN^NuNV/ /$.$n / /N0PJfB$.$nN^Nu/ /NPJg-RBHn/NP`/,OBHz\Hzj/. /.NJN^Nu/,O//$.&. HxHy?eNPJf>J?eg(A+JJg /NX//Hy+VNDr B$.&.N^Nu!C!BB//9?fN8 J?efp`A+JJg /NX//Hy+|NDr `/,OJ?egHy+NDrXHxBNPN^Nu/,O/$.HxHxN!n !n !nBB"y:h!I"#:hp$.N^Nu/,O// .". $.. y:dJf$&N^Nu"PfBf<(f6 f0 (Jg #@"h"p-@ -H$&N^`K$#:h` I`/,O//&.Hzd/NK<PgHzBBB/NJ$.&.N^Nu/,O/ /HxHx N$HB@P B bF!J?efpL9:/Hy?eNPA?e"P$g2#J %HB@FHzBB/ /.NJp$.$nN^Nu#?e`/,O/ HxBHy+BBBHx Hy?eNz HxHy?eN&HxHy?eN&TBHxHxBHzHy+Hy?fEzN,Jg Hy+NK.BHxHxBHzHy+Hy?fNJgHy+`BHy?eNLBHzzHy?eN$nN^Nu/,O/$9:".¹:p L"B iB)g(p L9:@"B ∀Ѐt"#:@S: $N^Nu/,O/ n h|"HE3Jf* $_N^Nu ( "2 ) 2 m f (c"H hJf I`/,O//".. :t L y: tĀf$JgftĀ B h`gJfA`Uffr€ A $&N^Nu/,OB.//.N~PJg(Z g gA N^Nu/,O/ $n HxB/ N(HjN˂B$nN^NuNVH?ԂR#:"ҁ#:Hy:N/9?thNQ/ /.N`Ѐ` F$ECЉ:c#: !@R#:` /,O n (Ѯ-PN^`޸NVH00&.&n$$n(tԎpĀHx`/ /N)0C B!I4 j4-P// /. /.//././. /.N$0fBJg>BBBBB-|Hx/./+N@$Jf .re j4 L |N^Nut`t`/,O// y: 9:".€t L(C(FЀv!(BJf*p L9:@ ∀Ѐt B#:@S:$&N^Nu/,O/ / $nG@Jf $n&nN^Nu *Zf*[Hx/ NHx/ N$jd`/,OC3l YJfBHxHy:N{4NQ#?thHxHxN#:p#:#u0:"H <r"BBT fp#:r#:@!|tp#:Hy:NBHy:N| SgHy+NK.B`Xv f/ N?XE J L N^Nu .fڴg`/,OH <$.Hy:KN :r L y: XI6f,Jg(f"r€$A&j/+NXp f/+NXEGHy:N n J L<N^Nu/,OB/.NP N^Nu/,OB/.N*P N^Nu/,OHx/.NP N^Nu/,O/". :t L y: pJgfJfA $N^Nu/,O/$. gfHy:NXJlBD/N"XJg@ h"n"i"iVIDHy:N6X $.N^Nu/NPXJft`t`/,O//&.Hy:Np//N$ pg C!B`Hy:N6 $.&.N^Nu/,OH 0&n$n N(Hy:N$+` :r L y:pXUf%B Hy:N6 L N^Nu/ / N$Ppg%B`/,ON^`/,O/". . A`f :t L y:t!$N^Nu-@$N^`/,OHx/./9?t`N4V N^Nu/,O/ / $nHy?<$n&. (..IgHxHx(N&HPHxHxN*HHy:N$Ĺ:p L(Թ: B(h Jgf`gB/NtP g"Hf8Jfj"@*) E"h$jg*Hy:N6X4|`Hy:N6XE`JgZHy:N6X4|Hx(/ NP`'j`$'Jp&B B j hp'@ jpШHx/HkN)0*[ "K+I+DB B!MB (MKHx/ / GNB/*/ NHy?PL N^Nu/,OH><$.&. .(y:,&lJg'B$k|K>*<@,<?JfP$lg/N4~)HXJgkN/+N6XJgJ/N>Xg<-JL<|N^`g/ NP/ EN/ FN $j`E`L<|N^Nu/,O/. /./9?tdNVN^Nu/,O/./9?tdNWPN^Nu/,Op@Ю//9?tdNWPN^Nu/,OH>8HxHxHy:E{4NBHxHy:NBHxN}#:.:GDNHy* {Hy:IM.NHy+Hy:N y:<#:(Kg!|:G:#::<#:<:"y:p L9:#: y:&g!K#::#::p L9:#:C: Q#:$g!|:$h#::#:(/ y: hTNN?#?f#:Hy:NBHxHy?qNA?pB !|!|!| Rr f 9:l#?qB?q cpF#?q|B?qx 9:t#?qt[I#?qp op_F#?ql[I#?qhBIUN&[I"x(| *XB&< "eBN$r&X#?qP#?qT#?q`#?qdHxB//N(#?qX#?q\ 9:#?q[I#?q jR#?q[I#?q#;?qB?qp#?qB9?qB?qHy:NHy?qNvB/<B/9,Hy?nNHxHx"9:/N$.N.b/ NtPL|N^Nu/,Op@Ю//9?tdNXPN^Nu/,O/ BHx/9?t`N3$H|Z/Nt/ NRf/ N/ N PE J $nN^Nu/,O/. p@Ю//9?tdNX N^Nu/,O/./. p@Ю//9?tdNYN^NuNVH8 &.$. /E4N(/NPfR/N(/N4Pf>/E4N(/N4Pf$B/NHn//N5hJfJfpLN^Nu/,OH80$.". . $nBxgBxe"BxgBxgpL N^NuBx` .SxeЀ0;NT/G4N&/*NPf/N$/*N4PVIDЀ` 9:g|Sf.*NW` 9:t[ _`/*/NtPJV`B`F/,O/ /$n$. *MgTHy:Hy:NuPJg,// y: N$Hy:NuT $.$nN^Nu$.$nN^`Hx//*/ Nz$`NVH?<$. E r$@HxHx IN&HHxHx N(H n.(0/NdHn/.NJfpg8WgpHx / E-@NHx / N/N, .LXJgHx/+HjXN( / N?X n%h<@"hJgJg%iD"h5iH"h"i%i$([g h h hJg%hL"hJg )%@PJg%hT n"h"iJ VID%@l"h"ifr%AlHx hpШ/HjpN( B`BdBjhL N^NuHxHnHx/ GNHx n (X/HxHjN `Dp`PHxHhHxHjTN`Br%AL`8NVHH?<&n$n (.DO. wr€(ABPBTBXB\B`BdBhBlJgB%K%k $B %k$,B(%k(4B0%k,%kt[I%GpBBBB X - Jg%@Bmh/-PHy3 ENp%mT%mPp f U (@%@/ N@@imsjXJgHx/-Hj"FN -BJgp%A%@ U %@\BX/ N? k|X:DBHBBBBBBCJfT0 Jg"-IP-GT-FX-E\-D`-Cd-Ah-nHl"+(P&+,T(+0X*+4\HxHnPHj(&<)0"CNHxHn`Hj8"CN k hJg%h$| k%h k hJ gph k hfrhHx kv֨/HjN( k5h +[g k h hJg%h"hJg )%@ (Jg%@\BX+Z[ c gJ.OfB%| k(%h, k(%h0HlXBHlhHlx/ N@%l\%l`%l|%l%ll%lpHxX/+(/ N)0./ N f%lPD[I%E@%lTL[I%FH%l [I%G%l$[I%@%l([I%A%l,[I%C%l0[I%D%l4 [I%E%l8[I%F%l<[I%G%l@$[I%@ %lD,[I%A(%lH4[I%C0%lL<[I%D8 k($(X&(\*(h֨lՅ)Bx)C| (`Шp)@P B?oB~ރ݂)Fx)G|)@%l|P%lTL< N^NuB)KHx/HxHjKN)k BHx/ HxHj N)k$B Hx/ HxHj(N)k(BHx/ HxHj0N)k,B Hx/ HxHj8N)k0BHx/ HxHj@N)k4B Hx/ HxHjHN k)hBHx/ HxHjPNBXB\)k(B Hx/ HxHj`N`)@BHx/ HxHjN`)@BHx/ HxHjN`&B`V()@Hx/ HxHjN`z "@ (H (Ѫ (Ѫ (Ѫ h:|`^p`n)@BHx/ HxHjXN`bx%D`XNVH08(n$n &.Hy:GNXpf ,$f4t L N^Nu/N"X$fHy:N6X`/(NXHy:G6NBBHx/B-|Hx/./,N@`$ gRg R/(NX`NVH>< n . &.$n".&n$tftpf(P`/N4Xfrg/N4Xfppf`f,g/N4Xg&Df0/N4Xf `/N4Xfpfrfg/N4Xgp//N>(Prfhf//N5PHx//`Fg/N4XfrfRpf,/N4Xg//N>(Ppgb/I4NXgL/NHx/K \NHx/N.+S/N"D//G N./N//N4pg //N5 Prg6`& g/N4Xf`:pf`NVH?0&. *.,... n&hN?(N $+ExpffxfB//N B` g/N4Xfpfpf /N4Xg//N>(Ppg//N52Ppg //N5VPpg~`nfng/N4Xghg/N4XgTBBB/ B-|Hx/./N@`.g\B//N L N^Nu/N4Xfpffpf/N4Xg//N>(//N52`/N4Xf pg/N4Xfppf`f,g/N4Xg&Df"/N4Xf`/N4XfpfZpfg(Ppfrf~//N5DPHx//`g/N4Xg g/N4Xf~`pg/N4Xf pg`//N>(P`/,O n Hx"////.NbN^Nu/,OHxHx n /Hx/.NbN^Nu/,OH80$n n (*$&(G4pf/N$Xpf /N4&X/NXfpHx7//// NbL N^Nu `/,O n Hx"////.NXN^Nu/,OHxHx n /Hx/.NXN^Nu/,OH80$n n (*$&(G4pf/N$Xpf /N4&X/NXfpHx7//// NXL N^Nu `/,O n hN n BN^Nu/,OH8 (.$n N?$BHx//*/N5&f-B -DLN^`X/N>X LN^NuNVH 8&n n(h$+pdtHy:NE lpШ/// N)0Hy:N6/// NLN^NuNVH < n&hBBB/ B-|Hx/./(N@`$f(BHxI/ n /Nh$gp?ft L<N^NuHy:N k$hXK*gD +`$g:Hx/ / N($ Jg$/ / Hx/+`HkHy+HxNGNpHx/ / N(Hy:N6`hNq/,O y:, hpl;chl BN:XN^Nu/,O/ /". "y:, )R#@ n$hJf,t )S#@ )g BN{X B $.$nN^Nu$*ce$R`/,OH8&n n$hIJf BLN^NuHxHx N!j!j 'H$RP`/,OH 0 y:,&hJgD$ @/N$kXJg BNG $RHx /NPJf/N6XBL N^Nu/,OH<0 n &(($(pgpgJfJg b <e؃HxHx N$H!C!D y:,&h* @/N"+"y: B AJf$'JN/N6X`tRdzdb P` y:,$h$ @/NA$jXJf/N6Xt`&f *gB J$R`L <*n*.&n$,.(x؎pȀJ f6Hn/-/ Nn$ f$nBBHx/ B-|Hx/./+I@`N$f F (Wre&0 3x LVID-@Hx`//N)0C D!I4// /. /.//./.B/ N$0fTJgPBB// B-|Hx/./+NJfJ/*NXJg,P%CP/*N6XHjHNX L<|dN^NuFƪP`t`$`t`NVH<<$n(.&n$v֎pƀJ fpfHn/*/ N$ fJ(nBBHx/ B-|Hx/./+N@`$* HKJg/NX L<<*n&n $m$+Hy:IN Xrg^rg&<6JfJJg /N"$HXJgf/*N/+/ / N<$/* CNHy: CN L<|N^NuJf j$PB(<*<6Jf&B`/NPXJfHy:N6Xt`/*NR/+/ / DN$/* ENJf~$jd`Jf /-N4X$y:B*<4(<6,<JgJLm /*N/* ENPg/* DNX$R`R/+/ / FN$/* DNJgHy:N6XJf`BHy: CNXt`NVH00&n v֎pƀ$p eN n$h/*NԪ,Hx//N)0/*N6Hx/+/N L N^Nup`NVH?8&n$n I r(@/ N>$*&* +8"+<҃т%@%A X(*cB|ݪ.߅$ +0"+4Ӫ$Հ$ +g@v@g/ NN($,&, "(+HLX*,d|~߬$Ն((*,&+@D$*&* ҃т%@%A ,.cBrӪ$Հ$۪&ׄ$-KLN^`9NVH?<$nx؎p&@* D/N{h-j-j-j-j(j*j/N|HxHj/ N)0.*|*<$Jf .".$.Үт$ & ցՀ-B-C-S-k&+BG(4/<B@B//N-@B/<B@B/./.N,...ށ݀&.f$&(*-j-j .".̒c n̑Ŷd C-HB".ؖܕ(.*.JgF%B%C/<B@B//N( n !A/<B@B//N( n!AJ gF%D%E/<B@B//N( n !A/<B@B//N( n !AJgpE(JfJg(/// / N(4 ././/N(@*A/<B@B/ / N n !A/<B@B/ / N( n!AJg n !n!nL<*n(.(n$E r$@J fH*- Sf:&-Sp e,rf"Hn/-/ N Jf&nBBHx/ B|-|Hx/.|/,,<@` FNJflt`ԊJg6Hx`/.(/ ,<)0"FN Ы,Hx//"FNUfRAh`N//Hx / B|-| Hx /.|/, FNJgHkH-@xNX .xL<|TN^Nu B%H4/ / /. /.//./.B/ N$JfJg/// / N `p`NVH0 $n n tԎpĀ&Hx//(Nh Jf///*/ N L N^Nu/,OH> $n,. *./ N .$j,& /N$*(*%F%E/N6 ;g-D -BL|N^`ۤL|N^NuNVH?<(n$v֎pƀJ fp"nfHn/)/ N$ fN&nBBHx/ B-|Hx/./,K@`N$* H(<Jg/ DNX LugpJg /* N|XBLI(&/// N f*:,gv#>ydL N^Nut`NPJf`r €g`/,O// n&. $/N@rFƒ///N$.&.N^Nu/,O n P N^Nu/,ON^Nu/,ON^Nu/,ON^Nu/,O/ n ( "WgQfR (P$(\dc(A!@PBdB\//NP$.N^NuB`/,O/ / $y:,GE"N"*\XҀ%A\$y>uJf8J>vHg 9>vD y>vp$p/ NbN%@XX J $n&nN^NuE`/,O/Nv4$9>vH>vVDN}P$.N^NuNVH?<&n/9>uHy,>N y:,/9>u/9>vD/9>vH/( h/(`Hy,UNE>vl t"" D0|Jf0|/Hh/Hy,NQBBSdHy,Hy,Hy,Hy,Hy,Hy,Hy,Hy,Hy)rHy,N(y:(K@JgJLm(Hl/,`Hy,N$l| (<,[*<,;Jf(T`,.*NE"X-@JgR G& F. * r$<,8g$Wf$,*P/ N/./// ////*p/*Hy,N$j,`v`Lr fH$*rm&x// N/HxHx/ NLN^Nur`r// NB/`"ЁJgx// NB/B`/,OH8 $nJ gK?Jf L<N^Nu/ NXp fJ*Sj p%@ S/ N$jX`/,OHxB/. N(BN^Nu/,OH8$n&jI> +ZgJPlS/ Np%@ / N?P/+N6/ N R/( N{h -JLN^`M/,OJ?tgN^`6N^Nu/,O/ / &n$kd/*N/ HjN -j$n&nN^`/,O/ / &n y:,$h'Jdp /*N/ HjN/*N6B$n&nN^Nu/,OH 8 n$n *S$rrᩃ, r€fX&PJf f`r$B"h%I"X!J`2R"jItd.f(Hx`HjHkN)0p& BLN^Nu&k`p#`/,O 9?tgHx N`XN^Nu/,O n g"D€p N^Nu (g"D€p@`B`/,O/ BBHzBBHy,BBBHxE-N#:l$BBBHxBHy,BBBHxxN#:h(HxHy:@NLBHz$Hy:@NBHzHy+߽N; $nN^Nu/,OH 0 n&h4J gHkN):PX K L N^NuBHx/9:lN3$HHxHxHhN{4p%@$ /NHx/ / N)0$.N6X&J`/,O/ $nN(HjN):xXJf&N(HjN{VHx/ /9:lN4V$nN^Nu/,OH8(n&l4pgTBHx/9:lN3$HHxHxHhN{4Hx/ / N)0p%@)J4$-KLN^`JLN^NuNVH?< n-h4B:B:B:B: B:B:B:B:B:B:B:B:B:@B:DB:HB:L-|32|$BrG:tI:@K:*<:$nX&gxȀ,(ꌍLDf(~΀,ﮍL~fxȀ,(ꌍLgvgvƀ(&ꋉ= BBBB ~#GRR v@frBBBB~ϨPB C !I$B(B,B0B4 h|BhBxB|p!@BC!IBBBBp n!@LB/./9:hN3$H JgHJg,Hxx/ /N)0p r$&J K L N^NuHxtBHhN( p`G`/,O np QfHx//9:hN4V N^Nu/,OH><*n(n $.JfJfBL<|N^Nu$UB&<0( X*<)0Jg&jfJg R$K`&Hp` *JgX'@ j ,p$JgHxtHj/"ENp( / CNXJgN kgJg@&hgp`+@`JgP`THxxB/ N()B)| `0p`,/,O/ / $nG4V RJf $n&nN^Nu"h (Jg #@"h"Hx//9:hN `%@`NVH00$n$. .Jg`JfHGA)0JgHx// N *"* î *"*îP.NX$g S&rrò<//. / N2 rl S&rrᩃ< L N^NuHxHj/ N`/,OH0< n$n (nJffBB BB!@"PtJgz&iJg )S&r"²<g( )JgL'@*i*B*l#M*X)I"K` F *F *F * F`!@`L< N^Nu/,OH00$n$. &.//Hj G2N$j| Jf L N^Nu//HjN$j`NVH88$n/ N-&j4BBBBA I3XBx$"Cvƀ"&Ʃg&,gf,BBBB Br!AR Xr?fBA-H/*NI/ Hn/ N3BBBBLpfB j|BhBxB|r!ABC!IBBBB/*N6XJg / N1XLN^NuNVH<8&n$. $kN(IHxHk/ N)0&., *Fƀ".0 *F€ .4(*F(.(**Fȅ*+Fȅ-D(+Fȃ-D&+FƁ-C"+F€-A Jf/ NX$ L *PXgg%@P/ N7h".S$p€p- XggTr fLtăgJ fp>pmHx?/ N@P * UreЀ0;N\n@\&/ N?XB L N^NuJg4$*Pg(/ N?`@DgB *gJg&p%@ Rt/ N?X`Jg tFĪPg/ N}dXt`B`NVH?<$n(n ,,*Z g fvJg /HjNXP$0m3"-A f2.,p"S&p€p*Yg"²= fJg&zB`8B`"²= gB L< n(n $n$.&,*h((Hy:GNXJg$y:B*<@`,<6Jg *Lk^r`lVgRfL/*NBB// B-|Hx/./ EN JfJg / / N8PR/* FNX$R`Jf, m$PK@`*<6Jf>Hy:N6XJg B`/ NPXJfHy:N6XpL<|N^Nup`lT*OfL/*NBB// B-|Hx/./N JfJg*Z[ bR/* ENX$jd`\ g/ / N8P`NVH <&nE r$@B4+ HxxB/N(p%@ rgp%@%k` /+N4%@$%B( k(%h,%h0$+l/+K6N B/(IN . BP f / /N8P B/(N/+NPL<lN^Nup`|/,O/ $nP|ZB jlR/. / N=Pp Ъl-@$nN^`/,OH0Hy:N$y:XBJgVJLm/*NXJPm /*NX$R`/ NXJfHx/ CN/*NHy:N`/*NXt`Hy:N6XJgHxHy:@NPL< N^Nu/,OH8<$.*n .(y:,$l *P *ZfJl^G6Jf0Hy:N}VXJf/*NHy:KN/*N pfJPl // NPHy:NX`0%@PN(/ NXJf$Hx/ NPPJPmt-LL<N^`&j|(<7~JfHxHy:@N`/ HxB/ DN&k`NV/ / &nE r$@HxtBHjN(p$%n /+N/ / N8/+N6$nx&n|N^NuNVH 0$n&n ".*RfDJg@ j p'@$ (-@ n$PBg "XJgF"i-I"nJg6f0'@$/*N/ / N8 -jL N^`نR`/,O/ / n$PGA(Jf $n&nN^NuJg*[g/./. / N $jd`NV/ E r$@HxtBHjN(p$%n /.B/ /.NA$n|N^Nu/,O . n h h -n -@"h(N^NNVH?<(n&n $+'lp$lHy:KN/*NP(<6&<*h *P g(/*E6NHy:N/ NNHy,NK.Jl,Hy: DN/ *CNHy:N/*N`* "j4"҉-A A.*Yg*jlf*[fp j  gh**f`5B |%kpHx`HkHjHN)0Hx/BN>NJg j hpJg/ ///NL<&.$. (.G r&@(y:,$l,<6*<*hK *P g2/*E6NHy:NPpg@/ NNHy,NK.*Yf"/*N6X-|:L<|\N^` j  g**fJl&Hy: FN/ ENHy:N/*N`bHxtBHkN(p& ,'@pr'A'C'B 'D$ j4$(5| |%@Hx`HkHjHN)0HxHxBN$Yf0Hy:NX& KMLJ,f@Hy:N6XNJg  j hpJg(/ / /HxNL<|\N^NuHy:/NP`/ / /HxNb`/,OH00$n$. &.Hy:GN/*N0*X@P @g"/*N6X-|:L N^`j-j@-C -BL N^`NVH?<$n*jGBAH-HIA-HA-HA -H-Z gJPl*/ N./-NPJgB/B/ N2` gHx/./ N)0&*-[A f`,*Fͮ**Fˮ(*Fɮ.*FϮ/ NX$f&nHxHm(/ N)0 J.g0 9:F 9:F 9:F 9:FͮˮɮϮ/ NX(f/ N>P/ N?PG%Kl L<&n$. $k *P g>/ N>P/ N@/ N?/*N6/ NPHy,*NK. g/*N6/ NNHy,4NK.vư-3g@%@PK>(<@*<A"(j|,<?Jf.pgbRI/ NP/*/ NMLS `/ NXfP/ FNX(l`P/ DN/ / EN `jHxXBHjPN(%BH%|L Jg/*N6Hy:@Hy:PNu JgB/ y:LN(@Hy:@NuT KJ:NDrHx/9:,NK\$.$nN^`$.$nN^Nu/,O/Hy:Hy:NuPJg,/. /. y:N$Hy:NuT $.N^NutN`/,O/Hy:@Hy:PNuPJg,/. /. y:LN$Hy:@NuT $.N^NutN`/,O/Hy:Hy:NuPJg,/. /. y: N$Hy:NuT $.N^NutN`/,O/Hy:Hy:NuPJg,/. /. y:N$Hy:NuT $.N^NutN`/,OH <&n|ZPB4+ Jf klS$k|K>I?Jf L<N^Nu/ NXp f *Pg/ N`Jf / N}dX`JgJj/ N}dXB$j`p%@ R`NVH<<(.*. $.E r$@(y:,&l k hpL60HHxtBHjK(Np$%lpr%A%D%E _g B%P$%h(%n,Hx@Bt0Hr(N"nA( BbXJg // N>PB0*$.$nN^Nu/,O/ . n$y:,%H%n %@%nBr%A J.gjR/(/ /NNE"%@` -J$nN^` /,OH<0$n$.&."n&n . .' jJg!j j(*"<Jf"< %K%C%B%I%APJg // N=P-k-J -BL P *P-@ ."gg|Jfx"f,$g^&j/+NB/ N5$ g 0 3g/ NF$Xg jԨ4 B(ft/+N6XJ?tg/BBN` L N^Nuf6@JfR%@P j%hl R/( N{h/ NwPJfBB`B/ N5"P *P@Jf`@`r€%AP/HjNP`BHjNXP*Sgt#`t`8t`>/,OH<0$n(. $.&. RGT^Jg*(f$Hx// NS f-CL XJg 3tf-J$nN^`p@PHx/ N>P$nN^Nu/,O/ .B@F'B@F B@FJgJ g /N6XB$.N^Nu/,O n!n p-H -hN^`/,O n". "h!At (xo !@|-H -IN^`Nq/,OH<<$y:,(*&<>K{hIwB@F' R"D )F&j SJfNBrӹ>w\*9>wXۀ#>wXӫ*+ۀ'EBXB@F/ CNp%@ R/( N/ N ` &f'K hB@F"h/(NXB@F'`/,OH?0(.,. ..vFƄHy?tN 9?t y>vXte,f4Hy?tN6Hy,fNDrPB E L N^NuJfBpL(* E6 g$/Hy_NPJfHy?tNX`R`r;chm8"y>vA(rxL8G8#) !F!G!D!@Hy?tNX`b"<>uf`/,O/ /$.$y>v *g /NX j /(\Nr/N:Hy?tN <>ug y>vB(-|?t$.$nN^`/,O/ n hBrӨ<$(8Հ!B8$N^Nu/,OH8$np". n (j&j/+N/ N>p)@X/ N}d -kLN^`羚/,OH?<$n&. (.txL(K((RG('LB'M //Hy,Hr(/ Hz/ Hx/.N($Jg/Hy,NK.A(h*//Hy,Hx/.<E GN/Hy+BBHr( *<X ENA(p,$./Hy,Hx/ GN/Hy+BBHr(@ ENp'@d S!M(E(-J-D -SLvA( 9>v>yfHxHy>y NPN^NuHxHy>y NNPPJgp#>yd`/,O/ / n>v(fHB@F' ( f0"h @!@B$i$#H )Xfp#@X/)N_.XB@F$.$nN^Nu/,O . n >ug h,-pN^` N^`h/,O y>v 9>vDf h N^NuDj hx`g h`g h`Hy,NK./,ON^Nu/,OBN^Nu/,ON^Nu/,OpN^Nu/,OHy:NHx n/(N@Hy:N6pNN^Nu/,OpN^Nu/,OpN^Nu/,OpN^Nu/,OpNN^Nu/,Op-N^Nu/,ON^Nu/,OBN^Nu/,OABN^Nu/,OHxHnHn N)1 JWDN^Nu/,OHxHn HnN)1 JWDN^NuNq/,O/$. . rlHHxHy,/N($ Jg HxHy,/N(s JgA` B\ $.N^Nu]g` BZ`/,O/$./N)/<./NPJg-H$.N^`d-B$.N^`NVH?8&n$. *.$nJfB C LN^Nu// N&PJg8/N#GX&Xg/NBB/Nv(jHy,%NK. S3 b$veII// / N)0B6( &L/ N&Xgh/NFXUg/NFXWfL$%|`:/NFXGUf^Hy,4/INPJfHHy+/NPJf8/N$/Nԅr ЅrF.[IƀP$%@`f/N$/N.[Iƀr `NVH<<$.&. *.x؎pȀrf Hy+z/N)/`PJfdBHxNDpfHy+c/N)/`PJf>BB`rf2Hy,L/N)/`PJfJ:|gN"A L<Jfx#;H#;L#?t#?tHy+NOH` 9;PgHy,F/N)/`PJg 9;H"9;Ltvg3 /N$Xg&xF/B/N("9;L z "[I-@-A//./Hy,^//NE .N$X`/GFNXUfHy,4/ENPJfHy+/NPJf(9;\/EN$/NzR-@pF.[Iƀ#;H#;LP$G;L//9;HN#?t#?t/N/Hy,jEOHN/NFUf:Hy,4/INPJf$Hy+/NPJfp @HhaHy+NPHy+NXL<\N^NuHx$D/ NOx$PIKd,<MJfr/ NOXJg/NBB/Nv&k/EN(/N.[IƆp #;H#;LP`/NXUfHy,4/NPJgv/N&Xgl/N"HxHx//<@dz/N""*Hx/N"! HxHx/N"{n/N" JfHy,e DHhN)/`PJg/ "FN$X`NVPH?<$.E r$@J;`f#?t;`#;X#;\J;g\BBHy)cNv JmD/9:,Hx`HxvBX-@\/BNJfHy,wNQ$XHy+N!<&XgxHy+/9;@N)/`PJfTJ;`fJJg/NFXWf /N!2XNB~ށ݀-FP-GT(h9?_ gGDrK,<F* PHy,/NXJg^/N/Hy,{N/ FNUf8Hy,4/INPJf"Hy+/NPJf n HhaHy+NPHy+2NXHy,?NHx/N! IJf"JgN/NHx//N(yd/N)/<Jo,.S 6* gfB6y hB/Hx//N&f B//. //N&g ,* #;X#;\/NFXUgB$%|K!IjHy,NXJg/N/Hy,N Hy,?NHx/N* fJgD z R&FrF€,[I E"F, z $%A*`NRd"9?-A`"n`JgJf0/NRX/N!2XJ;`fJfz?_`2)0Ag^")-Ad"nd`Hy,4/INPJfHy+/NPJf.`pfHy,F/N)/`PJgHx/ Hx//N*g,.*#;H#;L&y;td,9;@Jf,<,GDrI!/Hy,NHx/NJfHy,/N)/`PJf #,';@/IFNUXf/N/Hy,GOHN/NUf>Hy,4/INPJf(Hy+/NPJfp;\ @HhaHy+NP#?//NP`&B`JDg//N)/`PJg&kh`~f Hy+z/N)/`PJfTBHxNDrfHy+c/N)/`PJf.BB`~f`Hy,L/N)/`PJfJ:|gN"/N!Hy,4/INPJf(Hy+/NPJfp;\ @HhaHy+NP#?B/NP`2G;\  /N*XfV//9;XHy,NDr J?f N*.P,.ToB/9:BHy+Nt`&h|F/B/N(" ~ "[I-@X-A\//.X/Hy,^//NE .N*Xf//9;X/Hy,NDr`DB`Hy,NDrX`,|?_`>,`D#;``\Nq/,OABN^Nu/,O n-h N^` /,OH00$n$. &R"* pfy>vWIDN^Nup`/,O/ Hy,HHy;NM.Hy,NHy,fBBHy;@EXNHy,oHy,fBBHy;N,.+}Hy,fBBHy;N$nN^Nu/,OH? ,.&. $n..*9:,N0Jfj$G(;:/N{h///NUb*5/Hy34/ //NU$-E-|34-C -GLN^`BBNYVPBLN^Nu/,OH? $n.. (.*9:,N&Jg"JVID//NYVPB LN^Nu $G,;:/N{h///NUb*%/Hy34/./ /NU .N6/Hy34//.NV$Jf/NX`v/,OH?..&. ,.$.*9:,NJgB BLN^`"Jg /N6XB/BNUb(/Hy3//BNU.Hy3//NV&Jg /NX LN^Nu/,OH8(.J:4f2$G&:/N{h/Hx/Hp);NXfLN^Nu/,O y:, (f,p g$pPf(fN`N^Nup`/,O y:, (R!@N^NuNVxH?<$n&n *Sf~$&+ *@"*D(*f*+,+ *H"*LdJ9;fHxA/.HxI/ N>;*k&+ .$+,*H"jL**@ jD(* *"<+Jf <*Ѱ"/ // /// /-Ex-H|/////**//*Hy,NDr<` (*mN$*8&*< +"+ ҃т%@8%A<,.cBvת4(*0ق%D0$*0&*4*֫Յ%B0%C4(*,*HL%D8%E<,.cpr҃т%@0%A4"*@$*D4&*0%C0LuI|g|"*fN/9>uNXBrӹ>w<&9>w8׀#>w8 *g&Rd%@&9>yp#>y jJg r gp Jg/ N?XJ;g / y?tNXp// / N)x&H$( r f((N('D/N/ Nj jPJg >u j (R!@B>yB@FLN^NuB`J>vfp gnBN&HJg/N6r'A p'@l/ N@#>v@ 9>vr#>v/9>u/ N=J>vfNB>y `DJgBp%@ /9>u/ N=/ N/ N$JgJm#>u`N` &Hr!A  g0Jg,// NvLHx/Hk@N)0#>yB`fnJf`&y>vB>v@ 9>vrr #>v`$/`R``/ Nj` `N/N/ N?P`l/,O/ $y:,/ N> /NN/ Nw $nN^Nu/,O/ $y:,/ N> /N/ Nw $nN^Nu/,OH?<(.$y:,I`tG;K>*<q,<w.<`~&*f BLug&B@FfBrӹ;$9;Հ#;`//NPJfB@F`fBrӫ&׀&/ N / EN/ FN *R%@B@F/ GN *S%@`/,O n (S!@ (g BN^`N^Nu/,O/ y:, (R!@"P$)L/NXJVD$.N^Nu/,ON}JgN^`N^Nu/,O/9:,NXN^Nu/,OH 0$n&j * rgDm,r€Sf*Jgjt%B Hx/ N>PL N^Nurg.// Hy,NK.+YgJk g / N7hXR`QRHkNPX`*gp%@ B-JL N^`/ N $/N\ R/( / N=&H/ N`r%A B/ NHx/ N -KL N^`/,OH8&<?K6(<}dJgJLm/*NX*Og /*NX$R`*Z g[ c jlRB|Z&j|Jgȷ:,g,/ BN +P"'APXr fJj/ DNX&k`/ CN`Hy:N6Nv4XE>uJg/ N HxHx@/ NL<N^`NVH?<$9?_f$9:R; 9;RrdB#;Hy:IN&y:XBK>JgVJLmr/+N(+*+$k|XJf` +L<~ '@E6 "Ѐ"RfvJ9;f ;Hk/+`Hy,rNDr /+NX&S`~*Sf$/ N,*0.*4 "Ѐ" @"AXrfdJ9;f\; j8"j< *"<+Jf <*Ѱ"/ /-F-G//.//,*//*Hy,)NDr$-j0-j4RT/ N4XJ;f& *Pf * ~glm SfR`_g/ N?.*L///Nh$ J?tg///HxHxN` LN^Nu-D-@ -CLN^`?NVH8 (.$.&.Jf pLN^NupdHxHn//ENJfp`f&. fHx`/.//NJf n `/,OH8 . &.(.Jg/,O/ .$nJ g>JfJf0B`$r_dHx`//./.NJg$nN^Nup`$`p`NV|H?< n$.&n(E r$@  g/ Hy, .NDrPp`v fpfJ$fL K"H hTJf)g K"H hTJfppgbpp;gX r€SfgR/ Hy, U`BBBHx B-| Hx /. n$/(N@$Jf ppfzpL *0(*BBBHx B,-| 0Hx /.,/-N@$Jf ppf"p`f&JgHkHjN)/`PJfJgr$gjR``ZLpSg$R` i<|`Lh!hTR"j<4e`B`%@($jT`$p`pB`|NVH><*.*n(.&.(n$&n( " g/ Hy3\Hy, NDr t`JfBr€SgJ fJgf< Jfr gE0rWf/ N)/ fpfBHx,<T"FN(HPJg B$h<"n(JgX/ /./Hn/ N.f$J\g6Jf& B (4"+AfHfR~/ NU&X`fBBBHxB-| Hx /./-N@$Jg.``gR`p`Lx +(g(fV 9; g J"H hTJfrp‘gZA ./ // /.//././HrN$`fAJf`VA:Jf`HA`A`A`p-`.NVH88$n B&* f *"St d(t`HxHn/Nh$ g LN^Nu(./G/ /Nh$ fJ?tg/*/ N`PJVID/N,B/./ /*/*I/ /*/*/ N$(NJgHx// N Jfb$JfZJgRdJt `DNVH8 (.$.$$n(v֎pƀ  g/ Hy, FNDrPpLN^NuJgJgp`fHx`///NJfp gp-`-J C-hBHnHxHn/NJf n"hLJg(g///. Hx`//./.Hx/.N$`\p`VNVH?<*n*. &n$$n(|܎p̀ " g/ Hy, NDrPt LJ f8Jg0"*D d ///*4/.$N&DL N^NuB`p-`/,O np fpfN^`p-N^Nu/,O nBBN^Nu/,O nB"fN^Nu® gP`/,O y;gHzHy;NPN^Nu/,O/./.Hx Hy?v/. /.N FN^NuNq/,OH< n"n ("( $)&) ցՀ!B!C (*dBrӨ$Հ (*)ۨ ф LNHx//NN 9;-@ . fHx//.N LN^NuBNX`NV//&.tԎpĀ/N/N,//N0$.&.N^NuNV/tԎpĀ/N/./N\ $.N^NuNV/tԎpĀ/N/./Nr $.N^NuNVH88&.tԎpĀG(I)0 9;<-@$n(*PNHxHj /NN Jg *Pf/N,//Nf LN^NuNV/tԎpĀ/N,/./N $.N^NuNV/tԎpĀ/N,/./N $.N^NuNVH<0$n(***"*B////N(t L(r LA  *:cJm%|0-D-E///*Hy, GGLN/Hy, vNHy?wN{h%y;4$#;4R?w( *Xk> y;8"(mf.$*&* ("(c/ RN/ RN#;8NP-|?wL (1g 01f!h$pHx0HhH/ ` (|Ff(Hx(/ Hh N)0 B$nN^Nu$|`p-`p`/,O n (|f@!@|gr !A|N^Nu@`/,OH00$n&y;< +P%@$/ NP&B +"+҃т%@%A +PXgBL N^NuNVH?<&nE r$@pg(y;<$,P/ N,,.,",PXgJg S (PL$nN^Nu/,OH><$n&j/ I{hNXK$<MLJgv$<|(<>&<?*<MJ f+Cg^,* f j *Jg!@ j / N/ BN/ NMDHx/ /9;N4VBN/ / BNP`z 9;"9: e$L|L// / "EN Jfp`^LL|`'@0`p/9:,"DN y:,%hp І!@/ CN/ "BN/"F iN/ NB B k0%H A'H0`/,O/.Hy, NK./,OH 0$n&n $.BJg$/ N)/<.Hy)Hr/HrNEpg$/ N)/<.Hy+̵r/HrNEL N^NuNVH?<(n$lB/ G{hNXK$<MLJg*<|tԎ|܎~ތ*j$JgJ,f y:,"j!i/N?HjN):xHjNPB$nN^Nu/,O/ / &n$n JfHjN):X/ N{h k,PJfBA%HB k(%H A'H(pЪ/NPX-K$n&nN^`%H"h (Jg#@ j"h" j!J `'@0`$n&nN^Nu/,O/ / &n$n *gR" Xf^B/ N{h jX * Jg>!@ j / N|HjN):xPJf HjNPXp$n&nN^Nu'@(`B`/,OH8$n / /.N4PJfGIMLJf LN^Nu// NP`Nq/,O/ $nAHpXf/N[X./ NP$nN^Nu/NZ`/,O nppf6J(f0Bh"y?w@!Il"Ch#?w@|-y;N^`N^Nu/,OHxHxHy; N{4B?wDA?w0&n.E r$@$&+zBb/N$&+,%B%C +%@Xjz|܃ۂ%E%F;%@Jf2/ NNN$y?wDXJfLNBL |N^NuN9|BHj/ HxB-|Hx/./N@$Jgp`,*HLfJPg j0/ hNX$j(`p`NVH 0$ntԎpĀN j0/ PNX *8dHx/ NP`pNt-BApBr$f JfNHx/ NPt#`8""@RftJg-@Jft%Bpgntgvt%Bt%@x//Hy3l/ Np%LB .%@B*' NHx/.HnN$` t`Xt$-B`Zr%At%@x" `t%Bt%@x" X`pgtg`v/,O n /.Hyh/(//(NN^Nu/,OH/0 n $ n h$hJg Ur!eN"r,JfNpL N^Nu )XSf$J) g iJg!i&i&JfB) // NrPB`()H*)L (HڨLـ!DH!EL )PШP!@P ;oB~ޅ݄!FH!GLe6!@P h`NVH?<(y:, T$h(/G{hN%LX|X܊K|$ X&<Xf"jXfB-RL<|N^` i(Q)H )" Jo nz n>rFx Є#r"Ҋ" r pF @ " AA!I`z  #r"Ҋ" r B) @ ( D` n4  #r"Ҋ" r B) @  @`r" #r Њ" r B) @ `JgBrӪ(*ـ%Dpr #A()*) %I/N/ DN/NB * gB/// /(CN/N`r/,OH08$n&. $.&j *r€%AgD *ԫ %Bo""R j#H %k\AX$ k\ 'J\-CL N^`(y>vgԫ %Bp`g/N}VXJg%LԬ %Bp%l\AX$ l\ )J\/N|X`/,OH88$n$. n(9:,B&jfl +:,g`Jf|RBtի< +8с'@8(K/// NUb$BHy3tHy+b/ / NU.Hy3tBBNV$`2/N|XJgN-CLN^`'>/N|/N6P/ N`X*g &R"j'I"rê&B`0LN^NuNVH><(. n "g ?w&tFJm$j&EGg,IKzڎ,</ Hx /N/ Hx/.NB// FN .$f <; -@//.// .?wT/Hy,=NC&".fL<|N^Nu/,OHxHxN}#; @#; ; #; ; A; P < !HSPf#; @>vN^Nu/,OH <&n$k(JfHxHx N$HHxHxN}$AX%HX%H\A`  ` !HPfHjNTP$  `/Hy,jHx /KEN/Hy+bBBHjIXN$  l$.Hy,rHx /N/Hy+bBBHj8N%K x'J($L<N^NuBHzrHxNZ#;  f`Hy,UNK./,O n . "9>vB!|gJg !@!AN^Nur!A!|; @`/,O nBN^Nu/,OH8 $n$. (.&./ N%D%C X-B-H -JLN^`/,O/$./Nh/. //Nd$.N^Nu/,OH 0$n/ N>X*g "j&R'I"$*p%@/N| L N^Nu/,O/ / $n/ NX*g "j&R'I"p"jf*"i:,g//. / N p$n&nN^Nu/N|XB`/,OH0 $n&. $./ Nx%C%B X-HL N^`/,O/ /$n/ NJ!A/N|$.$nN^Nu/,O/ /$n/ NtĪVD.N|$.$nN^Nu/,O/ /$n/ N!/N|$.$nN^Nu/,O/ /$n/ N!/N|$.$nN^Nu/,O/ $n/ NpX-H$nN^`/,OH 8$y>v/N{h * R%@ tFĀ"A(h`r ҂ҊGXXg "j\")j\"hd"%hd\!A`!AdJf$"A(h`" Ҋg "j\")j\"hd"%hd\!A`!AdJf""A(h`" Ҋg "j\")j\"hd"%hd\!A`!AdJf>r"A"h` Њg (j\(#j\"hd"%hd\!@`!@d$*X/N|Xg/9; N_XLN^NuNVH</ N$ *J&M`!i#H%I I`Lg/N>:XJg/ NXnhg / N?X"* +-@ .g/ N?/ N>P//BBNV *S%@ *gXBLX kJg@"h(f&'I(J IpJg,"i(f*l()m(((H I`p(H I", o `p// N@Pf / N?XJf*XGJo //2\/ NS `/// N -CLy>vf /* N{hHxHx/ N`l jTJgd (hrgZrg` *@fV *@g *@%@@t/* N{hHx/`/ N\`XJf *@r` *@r%@@$.$nN^Nut F`/,O/ /$n * "WgQfteb 9?Z"*gЀ$ bLLB%A-J$.$nN^`/B/BN(4 .B//N(`$.$nN^Nu/,ON^Nu/,O/ $n *rd,"9?ZҁS%@//*/N %@$nN^`$nN^Nu/,OH< nn$h|G>IK?Jf L<N^Nu/ N/ N/ N$j `/,O/ $nJhf> * c <%@/ N>/ NP-J$nN^`+$nN^Nu/,O n "n"i|!i!y;N^Nu/,OH 8&n$n 9?Z$Ԃ/+N(j| 9;//*/N$d<$k|/ N>"*Ҭ %@"X c"<%A/ N?X-kLN^`6/,ON^Nu/,ON^Nu/,O"n n !iN^Nu/,O/ / &n$y:,/ N> +ѪX-J$n&nN^`*/,ON^Nu/,ON^NuNq/,O/ .". tg$t g:tfHAgtJjr`gtf$.N^NupDftg`/Hy3Hy,\NDr B`/,OH8 $H$.(. /./Nt&Ppg8p gpg/Hy,rNDrPx$%D%CB JLN^Nu(.`/,O/ n"(pDf@grF n "(gtDft gr n"(gtDftgr$N^Nu/,OH>"nA*)BCBBBfJgJgJfPHy,` |g0e|g(|g Sg&Hy,NK.|g| f"H`$R`"`&`A^Jg/ //N L|N^Nu/ /`/,OH? n$hbVBBCBBBBf$~f8f4f0m,gf$BLN^Nu"~gZe~gF~g6Sgp`~gJ~ fr!AR`r!ARreR`~!GR`rgR`~gR`~!GR`/,O/$.B/. NX$.N^NuNq/,O/ n". ($R!B!n p!@!n 1A$Bh&$N^NuNVH?<(n&n .*.(<g(<Jjr0grr €-A$<@g$<Hr€-Agr0r€-ADjr&<@Df&<Hgr0gp.F ΀,F̃ FgBHx/Hx/ ENJgHx/Hx/ NHx/Hx/ N`JgHx/Hx/ NJfJg KBeFHx/Hx/ ENHx/Hx/ N -|-Cr@-A -KL// n N&Pg://./ j pX/Hy,NHy+NDrJf$ L <,.Hy;c@N6XGK$$<MD&<{V(<)2*<"4 F$hJf L<|N^Nu j *Jgh!@ j "*g *//NP/*LNHx /*LNIHl BNHl CN/*H DNJlgHy3Hy,NNK. F!@` jDJg Y%@D/(/NP/ ENX`L/,O/ / &n$n HxB/ N( JgL rg/Hy,jNK."+ +Jg:Jg Hy,NK.$%k %k%k %k J $n&nN^NuJg$`NVH>0(../N$H/N*P ;bgN)@$g,<,Jg,<,G&<+Jg/N&XHnHy*g/ N( E(Jg./.Hy*g/N*./N////Hy,NK$/N/Hy*P(HJg ( EgHx/N$PHxHxN$H"n !i!k!C!K!LBhBl!B@!l/Hy,/N - g/Hy,N/N ///N)#/N)2R `vJf/N)2X`|/Hy,/*HN( `b!L%D HnNr/+N)/<$B.PA`H/,O n /(/N,PJg"hN^NBN^Nu/,O/ /$n$. "R j "*Jg*//*//No%B%@$.$nN^Nu///N26 `NVH?<$.(n-T-B-l-n BB&y;c.<(b&<)/`x؎*<2^JfBHy?PN n LN/Hy;c N/Hy;cN$.$nN^Nu/,OH<$ 9?_"g6f0Hy?4NXJ?(gB?(Hy,yND6XHy?4NXJg& <*Ѱrg <+i,//Hy,NDr L<$n&. ***jHy?4GNXIMJPflJ`ff%y:,`Hy?4I6N/ N@Hy;c@N ( *ghHy;c@NHy?4NB`Hy?,NPHy?4Nt`,Hy?4Hy?,N$PgzHy?4N6/ N@P L<|N^NuR;bHy;c@NXJ9;bfpYfJ*?j mJg// N$Pf |e/ N4p8*.x؎pȀHx/NOx$HPBGIMJf/NO L|N^Nuf$*<f"/N$HX`$ /NXg/N$Xf` jp%@BHy+Hy,XHy+/GN$g&HxHy,BHy'/N L N^NuHx/.NR<$PgHxHy,BHy,X/NHxHy,BHy'/N(`/,OH8 (. &./NO$XfBHy,Hy+Hy,X/EN$gB/NR<$.&nB(*y;cD,<*Ѱ&YEI)/<*<+Jf*Jg^HxHy*Ѱ///N&L<|N^Nu/N.////NJf,/N.////NJf*m,`HxHy+///NJg`NV/ BHxHy?N{4BHxHxHxBBBBB/.BHy,Hy,HxHxHnBBHy?EN nLJgLHxHx/(HxBBBBB/.HzHy,Hy, HxHxBBBHy?ND$nN^Nu/,O/ $nHy?N%y;cD#;cDB Hy?N6B$nN^Nu/,O/ /$nHy?N$* XgHy?N6Xt $.$nN^Nu y;cD *f#;cDHy?N6X`"H hf#@`NVH?<&. $.pgSgHy,NK.pHy?ENX.<)/`(K(yG6*9:(y;cDJg8Jg"B// GNPJgJg , Fo, (lJgJf`(FJghHxHy,4/N(ydHx//NHy?NHx/Np .?NX:fnJg g$Hy?NXpLu#>vp#>v#>v#>v#>v#>vJ9;caf!P 9>v@@#>v#>u>vJ9;c`fB9>vN^Nu/,O/ BHxHy;cN{4HxHy;cXE2NHxHy;cTNB/9;cTND$$nN^`H/,OHn /.HxHy?lNDN^Nu/,OA?l N^Nu/,O y:,AN^Nu/,O y:,"( (@g pN^NuNuJfNP`/,O n;ca!n !n!n!n!Hp!@!H!@!H!@N^Nu/,O . 9;c` n@N^NuNVH8<$<>uJ9;caf$JgNH 9>v@#>vJfA`Jf` 9>vC>u I"(c "H hر>uf )@@#@@Jg 9>vg 9>v|E>u"J")@g ")c $I"iܳ>uf *@ f *@@%@@ J!J!J hܱf 9>v g(>ug R$I"i>uf!I%H!j"H$I%i%i$jܵf"ifJ9;c`g:p>vdHy,[NDrXJg.J9>vf& 9>vr@#>v` J`Jg 9>vf-|, -|,-|,p;chf L<N^NuJgEKJ9;c`g <*CJ9>vg <*C/Hy*;NPv֎I>vG C/&/,Hy>w(Hy,N*\Bx6؋HmhHy)2N*uLRPp@gvh/Hy>w(Hy,N `>Hy,NX`/,O/ /"n". . y:,$(R!B$P/Ӳ$2Հ% (S!@ (gB$$_N^` h$$_N^NuNVtH>. $pĀJ9;cbfHxHy>w8Hy?N)0 `8B@ D#bF$NE"&Jg( 9?h-@tN( .tfB@FL|`N^NuHxB/N( <>uB|ݹ>x"9>xӅ#>x Jg BC>w8 *,)ݨ"Ӆ *),) ݨ "(Ӆ!A*),)ݨ"(Ӆ!A*),)ݨ"(Ӆ!A*) ,)$ݨ$"( Ӆ!A *)(,),ݨ,"((Ӆ!A(*)0,)4ݨ4"(0Ӆ!A0*)8,)<ݨ<"(8Ӆ!A8@@fJHx/Hy?N)0N(#?hB@F`NV y;cHn/(8/(@BNp-@-A//N$N^NuNV y;cB/.Hn/(8/(-H-A -@N^`H/,O . ". nJl-H-A -@N^`J-H-A -@N^`H/,OH00&.&n$y:,HxHx/ j/(0N$fd *R%@/ /NƘ$Pf . f/./N$P *S%@ *g BN{XHx/ j/(0N L N^Nu/,ON^`R/,ON^`Ix/,ON^`I/,ON^`I/,OB.-@ N^`I/,OB0.-@ N^`I/,ON^`INq/,OH?0 n"n pg2m&tg^p"<&|xg$BL N^Nuzfp`p"<&|.,)$Ā&Ɓ( * f"#F`pr6|`аfWD`/,O nJg JVDN^NuB`/,OBBN^Nu/,O nJg N^NuB`/,O/ //. /.E}NP$gN/./.NPJg:b:e4 PRVTf". .n$m . ".n]ID$.$nN^Nup`p`/,OH 8$.&n&'n $nJfE3mlI)/`3mpe6A`$ jJf$j`/ //. /.NJg LN^Nu&Z g//NPJf k`/,O n"n !I!nN^Nu/,O/ / "n&n"#K#n !n $_&_N^Nu/,O n (N^Nu/,O n h N^Nu/,O n h N^Nu/,O n h N^Nu/,O n ( N^Nu/,O0|$ N^Nu/,O n h4 N^Nu/,O . rg(rg&Jf&p rr nNV-n-n n-hHN^` -@/,O n-hHN^` ~Nq/,OH8 .(. Jg"9;x y;|BlgXR`JfrLN^NuBJfdBN:XtHy?Hy? y?/08N y?/08N$Hx y?/08N y?B8Jg`Fv"9; y;BmJfJgpBN:`gXR`BA:JfZBNXHy?Hy? y?/0(N y?/0(N$Hx y?/0(N y?B(`BNX`BN:`/,OBHxHy?N{4Hy,6Hy?NM.N^Nu/,OH><(.&. &n*.$nJgBJg<&n(n &.Jg|Hy?NXBK)/<(<($;0lJpL$y;4,g/N*./ / DN Jfv3Xg0|p e^$*jHy?N6Xt`:;xl y;|J,gJg/// N(B48 Hy?N6X L<|N^NuR`R/,OH><&n(n &.Jg|Hy?NXBK)/<(<($;0lJpL$y;4,g/N*./ / DN Jfv3Xg0|p e^$*jHy?N6Xt`:;l y;J,gJg/// N(B48 Hy?N6X L<|N^NuR`R/,O//$. 3 Hy?NX;l4 y;J<g("9;0 y;4PBlCf. (j.vt`NHy?N6Xvt "$.&.N^NuR I`;xl y;|J gBHy?N6X`/,O//$. 3 Hy?NX;xl4 y;|J<g("9;0 y;4XBlCf. (j.vt`NHy?N6Xvt "$.&.N^NuR I`;l y;J gBHy?N6X`NVH<0&. $.prg8S NRd(GR3Jm, 9;x-@N( .n/NXt L $. &.(.*.,.-C-B//NPJg."hJg2-F-E-D-C-B-C-B L|N^NpL|N^Nup`NVH>$. &.(.*.,.-C-B//NPJg*-F-E-D-C-B-C-B "hL|N^NpL|N^Nu/,O/ $n/*,/*(NPJfp%@%j$-J"y;c$nN^N-J"h `NVH?$. &.(.*.,...-C-B//NPJg.-G-F-E-D-C-B-C-B "hLN^NpLN^NuNVH?$. &.(.*.,...-C-B//NPJg.-G-F-E-D-C-B-C-B "hLN^NpLN^NuNV". .-@-A//NPJg pF(N^NuB`NV". .-@-A//NPJg pF(N^NuB`NV//$. &.-C-B//NPJg$"hJg-C-B-C-B $.&.N^Np$.&.N^NuNVH?$. &.(.*.,...-C-B//NPJg.-G-F-E-D-C-B-C-B "hLN^NpLN^NuNVH0 &. $.-B-C//N$HPJgB h Jg:-B-C//NPrg$//*$N;bPJg-HL N^`&L N^NuNVH<0&. $.prg8S NRd(GR3Jm, 9;-@N( .n/NXt L $. &.(.*.,.-C-B//N PJg."hJg2-F-E-D-C-B-C-B L|N^NpL|N^Nup`NVH>$. &.(.*.,.-C-B//N PJg*-F-E-D-C-B-C-B "hL|N^NpL|N^NuNVH<$. &.(.*.-C-B//N PJg&-E-D-C-B-C-B "h L$. &.(.*.,.-C-B//N PJg*-F-E-D-C-B-C-B "h$L|N^NpL|N^NuNVH8$. &.(.-C-B//N PJg"-D-C-B-C-B "h(LN^NpLN^NuNVH?$. &.(.*.,...-C-B//N PJg.-G-F-E-D-C-B-C-B "h,LN^NpLN^NuNV". .-@-A//N PJg pF8N^NuB`NV". .-@-A//N PJg pF8N^NuB`NVH0 &. $.-B-C//N $HPJgB h0Jg:-B-C//NPrg$//*4N;bPJg-HL N^`L N^Nu/,OpN^Nu/,O/". t $N^NuNqNVH?<&n*n *.".&.(n +,$x ,~ćaEDrpgHy3\/NGNPEB <,d+g <,d///// Hy,iN(+8*+< $n-D-E//Hy,N JgXJl &k$(bH-t) B .ڮـ-l8BG(/././/N ./-D-E//.// Hy,N-l8BK(/././/N$&-l,B(././/N-@-A/././/N-@-A-@ -A-|,"JLJf^ AHh$ /HjN)/Hx/ /N)0Rj`\BJfJf @dgb @dg @dg4|`j Adef +fT4|`T d|g8 dyg d{fgHx/+HjN(yd -JL8(.$n *.Jf%|"*,p D6|Jf6|%KX D|Jf|%F\,*$ *f8"jA&* BG(4/// /N .B//N%@%AJf* * g$"*gL/B/*/*N(%A$G)@N&N$/*/*Hy,/I(N/*Hy,l/G(N *g?BgHy,*/N(F * g?BgHy,$Xg jl h JgJpf/ /.NhP *tg /N" X *pg\-@ jl h -hp/FB-@B-BN9|-HHnN!Zj&XA!EgBt/NX L N^Nup@`%nt`v `NVHxHxTHxBBBBB/.Hz.Hy,Hy,HxHxBBB/.N@N^NuNVH?< n . ,.-nI" t‚(ArftpfL&XgBBHnBHxB/BN",$ K!Eg$/N/././ Nt@ L< N^Nu np!@( .!@r!A !|3 /N"/././ Ns/NRpfJ.gdHy:IN&jl/+N$+`/+N4HnHk//Hj/*`Hy,HxNGN(.E6NHy:NPB`"k$ g#H'H$C$!I`jpr/Hx$N$HPJfX J L N^Nu/,OH8$n jJgI"&P"hJf@B// NPHjNMDHjN{VP*fHx$/ NPLN^Nu'I"h"// NP K`/,OH<<$n&n (n(.Keb// N&Pg*f HjNX"jBJf*/// / / N*f HjN6XB`Beз blgL* X PDf0//NM$Pg/N6X// NP L<BHy?(-@pNNrX .pJgJfp&`>p`8BB`t`JgHnx/ GNPJf@Hx`B/"EN// jNJfHx`/ //.$ FNJfz``$j`d/,OH<".(. *. < b SSg~ brrt bQ bY ?bUJmSv/Nr./NPJg0pgVeJf@"HpЈBf` t `B`Wg"nS" LHy,nHxHx&Y/BB/EN@HxHxBBBBB/.HzugJ9;cbf// NdPN%@8%A<`/ // HzHBNj-@-A//N$`p`NVH00&.&n$tԎpĀBBBHxB-|Hx/./+N@$JfHx`/.(/N)0 B$h4// /. /.//././. /.N$0f~Jgz$*@HxHnN2/*D/./Nz$fD/.NZXJfL/.N$@Hy;cNBHjN~$Hy;cN6/.NX L |N^Nut`t`NVH88&.$n$tԎpĀBBBHxB-|Hx/./*N@$JfHx`/.(/N)0 B&h4// /. /.//././. /.N$0fJg$+@HxHnE2N/+D/./Nz$f/.GZNXJf/.N&SHy;cNHx/NR$Hy;cN6JfHHxHnN//.ND/.Na$HJg(f0B/ N`X/.NX/.NX LpN^Nu/.N`//.N~/.NJf*GBI`춄lB/./ N$@ fR`t`t`t`t`/,OH80(.&nJg/9;cTNaXJgxpй;chL$@ /N`XJf&B L N^NubFHx/ N&/ /NR$f/ //N$ / /NP`t`t-`t `/,OH?< n". . $n(*($(.fLu$y;eBI(K(&<):p 2,-@N&nJgB,/+ SNNHk CNPRpfL< N^NuNVH0 .$n $rv\ 2,-@N( .f N(-C Ԋ-BL N^` L N^Nu/,O/ BHxHy?4N{4E;dHxB/ N($DHy+Hy,+BBHy;dNX,$nN^Nu/,OH00 9;ch&BEYG(;cheHx/N#;ePL N^Nu/NHxBHhNR`/,O/Hy?4NA;dXB"HJf(#.! /;dHy?4N6X $.N^NuRPp fHy?4N6Hy,/NDrPB`/,ON^`pNVH0 9>u-@ .g2BHy>uN($N(PvE;d DrJf L N^Nu FĀ/2 rNX`/,OH8$. .A>u&Jg //NPJf4//NPJg$Hy>u/.NB@F'N>B@FPLN^Nu/,OB/. /.N N^Nu/,OB.//9;cX/.Nd N^Nu/,OH><&n$n $p'@N(Թ;ev:|@*<(I;d,<`(/ B/"EN Jg.XfBrӬ(ـ((B FNSXf lփ`-J BL<|N^`/,OH0 $n&. /9>u/N/NB%@N( Jg-j"RL N^NL N^Nu/,O/ /$n. 9;chS%@N(Jf-j"R$.$nN^N$.$nN^NuNVH00tE(G` n (-@N .f L N^Nu&BNSXf lԂ`NV/ $nBB-|`Hy?4NB;dNv4BE/ N@/ NN}P-|?4$nN^`7Nq/,O//. Hx/9;eNp BP$PJg/9;eB/N( B $.&.N^NuNVH8B@F'BBI)0K?X;em,;eB;eB@FL<N^NuHxN$RX`$s(HxHp)?8/ N u( RX `/,O/ /$n . J9;efRB@F'"9;epm2!?X  @?8R#;eBB@F$$.$nN^NuHy,gNK.rF€/NX`/,O/ $nB/ N2/9;e/. /N)0$nN^Nu/,OH 0$n$9;eG Q$j//NPJfL N^Nu/,OQN^` T0/,O/ / $n&n N(HjN):xXJf$N(Jf-J$n&nN^`z%S&$n&nN^Nu/,O 9;e԰eN^`pN^Nu/,O 9;e԰eN^`Hn|Hx/Ng, .| r€/r€// Hy, NL pN^Nu/,O"n-|, 0N^N/,O"n-|, 0N^N/,OHy?xN):XXN^NuNVH<8&.(. $.$n*.Hy?xN):XXfpHx/HxG/ N>/9:,I>u// ////Hy, dGDrN,./ jNHy+N/9:,//////Hy, NK.L<,.(y?Hy?E{hNX&.GM ,g(G|vFK(<)0*<x"F )fJB`JgHy?N|Xt# L<|\N^NuHy?Hy?N$PgHy?N|X`",$,j$, d$Jg c$/Ht/ "DN Ь)@ k mBHy?N/// EN$Hy?NJg>Hy?N`/,O/ $nJf<%|3hHy?N{h/ Hy?N`Hy?N|B$nN^Nup`NVH80(.$n&. n(tԎpĀ&y?J?g( 0af (rg"r5gd4|- L N^NuB?4|`Hx`//N)0-k C B!I4//.$/. /.// //. /.N$@0`JfJf $ E`NHy?N{h y?$( &Xd&$hHy?N|XGJfENr`>d$Jg//?/ N$@ J?tg///BHxN`Jf؂ y?$(`4|`/,O/ / $n n pdT#?G 0af f *ko *kn/B/ N($0a%K p#?#?$n&nN^NuNV/ HxHxHy?N{4Hy?NcHy, Hy?NM.BHzHxNZ#?$HxHxHxBBBBB/.HzHy, Hy,!HxHxBBBBEN@HxHx5HxBBBBB/.HzbHy,!Hy+jHxHxBBBBN@$nN^Nu/,OJ:4f\J?gTHy?N{h/<BHy?N`J9?g/9?N_XHy?NPHy?N|PN^Nu/,O/$.J:4fHy?N{hXJ?g y? 0ag"B?J:4fd-|?$.N^`"( R!@Jm mB (f"h Bl (0RnB!@  gR`$.N^NuNq/,ONV#?N^Nu/,O/. /./9?NVN^Nu/,O/./9?NWPN^Nu/,O .//9?NWPN^Nu/,O .//9?NXPN^Nu/,O/. 9:,//9?NX N^Nu/,O/. .//9?NX N^Nu/,O/. /. 9:,//9?NYN^Nu/,O/./. .//9?NYN^NuNq/,OBHxHy?N{4Hy,!2Hy?NM.N^Nu/,OH8$nHy?GNXIML jgn0*2RA5AI6J@fB5|Hy?N n N$Hy?N5|Hy?NP GML jg*$RHy?N LN^NuHy?Hy?NP`xHy?Hy?NP`/,OH<$n(n Hy?GNXKML jgR0*S@5@f05|Hy?N6NHy?NBjHy?NP -|?L<N^`HHy?Hy?NP`/,O/ /"n I g gJgF$n $"HRg =fJg Rf @R  g` nR p$$_N^NuB`NV/ /$nHn/. /.N| Jg".C ng fB$.$nN^Nu`NVHn/. /.N4 Jg n N^NuNV//Hn/. /.N g$&.Hx Hn/N)- g n $.&.N^NuB`NV//Hn/. /.N g$&.HxHn/N)- g n $.&.N^NuB`NV//Hn/. /.N\ g$&.HxHn/N)- g n $.&.N^NuB`NV//Hn/. /.N g/.Hx&]/N$X JgB$.&.N^NuHx//.N)0 `NqNVH08$nI@G( *@-@$.&"p RfBg<"BA/// N f-n N( .0| %pL N^NuB`NV/"n )@-@". tg0| 1-@ n $N^NuA`NVH88$n *@-@&.$"pੴfB D LN^Nu0| "r-I(.gBRfBpᩄN(I@G(/// N g *@-@&.$ rRfBr㨄`/,O/$./.  @HhNPJg $.N^Nu/,O np А//NPN^Nu/,O n N^NuNq/,O-n B N^` b/,OH80&n$n HxHy;hNZ$+8Pd8&+ug@Hx/N-H-DP QJ9;cbf6//NP .g/./NP n n BLv N^Nu/,O/ / n $P$(/.NHy>u//N$.$nN^`x*/,ON^`x/,OBHy;hNZPN^Nu/,OHy;hNXN^Nu/,OH80$n$. JgHHy;h@NX&<;h@GMLJ;hLf jJg!j j Hy;h@N6XJ gvHx/N&P(<>uG(gBN6/ 9>vВ//N)0/B 9>vВ/NNN//*/ j N$/B/N//N///9;hN` p-@ -JL N^`6/Hy;hPNP`/,O n"n P< N^Nu/,OH 0&n$n $.N6 <>ug// 9>vГ/N L N^`|NVH><$.*n ,.HnHx //9;hNHxHx&<"CN$H !B!M!n !FJgHy;h@INX*<;h@GMLJ;hLf#:,;hL/G6NHx/"CN& (<>ug8/B/N(///NN6 9>vВ///N)0$NN/B/N(//NHy;h@NB;hLHy;hPNP y;hH%HgC!I#;hH%|;hH/NX J L<|N^Nu/Hy;hPNP`/Hz/N `/,OBBB/.N N^NuNV-n-n <>ug./Hn/.Hzd/. Nj-@-A//N$N^Nu/,O n hX/(/. /9;kN` N^NuNVHnr® p@/ n hX/(/9;kNJf n N^NuA`/,OH 0$n$. &jXJ*f*ug BN:X-B -J"kL N^N/,OH<8$n . &n"*t* fR jX$ ĨgBgu$s  R$3 (j%|3 3 g (CfB/HkNR0P3 g ,A䰬f:/ HkNR0P-BLN^`Jf //+N`/HkNR4`Jf / /+N`/ HkNR4`/,O/ /"n $.JgA "iBf B$$_N^Nu b $nЪ bRP`p`NVH8 nBBE(J&P"n )"+b\d"kJf("P)i "P%i "P#n P!n LN^Nub"P%I ) $I`'i #P Jf`"k Jge&P)K + "J(K`'i #P J f`|/,O/ / &n$n JfB B&A $n&nN^Nu/ / N S"* (Pbd%h S%H B`%h S%HB `/,OH 8$n&n JfG K LN^Nu/ / IN RP +f ($( Jf$`$/ / N R!B P`/,OH8$n&n (nJkfS *@H SJg!k k *wg( +"*Dg*/// /*lHy3Hy,"NK./ HjN,P T&g!K('LS<$n$. Ix/ GNXKn&<6(z|ڊ,<ML *LPfJdfZrgJg,HjHjN PJg/*Hy+HxNGN R/ N6XG K L<|N^Nu/ CN//*h jdN/ N *LPd"jJf:// NPJg\VgVJfN`rp/ / FNP*sf`0*ug>AB&H(fR`&JDf ppJfPfXfTfRSvƄ&ЁL* &@B0)SHRLJif.S QJg!i i j"g!I%IA#H0)R@3@@f: QJg!i i j "g!I%I A #H *%@f%jR *H,e "*<4d/ NpX/ N6XJBjd/*B/ N( `Np`&iJf/ N6/*lHy3Hy,#6NK. SJg!k k `/,OH8<$n(. "*pvƄ gNJg*KxI|GML/ / NP*rfpL<N^Nup#gx/ N6/ NP` @ %@pJg`HjxN6X jX// PN$Pg&*wfD//*N&HPJf2// NPJg HjxNXjrp `jA`%Ap`&HJg HjxNX&*$ j&g!K%KA'HB'BBkN'A*wgr'jDR *(7@j7@"Ҫ%AoB"*@ӪH*ufD BQ BASd`>"k g#H'HC!I `/ HjNP`pЁABm:Jf%K *fD/ Hy?@NPRJf L<N^Nu(//, l -IN// NR"nP`/ Hy?0`B`NVH0<&n$n *n(n$.BrӪ&*׀%CHnHkN"[IӪ,&*(׀%C(&.Pg(  3 g //*NPS0$pL< N^NuBrӪ$&* ׀%C /.N// N$H* g$///+ kN Jg/ / N PBPB`Jgp(`/,OH08$n(n Gx/ N"*@I X& LA0LA%@48eR%@8I *<4e-KL N^`>Hx/ NP`/,OH 0$n$. Gx/ N%B,XHb *<4d/ N@X-KL N^`/,OH 0&n$. Ex/ N'B0X-JL N^`/,OH08$n(n &.$.Gx/ N%LP%C%B[I%@BBB"*@I X& LA0LA%@8-KL N^`@/,O n (N^Nu/,O n (N^NuNVH?<*y;jBBI(4Jf r LuNPJ:4fHy?,NX&y;hI)/`Jfz JfB y;h%H #;hJ:4fHy?,N6XN(%JL N^NuG``0|>"<?@ <;k` <>ufX`b/*l/+lNPJnv&k`j%k%K k '@`z/,O/HxHy?PN$Pg4/.,/.(/.$/. /././././. /./N,, B $.N^Nu/,OH0<$.Hy?,GN$y;hXI6K&<PJf-|?,L< N^`RHy?,N/ /NHy?,NSHy?$ CN$j`/,O/ /$n$. *g BN:X//* j NP-B -J$.$nN^`NVH00&n$n BrӪ$*Հ%BHn/*NPJf.J?fHx/+N-HP nJg B!k$.gL 3 f%BpL N^Nu  3 g$/HkN"[IӪ,&*(׀%C(R0P$`BrӪ$$* Հ%B /.N/./ N. B`NVH0<$np;chl J9;cbf/ NXHy;jIN// G.NHy;kN// NHjN// N$$&< CNK>urFҕ r0/N4HjN// N$ CNrFҕ r4-@L< N^`B/ HzBNp-@-A//N$`NNVH88$n jdJg Hx/*hNP *-@ .g /N/XGx/ N}VXJf BLN^NuBN$ j&QIJf / N6XJgHn/ NlPp`( *<"*4d"B;he "jH@,eSe/// N D`/,OH <(nHy?,GN 9;j y?0XEJfJgj @$H PJupFЕ"t $Q *g<"S%A&2Jg&Brө()ـ#D/NZX C L<N^Nu iJg#J"`/. / Hn// / NtJf&.`/,OH88$n&. (.*wg jX //// N`N$I>upFД r "P")d0R###ABrӨ&(׀!C-BLN^`ې&h +d!I `//// NJfLN^NuNVH?<$.(y;j.< (Jf Lrgz 9>r-@&.gJfDp(///Nh JlgB/Hy>rN( Dg<gJf `ffDg&Jf|-FLN^`pfVJgBJgpĀp gpg /NXJgJf`pfJfJg/ y;kNX`Jg`DJgB`:LN^Nu/,OHxHxHy?TN{4;k N^Nu/,OJ9;kgHy?TNXN^Nu/,OJ9;kgHy?TN6XN^Nu/,O/ /$nHy:NX*[g< j h$( g/N j$(XHy:N6 B $.$nN^NuB`/,O/$.gHy:NX-B$.N^`r$.N^Nu/,O/N8n$9?PB?PN8 $.N^NuNVH?<*n$n&np fDJg@-UBB n %gdJf*r fJg* y;k N .LH[I`G`pJjG.),rfB`g&I.B` ff&I g.`gB>`&I.Br-|36px-@pf>B(Np n0 r"@ ",. f`r&I([JfI,&rg2/B/ N( Jg*-Hඈl-C&.jBB`F/ N)/`-|3%`g &I.B` ff&I g.`gB>`pBB"fJf (N`JB`p`Hx B//N(0Hx B//N(,."L`Jf~` R-A"l".Ӯ-CJgr f*Jf f.&Jo$p ffJgrSJgJeBJf(.ИJo$r f\JghSJg@e8Jf&.֌g(p fTJgb RJg6e.(@fDf$Jop fBJgNSJg&eJf`"o"Ӯ-C` Jf2BJgFJgd`/ /. Hx N S`/ /. I/-@N .`0`/ /. Hx0-@N/ /. /.N`0Jf`/ /. Hx0N S`x0Jf`/ /. Hx0Nx S`(@f`/ /. I/NP R` Jf`/ /. Hx N* S`/,OH 0$.N8nG / BBHx/E9fNJ?f/ BBHx/NN8N.L N^Nu/,O y:, h([g. h"hJ g Hn B h/(Hx/.N9fN^Nu/,O y:, h([g. h"hJ g Hn B h/(Hx/.N9fN^Nu/,OHnB/.Hx/. N9fN^Nu/,OH 0$.G / BBHx/E9fNJ:xg/ BBHx/NL N^Nu/,OH0 $.&. /BBHx/E9fNJ:xg/BBHx/NL N^Nu/,OH8&.$. (.N8n/BB//N9fLN^`/,OHn/. /.NC N^Nu/,OHn /.HxNC N^Nu/,OHn /.HxNC N^Nu/,OHn /.Hx NC N^Nu/,OHn /.HxNC N^Nu/,O/. /.HxNC J?fN^`xN^NuNV/ /$n$. A(-H/./ HnHx/.N9fJg JgbB2($.$nN^NuB2`/,OHn/./. /.NDN^NuNVH?0&.(. ,.E r$@Jl`BHxHxN L N^NuBHxI/N `Jg~ f.p#;k///NH g-CL N^`J;kg*  f$9;kjtB;kB/ N2 *X"~lfrmj҂Qf~ LG~]I///*/Hy,&#Hx@E/ NE$G𨺂m(B;k`Jr l#;kt `~ LGR`B`//2XI/NR `/,O/ N8n 9?L"R#?LBHx r0 3 I/EJNBHx HxN$nN^`/,OBHx ./N N^Nu/,O/$.N8n/NGX$.N^`B/,OH 0$. N8n/.NGG/ BBHx/E9fNJ?f/ BBHx/NN8N.L N^Nu/,O .". AGNg//Hy,&2HxNN^Nu/Hy,&JHxN `/,OH0 $n$. &.N8n/ NG/BBHx/E9fNJ?f/BBHx/NN8L N^`/,O/ /$nJfF4|BN8nHxNGHnB// /. N9fN8N.$.$nN^NuJ g/*NXJg$*4|`/,OH8&. (./BBHx/N9f$RHx/N"n"////NDLN^Nu/,OHnBB/. /.N9fN^Nu/,ON8n/.N/BBHxHy)NHnBBHx/. N9f,N8N^Nu/,OH8 $.(. N` 9:gfJ:,g^Nv4Hy>uBHy?N( Jg>ugE-Hx NX` y:, <>ug 9>vr#>vJ?f&<J;kfvp#?J?g y? 0af#?N8nBBHxHy,&ENJ?f#?//HxHy?NDHy?BBHxHy+i+N#??$BBHxHy+NN8J?g y? 0af#?N֨B/NDHy,&]NDrX`/BBHx/N9f`/,OHn /.NI/,OH8$.&. (.9?_ gFN8nJg/BBHxHy)N/BBHx/N9fLN^`LN^Nu/,OHn /.BN N^Nu/,O/.NHn/. /N^N^Nu/,OHn/. pЮ/N> N^Nu/,OH<&.(. *.9?_ fRtN8nJg/BB/Hy)N/BB//N9fN8J?fLydX-KLN^`*LN^NuNVH8<$. (. n$hg& D/G{hN j(X*Wg: (e2*hI/ / /B-HN(42HAtā ne-CL<N^`+JԨ/I|NHxK/ /NhJg/N/ NGd/N L<N^NunHx// N Jf`/,OBHxHy;kN{4 N^Nu/,OHxHxN N^Nu/,OHx/.NPN^Nu/,O/ /J?fE;k@J9;cbfBrӪ$Հ$$.$nN^NuHxN:Hy;kNBrӪ$Հ$P-|;k$.$nN^`/,OB@ @ bF!R>uN^Nu/,O 9>u"S#>uJf Hy,&NK. .B@FN^Nu/,ONuJgJ>uVIDN^NuB`/,OH0 ENVN&J>uWDNgtL N^Nu/,O/B0. "0 ::B@ A&bAdF$N^Nu/,OH0 &.$n ?*UN$/* N PPJfB/* N*B@FL N^Nug P`v`/,O/ $n//*NPJg|$nN^Nu/,ON^Nu/,O/ /$. HxHxN$HHxNL%H /Hx/ N{4/.HjNM.5B.Nr%A J $.$nN^Nu/,O/ $nHjNMD/ N{VHx/* NdHx/ N$nN^Nu/,O n B(N^Nu/,OH 0$n&n?+UNp$/+ N$ %n %y:, %|>u/+ N*B@F L N^Nu/,OH00&.&n $n?*UN$/* N"PPf. /* N*B@FXJ+gX-JL N^`^ I"Q`L N^Nu/,OH 0$n&n?+UN$/+ N$ n %h%y:, %|>u/+ N*B@F L N^NuNVH<<&n$n |IKp$<$&<( X*<M-J-KB.J9;cbgTB/ Hz/*N-@-A// BNJ.f BL<8$n(n G r&@/N2$&+((+Xj BS;Hx/ / N)0 "* *,fm BBBBL|N^Nu*,o$%A$*%Bjvx؁׀$%D;%B/ NatX`NVH<<".(n E t$@&@$gHy:KNXJf. y:,&h$<6Jf(Hy: BNXt L<Jm hJf8Jgt"9:A $L<(B@ЂLAR c <L <r$+Ԫ ;^I[I҃тfT`\DL "n n ")$&(Jl>JmV"i]I[I,<ՆfS`_DL|N^NuJl(<SfT`\`p`NVH?<$n*n &nBBB nB-R-j .fJg(***$&-,.f.*^ID-@|f/ I^NXJgHjNXJg/ NXJgI(4/<;B//N&-[IցՀ/<;B//N**[Iځـ/<;B/./.N.*[Iށ݀E(// "//N @"A"I(JgJfJfևՆ/<;B//N&'A/<;B//N'A`fR`^`/ HjNbPJg,...ޅ݄&'G *Ъ'@ ;oBR݁&'Ge6'@ "+,.f.-]IDgL nT 4-@ ."fd r) -@ .R(/ NXX`,`B/+ Г//.Nr`./ B/"GN Jf>`Dx(؁////NJg/ / N D-hP`(MHxH/ "ENPJf/ / NPB`d*@HxHB/ N(* +@ Jg .R-@,/ D/( А//.N$ŕ~΀ r GT+ -@ .R*,. -@N(T)l/ N(//HnNN-@ g," tT+ -@ .R*(M`NVH?<&n$. &.//Hkzڎ/NHn//// N$H$JgH,.T 0l-@ .(<fg""~(@Jg/// /N^Jf/ DNXB B L.:.. cgB;kE;BG)/ b2p bQ bY ?bUJmSN^Nup `B`/,OH8&n$n *"+/NX @CpЈ"ҋ s %HgI!L 'h%A LN^Nu/,O//&.$P/N/NP-B$.&.N^`^/,OH0<$npTeHy?IN 9;kXBG;k y?JflJg#;kHy?K6NX$ P&<pTdJ;kg*P/ N/9:DGJN/9?N/9;kN/ NBL< N^NutTe*If"hJg#h "h "Bh"jX!IgK#M %HXCX!I RTBtի&ׁ&Sr`*/NHy?NHxHy?"CN&HHy?N/NJfpTe(p `VBk jX'HgC!I %KXAX'H RT`/,OH00$n$. &GppTeJg* jX"hJg#h "h "ST L N^Nu/ NXJgf"Nr*HjHxBHy,*iNt`A`/,OH88&n&. $.(.// IXN$HPJg// NPJf/ / NPp LN^Nu5n%C%B1|!C!BB"kd%I"'Jd"R g#H$!J// NիPB`'Hd`/,OH8<$n&n + S kJg!k k 7|(SJg: lf2 lJg!l l / / N| ,ѫ/ / N2 k h(PJg@ lf8 lJg!l l / / N4 ,ѫ'l/ / N k h(PKPJPgn lff$+f\(+/ / &<Z CN/ / GN/ / CN/ / N.NHx@/ Nu`B`/,OH0<&n$n *n/.Hx/ N{4I & X/ /NM.B A %HBB"+ҁp€ kp?mpp ЊC(JgB// Hy,// Hz/ //N$$Jg/ N{V/NMDP L< N^Nu/ Hy+i+// HzB//N$ `/,O/ n$h/ NB HjNP/ N6BN/,OH80$n$. / NX * :,g> j JfH$*&*BBrƒ(g ( XGML/ /NP *"*g-JL N^`ff/ HjNMLP` P`/,OH><*n y:, // NP$H- gN / INX$ X*<ML(<6&<P&j JgLB A %Hp/ DNX &S/-/ UNPJf/ NBrӪ,*݀%F/ CN`/ / ENP`/,O n( fB`//NLP-HN^` <>ufN^NuNVH 8&n&* <>ugf// NP$HJ gT-H/NB jC %I$ X/NPPIMLJ fuf n B`/,O/ / &n /./.NP$H/NB j %KHjNPP-J$n&nN^`~/,ON^Nu/,OH<ugDB>u&y;mL&9;mP(9;mT/N//N/NBrӹ;md&9;m`׀#;m`` 9;mX"9;m\&9;m`(9;mdf Hy;mD ENXHy;m@Hy>uNP`x/,O///9;m/9;m y;m NHy;mN 9;m "9;m$BRт#;m #;m$ $9;m&9;mfHy;mNPX-|;m$.&.N^`}n/,OH<0$nHy;m@NX$<;m@GML 9;mX"9;m\&9;m`(9;mdf# ;mP#;mT#;mLJfBz۹;lD&9;l@ׄ#;l@A>uJg0&9>vDj&ځـ#;mX#;m\z#>uHy>uNPX$y;mX&y;m\/N6 " L fL&* g/NX R *Jg,!@ j /N6XJg( n BL<N^Nu k0!(`$R`/,O"n n JgJfp`JVIN^Nu") (bUID`p`/,OH8&n"n iJgp g SB LN^Nu$h(Rf(jJgp fB B p%@ "J`f((Q!Lg)H(h#LgLfB("!I "H @B p%@ R(h$g)J(j!Lg"f(!J%H$I`)I`&`)H`&`Jg p glf*(i g)H(h#LgJf@(#H!I "H @B p%@ j(P%Lg)J(j!Lgf( `z)I`&`)H`&`/,OH8&n n $nJgJ fg"Pf"hp f2B !@ "h$Q!Jg%H$h#JgBf8$"!I"h(Q$iJgJ f&JgJ fZp#@ ($H @`~%I`&`JgJ f4B p#@ $Q(j"g)I(i%Lgff\(%I#J"h#h B "iJgB "h$Q!Jg%H$h#Jg.f$$"!I$SJgB LN^Nu)J`&`%I`&`p f4B !@ "P$i g%H$h#Jgf$#H!I"P(QJgJ fR$iJgJ gJgJ f6JgB p#@ $i(R#Lg)I(i%Lg\fR($#J"P#h B "QJgB "P$i g%H$h#Jg,f"$#H`%I`X&`R)J`&`%I`&`/,OH0<$.(n $lf"&l&, Jg%KJgιf&`Jg*J$RJf$m&m&- Jg%KJg6f,&f&MHx/ / N)0 l JgZf `'J` B `!M T!M lJg!MJg K hJfJf/ / /Nr L L< N^Nu B`&l&, $@`2'J` B `/,OH8(n$n JgDG$/ N/ /,@NHjN{VHx(/ N-KLN^`l8LN^Nu/,OH<(n$n &TBAKJf4%HBBr%A JgDJl: / / N P K L<N^Nu/ / NPJl" K&A`Jg"+`!J`(`/,O/ / n$PGNJf J $n&nN^Nu/ /. NPJl$R`Jg$j`/,OH 0 n$PBG Jf$B J L N^Nu/ /. NPJl $ $@`Jg *$B`/,O/ $n"jJg I"QJf $_N^Nu jJf J  hJg䰨g`ܵf`/,O/ $n"RJg I"iJf $_N^Nu jJf J  hJg䰐g`޵f`/,O n"PAJf N^NuJ l  I"@` )`NVH?<$nC$-I/ KNX* G6J f/.NXB LJg *//NPBB B/ N6X-JL< N^`  A&PJg B/ N +S'@Xf/ N/ CNPR`/ NX`/,O/ $n/ NHjXN/ N6 -J$nN^`z/,O/ $n *Tg /NBTX/ N/ Hy?N P -|?$nN^` LNVH00BHnHn/. /.N$f $n&.Jf JgHx/NPt L N^NuG6p8g/ NXJgHx/NPt` n @ *Tg /N.BTXB"B#A `$-(f8p+@B(B$/ N6/N/ N| "U -Jf %@`/ N6/ EN/ N `#@"m"SB"j+I"%MR/N6X`@$-$gB$x؂*</N"B iXJg@"hh (lJg,#@l"hl"h"BS$/-HN6 n/ ENP`"B#@ `/N6// N `r%@`Jg#@"m"S`%@`NVH?<(n &n n$h*j tԎHx(B/N(( --@ n d pLJg*(g$j8Jfp&BL/ N mhX -lJgJ!@l ml hS(B-QpW+@&.(.$. ,.*./NoXJgD"h "i8Jg4/.//-B-D///N$/No$X L|N^Nut-`t `/,O n /(/(/(/( /(/Nv n BN^NuNV/ $nBHn/.N Jf $%n$nN^NuNV/ /$n /*$Q//.N JfHx//N Jf nB$.$nN^Nu/,O/ . n"n XBmB$N^Nu")$) !A!B )gt `"gSgR@`r J)j `t`/,OH<8(.BBGoIo$g Jg e L8*.(. &n&."3|̃I fPp,.Rpm>$EBIfB` gRP`//*/ //NJgL|N^Nup>`p`NV n "Jf$@-@/.Hn/.N. N^Nup`NV\H?<*. &.$.*n r€$ABhBl-|\pBt/IoNXJf p L<4N^NuGo$x(f2/N/NPJg|(f* h (~eJg/NXp`/NXp`[g/NXgxgV rzFfrJl| DjA@ gAxAȀg$B%AB BBB m"m %H %I$%C,[I%D(%B4[I%F0xA@.gJ ~!G!AB BBB,-.- !F !G$!C,[I!G(!B4[I!A0@R"Ef B| !FB BBBR?ޠf~g`pf///N JfrHnhBBB// //N@ r-fN`B J`&///N `0BB///KNUgp`BHx///NUf/NXJg,((/NXYfr n h h -hd,.dR/BBIN"R.Hx/K-@`-A\N&H/ .`/HhN&'B,.dP Hx/N$B//".\// NV//I-@`N ./ NP .``NV/ /$n tԎpĀpgBHx//* Nh Jf//*/*//./.Nb$.$nN^NuB`NVH<8&n&.*.(. IHxHy3L/ N)0 S @dd$k/NoXJgCo$p(f8$n &ntԎpĀ** S ?b&* gHx//Nh Jf~&(*gHxI/ /Nh Jf\( ,Hx/N$////// /.N$Jf //*/N //-@NP .L|N^Nup`/,O/ / n$h/ NX *ptg|xHjGPNHj NP-J$n&nN^`;8/,OH00&n kd$h. g,$*h&*l'B('C,prfSID L N^Nu/ N$*h&*l'B('C,prfSID.N6X`/,OH 0&n kd$h. g($*h *l'B('@,VD L N^Nu/ N$*h *l'B('@,VD.N6X`/,O/ / . &n n$h @fg f~g> @fyg:p$n&nN^Nu/ N *hlVD&.N6XB`B`/,OH8&n kd$h +gSg@pLN^NuI <3'@h'Jp/ N/ / N`/ N6B`I@ <3`/,O/ / &n kd$h/ N/ Hj@N` -J$n&nN^`90/,O/ / &n kd$h/ N/ HjN` -J$n&nN^`8/,O/ / n$hBHjGMDNHj NHjGdNHj@N/ N{VHx/ NB$n&nN^Nu/,OH <*n$n &mHxB/ N(/ N +h"+l%@p%Atr%A%|Bx%||tPHxHkHr(I)0NHxHr(Hj`N(HxHkHj0NHxHkHj@N/-N4%@/-N4%@ .N6BL<N^Nu/,OH> &. n$h/ NtAăXg *hlfHj/9:,N`(PBpDf&*h(*lz|b/ N6 L|N^NuHj@/9:,N`(P`NVH?< n&nE r$@vd"(h&( / Hx/Nx$ f(**prg/ NXrƁ| ܌KM lh"ll "*xz.eP&( ؁׀)Ch)DlHlNHlNP/<HxAHlN`/ N6 L8 n&nv֎pƀrd $h(( / NXtȂ* XIM *h"*l$gjJ*ygxzځـBr C !A%Dh%ElHjNHj NP/<HxHj@N`/ N6/ Hx/Nx$$`Jf`J*xgt/ N6X L|N^NuBrӪt$*pՀ%Bp/ /N$prӪt,*p݀%FpPJ*xgJf`Jg(`t#`BB`/Hy;mN$Pg8/Nz&XgB n Hy;mN6 $.&.N^Nu/Hy;m`B`NVH<&nKI( +-@$nHj/ / N fL<N^Nu/,O/$.J.g /N XHxB/N( $.N^NuNVHn/.N|PJf". WDN^NuB`/,O"n n" be )"(bUIDN^Nup`p`/,ON^`/,O/ / n . JfJgNr$Ҁ-A$n&nN^`1lE$Jf-J`Ⰸg6|$Cc / NX-K`/ NX`$n&nN^Nu/,O/ / n . JfJgNr$Ҁ-A$n&nN^`1E$Jf-J`Ⰸg6|$C6c/ NX`/ NX-K`$n&nN^NuNVH?<$nI$<(K( *-@&npf4Hy;m$< BN/ N):xPJg-|;mL/./KzNPJg0(EJghJ fbG/ /.N\&Pf$*&* D*֨Յ%B%C *Ш%@ ;oBzڃق%D%Ee6%@( Hn/ /N& fBHxG/ N{4Hy,/*zڎ/NM.B-GB...t$ԇ/IN/./N K6Jf4/NXv# .g/NX/NMD/ N{VP L(Q//G|NPJf( .Jg*_f$HnHxHx/HxN0L<<$n *gZHx Hn/Nh JgL j"*[I-@-A//Hh"(`[I-@-A//.Hy,/ANDrL<|N^Nu&ntĮxȮ&<B@IK*<|,<}6WNg~BCSjD j"*[I-@-A//Hh"(`[I-@-A//.Hy,/NDr`8gB/*Hs(N B/ / ENPJftĮ FN`zJgJgJgt/ N6 LN^Nu ֪ՀJg()C.g$%CB` j.(BևՆ`/,OH>8$n,.(jG/ N n "(XJmt&.BցՀ*,B "nZpgg n(gD j/(NN"j n  n$ np XB/ N6 L|N^Nut`t`/,OH <(n$n &lK/ NHxB/ N(/,N4%@/,N4%@ %ktBp%|pf%|HxHkHj`I)0N$ 0Hx/HjPNHxHk Hj0N$Hx/Hj@N/ N6BL<N^Nu/,OH08$n . (n&jrg$vgzrfHx/ / N( B`H/ N +tĀXf""ve0DkDj kv e '@/ N6X L N^Nut`t`/ N(/ N6P`t`NVH?<$n*n &n(j/ -H-IN "-XJm*,B$&l'@'A HxHx"lA.+B$& "o$&// /,N$.g +"+ *+AHl N/ N6 Ldt` *&ng$Jf:HxHnHkxN)0 n ( '@HkN6/No$P`|t`NVH8$n HnB/N Jf>(nGHxHl/ N)0HlN6/No$Hx/*/ N LN^NuNVH08$n HxI/ /*Nh$ fv&.HnB/N$ f\&nJgHxHk/ N)0 +DfBr'@HkN6/No$ *PgHx// N$ L N^Nur`NVH?<&.(.(n C*(HxHxN&HBHx//. Nh$gHx/ NP`HnHnNt$Pf4|Hx/ N$HP/ Hj/. Nh$ g0/ / N,P L+fnpxfdHxxB/N( E!j|p!@!j(B R$HjNPBHxAp(Юx/N` .xX/E6N/No$JgHy:NB//NA(Hy:N`p+fJgHy,1Hy,1Hy,1N$y;m(Jf $n&nN^Nu/*$/* /*/*/*/*/ /Hy,2N$j$`/,OH8&y:,$k j /. hhN0*X@HX @HfPHy:IN0*X@HX @Hg-|:LN^`z/*N/+HxHxNDLN^Nu/,OH0 $n$*N&gPHy3 /./*h/./. HzDBBp@//// NI$0g /NX L N^Nut `NVH <(n&n *lHxHxN$H m /(d/ /Nh$f*gHj$/ N$$Pf*gp PBBr-AHn/Hn/+/ / N*$fTHx/+ ./N$ f&/+/.NAP L<N^Nu `/.NNXHx/ N`t`/,O/.NNBN^Nu/,O"n n BN^Nu/,O"n n BN^Nu/,O n -P N^`!/,OH<<(n*n $l/*N// &<=d"CN&H Jf/*N6Xt L<Xfpg ,Pg/ N?/*N6Pt `/ / NA"$PfPx؊*<M/*/ ENPJfF// "CNPJg< +P$Pf&r g$f/*N6X`Lt`t`/,OH 0 n$h/*N n // N=d$ G6f/*NXpL N^Nu/N>/N?/*N B`/,OH8 n&h/+N n // N=d$H I6Jf/+NX4| LN^Nu/N> *P"%APXr g/ N?X4|/+NX`Jk/ N?X4|`Hx/ N>PE`NVH08(n$n &l/+NB&Y/// NRf$/+N6Jf *gHx//N$ L N^NuNVH <*n(n E r$@$,p?e&mHxxB/ N(%Br%A%k` /-N4%@$%TpHy:IN/+N/*p/ N=d Jg6Jg / / N8PE/+G6NHy:NP L<lN^Nu4|`4|`/,OH 0$n n $&j/+NXg// NB$HPJg\p gT$*(fLR)p fBB/ NG L N^NuHkNPX/+N6X`t`t`/,OH>< y:,*(NRd$$nBBGIT^K| f/NR L<|N^Nu//NPJg8 3 f,(Hx/BN/NR`C?p f /NXx`P/NX`NVH> ,. . &.x؎rȁf@JfjBB$y:,/ N> *P"XgL%@P/ N?Xt%`"JgBB/Hn///N_h$g L|N^Nuz"`HxHy3 Hy,2?/ BNUBHy3 Hx/.NV$$pg"r#fJft<`HxB/N( `tJg///N^ `xNVH8 $n x؎pȀ&*gHx//Nh$ f"&J f&//*/N14$ * f" LN^NuHxHj N0$Pg`*fHx//N `/,O-n p-@ N^`NVH<0&n *+Jf n B L $*%K/ N?/,N JfB`Hx/NP`NVH <(n $TJf n$h y:,&h/+N/ / N=d$H $<6Jf/+ BNXpL<N^Nu/N> *XKf6B./ N?/+ BNB ,rdp//,/ Nż`Hx// N(yd `NV/ /$n pe2$Y/NCXJfHx/*/N $.$nN^Nup`Nq/,OH88 n &n&+gd(Qf`(h$l0 *oR(+ / NdB/ / N@$fpf/// Np / N,X LN^NuB`t`/,ON^NuNqNVH?8&n$n $. b(*** "B,.bx&*HnI/ / nN Jf@/ d$/HtXNx Jf"~fp f$/./ / nN BB LN^Nup`p`p`/,OH8&n$n $HxHkHjI)0NHxHkHjN +A$f"HxB/N( %k8LN^NuHx//N(`/,ON^`/,OH8$n&n (nJgt Sglpgd/*N/NB/ / N=d&I6f/*NXpLN^Nu(Rg/*NBXp`/NBx/*NPB`/,O n(RWIDN^Nu/,O n(RWIDN^Nu/,OBN^Nu/,OHyHyHxH/./. NN^Nu/,OHynHyHxl/./. NN^Nu/,OpN^NuNq/,O n /./( /(/(//.Hy;nN=|N^Nu/,ON^`f/,Opfp-@N^`LpN^Nu/,O/". . tĮft-B-A -@$N^`䋘p$N^Nu/,O .g SgpN^Nu-|3 $ -|:<N^`I-|3 $ -|:<N^`I/,O fN^`䋶pN^Nu/,O". . f-A -@N^` pN^NuNVH?<(n"n &nnE r$@-k*k -MA$p%@ +*B%D%E %M."Steҁ2;N D DbBJ.gD%y:/ /./ N5p. Jf,* `/./ NPvf>x%D`B i"(-A[I-F$.&.mL-MB$.&.(.*.o%A *-@'@ ()Hn/ NPJg. L>88nTnDn ^..x >8888n p p p p,Rr-AD` .T *ZgDt HxxB/ N()B m)h` /-N4)@$B*/ / N8*`5|  xt ,S&ŕr°=:g&BB/ N=P|fJp gx`>-BXtpAX-Hhr-Al-Cd-@`Hx/Hn`/.T/ / N|.fJf"n "XB` Bp`//(`/"F QN. fJlf~`B///.T/ / N.f///"F iN. `(.TJf Hy:@Hy:PNuPJgvG`J bHx BHhN&H///Nh.f:B3(Hy:@Hy:PNuPJg/ / y:LN.Hy:@NuT Jg"BHi/ NPJDf .Tg /NBX/.HNX`0*X2A(<|fRJAg(/ DN@\-BXXJl gD-BX`^@5@X j / hTN/ "DN@\-BXP`JAg@5@X j / hTNX/ DN@\-BXXkfp f,Jg/.TNB/.X/ N=d-HT fR~`BXr?m* j|JgR (Pg\ h`BX|?m` gD-BXp g`/NBx nT$(PXg~ ` nT$(Pfx`BJ:gJgrff&*|,<Jfn nT (fr f~Hx/ FN.PfF .T *ZfT5B JfJg/ NPX.`//.TN.Pf` C (//"FN.Pf C&(`jp//"FN.Pfp f~j?XBBBB *lgJf 9?_// NPB j|Jf nTh`.h h`/N?X`-jX`-j\d`QfHx$`//Nh. f(.`/.TNB/*NPJfF/ NCVXGC.-HTfXB`Bd .Tff/*N6Hx//N.`$// N=d-HTPf/*N6X` h`/NX nTJg(Rg h`/NBx nT"(-A`X(Qg p-@d`t *gJffJHg^r-Ad`T/// "F iN. fp?e|Hx`/ HjHN)0%l`Hx(BHl`N(Hx`HjH/ N)0)j/// "F i N.$`/HnT/ N7.. f/.TN>X nTpfQ/.TN?X` (P!@PQg|!F ` Yr8eB//HnT// N.` Yr8eHx` Sf(`HxB/N(///Nh.fN 9:@F` 9:DFd 9:HFh 9:LFlHx/HjN)0`^ Sf"(`HxHj/N)0///N`:/HnT nT/(N7.. f .Tr"fv~/N7XJg F&h(tHHn\/-N.Pf~-C`-BdA`(p)@BB )B)D)n\/ /.T/ N./.\N,`r$f~/N7XJgD"F&i(tl`re^`.`z~`pNq/,O//". . Bv f .QfrVIDЀ$&N^Nup`/,O/".J.g TtdJo?b y? BJfp`B$N^Nu/,OH0 $.Hy;cENXpf y:,$(B/NP&gHy;cN6X L N^Nu <>ug>ufB>uHy:N y:XJfHHy:E6N?Hx y? /0(N y? B(S?Hy;cN`fB h`NVH0 $.BHxHxHxBBBBB/.BHy,2THy,2jHxHx&Y/BB/EN@JgHxHxBHy?BBB/.Hz\Hy,2oHy,2HxHxpB/B/N0&.tԎpĀHx`/.(/G)0NC B!I4-y?//.$/. /.//././. /.N$0fJgJoN*.o,Hx/N(Hy;cN$y? &9? c J f8Rf// /N#?#? Hy;cN6// N`Hy;cN6//N tNr L |xN^Nut`t`/,O 9:`r cp #?Hx/N#? B?BHzjHy*N;N^NuNVH8BBBHx B-| Hx /. n/(N@$Jf 9??gHxHxN&Hy;cN"9?"y? gd 9? B @(RdXJf R#?Hy;cN6-BHx n /HnN$g /.NX LN^NuHy;cN6Hx/N t `t`NV/ $n BB/Hx B-| Hx /. n/(N@$Jf-R$nN^`p$nN^NuNVH<<&n &BBB/HxB-| Hx /. n/(N@$JfHy;cENXK>uJg2 +>uf&(y>uHx/NP$g,Hy;cN6X`Hy;cN6Xt L<vDgJfHy;cN6Xt`Hy:N$y:X(<>I?*<Jfb#>u$y:I>K &<?JfHy:N6XHy;cN6 +XgDHx/HnN$ `*Jg/ DN *Xf/ NX$j`z// ENPJg/ NHy:E6NHy;cN t`  >uf *@f/ N/ N// CN$j`8NVH?<*.(n (, BB/Hx B-| Hx /. E/(N@$Jgt L,< .<?JfF/+E6NXJgHy:NHy;cN ,PgHx/HnN$ `Jgf"/ N-j%D/ "FN// GNR$j`Hy:E6NHy;cNP`TNq/,O/ n". ЈftāgpFVID$N^NuJgp`B`/,OH00$y:,J8g( j@$/N{h$j8XG(Jf/N|XL N^Nu&*NB$C`NVH?<..pЎr€-A$y:,JfJg // Nn*P(9>w D,%D@ 3 Mf%n D%nHBB8B4Jg"9;n([I"n&)[I€VD%@0&D-kN( 3 MfpL.&n (y:,/B/ N(-|3 | . B*@B`/./.N[PRft`BD`Dp`~&B DrJg"n-I .mJg$J;n(g l@&/N{h/N|PXXr Ӯ "nnX"<3 fT"n "gNp0fv"*4"n ӑBJf LBm k>/NoXJg>"y:,#M<"h 0-@6@/ / iN&/N JfRPm`v J;n(f y:,B0;CR`*n BBIo$`Jg/./.N\-@Po/N{hX".&Dg/N|NX`f *0rf4/N|NXp0f "*4"n ӑJg / NnXB`Jgp%@0// $X/NUbHxHy3 T/.//NUBHy3 THx/.NV$gFNr0f *4"n ёJg / NnXpgr#gt`t `t`NVHxHxHxBHy;n(BBB/.BHy,2Hy,2HxHxpBBB/.N@N^NuNV4H?<*n (n&n$nJl~ L< N^Nu y:,"h )-@<"n<"Q o&" [I h h,$(&(BՄbAJlA>(tԍꂴoL*"-A4& ,@Kh b,@JfJfFJfx$*n4&|LhA@-H8 cHx/N(PJg/// Nh. gz8g//NP`JfJfFJfj@`VHx/HtXN. fHx/NPJg~ `Hx/HsXN. fHx/NPJg`Hx/HrXN. fZHx/NvPJgp`//HtXNh. f.Jf //NDPJg`v `//HsXNh. fJf //N PJg`> `//HrXNh. fJf&//NPJg\`(@`~/B/N( *ڃJg/// Nh. fjڃJg~/// Nh. fN/./. /.// /Hy3 MN.f(JfPJfjJg// p L( EHp(N. `/B/N( `~/B/N( `// EHp8N Jg.`//  EHpN Jgz`NVH00$n v֎pƀ$*gHx//Nh JfD$ *gHxG/ /Nh Jf" ///* /*/*//.NYL N^NuNV/ / &n E r$@ +g l (`f:JoHy:KN/N &HP MK6JfBHy:NXt` gt L<N^Nu&j$/,N4Xf *Rg`+Z g gHy:NXB`/+NBB/*/ B-|Hx/./,N@`$ f$*g/ / N8$P/+NHy:NP`ZpgJg6 g:BD-B` r-AB-J -LL<N^`֊B`t`NV/ /$n tԎpĀHxxB/N(Hx` BHh/*NhJf/.///.Nd$.x$n|N^NuNVH8&n(n E r$@HxxB/N(%l k%h` /+N4%@$/./ // NdLtN^NuNVH00&n$k$&</B/N(/*N// N5/*N6/ n //NL N^NuNVH00&n$kHx&/ n /Nh$ f6.g,/*N// N6$/*N6Jft`t L N^NuNVH?<&.(. *n(n,.$.*Sp>ej C$hBA-HJg rgJgmNJfJf*Mg0?Jg`*Mgt?pgvt`*[fXNCBHy,2NpPJ9:g?Hy:N*[Hy:N6NCPpgJfJfJg /*N&j4XJf bx.0M3fh IHxB/ -@N( M(Hx/ .HsN)0 -A )F)B"9:@Fì"9:DFì"9:HFì "9:LFìJjr€ |f *P-gr%@P *L-g r`f`*[grfJgJ9?f`z/*N&j4XJg8HxB/ N(. L xHxHsx/N)0)sxJfB/*N6XJg HnN1X L CP/N@/N? ``dA(˨ (Jf``t`pfJfV`NV/ $n *fT"* * "jJfd jJgA/// ///.NgJf4"*g.Hx/HnN `HxHn/Nh Jg$nN^NuC`/,OH 0$n$. &n .gHxHj/N)0 JgpgpgSf  + + + B"9:@Fê"9:DFê"9:HFê"9:LFêJg2B/ N5PJg"/ N>P/ N@/ N? BL N^Nu F +F +F + Fp`dHx/ HjN)0 `p`NVH 8(n$n &l *f`/+N"jXJfp jJgA/ /// Nk$/+N6Jf6 *g0Hx/HnN$ `HxHn/Nh$ g LN^NuC`/,OH8(n$n &l/+NHxHl/ N)0 +( +, +0 +4 -kLN^`@NV/ E/ /.NmHx n // N$nN^Nu/,OH08$n&. &j/+Np%@L$ Hx/HjI)0NHx//N 9:@F 9:DF 9:HF 9:LFB/ N5$Jg"/ N>P/ N@/ N? -kL N^`P/,O/ / $n&j/+NXJLg2B/ N5PJg8/ N>P/ N@/ N? -k$n&nN^`BLHxHjHjN)0`/,O/ . g//.Nn*PEtBBHxHy,4NJgp$nN^NuNV/ / &n gHxE/ /Nh JfJfE/ /.NolP$n&nN^Nu/,OH 8$n&n $.(j/,NXJgHx Hjx/N)0 Jg8 +r€f Df *gt` c,Hx / HjxN)0 B/,N6 LN^Nut `NV/ $n fD"jJf\ RJgA/ //.No Jf4"*g.Hx /HnN `Hx Hn/Nh Jg$nN^NuC`NVPH><&n(n Wr€$A*k ,gHx&// nN$ f4/NbF$Xf$/Nat&Xf**fJfvHjN2X$ PHx// nN Jfb 9:@FP 9:DFT 9:HFX 9:LF\x؊Hx`B/N(/-N/B/ Hm ,<2 FN *<6Jg>/-"ENX ,f n B`Fv`DHxBHjN( B`6/B/ Hk FNJfJl/-"ENXt# L<|,N^Nu'Jh m'HpgCp!It+KA'Ht//-Hk`NN,$ JhgpgJftBh kpJg!ktt kt p/- ENXJg~pgrWfpHjxN2$*x&*|**%Bx%C| *%@Xjz|܃ۂ%Ex%F|;%@$*&*,*x|%B%C *%@jz|܃ۂ%E%F;%@JmHx/,Hj n N$ `$tW`/- ENXJgpg4rWg,Jg:`Hx`// nN$ fx`"$`n/,OHyHyhHyHyh/./. /.NqN^NuNV/HxHnN2/././. Nz$gB/.N$P $.N^Nu n `/,OH8 n". . "n$n$. Bx g Bx g0Bv gPpLN^Nu/)/N7PJWIDЀ`/)/N7PJgȴhgSg(.$p^`B`NVH?<(.&. n$pfRg RreEJglHy:N/N"&HPI6Jf*Hy:NXz LI?"-AJfB`6J g ". fR/ NXpf,.*hJf(rgr/ NXz/+N6XJf@`:.`pfV *hgH|FJf@N9|/// / B-| Hx /./N@`*g"/ NX`Jhf ,*p`,.`|ܪp`%Gh// N@/ N $j`"B`z`NV/ /$n Hx$Y//* Nh Jf//*/*/Nu*$.$nN^NuNVH8< .". *n(.$k//N&jp&*h/ N? j/(N S fJg*Jg D `t`t`NVH 0$n G/ $Y//*/Nw4Jf.Hx/* / GN Jf"*gHx//N L N^NuNVH?<(.*n B/-/- HnN$ fHy;cGN$.X&<>ug C//NPJgJ>uf 9>vDgJgHy:N/N"$HPI6JfbHy:NXtHy;cN6 .XgHn/N$P .g /NX LXp f/ N?X&k` +g Hn/ GNP,.g/N'F// N? R`B/ NX`NVH08&n JmJm/+/+ HnN$ fn/+/N *Xg6//N$P/ N? j/(N/+/+ /N$`/NX`t`t`/,O/ /$n n $/ N>Xpf: *gtrfBp%@x%@|`S%@B/ N? $.$nN^NuJl *xrg6 nrҀ `p?m( pmRJhgxn`t`t`t`/,ON{BN^NuNV/ /BHxHxHxBBB-| /< /.BHy,2Hy,3dHxHx BBBHy?EN@HxHxHxBBBBB/.BHy,Hy,3jHxHx$Y/BBHy?N@JgHxHxBBBBB/.BHy,3pHy,3HxHx B/BHy?NBrӪ$*Հ%BHy; / DN$prӪ**ۀ%EPJ*gJftN L< 3 g/. No$XpLHy? , Xrgn_f"T/"l$B0)Fr㨀iH/Hy,4Hxd/ DN ///N <+Jf ///NԬ/ N?(l`d"l$B0)Fr㨀iH/Hy*=Hxd/ DN` <,LDJg ,`B`Jpg` j4J(jT-jLrN(/9?LNQHy?<*.$n &*Dg / NtX,Brgӹ?4$9?0Հ#?0RTBrӹ?,$9?(Հ#?((*8$ cgJff$gFHx/ NZHxB/ NBL<|N^Nuӹ?$9?Հ#?R$`tDj>P/ HxGN/ HxN/ B/N`gg DgDkB f *@g **ڪLoHx/ NZjP"* *jR‰ntJkp*FgJLob*:g2*U g(Hjh/NPJfj/ NX *@g jtJgHx/ NPJgj *J@k grFā f"gB@%@pFJf"Jg,JfVr fft ` fp g8Dj g"/ Hx^G N/ HxNj@`/ /NP`*WBf ggE-JL<|N^`Hx/ NZ/ /N *ЪLg / NXE`Jf  fL*MBf* g"g0j~ff$ PGInJfj`Jfx ff`Jj*PBf f*QBfJ gDJmHx/ NZP/ /N*PBPf gp/B/ N`p`*RBf6 g0JmHx/ NZP/ /NߔHxB/ N` gp*UBfB g< * f@%@B/ NP`*TBf f`*TBf gEj`p f6Jkzf8t  f*KBfB g:Jg@HjN/ /Nn `$/N/ /N `F/ /GފNtƂPg / Hx NP *g/HjNBPBj~` g*LBf g$ PGIn/NXr gFr g@rg/ /KnN/N rgvr gr f//NP`Z/ /NP`I3 hrF€4/ /N/N rg$r gr gJgrF€4g`*NBf g/ NX`*ZBf gHx`v *ЪLm2 g$*|l/ HxN `8Hx/ NZ`(* P//NPJmpGJf/ N / /N`,p g2B*HgB*IgB*Jf g gBj~Hj8/N0/ N * g@%@/ Hx/N P:*|/ /N*HBPf gDj0j|td0|$G Jg/ HxNSP`0*~2RA5A~J@f|5j|`r/,O/ /$n *Bg8Hy? $n$. ,.Hy?bh @fgbF @fyg @f{fHy:N *Xg mgHy:N6X|` @tgp @t]g`| @twgb @tjgj @tsf\&|` @tfx&` tf/N&HXJg@IFg**(*B@ C#bF$-C4 j// hN/ -E(-D,// kN,g"j/ -E(-D,//"iNB@F/ N` HtHg trf/ B(-|,Hx/.(/,NB,g2gP(j mft-[gj(l(lf@ j/ B/ h(N` f~g tg f}fHy?r-@0 n0XK6JgJg gpHrHfHy?8NX|`Hy+N!F>$XgB`pD-@dB8-HrHy?8NXB`JfB8 .8`Hy?8N`Hy?8NX| ` j&`-[gd jJg (D&Hy:N6`B`Hy:N mX hf$-[g jJg (`p`Hy:N j$mXf-[g&$`Hy?%p/3  y;oH%HgC!I#;oH%|;oHHy?<". $n&.Jg t  y;o*p &UHy?0". $.*. v  y;o&p $SHy?vƪgvQă`"*fBJg$vƁgvQăgHk/N`(PJfB`pQĀgHk/N`(PHk0`B jL+gJg0Jg*g2JfJ`,ܪ"jUn Jf*FgІJg$Dkp`/,OH 0". $n t  y;o p *gSgHpL N^NuG <3 %@h%HpHy?J*Ygl"[I'@('A,$*DjJ*Xf JjJ*YgBzځـ'D('E,t,fB/ NPtJfHy?/ B-|Hx/. n/(NBJgtHy?e*Hy? *.$.&. ". .$n(. J;o4g|f"| $rf | %@Hxp-C-B//HxHj// y;o4 hNJfDpt-@ -C-B-C-B-|-J-E -D y;o4"hL|N^Np-L|N^NuNVH> (. $.,.*.&.E r$@ HtFfzHn/N$PfB/./ Hn/N$fd,(*/.-F-D///N$f$nHnHnNt$Pf y;o4JgHxt-F-D//Hn// PN$f/.N$Xf np!@ r!A(!|3 .!@/N"/./. y:,/(Ns/.//./.-F-D///NV$,gt/.NoXJg,/.NmpX`t-/./. y:,/(Nt@ /.NoXJg(/.NmpX`Hy:Hy:NuPJft L|N^Nu//.//-B-D// y:N$Hy:NuTpf`/,O/ Hy3 EN#?\XRfHy3 Hy,6lNK.Hy3 DN#?XXRfHy3 Hy,6`$nN^Nu/,OB@ @#bF$N^Nu/,O .B@FN^Nu/,OH 0$n$. Hx/GN%HPJg@Hx Sj^ @HhNP%HBB *Ђ%@ %BBBL N^NuA`/,O/ $n *g/*/NP"*g *Sj^ @Hh/NPBB$nN^Nu/,OH8 $nN Jgh RB"jJg$"&j^18x„gBB"R$ f$"*S%AfBB/N LN^Nut`/,OH>0$n,. &.N*(G)0 *JoJnJfBB/Np L |N^Nu"* d.$l$///N؂Ԓ$ f$`"* `/,OH> $n&. N**g RJf"$*Jn$* /N L|N^Nu"$fX"EJoB0(ȃfR"Bf`Rg"EJoRB0(ȃf(j^"jB1Hxȁ g`B`B`z/,OH8 $n$. N@f8BBB`< j"(* d>"Bl"H%C҉$f$&*JoJnJg-@LN^` D`/,OH80$.$n N( *Gְf/NXpL N^NuJf4Jf$Hy,6NDrHx/*/ NJf *%@$ j *g(&*"j^ @rƁrg*R *R%@ f%j/NXB`fF`/,OH?<*n&. $noN( *gJfJg *%@$G)0|"jl"* *$b$l$// /N(j Jg8 *"Azʀ"BC " I"bjSF–ժԪ%B f%jJnp`&Hy,6NDrHx/*/ NJg6/NX LHy?hNHy,6/ NHx // N(y&9:B/ Np :f`&// ENPJf&Hj$N):PHy?hNP J L<L (P*g/(`//9? N4V `"hTJg/(X/(\// N$n&nN^Nu/NU&`fNVH0HxHxpBBBHy?NDHxHxHx'HxBHy:TBBB/.HzHy,8Hy,8HxHxpBBBHy?NDHxHxHx'HxBHy:PBBB/.HzHy,8Hy,9HxHxpBBBHy?NDHxHxHx'HxBBBBB/.HzzHy,9Hy,liHxHxBBBHy?NDHxHxHx'HxBBBBB/.HzHy,95Hy,9JHxHxBBBHy?N@BBHzHxBHy,9\BBB/E-N#?$BBBHxBHy,9aBBHx@/N#? $BHz,/9?E3RNBHz/9? N 9?Zr $< c$r#:XN贀l #:XHx kH"(P (\Ё@Ax (@Hy,<NXnHy+NXJg&SJgR` dg vg cf|`~`& z` f Hy+NXB4/Hy)^TNRP`6"+*A ( fI ` ,PЬ\"+ҫ`dIH`nBB`h kH/0`Hy*'NRP`(JgJg/ /. Hx$/N DL8(n*. (..$&LJg +b&+JfJf$SB`&S`,g0l//N b$HPJgX1l ,(!@(,,()E(+fh cXB/N B/// N $f/ N )F(XE J L|N^Nu0k//N $HPJg+g< +Ђ%@ +pLЫH/N):P%kHHX%C'B$`// N  *"+҂///N)0`/,OHx/./. /.N N^NuNVH?<$. &.*."n$Qpf*gR&*((nBp-@K)0 *m4Jn"n Q(g(nB`4֨ PJf` JB`؀Jf.g.*,܃ *r€ oJfJfR// N  *Pg: gDB0j//N &H JgZ +"+g* f, kHpLe (PШ\ Ad,'F d /B/N($ (J$R`B`"JgP f, jHpLe (PШ\"*ҪJn6 n80j//N &HP`8"*Ҫ Jo԰d, d "*Ҫ/B/N(ݪԇ `@"*Ҫ Jo` jHpLe`X A `B`$(JB$K"*g *gt f jHpLdXJo"B/// N&HJfp7L<$n(. Jg*f *( n nv"j j"$ Ԉ l// tHԊ/N)/%B *"*Ҁ/"*(/B/N &%j(/N "B J L<|N^NuHx/N &HPJg4/(/*B/ N &// N I *f / NXE` *"+/*//N)0/ N`RHx/I N&Pg$*(&HK *<,< & o// NP+f /N "`  o '@/+/ *(// FNJn/N "$X`Hx/NPJg&&H`/,O n h$Jf N^NuB0( g P`/,O/ / &nHxB0+/0+/N $H JgB0+/HkHhN)0 J $n&nN^Nu/,OH <(n/ K N n $h$XG$< 'Jfp`/ "BNXJf/ NXBL<N^NuJf $)H$$R&H` &`/,O/ / $n&n Hx(Hk Hj N)0 +v%@AH%HB$ -K -J$n&nN^`DNVH?<&n&. $..Jmpo//Hy3BHy,Jf(oC`0 *m$RJgJf`$R`Jg A±m(`"F&n4Hx/// N +\Jg"H&I"QJf%B&$$HB`(( R&HBJfރnrJgJg&Jg f(&jHpLe +PЫ\,*܁lJf"(g: fD&hHpLe6 (&kPmJfn Rר R (Ԫ///N)0$R `&ޫ&S`,JfF,*܁ mfJfZҪ//B/N &٪//N Jf`h,*܁ lJf0m/HxN &HPJg( o\Hx/N P+fF/ N X/ N "XE J L0*.$. $n/./NP& bJfL |N^NuvF/Hy,FN$$$V^Hy,<`Hy,=qNXJg Jg ng2Hy,=`JHy,=~`Hy,=n`Hy,={`Hy,=`Hy,=`x؎/Hx//NK 0Jl Hy,=N/ ///NLNP  b\؄0;HNRR2:BRRRRRJHy,>!NXB./Hy,>s`Hy,>.`Hy,>H`Hy,>X`Hy,>c`Hy)z`NVH< (.&. *.$n//NPre6Hx/Hy3Hy,NP bJm gtb@ gH g^Hy)z`@ b\Ԃ0;(NT\dlt| fHy,>`Hy,>.NXB./Hy,?g`jHy,>`Hy,>c`Hy,>`Hy,>!`Hy,>`Hy,>`Hy,>`Hy,? `Hy,?`Hy,?6`Hy,?N`Hy,>X`NVH><&.*n *.$n//NP,pe6Hx/Hy3Hy,NVH>8(.$. *.$n//NP&pe6Hx/Hy3Hy,DN-J-E-B -DL|N^`HnHx//GJNJlHy3Hy,JgN gHy,O`D/ Hx//NJmv$JngB0.Ԁ`z egr fHy,*`Hy*N.+}NB0./Hy,DnNB0./Hy,DN eg8b0 g0  g*Jg4Hy,D`$Hy,D_`Hy,Dd`Hy,Di` fHy,DNX`-J-E-B -DL|N^`RNVH8<$.&n &.$n//IDNPr e6Hx/Hy3 Hy,Hy,E#N/ // /N 1H`Hy,E)N/ // /N :`vHy,CN/ // /N <`\/,OH0 $. . &.$nJgJgrgxm4Jg"rgZ/Hy,E0NP-J-CB -BL N^`Xrgr$fB L N^`B L N^`B L N^`"B L N^`dL N^NuNq/,ON^Nu/,Op-N^Nu/,Op-N^Nu/,Op-N^Nu/,OBN^Nu/,Op-N^Nu/,Op-N^Nu/,Op-N^Nu/,O/ /. E "N/.Np-$nN^Nu/,ON^`4/,O/.N BBN^Nu/,OH>(.&. .,.deBL|N^Nue:d/". Ҁ/Ю/N)1 Jfc`B`/,OH>8$n&n BBHxHx/// / IVNJf@+*dP/Hx/// / NJfgBL|N^NuP+*d///// / NJfgB`+*g` `/,Op-N^Nu/,Op-N^Nu/,Op-N^Nu/,Op-N^Nu/,Op-N^Nu/,Op-N^Nu/,Op-N^Nu/,Op-N^Nu/,O.P. N^Nu/,OH?0$n"n n..".,. .$|B*PB&C cE J L N^Nu5I4BGBB BHp8B/ N( Jg6/// N)0 DJg"//HrHN)0 E`B`B`/,OH?(.*. .".BBPB/. /HxN & g4//.//.pF/?Bg//N G Jf /N XB C LN^NuNVXH<<&. (n&n(pȀp ig if ,g pL<<8N^Nu,+5fE/ N)/JfHy;r@N/ NPv`F/./.Hn//.Nh&g/ NX` Hy;r@N|܋X g$/N/ NPv/././Nt@ $`D/ /.N$&Pg /N/ NP`R /NX n!K/.//Ns/ N .g/N$` y;q;peHy;r@N/ NPv`r y;r"C"g!C#;r C!|;rR;qHy;r@NBX&C`v/ NX&`,/,O n Hy/(/( /(/(//.N YN^NuNVH<8&..HnHn/. N` Jf\*QG_hIN,$n *$g S%@$B`* *("R%A(Jf2Jg:B//HxBN$g(/./ NP LJg: o>Hy?ҜN#;rHHy?ҐNPHy?ҜN6 $.&.N^Nut`NV/ /$n -@$./N -@ .Xg // N %U B((M*j P`6,B l-h"nJgJ gVpfN/ N/.N"t @ t //./ "n i N$N<-@/ N"n""n f.-F(nJfp&j JgP&k2m-IpfBr`<-@`Jg$pf/ Nf/ "n iN/ N@ / NX`I.BBJgZ"nJgJf0- @fXtg^pJngrJf,/N X"n) gJg i/.// h8N `rg @gj"n") *Tg貀d *-d*JfX/ N/.N/./ -І/Nx$N-@/ NBJg(JgHx/B/ N +<$f / N8B/B/ N +<$/ N"n"ۭ`ۮ谮fJfBE`jtăDj@JfBEg"nfJgDk*f/N X`BEgJf~΃"nJg j( fvJfrJHfr*fjJg /N$XJgZ"n) gJg i/.// h8N f/N XJf&j :*Jgz*K&kB`K`BE`Jg`Jf%K`Jg"n$`t9`t#`/,OH0 &. Hy?ҜNXEM й?Ҙ;rHbZ$չ?ҘHy?ҜN6XJg4/< .r ?N///9:LNf$f/NTX L N^NuHy?ҜHy?ҐNPJgB`/,O/$. Hx//./9:LN-B$.N^`/,OH?BPj/ N z L N^NuDjFJ*j0*@ G @ @ g*gB0*L9:/Hx/ N$ g`x/ N x$Xg`fB`xNVH<0&n (.*9:,/. //. /Hn/.N {$f"HnHnNt$$nPg/ N }VX L Hn/ N D$/ N Jf^0*JgC`"< YfHy:Hy:NuPJg/ / / y:N$Hy:NuTpNgrf/ N`Xv*`\r@f`d gZ gP f`D  n  n f`Hn/ N D$/ N Jf~".o g, g6A B g/ /HjXN JgJ9;rDgj` g @f`/ / N$PJgrx*f2` HxHn/ N $/ NPJf . ct!/ NH LN^Nu"<Ly:m5@0*Jg @5@B jJg hJf$`@`FC@5C`/ /HjN JgJ9;rDgj` *c-@%n` *c-@%n`/ NۆHx/ / N $f,.,Jm(", B?b$Ly(: 9:(<L@H*[IĚmLЂ-@f Jgz-E .  g%@`%@`N`$`zt`t7`/ / HxN$ gz*f`NV/ /$.//./.E/ N //./ N 6/ /. N ^$ .N  $.$nN^Nu/,OH 0$n&n +gL$+(JgH *d %@ /*/B/ N &/ N "BL N^NuԨ PJf` KB`Hx// N. Jg`/,O/ / &n b@HxHxN $HPJg* c4Hx/N P*f/ N XE J $n&nN^Nu */+/+/N)0%k `/,O/ $nj/ HxHxHx/*PN~/<HxHjN` $nN^Nu/,OH<&n kd$h/ N +XKrgBr ghJfr <3*f <3'@hI/ / N`lZ/ N B`"'|3hIX0*@ @f/ NXp L<N^Nu'|3hIX`/ NXp`/,OH00$n&. // GNP$fX/ N@// N$ fgN^`R/NXpN^Nu/,O n0(@@1@N^Nu/,OBBBHxBHy+cABBBHxXN-#?Ҩ(N^Nu/,O/ / BB. r//9?ҨN3$H JghHxXB/N(A(%H,A0%H4Hy+cAHjGM.NHy,FHjNHy,FHjN$HjGcNHjXN%J%JP J $n&nN^Nu/,O/ / $nHjGdNHjXN&J /N~r/ GMDNHjNHjNHx/ /9?ҨN4V$$n&nN^Nu/,O n"n #H Jf*Rh@(#H$B8 h#H< i$8!IN^NuRhB0`/,O/ n"h ($J f4E(fDSi@"h8 (/,OH <$n"n $.f Hy,FNK. BBҨ*H PJf I`Ҩ PJf j<(j8dN *D&j@dB̐l eJ*&BIJf,/ / N jTPJg(!B%BT%KPpL<N^NuB`/ / N&SP`%BL`B`/,OH0<(n$n &nBKh&< JfJg Jg0L< N^Nup"*fjJgD RJf4JgV0*kg0 +Df^&)JP/ / Np BP&J$@`0*hfTf)RT/ "CN$HX`xJf)JL`Jg +Dg ngx f| kHpLep (PШ\ kml0*kf` +Ы j///N)0 *ѫ *Ѭ8/ N $H` k `B`-|,G L< N^`/,O/ $n/*P/. / N %jLT $nN^Nu/,O/ / &n$n JgH/ / N kTPJgB!J'JT RBJg *Dfr€%Ap/ // N $n&nN^Nu'JL`/,O"n . g< iTJf#@T` A(g-@ -IN^``"f/// N N^Nu/,OH8&n$n JgtIL kLJg""H0) @g @fI h`"QJf/ / N %@Pf'JT( RBJg *Dfr€%Ap/ // N LN^Nu/,OH0<&n$. $kLJg.(jK&< Jo>Jf$Jf/+8// Hy,G$NK.I`$L(l *lD%@ժ8Kd$< Jg`Jg:'JL%L kLJf>BPBTL< N^Nu/ / N/ "CN$H `r/ / N/ "BN$H `Jf'HT`'LL`/,O/ / $nG J@f $n&nN^Nu/*8/ NP`NV/ $n/ N -|-|Hx/.BHj< n /(@N BD$nN^Nu/,OH 8$n". $9;rP l$<GX/ c // I BN Jg / /.HjN Jf/ / N Pp7`"Jfp%@Jf%B *e BLN^Nu%@`/,OH 0&n.2+BH0k@҈0+D jR‰lJJLg k(JfE J L N^Nu (8J,gB,B0hp/N DX+gBBN h$HXJg1k 0+@1@1k0+@1@!k1kFF!kPP!k44!k88!k@@!kDD!kHH /N~b $/+/+/ N BJg/ N X`$ @`%k%k%k%k + + j hB/ PNPJfB// / N n Jgj/ NDHkNPP`/,OH<&n$kLJfBPBTL<N^Nu'jLKI / / N/ N$H JfJLf`/,OH88(n$. (.&Vpƀ6| g0o*/ Hy3Hy,G:NDr E J LN^NuHx/N $HPJgڶojoVB/ NT%HPPg.%JHp%@L%H *%@%K\BTBX*f/ N X`z//N P` jC (%Kp Ђ !n!n/BԔ/N( `8NV//&. Hx/././HnN $g//./.N)0 B $.&.N^NuNVH 8$n$. G6I -@ .f LN^Nu/N -@$./NP`NVH0 n$h,"(Xp!@X& (\0g8///NM$ -@ .g // N

L8(.*. ,.&./No&HXJgp(g/No$Xt& L|N^NuHnHnNt$Pg /No$X` n $k/ NxXJg //Nn*P j( g*g0*@ 2*BJ@f^I @2*BjHJAf*gN5|5H4*HgdBjH/ N/No$/./. y:,/(Nt@`.JAgB@`fBHx/ N$ f0*`~Jg/<HjNXP(j0Hx/ N PJf Hy*iNK. nr!A( rr"". F« !@ !|3 !LDf0,@ 9@/./ N x$/*PN4~)HP/ NJglpЮ/N nR0HhN6/.Nl/.B y:,/(Nt@/No$XJg/Nn`0,@`h//./N{~փD//./N{/./. y:,/(Ns$`t-`@t`:t#`4t`.t `NVH0 &. Hn/Np$Pf/.N nX(f/././N y$ nf0(@ E @ @ fZt$`&BHx/N n2( JkRJg8tf t/.N/No$P L N^NutgA1A$` n(gJhHgB`pt nJgJfht `4(HBhHJfh`hpgx`vt%`pNV/ /$n $pĀ/*/*/N. Jf///.N $.$nN^NuNVH<<$n y:,((&*(R**BHnK/ //Hn/ G ~XN$f-n/.Hn/ //Hn/ N$fP-n/.NH/./.I xN$ GgF/.NX/././Nt@/.N }V/././Nt@/.N }V`P .UgN/NXHx/* HnN$ f/././EsN/././N L<Hx/N.///N)0`JgJpf8JgPJ?tgpB///B/. N`//NJf`rgp#gJfF E/N ""EBXJg ///N zB `J?tf//NP`J?tfz//NP`t`t(`NV//&. Hn/Np$Pf././././././/.N $/No$ $.&.N^NuNV/ /$n Hn/Np$Pf,/.N>/*/.N P$/.N/No$ $.$nN^NuNVH00$n &*gJ g bHnHn/Np|$ fz//*/*G/ N Jf2/ /.N ^$ nPp Ю(fF//.N }V/././Nt@/.N }V/././Nt@`,/././GsN/././N$%n L N^Nut`NV//&.Hn/Np$Pf@/.N^ nX(g8"h"i/. / i0N$P/.N/No$P $.&.N^Nut9`NV//&.Hn/Np$Pf6/.N n"h"i/. / i4N$/.N/No$ $.&.N^NuNVH00$.&n .$nJg&g>HxHn/ Nh JfJf,BHx/ HnN L N^Nu Jg>-@Bd-@/./ Hy,HN/.// NJfJf`B&B`NVH00$n &n&pƀ CPBBB/ ///.N $f8//</*/*N 6$g&/NoXJg /NmpX L N^NuNVH80$n &n&pƀ * g Hx(//Nh$ f`  CPHx/*// ///.N $f8//</*/*N 6$g&/NoXJg /NmpX L N^NuNVH00$.&n .$nJgj&gHHxHn/ Nh Jf .j pL N^NuJf2BHx/ HnN ` -@kJf B&B`"*o-A/./*Hy,HN/.//*NJfJf`NVH 0$n GHxB/ N(A-Hp-@-j-j * -@/.BHn/ //.N *$$f././</*/*N $ .g /N X L N^NuNVH00&.&n HxE/ /+Nh$ fh +-@ nJgA/./Hn/ //N *$f,Jg2/./ /N $ g .g /N X L N^Nu/.BHn/.N $ .g /N XJfHx/ Hy,HNXHx/+/ N$`NVH?<(n &nE r$@ ,gHxK/ /Nh Jf ;b/ N/ / Nb Jg$&*(*֪Մ%B%C *Ъ%@ ;oB|܃ۂ%E%Fe6%@(Hn/NpPJf& n0(Jg@BhJ/-@No$X .L// Hy,HN VrA e`//*Hy,HN2 j G`NVH?<*n*.&n..E r$@Hx/ Hy,HN"+ g(-Dg&+-C + $grd bjHx/N(HPJ f L$,+ %Fp%@BB B"m%i0XBm f +fJ?tgHxN`XJgJgHx/N&///N)0`B`*B`4I`b// /+Nh, gRAg // NP/.E "N/.N L&.< \JgPp-@DrX-AHB-H N9|-HLG/ N!Zj$X*<!EJg"/ ENX/ NU&/"GNp@P`$.0A(g://.4N"\ .4PG" f/N.N/"ENPt0`/N" `/ -HN!Bp*"n )$"@ ) F+@/ n/Hk/.4N"zx$K" g/.4N/ ENP`D&n0Hx/ N"!/"GN'R%K%F$%L/ N"/.4Np@/ EN L&HJg/-N&mX$<6Jf/- BNXt=`0+ j g/- BNXt)/ N" `d/ N/ ND/-"BN j ( g+f/ DN`B/ N $Pg&k*(Jg,B/+$"GN"E#H +/+$//"FN E!k$$"E#k@@"n i"E#h`D"n/)N4 E!@H"n/)N4 E!@Lp@P+CgHx HkDHlD"FNp@ &B/ / N$Pg / DNX`0* @ @f< k!L ,@@*< Dg(/ N . ENXJ f / / NP/ "DN`/ "EN`t&`t `t%` /,O n N^NuNV/ HxHxHxHxHxBHy;rlBBB/.BHy,IkHy+&HxHxpBBBHy?ENHHxHxHxHxHxBHy;rhBBB/.BHy,IHy+' HxHxpBBBHy?NHHxHxHxHxHxBHy;rdBBB/.BHy,IHy+&HxHxpBBBHy?NHHxHxHxHxHxBHy;r`BBB/.BHy,IHy+' HxHxpBBBHy?NHHxHxHxHxBHy?ҰBBB/.BHy,IHy,IHxHxBBBHy?NDHxHxHxHxBHy?BBB/.BHy,IHy,JHxHxBBBHy?N@BHxN}#?Hy,J(Hy?NM.Hy,J(Hy?BHzBHxHxN(,Jg/Hy,J.NK.$nN^NuNVH8 .(n &n$lBJfJgSff +rgrgSfJ9;rpgHn/ N DPJf6 +rgvJfB@F$nN^Nu"P"(Jg&#A"h"B@F/NB@X @#bF$`#>v`/,O/ /$nNPJgBB@ B#bF$B y>v%H #>v/9?ڐN_B@FX$.$nN^Nu-J$.$nN^``/,OH0 $n&. $.Jgf/*N *%@XJg,%BJf0%j$/*N6X-JL N^`<(.". . (n(B/.-@-A///K.N&(gHy;sGN$nXB*< x,<6 mBHy;sN6/N $Pfp.'gHx/N!$@PJfV L<|N^Nu/*//"EN Jf,Hy;s FNHx"n/1,/*//NHy;sNRP`r$@B/N BP$ `t `NVH88(.&.$. Hy;sNXI xG!-B-C///N $HJgVBBB/NXg/ N 8XJ*j&jHy;sN6X-JLN^`bHx / N DP-|;sLN^`z/,O 9?N^NuNq/,O n (R!@N^Nu/,O n rWDN^Nu/,O". n"A ) "h b$e(-@*-H p*Ё-@N^`(VpN^Nup`/,O/ $nHy;tN jXJgT!j j B y;tD%H A#;tDB*(S ;tPR;tPB*(-|;t$nN^`B*(!;tD`NV/ /$. n$hJgN * f&/./. Hj*N)1 JgЀD$r `δRID`*(@.g/ NX J $.$nN^Nu/,OH08$n.(j $* &j$Jg@Jg& Hx/NZ jP *Jg!@ j /NX/ HlN)+Hy;tN j Jgt!j j B*(S ;tPHy;tN6XpdVp*Ђ-@ -JL N^`'@`z j *Jg!@ j `p'@`B*(!;tD`Hx/ /9;sN4V L N^NuNVH?< .Hy;s-@NX"<>u .JgT y>w"-A"."A,&IE$ & ׹?ڤ(9?ڠق#?ڠ!A,"(-A"."A0. B߹?ڬ$9?ڨՆ#?ڨ!A0"(-A"."A4* B۹?ڴ&9?ڰׄ#?ڰ!A4"( -A"."A8& B׹?ڼ(9?ڸق#?ڸ!A8"(-A"."A<*II$ & ׹?(9?ق#?!A<"(-A"."A@-IB$.&.׹?(9?ق#?!A@"(-A"."AD-IB$.&.׹?(9?ق#?!AD"(-A"."AH-IB$.&.׹?(9?ق#?!AH"( -A"."AL-IB$.&.׹?(9?ق#?!AL"($-A"."AP-IB$.&.׹?(9?ق#?!AP"((-A"."AT-IB$.&.׹?(9?ق#?!ATJgHxXHy?ڠ/N)0 9;sL9:/Hy?NP-|;sLwR/NP`v//NnP*.JCjlgjrWID$ //NZ//// N:(Kf6/N$9:,/N y>wR/N BLwR/N`&($fbJgB()(&9:,pf0Jg,/N y>wR/NHx/NB/NX`l/N y>wR/NPv`/N"l(/NP$9:,Jg/N y>wR `/N y>wR/N n Pv` /,O/./. .@@/B/./. /.N!N^NuNVH?<$n..*n,. j(g&;sc*$9:,/N y>wR/NPBLwR(`A(< `BB/ //. / NdGbEJf*Jg /NX$9:,/N y>wR/N`*($(9:,Jf4/N y>wR/NPJg /NXJg* n p`R/N y>wR`NVH?<$n&n (n.J;sg$ B/NZPJg *rf/NX4|`/.B//* /* y:,/(/ N"8,Hx@NB&* xgpIVI[ID@. x騆N9|/B/ -C-E///NC"JgB/N$9:,/N y>wR(/N4 4| LwR$/N `&* f$j` *.*fpgrf *.+g*(@.g/ NXKJg.*bB/NX4|"`N/Hj*/N)0( ** /N"l$@/NPJgJgהB`P&$9:,/N y>wR /N P`NVH?<&.$n (n&n(.g;sb 9;tP-@ ."9;tT-A".Ё*<:poLHy;t EN 9;s$9:pXl$JntS.<N*y;tHJfDHy;tN6XpeBHx/9;sN3*H +J$+C / / NP+@ pD)/ / Hm*N)0,Hx/(<Z DN/ /.<))"GNgHx/N/ /"GNHy;t ENB-(R;tPB y;tD+H C#;tDNHy;tN6PJgD& Hx/ DNPpf .fB j+H %M/NX-FLwR/NP$.N^Nu/,O/$9:,/N y>wR/N`P$.N^Nu/,OH8<(.(n G;t@*KBB$UJf"PJgJfD-|,L"LL<N^Nv`ظ$f Hj* * /Hy,LN$* $j`K$SJfPJg L<N^Nu*C`洪$fHj* * /Hy,LN $j`Nq/,OH8HxHxN$HHh@ND y:, h&h$I@B/ NZ $g /N" ^X +%@g /N" ^X +%@g /N" ^X/ N%k p%@ J LN^Nu/,O/ y:, h$h$HjN):P n!J$X$nN^Nu/,O/ / $nN(HjN):xXJfBN(/G" NHj@NR *Pg/NX *g/NXHx/ NP$n&nN^Nu/,O/ /$n j$pdN!$/*$N!`%B$X$.$nN^Nu/,O/ $n/ N! j$ (Xg-@$nN^`$nN^NuNq/,O// nB"<0g f Ё$&N^Nuv!L҂R`NVH0 B?(#?(?,BBHy,LBBBHxHy?(EzNBBHy,LBBBHx Hy?8N 9?Z"tt t숀 c* <#;t\BHxHy?0N{4 9;t\/Hy?8N&TB;tXB?HxHxBHxBBBBB/.BBHy,LHxHx$Q/BBHy?ENXHxHxBHy;tXBBB/.BHy,MHy,MHxHx&Y//BHy?NX fG P jJfJpr$B *;tXBL N^Nu"hJg#h"h"/Hy?8NP`"hJg#h"h"/Hy?8NP`/,O/ / &n$SJgL/ N!">Hy?0N jPJg:!j j Hy?0N6/ Hy?(N PB $n&nN^Nu#?,`/,O/ / &nHy?0N$SXJf,/<Hy?(N$H PBfJg j *JgN!@ j RA?("P%I Jg.#@ %HHy?0N6&X$n&nN^Nu#?,`#?,`/,O/ $nHy?0NSX-|?0$nN^`/,OH><$n(n &.$.Jf *f B0, /Hl NP*xȀ G kJf jJg6"h ("( fJg#h"h"/Hy?8N PPp й;tX;t\c4Hy?0N y?, h*PX,<!">JfHy?0N6X/<Hy?8N !B!C B0, !@!np ѪR ѹ;tX"k!IPgI#L'HX؊!DL<|N^Nuf ("( g h` I`r ҹ;tX 9;t\bRJf/ FNX m h*P`0/,OH00$n$.&. jJf\/<Hy?8NB!C!B B!n"j!IPgG#K%HC!Ip Ѫѹ;tXL N^Nu h`NVH> $n n &.$.(.B0( /Hh NPr€ rJf Hy,MKNK."hfV*(,( fHJg#h"h"|ݪS ݹ;tX-D-B-C-B -C-JL|N^` I`/,O/ /$.$n RJg  h`//. N"Pr€ n pJfB$$.$nN^Nufʴfp`/,O . "n QJg h` n hJfB"N^Nubp`/,O nr TDN^NuNVH?<$n$. (n ?r€&A l h$-lBBJf $(f$9?(/K" ^N/ NPJg n-Pf .g"S-A @|/B`rv@~ή*g"Hx/ K"!NPJg/.// N"|. g/ N"X`&f / N"X` j((fF/ N"X~Jg n  .G" g/NXJg/ NX/N L(B0"@ GcȻm ( g,... "(f~B0( ,.ct/Hh /N)0-F/N"//N .g"S-A @|// N" $nBSXg`&<@JnX`Nɛ`>/N"//N ~"`:|`Jg / N"XJg~`/,O/.BHxBB/. /.N!'JWIDN^Nu/,O n "n"i$")"h"i$ )Jf JWIDN^NuJg///N!, `p`NVH<<*n$n &* n pm t"`&<Hx/N*(؃ S-@ DB( m(h$G@B/ NZ/ Hx //HnB/N!'$(.NXJf . n ///N$ //NP L<Jg#hll"hl"h j@N/*`N!1XHy;uN6 $.$nN^Nu I`t`/,OH8Hy;uGN$y;tdXI6JfHy;uN6XLN^NuJp g67|Hy;tN6XG/ NH`,HxN`Hx`B`%B%C%D%E%n $5k B(B,A,%H05l%l , rgtf$<6(<>&<?/ N.X&HJf-n "n &t(Y*QI*|! n&( f:B`XJg& * g/ N"XB&`p`v`$v`/,O/ n"n " <Jf$f "`t!LBЂe"Ё$N^Nu /gt!LЁ`/,O/ / &nHx/ENHx / N$n&nN^Nu/,OHxHx N BB N^Nu/,O/ N$HJg BHx//.N(zJg RB( J $nN^Nu/,O/ /N$HJg:BHx//.Nh$g/ N!EX $.$nN^Nu n `t `/,O/ .$nJ f-J $nN^`/N!F>$Xf p $nN^NuB`/,O . n-P -@N^`2B/,O/ $nJf HxHxN%H//N)/LR j $nN^Nu/,O/ $n *S%@fHx/*NBP$nN^NuNVH?<$npЎr€-A-R-j"n)g"n/)N!G&-HX*(R-jB./,N)/`z`z`-GB"n`/N`/N" `/N` n(g@J gUf/.N" BB*Xz`bJ.gB/ N" X/.N" BB*"n Xrg~Ud~Hy,ONK./ N" `J gpUfhJ.g/ N" X`l/ N" `Dfl".fDkgp@//N"!P`Bp`z`z`NV/ / n-HC(-IBBB."h!QBBBE/ N$/ N $.$nN^NuNV/ / n -HC(-IBBB."h!QHxHx/.E/ N$/ N| $.$nN^NuNVH<<$n$ j$/I)/$Xg0/././/.N!]&/N!E $.&.N^Nuv `/,O/./. /.BN!^PN^NuNV//Hn/. N!Fz$Pf&&./././/.N!]$/N!E $.&.N^Nu/,O/./. /.BN!^N^Nu/,O/ /$nJ.g,/ N!XtĪg,/ N!Xt $.$nN^Nu/ N!XJgt`HjN):PX`/,OH?<$n(j$*<,<" . / EN*jX *Jg6+@"j"BPG6.<"Jf/NXB D L<&n. +g/N!bBXHy;u@INX&<):P(<6*<!a,<!aK!ah$SJfHy;u@N6X J L<|N^Nu k%H R&gB!K$'JJ f$jHj CNHy;u@ DNPJg/ FNXJf/ N'J`#?D`/ E`/ NHy;u@NP`n/,OH 0&n$n Jf"$+ B Jg /N!ahXBL N^Nu?g,/ N!aXJfHjN):P$+ 'J / N!bP`p`/,O/ / &n/ N" $H/N k%HPg6C!I'JC%Ip%@P/N6 n X$n&nN^NuA'H`/,O/ /$n/ N"jXJg6 j$/N jX *Jg.!@ j BP/N6X-J$.$nN^`< j!@`/,OB/./. /.N N^Nu/,OH 8$n&n (jJf>%Kg.$/NB k%H 'J/N6PJf>LN^Nu$/N jX *Jg.!@ j /N6%KXf-LLN^`T j!@`NV@H?<(. _r€-AH|tĄ-BDr„-A@tȂ/.N" $HnT/.N!c BBEE"K{..TNlNN*9:t LBXڀN}6HxBB/N&HJf0B/N!cXJfJgSfJVID$ L<N^Nu gJDg+g/ N" X`vJ@gpfHx/ N"!PJfBLBPBB/.P/.LHx"y:,/)/ N"$I"g/ NX/ N" Xpf@R` y:,/(/.H/ N"|v$/ NJfJXf nHJfF/ N"^XJfJg2/ N"jXrl +We / N"X`/ N""`/ N" X`r/,O/$.Hy,ONDrN~xB@F p#?/N!\N!PJg-|+$.N^`-|,R`/,O/. /./9?$&PprgHnHx-B-C//.N!JgtFĪ8/.N" XUfp .Jg&/N!iXJVID`P j/( /(NPJg4tFĨ(-J`/,O nBfN^NuI`/,OH00$nHy?8GNXJy?,f3?, j/N!k@&09?,$r "R@3?,.;u@N 9?@X @Jf0Hy;u@N6%B%C%BX-|?8L N^`8J f"hff RRy?,` P`/,O/ HxHxN$HBp!@ Hy;u@NA?@"P$ g&#J %HHy;u@N6 n X$nN^Nu#?D`/,O/ $n *g /N!bXHy;u@N RX *Jg.!@ j Hy;u@N6Hx/ N $nN^Nu#?D`/,OHx/.N. N^NuNVH 8&nHnN!l&XI!l$./N$HXJg *f *f/N!lX J LN^NuNVH><&. $.HnN!l&XGI!lK):P(<!ah*./N$HXJf/N!l K L<|N^Nu *@"*DJf*,dHjNX&J`*+@,+Dd*,d/ DNX`NVH0< 9?f Hy,ONK./IFNXrg,t gUf 9;X"9;\tvfTHy,P` 9;X"9;\tvg$v /B# /B-@-A//.Hy,ONK.Hy?_-@-A//.N!$ Jg Hy,PC`FHx/9?_N"!HxHx/9?_N"{ $/9?_N"Jggl/ EN/ FNPHy:NHy:N6P`hHy,QhNK./.N" ^(Xg / EN/ FNPJg/ N" X`B/.N" ^)n/ EN/ FN Jg/N" X` P`Hy:N6X?(f/ N" /.N" ^#?(P/.NX/*0N6XJf / N!XHjN):PHj/ N!B/ N!j&g/ N" X/ N!ah n B`^g/ N@XJg`/*0N6XJf / N!XB/ N!c/ N!ah `(/,O/ Hy;u@N$y?@XJf8 R *JgB!@ j Hy;u@N6Hx/ N $nN^NuJ f .g$R`#?D`/,OH>0$n,. / N!(/ N ߦ$PfJg$***p%@/*0N&*p%@/ N!&P g / N!zXp"G6g// N!~$Pgpp@ƀ%CpAƀf / N!X/*0NXJf / N!Xg&/ NXJgH`B/ N!$Pg2 L |N^Nu n/(Hx/ N!$ gb`p`/*0Np&jXJgBJf / N!X/ N!v *Xg/Hy,QN!Hy,QNK./ N!/B/ N!c/ N!ahJgV/ N" X`H/,O/ /9?4/9?0N$HPJgP/./</N!w Jf,Hj8HjXHjXHy,QHy,QNLp$nN^Nu/ N!ahXB`NVH?<.$9?0&9?4B.pBBG!wI!ahKDr-B-C//N$HPJgh$(@&(D/.//N Jf&Hj8HjXHjXHy*ѰHy,QNLx`/ -@NX .Jg/HjXHy,QN z`JgHy,R EDrNXJg Hy,RNXHnN!l&$./N!lPJf /.NpX/N!lLAhpfA(zXHnHx/ /N$f ."</BHrN( `NV/ / &nE r$@ 9;urg&rg0JfTN&'AB$n&nN^Nu$n&nN^`%/ N "*&'A"*L<'AX`$n&nN^`& /,O n J@k0"$f*"g o@  BN^NuB`p`/,O#?H# ?LN^Nu/,O .0 3N^Nu/,O n h"hN^N/,O n h"h N^N/,O n h"hN^N/,O n h"hN^N/,O n h"hN^N/,O n h"hN^N/,O n h"h N^NNVH?/ /.4N"\ .4PE" 0f/N.0N/.NPt`/N" `/ N!Bp$"C i$ ( F%@/ / Hk/.4N"z$f /.0N" X/.4N" /.NP`LNVH0< _r€$A y:,&(Hn/./. N!F$ fDp-@D-| HB-n N9|-HLG/ /.N$PI!Eg/.NX L< N^Nu$.0K(g:/ /.4N"\ .4PE" f/N.N/.NPt`/N" `/ N!Br$"C i$ ( F%@I/ / Hk/.4N"p$f /.0N" X/.4N" /.NP`JNV|H?<&.(.Hn//. E!FN$ f,Hn//.N$ f p-@r-AB-nG9|N-HHn/.EN$Pf&.(n C*h/ N!Xg /N"X .rf n .ft`tUf n .f (.gp-@r < 8gp8-@B-nN-HHn/.N$Pf"&n$npfg / N"X .|܎rf n .ft`Uf n .f (.g"f m/ hTN$XfHx/ N"!B/Hn/ N!]$fNJg / N" X$nJg( *rffft`Uft`gJfJgl/ N" m/ hXNP// N"\/ G" N Jg/ NXHn/N"\/E" N/ N/ N!`f.Jff$ .f//./.N)1 $g..RHx/(<"DN*//./$<(yd BN".R-A|Hx/"DN(/.|/./ BN$./ // /9:,N 6$//*<"EN/.|/ EN$JfR// / Hn/ /N"$ m/ hXN/ N! /.N!EX/.N!EX L-Hf"t `/N" `/ N!Br& l$ ( F'@// / Hj/.4N"$f /.0N" X/.4N" X`J/,OHy?pN˂BHxHy?lN{4N^NuNVH?<,.&. $.&n*n(I/ /93(/.N!_ JfT Ag n h$hBJg>J fLJ$f *-@$g roepp-@$(.$ S bHx/N&/.$// Nh*gJg / N!2X .ff `x؎JfnBHx //NhJg"p e~ 0=3gtHx //N(yd Hy+/N)/`PJf|f/&<!<"CN$HXJg~`BHx //N(z`Hx/Np/"CN$H Jf .fpL/// HxB-|Hx/. F/(N@$*fpB/ N!*Pf^/-0N -"M"Xg mgr,+A]w"+@-gr€+AHn$//./ N!V"gJf +L*,-"+A -r€+ArÁfJf / N!X/-0N6/ N!PJf~, fJgBBBHx/ N!JgBHmXHy,[CNDr `r`//./ -@N!/d ".|g.Jf*-g&p`JgN/ N!z`@JfBBBHx/ N!JgjBHmXHy,[kNDrp`hHn$///./ / /N!rH*fB`&B& z`hz-`b& zB/N" X`d//NP`Z/,O n /./(B/( /(/(B//.N!`N^NuNVH0<&.*n Hn/N!Fz$PfBp-@B-nN9|-HHnN!Zj$XA!Eg /.NX`f&n/.N$k/ N!aT/ N"BB/ HxB-|Hx/. C/(N@$$(A" I!ahg/ N/ NP L< N^Nu*g/ N/ NPt`+g/ N//-/ N!w$/ NJfHy?lNXJ?pg/<Hy?pNXPHy?lN6`NVH0<&n$n (."D i(h$ ,-@*.&< pd(/Hk/ N)0 JfJB +$`/B/ N(/ / N!$fJf// HkN)0 `HxHxN& -@B(K@B/ NZ/BHx/Hn/9?(/,N!'$(.NXIJgHx/NP L<|N^Nu,./N)/(/+$/N=Hx/+/Nx L< N^NuNVH08(n n &BBBHxB-|Hx/./,N@$$fHHn/Np$$Pf6 n$hHx/ N"!PG"pg/ NXt/No$X L N^Nu/,Hx@/ N"|$/ NJf/ N" ^/ N!P`NV/ /$nHn/. /.N!F$ f>B-|TB-nN9|-HHnN!Zj$XA!Eg/.NX $.$nN^Nu$/.N RXpf&"n/)Hx@/N"|$ f /N"`t/N" `NVH 0 n$h/Hn/./. N!P$f,$j$G@Hx/ NZ/N" $/ N L N^Nu/,O/.B n //.N! N^NuNV/ /$nBBBHxB-|Hx/./*N@$$f(/ HnB n /N!P$f /.N!X $.$nN^NuNVH8<(n&.&ngfRg$l*j$(Y/HnNtPJfPHnHnHn - F //Hx/./. N",$ g /././ Nt@ L<N^Nu". n .Jf2/// Nt@//B.//.N||Jf&B`///// NHJf/.N" .&//./ Ns`p`vNVH0 &. $nBJfbHy:@Hy:PNuPJg@Hn y:LN$Hy:@NuTPpNg(Jf/.N!G&$HXpf B`&Xg:/././/B/9:,N!$/N!E $.&.N^Nut`t `NV n Hn/(/(/Hx/.NxJf n N^NuNV n Hn/( /(/(//.NBJf n N^NuNVH <(n$n &n*l re>BEHn/ / N!".P tcrJfcp&L<N^Nu$Q-BJg/B/ N($%mP `NVH8<&n*kB(Y/B/ I!N$ pf>&.PpcvHx/N$H !m/Hh/ N$f n L<N^Nu// NP`/,ON^`ՠ/,O/ / $n&n B/ N!mXJg,"hJ0g&/ HxHj/N!$n&nN^NupF`p-`/,OH8<&n AbK&<hIHx/ N$H/ //. CN$fBB0*P(rcxf n L<N^Nur ffHx / NP&D`t/ / NP`t`/,ON^`ԦNVH 8$n BBBBB-|Hx/. n/(N@$$fNHn/N!Fz$Pf&.Hn/N!$/N Jf/./.N"$/.N" $.&.N^NuNV`/ /$n $gpĀ//*//.N!jJfHx/*/N $.X$n\N^NuNVH0 $nBBBBB-|Hx/./*N@$$ffHn/./. N!l$ fL&.Hn/N!$/N Jf,Hx/./ /. n/(N!$/.N"  L N^Nu/,OH0 $n HxHx N&/* //*//.N!\$fHx /*/N$ Hx /N L N^NuNVH?<&...,. _r€$A n*hBBBBB-|Hx/./(N@$$f:Hn/. /.N!F$ f /.N!G&(XI!Ef/.NXt L$Pfb*.0ft/ N!B"m$ ) F%@%F%GX gbL gp `gLtHk(/.4N"\ .4Pf/N" XJg/N" ` gp f$ .4rtg/ Hk(Hk/N"z`HHx//.0/.N t$p$%|%|Jf`/ Hk(Hk/.4N"zx$f>/.0N" X`0p`zHx(/ /.4N"r$ g/ /.4N"\P/.4N" X//.N!Gh/.N `Ft`/N" `NVH8 n"n &.$.". . g(f LN^`B-@-A//./// /N!pLN^Nu/,O n /( /(/(/Hx/.N!N^Nu/,O n /(/(/(/(//.N!N^NuNV". ./.-@-A///./. Hx/.N!pN^Nu/,O n /(/Hx/.NFN^Nu/,O n /(/(//.N(N^NuNVH 0.g 93(Hn//./. NЬ$fHn/.N!Fz$PE" fp-@p-@B-nN9|-HHn/.N$PfH nGJfd"npg (f|/ / /N"$/.N"/.N/.N!EX/.NX L N^Nu 930`&t/ /N"\ .Pf/NX .g/NX`t`t`/N" `/,O n /.Hx/(Hx/Hx/.N!N^Nu/,O n /. (//( /(/(//.N!N^Nu/,O/./. Hx/.NN^Nu/,O n B/(Hx/NN^Nu/,O n B/(/(/NبN^NuNVH 0Hn n /N!Fz$Pf@p-@-|B-nN9|-HHnN!Zj$XE!Eg/.NX L N^Nu .GJf.fF/ /N"\ .Pf&/N" X .g /N" X/.NXt`/N" `Hx/ /N"r$ g/ /.N"\P/.N" /.NP``/,OBB n /HxNN^Nu/,O n B/(/(/NN^Nu/,O/. B/.HxNN^Nu/,OH0 $n peT&/NoXJgH"h "i,Jg4Hx/./*/* /*/N$/No$X L N^Nut`t`t `NVH08(n G r&@&/No$HXJg(#f/No$Xt L N^Nu h h,JgN ,",&'AB/ B-@-A/// N$f$/.B/ /,/,/ /N $`t/No$X`NV/ n pЎr"($("@"#B/.B//(/(/NL$.N^NuNVH08(n G r&@&/No$HXJg(#f/No$Xt L N^Nu h h,JgN ,",&'AB/ B-@-A/// N$f$/.B/ /,/,/ /N$`t/No$X`NV/ n pЎr"($("@"#B/.B//(/(/N$.N^NuNVH> $n*.&.pe.(<T g(<Hn/.N!Fz$PfB-DB-nN9|-H,fv/*N?&/*N4//N5/*N4//N5D-CHn/. N@$PA!Eg(/.NXJf /N>X L|N^Nu&*`$n/.NXJf B/ N" `GAgpFgp@/// N"|$ fJj/ N"$X`t`/,O n B/(/Hx/.N!ՄN^Nu/,O n /( /(/(//.N!ՄN^NuNV/ /Hn/.N!Fz$PfBBp-@B-nN9|-HHn/. N$PE!Eg/.NX $.$nN^Nu/./.N"$/.N" /.N`/,O/./. /.HxBN!N^NuNV`/ /$n $gpĀ/Hx@/Hx/.N!JfHx/*/N $.X$n\N^NuNV`/ /$n $gpĀ/B/Hx/.N!JfHx/*/N $.X$n\N^NuNV`/ /$n $gpĀ/*WID//*//.N!JfHx/*/N $.X$n\N^Nu/,O n Hx@/(//.N*N^Nu/,O n B/(//.NN^Nu/,O n /./(/(/Hx/.NN^Nu/,O n /./( /(/(//.NȨN^NuNV/ /$n Hn/93(/N!_$ f /./*/.N$/.N"  $.$nN^NuNVH0 $n Hn/Np$$Pf, n&(/./*/N~$/N"/No$ L N^NuNV/ /$n Hn/930/N!_$ f /./*/.N&$/.N"  $.$nN^NuNV/.gJ 930Hn//./. NN$f /././.N$/.N"  $.N^Nu 93(`/,O n B/(/Hx/.N!XN^NuNV/ /$n Hn/Np$$Pf"/./* n/(Næ$/No$ $.$nN^Nu/,O n /( /(/(//.N!XN^NuNV/ /$n Hn/930/N!_$ f /./*/.N0$/.N"  $.$nN^NuNV/.gP 930Hn//./. N$f&B/./././.N$/.N"  $.N^Nu 93(`/,O n B/(/(/Hx/.N!۠N^NuNV/ /$n Hn/93(/N!_$ f(Hx/./*/*/.NB$/.N"  $.$nN^NuNV/ /$n Hn/Np$$Pf(B/./*/* n/(N$/No$ $.$nN^Nu/,O n /(/( /(/(//.N!۠N^NuNV/ /$n Hn/Np$$Pf*Hx/./*/* n/(Nn$/No$ $.$nN^NuNV/ /$n Hn/930/N!_$ f&B/./*/*/.N$/.N"  $.$nN^NuNV/ /$n Hn/930/N!_$ f(Hx/./*/*/.N$/.N"  $.$nN^NuNV8H?<(n*n ?r€$Ax@f(93(GJfz/ NHx/ HjN)0v ?f/ NX ?fHx/ HjN)0 vJfHn//./. N$f :|Hx/.N"!/,/ /.N"|vJf` *"*,*h.*l(*f4**p]ID/ N!BX ?gHx/ Hj8N)0 ?g2, Hx/HjHG)0N JgHx/HjhN Jgp/,/ /.N"|$/.N"Jg6/.N" X`((930`z g"Hx / / Nh$ g2 L<N^NuHx/ / $<)0"BNHxHmHj"BNB`R ?f|HkNX`lK`fU`]`B`NV/ /$n Hn/Np$$Pf.B/*BB n/(Hx/.N!$/No$ $.$nN^Nu/,O n B/((WID//(B//.N!N^Nu/,O/././././. Hx/.N!N^NuNV/ / nE r$@JgtgHx //Nh Jf J ("g, B?cp$.$nN^Nu"$(%A %B$L<%@( ("g B?b"($(%A0%B4L<%@8A Hx//././. /.N!`/,O n B/(Hx@/B/.N!N^NuNV/ /$n Hn/Np$$Pf*B/*BB n/(/.N!$/No$ $.$nN^Nu/,O n B/(B/B/.N!N^NuNVPH 0&n$n $_pĀJmHnT/93(/N!_ JfHx/.TN"! nTPrgt/N"XJfH/+Hx/.TN"| Jf./N!B *"* B!@(!A,/+//.TN"|/.T-@PN" X .PL DN^Nup`p`/,OH0 $n &/NoXJg8"h "i + gJf/NXJfE J $n&nN^Nu (g @%HR`$j `/,OH0<$. y:,$hJfr%AHy;uN6X(mJfBkB *rlJS%@`BHy;uHy?ݔNP`r%A/N`R!@`// /, lN$ f(T`NRdARJ- g4/NHy;uNBHy?݌NPHy;uN6`B/NX`NVH><$.Hy,[EDrN(<3lXv֎*<E"D Y( Jf,Hy,\NBK!zN&HP&<!JfL<|N^Nu(PJgJLm*l|Jf(T`/-/,`Hy+,Hx / EN&y?݄Jf*m`̻fJf(Jf"pf/Hy,[NP/ Hy,[NP`/Hy,[NPrg k?f Hy,[NX`JgHhXHy+NP k Jg0,(Hy,[NXpf/+ Hy,[NPJf`Hy+NX kJgJ(g Hy,[NXJfJHy,[NX/+/+/+Hy,\NB.&k$`Hy+`Z FHhXHy+NP` + grg/Hy,\NP`Hy,[`Hy,[`/ CNX y?x(p Jf*pfHkXHy,\4NHy,\;N / N&HX`0g$(l `Hy,\[`THy,\m`L/Hy,\~NP`pgJgHkXHy,\4NP/,Hy,\CN PrgrgJfHy,\MNX`NqNV/ /$nN( *P-@$. ?Sg, BHh/HjPN( fp$.$nN^Nu$`B`/,OHn/. NI/,OH00$n&. $.GPpfDN(/</ N(p%@PUfHy?ݬNPX@-JL N^`U/</ N(4%BPUfHy?ݬNPX]gL N^Nu/,O nJgpfN^` h N^Nu/,OH8$nG@IML *rg]f LN^Nu/*/ NP`/,O/ / .$. gJg /N!XE!JfB B $.$nN^NuB/NPrgrgJg`/,OH8&n . ?ݤ y?ݠ$p I)1Jf J LN^Nu f +f//*/+N Jg$j`/,OH?<$n.Hx Hy,\/ G(ydNHx Hy,\Hj NJg6 9?ݤR%@DB@BGI6K}6.B *@"*Db BL<$n&.BG((<"jI6K *?fpg Hy,\/ NZ *P-@ ."?*JgpJg /NXJg /*N6/ N"/*N ,<!/ FNXg/*N6XL<|N^Nu *P-@*.&?f g//HjPN( f`N/ DNXJoJXgHy3vHy,\/ NpfJg /NXJg /*N6/ N"/*N B *P-@$.  @g BHh/HjPN( f?Sf NpfJ\f/ N:` y?P$:,gtJ fnpf4Hx/ N"!PJg\/*N6/ N"/*N `Jf8Hx/ N"!PJg$Hy;v/ N./*N6 `vJg`v *P-@ .f *Hf*g~Jf4Hx/NbPJf"/*NHx/NZ/*Nt`*Jg& *D"[I-@-A//Hx.Nm jJp/NX`Jf/*NB.Hn/ N" J.f / N"XB/*NXJ.g0/<HjPN(4p%@ *P-@ .PgHxHx/ NP B`J.g/ NX`$` <;vJ\o <;v/`/,O/ $n j *Jg!@ j %|;vNE"%@B j h%H jC!IHy;vN6Hx/ N"!/*NHxB/ N-|;v$nN^`\ j!@`x/,O/ $n/9?N!aT/9?/ N!d|/*N%y?HxHx/ N*Hy;v@N6BB/ N\ $nN^Nu/,ON^Nu/,O/ BHy;wN!g#?hBHxHy;vE{4NA;vB#;vB;v#;v;vB;v#;v;vBBBBBHy,\BB/9:\HxN-#?ݜ8BHxHy;v@NHy,\Hy?ݬNM. 9:p#?ݨHy?ݤHxHx/N$#?ݠ .!Hy,\NBHxHy?NFHy,\Hy;vHz Hy?EfN.,\Hy;vHzHy?ݴN$nN^Nu/,O/ /BHx/9?ݜN3$HHxB/N(HxHxHy2/ NC%np%@$BHxN}%H$ /N˂%Bp%@ J $.$nN^Nu/,OH 0$.&n Hy;vN6BN" $HHy;vN;v%B&"j Q%H g$C!I j %j-SL N^`jA#H`/,O/ $n/*N~rHx/ NCNHjNːHx/ /9?ݜN4V$nN^Nu/,O/ $n j *Jg6!@ j Hy;vN6/ N" P-|;v$nN^` j!@`NVH?<$.Hy;vNX&YGIK!/BN$HPJf(/N0/.NbP-|;vL0&n&. (.$n*.$+ jf(Hx/N"! "+Ӫ,݀$/N" -E-J-D-C -BL |N^`eNVLH?<&n&.$. *n ."_xȁ(D,+$k~gr€-ALA"!g>Hx/ N(*+Prgr~gJg:|/ N"X L<$N^NuHx/ NPxf(HkN(*+X~fHkN6X`(*+pf`␀JoxJo <rlr$<v/-BP-CT//.P-DP-ET//.P/ N"H*@JfDJg n !CJLg,&'C`"Jl <BnLօՄ`// / N"|v*@ Jf*l,(l(Jmd <r. mN" ֍Ձ`L$<B`@:|`NVLH?<"n&_tƂ&y:, n (*( n$$i j|g~g>|fJl8| L<$N^Nu".B,<~ "lN8|T` j,(.( 93J"93Jf n Bp n$ I`g2g|Ć~`g" ) f.g8| `jp`r`|~΂ggHx/ N"!/+// N"|v(@/ N"Jf C (|&fpp*@.g j(fxrg y:,/(/./ N"(@ Jf/ N" ^XJfh& p*Jf JgfJfHx/ N"!~P`|`.g`8|`\.gN`r`B/ N"^X` IJfDr€/.-DP-ET//.P/ j/( /(-@LN& .LSJfJf`"`A"!Hx/ NpP%@Hx/NZ/*NjJ/*N6/N/ N"XBHxHy,]1/ / N Jg Jf p̀ n n$ n `8|`J np `/,O// n&(Hx/N"!/. /N"$/N" $.&.N^NuNVPH0<*n&. &n _r€(A$m *rereSgt`_fN9|//- / // N""$f taf/ N" ^Hy:N y:, h h h$( !J Hy:N6 Jg/N" ` @ffHx/ N"!N9|// / N"|v$&<"Jg / CNX`:pf HmNX",,&pf HmN6/ CNPB L< 8N^Nu/ CNX` fB` fzf8JmHx/ N"!B/ B/+// N"$.N"`^ fzfH$kVHx/ N"!B/ B&[I-BP-CT//.P/ N"$.N"&` g<`Bt`4/,OH>8 n(n &n$hr¨,t ( vfDjt0DfBJk jJg(gB@gBgB Hx/ N"! ",'@'A ,+// / N&f6/.// / N"}&.gg6Jg +"+ ()A/ N" L|N^NuglB`d*B۬"ӄ(`NVH?<*n(n &n..$mp,"- Df@$ f@@g@$fn|̮A"!fdJgfHx/ NP ",'@'A A"}rrffJgT&+/// / N$*B۬ ф(`NB `Hx`Hx/ NPpfHmNX`Hm-HN6/// / nN$/ N" L&.*.,.xFȮ fHx/N"!PHx///N"d$p-fHxB///N"$Jf /N"X L|N^Nu/,O n P  y?"p N^NNV/ /". .$n/ -@-A//N!$$ f2Hx/N"! n/(Hx/N"{ $g/N" X $.$nN^Nu R/(N RRX R/(N6/N" `NVH80&nBBHnBHxB/.BN", JfV$n&*pf j(($( / N"/+Hx/ N"/Wf&/ /. -D-B//N"4L N^Nup`/,OH <&n$n (k/+N%T(XBKJf)B-kL<N^`/ NX$j`/,OH8<(n&. *l/,N$UXfh$j*BGJf+B-lL<N^`/ NX$j`"h!iJg$K&kB/ DNX J$KJg&jf`AB(<"<`/,ON^Nu/,O//"n&)$)( )SЂLB @ S"ҩ4LB҈tpԀ SЩDLBJnpЁ$&N^Nu/,O// n". . $(4ā h0 p,Jf $&N^Nu$(&( g P`/,O nJ,VIDN^NuNVH<0$n*.(. v *$.GJf L 8&n. kPJgJo // NJPvxBI $kXBJg**,*JfJg Jf $E`B`JgBrӫ,+݀'F j *Jg@!@ j / NBBB8B b2p bQ bY ?bUJmSN^Nup `B`/,OH08$n&n &.$.+g4IP/ N + Ѫ +$ѪX-LL N^`$L N^Nu/,O n/(@B/(%D8%E<%B@%CD/ N/ NP`/ /NP`4d~`>B`8-FB$.&.".֮Ձ-HB .".쒃nJ-IB".䕁`4~`NV". .B-@-A///./. /.NpN^NuNV". ./<-@-A///./. /.N>N^NuNVH?<$n*. (. *"* n$&(,.l$&(j$-C. -j-j ,**jG($ch///NP.$.&.ցՀ//N(Ԕ $v| 쩂-@-A/// //N"J6Jfڇ,.윌؆$*&*,*///NP.,*.* ށ݀//N(Ԕ ,~~ -@-A///*//N"J6Jf:-DB".֮Ձ(***,* .*$ޅ݄n$& n !CL<&n(.*. &..IP/ KN +4"+8X$<6n&Jg// +X/Hy,`NDrR4/ BNHxHy?N$H!E!D !n/ NB k0%H 'J0Jg C E/ BN L<|N^Nu4|#`/,OB/. /.Nb N^Nu/,OH>8&n&.$. (.HxHy? N$HIP/ N "+@ƒ k< p Jf>%B%C %D@ k<"P$g#J %HRD-LL|N^``*(,( g P`/ N6X-J -|? L|N^`DNVH?<.. ,.". .(. &n$zڎtʂJm cf&L.8 cHn/Hn-@-A///N"$fd/N(Sp.HxhKN$HHhTNDBHxHjPN{4Hy,aHjNM.B A %HBHCH%IL$%n%G E "(%@%A%D%D%n(X%n,\p%@(%C$ I N∰c *$@"*"*%@0N!r @%@,p"*rЁ%@( *0 GLh%@8B,C,%I0Hj@HxBHxSN$%H +@"+D%@@%AD%@8%A<$n|܎p̀z"*Hx/<N&PBBGI"J j0*pLJf"R4c/</N L<|N^Nu -"- F !A//// N$f/- /-/. //N$f*U`NqNVH>8(.*.$.(n&n E r$@Hx/N"!PJg-E-BA$p%@BB Jmz%BB l%h0A, /,/.///. /N"&Jg:&B//Hy,aN`/N" L|N^NuBBA`&`v`/,O/ /$.Hx/Hy+HE($N Jfp$.$nN^NuHx/Hy+N Jfp`Hx /Hy,bN JgHx/Hy+6N Jf`/,O/$.J?tg/N)/<./Hy,b N` $.N^NuNVH?8(... *.(n&.&n,.$E r$@Hx/N"!PJgN/+HnB///N"$prYgJfgt`g/N" LN^Nu-L-CA$p%@BB JmP%C%@ k%h0/NB// Hy,bN`/+/ ///N"$ n  (`~t`x/,OH< &.*. (.$nHx/N"!/N/*///N"d$p-f/*B///N"$/N" L<(.&.*.$.(n&n E r$@Hx/N"!PJg-E-BA$p%@BB Jm~%BB l%h0K, /N/,/ ///. /N"&Jg:&B//Hy,bN`/N" L<|N^NuBKB`&`v`NVH<(.$.*.pgB/. ///N"&/NC/B/-@-A///NC",L8,.$n Hn/Np$$Pf n*(&*(*Hn/B//Hx/IFN$Go$fXJg֮JgHn/B//Hx/NJg rf$B n .Ю /NX L|N^Nu$/NXr-ftV`NV/ /$n BHx&//*NhJfNHn/93,/N!_ Jf4/NZ/.///.N/.-@N"  .r-fpV&.$nN^NuNV/ /$n BHx&//*NhJfNHn/934/N!_ Jf4/N/.///.N|/.-@N"  .r-fpV&.$nN^NuNVH0 $n BHx&//*NhJfJHn/Np$PJf8 n$(/NJ/.///N/-@No$ .r-fpVL N^NuNq/,OH 0$n&n $. n SreV *&rf/N!XJgL N^Nurf/N!X fB`/N!`/N!X`&`/,O/ /$n$. /*N j Xg //NXP-j$.$nN^`/,O/ /$n/*N j$. ĨVD.N6$.$nN^NuNV/ /$n-|3|-J-n HxHnHn/ N$f jHn hN$/.N!P $.$nN^NuNV n-|3X-H-n -n hHn hNN^NuNV n-|34-H-n -n hHn h NN^NuNV/ n-|3-H-n -n-n hHn hN$XfHx/.NlP $.N^NuNV/ n-|3-H-n -n-n hHn hN$XfHx/.NP $.N^NuNV/ n-|3-H-n -n hHn hN$XfHx/.NP $.N^NuNV/ / n-|3-H-n -n hHn hN$Hx/.N JgNJfJ$n/*NX *?g" <.g <//*NXP/*N6X $.$nN^NuNV n-|3-H-n -n hHn h NN^NuNV n-|3\-H-n -n hHn h$NN^NuNV n-|38-H-n -n hHn h(NN^NuNVH>0$n-|3-J-n -nHx / NPg n (("(,vxgx&n/+N(+ *+$/+N6P| jHn h,N&XJg*pJg n"(($(,cp Jf //.NP L |N^NuBBB`|B`NV/ n-|3-H-n -n-n hHn h0N$XfHx/.NrP $.N^NuNVH?0$n-|3-J-n -n-nHx/ N|PJg n,(.( &n/+N(+ *+$/+N6P6| jHn h4N$@XJg. n ("( $&l$&c(p//.NP L N^NuGBBBB`p`NV"nA r @ 3!I!n !n !n!n"i/ i8NN^NuNV"nA r @ 3!I!n !n !n!n"i/ iv`B`NV/ / $nG r&@ * f~fB$n&nN^Nu*f,*g j h'h/* /*/ N ` j h'P/* // N Jg`/,OH 0$n j"h&i/N"/9:, * /BB/*B/ k4N$ Hx/*N"! L N^NuNVH08$n(j&,g j"h&Q/N" * -@HnBB/ B/ k8N$f*fkBHx/*N"!P L N^Nu*gp#f j hJg`B`NVH?<(n&9:,&l$kJfHxHx N$HB/BHxHnHxK {N$ gHx / NP L".PTBS*p"Er &[I z " ,.o "-AhHx/ RHv pHnh .P".TB ч-@`-Ad//.`/ NV .lRѮhBAp-HB$.hmJ.[gblv &[I,,(֬,Ն/N j P/.\/.hHnp/ hN,/ NeHx/NZ Jf,n[Y`B`\B8B<`/B BHp`-Lpp-@hBlB.[`L nX$J.[g /NGX B (("(,-@P-AT,.0..4m> .P".T,.H..Ll(Jg(Jf"/NYr/NXt/NY R`JgB/Ny B ( PDf:$!@ ".D@fHxNr/NYr/NX/NY`/NZ X$.D@fR?O`J,gxJTgpI@$<ML *JTgZ// BNP`Jf`dBB.X`/,O nB/(/(/(/( /(/(N"jN^Nu/,O nBB nBBN^NuNVH8 n $."P()(&),Hx//NiHyoVHx/.r //-D-C///.NfLN^NuNVH8 n $."P()(&),Hx//NiHyoVHx/.r //-D-C///.N LN^NuNVH?<(nG r&@$l y:,-h$,-l-l l"P&, ,$x@ȀgTgJp /B//-n-n/././ NV , lJ WID L0&n n $.E r$@"y:,&)"P()(*),Hx//Ni,-@p -BA$p%@%D%E %@%B/ NvX/B/ / N"}&.NRT/+N6Hx/ N $Hr k/( //N($ %@%A%F0%B$%B B%C/ NoV L |N^NuNVH?<&n$n .rҎtā-B kJg^J8gXWID-@"j"Q,gb+fZJf4-jJfRJgB k"h4-h8"i L8(n&. (.$n&n(..3/ / l$N$PfJfHn/. /./ / lN$g&.,.(.$.*./Hx/. N"| Jf( g"Jg-E-D-C -BL|N^` L|N^Nu/,O n !|!|!| B!|BBB B$B(B,B0B4B8B/NXf2"3h pDf@g@@gb fp `XR`"*A 3rgQgFR`/./NPJn*f"3 pDf@g@@g|`BLHl/ HhN f n n !E/*N6 L<4N^Nut`t`/,O n/(N"BN^NuNV/ / n"h$i"* * "itg8tfV/(/(/( /(-A-@//N$.$nN^Nu/(/(/( /(-A-@//N`Hy,ewNK./,O/ / &n$kpfD j h P + Jf/+ / N!P$n&nN^Nu h// h\NPr-f`B`NV/ n h h ( "t B/B -@/BHy,eNDrB$.N^Nu/,O n (Sr eZЀ0;N::PP$0P:F h BN^Nu h ` h p ` h ` h r `-HN^`NV nBBBB"h"i )X//N!:4N^NuNV/ / $n *-@ .gLHy?NXGML *-@ .f-|?$n&nN^`@Hy?Hy?NP`$n&nN^NuNVH?<$. B$h,(/*KN(*"D.)&) (iHx/ N" Jgp/*G6N *XrgYf6Hy:N y:, h h$(Xp Df"B fHy?Hy?N/ N):xPJfHy?NPX-|?L<N^`=Hj/ / N fL<N^NuNVH8&nE r$@(k/Hn/ N JfF ,rgFYfb/9:,/+/+ /+/*/N~ n/(-@NX .LN^Nu/9:,/+/+ /+/*/N`Hy,eNK.NV/ /E r$@/Hn n/(N$ f/*/N( n/(N $.$nN^NuNVH?<(.&.$. *p"ꉂ ҃тz?ʁK"I6|̮Hy?GN$p]?XJfHy?N6Xp` jfD ("( f6/*NHx/ N Jg(JfHy?N/ N"P`/*NX j$P`Wf( j hJg/*N j h$h/*NPHy?N/ N"PJf n L<|N^Nu/,OH8Hy?ENC?X J$QJf$X?fHy?N6XpLN^Nu&jpf$k$jJg(j(l .g$S`/*NHy?N6/ N" Jf n `/,O n h h P N^NuNVH8&n 'r€$AHjHn/.NL JfT(n l g>/9:,Hx/ /<@dz/*/*NJfHxHjHk XN(yd /,NXLN^Nu/,OH8<$n&j(kHy?KN| +Xg:", R)A p'@Hy?N6HxHx/ N"{nHy?NGMLJ,fZ&j$+&+ (p"ꉂ ҃тt?‚  @?"p?f0 iB-|?L<N^`+Hy?Hy?NP` i"P`/,OH00&n k$hHy?N&+B$* S%@Hy?N6PGSf Hx/ NPHx/NPL N^NuNq/,OpdpN^NuB`/,OH0<$.Hy?KN&y;wXJfHy?I6NXJ gHxHxN$Hv0/Hy,f)HxHp8NE$BHxHjN{4 BHxN}%HHy,f/Hj$<M. BNHy,f7Hj"BNHy3#Hr8Hj8Nz$JgLHy?N y;w%HXgC!I#;w%|;wHy?NX&J`fHy?N6X K L< N^Nu&k`/,OH8 . (.$r B /N$HPJgr&/NX g< `gB *%@f *Jk@%@/N6XBLN^NupĀp`rāp`p`/,OH08&n$n HxB/ N( +"+ BvdBr%A<%k ("+$%A, +(%@0%k,4L%A8HxHy,f>HjI(N5| HxHy,fBHjN%|HBXB%j<B*5|$VEW%|VEW/+N(_\5@L N^NuNVH?<&n$n K8/ N4XI6J$g-j8-j< +rª,Ug>(+z`ʀ// / N Jobp, @&0I B׮ .т-@/+N%n@%nDBA-H&*$%C-j0XJn&$QIK6&<"T$nJfB`F$+(kgD-B[I-A/./././.N(-@-A/./././.N( @  kJf "($(-h-hzf B$"[I(.Үф///./.N(4(* `D-H-IR .".(,Ҭф @"A(.*.c .蚮와BBB/./9?N3 JfhE4V nJf`/+NBB/ NJp LHxHx&Y/BB/EN@JgHxHxBBBBB/.HzHy,fHy,fHxHxB/B/N<(.*.$G r&@Jghpf^HxHn//N$fHy?KN(y;w .XJfE`f&,BE,<)/0&. ,.*.$p Hx /N$HPJg(/N&jrā *XrfJf-F-C//NPpg*gfB0+l\ J3 gPp$*"* g, `g,"*%AB/N6X L |N^Nu%B`Ԁ%@`t`t`NVH8 (. &.$p B /NPJft LN^Nu(grā$hpg$  2 f *(r L2) $`/9:,Hx`B-C-D//NrJf  2 f> *(r L2) $/9:,Hx`B-C-D//NJgL`Ft`NVH?<.. -n*.&n&.pЎxȀ-D(p "-A FgHy:Hy:NuPJgBBBB/BBB/. y:N$Hy:NuT JWID//.N&$HPJg nN9|-HHy:Hy:NuPJgHz(/.// /-n-G//. y:N$Hy:NuT pNf Fgdbx dmgZbL @dgP @dg AdegFb @(d}g: @dtg2`zN`$`2p`4N`$` fRg*fBt` Fgb( d{g ~gg dgc  d|f ` dygC8-I/.// /-n-G//./ N"$pf dmglbN @(d}g AdrgvC-I/ NX @dtg t`tft `T Adrft`& dwg ~gfRv@/*B/ /*NX$g^prg L"n-Q-i/[I//./.N((.*."n"#E"n ")(g*.؊g(.*.ܚc-@-A)@)A**Ҫ х`!n!n `2p)@HxHxN)Hr()D)E BB j "0ڰف RPeB%| r%A(%|$**(* v&r ⫆%C,Hx8BHjHN(%EH%DL%|P%|Tx%DX%C\ j *"<+i,JoJf"<*Ѱ///Hj0Hy,gNOHBI0KOH`BBK`> ("((.*.dJg(-*-c*H ` )")(-*-e l *.!\R `Jf"<*Ѱ//Hj0Hy,gNOH`X  j/(/(/(/ Hy,gNRe/* /*/ Hy,gNOHB*/ Hy+i+Hj/ Hz.BHx 93z/N((0g/Hy,hNDrPBI"*f *//INHx/.NK"/-B촮m +//.N +//.N/.N/.N6/*Na$`/*Np/*K6NHx/.IN +//.N +//.N'n&*(* 'C'D -n-G//.NB/.BN,/.N/.N#J0`hx`x`  A/(/(NRP`/.Hx"n/1,N$.R `/ DN/9:/*/"FN`P(/.Hx j/0H CN j/(/(NR`\/(/(NP jp ԀJf *//*N *R//*N`,B`/.// /<@dt j /0N$f" .Jg"€R*eB&`BBIK""`/.// /<dv j /0N-@gJf$Re`t`t`t` Fc Ff*fp f +SH@J@b%k%kp %@Hx +/IN-HHx +/N-H +//./Nh$g< +//.EN +//.N` dhf`/,OBHxHy?N{4BBBHxBHy,hABBBHxN-#?4N^Nu/,O/9?N3&Hy?N{VPN^Nu/,O/".p ep$f PfpUgp$N^Nup`p`/,OH8 &. $.BBrƒ(fBE(HxdB//N(f*HxB//NWDLN^NuB`p`NVH?<$n,.*B"<d//GpNP*Jg` RI[I$&D@(B*CB"<ВdG(HxBt&uPHjN/ /*Na *rl-BL$((p L0(9 /9:,Hx`B-E-D// k NJgP`Jt`NVH?<$n,.&.-n.. .$&jt"*! !g pL4i g f&Ah (Jm-G[I-A,...ރ݂"[In"([IցՀ .S,܅LE`Jn JgTB`*d*/-B-C//././ kNJf-EB..֮ՇL,X(ۮ`B;w`/,OH0<&n$n *ktHxB/ N( + "+$ BvlBr%A<%k(("+,%A, +0%@0%k44L%A8HxHkHjI(ydN5kHxHy,fBHjN%|HBXB%j<B*5|$VEW%|VEW m(Jg/ /NP/ N(_\5@XL< N^NuNVH8<$n(.". &.*n .G d{gb2 dwg (d~g dmfg*ft` dgbj deb(jt/. // /-A-D/// N"$pfp dwgTb Adrg~ dmg` @(d}gxt`> dygp d|f`lft ` dwb< dvgN AdegDc AdrfV`4 @dg* @dg `: dhf0` (d~g< ~gfpt/ N/*B/ /*NX$f` dgfX r T/*/*/rF€&[Iˆr -B-D//N8$/ N6X` *Jg%@B L<N^Nu` *Jg``/ / N#%RP`& /N *Xg,/NbHx // N(ydB/N6B$`tt`J frB-Hx/ HnN_$ fb& /N$*XG6f%n/NX`2//.Nb%n/N/Na` t`NVH><$n$.(jt&jHxB/*N(/ / N#%R r T/*/*/rF€*[IĄr -D-B//N:8$(gp(jt&jHxHy,fHkN(yd l( Jg@/ /NP/ N(_\7@X*g-BP-J -|*BL<|N^`@|`*g(+( cp $*( cr ,+<-D[I-@*<(4/././B EN(@*A-B[I-@/*$/* /./. EN$& " cZ// P/-L-M/ /./Hy,hQNDrIB( PKDrB0+m^L<|N^Nux`NV//&. $.-B-C//N/.HzzB-B-C//BHz N $.&.N^NuNV//&. $.-B-C//N`/.Hz,/<-B-C//BHzN $.&.N^Nu/,OH0 $n/*,/*(N$*(&*, ("(%@(%A, h hdPJg hJg/ NX%B(%C,L N^Nu/ Nf`NVH<0&.$n GpgtHx/ /Nv$ xgv/ N)// "EN$&/ EN-@-A-j-j .".BS҃т-@-A D$(&(pr҃т @"A,... މ݀ F"GP,...Ğm .".,. oB .".̒m".$.,. o D((` DHh/.N)/`PJf:/ NXt-B`6/ N6Xt` "G Y. JfJf5A B,R`/.HhN)/`PJfHy?@N/ NSx jPJg!j j / N6/.N{V/*Na/.NR/ NU&t-B`///N)0#?H#?DHy?@ CN/NU&HxHy?@NZP`Hy?@"CNXJg/NU&`> F Hy?@"CN/ HjN? Jfl * //*Hy,ipNN`HxHy?@NZ *  y?HB Hy?@ CN/ NSx jJg!j j / N6/.N{V/*Na/.NR/ NU&t `v-C`zz-E`rG6,*.* D ("(f/ "EN$&/ ENP*,g/ NX|-F/.N{V/*Na/.NR/ NU& .L/ j/(NPJf,/N;Hy?@NPB/N@PL< N^NuR`|/,OB/.NPN^Nu/,OHx/.NPN^NuNVH?<"n r€$A-Q )-@A%Hr%ABB%@B n h%h0B 8|t/ K-IN n&h|X(<&<(ydzڊK-M, . "nJf B*n#mx/ N6 L<*.BHy?@NZPBBI)/`K;G,<Dr?De*Hy?@NXJg /N@X B L<|N^Nu y?H$p<Jg4(g0/HjNPJf"Jg"/N(/N///Hy,i FNR`/N$X`/,OH8<&n BHy?@NZ(9?D(y?HPK)/`$bHy?@NXB`:$t,Jg@&g(&Gh/ IN *l K6gR%@l-jp/ NX|*.Hx/N (H!|p!@!D(!C,!n0!n$!n !G8!n.Xg@BBHnTBHx/</BN$.N!EXpf////N`t `K9|N// /.TN"|v$ A"g(/.TNN/Hx/.TN"/Hx/ N` .Trg(/NN/Hx/.TN"/Hx/ Nt`$&+((+,%C%D /N n X`/,O/ /$nN9|/Hx/N"/$Hx/ N $.$nN^Nu/,O n ("( N^NuNVH8&.$. (9:,N9|/B/BHx-B-C///./. n/BN"0 LN^Nu/,OHx/.N N^Nu/,ON^`/,O n hhNBN^Nu/,O . f}g>b* @,tgb @f{g @twg p-`& f|fp` f~g tvf` n fN^NuB`/,OH<(. &.$.". z Jg pL0 . ".$n$v xe:B jJg&Jf"&|#T|&փ"R")f6P$S jJfL |N^Nuv g-A-@L |N^` x e2s8N2~~~~~~~~DR *"* Bxdp`,Fxfx//NPPJfx**  *&< d&&y;{Hy;|NB/// N/ /HsXNx Hx / -@NjHy;|N6 .`x`t(*** BreJ &< d&rf,p///NĎ Jg/ //Nx `pp`vfB`xfp`zxfB`b/  c < //9;{`p`H/,O/ / BHxHy;|N{4HxBHx /9:LGfN$@HxHj //9,Nxl#;{(.BHx /9:LN#;{$n&nN^NuNq/,O/". t gp$N^NuB`/,OBN^Nu/,O//$. n"(pe@ v JgSgp$&N^NuJf-H$&N^`?8!|2hB`p`/,O//$. ."v JgSgB$&N^Nu-@$&N^`>FvE`/,O/ .". @td-A -@$N^`BB$N^NuNVH?<$nN9|$BBBBB-|Hx/./GANJfBBBBB-|Hx/./N(HxHxN&$BGxIK}6,<.*f6BHxB/N(Hx/NJgxJftLHy,r/NNzP& L *(r L2) $/9:,Hx`B-C-D//NJgL`Ft`/,O/ /$. /Nb$H BBBHxHy+̏Hh N_/NHy3%/Hj0NzBBB/NJf-|) -B$.$nN^`$.$nN^Nu/,OH0 n &. ;lRf  k/Hy;N;$HPJgP(gHHx/(N"! n/(//*N"|v$/*N"pgJg L N^NuHxB/N( B`t`t`NV//$. &. r /Hy;N;PJg<(g4/.HyfB-C-B//BHzN $.&.N^Nup`NV//$. &. r /Hy;N;PJg@(g8/.Hyf/<-C-B//BHzN $.&.N^Nup`/,OB@ @#bF$N^Nu/,O n . 0 "93g$ "Pg "g " VIDN^NuB`/,O .B@FN^Nu/,OH><&n"+, x /Hy;N;$HNb,PJfp'@'k$/ N "X` *g(j"+$*LlP(Jgr'A`g+fx 'D`Jgr«,Uf/* /*Hx/ NvJo ,(r /B/+<$n&. ./ N$Xf( FIf xgƪ|gJf/ NXt L<|N^NuG0/ N#Ej/ N,*Hy3&TN\(Hy3&N*KI!/N&ւXgHx///NHx///N Rpf*gdvN$/* Nax/NdjHj Nu ( Is *$f@%@Jf&Hy,kNK.v`BHy,kHx/N`/*//N"//*N>BBBB HjN"/ N`NV H?<(. -n$.$n,.(n ?r€&A*v & Ff@/// / Nr.f *+,+%E%F + "+$%@%A L debP Fg" (Fg dwf -Jgr@+A` Fg (Ff/ N:.Xfz *fXxDjmHn(/N!Fz.Pf.BBHn,B/B/.(BN",. g/.(N!EX/ N*X`x`/,/ /.,N"|v. A"f<"n,rf.*+,+ +("+,dm*g6/ NX~-` ~-/.,NX/,//.,N"//.(N!E`n/ N+n, +(&r"+,z +@+C / /<Hm/<@d/+/+NJg m h+hJf+|*gHxHjHmN)0&-  bf.-g,-gp -m-m Jf$ LL/B/./.N(+A*<(4/B/B EN-mB /./. // EN .B// EN*.,.dD~` -"- B,<+|d>| +Fv@+C&z | 쨆+CHx8BHm@N(&- z /B/- /-N(+@@+AD+CH+mL+mP+mTB/./N,*g| /,N?+HBHxNT&-H0 - r c <-@4A0'Hr'ABBB'@/ NvXHx/-N"!/-B/ /-N"}r.*<"GU&Jg$/- EN/NP`4v+C+C+A`BB/9:,/-Hx/-N!T./- EN/N Jf mpgbp+@ - r %@ Fg - $r"-v 稄%B %@$z/N$ /Hy+i+// HzvBBHxN(.$Esfd-gR/.NHxBHy,lBBBHxHmNz .N/.(N!E/.N#J0 B`BHy,lHx/N`A//|ʆp// Nt.`/ N2.Xfrp/-B/ /-NX.E\grí/ N`$ dggtŭ/ NX`jT/-/-HzftFă"[Iz -@ -D$//N8.|ͭ/ N`tĀ+B`zʀ+E`/ / NP`/- NbHx // N(ydB$`|`Hx/-N"!B B$B/. /.$/. Hx/-/-N". .N"`~`0p`/,O/ /$./Nb$HX(f./N/* NaHj0N B$.$nN^Nup /HxB/NJg`NVH?<$npЎtĀ-B$* f4 j&(/93T/GNPJg/930/NPJfB%B * f$*Lj Jg@%@N&$jA-H/NuXA-HA -HA0-H * g @%@/.Nu/N,BN/* Na,*HXJfBHy,lHxHj Ns`*g""*$ S%@$ *到f Hj$NuX/IN jX&<#aJfr+A/ N " CN$X`L CN$Hx/.N&H/N'J CN$ *(lR%@(/N/.N4/ N -'@'m'm'|#tb 'MT j'H'h'm00'm$$'m j/(N!(j j*f`-m-h(B/-D/-@/./.N(4-@-A l (n <.+$'GIBB-@[I-AK"BHx/*N"!Hn/.Hn/./././.N(-@-A///*N,.N"XJft nfv|$,.f*k/-NRT/-N6PJgH/// N j/(N!N\`BHy,l#Hx/.Ns`&/./././.N((*".[I/./.BvցՀ//N(4-GB$& .".l$.&.-CHx/.N (H//.// N ( r "[I n(*(ځـ)D8)E<(.g@/ /.N"TB-C(.*.ۮ .ф-@Ԟۮ".ӄ-AP`$B`/ /.N"TP`$+BHn/*Hx Hx-h(B/-D/-@/./.N(4-@-A///+$/+0/ JWID/N"0 '@'n ,-@ ., o2Hx/NZHxBBB/./././ N" Jf/,NRT/,N6P/ N "X`/,OH 8$n&j(jTN($ */ *$/Hk0NJ +(S'@( f Hk NuX/N>)j)j/ N / HkN P-LLN^`2/,OHy;|/9;N+PJg//9;Hy*0ZNN` N^Nu/,O n"hJg""P"BN^Nu/,OH?0&n$kp y:, h%h`&. f /*NX"*[I'@('A,J*6g**[I,.ށ݀'F('G,J(fJ,R`^IDJf /*N6X L N^Nu/,O/ $n/*N *Xg%@ BBBB(B,B0-j$nN^`/,O/ HxHxN$HPJg`!n Hy?lN"y?dXJgJf4|` .g"i(`$8#J8EHy?lN6X $nN^Nu4| `/,O/ / &n JfF n$h'|3&h'Jp/*N/ HjPN`/*N6B$n&nN^Nup`/,O/ / &n$kp/*N/ HjPN` -j$n&nN^`/,O/ Hy?lN y?dXJgJfHy?lN6Xp`N .f $h8"JJf h(` ". g$@`f(!@8Hy?lN6p./ NPB$nN^Nu I"Qf `/,O/ / &n$kJ+4gB+4B/*N$PHkN/9?hNQ *,Pg f k hBB&j8Jf $n&nN^NuHx/* /*/ kN&S`/,OH8<(n$n &lHxB/ N(/+NHy3&N"+t xFȫ&[I‚$%AHxHkHj0K)0N HxHkHj@Nt`HxHkHr(NHxHr(HjPN .N4%@/,N4%@ %| /+N6BL<N^Nu/,OH08$. n$hHy?lIN y:, h%h`vƂpAXG6g:/*N/*NPJfJ*6f *5f,Jg&vEƂ/*N/*NPHy?lN L N^NuHjP/9:,N`( * PgJ*5f/ Hz`/HjxN|5`/,O/ $nHjNPXJDg /*N_X/<BHjPN` $nN^Nu/,O/ $n/*NX *5f|5Jg/ NX-j$nN^`ࠎNVH 0HnHnNtPJfPHxHxN$H!|p!@<*n,.$m y:, h%h`HjNX F hf"/*INX *5f/*HjxNXP*5B*5/*G6N/*NP( *<N,Jf(-#gR *g%j%@%j BB /*N//*/*Nx$/*N%j BB`XJ*6f f *f/* /*/ EN$ pg,pg&p#fJf$*g%j%B`pJgJ/*NX L<|N^Nut#`t`NV/ /$.BHxHxHxBBBBB/.BHy,l)Hy+_MHxHxHnBB/EN n@JgHxHx/(HxBHy;|hBBB/.Hz&Hy,l5Hy,lZHxHxpBBB/NDHxHx n/(HxBBBBB/.Hz@Hy,leHy,liHxHxBBB/NDHxHx n/(HxBBBBB/.Hz0Hy,loHy,lsHxHxBBB/ND$.$nN^NuNVH?<&n . ..$n n$C" t‚*Arf"tgv L&('j,` f~gbt B}bB Bob @Bkf/*N jXJgpШHx// N)0 `* f|g f}f/*N%SD/*NP` Bzgtb Bmgb tvg Bgf(&+fBJfpHxHx N&H !DBP BgfxBHy?lN/*N$*KPN(*/ N/9?hNQ/*NHy?lNJgj/N` Bgj` BfgRbB Blg BlfHy?lNB+X KBJfbJgp y?dJft` Bwg`/*N/*NPJf8$n(n (.Jgz$*gz*$* S b04N@ @f,Hx/N"F&H"LPv(|#d04BUB Bb*Ԃ44(N ``pRFzB`z`&`4B B`g @ B`b J@g B@f` @gB`z )cf RPft``$)cp€`4B BPgb B0g2b@g B f` Bgb@ @`g Bf` Bf`Dk$)f//N PL|N^Nu4B Bg8b$JBfX ЩcLbF刃B`J@ @ g B@f(B)ЃBc)ԃc刃B)Ѓ`@ @ g @@fJgJf`JgJg )e`B`F/,O/. /.BN#N^NuNq/,ON^NuNVH00$.BA-HHy?NXBEML9?xf6Jf y;|Jf:Hy?N6XE nJfjL N^NuHy?Hy?|NP`"hf2 (Jg.#@$h$$n!JGg%K-HE!J I`#;|`-K`"h (Jg#@"h"Hx/NP`j-@`Hy?N6/ y?t hNP`L/,OH88$.&. (.&nHxHxN$H !C!D!K Hy?N pIMLJ9?xfBJfRHy?N6Hx/ N -K-D-C -B y?t"PLN^NHy?Hy?|NPB`BB y;|%H #;|-|?LN^`s4/,ON^Nu/,OBHxHy?N{4Hy,lHy?|NM.#;|p?tN^Nu/,OH0<*nHy?GN?xXI;|$<6&<$TJf-|?L< N^`r j *Jg@!@ j Hy? BN/* /*/*/ UNHx/ CNHy?N `#;|`/,OHy?NB9?xHy?|NPHy?N6 N^Nu/,O/ n ( ,dB$N^Nu"($ b c$䊐!@ 䈒!A$ ( "'!A,"(e"($gLA(e b,R0!|| B(B$B !|',p`t!@(`j/,O"n n @!i<!iH!iD !i8!i4") !A )$ b!AJg "(L@!AN^Nu`NVH?<$n(n *$** &lB+ሀ+0|bp-ARjX",Yx-DxJn(TJg-l",&n`؁ҋ-A"B*|ځ,..."GA B>2Tcf RfB`f:|.*ͳeA B<2Tbp, FA׮d|SbRC ,RB>2.^:| >2~Tf55nV1B %F jL20RA1j$`j*I`xft `T. G` .ЃѪ$٪ / NtR4٪8R<٪@pSXe dR* Lp-@ kޮؾe:| B03~Tb K穃RJg .re)JHxHxN $H(PgB . oHx/N P *"*g f jHrLe$(PԨ\"ҪԀ(J$@ .-@PrdRdFpSbRF RB23^^0| 23Tf77V;E*'@*B.`-G`"nf"`z"Ҫ$ `dB``I`^..K RJg re)JHxHxN$H(PgB . oHx/N P *"*g f jHrLe$(PԨ\"ҪԀ(J$@Ppd` Ы$'@$".ӫ reR'@$/ NXJg <税K RJg re)JHxHxN$H(Pg B . oHx/N P *"*g f jHrLe$(PԨ\"ҪԀ(J$@Ppd`r gRJgQpF稀~e)JHxHxN *H(PgvB . oHx/N P$m(M)JB`D"Ҫ$ `B`I`"Ҫ$ `FB`BI`@JfpSe dR+ ".ӫ@R< Zm("n /N ""n BR4".ӫ8X \`8RD +HTЄ'@H`/,OH?0 np mE J L N^Nu f (f( f bBB:0 3'X0 3'PvSx ؅Hx/GTN$HPJgJfBL$%EF%CB `jHxp/N%HLPf/ NU&X`D/,OHx/. /.N N^Nu/,OB/. /.N N^Nu/,O/ $n *Lg /NU&X-J$nN^`/,O .rg rg0Jf2p-@ -|;|N^`Xr-A -|;|N^`BN^Nup`NVH?<$n&n $** "nB*k-X,+YJn&SJgN*k,+`BSJoFBЁ2*B> Gg@J* gHh/B* /Hy,mNDrpL0:B<ܮݮ"*Rd,/ N "XJ* gB* /Hy,m`J&|-F`Jl"n#@HxHxN PJf/ N "X`BB"n"Hx/-HN  n (Pg: f>"hHpLe0 )PЩ\"(Ҩ"@Jm (-HЇ @ bCJg @  g´d"|҄-AB*,0| 22nTcԸfv"*܃e0| B>2nTb. GA"RB62.^~ ރ62>Tf5~5V1B %A jL80JRD1t BSbdRE t -B$".( `:"(Ҩ `B`B22>Vv ҃2B62`&`8" A`P/,O nBh!|| B(B$B !|',B0N^Nu/,O n"n pln fh )f`) fR( fH ("CLJf*n !nBJg| /N`XpN^NuS2BiQ`B`/,O n"n pl f )f) fr( fhJLgb <"hL3Urf ("CLJf,n !n!nJ g| /NXpN^NuS2BiQ`B`Nq/,OH8 &.". "n .( ؀ CE36cJg (tfRgB(Jg8rLSLN^Nur(tfT`V|:W`B`/,O/$./././. /Nb B $.N^Nu/,OH80&n&. $n( XB//*/Hy,m// NE$pf pL N^NuB*B*Єc///Hs(NrgЂ`B`/,OH00&n&. $nJ*f2J*f,J*f&B0*/Hy,m// NEL N^NuJg[SHj/HkN# rfp`$RRB0*c$/Hy+Kc/Hs(NErgЂ`B`Nq/,OH80&n$n $*,g( +"€gL j6( Cg2 Cg CfV 0r-A -JJgL N^`J 0r`FfZ j6( Cg\ Cg CgHy3'Hy?N PJg$/?BgHkHy3'Hy,nHxNGN/ N "XE`,r 0JfZJg8/// N B,B J L N^Nur`L N^`/// N `/,OH?<$n n&(tsăgp e&Hx/ N #\$HPJfE J L("GB4(ԉ<("F( f( f $~ЂB4(ԅЂB4(Ђ4( ԀB0("ЂB4($ԀB0(&ЂЉ$Ђ o<z(BGX g$ gHy3'Hy*NK. f(  gB4( Ђ` f( gBB0(`6|@̃$pʀ// B/ N&܀JgJgzzF`pB0-fb- g fPf `Fg>& &m,- .p"G, Ah B@CЈ,~І o<`Ac// N #\$HPJg(j:,9F @g&p// B/ N@g~9E`|// B/ N&܀` Pc// N #\$HPJg(j:,gH9F @g,p // B/ NJ@fp@g~9E`|// B/ N&܀`Nq/,O".B@AdFN^Nu/,O y:, ("!AN^Nu/,O y:, ."(!@N^NuNV n -@ nJg N^NuNV n (-@ nJg N^Nu/,OH<&.$. .BzfzgrVIDЀL8$n&n ,+(*+Hx$N|(/*NPI6 *m6/ N "Btժ *с%@/*NPt7/N L|N^NuB jJf^%K%KR/*N/*hN&Bר4"(0ӂ!A0PJgBrӨD$(@Հ!B@/*hN*X*0g B`!K`/ NX`/,OH?<$nHx$KN&/*IN2*IA5A/*G6N gr/*NBHx$N$/*N"*H f^/*N/NP/*N/*N0*@P @g|B/ /9;} N8 /*NX-CLBrӨ&(׀!C/*NHx /N/ N "-BL N^`~B(hJf !KR/*N/*N_P`)K`/,O n(f (x #Ǽf JfN^NuJg #fg h -hN^`/,OH00&n&. +3pHxHx N$H /HzX/NZJf&<#˒%H%C'J L N^Nu/,O/ /$n$. B/ Np// NF-B -J"jp$.$nN^NNVH?<$n r€(AHxXB/N(Hx$N&HjN@/*GN/*N5||/*K6N Hj/9;} (< DN/ N#P/*NHy;}@NB0*, y;|B j$ JgF!j j  jJg  j B/9?NQHy;}@NPJgZ&j/ "BN|5/ N$ XB/NXHk,/9;} DN/N/ N{V Hx8/ NBBP j Jg /(N[Hx /* NB / NTXJg *4g / N'|XN%LBN:X*< ,<Dr&jJgJf@Hx/ N#PG#ښ jJgCpDg/ / NP`#?` SB(pf&kH`/"EN$*hXB Be"Jf/Hy,pD"FN/ / N#ښ`d)M mJg/ / hHNPp,`GK&2B/ Hz/ NRr&f&y;oJf/9;}HjNUp%@/ Hx/9;}N%/*N%(Hx/ N&Z.N! *Xg/N#BX/*G~rNB/*N/ N$Z/*N@/NdL<||N^NuJ4grFғ 2gB// k4NP*ke&kX`,)M mJg- g / / hHNP,`/,O/9;}pLЮ/NVZN^Nu/,OH0<(nHxHy?KtN$HP$< &<#JgX #8lfHxHj"CN$HP`HxDHjN&HPJg S(,gHxDHkD"CN`// BNPJf$K J L< N^Nu*1g kJgJg/ /"BNPJf`/,O//NRd&/.N#*$Xg/. /N#*P/NR B $.&.N^Nu/,OH0<$.HxHy?KtN&HP&< IބJfE`b #8lfHxHkN&HP`+1gHxDHkN$HPJg R("B)g HxDHjDN` *g// CNPJf J L< N^Nu/,O//NRd&/.N#*$Xg/. /N#*P/NR B $.&.N^Nu/,OH?<*n- f@0-g:;|d, y;| pJg #8lg(h L L<&n n + #8lg $bHxDHhN$HPBI ,<#Jg"R)f8 jJfB/ / NPJf$ B L<|N^Nu *g // NPJg$ HxDHjD"FN$HP`B҈ T0|(bf`R31*DRg`B`/,O//NRd&/. /.N#$Pg/./N#*P/NR B $.&.N^NuNVH<&n *npf`-)fXI/ kL/( /+N#N$H Jg6// N& j(PJg#g/ / HxN / / N#NPL<N^Nu/,OH> $n&. pe /*N0*B:4BXB Bg|Rtg(؄$ąWf(S؄tą袶gnxfHt嫀C5@ g| f <,/HjHy,poNDr J*f$|BHj/9;} N8 `8f-jL|N^`26J*fҁtFB@㫄C5B`@@5@ gt <,pj gl <,S2`bL|N^Nu/,O n-hN^`3L/,O n-hN^`3/,OH8 &.(. Hx$N$$y;oXJf-BLN^`P j8Jg//NP$jX`/,OH0<&.&n (n$kHNRd$Sf:+5g2'y?H,)f"HxDHjIמN$HPK &<#Jf-BL< N^`hB//+NPJgFHxDHjD"CN$HP`(P"R,)gHxDHhDNPJf`Lg/ / N&P`HxD 9?/NPK(`/,ON^`/,O/ $n/*N/ NtP-j$nN^`0P/,O/ $n/*N/ NP-j$nN^`0"/,O n"h|N^N/,O n"hN^N/,O n"hN^N/,O nJg/9;}Hh/. NT N^Nu/,O .;|d y;| p N^NuA`/,O/.N#pXJg #8lfA N^NuNVH80$nB A %HJf%y;|BB85|B*BB BBHxHxG}N%H/ HxN%%H/ B/9;}N%N!\%HBBB/9;}HjNTl BHxN%HB/ N$>Hy;}@N 9?"9?BvցՀ#?#?%@%AHjHy,pHxG/ NE.HxN%H 9;|5@,PJ;|fR#;|&9;|B4*, BdJg#;|Hx/NT$(9;|Pg///N)0/NU&#;|`: 9;|R#;|fPp#;|5y;|,B4*,/NXJfд;|dlB0*, y;|! -|;}@L lN^`- fJg Hy,pNK.t#;|v`BG#`Ѐr` /,O/ $n/ N#/ N# %HP-J$nN^`ߎ/,OH08&. CCB$H  cHgJgXNRd$HxHy?NX$HPG)/`IjJfB/NRX J L N^Nut LI$AE" Rpf-AL N^` #8lg/HjNPJgHxHjN$HP`/,O/ /NRd$/.N#X$HJg/9;}Hh/. NT /NR J $.$nN^NuNVH08$.&np fN(&I/ n/N#$HPJg\ hBJg(Jf$&B/ / N#HP/NX L N^Nub&//B(Hp/.$N$`t`t`/,OH88&.(. CCB$H  cxgJgNRd$HxHy?NѤ$HPG)/`IѶJg. #8lgl/HjNPJf^/9;}Hj/NT /NRX J LN^Nut LI$AE" Rpf`-D -ALN^`DHxHjN$HP`vNV$H?<*n(n or€$A$. B.; i&g Xig@Hy:Hy:GuNPJg/ /. y:N.Hy:NuT rNfHy:Hy:NPJgv/ /. / y:N.Hy:NuTpNfHy:Hy:NPJgB/Hn y:NHy:NuT g&Hx/ / &<)0"CNHxHmHj"CN( z*JHy:Hy:NPJgHn;Hn / y:NHy:NuT . izb ixc,NL$,<#Jg(@// N#&B/. /HxB0-|4Hx/.0/,NAR.$Jg //N#HPJg/ FNX`n*-gt$k&HxB/ N(Nκ-@(NRd(HxHy?N&HC-I$IRJf./N/.(NΞPJg $*B L ig4` i7g&b iJg ig` ig ig`N`.`~-`*N`.`~`/,OH88.NRd$HxHy?Nj$HPBG)1IxJgF #8lgR*5fL j/B(Hp/.N Jf./9;}Hj/.NT /NR J LN^NuHxHjN$HP`/,O/9;} .//. NT N^Nu/,O/9;} ./NVZN^Nu/,OH 0&n$. Hx/N 'PJg: (R!@n BL N^Nu/HkHy,pHxNGNp`HxHxHxN $H Jg//N BP`HkHy,pHxNGN `/,OBHz˖HzHxN N^Nu/,OHx/.NdPN^Nu/,OBHz˔/.N N^Nu/,O/ / &n$n B.// / N$4k5k6%k8 +@"+D%@%A +H"+L%@%A +P"+T%@%AHxHkXHjxN)0$n&nN^NuNVH<0$n$. &n igZb igb, ig igh iug t L HxHn/ / // NvJgv#f `l, *gt f~ jHvLep"* hP vl\W%AVJgP*gV( jBn`lJgZ// // N$`DHxHx/ N, g *g f"jHpLe"*"iP Aplr]%A\Jg*g\( jCnG0+tG@/ / N$PJfT.$F`"*gCH`C `HxHx/ N$H `"*gAH` A `HxHx / N "$H `*gt ժ( jPPPCD0+A@ nC/ / N$P`*Jgd fl jHpLe`"* hP tlN]%A\Jgv*g\( jD0+A@`~"*gAH`A `HxHx/ N "$H `"*gAH`A `HxHx/ N "$H `p7`p2`T/,O . c VIDN^NuB`/,OH<<$.$n B(1f-JL<BN^Nu/,O"n n BN^Nu/,O nJf n  WDN^Nup`NVH><&n(. *.EK$+\g&Hx/N(H/+N \d/+N6// N `$kJgQB,SKJfBJg /+NQX/+N6XE PQ`BBSdX-C -LL<|N^`$B./// / DNJg/ NHjNS\),PRJ.f$j JgQ`z t,p!@ !@/Hy?NP`L<|N^NuNV/ / n$Ph0$ /N|/N6BHjdNXHj/*N/ N$IdBHnHz^/ Nz($.$nN^Nu/,O/ / $n n %@X\d*BHz/ GBN *\XcBHzr/ N B$n&nN^Nu/,OH 8&n(n $l`%|$bpBB/ N/+NQ$ //,p/ N#p//,t/ N$WN.G6N*4X g f&B/ N$/*N/ N$^/*N/9;}HlhNUp)@Hxx/ N-BLN^`/,OH 8&n$S+1g Hx/ NBP$ /NXI *g // NP`/N6/ N#xHx/*GN/*N~r/*IQN/*N/N{V HjdINHjN/*NHx/ NBLN^Nu/,OH 0&n$S$ /NB*/N6/ Hz 9;}L9:/HjdN/ N$Ik@0BL N^Nu/,O n"n g H1@>(1fBN^Nu/N$IX`p`/,O n"n g H1@B(1fBN^Nu/N$IX`p`/,O n"n g H1@@(1fBN^Nu/N$IX`p`/,O n"n 1QH(1g /N$IXBN^Nu/,O nBHh/(N8 N^Nu/,OpЮ/Hy,r;NDrPN^Nu/,O/ /$n n $pePJfJg2/*HxBHz N%К`Jf/*HxBHz N%%BB$.$nN^Nup`/,O/ $n  f NfT`\D$nN^NuB`/,OH?<*n( *<I6.<,</ EN mXBJf2/NXJg0"n tL(Jgc "n "B L!|@1|H1|FBHxHxN%HB jBX fN %@BGQN%HHxHxN}%HHxHxp F3// HzHy,rVHjNz$Jg/Hy3'Hy,*NK.HxHjdILNHxHjNBHxHjN{4BN%H/. n/(/ N#|$B@%|D%|$|%|$7:l%|$t%|$%|$Dp%@5|4|6$.N#p%@8/ N#d/ N#ͨBLN^NuNV n (-@ n N^NuNV n -@ n N^Nu/,OH00$n& /NHjNPpGJf $// N#P-CL N^`4"h`$)8rgJg$/NX `/,OB@ @ bF!N^Nu/,OH8 "."n B)B)$@A)07yB)v$BE 07y$ B)vԀB)Ђ$x 誱& ሷ&"詷&$x 誷& x騷&"ꉷ&拵$x 骵t䨳LN^Nu/,OH 8$n$. //*NPЪ/Nn$HXG)1IFJf J LN^NuHxHj!/N Jgn / N$HX`E`/,OH0 $n$. &. Jg\ jHx/B(HpN)1 Jg* *g(/Hx//N'JVDL N^Nup`B`/,O .B@FN^NuNVH8<*n&. $nI r(@( y:,  i{f$*per L(0)3'g: i{gpp"BB/ /B-| Hx /./(NARJf:&B3'N$ igpb. i{g ig/ // N#`p!`G` i{g* ivf D%h[I%@%h[I%@`&+pg~pf *fnr ehHx B/ N( gT/*/ /*Nh Jf^/ / SNPJfP +g4/*/*/ N `0&+pgp`"Dj()j`g %T%lB/-@N.X .L<N^Nu/ // N# Jf0-0@A @g @@fHx/ N#8P`/ N#(X`/ // N# r4f`p`NV n -hHnHz`/.NzBN^Nu/,O/ /$n BHz/ N\$ /NJ*f$/ Hz 9;}L9:/HjdN-B$.$nN^`NVH><&n (.*."S i4( BbVpl> (f6 (f. (f&B(ኄ(v)f Bgb Bg t/N "BX`vB` B5gb BfI/ HxB/ K &NHx/E NJgHnHxB/NHx/N$S Bg BgFJfB08 /N#$HHxNPJg j| PBrӨ $(Հ!BB`r j `gHHxNB0* /I#NPJgB0* /N h| PBrӨ $(Հ!B`P&/// /9>` "*gAH`^A `VHxHx/ N "& `R"(gCH`C `HxHx/N "& `/,OH 8NRd$ ./Nv$HXG)/`INJf/NR J LN^Nu/. pЪ`/NPJg / N$HX`/9;}Hjh/.NT `NVH<&n*n I/ / / Nd$H Jg2B-!@+1g / N$IX/ / NPBL<N^Nup`NVH<&n*n I/ / / N$H Jg.m\+1g / N$IX/ / NHPBL<N^Nup`NV/ / $n G/ / /.N Jg:%hdhXh\h"h`i-/ /NPB$n&nN^Nup`NVH <&n*n I/ / / NJ$H Jg -$<$vDf* h`(4 g g/ / BNPpL<N^Nur*gg@Jf pЪ`/HkHy,rcHxNGN%md/ / BNP+1fB`JgrҪ`/HkHy,r`/ N$IX`p`/,OH<&n/+NpЮ // Nn$H I6Jf/+NXpL<N^Nu/K NHjNS\/+NQ/+Np%@ %@/ Hy?N PB`NVH?<$n&.*<$ (<R,<.<)1NRd$/. / "EN&HPJf/ DNX"j\Xep`(!nJgLC gBB/ DNXBL<(n$opĀ&T//. N#$HPJg (K#Hf//NPt L<|0N^NuJf $bpg // NPt`(0gHxHxxN&H*4P g& g// NPtJgHxx/ NP`(,@*,D *@"*DgLHxB/N( B!E/*N//NRd(HjNT,Xf,/NRXJg/ / N/NB `D`B/"F/)`N Jg~/9;} FHhhzڎ/NT/NR"F)ggBB/ CHh/ N2 F"h`7i, &(`//EN/ / N/NݴJf0/ N "X`\Hx/"F/)`NX Jf(/NT`k/9?|NN$/ /N$b/N/9?|N6L/ / N#0$HPJf`J/9;}Hkh/NT/NR&+`"C)1f DN&// "ENP/ ND&HX`g+gg+X c g/ NXJf B (g6g2Hx/N .PBJf"Hx/ N$"DN&// EN` B|B/// N$/"B )g.g*/ NXJgRHx/N .PJfDHx/ NP DN&// "ENPJg"/NRXJf/.N~X` B|"C1i, h-HN-@ n//N$b/.N| `&L`,B/ / / N$/`/,O//"n n ("($)(&),f6(,h.WID$&N^NuB`/,OH?<*n(m&LE(<$:Jf.+J0f+m( +m,$B+@4EJfL*,k,b&k`$K` *"* +@ +A$ *Ъ`,gg/ / NP$- &-$JfJ*,,, f<"-4 ,b0eR(-(*-, ,",,.e,.b.>,.l,e$)B)C )m4 -("-,)@)A9l,.(l`/,O n2.JPfBN^Nu0(@@c1@`BhBPp`/,OH <(n l0&h`+1gHxHxN b$HPJg1k, p!@(!@*h kB(HxHpHm$<)0"BNHxHy3),/ "BN;| j|B|B|B(B(B(|K/ N6B/ / / N$/,-ML<N^`ݒL<N^Nu/,OH0 $n * "*$$*(&*,f |KBjR5|P|JL N^NuJ*Jf/ NBjV5|TX`NVH?<&n$n 0* g|ZL85j@:5jB85j@:5jB$.&. .".얁f(BjNBjLJ*JgBjRBjP/ NBjV5|TX0f45n85n:5n<AK/ NXJl B*JBjVBjT/`T/ / N@PJg/ / NP`/,O/ /$n$ /N jXJf8/N6HjN BjRBjPBjVBjTBjNBjLP$.$nN^NuB(XBh"Bh Bh&Bh$Bh*Bh( h`NVH?<$n, /IN&jXBK)1Jf$C6Jf/NX-JL85j@:5jBp8f6/ N#*XJg( f"/ N// /./ N$L< N^Nu/ N(k0+0@AX @Af.0,0@A @Af* gbLJgt g/ / Hy3)N&4T p/Hx/ -@N/.N " .`x(K` g. fHxHjHnN)0 tHxHjHnN)0=j nJnf=h* (g f"hHpLe"("iP v dpЁ!@rӨ nJg"(gvר($hA n HxHn/ K)0N \JgHxHn/ N g" +4f kB(HxHp/ N Hx/ Hn/,N%ѶJf: nJgJg4BB// N$7:` n (g0HxHy,rHnN)0 n(fh=|B` g*|B.|^*Ajj`HxHn/ /// N&ƨJgv#f~B`x,0gHx/N .=|PJg~// // N$`h n$h(g2HxHy,rHnN)0 4B0*Wf8=|5`& RgB*B*ЊHx AHp`/N "X`T=|` n (g"HxHy,rHnN)0 =|` g&|3|3jjjj`HxHn/ /// NvJg`B`"(gCH`BC `:HxHx/N "-H `8 lB(HxHp`rg.v֨([I/+hNר4 (0т!@0/+hN*P/./ N$P`p2`p7` /,O/ $n0*0@A @@g @Ag @g2B$nN^NuHx/ N#8P` j 9bL((B"CEv d8$IIve< 9c&2 `"Ever 9c0 `Ђ(T` vdRrfJf`B*|^(@hhHx/ /N `G)0Jf.J f(Jf"JfHxHy3)D/ NHxHy,s(`X3|3hhhh`p/`8NVH0<&n HxHxN$H/+HN&]/I/ /.N$Y$K6f,.g.g/+// N Jg R /+HNXJgbHx/ NP`RHx/ / I)0NHx/HjNp%@ k%HgC!I'JA%HR/+HNXt4 L< N^Nut`NVH08&n /+HN&]/E/ /.N$Y$I6fb/+// N $HJgJ ( S!@ f@ hJg!j j S/+HNHx/ N t4 L N^Nut/+HNX`/,O n!n  A -@(nJg0Jf /NRX`f gB ,-@(n`Hx/* DN/ B/ k N(/* BNJVIDԂ`xHvH/ N#*/NRB-Hs/ / N&HvH/ N#N `&/,OB?Hy?NDHxBHy,tBBBHxHy?Nz$N^Nu/,O n Jg"y? )@")D!@`!AdN^Nu/,O/"n . n igLb$"og`-H-@ -I$.N^`pr Xifi0Jf B$.N^Nu!|$(` b0/// N# r4f`Jg( g gp/`p`/,O/ $n?g2j0/ y?t hN/ N#x/ N#d B$nN^Nup`/,O/ /$. HxN#L$H/ n/(/ N#|B@%|D5|0%|$|%|$l5|4B*6BJf#?/ N#p%@8/ N#dHj(HxB/ y?t PNj@0/ N#ͨB$.$nN^Nu/,OH<<&n$n (.(n*f Hy,tNK.+1g( +(g"Hx/ DB(// y?t hN5k, Jg4 ,4g(/ N " ,4X fDfpAL<gJ:}fgJ:}4fgJ:zg/B/ N B, 9:zB@ D#bF$B/ /N% Jg|/+hNBrӨ*ۀ ר, ((т!@(/+hNPBB@F` *,g0gJ:}fgJ:}4g/B/ NB, p@ 9:`d/ N "/+hNBtը*(ہ!E/+hN p7`B`\p3`V/,OBHy;~NPN^Nu/,OJ?fHy;~N#XXN^Nu/,O .g SgpN^NuN$B`p`/,O/"n".FAJf $N^Nu . $)fJf I"Q`/,O/ /$n/N}VXJfFNv4$* pA}P >ufpĀRN>u%B $.$nN^NuN/NXt`/,O np rf!A -PN^`ߋbS>u!@ N^Nu/,O/ $n nBC%IB p%@%n %n%nB JfHxHxN}p%@ P$$nN^Nu/,OB/././. /.N$N^Nu/,O/ /$nJ g / N$PX jJg(/. N$XJ g / N$X $.$nN^Nut`/,OH80&n(. &.$.HxHxN$H/N%D%C %BB k%H 'J -SL N^`ߊ/,OH 0$n PBG$m L N^Nu/*/*//.NR`/,OH8<$n$. /&< CN(*///*KNJfF//Hy,tNDrpFĀp/*//*NJft/I6NHxHxN&H/ CN/*//*NJf 'BB BB j'H %KG/*//*N Jf"Hy,uNK.%H -RL<N^`߈%H /NXJgp-@ -KL<N^`[*L<N^Nu/,OH<8&.&n $n .JgJgJg (i8g i7gt L $/N6 B $.$nN^NuNVH 0$n&n BA-H/N jXJgR"tg (t䨷f4 f B p%@"P (Jg#@"h"B"n!I"-H A`%@`/N6 nXGJf L N^Nu%@"h"Hx/NP J$P (Jf-@"h"Hx/NP`/,OHx/.N$PN^Nu/,O/ $n/ N$XJ g /N~rXB B$nN^Nu/,OH< $.pFr gxȂA3*HB$H fBB`6(`&zFʃf.vFƀz ff 2"2 L`/,OH0 $n$. /*hN Btհ&0ׁ!X-jhL N^`lD/,OH 0$. HxHxNT$HHy;~DN G;~@p Sf@BCJf&JgR i%HgG!K#J%I`jmLR"H h`CJg (m2f(/ NU&Hy;~DN6PE J L N^Nu"H h`%h%H"h"C!IHy;~DN6%B//./ N#|BHj0NL$B@%|D5|0|4|6B%|$|%|$l%|%|%|%|lHxHxN}%H5|r.N#/ N#dHj(BB/ y?t PN` S%HgC!I&C;~@`/,O/. n/(N8PJfpN^NuB`/,OH> $n&. $.*.(./*hNBrӰ8,08݀!8۰( 0(ф!(X-jhL|N^`j /,O/ .gSglp$nN^NuBHxHy?E{4NHy;N˒JgHy32xHy+i+NK.BHxHy;~DNB;~@Hy;~$N#XB`J;~@f g8/HlHy,uNDr t/%|#(/N L N^NuB`* g fF`Hx8BtHr(N(HxHkHr(N)0 k4Jgj%h( k4%h , k4%h0 k4%h4 k4%h8 k4%h< k4%h @ k4%h$D`IHx8B/ N( + g k/ / hNP +g kHj,/ h4NP`/,OH< $n n &.pm^ PJgN"h"(((*ڄ$ Xe6B)ሀ) @ Јc2*g//// Hy,u/NDrLc ?b t?B*uej?`R`B`B9 vR`&(Hx!N$X*gf/ NXHx'G*N *%@/NP`LB0*X&`@J4g8Hx!N$//*4N&^/N`&+z@e pet`Nv@/Hn/Nh$ f4 .c.BHy?.< GNHx/KnN(HHy?,<6 FNJf4NCHy? GNHx/N(HHy? FNJg NC(+AG gHx!N( *Xg j/ hN/*NP%L/Hn lN%HPf *ft7Hx'Nj/NP`JHy?NHx/N(HHy?N6NCJf``&P(hJgfHx/ NpPJgNC*g/B./././HjHy,vNDr`fA32`HjHy,v>NDrP`:Hx!N$ *Xg j/ h N/*N P%L/Hn lN%HPf *fx7Hx'Nj/NP$`:HjHy,vUNDrP`zWf *`zWf *x`T"hB)ቂ)z!g *reJg&/ DNX` *`WfG` B`Hx!N(N$& "**&'A "** '@'A /N`//N#PJf/NU&X`B tDgF tEg tCf<$`$*Hx$N$%D/NLPJg/NU&`n`,` tGct tLfV r!fx *'@`@NVH><(n$n n&TJ g0,0gfJ(f"*A%A( gB gXJfrB(B(B(ኄ(B *fz"*fA `*+ j(gA%At!`*+tWpg|gvxF`/HlHy,uNDr t// N "X` f jHpLe"* hP |lY%AXJg*gX( jC @B*g&*(+gHlHy,vnNDr/ N f + f +0fN'@'AHx/ / N Hx$N(K4Wf k BX'J&[I-B-C//HxHx/ N/NB`AH`HxHx/ N "$H ` JB֨ PJf`$B// /N#Jf>`B// /N#Jf*`4*g> / // N$$ g&/NHx/ N R L<|N^NuB`/ N$X`t2`B`t7`NVH<8$nHx$N$B@*tXIjrdB&jJf*/*N&jXA6JfV/*N/NPG K L @/// /N&_prpg f(kCB,t-B"*g*gB KBШ PJf j**DX/// Hn/ hN .gA "J*j>/ N&n(kB,X` SJg"h`>t/`zB/ / N `/N`/,O/ / n"n .B@F'Jgi B$hdJf*!I`!IdRh/(N_X-B$.$nN^`@%I`/,OH88$n(. Hy?N&JXBBIf8Jf"y;~ A8BBf>Jg#;~ Hy?N6 LN^NuBpF/NPJgtRD`EB g#H XifJgF R (f< h fb/( NXXJfT%|$(k0BL N^NuJg *gp/`"* b/ // N# r4f`p`NVH<0&n$n (.$  g*pGrgJg/NX&f~ f  gj 9>-@ nJg(JfTJgv+0fnJgjHxBHnN(=|-RBHnN&JgC&Hg*/NXv`&"h )1gg (-@ n`/NX L HxHh / N$. L|ҹ> A -@ n Jg0Jf *H-@$nJg`g (-@ n`/NRX J L N^NuNVH<<&n$n *n+1f/ N "Xp2L</,O n"htN^N/,O/ /$n . gz%@A#YffHx/ NX.N*XJgVJgHjHy)HxNGN "* <)te 033<-@ -|,w4$.$nN^`gHx`$.$nN^Nu/,O/ /$n B/ NRPJg($ /N/ jNHx/NZ *UrTD@$.$nN^Nu/,O/ /$n Hx/ NPJg($ /N/ jNHx/NZB*$.$nN^Nu/,O/ /$.$n HxBHj N( Jf&Nv4B/ /N8 $.$nN^`@$.$nN^Nu/,OH8&n$n / NXJg.JgHjHy)HxNGN /+Hy,w>NBPB+pB+L</2 I "NB+L<B B+L</2 NB+L<B  *PrlrAlWftHx/ NPJf\HjL/*GN *PgVnPJgHjHy)HxNGN /*Hy,wFNBHj/*Nj0LN^NuHx`A<-H -jLN^`N/,OH08$nHx/ NG33$ <& (PI [(g //*NPfL N^Nu/,O nHh,/(NPN^Nu/,O nHh/(NPN^Nu/,O nHhL/(NPN^Nu/,O nHhP/(NPN^Nu/,O nHhT/(NxPN^Nu/,O nHhX/(N^PN^Nu/,O nHh\/(NDPN^Nu/,OH0<$n&*Hx/ NP *x|g$ /N/*NHx/NZ/ NJgBlDJgHy+NBXJgHjHy)HxNGN -|,y,L%L8%L&*hpm. g(* ڄJghHy,zNBXoZHy,zNBX`< c, +b$B+Ѐ0;NX>FXbN g* ڄJfPmB// /.N)0ٮ (` f`  f` f`~ b`t b`j/ B+/Hy,zNB `: f*TJgHy,z`rl f`plB+ሀ+ @#f< g* ڄJg frB+B+Ё%@Jg/Hy,{NB`6B+.rB+pᩂB+ሀ+g /Hy)FNP`rpeRp`~pd/ NޖXJg*JgHjHy)HxNGN Hy,zNBXBp *\Jjr@%A\Hj/*N>PHjL/*A0-HNHj<#@gt2*8@gJg?BgHnCh-@-IN* ./Hn"nN//Hy,{(NB  j#8fZozHy,zNBX`b5@8 +gTJf2  j#8fJZo^z`:5@8`22*8Af^ A#g`Hy,{NBX j#8f `  A#gXoDz` Xo6z`pzEj8j9 j#8f|B(`z`B+B+Ё%@`z// / -@-AN)0 . ".(`n//./ N)0BBp JgHy+NBX(p n n n `rJgHy+NBXp`JgXHy+NBX`F/,O/$.". S b$0 33 B $.N^NupF/Hy,yHx/NE`NVH><$n&. ,.*. .*n4*_gf6|rKFd4<KHxHxN b(HPJgB8AH)H)H(B &l*_g6&lTE0X@A@JBg// HkN)0 / NXJg?BgHnN&B/HnN*JgHjHy)HxNGN B+ሀ+/B+///Hy,yKBNJBg /HkNpPHy+NX *@DmbBtժ, *(с%@(ժ *с%@/ N "Xr-A -JL<|N^`ܾ6|`P|@CX` ,(ЪdB-@/BHx/ N4B j<JfD%L8%L0&n$n $.*.(.,.Jg Urez/ N XJg:/HnN0&PJgHjHy)HxNGN /Hy,{ZNBP-F-DpF-@-BB0-@ -JL |N^`L |N^NuNV/ $n*ghBHn/ NN|| HxHnHnN)0r *R%@@Hn/rF€/Hx/<W/ N$nN^NuB`NVH0 $n*gJf N %@|| *"tA"tA"A@p$*g&*"XDj82*H @R A#gdt4J @X A#fLZ"*R%AAHn/pF/Hx/<!/ NL N^NuB`^t` `NVH?<(n$n *. E.((A-HHx/NZ/ KN, pmTJg2JgHjHy)HxNGN //,Hy,{cNB /.N/N "PLNZHx/ / Nz -J -K"k($n&nN^NHx`Hx/ / NL $n&nN^Nu/ k N/ k,NHx/ / N `JgHjHy)HxNGN B+L</2 N̲./+Hy,}^NB p-@ -J$n&nN^`ς/,O/ / $n&n B+L< 2 rmtrmUrdJgHjHy)HxNGN B+L</2 N./+Hy,}zNB p-@ -J$n&nN^`r f/ k NB+L<B Hx/ / N`Hx/ / N / NXJg.JgHjHy)HxNGN /+Hy,}NBP+f4BBB+L<2 /HxB0// N$n&nN^Nu/,OH 8$n&n B+L<(A) (PJgB lB(",((l  g gV-LLN^`/// k>Hlb+f&BB2 /HxB0// NL N^Nu% Hx/ / NN `/ k NX/ k,NHx/ / N*`Hx / / NB+L<% / NJg.JgHjHy)HxNGN /+Hy,}NBP-J"kL N^NJgHjHy)HxNGN B+L</2 NL./+Hy,}NB p-@ -JL N^`NVH<8$n&n B+L<J4gA (PJgB l g-LLHx/ / Nj/ k N/ k,N////`XHx/ / N< ////`bHx/ / N/ k,N////`lHx/ / N///// / k0N$`DHx/ / N +f*BB/HxB0// N"`JgHjHy)HxNGN B+L</2 N8./+Hy,~ `/,O/ / $n&n B*y *rgr g0$n&nN^NuHx/ / N -J"k,$n&nN^NHx`/,O2. n hHfh8frN^NuB`/,O/ / &n$n *g/ ?UNPJg/ NôXJgJJgHkHy)HxNGN B*L</3 N:./*Hy,~'NB B*L< 3 SreRЀ0;NH8H^^^TB/ / N -K -J"j($n&nN^NHx/ / N $n&nN^Nu/ j NXB*L<' *f:B*L<A  R BBrF€/HxB0// NHx`NVH8<$n/. / Np Pg $ /N/*NHx/NZI/ Hx/ N#6&HJg PJgJg(+KHx// &<)0"CNtԎHx//"CN *DfBDj *g-@/ N B// / / N $/ N Jgv/ NXJg4JgHjHy)HxNGN /Hy33Hy,~5NB / / N#NP/*N6XHxBHjN( L<N^Nu/ /<@i/9;}N%`NV/ /$n/ ?<#UNPgpg"j@Jg j fB C#ftB <,~%AB/HxpF/// / N؄L N^Nu C#ftHjL/*N"*RP <,~`t`/,O/ / $n&n +g/ ?UNPJg/ NXJgJJgHjHy)HxNGN B+L</2 N./+Hy,~NB B+L<A (gLSgZJgHjHy)HxNGN B+L</2 N./+Hy,~NB` Hx/ / N `!j/ k,NHx/ / N$n&nN^Nu/,OH 0$n&n +N%@%A%@%A0*02A0gr@@5@0BL<ANJ ff/ NXJg*JgHjHy)HxNGN Hy,~NBXp\BHr) G @f0/N/"DN/ N "Hx/ N4|2 L+0f/N/ NB/NZܫdB-F/BHx/ N/N/"DNP`"*gAH`ZA `RHxHx/ N "$H `NJgHkHy)HxNGN Hy,]NBX`*B(F`,E`FNVH?< 9;~g /NXNZ-@N(*$y?IZGJfL/.NhR;~BHz| L9h:/Hy?N 9;~g-@L/Hy)2N fTr l  f Jf8|`Hy,zNB ЂXn2B// /.h-@DN)0ծh .D$`|Hy,zN`Hy,zNX`dB// N -ndT&nP-n`h|KpTm4JgrfJg<`HjHy)HxNGN `4k_gB._JgR/HnsNB+ሀ+.B+///Hy,(<B DN/.d/N/Hy, DN ./NLHy+ DN pgJgHjHy)HxNGN Hx/Hy,# DN `|`*cf.JgHjHy)HxNGN Hy,NBX`/NXrf*/ / Hy34Np L<4N^Nut f:N%@%A$9:z 9?-@ .-@t*1g JgJg/ HntN%.P// /N% Jg/N`*cf&JgHjHy)HxNGN Hy,`*/NXpf^/ / Hy34\`2r f|N%@%A$9: 9?-@ .`@B`bNVH <$nJ?f2HxHy?NLBHzp L9:/Hy?NG}J;~fHxHxN#;~P|4%|%lp %@$HxHxN%H0p%@DBpBhp%@lBBBBp%@tB%|BBp%@B%|$%|$p%@`%|$BHxBHjG(N$ /ND/ N#dHx/ N#K .Hy,HxI/ NEHxHxp F3// HzJ/ HnNz,Jg// / Hy,NK.%nHxBHj8NHxBHjHNHx/NZ.Hy34G8Np BBp%@p %@%@B*%y:/ Hy34NBB/ Hy34\NBB/ Hy34N.Hy33N%|%h%|33/N 9;~ g /NX%y?X#? 9;~g /N6XL<N^Nu/,OH8$n 9;~g /NX y?C?Jg (Xf" 9;~g /N6XI~rJ?fHy?N /9;~NB;~P/ YB/GǦN/ Y|N/ Y|N/ Y|N.Y|N/*N *< g /NU&X *@g /NU&X *Lg /NU&X *Pg /NU&X/*0NX-JLN^`lCX @`/,OH 0$n$ Hx/NZ/*N G " jJf:/*N6XG " jJf>G " j8JfN-BL N^` (%@fBBS/NX` (%@fBBS /NX` (%@8fBGP4J6C0 *\g" Bzʂ C0f&BA5A06<JGf` |ĆB C0g@`B@%@\IJf8Jg`B*HjL/*N$P/N/ N%VHx/Nj0`,B*HjL/*K$NPJCfj@0Hj $n&. $.*.(./*hNBrӰ8,08݀!8۰( 0(ф!(X-jhL|N^`0NVH0<(n /.Hy;N;$HPJgpHhNX*9gZ& /KNXG6JfHj8*[f/HjNM$Pg /NX`t#`*9f/NXt@ L< N^Nu/*N j-HXg (%@fBBS/*N/Nj8 nPJfB`$ P"([I-@-A//HxHx/NHx/./N Hx/Hn/*N%Ѷ$fZJgExG  n/ "( ,d //(N$/.N-Hg JgJg/N "`t`/,O-n n-hN^`N/,O/". -n t -@$N^`$NVH<<$n&R$ /INX+[fK6*<%f(<%\&< "/*N&jXJf/*NX-BL</,OH 8$n&jpN$/+N(k/+N6PJg2",([I%@(%A,B@F *(,VDLN^NuBB`/,OH8 &.(. $nN$ @iFf0 *f@BHxHj/N#ۼBB@FLN^Nu/ //N$[ r4f`p`/,OH< $. /.Hy;N;$HPJglvAƂgVN (/*N**/*N6PJf,& /N{hHj`/.N`(/N|BB@FpL<$nNZ&$ Pj8Jg8,<I6*<%f(<%\K "/* FN&jXJf@/*NXB@F *g/N[BXpXHx/N#PL<|N^Nu +%@fBBS/*N"+[I-@-A//.HxHx/ ENHx/ / DN .NX`V/,O/". t /Hy;N;PJg/NXB$.N^Nup`/,O/ n/(Hy;N;$HPJg$/NX*[g B$nN^Nu/NX`p`/,ON^NuNq/,OH80$n&jp&. f HktNX kJVIDB(B,JfJf HktN6X L N^Nu"([IӪ,(*(ـ%D( P`/,OH 0 . $r Hy?$GN$y?,XJfHy?$N6 J L N^Nupg$j`HjtNX`NV/ / ". .&n-@-A//Nz$HPJgR +g"Sg>6|HjtN6X $n&nN^Nu'|35h'Hp/ Hh N`PG`'|2h`G`/,O/ Hy?$N$y?(XJfHy?$N6 J $nN^Nu j .pg$H`Jg!j j `/,OH 0&n$kp$ t/N/ Hj N` -BL N^`ި>NVH0 ". .$.-@-A//NX$HPJgJ;(gHhHy,NDrPvAƂgl"* 9;(Jg8Jg/HjHy,NDr pĀHjtN6X L N^NuJgHjHy,NDrPHj /.N`(PB`B`NVH 0". .$.&n-@-A//N$HPJg f}g,b^ @tAgb. @f{gR @fgtHjtN6X L N^Nu @twg$ f|g @tYf&;(`~ tWg|b$ f~g tBf0(Jg|@@`f tZgB tvg tXfzp"<f0(0f@1@0"A1@0`#;(B`B0(Jg@@5@`@`@`B0(&`0(Jg@`@`0(Jg@`@` hJg&(`B`/ /HjNz$ `/ //*N~`t`t`t`/,OH0 $n$. /*hN Btհ&0ׁ!X-jhL N^`dNVH<<". .*n-@-A//N$HPJgfJ;(gHhHy,NDrP0*2A & tI6 A f:*<( x$<M/* EN&jXJf@/*NX*grt#`"J;(g?BgHjHy,NDr t@/NX` +%@fBBS/*N/NPB"-gzJg(J;(fv/ N "X`J// BNPJg^t` +d Jg/ //+Nx$ / N &HXJfJg Hx/ NZP L</,OH 8(n . &n$T igbb$ ig>"ofJfp/` XifJ;(gHjHy35Hy*BNDr $ t/N0*@5@ S(X gD gnjA0/N6'|#(XJ;(gHlHy,NDrPBLN^NuJgJg@5@*1g kJgJgj`JfJ f JfJg@5@*1g& kJgbJfJ fJfJgH`j`HxHxN$H!BpHxHxHhtN{4Hy,6HjxNM.Hj GcN HjHN/ HzbHxGZN%H/ HzHxN%H/ n/(/ N#|$B@%|D%|%y|%|%~Vl5|0|4%y;|B/ N#p%@8/ N#dHj(HxB/ y?t PNj .?$N y?,%HXgC!I#?,%|?,Hy?$N6BL N^NuHxB/N( `&NVH80&. (.BBBHxB-| Hx /. n/(NAR$fl-D-C//GN$HPJf2 r /Hy;N-D-C//N$HJgd0*& tG6g/NXt L N^Nu@5@J;(gHjHy,>NDrPHx/ N#/N `t`/,OH<<$n(n&R& t/(< DNXJ;(gHjHy,HNDrP0+2A K6 A g>J;(g?BgHjHy,NDr /NXt@ . g/N "X`/N *(Xg"Hx/. B,// y?t hNHx/ Hn /*N%Ѷ$f n Jg, gv gXJff n (h(/* DNX *m/. N "Btժ**ہ%E/*NHx/ NB `0+ f ft/`0+ fr g (g  f"hHzLe"("iP gY!AX n Jg(gX( hB, `"(f (ftC `" ff"hHpLeZ ("iPBmLBѨ n Jg(gBѨ( (B// /N)0 `CH`B`Hx//N "-H `"(gCH` C `HxHx/N "-H ` *"*BRт%@%At7` n B"jJf%H%HR/*N/*hNBrӨ*(ۀ!E" [IӨ4*(0ۀ!E0/*hN*/ DNHkxNPJ+jJg /+N_X/<BHk N`/N L<jf8 nf./9;\Hj/.NT/NR J LN^Nu )t-@"n`NVH <*ntԎ/ n 0(8@"// N(H $n Jf J L<N^Nu&P0+0@A @Ag&/ N "Hx / N // NrPA` *"%AfD-0g<+0f4 kHx/*B(HpN)1 Jg/ N "Hx/ `5k, Hx/ Hn /-N%ѶJft n Jgjh// N#jP`T/,O/ / HxHxNT$HHxHx N&HBlHxHjPN *P@P&B/9;\HkNTlBHxHj\N{4NQ%H`%KXHy?0N):P/. n/(/ N#|$5|0%|%t%|%rx%|%|/ N#p%@85|4B.N#d/ N#ͨB$n&nN^NuNVH?<$n& n -h(-hp e.Hx/N #\-H PfHx/ NP|7 LN$K/ / N$HPG(JgJg / NZ,X/ / N/N `$ \/N jXXI6Jf/N`Jg h/ / PN,P/NX`|`N&K/ / N6PEJg~ (g(+*+"@,)̄.) ΅ "fb/ /N /N/ // N#,r4f@`N$K/ / NPE(Jf/` CJf / /N/` / /N/Nl0 S (fh/ / N&nP`X|`/,O/ / &n$SHy?0N):p/+N/N/+N6/ N#x/9;\pЪX/NUHx /*XN .`NQHj\N{V/ NU&B$n&nN^Nu/,ON^NuNq/,O n ((g"h-@JgN^N y?t"h `N^Nu/,ON^Nu/,OH08$.gtBHy?8GZN$y?/N BB B HxHy3)HjN)0-BLN^`|x%D"9:x2LD//NP`/,OH0 $n$  B/NZPJg-BL N^`| 9:rf,"*o&Lv<&n/ N%WXJf*$  B/NZPplBI%XKd&<%(< "/ N$HXJg***( *f."*fA `>/ N%VX-BL<|N^`k: fx jH|Lel"* hP |dZ]%A\*g\( jB(kk @EHx/ / N/ / CN`:AH`HxHx/ "DN$H JfHx/ NP` L<|N^NuNVH00$.&. HxN$HXJgb h| @CB(B(GHxB/ N(=|cHx/.HnN)0j/ / //N(L N^Nu/,O .B@FN^Nu/,OH><$n BHj N(Hy)[/ G2N$  Hx/&<Z CN *(K*CrgmJgSg-BL<|N^`irYfN>&( pl Hy,U/ N/B0*//*NBHxHy3)/N)0 * g/NU&BXB *g/NU&BXBBj/N/ jNHx/N/N`BJ* $f:N&p%@B B / N XJg/Hy,/ N rL9:/HjN/N| `(* ,9:N.* * R%@ KVrl*0f// CNPBHy?8NZPJ?*j fJ-fB-ኄ-x؎/B0* /N#(HPJg\B//Nަ&H ,<%JfrJg` lHxHnB(HpN)1 Jf*b-@BX .".BI(4f2///9:[I/NHxB//N((*`*+[I////N(*"+[I$&mR$.&.n "`/ k$`8$*X&*\GN(*oB$*X&*\N/9:[I/(*//N(4`d(+L9H:*[I`*(9:L(.*. &.,.f:Bg&/HxNX.///Np$gpf2 L|N^Nu/HxNX.///N>$gpg////N%К`/,O/./.NX. /./NBN^NuNVH>< .$n (.Jgn"-AJgV//NhP&HJgF y:, (&!@NRd$ -@&n*<RJ@f / EN/NPB L<|N^NuB`KD/9;/ I/ NT/ EN"KBzڎ@e&B/9;/ / NT/NJg$`//.//) Q-IN$"nJgPJfR`/,O8N^`/,ON^`/,O/ $n HxpPЮ// N)0"%A *Ъ b%AJg "*L@%A$nN^Nu`/,OH0<$n&n "+ AB(ሀ( ?nt gl gdR$+&V%C&W%C oT%A U%@IK&/ NXJg."*0f"<*Ѱ///*Hy,NDrL< N^Nu&SJg%k%kԫ`ժ`RdժPRT`NVH?<$n(n "nB&,*,B(`(TJgJ&,(,Jo C&*SRrfB2. g,Jg///*Hy,NDr~ LB/Hy+NDrPL pN^Nu$n268vƒqV| R`/,OH8< nG`B4(X\I bK vFxGF$SJfHxHxN$HPJg&&Hx/NP"*g jH (\&JJnL<N^Nu g `/,O/ /$n$* /Nj/NP-B$.$nN^`/,OH8<$n(n &jxJg8/ NX(.v(֊K f ;g/ N XB L<N^NuJfJ *Dk J*Bkfrg/ N Xt#`BHx// N$g/ N X`Hj8N|*kXJg -'@fBBS/ N X$MGxJgJf B/ N "`/ /*/*N$ f$R`/,O/ n$h / NHj8BN/ N -J$nN^`r/,O/ /$n$. *uJlJfl$.$nN^NuRAu v* >bR@ >c *g$HjHy,NDrB*u/HjvN B*u` *g$HjHy,NDrB*u/HjvNB*`NVH?< n(n pfJ(Bj\ ;f&hxJg fz ,*B$+@&+DBXՁ,.b^gXHxBN b$HPJf p7LP/NBL N^NuNVH 0 n$. &n"n$hxJgZ fR tTgbP @tXg @ tPg @tUg / /./ // N$Jf tRf/ NX` tWgd tOf/B-|Hx/./)NBJfbN4$Hx / Hj8N)0B<@`D/N `,/B-|Hx/./)NBJf%S8BL N^Nu&8`/B-|Hx/./)NBJf%SX`&X`Hx Hj8/ N)0 `p`/,OH<<&. n $hxJg f Brӹ?,$9?(Հ#?(Rg$*g/HjHy,NDr $`tFă//NɨPJgIN"*Jjxȃ**0]36 g%A/GN// KN p~fjB4*lBjl*gJ*g Hx/ NP * ?bJg* jngpN$"* %@ ?bFgB0*n/HjHy,NDr / NRX/N``2`D?%A`rm8g/HjHy,NDr N$/ NR/NP`r jd (S!@f j`"*d  Pf%@d jdS *` jd%P`B$* /// N$P *gN/NX/ NXBL<N&/ N jh(I @Hp(HjHy,;`R@5@lB2*X\lr*gHjHy,P`"+ҫ `&S%KdB +gD kH hP'H%HhR *h"R%Ah @0*nH40+36B5Bn`gAH`A `NVH?<$n*j / NXvh֍(< |o"B/ NXJg0-MLuN^Nu/,O/ $n/NBX$nN^Nu/,OHx n /(@N"n"PN^Nu/,OB;Hy; NDBN^Nu/,O/. n/(LNz P N^Nu/,OH8&. n$(D/NBrӰ>(0>ـ!>X-BLN^`/,O n(gF"h @fpd.Hx/N&4PN^Nu `fp'dHx/N&5`B`/,O/p;chg*/.N"9;chS$LA X>ueR$.N^NuB`NVH 8E r$@Hx`/.(/N)0(j4G`HxB/ N(HxN/ Hz8t//,DNf,p,gT *`"*d$*hl%@`%AdA`%H4/ /.$/. /././././. /.NLpN^Nu *p"*t`/,OHx/.(/.$/. /././././. /.NN^Nu/,OHx/.(/.$/. /././././. /.NN^Nu/,OH0 $n$9>uB@ C#bF$/*LN "n "/*LN*B@FPL N^Nu/,OH8"n n B@ A#bF$B$1&1װ(0ق!PtfB@FLN^Nu/,OH0 y; gHz Hy;NPHxNL&/./. HxNZ$fHx/NdP B L N^NuHxHxXN$HBHx/N{4%n@%CD%BH/ HzJHzdHxN%HL$HxHy; NZ y;%HPPgCP!IT#;%|;THy; NX$ `d/,O/ / $nHxHy; NZ jPPJg!jTT jT PHy; NHx/*LGdNHx/*DN/*HN[/ N{VHxX/ N$$n&nN^NuNV n -@"n-n N^NNVxH0<$.E r$@Hx`/.(/N)0(j4  %xg %g %LgB %f p"038Hx /&x/N(yd%C4p %@D/ /.$/. /.//././. /.N$@0JfbJg^  %xgr %gn %LgjB %f p"038//K)/`NPJgG38B//NPJf4 0/38( L< `N^NuB`6p`0p`*B`p`p`RPrf4|`/,OH00$n".Ly;ch/NY&// N*/. /NLG2fHx/ NPL N^Nu//*HN_B/ N`/,OH 8$nHy>u/ IN/GN$ pfHjN):PHy>u/ N/N$Jg Hx/ NP B LN^Nu/,OH0<$n/ NX$<>uf(BGt *fB-JL< N^`$~Iv4N// N"$G}PN/N JgKL&<tHx/NPJgNHy>u/*HN_NPt`|BHxBHy,~ CN`BHxBHy,~N`R/,O/ / y; gHzpHy;NPBHy; NZ$y;PG%vJfHy; NX$n&nN^Nu/ N$jPX`/,OH0<$.HxNr/N:/NNv4Hy>u/N&N}PEKI/N&HXJgHx/N'JP$K`/N6XG "Jf L< N^Nu$*/ NX$B`NVH?<$n(. S b*@g&9;chHx/N$&HP(HBK;chet/ N// HzZHxNp-@-A//N$%D@/ N6.N%vXBILKt;che*//NPBL<&n(nB$y?ܰl$@JfZplX8| /Hs 9?Ќ/&<)/"CN&y?" Ҋ A $cJ g 9;mTn #;`m4|(? J L<|N^Nu y?plHl 9?R/HhN)/ `jo/B/N( #; y?// N%P$H//( / N)1 JfJfzJ gE`lHxp0й?/NT&HPJgp0й?/B/N(K0//9?/ "CN/ Hn/9?/ N&b$H".(g Hy,WHxNGN/ NU& `ԍ Ќ @cR g 爴g2IvF*ʃfЁF@038fSg5@`R`F@5@* `/,OH0 &. . $nf-J L N^` R/( Hx/N&N Jg$( / /N%2PJgJf L N^Nu hJg촨f`NVH?<$. $n&n-RJg"n/) B/N&N*H JfE J LHy,^`6P`/*/NPJf Hy,h` y;#;Hx / NP$y;JfLN^NuNq/,OH8&n(n$k/ N BHx@Hx / N BJf(%K k h5h5n T$g!J(%LLN^Nu/,OH 0&n$k$* RJg!j j B/ N z// N" 9?| g &/N~bX-y?|L N^` /,O n h(g -HN^`vN^Nu/,O n (4gHxHh/N N^Nu/,OH<<$.(n (.*. n$PGK)1Jf j JgB///N Jf" jJf Jf&j`/ / /N Jg$R`NHx/N .&Pf/N "/ N P`B//HkN Jg/ NX`-KL< $n(. &***$*,*(J,f$Jg$//N#PJfp *0fVJg,Jg(`8JfJf&JfA L|N^Nu *0$Jf&///` *0fJgf////N`$///N#N Jg"h8Jg //NPJg//-HN#*P n%H,J0f~%h 0`t$`/,O/ $n jJg/,OH<$n *4g%@4Hy;INXG;KMLJ9;fp;#:,;/ G6NHy;HNPIKMLp8mHHy;HN/9; / NU/9; / NTlBL<N^Nu/ Hy;NP`zHy;H/ NP`p`/,O n5Hy;NB9;B;Hy;NPP-|;N^`$/,OH< $n$. Hx/N PJg~ *0%H0Jg /N X*7f BL!@ j p8Ъ/N/ /* jN/ Hy?XN +gS'@`|'@ `Hy, BNX`f/,O n (N^Nu/,OH 8(n$. &n$lJfHxHy?XN$HPJfdp7` jg$H` j!@ `0Hy,NDrX`6Jg!j j  R *Jg!@ j j (gS!@Hx(B/ N(%LN%@ %A$%B%K l%H gC!I )J%L B k %H 'J jRBLN^Nu/,OHx/.N N^Nu/,OB/.N N^Nu/,O nBN^`v/,ON^Nu/,O// n ("( $9? &9?$f PJg (7fA $&N^Nu/,O/ $nB *g/N BX$nN^Nu/,O/ / $n&n jJg8(+f$B/ B//N  B$n&nN^Nu/ N&"XHx/ N %HPfp `/,OH 0$n&n / N&!X$ +g&// N&"@PJf$ 9? "9?$%@%A L N^Nu/,OH00$n$. &.&n *g//N PJg4/ N&"XJgB// N&"@PJf:-C -JL N^`/ N&!XJfB`Jgp& L N^NuA`/,OBBHzHxN N^Nu/,O/ /$n$. *g Jg /N XHx/N %HP j $.$nN^NuNVH?<&n(n ,|܎(<#NzڎJfLJf$,gVBHn/ N-H// N $gJg4/,/ N&&Pg"E`/+0/N PJgv`B ,$f ,Kf ,fV ,ftJf/ B DNPEB/ /.N&\V +4",(PgtF‚t8F'A4 kL h(Jg/ / HxN Jg +f2BB// DN// N#HHn/.N#H LJg:/(0/.N P"n IJfLgJgJf/ N&X|`&NRd,/N#*XCRJf/N nXJfpHx4B/ N-E-D-n-C-BBHn/ HxN&'`, nJfJf/HxN&( .P,<?JgJf/`/N nXJgJf/N&X|A`\"hJg c (4gDg(Df$/N&X`:$(4Jg~/N&X`//N&,P ngbJfBrӹ?.9?߀#?Hx4B/ N-E-D-n-n/// HxN&Vz/ /N#N$L $n&. (.*pʀB@|̄Df$*pg*DHx4B/N(-Jp,-Dl-BH-RL pg-jP Hn@//N&'`( fh$.@pgzpgSfR/Hx`$pf *g///N $B/N&PJgZC&Lg/NXJgdxA L|(N^Nu/NX`,p`h/HxN&/N& ` j(Jg//HxN /HxN&/N&`x3`NVH 8&nB/N&$HPJg(7g hH(1fIHx4B/ N(-|$-S k -h-KBHn/ HxN&'`$/.// HxN&Z .(g /N&XJg / N&X LN^Nu/ HxN&ZPB`NVH0<&n$. B/N&$HPJg&(4K&Df hH(1gJfIHx4B/ N(-j-j-j0-CHn/ HxN&'`$//./ HxN&Vz(I&ZJf&/ N/ N&/ HxNB L< N^Nu/ HxNP/ NX`// N&/ HxN&B`/ HxN&ZP`/ HxN&ZP`/,O n h N^Nu/,OH0 $n n *4Dk BL N^Nu(1gDf0pA` *f *7fp@`N$*&*o`p3`NVH?<$. &..B. I):PK,Y.<&.BB@$@2< @eF!///N&8$&H Jf-JL(// /-IN)0"nBހ Jo/B/N(ބ ԃRp fJf|Jgrg| Ъ %@ npJgj"*o( *g //NPHx/N%H%BP&jr-AJf%Bp7LHx/N'H$Pf.B(p7`HSgU ~bTStA`B$ *'@(g"+$//*/N)0 BL N^Nupf pV`pT`p`NVH08$n(n pf *4gGHx4B/ N(-j-j0-j/ N&2>-H jHJg( h-P/ N&@-P"jHX)1g-hHn/ B/ HxNJfJg &lJgJ n'j4'jD *p"*t'@@'AD *x"*|'@H'AL *"*'@P'AT *"*'@X'A\ *"*'@`'Ad *h"*l'@8'A< *`"*d'@0'A4 *X"*\'@('A,$*&*"g NtցՀ'Bh'Cl jH7h,BBB'n /./,/ N JgBL N^Nu .ѬB`/,O/". . ѹ;tgt!gUfѹ;x$N^Nuѹ;|`ѹ;`NVH<<&n n (n r€$A P"fJ fJ(gpep`HjHxHx/ K &N* b", gBgx$,(g f(l$ry(d/ HxHxx/ NU ~bz(b~& ւ/ /Hxx/ NBG)1efp`f// / N Jf BL<S~R"HRp gXep .fzJgBv`p`CB`ֱg"WfJgBg DzЃf-j nJg ($b nJg ($bBB/ BB-|Hx/./,PNARJfpJgD nB(/N * nBXd"/// N)0/BHu8"DN-M* gb gBv-`p`6 c fBHn/HxN&'`& f$*n - *g6 nB///N)1 JfJfJf* gD g f / //.N&#& f n * F&[IĨX\!BX!@\** [I&*(Ƅ"*,…!CX!A\` nJg (fxJ(fB(ሀ(JgbB0(-@f@Hn/N PJfF/.//*l/*h/*B*/N$ &JgTB` n (f(g`Hn/B*/N&'`& f/./ /* N/.N&BBz@ nJg|(JfxB`: nJg< (f4 * g*B2(///*l/*h/HxN$ &p`>Hn/HxN&'`& f, n-H-h-h0-h/N&2>-HHn/ //.N&f .fx`6"*Sg8/./N PJg*n n((HB D/(NZ-P*<"D g g/) ENXKA`: i$ P/ B/ hN*H D/("ENX Sre-agA"DB)5//BB)4/0),/Hx HnN G JgB6-`Hm ENXC-IHn/ //.NJf .g" $@ r "*AC%CB` i| h`0 n-h-h0-h/N&2>-HHn/ //.N(&f\".g $A`Bv `x`Bv`Bv;`&`*" $@ `>B`/NU&X`~B`Jg/ N&X`EBv/ N&X,gFJfJgB=B`Bv7`B~;m Jg / NU&X/ N "X`2*J`$lJfPJgBjJfRHy?Hy;XHy;hHn/ N& `lJgB=B`ಀl// N P/ NX`B=B`/,O/N$HzT/./././. /.N&tB@F$.N^Nu/,O/N~$/.N B@FB$.N^Nu/,OH0 $n&*NN$/ N V/N& B@FBL N^Nu/,OH 0&n$kN$ *(g//*$NPHxB0*/Nr/ N& B@F L N^Nu/,OH00&nHxHx,N$Hp,!@'HN&Hy?/. / N& $g$B@FHx,/ NBP L N^NuHxB0*/N%|;h%|;X %|&@B@F/ N Dk@ `NVLH?<-nd . -n`-n\".tf$p"ndfL<$N^`PJf|`JfWf"nd*E[BBB|I .gHx/N-H-nBP"nd-i-i"n\ -@D-@-n`Nj.&.pmdJojUf .g gJ.[flB@F| .g/./NP .ЮJ`g n`"n\"c| ` WrdzB@Fr7fJfJf"`HnpF/N$,P`vE&4>G$tFąJ.[gf/ Hzd/N, f/ /N,PfRr&f`0 39Hx4BHnN( y:,,($!BNRd$ 9?-@l&nl JgrF…-API-DL-FTx؎Jf/NR/.TNB@FPB` .g B2+,fr +-@p .pgbrDgZHn/ N#/NR k-PHnh/ B//.LN, fBJg$nJgJntg`pgbAurfHy:Hy:NPJg /.h// / y:N,Hy:NuTJgXtNf.|`(J9:g$.h5k, B0+0%@BHj/ N#%n//./ N,fծNRd$ +-@t$ntJgKJf/NRBBBNRd$Hn/ N#H +-@&nJgP`DHy:@Hy:PNPJg/.h// / y:LN,Hy:@`N`,`JPg RB(Pf/ / N#*/NR-R-j-j pfHnx/ B/HxN,ARdfJg"nJgJoN$/ `d j 3h,#j,#j4#n B R( g\ g\#F$.x//./.N, ARdf<ծN$Hn/ N#NP *H-@|$n|Jg|`n,*`,*`N$Hn/ N#NP/NRXHn/ N#H/.TN `N$/ `Hy:Hy:NuPJg>// / y:N,Hy:NuTNRd$/ / N#NPJgJ`~N`,`r Lr LA"n\" L<$N^Nu|`NVH?<(.*n &.HxHxN b$HPJgH/NBX$pg, oHy393Hy*pNK. oHxHxN $Pg%B(%|"H!AB /./B/ G "TNl *Ѓ"/B/N( (j* XB|"E Y* JgR 度Bgx&SpR//// -HN nBgHy39"/ @Hp(/ NԃRp f(f*8|D J L"-A(x,,.<(Hx4B/"GN .( rm@rm SgL (G~gSAI AcB@@Vp Djr0(B<// /.I)0-@NA .Jg"D)+g"DkYC(@(Kk"Eթ@/ /HmN$DR pF`Ff"DR"  Ԁ$Eb"// HkN)0+@ (D@ pp`$&"`@E`jlfEB`\`z` (fJf0+ mgg`"C bv c6B@.GV~~ gReJfXB2+ g:v`F`~ g pg&`0f*B0+ fEv `Ev``6W`/,OH?<&n(. .$n*n2*tpg gjR `XJg+ b@BA5A| z…0|e  ԁb@I // / N)0L<859 R* n BL1\l$&R,0 X6qlKbf0i P0Y Pb <&0 T:1<Fbf0) P09 Pc!"Ѐ`/,OH? n$n ,.B2*Jf&2|tuF5l\BzB~uFlLN^Nu2|t`B6Rl&gpl:p tJfpB2|tuFRX*"`lp tJgDfJ2|tB`JggRp tRh `t mRh JgB2|t`Rh `"`B2|$`2|t`/,OH?< n$n B2*Jf"|zuF\C~B:|oL0*(B80(D, 뮌h2|dzlb1F"h*((R!DX"h*(,R!FX"hz, Cx* 1F!ESfJg,f0|zB`6ڇ`,(6hJgRgr*B00\B>0\*8 D6|o1E(h,((R!Dh(h*(,R!FX&h|*G 1E!@ B>( *(B8( &D, 뮌h2|dzl1F"h*((R!DX"h*(,R!FX"hz, Cx* !EW.믌Gx1FlT"h*((R!DX"h*(,R!FX*(|1@pЅ!@`І`,ڇ`T!E`x mB0( B>( 8|*o< F1E(h,((R!Dh(h*(,R!FX&h|*G !@U, ᮊF| 1Elj(h ((R!D(h (,R!F*( |1@pЅ!@JgB|zRX"@."`8 DІ`V`B0( B>( *8 D6|o1E(h,((R!Dh(h*(,R!FX&h|*G !@|܉.ᯊGx 1ElH&h ((R!D&h ((R!D (z1F|܀!F` І`^`"`B|* `|z`NVH?< n"n Jf(B4) (B6)"ᩂhxmЂ`BE3>0I3<&hB03*-@&h3(R.(6hJfxKB2-B0&8 Dx1CoB&h((*R!EH&h&(,R!F8*hv1@K!M`҇!Aeb`(B0 3=0&K8B6-B<"8 A:|þo1D&h.("R!Ax&h((.R!GH*h~(K8& 1D!C*p]3FJg^\*筈Ez1DoB&("R!A&h8&("R!A&h8&(x1@K8!M".S bB2 *nB8- (B:,ᮌh~l1F*h (.R!G*h (,R!F*hp,KH 1F!@(0=3Egz=38&n&. .*.(n(. n ".$Jg 1ft8fJf pL|N^NuB|fvJlJDt" S|eּf0|per e|eHxHx/+( k N$H Jfp`B`'H !B!E(t"!A$ S!@,* ^!EH !@DS!@Lp Ќ|LF!@PHx//+( k N%H0Hx/*$/+( k N%H8Hx/*D/+( k N%H<\ %B$Hx//+( k N%H *"%A J0gJ8g JJlfJfRB`Jf JlfJgp L*|// p 3F|N"UPf%|UfJf`JgSgJ[fJfB0+0// IfN +0// N/ Nrp%@JWID`TIVzf / N&/ NPJfFp%@ `vf4 *D j2} v(Gjr lV5G j,**R%Eh j,*.R%Gh j|. |܈5G%FRo/ // GN//./ N/.// N$`: Zc *&T"ᩂj| mBV`Jg//// N&>/ NXJg-JL0*<&j lcple&*X%Cp.*h%G\p%@X,*dJgBxd< j$ e,(*rg"// EN%@XPreSfp%@XreJ`g j00h"* jBp j"*&R%CRr *Sf, *T"*dJmЪ0B/// N%jdT/NRdSl R`X/ N *lX bJ f BL0 lc>ple.*dJg("*$ e|g// CN%@XP *X"*ҁ"jrdWjj2 j"*,R%FSG D0Rr  GbxB3xRr "j"*S *X jl%HlxbP|dHS%@X *d.R%Gd j0B0 *@,*PL%@@ j<:0 Ϊ, j81z *@ j<1f *XS%@XfRdf`N/ BN *lX bJ f BLЪ0//// N&%jdT/N RJf Ѐ`.*d j0B0x"*@**P멳L%@@ j<00 B:Ϊ, j81z *@ j<1f `OG`Ъd%@dBX j0B0%G@0,*PL%@@` j00xBQ j"*,R%FRr *SSlRdfn *T"*dJm*Ъ0B/// N%jdT/N RJf:`B`B`z fp`p`~/,OH0<$n&. $* [ ctFBGI&K|ple/ NXJlfJfBL< N^Nu"*dҪl%AdBl *T @JgLcH *T"*d j$bJmhЪ0B/// N&%jdT/N RJfv`%Al%HdJm(Ъ0B/// N%jdT/N RJf`XB`B`rWDB *T"*dJm2Ъ0//// N&%jdT/Nx RJf Ѐ`B`[fp`p`/,OH?<$n&n $*40fJf(*+(j .*,*,K)0Jf&%L %GB ѫ&%B4BL"hJg6BBBJ g p"B/ h/(N& BN^NuB`p`/,OH 0&n$.Hx@Hx/+( k N$H Jg*HxHx/+( k N%H$ f / /+( k$NPE J L N^Nu/Hx/+( k N%H( f /*$/+( k$N/ /+( k$N`Ԉ%B,%n 8BB/ / N& `/,O/ / &n$n B/ / N&/+(/*( j$N/+$/*( j$N/ /*( j$NB$n&nN^Nu/,O/ $nJg> jJg6J$g0 (g / /N& P/*/*( j$NBPB$nN^Nup`/,OH 0$n$. nJg 1fp8fJf pL N^NuBHxHx/*( j N%H gnB jB Jl D jr!A Qg / N&rX` j!Bp&j"<&|J gB/// N&^'H f/ N&rXp`d/ N&XB`Tp`N/,OH<0$n&n (.&+ **0$*4c$*, +d$JgrfB'@ի j8Jg///*B`*JgSB娆PB`%C %BB M$ի`8**,ޅ`Jf̲,f" j0"j(gdS-H" Jf%A4// / N&-@"*4 *0 dj @S-H,f"j(g d\S-@" JfT%C %B'D ѫ&%A4-n-K -JLS-I"Jf6%C %B'D M.߫`-A`**,-E`-A` A "SBB`Br$ *"*~΀"G @K -Mb`Bp -@r-A/ /*$HnHnHnHn/* HhHiN&.$gBpf/* /+( k$Nr $` jb: ; jB("hpe. j .R%G!`>JgSB娆PB`pgAp-@Kx-M촮er &.;ЮЁ j b ~fxJfZ//+( k$Np $'|,Y%C %B'E ѫ&%D4P``0|p `~JgSB娆PB`r"p j !Rf%@`dC`/ /./././.N&,Jg%H/* /+( k$Np$P%C %B'E ѫ&%D4// / N& rf/ /*N&n(S*+&* $*(*4.*0PdSJfB`.*,`~$B%D4// / N&(*4 0fxp$%C %B'E ѫ&%D4r`*%C %B'E ѫ&%D4~`%C %B'E ѫ&%D4p`/,OH<0$n&. JgJgJgpg>Bp&|& jr e"ҁ23N ,b rt`"*gXS%AR *R$"@B!A j gp %|,s jr!A`$ (Pcz %|, jp!@B`Tr B"*gS%AR *R$ @ j (BЄzLEJgp %|,`~fz `p B"*gS%AR "R$ j"@Br!@ jz B"*gLS%AR "R$ j"@BrѨ jz B"*gS%AR "R$ j"@BѨ jp B"*gS%AR "R$ j"@BѨ j%h0p p`r %|, jBp`// /(N&0 zf"JfJg j hpfB `Prf jz jBp`Jgrf( jHh/ /(N& j J g z `pp "*gS%AR "R$ j"@Br!@ jz B"*gS%AR "R$ j"@BrѨ jz B"*gS%AR "R$ j"@BѨ jp B"*gXS%AR "R$ j"@BѨ j (gr %|, jz!E`$p pL Jgpd "h-i /N "XGJg @ -@ nJg0Jf A $N^Nuf g (-@ n`/,O//NRd&/. /.N$Pg/./N#*P/NR B $.&.N^NuNVH<$n&n n-P-y> jB(IJg&K/ / /Nz Jg-S/ /N#NPGJf/ K/ N B/ N&Jg(Hf"hLJg"Q )f-i/N&XJf8/ HxE/ N / Hy3GeHy,kHxNGNL<N^Nu/./ / Hn/ N`/,O/ /$.Hy?N$y?XJf-|?$.$nN^`]δf@/ NHy?N6Hj NHxH/ N -B$.$nN^`$R`/,OHxN$XN^Nu/,OJ?g N&B?N^NuNV/ n g>J;g./HxE/ N / Hy3GKHy,HxNGN$nN^NuB/.///.N`/,O/ "n i $hB*Hr/ /N& $nN^NuNVH<&n +fH k I,'JgIHkHxE/ N / / Hy3G2Hy,HxNGN `J; n&r€'A/ HxN&ZP-KL<N^`D k (1glHxHxHN,$HHy?N y? JfPJfXHy?N6 k XI,'JgIHkHxE/ N / / Hy3G2Hy,Hx`>g P`I Hx/ NL%K/ N#ـ%y; BBBBB y?%H #? J;g8HkHxK/ N / pЫ /Hy3G2Hy+X=HxNGN N / HzXLy:// N-|?L<N^`ZHy?N6XJgHxH/ N PL<N^NuNVH <$nHy?N&jXJf-|?L<N^`Zl +g\ k I,'JgIHkHxE/ N / / Hy3G$Hy,HxNGN.?N6XL<N^Nuf>Jf8 k I,'JgIHkHxE/ N / / Hy3G$Hy,`$*I rlfJ;g"pЫ /Hy3G$Hy+V]HxNGN/ NTHy?N6/ NHxH/ N -KL<N^`"* l k R%B0(0@A @Af>BR%ACB k *hBB-HuHk/ /N"* l,N "9:$LA Ё/ Hz0// N`@ 9:Ѐ`"*fr€'A/ HxN&ZPJ;g8HkHxK/ N / pЫ /Hy3G$Hy+VHxNGN r%A/ Nj *R%@Xl/ Hz 9:Ѐ`Xl`J;gHkHxK/ N / pЫ /Hy3G$Hy,&HxNGN `PNVH>< .$n *n"*0&jHtf -,gT-@L<|N^`*7gFSf8 +#4f0 <+0g 9;}"[I*+@,+Dc%@`%AdL<|N^Nu|g tf-m -A -JL<|N^` /- // N(H Jf$-|3GW-|,P v-CL<|N^` (*4 f y:, (&!@*5g@xHvH/ j/(N\$ g$B,Ht// N&HvH/N#N ,gHy3GWHy,hHxNGN y:,,(!C` +#4fX <+0g 9;}BBvƪ\*f4$*`&*d"[I*,b,f$+@&+Dc%@`%Adf`B+5/BN GPbHk49k, *4Yf/*H j/(N \PJg5 *4fg%y?HB`Bd`NRd(@/ j/(NPGRJf / NX`%y?HB`Bd5-)fرLg// N&P`NVH0 $n$.JVDJf/. tԎ/NFPB/*NZ j$ P/p // hN$/*N B L N^Nu/,OH<<&n*n $.(n&.(.Jg mH (4f&HB/ B/ N&:$HJgF*(agB hhf:B+5/Hh/N)0/NB L<+ +f\$ PHnB+//N#,-H\ gJHn/N#H/9?NBrӨd$(`Հ!B`/9?N*/.N "X` VHn nB0( /N#$HPJgJ(1kzB+HxHsHndI)0N/ Np./HnhN n (g,/9?NBx٨4,(0݃!F0/9?N*P*.df *.hf -J\Hn/.\N#HP` @ -@p*npJg0IJfJg4Hn/ N#H$l PHn/ N#*/NR +*5g@/9?NBtըD&(@ׁ!C@/9?N*B*5B+HndHxE/ N /// Hy,HxNGN(JfJ\f`JB` f` m (4f>0(0@A @Af0Rf. +c&/Hn`// N'Jg-J\(M`g *g m f(M --@t*ntJg0`Jg *.hBJf/KRNX+*5g-J\`xHvH/ /.dN8* fNRd&Hx/ N#(HPJgHvH/N#*/N -J\&,B*5//*/K)1N Jf/9?NBtըl&(hׁ!Ch/9?N*HndHxG/ N / HjHy,HxNGN$Hn/ N#NP`d/N/9?NB~ߨ\ (Xц!@X/9?N* `0* `8-J\(HB`,B8 .df/9?NB~ߨT (Pц!@P/9?N*P,.hf$/9?NBrӨL.(H߀!GH/9?N*PJ; o2Jg, .dg$JfJf n(g Dg :Hx/.N 'PJg +fHx/HhN JfB+//BB*4/0*,/Hx HnN G$H&l HlHx*x/N  JgB*/*HrHx0HnN#(KGNg/// Hy+TrHxN.N",pXg)@` f/9?NB~ߨt (pц!@p/9?N*PJ; n`B+//Hx0HnN#*HndHxK/ N // Hy,HxNGN-Ch,pg&Ufv/9?NBvר,(((ق!D(/9?N*P`FJ; njJdgfBHndK/ N\Hx/ Hnd/ N&:*f^B/ N&.Hx/*NZ j$ P// Hx / hN*.NXJg /N&XJg0 E1|h"E>)`G:|gB*5// /N)1 JgB+//Hx0HnN#-HXA.<*"E)agt/9?NBrӨ|$(xՀ!Bx/9? GNPJ;g.HndHxE/ N / /.XHy,HxNGN EHhNX`Jg .dgJff6`B`\-lL-lP,< .LPf, FN)@)A/ Nh/// Hy,AHxN`f"FNtт$.L&.PmJ; n/// Hy,fHxN`(/// Hy,`v)C/ / HxN&Z `Jf`HxBHnd/ N&:*f,`N 9?"i@gp/NBrӨ$(Հ!B/9? GNPJ;g"E i@tԨHndHxG/ N // Hj/.XHy,HxNGN$`l/NBrӨ,(݀!F/9? GNPJ;g0HndHx~HvxN /.XHvxHy, HxNGNr-AX|B*5/// N)0 E0(`2A1A`Bhb JXg$1nZh~XfFfp//N%PJg$ EHhK/ N/ // B/N&\~"E*iP,.<Jg-iTXHiHnN EBPBT/"GN/9?C-ITN..X[Iߨ (ц!@/9?*<* EN/9?"nTNߨ (ц!@/9? EN*<& M*mBHn// / "ENJf`*pff EBhfr-AXJGWID`|f E0(h @gJ@f"EBifr`p`/ GNX`/9?*<"ENBrӨ$(( ـ!D /9?(<* DNPhfRf/ NXK)0JgB+///N jB+B(/Hp/N Hn/ N#NB+I/ NތB+./ /I)0NB+B+/HnhHsN7|7| n *4f (@@!@B+ЀB+"@C!I!h(||/9?"ENBrӨ$Հ Ө &(׀!C/9? DNHn/./ / NzJ\gHn/.\N#HPL<$N^Nu *4g/ NۂX,HnhK/ NB/*NZ j$ P/ B/ hN*H/*.<"GN Jgr& -agp.<)0JgB+///"GN B+/Hm/"GN/N`THnl/.NjPJg(4/.lNRX g6`/ GN`hB+B+ЁЀP!@`Jf@`NVH>-mDy;_0**@=@KCA',0f/ / Hx`/ N "X4|3`t/ / HxN *f"*fA `& f jHrLe"* hP vdpЁ%@rӪJg *gvת(rd g0 f jHvLdHx/ N #\$HPJg *Hx//N)0*S/-N$&(/NHnHx/+/N&"$(<6G*Jf@$-/ DN/N/ N " `AH`HxHx/ N "$H `C&!ιHf,//N/N&"$-/ DN/N/ N "`p//NBBB/B/ N$@$-. DN/NP`NV/ $nHxBHnN(|p-@ * g>"*g8/Hy3GB//HxHxN'!%H g%|&rB$nN^Nup`p`/,OH 0$n&R/* N'$$XfB /+N# L N^NuNq/,O y:, ("!AN^Nu/,O y:, ."(!@N^NuNV n -@ nJg N^NuNV n (-@ nJg N^Nu/,ON^Nu/,OH 0$n$. gJ;gJAGNJgbHjHy)HxN A3G/0, */0 Hy,GBNHy+N%Bpgt-B -JL N^`Hy,HxNP`L N^Nu/,OH <$n4*fSBI L Bf>BjfBj\Gv jJfHBj$*gI$PKU&&j0JfHL<N^NuB0&@T 2 `g /NB `XSB`"hJg#h"h"/NX`Hk/-|/ HnN PJg(%Hh5|f j5h,\5|dB$nN^Nup2`p7`NVH0<$nJgHxBHn&<("CN=|=|=j,|BtԎ/K/ / Iv(N&HJf .L< N^NuHx BHn"CN=|=j,p-@PB// / NJf/ Nv .X`"j5i,"j'IgI#L%K '@"j!IgG#K%H!@B`fp2``NVH <*n$.EHx\HmT/ N)0Hx/. / G(N/ /I(dN.N(Hx@Hm/ NHx// N/ /N$L<N^Nu/,OH0 $n$. /*hN Btհ&0ׁ!X-jhL N^`/,O . n"P iJgrf"hlN^N/N "Xp3N^NuNVH8 n (rfB(5LN^`"hJgR ) 4fJSt@rHAxBBDB.BAC@BHxHn/N#ۼLN^NuBt^Bv`/,OH80HxHx8NT$HPJg Bp!@p!@Bp!@BBP(B/GLN& B/N$ B/N/ Hz/GN .Hz/N/ Hz/NB0$/. n/(Hy,'wHxHjNE5|0%|'|%|&t%y;|(.N#B/ N$Ud|4%|&lp%@8/ Nd/ N#ͨBL N^Nup `/,O/.(/.$/. /././././. /.Hx/9?N%N^Nu/,OH00$n&n Jg8N $&%B%C'B'j HkHk/ N L N^Nu$*&*BRՀ`/,OH> $n&. $.*.(./*hNBrӰ8,08݀!8۰( 0(ф!(X-jhL|N^`&/,OH8<$nBGRdI.KJ(<RJf L<N^Nupf,0*0@A @Af&N&HxDHjNPJf/ DNX`pg$j`"P )f"n "ifRHxDHhDN`NVH?<&n&. NT(KRdN$HxDHkN(HPzڎ.<#*|܎Jf/NRX-DLB -JL N^`Z@5@0p-@ -JL N^`HjN pL*'@[I& *L<B@XJl'@ g: g$Jg/ N`/HjN Jg(/ N`/Hj`/ N`/HjN L N^Nu'j[I& *L<B@Jl'@/ N`/Hj`/,O/ / $nG)1Jf J $n&nN^NuHx/./ N JfHx/. HjN Jg$j`/,OH 8$nHjG NHjNHjN JgS;BplS;BB/ Nj0B/ N/ NB@ B#bF$&jJgTB/*P/ N#p(k j *JgF!@ j  ,S)@fB/ N$B/ NU& BB@FLN^Nu)@`/,OH8$n&R/ N/ N$V/ N#xHkINHkNHkN/NU&BLN^NuNVH?<$nK r*@B@ D bF!Jf.Hx/ NB@FP/ N`/HjN `JgBtF&|!jCB|B.BnJgHxHxN b&HP,<*<*JfHx/ N/9?"FNBrӨl,(h݀!Fh/9? ENB@F fB f8L<|N^Nu&*$*J;g ltF+C[I* L<B@Jl+@`p8!@(B !@Hx8/N k(k(E8)|@)|p~HxBHvxN(|NRd-@/*HvxC#-IN"nJf/ HvxNPJg ()@ /.NR)|~Hx$HnHtxN)0Htx/ N.rӫHx$/ N&|9@~߫ HjXNB-|8Hx8/.HxHx/ N@/9?"FNBrӨ\.(X߀!GX/9? ENBHj\HxBB/ N.g$p7f/9?"FNBrӨl,(h݀!Fh/9? ENPHx/ N *P g R%@Wf 9;R#;SfNBJgHxHxN b&HPJfHx/ N/9?NBrӨl*(hۀ!Eh/9?N*`xB`nJ;g^AGNJg4HjHy)HxN /Hy,GBNHy+N ` Hy,HxNP`|l *R%@ؼl4S;B`&|L!F(B !FHxL/N k(kHx'BHl,<("FN`9|p~HxBHvx"FN| NRd-@**/HvxC#-INP P"nJf/ Hvx-@NP .JfHxB/"FN * /.NR9||'B/HlNJJgHx/ N/ N " J;gAGNJgJHjHy)HxN Hy,GBNHy+NP`* HxHh`/N)0 ``Hy,HxNP`z(Hx$HnHtXN)0HtX/ NHx$Hx(Hxp/ N9@.$HjXNB-|LHxL/.HxHx/ N/9?,<"FNBrӨd*(`ۀ!E`/9?I*NBBHjBBB/ NP~*g~7ff/9?"FNBrӨl*(hۀ!Eh/9?NPHx/ N *P g R%@Wf 9;R#;SfNB`jJ;gAGNJg4HjHy)HxN /Hy,GBNHy+N `|Hy,HxNP`pl *R%@rlS;B`NVH?// N#*/"GN"jB)Hq/ /*N& FN$// N#N HxDHlDNd(HP`*"U )fB// N#*/NBHx/< Hm`Hy;`/*"EN$ FN$// N#NPHxDHmD"GN*HP` NVH?<&n(n (.B0+ /N# h h$PXJf0/9?NBrӨL$(HՀ!BH/9?N*P`fB,gl$j` fHx +P/HnC)0-INrҎHxHm`/"n-AN". .f. fBn .f. fBnHx/HnN)1 JgF/ GNXHjXN"+([I-@-A//.HxB/ N g/9?NBrӨ4$(0Հ!B0/9?N*Hx/ NJ;g8HjHy)HxNGNHx/Hy,OEBNHy+N-KL<|N^`#\K/ Hl/ NHx/ HlN)1Jg/9?NBzۨD.(@߄!G@/9?N*Hx/ N0 gB gJ;gHjHy)HxNGNHy,EBNHy+N`RJ;gJ(kHjHy)HxNGNHl HxE/ N / Hy,hEBN.+NX/ N "X`|J;g(kHjHy)HxNGNHlHx./ N/ ` , %lB%@"j" [I,*J;g*<N o*LNٞPEIٴJfJgJ$* JgDg@t1`"h g" )4gJi0l +d`fJf$HHxHhNP`$/NR// Nz$ fhJgJg$RJf&B/ NPB/ N`>/ Nڦ$Xg`(m0$R&-JfJ fJfJgNRd$HxHy>NتPG,<&lJfH/NRXJg"- + Jgf// N$PfJgJg`R`>( PC`B(D *( PfRpf"h g )4gJi0l YfJf&HHxHh"FNP`b&`/ N$Xg`,m0`/ // N#$ f 0*@JgnJ@fRHmE NHmNHmN pfm0r+A/ N:Xm0B/ N׼B/ Nzg&p// N#`J@gm0B/ NP`p`JgvB// HxB-| Hx/./,NAR$f>Hx4Gp/ /*Nh$ f J.tgHkN#XJft LNBrӨ $( Հ!B /9>N* ``K/ / N,&HP(<'+ JgJfN/ / DN/ N "/9>NBrӨ $( Հ!B /9>N* <Lr)g/9>NBrӨ $( Հ!B /9>N*/ N "`x .t@peHx/ N #\$HPJg *RCA',0g // HxN p/ // N$}`// Hx`r'eHx(/ N #\$HPJgT *CA',0g// HxN p`// Hx`NVH<<*n . $n$-(m(JgJg B (f ,g/ N "Xt/`Trg0zfr'eHx(/ N #\$HPJg* j v)`4pe"Hx/ N #\$HPJft7 L<"*g8/Hy3GB//HxHxN'!%Hg%|'-B$nN^Nup`p`/,OH 0$n&R/*N'$$XfB/+N# L N^NuNVH< ."n n&n )fP fJreDrg>J0 2"jg4Jg0*hJg(E/ / N(hPC*JgJf/ /NPABL<N^Nu ,f/ /N/+N(P$h/ N lJg$HxHhHmN)1 Jf / N&"X&k/ N6/ N*`/,ON^` Nq/,OH8$.&. (.//N'?VPJg-C -BLN^`LN^Nu/,OH<$.&. (.*.//N'?xPJg-C -BL JVDN^Nu/,O/ /$n$. /N'VXJg.Jf(* f,/N'bb// N'? Jgp%@$.$nN^Nu/N'gXJfp `/ /HjN'W& `/,O/ /$n$. /N'VXJgJg/N'mXB$.$nN^Nu* f*/N'bb// N'? Jg/N'mp%@`/ /HjN'W& p`/,O/ $n . ". nJg Jf///N'cf Jfp %@$nN^Nu-H -J$nN^`*/,OHn/./. /.N'AN^Nu/,O/ $n . JgJf/N'btXJfp %@$nN^Nu-H -J$nN^`/,O/ $n . ". nJg Jf///N'dH Jfp %@$nN^Nu-H -J$nN^`j/,O/ /$n . ".Jg"JftFā//N'bPJfp %@$.$nN^Nu-H -J$.$nN^` NV/ $n n ". .Jg(Jf"-@-A///N'b Jfp %@$nN^Nu-H -J$nN^`/,O/ $n . ".JgJf//N'bPJfp %@$nN^Nu-H -J$nN^``/,O/ $n . ".JgJf//N'cPJfp %@$nN^Nu-H -J$nN^`/,O/ $n . ". nJg Jf///N'd Jfp %@$nN^Nu-H -J$nN^`NV/ /$n$. nJg0Jf*/Hx/ N> Jf"HxHn// N'C$.$nN^NuB.//N'mPPRfp %@`/,O/ $n . ". nJg Jf///N'e2 Jfp %@$nN^Nu-H -J$nN^`NV/ /$n$. -n-nJg0Jf*/Hx / Nn Jf"HxHn// N'D$.$nN^Nu". .-@-A///N'mr Rfp %@`/,O/ $n . ". nJg Jf///N'e Jfp %@$nN^Nu-H -J$nN^`/,O/ /$n$. Jg0Jf*/Hx / N Jf"HxHn// N'E$.$nN^Nu/./N'mPRfp %@`/,O/ $n . ". nJg Jf///N'fj Jfp %@$nN^Nu-H -J$nN^`T/,O/ /$n$. Jg0Jf*/Hx / N Jf"HxHn// N'F`$.$nN^Nu/./N'nPRfp %@`/,O/ $n". .JgJg-@$nN^`(//N'hPJfp %@$nN^Nu-H -J$nN^`/,O/ $n". . nJgJg-@$nN^`(&///N'i Jfp %@$nN^Nu-H -J$nN^`&/,O/ $n". . nJgJg-@$nN^`'///N'i Jfp %@$nN^Nu-H -J$nN^`/,OH08$n . $.&.JgJg0JgF&BEI'oжf-BL N^`'B/NRX`///N'j< Jfp %@L N^Nu-H -JL N^`4/,O/ $n". . nJgJg-@$nN^`&///N'j Jfp %@$nN^Nu-H -J$nN^`/,O/. B/.Nj N^Nu/,O/$. /Hx/.NL Jf /HxN'7-H$.N^`"/,O/$. /Hx/.N Jf /HxN'7-H$.N^`"/,O/$. /Hx/.N Jf /HxN'7-H$.N^`"/,O/$. /Hx/.N Jf /HxN'7-H$.N^`"h/,O//$. &./Hx/.NV Jf /HxN'7-C -H$.&.N^`"0/,O//$. &./Hx/.N Jf /HxN'7-C -H$.&.N^`"/,O//$. &./Hx /.N Jf /Hx N'7-C -H$.&.N^`!/,O//$. &./Hx /.Nx Jf /Hx N'7-C -H$.&.N^`!/,O//$. &./Hx /.N. Jf /Hx N'7-C -H$.&.N^`!/,O/ /$n$. /N'V/ /HjN'WV$.$nN^Nu/,OH 8$nJgNG'KI'm$*f, *g /N'oXBB B-JLN^`#// N/N `LN^Nu/,OH0<$nJfbp/N'6$&*XG'gI'AK'9Jf B L< N^Nu/NXJg//N// N&`/N'KXB`/,O/ $n . nJgJgJg,J g&-H$nN^`//N'i PJfp %@$nN^Nu-H -J$nN^`/,OH0<$n . $.&.JgJgDJg&BEI'7nK'K춊f-BL< N^`"RB/NPJf/+NXR`///N'k$ Jfp %@L< N^Nu-H -JL< N^`6NVH?<&.-n BBBN'6&HXJg$Y/I/ B/./K'8N.g޶f$K&<'bR*<'N,<'AJf K LSr e6Ѐ @00XN@^p*v g g/. CN/Hy,NK.///./N'\.Jfl`///./N'\`///./N'\`///./N']l`HnB///./N']. nJgJg!n /./ "FNPJg .gB$@`///./N'^@`T * g`/N'V$H/.N'oP`Jf" * g:/N'V$HX/.N'oX``/ N'7J$H// B//N.f/ N'KXG`6///./N'^`///./N'_`///./N'_`Hn///./N'`(g-n.<'7J n!n /"GN-HXf// B//.N.`N/,OH8(.&. /Hx/N$ f /HxN'7/N'l`//N'K/N'oLN^Nu/,OH8(.&. /Hx/N$ f /HxN'7/N'l&//N'K/N'o"[ILN^Nu/,OH8(.&. /Hx/N@$ f /HxN'7/N'l&//N'K/N'o C LN^Nu/,OH8(.&. /Hx/N$ f /HxN'7/N'l&//N'K/N'o C LN^Nu/,OH8(.&. /Hx/N$ f /HxN'7/./N'l&//N'K/N'o C LN^Nu/,OH8(.&. /Hx/N.$ f /HxN'7/./N'l&//N'K/N'o C LN^Nu/,OH8(.&. /Hx /N$ f /Hx N'7/./N'l&//N'K/N'o C LN^Nu/,OH8(.&. /Hx /Nr$ f /Hx N'7/./N'm&//N'K/N'o C LN^Nu/,OH8(.&. /Hx /N$ f /Hx N'7/./N'm2&//N'K/N'o C LN^Nu/,O//&.$. /N'V//N'K -B$.&.N^`/,OH8(.&. $.///Nz Jg-H -DLN^`//N'7/,OB/. /.N'T N^Nu/,OHx/. /.N'T N^Nu/,OHx/. /.N'T N^Nu/,OHx/. /.N'T N^Nu/,OHx/. /.N'T N^Nu/,OHx/. /.N'T N^Nu/,OHx/. /.N'T N^Nu/,OHx/. /.N'T N^Nu/,OHx /. /.N'T N^Nu/,OHx /. /.N'T N^Nu/,OHx /. /.N'T N^NuNqNV/ E r$@Hx/./N)0/*/N(P$nN^Nu/,OH88$.&.(./N)/8&n$n (n/+N)/<$R(+B"+B TEB*|ERETE D (DBDDDC&C2C4CA"A A D @pє./+/ N)0A( L|N^Nu/,O n N^Nu/,O/ "n n $nS $_N^NuNVH8 $. $npЎr n&((("@"#DHx//N)0Q BP LN^Nu/,OH 0$n$. &n/*/*/N)0 * B L N^Nu/,O n"n PB(|B(B(B( B( B(B(B(B(B(B(B(B(B( B( B( B(pёB(S N^Nu/,O n"n B(|B(B(B( B( B(B(B(B(B(B(B(B(B( B( B( B(pёB(S N^Nu/,ON^`/,ON^`/,ON^`/,OH><$n&n(j&. BK)/<,<)0e C L<|N^Nu*4L/N$R.//"FNւR `/,O/ /$npf *"*$fB$.$nN^Nu/N':X%@X`NVH?<&n $n(n. 0@"TreA L<&n *n. I r(@"+ 爰gA L<|N^NubJg谁eB/NT$HPJgBB*<'U,<)0 n¶e 'JB`Jg&Hx// "FN ", %(%(QRP`/ ENX`/,OH><&n &.(n$kcE J L<|N^NuJgJg*CB(<(tL +e:JfHx/N'q($Pg*H($CB*<'q,<)/<e.'BB`Hj/ DN"RPJ5fJm|R`/ "EN"D"( XJg(/ FNXRR`/NRXf/NX`<(n (.JfA L<|N^NuJgHx/N'q($HPJgBGBK)/<*<'q,48fG'oQVBBSdN/ NX`/NG."EN%8XgRXf// B-J/ BHx /.NJfh`/2,NX`NVH?<&n (.JfB C L<$. *.JgbJg^$B&BBI'6rK'7n&<'U,<'6/NXJg@BG'7nI'K gB/NPJg/*NXRf/N'oXB`(`B/+NPJfJg8BB +B-@//.HxHy+"CNJg//+ FNP Rf &B/N'7@//N'7/BB-B/BHx /.N&$g,BG'6//N RPf C L<|N^Nu/,O/ nBtfWD$N^Nu/,O n ("(N^Nu/,O n h N^Nu/,O n h N^Nu/,O n"n Jg" h N^Nu/,O n"n Jg" h N^Nu/,O n"n Jg" h N^Nu/,O n"n Jg" h N^Nu/,O n"n Jg" h N^NuNVnHxHxHn/.N N^NuNV-n -nHxHxHn/.NN^NuNV/ . gH/N'q-HXg8/N)/V$ f2/././N$ g0 nBHpH//+0N,/NU&X L >>8x>>l>>>>>T>`>>>>>>zf: ЀLPJV`$*/N4XVIDЀ`$*/N4Xft/ / `/,O/ BHzHy*E;N#?`BHzJHy+N#?\$nN^Nu/,O/ /9?`ENDr $& X/NX*g,B j * Jg:!@ j S\'j|p/N6 L< N^Nup&`)@d`NVH?<&n&. (n$S/ (< DN *(R%@(XK*<ML$*pg( *(S%@(*<6Jg / ENX Lt/ NX` t`/,OHxHxNT N^Nu/,ON^`/,O/. /<$n&n *,gI|܋/ /N'PJgz// Nz&ڋ// K'vNJf*,+4 g*J;,gHy3IHy,%/ N' / N'8X**,+ fg+4Hx/Hj N)0 Jf**,BJ;,gVHx&//I' N/Hy,5/ G'NJ;,g Hx/B*/N/Hy,D/ N// N'*,PfTrZ%AD@,-JL<|N^`t`>B`8+4Df+4gD`:// NPJf`0r`L<|N^Nu/,O n(@p!@D(,N^Nu/,O/ /$n 9;,J*,m0JgHy3IHy,S/ N' -J$.$nN^`JgHy3IHy,k/ N' Hy3I/ Nt*HxBHj N(5| 5||<*@,// N'*,$.$nN^NuNVH?<$n**$*8,<'.<'I'G'8K'*@ jPp4e *4Ѐ"@01hN JfLHGRGQHGOLNu?A <H<tvA 4!n8!n<(BL< ҀXQgDlD@@-Ar:DX"(0vt:D#X"XQR og". ofrB(f$Rz(0\fPR(0\BtfXRQ ".lD(@@"|'B:Dtd1H8 Jf#`fBz(0\fSP(0\vtfYRQ ".nD("|'B:Dtd1H8 Jf &.&(ԀCD1(BdC'@`dC'؀`C' jD@B:Dd1H8 Jfg `# gLNu0.gg @ @8fPNuB.NuBV ., faf`.fa<`a P?ngNua(f .Nual(g.Nu.NuaP(g.Nu.Nu0.@;g0.4 Af0C Af&J8f J @fJ.fjO4O( mRB.0.42.(@@g8P`0.`. ` @g `g gBNupNuafO(O4 mB.0.42.(@@gP$HBnA0.gfp` p`a^jg.`$ .gr .f&a4f`O4O( mH`$af:O(O4 m"0.42.(@@g .ft0.(@@?=@( .0.H4.H"(A.h".HABVa g`0.4@@?=@4 .0.H4.H"(A.h".HABVa vg` .flA4 .0".HA < 4V6a $6g4A 4!n8!n<Jn4nv`jA( .0".HA < (V*a *g(A (!n,!n0Jn(n 0.@ @fHB` .g .f&afO4O( m`$afO(O4 m0.42.(@@f .ft0.(@@?=@( .0.H(.H(4A.h".HABVa g`0.4@@?=@4 .0.H(.H(4A.h".HABVa g2`( .fpA4 .0".HA < n4Jn4n4V6a 6g4A 4!n8!n<`jA( .0".HA < (V*a \*g(A (!n,!n0Jn(n 0.@ @f8HB`( .g .f,afO4O( mJn4l0Nua\fO(O4 mhJn(mNuNu .gF .f a f8O4O(Ёn&`afO(O4Ёn$ (BnB.0.42.(@@gPA0.gfp` p`a[ngR`J0.gfp`p` Jg&VaXJgH orB.NuJgH g. g-nt-nx-n|Nu-nh-nl-npNu-n\-n`-ndNu-nP-nT-nXNu.g .g-n4(J.4mNuNuBn$. @fJPlJ`@ `f-n4(JPl&` fJPl orB.4NuJgH g. g-n4t-n8x-n<|Nu-n4h-n8l-nUUUUU6?ڢ!h5ڢ!h5?R zQ?TEeI?@`bk ?5?R]?CbvV?Řb?y~Ck ?g9F?TLa??b$S>?(ځb@Lw?O??񔝾y?Xa~>?F! Y?#*0B?pҚ?Go\?v0IT??hЊR0?-S?E>?_^>?](? -?شk^z?W*k#5?*pꜪ?2d? (ff?/҈3-2?ѱ!Md??#?l?I8'?rD6?zr'?,7?0: ?!?3!?Ƀ0 p?րz,[?#1%*?㲨Uk?-vOd1Y?[Ѣ? \?0f?E?ۏdP?s 6^S?核ͺ?(2ڮ ?Fݷ`"?>}֢?hoj?ĐYİ?D}px/?AD?Jf(? L?IqY?ԄWN?۔;?8Ui j?w)52Y?Wn 7 ?|7y?uA?d_?UI{h]?5I?vQrK?.1?s/ѕWd?8*5?0?F.R?-ב?џRA?:DҠ?o ?w?2?U2V$?ulq?|l?&Yc ??_aҒ?~?*Qsg?:QS V?: u9Tn?rE;&?LoՏ?JJ`k?*-͍&<?eo"e?eqIj?o5?{D7f?Xc3?%RV"F?̩_?z?6X8?ϫ(~{6?^f!5?Z ?AJ?+{?Gv7}?Go?+hy?0j9G͆?1j?1 p?\1? 1(?kzw?Fc?ދT?efϿd9?4_V4 ?"`H 0(.h ?l` @o`:BnB.H.H("` @ n*:T(n:T(p/Ba:H#b`ל<Ѐ`*?eCa?UUUUD1?UUUU@?C?UUUUOZ?UUUUUU>wF>h?*?Vlp??UUUUUU?H70??dt?͆+؟չ?:(ì@Hri?gH{\?a\?څ()?uIn{? ?[~[ Zc?9ESQ?1Cfn)?s8x?Z+/,? ` E}?-7 Z7?7QpR?E d0?9NU8?>٧,PIM?2` PH?QqOĠsi?pC Ihz?5 怠yq&?֩Q8q@?͓e5h Ob?Z|(8?X>BJȠ[??;xi Ct&?#Ҭ%p_?$ g?3d2?(w 0?Gb ?Z>E*?X 6+p?zs ?,LfpXAA?F$d{?g*U h?Ǎtȫ\:.?ɹn/'??r|\}?$nS?c3+%\?Ҩ*\v?Z !?D֝j/?ٝx״ C?7T ?`^$u?* ,K??rZP ?|Hrz?9jP t?: /n\ P?nx.g6J(f .gaJ`a".aag'<HNu?}?A???ry??I U?ə}0o~?UUUUU?T?I?`=f?=H?H+e?ˍ?.4R8?)uC?뽲a?90I?e{v?.?%* ?z:?xǀ?dUQ?\L7W?V{=H?aќYX?{?d?7/ ?++,?8ΐk?h 6h ?)H?жX ??w% ?3lfP?ˇ'eÓ? Z}܊?NF?n^ɲ?Ƙ iƘ ?,?7/]L?,_rV?ՕG?D L?/ ?JО5?iGf?>ꦲ?>!M ?!45??!C6.??Z6Y?*b? 抛?d<{?cR ?uQ]a?Ӹ <?*=?:ƀ:?XJ?`+X ?Lj9;?iY?V]?JGV8?B-Q`? ?׉I;X?U9-{s?Ĵ?7Q?>mjk?^?|? x\/[?k1.7}?9,Qy? ?$@a0?L#_: ?Β4f?`? ӁEc ?Lo:<?pB­?"ڽ?^I60?h ?zz?.\ ?"L.d_?%h ZW?{}?EEF?U??%? ?f挕[l?Z8c>;?tǾY?yâ?VC?R7iH ?# B?e#?XȐ뉐?p4JZ?:=/?BpViF?"O|?:遛P?&z??s;?Dz4?TF?7a,<?3~gq͋?J?H` CZ^?0R?3h?Y#<̤I? ?emkI?w?m`$h??q`?[ة7(q?;)\ m/Ba:H#` m~/Ba:H#`l mb/BaL:H#`P mF (f( (Jf0?@`/Ba:H#X``NqGJg" o o> /o ?ox:DNuJg gA'`A'`A'` Jg g$A'$ o`A' or`vA'` o``d0Jg g4A'\ o> o>`2A'ל o$ o$`A' o o L< -AJf0ЀNuHAҮ-p-p-pBAVaՈgЀNuB`-|H?6=C((*(Jf<&<?Jf(B B``"B`.D 쯈`?0(=@2.ı=A"($(Jf< <?Jf"B B``"B`.D 쯂`?-C-@BB"|Jl .`hJnff`DeBRJgփԂӁURS` .Jf"B B``B`k.D 쯂 Al4=@Bn-A-B,.=FBn-D-E.H-|`:-A-B?=@Bn,.?-F.H=F-D-EB,.g",.Smnff`ze.H(R<.lB<.~HCL. .g :H#`NuR l`B41*Y?Y=*㽩9oE>!r~O># ` a8?^?nND*@ڢ?`Y򺥨O4oY_?sJ?<ք_B;~ K?nND*@ڢ?ڢ!h5![]|#~R66^"F!HM; `x0c!\᣻%!bΪ׹X!e$K :Ovgzes!SJ Ӡf!81e{0ՠLCNXڢ!h5!~R6hM;\᣻% !`:OvSJ1e{ڢ!h5 M;  SJڢ!h5  `ڢ!h5ڢ!h5?ڢ!h5@ڢ!h5@`@ڢ!h5@SJŸ@@M; @ڢ!h5@1e{ @SJŸ@:Ov!@`@\᣻%ˠ@M; @~R6!h@ڢ!h5@ՠLCNX@1e{!0@Ӡf8@SJ @gzes@:Ov!@e$K@@bΪ׹!X@\᣻%ˡ@`x0cݡ@M;! @6^"FH@~R6!@[]|# @ڢ!h5`VH 0( ?׀l`" @~m`&:T$C(1``H(D(Jml:U:U#:U:I"#:I:I" #:I# "٧,Q?2`?QqO?n?pC Ih ?5 怞??֩Q8??͓e5jt?Z|?7??X>BJ??;xi Cug?#Ҭ%_?$?E??X 6?zsQ?,LfpV??F$d??g*U??Ǎtȫ]?ɹn/' u''2'd('''''''''''(''\'d('''(6L'''d(6H'''('''d(''''''''''''''ޒ'd''''(''ޒ'd('''((''ޒ'd(''''(3t''ޒ'd(3p'''( $'Ҿ'&'d( '''(<'Ҿ'&'d(<'''(='Ҿ'&'d(=''''''''''''h'$'2'd'ϔ''''Ϡ'$'2'd''''''$'2'd''''''''''''''''''''('Ҿ'Ҟ'd('''''''''''''''''''''҂'ޒ'd''''(('Ҿ'ޒ'd(''''(p''ޒ'd('''(''ޒ'd(''''''''''''P'P'P'P'P'''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''(+^'&'H'\(+N'''(+^'&'H'\(+N'''(+^'&'H'\(+N'''(+^'&'H'\(+N'''(+^'&'H'\(+N'''(+^'&'H'\(+N'''(+^'&'H'\(+N'''(+^'&'H'\(+N'''@~C(GX(Gf(Gn(G(H(H(H(H0(G(G(G(G(Hj(Hj(Hj(HjA44V6.$gJ0.@` @g `gz0. 3g\ 0gP`V0.D @g: Dg20. 'g $g`B`p`p` `aC"q NC`C`J(gC `C`J(gC`Cb`CT`Cv`J(gC8 `CX`zJ(gCJ`fC `XC`>C`8J(gC `0C`*J(g C`C` J(g0!i!iNuNu nBCpa~ Nua @faNu.$gJ .B g~ gv0. 3gd 0gX`V .D @g6 Dg. . 'g $g`pNupNuBNu .Nu.$gBNu .Nu.$gBNu . fpNu fpNuBNu?<?<(J8(JF(JT(Jv(J(J(K(K&(J(J(J(J(J(J(J(JC"q NCJ`C<`J(gCX`C`J(gC `C&`C`C`J(gC`C`|J(gC `fC`^C`DC`8J(g C`2Cx`&J(gCf `C` J(g0!i!iNu(K(K(K(K(K(K(K(K(K(L(L (L(L(L(L"(L((L.(L6(L>(LD(LJ(LP(LV(L\A pNnCNunGNu.Nu.Nu.Nu.Nu.Nu.Nu=nBNu=nFNu4.Nu6.Nu8.Nu:.Nu<.Nu>.Nu-n@Nu-nDNu$.Nu&.Nu(.Nu*.Nu,.Nu..NuNqNV@'H@.P.-nL@.P._N^`y Nq o ,g XYNV@'H@ n CpXayY . f fx @f(@|(Bo` Afy0A|0Bo=n-n .rӮ=| , B =@B$%L@` L@_N^X`xNqNV@'H@.P..%g .Jg: g gL@.P._N^`wr. `g 0faJf <aN`0.(@ @?f .0a4`0.(@ @@d .0 gJ0j ,g`J,g`r. `g 0fa"Jf <a`V0.(@ @?fp .0H@a`:r. `g> 0faJf <av` 0.(@ @?f$ .0H@aX` .8aD` <Jn(m <a` <a`v-@/a"f, g f`"`,A"n avNu ,f n(g n(gpNuBNu.gL@.P._N^`u..g2| -n$L@.P._N^`tL@.P.N^`vNqNV@'H@.P.a.gB.$ga`-n$L@.P._N^`tH.gH.$ga-n$| L@.P._N^`s$g:a-n$L@.P._N^`uL@.P.N^`t.$gA`A4Va @fnan`a` NV@'H@.P..f8a..g| L@.P._N^`r.gdaW @fp `p BBQ|`-n$L@.P._N^`s$W @fp `p BBQ|`-n$L@.P._N^`s n Jg g( g>Nu".8pJgL/"H Oast"Nu".8pJg./"H OasV"Nu".8pJg/"H Oas8"Nu-A/a8"  g f`b`V`P .  f.,f0.(`0.4g `v`lNq@ .$gX .C1J(g f.PNu @f.@\Nu f. hNu f.tNuNua, g .`a*"H n Jg gjB0@? @@g@H@J)g` <BJ)g"`$")T"")p#A")pIaqNuB0@? @@g@H@J)g` <J)g` ")W-@pJgIAaq\Nuad@"`J)gB)p Iaq*NuNV@'H@.P.a.gB.$gav-n$L@.P._N^`o..gH.$ga&-n$| L@.P._N^`n$g:a-n$L@.P._N^`p"L@.P.N^`pa.Bg?.$g A2.A A0g A3f B>`A(Vafҟa a faJgJ(kSPa`$aJf Jfg.gNuNqNV@'H@.P. @fo .-@<<B.aB.aw.'J.far`{NqNV@'H@.P.W @fn<<"..f `@-APa a0B`{8 /@f.g0.@fBg$g gLgBfLrB.4<.4g ``-n-n-n B."_' W@`g n*g" mg. h`.@\`.P`.tpBBQ/<@`-n-n-n |/rB.4<.4g `P`FN'&0.@ @Df0g f-n-n-n B.-n4-n8-n<"_' W@`g n*g" mg. h`.@\`.P`.tpBBQ/<@`-n-n-n |-n4-n8-n8&n$. p'dHxHy3^/ N)1 JfHxHx/./. /.N(qN^NuNq/,OH0 ".BJg> n0B CCve $n B2"CEve g L N^NuJgRfB`Nq/,O/ /B n0B BCte $n B2"BEte g $$_N^NuRJfB`Nq/,O nB fN^NuJ0gR`Nq/,OH80 n"n $n&.$.Jgg2&J$KJg* g*R c"Jg"S2 gR c Bp Ā`RS`&`2Jg` nZxd@Y\0@0@20@XR fBJg4BJVIL N^Nu \fxdU\|\T`Jg`B(p`NqNVH?0,.&n .&.$.*. (.$n$JfGJfEBJg"U~"d/Hy3^Hy,NK.// /N(v<"@ JffF|W$,.l "` R$&oJfv"$ "L N^NuJf SJg|V$`,.l~"$`NqNVH?<(.$nfH J  gB"Cpd -fFE(:|JfJ 0fT XgNx`t Ur"d/Hy3^Hy,NK. +fE(K`rf< 0f6 Xf** c ct0Jg-D[I-CA(G(Jg/./.B/<N*/./.B/<N,.DABBG(4  b8|¹l$&Jgm$&fm/././/N& [I’0|`Tx`4x `././.Hx/<N*/./.Hx/<N,.`F b8|`R bB8|`8n`$&fmR/././/N& [I҃т`JJ gJgS-J n Lg`2 [f) ^fG"KBRfpp`Z$JfRp`PJfB`FJ)f "HRJf$`&BK(}/ / / N rg"rgJf$JfJg$pL<Jf* -f*) [g ) ]gbTIDG"K`RWID` ^WIDgRR$"K`Nq/,OH< &.$. ". C"CgD"B$Hpe xL`< XH@XL<[L<[(zꬹL<[镱 f zLԀzgpgSf CBL<[ t 䨳L<["x詳L*ےѪת٪ ݪӪժߪLHx/ / N Jg"B$"Fvƒ$2,RrfL< N^NuHxHy3c@/ `/,O"n nBqqqXXeN^NuNVH?< n-P*(,(.( "n EG@B)B)t婀B)v穀$Xf(n(.CI0jx ЉЅ$nCy0ǷV"€҉t Ҁ$nCi0$ p$āԉvԁ$nCY0&Ƃ։x ւ$nC 0| ЉЃ&nC0G*"€҉x Ҁ$nC)00F$āԉxԁ$nC90F&Ƃ։x ւ$nC 0i ЉЃ&nC0D"€҉x Ҁ$nC)0[$āԉxԁ$nC90\׾&Ƃ։x ւ$nC 0k" ЉЃ&nC0q"€҉x Ҁ&nC)0yC$āԉxԁ"nK90I!&Ƃ֍x ւ*nK 0%b ЍЃ*nK0@@"‚ҍx Ҁ*nK)0&^ZQ$ăԍxԁK90Ǫ&ƀ֍x ւ*nK 0/] ЍЃ*nK0DS"‚ҍx ҀK)0ء$ăԍxԁ*nK90&ƀ֍x ւ*nK 0! ЍЃK07"‚ҍx Ҁ*nK)0 $ăԍxԁ*nK90EZ(Ȁ؍v ؂*nK 0 ЍЄ*nK0"‚ҍv Ҁ*nK)0go&Ƅ֍tց$-BKI0*L(Ȁ( t ؃*nK 09B$.ԍԄ*nK0q"ҍp ҂*nK90ma"&֍HCցKI08 Ѝx Ѓ*nK)0D$ԍԀ*nK0Kϩ(؍r ؂*nK90K`"ҍHA҄*nK 0p&֍p ց*nK)0(~$ԍԃKI0' Ѝx Ђ*nK00(؍HD؀*nK90&֍r ք*nK)09"ҍ҃K 0ۙ$ԍp ԁKI0|(؍HD؂*nK90ĬVe Ѝv ЄI0)"D"FҌҀ*nI)0C*$FԌv ԁGI0#&F֋xւ(nG 09 FЋx ЃE0e[Y"FҊҀ&nE)0 ̒$FԊx ԁ&nE90}&F֊xւ&nE 0] FЊx Ѓ&nE0o~O"FҊҀC)0,$Fԉx ԁ$nC90C&F։xւ$nC 0N(F؉p ؃$nC0S~ FЉЄ&nC)0:5"F҉t Ҁ$nC90*һ$Fԉvԁ$nCI0ӑ&F։Ю p ڂօ!C܂!Fށ!G LV$ f R//./N$ f$%C/NU&X LN^Nut `/,O .. g -@ N^`ZpN^Nu/,O//. /.N) $/N)3* dictf n p$.N^NuB`/,O//. /.N) $/N)3* boolf/N) nXp$.N^NuB`/,O/$./. /.N) P-B -H$.N^`3/,O/$./. /.N) P-B -H$.N^`3/,O/$./. /.N) P-B -H$.N^`3/,O/$./. /.N) P-B -H$.N^`4/,O/$./. /.N) P-B -H$.N^`4H/,O/$./. /.N) P-B -H$.N^`4T/,O/$./. /.N) P-B -H$.N^`42/,O/$./. /.N) P-B -H$.N^`4/,O/$./. /.N) P-B -H$.N^`3/,O/$./. /.N) P-B -H$.N^`3/,O/$./. /.N) P-B -H$.N^`3/,O/$./. /.N) P-B -H$.N^`3/,O/$./. /.N) P-B -H$.N^`3/,O/$./. /.N) P-B -H$.N^`3/,O/$./. /.N) P-B -H$.N^`3/,O/$./. /.N) P-B -H$.N^`3/,O/$./. /.N) P-B -H$.N^`3/,O/$./. /.N) P-B -H$.N^`3/,O/$./. /.N) P-B -H$.N^`3/,O/$./. /.N) P-B -H$.N^`3r/,O//. /.N) $/N)3* stngg B$.N^Nu/N("XJg"n"p`/,O/ /$n/. /.N) $/N)3* datagB$.$nN^Nu/N)XJg"n"Jfp`/N)$X`/,OH8/. /.N) &/N)3* stngg BLN^Nu/N((RB/NT$ g///N(X Jg n `/NU&X`/,ON^`/,O//&.g,//. /.N) t/N)2$.&.N^NuB`/,O//$.&. B./N),X-H-C -B$.&.N^`NV//$.&. ". .-@-A//N(P-H-C -B$.&.N^`BNV.I[I-@-A///. /.NN^Nu/,ON^`NV2.H[I-@-A///. /.N^N^Nu/,ON^`NV".[I-@-A///. /.N*N^Nu/,ON^`/,ON^`/,ON^`NV-n-nN^`NV-n-nN^`NV//$.&. ". .-@-A//N(6P-H-C -B$.&.N^`NVB.B-@-A///. /.NN^Nu/,ON^`NVB2.B-@-A///. /.NbN^Nu/,ON^`NV .B-@/B/. /.N2N^Nu/,ON^`/,ON^`/,ON^`NV-n-nN^`NV-n-nN^`/,O//$.&. /.N(X-H-C -B$.&.N^`/,ON^`/,O//$.&. /.N(X-H-C -B$.&.N^`/,ON^`/,O//$.&. /./.N)TP-H-C -B$.&.N^`v/,O//$.&. /./.N)P-H-C -B$.&.N^`:Nq/,O .A*Ѱr!e p 3c N^NuNq/,OH<0 n$n "n&n(Z)Z[ c f^ fn$(&( )")(*mP(*nV$(&( )")(*e,(*b2"i``^ID`P g g fB`: g gp`*J^IDЀJ^IDrgxgzfL / N/ N/*/*Hj/ NV%n $nN^Nu/,O/ $nAJ0g%j$,Hx,/ NP$nN^NuHx/ NPB`%|%ju`%|%#jx` b + cSI"B&*Ɓ g8/ NX *"R%A @( b/ / ENP`zI// NP` *"R%A @ ( cV`**:|BBB(jgD Fgn :g =g *gHx#/ NPtGJg>/ NB/ N * $d*rd R# *rd RB0 *g RB0Jf *$SLfV#ApN^Nu/,O// n . C \fl 0ufd0|BBJ1 b HAɄARrf n0\$&N^Nu b AA`  b AA`B`/,O/".$< AR b g $N^NuNVH>8$n$/N):XG(8&,*(B BBB$BBB*(/*NX%H fgfn6 "g [g b"<fA($` tg {fR%HA)bJgB/ //N Jg`-nI);"B////NJf$.g/*NX%HJg/N)2BX n`jR%HA)&B`C%I ("f T%H|(A(ݚ`f (rg:*(G);"B////NJfnA L|N^Nu (uf (ef Xr%H%A|(%@A)` (af (lf (sf| (efr Zr`B/./ // nN`f/././ // nNJg-n`/,O . f$//./.N)1 JWIDN^NuB`NVH>8$n$/N):XI((*,G3e&f<*(GI);"B/// /NJf, C L|N^Nu/+//*/*NJfD `B/./ / / nN`/././ // nNJgh-n`.B/ // kN JgF-n&G);"B////NJf&.`N/,OH<8$n(. $.Jg0/N)/f6R K >fPBBB B$%Hp`pĀf R`dfh`| >gtJfV`B*(`J+g/NXJg%H&H$<"K cR =fD %@ )"fJ)gT%I &I K "f, %@$ (>fhT`HJf`Zf`Jf`FNVH?< n*n (n&n$hpfBg> "g@ \f*@ ngvn. bgBn /g@ \g: "g4B` ff| ` tgH ugJ rf| `|rpBJgZdHRRf`f| `| `BnBnHnB/ *<( EN Jgt6.2A( AcB2g\ dXCr` AbDHn// EN Jg.2.:E$ Eb(t  CA $"U ? bCEr`d bFCEr`$~sG0ACEr`Rr`RRf`Jg(JfpL` *tf *;fXp<` pf *of *sf *;f\p'` qf| *ufr *ofh *tf^ *;fT\p"`JR`DJg(`&`/,OH0<(n /.K(8NX&Hg gJf/ NU&XG K L< N^Nu%KBHy,s/ K(N JfG`.J*(f *gHxHy,O/*/N(JgJg(TB/ / N Jg/ N&HXJgHxHy,s/ N Jf/ N)2X`/,OB/.N(> N^Nu / g8 o"og.f,Sg$g"f SggfSg g fSfNuUINuNq/,O". WIDN^Nu/,O"n i ( f )g h pR#@ N^NuA`/,OH0 &.gLHx /NT$PfE J L N^NuHxHy?N$HPJf&/NU&X`HxHy?N$HPJgBHy3f/ N)1HjND%B %CBBB `/,OHy?`N6XN^Nu/,O y;6gHz"Hy;0NPHy?`NXN^Nu/,OBHxHy?`N{4Hy3eHy?dN)(BN^Nu/,O . -n rҀ-AN^`/j/,O . rҮ-A rҀ-AN^`/H/,OH<8&n$n&+BBI)/`JfJfHB`($ԅ(ث p DА//. NPJfJg$ D L8$nJg6 3ff( PB/NZ/*N8&H JfZ/NX$K J L|N^Nu& j ,*(/N/N k !8 k !8RP *b'@'j`BI)2`E`/,O nJg 3ff/N)ZXJf A N^Nup`/,O/ /$n$ PHx/NZ *Pfr%A-B$.$nN^`/,O/ /$nJg4 3ff,$ PB/NZ$j/N $.$nN^NuE`/,OH0 $n$. JgF 3ff>& PHx/NZPc"// N@P/NXL N^Nut`B`/,O//$.&PB/NZ/N$/N B $.&.N^Nu/,OH<0$nJgN 3ffF/*N)!*$* PB/NZ BG)$e*v/NXJf /N)2XB B L /N)2Hy?`NP jfHh/ NPJf/N)2X`Hy?`N/N)/<8|Pp,etHxHy?pN&HPJgHy3e/N)1/HkN)/L'LHy?` GN/Hy?d"CN$gD/N)2Hy?`N/ N `Dp N^Nu/,O/ HxHy?xN$HPJgHy3f/N)1BB %nP J $nN^Nu/,O n"n g2 ( f$Jg$//)/(N)1 JWIDN^NuB`p`/,OH<<$n(n pgJ f-|3f L<< .(n (.$nBBG)/&<*@Bg cr 3ff6pUg/ N)2X J $nN^Nu/* /*N)T$HPJfE`p`/,O nJg 3ff ( N^NuB`/,O nJg 3ff h N^NuA`/,O n". Jg8 3ff0Jg, ( b" hJgJg///N)0 pN^NuB`/,O/ /$nJg 3fgB B $.$nN^Nu * gB/NT$Pg/* /*/N)0 `/,ON^`2/,O"n n Jg 3ffJg 3ffN^`BN^Nu/,O n . ".Jg. 3ff& f Jg///(N)1 JWDN^NuB`NVH8 $npgJ*(f *gHxHy+/*/N(JgJ$gBHn/* N)--@ * Ъ$ fZ&.(RB/NT$PgBHjHn///*NJf2/NU&X`BHnBB/*NJfpLN^NufHxHy+(/ N( JgEJf/NU&BNPJf"A"n "`BNXJf/NU&X`B!B!C `/,OBN^Nu/,O n"n Jg 3g fJg 3g f WIDN^NuB`/,O//. y;>gHz8Hy;8NP$<?hJg$<?t/N)2 B $.&.N^Nu/,O/ Hy3g Hy?tE)1N?|Hy3g Hy?hNB9?pB$nN^Nu/,O". n <3g,J(g <3g<-@ -AN^`/,OB. -AN^`0/,O/ $nJg 3g f/ N)2X J $nN^NuE`/,O nJg 3g f(N^NuB`/,ON^`/,O"n n Jg 3g fJg 3g fN^`BN^Nu/,O nJf4J((g.HxHy3gR/(/(N(/Nh"n "pN^Nu/,O nSN^Nu/,O"n i ( f )g h p R#@ N^NuA`/,OH0 &.gLHx /NT$PfE J L N^NuHxHy?N$HPJf&/NU&X`HxHy?N$HPJgBHy3gX/ N)1$3gXHjND%B %CBBB `|/,O/$. .P/NXP-B$.N^`L/,OH8<&n$n *ng$f"( P& PIZcRB/NB/N +fDgX R* n "k n ("j n (t L<N^NuB/NB/`BHkGNHjNP`t`t`/,OH0 $n&*PB/NZ/ N$/N B L N^Nu/,O/ / &nJg 3gXfHxHxNT$HPJfE J $n&nN^Nu )!|) / N)2%KB%k X`/,OH><$n*n p(<*-jgB& PB/NZPJf$/NX-|3gx -JL<|N^`ZBHy3gx/ N)7" JfB/NXL<|N^NuB/ *<)6 ENPJg/ N&HXJgR ,<)($<)6/ "FN(HXJf./ N)4S / BNPJgHy3gx/ N)7P`~/ "BNXJf/ N)4X`b T/ / h NPJg +d // ENPJf~`B`/,OH 0 .&n $S$* j f6Jg /NU&XHjNR/ Hy?N P L N^Nu$0,Jf&t`BBB/ /N):JgS&t`/,OH8 $n(. &* Hx /NT$Pg@Jf%H %DpLN^Nu *///N)0%B %D/NU&`B`/,OH 0&n $n$pfH/*N(8%HX ]g BBHz//.N):Jg,B`R%HpL N^NuHxB/ N( Jf/N)2BX`HxHy)#/*/*N(Jgp,f`/,O/ /$n$. *gB$.$nN^Nu jg&/N)2 j *"R%A! RXp`Hh/ NPJf`/,O/ /$n$*PB/NZ jB%h P-B$.$nN^`n/,OBN@ N^Nu/,ON^`0/,OH<8$nJg4 3gXft& PB/NZ/*N&H JfJ/NX$K J L& PHx/NZPc"// NP/NXL N^Nut`B`/,O//$.&PB/NZ/N.$/N B $.&.N^Nu/,O/ /$n$ PHx/NZ *Pfr%A-B$.$nN^`2/,OH0 $n& PB/NZ$*F/NL N^Nu/,OH0 $n&. Jg0 3gXf<$ PB/NZPd j $p</NX J L N^NuE`E`/,OH< $n$. &.Jgz 3gXfr( PHx/NZP*fTf"// N@P/NXL N^NuNq/,OH80 n". & C (tĀ(EH"R&B' $<#<p#@p$ !@$)v#B((tgv!C"RJf0L N^NuxȀ!D"hJgp"#A Rv`p$#BJf Pxɨ`/,OH00&n$n &. r<Jg ( f$ B r,Jg* f>"PJg) f,"hJg) f (Jgdg^// N r,PJgj *g`Jg( fT"PJg) fF"hJg) f6r€%ApL N^Nur!Ag *7r€$A`2"p,Jg) f//N< r,P p,rè-B -JL N^`/,O n!n BBB N^Nu/,OH 8 n&h(k$PJfB B LN^Nu$ /. //+ N JgЀD$r `/,OH08 n&h(k$PBJfJg>$ B L N^Nu$ /. //+ N Jgo& ЀD$r `B`/,OH08 n&h(k$PBJfJg>$ B L N^Nu$ /. //+ N Jgl& ЀD$r `B`/,OH8<(n$. *l&$m&T LBJfJrª&Jgbv%Af\vƁ%C!J!J "0 $%A! ( D L<N^Nu( ///- CN JgЀD K&s `vƒ`"Tf)r"0 Jg( g$%A! vƪ&C"Jp$@&*VID r JgB"(g8vƁ!CpgR *r%Avƀ&Cg:+ f`.K f// NPWID// N TrèP`/,OH00$n"n .&jJf RJg r  L N^Nu& C$+ q Jf $Rg")pf @`"@`  p<Jf`/,OH8<&n". k$($A R *Jg"jJf\Jf\fNVID7t"S(@)<! BTf 'f'@ tŪJgh/// N^ `XB`JfntĀJWID"r(&)"p€#A(B)#@fJVIr'pL<N^Nu T f' ` @/// N)+& ($ Bvƀ"CJgFxf(pJf"H`*p`(p,Jg ,gf~vƀ)C"HB(r,!,p&)C$( *v!@tĪ!@tĀ(B) $*T fvƂ' pJg// `xJg*)@B*C+(r,!,p$)B$`\x`Ҷf` Nq/,OH?0&.$n $."CfH I  gB&@pd -fFC(6|JfJ 0f XgNt`p Ur"d/Hy3gHy,NK. +fC(G`pf8 0f2 Xf&) cR cBr0JgxLB@BB  b00|lPedfm^LЈ|`Tt`t ` b 0|` b 0|`JgSfDJfL N^NupJg$`JgJg& S`Nq o FJfЈNu o /"@f @NuNq o"og$fgfgfg gUINupDNu o/ g Jfp @Nu NuNq"o o"/ ml mX gSg2U g"S""""""""QB@Sd gS"QgSQ / @Nu mX g Sg3 U g"S# # # # # # # # QB@Sd gS# QgS Q / @Nu"o o"/ ml mX gSg2U g"S""""""""QB@Sd gS"QgSQ / @Nu mX g Sg3 U g"S# # # # # # # # QB@Sd gS# QgS Q / @Nu o"o / gJ"gf4Sg:" f"gfSfgfSfNuYYp`BB !NuNq/,O n p!@N^Nu/,ON^Nu/,OXN^`FNVH?<$/N):XK):x&P*<);"(<):P$n R hJgN&J [(h/ NXJg&JgNBBB// ENJfLg &fHy,` nL oXQ bTҁ25ND tfHx\/ NPJgZ// NP`D /g \g "g b/Hy,Hx$_/NE// N)5,Jf(BL<N^Nutr`tt`tb`tn`|Hy,/ NPJf`Hy,`// N`/,OH 0$nBG)4̴ e pL N^NuHx / NPJgR`/,O/$. . fp -@ -B$.N^`//N)5,PJf$.N^Nu/,OH 8$n(n $.pf* ,g// N)5,P`pLN^NuHx/ N`Hx / NPJg// NPJf`/,OH8$n(n pf* ,g// N)5,P`pLN^NuHx/ N`/,OH 8$n&n pfV +fBLN^Nu// I)5,NPg + f +g-@ -JLN^`// NPJf`Hx/ NBP`/,OH 8&n$. JfG K LN^Nu SJ gpeBHxITN$HPJgBHxN$PIU&f/ NX`B%|B %Bg< S/ / h NPJg>Hx / G)4NPJg*JgjB/ NPJg&R`Hy3g/ N)5,PJf/NXG/ NX`:Hy,Hy3h4/ N)7" JgHx / N)4PJfn`Hy3h4/ N)7PJgHx / NPJft`/,OB/.N)8 N^Nu/,ON^` oRNu o "Rf @NuNq oSNu o "Sf @NuNq/,O nBBN^Nu/,OH< $n*. (.&.$."*pf6BHxNTPJgB!E!D!C !B %HpLu::NAN8NNNj NCNNNNZNNN(N.fN8FN~N(kNQNNKNNN:NRN"N#N NatNuvHxEnNN nN N uxNhNfNNN:NSHxNJN,vNNN;\Nv4NNHxBN \NXNHy;NSN|6NO|NpHy>uNXN~N NnNFNdDN)Hx/9:DN Hxu 9>v~#>vB@FNHNs&g /NUXNU8;cbBN'N*RNdNN}P$<{ BNN`N B@X D#bF$N#N$HxN HN#N#զB@FN.N`NN#BBHyBBHxBHy:N $Jg Hy+NK.Hy:INHxN #?_Hy:G6NBNNdN9:NN/`ND`(<x*<!nEh/9?"DN ENXJfN@N*"BN/9?L/9?HN/ NHy:N$y:(<>*<(,<?JfHy:Np@й:,/NPJgN#>u#>uN$93Hy+BBHyu&BHxr/E(NJgHy+)`/Hy+ NDrp?_ 9;X"9;\P|~gp//9?NP`B`/*N j( "-!@(!A, j( -L|!@0$*|XJf/*N$RX`/ DNHxB"BHi0"EN/ FN"B$)`Hy+9BBHy!BHx 刔 BHhNJg Hy+A`N+Hy:Np#?_Hy;NPHy:NNǸ..4.N.V.j...//B/h////2$2//0$0V0$0V0000002R21 161b11b111..4.N.V.j...//B/h////////0$0V0$0V0000001 161 161b11b1112333"363L3x334444n44n4444445"45"5L5r555556646X66699779>9707T7x77x777998"868L8p8L8p888889 9d55556646X66677779>9707T7x777998"868L8p8L8p888889 555556646X6667777707T707T7x77x7778"868"868L8p8L8p888889 ::0:J:R:h:::;;B;j;;;;<<.=>.>`>>>???&?@?n??@@D@@@@@@@@AARAARAAempb0empb: can't find bridge device can't obtain bridge softc no PCI memory window found empb: linear space mapping might not work %s at %s: pa %8p man/pro %d/%dallocating too much Zorro I/O address space: mem 0x%08lx-0x%08lx: i/o size 0x%08xatzeeatzscbahqlatfscgrfulgrfrsgrfrtgrfrhgvpbusgivgiozsscppiapptapphamrscmgnscotgscvhzscwstscitrmpivascTandemmfcgrfclwescflmemflsccbscbzivscbztzsccbiiscgrfcvgrfcv3dcbiiiscp5pbbppcscmlhscqnempscgrfetnxscmcscapsscaumldblsthyper4hyper3Zhyper4+hyper3+mppbmntvazz9kfirm_eventCalibrating delay loop... %u/1024 us QuickLogicCIA ACIA B: %s system hz %d hardware hz %d couldn't map registers a2kbbca34kbbc: QuickLogic type MF-II : CIA A type Amiga keyboard event queue overflow : input fifo %d output fifo %d ser0: silo overflow ser0: %d ring buffer overflows. parparsendchpar-cdelaymouse-disablefdcfdc: unable to allocate DMA buffer fdminphys: couldn't get softcfd%d at %s unit %d:fdclose: dmabuf pa 0x%x: dmabuf ka %p fdstart: disk changed fddonewrite of track cache timed out. unit %d: %s %d cyl, %d head, %d sec [%d sec], 512 bytes/sec fdopen3.5dd5.25dd3.5hd: width %d height %d monochrome colors %d grfite at %sno ite_softc for consoleno chipmem for ite_bell: rows %d cols %d repeat at (%d/100)s next at (%d/100)s has keyboardpqrstuvwxymlnMPQRSBCD[?61;0c[?63;0c61"63;1"62;1"[>24;0;0;0c[?1;1c[?63;1c[%d;%dRP\grfccgrf%d at %sno chipmem for itecc datakernel font size not supportedno memory for console device.%d view%s configured ntsc: hirescouldn't get chipmem for copper listntsc: hires interlacentsc: hires double interlacentsc: A2024 15 kHzcouldn't get chipmem for hedley init bitplanentsc: AGA dblsuper72: superhires interlacepal: hirespal: hires interlacepal: hires double interlacepal: A2024 15 kHzpal: AGA dblno chipmem for grf.CCMONITOR80x64 (640x512) 31.5kHz96x75 (768x600) 38kHz96x75 (768x600) 64kHz128x96 (1024x768) 64kHzGFX (640x480) 31.5kHzGFX (1024x768) 64kHzGFX (1280x1024) 64kHz ***EXCEEDS CHIP LIMIT!!!***GFX-8 (640x480) 31.5kHzGFX-8 (640x480) 38kHzGFX-8 (800x600) 38.5kHzGFX-8 (1024x768) 44kHzGFX-8 (1024x768) 50kHzGFX-8 (1024x768) 64kHzGFX-8 (1120x896) 64kHzGFX-8 (1152x910) 76kHzGFX-8 (1182x848) 73kHzGFX-8 (1280x1024) 64.5kHzGFX-8 (1280x1024) 75.5kHz ***EXCEEDS CHIP LIMIT!!!***GFX-16 (640x480) 31.8kHzGFX-16 (800x600) 38.5kHzGFX-16 (1024x768) 42.8kHzGFX-16 (864x648) 50kHzGFX-16 (1024x768) 48.5kHz ***EXCEEDS CHIP LIMIT!!!***GFX-24 (320x200 d) 35kHzGFX-24 (640x400) 31.4kHzGFX-24 (724x482) 37kHzGFX-24 (800x600) 38kHzGFX-24 (800x600) 44kHz ***EXCEEDS CHIP LIMIT!!!***GFX-24 (1024x768) 32kHz-iite at %s: grfcl: Illegal depth in mode %d grfcl: Pixelclock too high in mode %d grfcl: sync-on-green is not supported CIRRUSgrfcl: Monitor definition not ok Warning: CompFQ minimum error = %ld grfcl: %dMB Picasso IVPicasso II (with CL-GD5426) (with CL-GD5428) (with CL-GD5429)SpectrumPiccolo SD64Piccologrfcl unattached!! grf4: got interrupt, ctrl=0x%4x downloading TMS codegrfcv: Illegal clock frequency: %ldMHz grfcv: Using default frequency: 25MHz grfcv: See the manpage of grfconfig for more informations. grfcv: Illegal depth in mode %d grfcv: Pixelclock too high in mode %d grfcv: Too many columns for console grfcv: Too many rows for console grfcv: sync-on-green is not supported grfcv: Monitor definition not ok grfcv: CyberVision64 with %dMB being used grfcv: Changing the used mode not allowed! grfet: Illegal depth in mode %d grfet: Pixelclock too high in mode %d grfet: sync-on-green is not supported TSENGgrfet: Monitor definition not ok grfet: %dMB oMniBusDominoMerlin with Tseng ET4000Tseng ETW32 and Sierra SC11483 DACSierra SC15025 DACMUSIC DACBrookTree Bt482 DACAT&T ATT20c491 DACgrfet unattached!! grfcv3d: Illegal clock frequency: %ldMHz grfcv3d: Using default frequency: 25MHz grfcv3d: See the manpage of grfconfig for more informations. grfcv3d: Illegal depth in mode %d grfcv3d: Pixelclock too high in mode %d grfcv3d: Too many columns for console grfcv3d: Too many rows for console grfcv3d: sync-on-green is not supported grfcv3d: Monitor definition not ok %s: CyberVision64/3D with %dMB being used grfcv3d: Changing the used mode not allowed! le_zbus_attach: bad manidle_zbuscan't map nic i/o space can't map asic i/o space ne_zbus: Individual Computers X-Surf gencp_xsurffake X-Surf on E3B Denebne_xsurfwdc_xsurf: Individual Computers X-Surf 100 ne_xshcan't map i/o space can't map buffer space : failed to clear NIC buffer at offset %x - check configuration ed_zbusbah_attach_subr failed(%d) bah_zbus: address %s %s: esstart - PNR changed %x->%x %s: Corrupted packet length-sts %04x bytcnt %04x len %04x bank %04x %s: Overrun ist %02x->%02x %s: device timeout qn: timeout... qn: transmit timeout (fatal?) qn: Promiscuous mode (not tested) : hardware address %s qn: device timeout (watchdog) qn: 16 collision - packet lost qn:still pending... Overflow CRC Error Alignment error qn: ERROR: status=%04x qn_get_packet: mbuf alloc failed used all the %d loops qn:sa_family:default (not tested) qnioctl: multicast not done yet msc%d: unknown event type %d msc%d: unknown data type %d msc: unknown event type %d msc%d: Board initialize failed, bad download code. msc%d: Board successfully initialized. msc%d: Unable to detect crystal frequency. msc%d: Turbo version detected (%02x%02x:%d) msc%d: Normal version detected (%02x%02x:%d) mscmfcsmfcp%s: ipcr %02x%s: fifo overflow %s: %d buffer overflow! drsupio%s at %s port 0x%02xlpt: Hypercom %s Z3hyperiobl_zbus port 0x%04x ipl %dcomattach: io mapping failedraising ipl2spl_table[IPL_SERIAL] from 0x%x to 0x%x could not establish shutdown hookcom_supio: subprod %02x flags %02x: unknown Series II %xgio at %sgtsc at %s port 0x%04x ipl %d io mapping failed lpt_supiosbic_save_ptrs: asr %02x canceled! sbicwait TIMEO @%d with asr=x%x csr=x%x %s: abort %s: csr = 0x%02x, asr = 0x%02x %s: abort %s: clearing data buffer 0x%02x %s: sbicabort - sending ABORT command %s: sbicabort - asr %x, trying to reset %s: sbicabort - sending DISC command sbic: reinitializing driver!csr == 0x%02x alloc ZII target %d bounce pa 0x%x alloc CHIP target %d bounce pa %p sbicmsgin: sbic swallowed our message %s: target %d now synchronous, period=%dns, offset=%d. NIIFY%s: WARNING - buffer mapping changed %p->%x sbicnextstate:xfer count %d asr%x csr%x Acking unknown msgin CSR:%02xnext: REJECT sent asr %02x RSLT_NI - not MESG_IN_PHASE %x %s: reselect %s targ %d not in nexus_list %p bad reselect in sbicsbicnextstate: aborting csr %02x asr %02x nextsbicselectbus: target issued select!icmd sending cmdsbicicmd: Waiting while sbic is jammed, CSR:%02x,ASR:%02x sbicicmd: last command ignored sbic: DMA buffer mapping changed %p->%x sbicgo: HELP! no bounce allocated for %d xfer: (%p->%p,%lx) Allocating %d bounce at %x sbicgo: LCI asr:%02x csr:%02x sbicgo: done & stat = 0xff %s: can't find matching acb sbipoll: Waiting while sbic is jammed, CSR:%02x,ASR:%02x sbicpoll: LCI asr:%02x csr:%02x sbic: scsi data uio requestedsbic_scsipi_request: busygtsc_dmago: pa %p->%lx dmacmd %x tcnt %ld : dmamask 0x%lx flags %x maxdma %d sc_clkfreg: %ld.%ld MHz gtsc_dmanext at end !!! gtscahsc: modified for Apollo CPU board ahsc_dmanext at end !!! : dmamask 0x%lx atzsc_dmanext at end !!! sci id %d %s: abort %s: csr = 0x%02x, bus = 0x%02x csr == 0x%02i sci: unexpected phase %d in icmd from %d sci: scsi data uio requestedsci_scsicmd: busy%s: abort %s: dstat %02x, sstat0 %02x sbcl %02x %s: siop_select while connected? siop id %d reset V%d siop sync: unable to compute sync params for period %dns %s: target %d ignored sync request %s: target %d rejected sync request %s: target %d (sync) %02x %02x %02x %s: target %d now synchronous, period=%dns, offset=%d Phase mismatch: REQ not asserted! %02x dsp %lx %s: Disconnect with no active command? %s: iob_curbuf/len already set? n %x iob %lx/%lx chain[0] %p/%lx couldn't find saved data pointer: curbuf %lx curlen %lx i %d %s: target ID %02x reselect nexus_list %p unable to find reselecting device%s: Bad message-in with no active command? %s: Unrecognized message in data sfbr %x msg %x sbcl %x %s: Status phase not followed by message in phase? sbcl %x sbdl %x SIOP interrupt: %lx sts %x msg %x %x sbcl %x SIOP: SCSI Gross Error SIOP: Parity Error SIOP: Invalid instruction detected siopchkintr: target %x ds %p scripts %lx ds %x rp %x dsp %lx dcmd %lx siopchkintr: istat %x dstat %x sstat0 %x dsps %lx dsa %lx sbcl %x sts %x msg %x %x sfbr %x %s: siop_poll called with disconnected device %s: siop_poll disconnected device completed siop: scsi data uio requestedsiop_scsicmd: busy siopintr: status == 0xff afscaftsc%s: siopng_select while connected? scntl0 %02x scntl1 %02x scntl2 %02x scntl3 %02x scid %02x sxfer %02x sdid %02x gpreg %02x sfbr %02x socl %02x ssid %02x sbcl %02x dstat %02x sstat0 %02x sstat1 %02x sstat2 %02x ctest0 %02x ctest1 %02x ctest2 %02x ctest3 %02x dfifo %02x ctest4 %02x ctest5 %02x ctest6 %02x dcmd %02x dbc2 %02x dbc1 %02x dbc0 %02x dmode %02x dien %02x dwt %02x dcntl %02x stest0 %02x stest1 %02x stest2 %02x stest3 %02x istat %02x sien %04x sist %04x respid %04x sidl %04x sodl %04x sbdl %04x dsps %08lx dsp %08lx (+%lx) dsa %08lx temp %08lx dnad %08lx scratcha %08lx scratchb %08lx adder %08lx %s: abort %s: dstat %02x, istat %02x sist %04x sien %04x sbcl %02x no SCSI termination, host adapter deactivated. NO WIDE TERMsiopng type %s id %d reset V%d %s: target %d ignored wide request %s: target %d rejected wide request %s: target %d (wide) %02x %02x %02x %02x %s: target %d now wide %d siopngchkintr: target %x ds %p siopngchkintr: istat %x dstat %x sist %x dsps %lx dsa %lx sbcl %x sts %x msg %x %x sfbr %x siopngintr: status == 0xff %s: siopng_poll called with disconnected device %s: siopng_poll disconnected device completed siopng: scsi data uio requestedsiopng_scsicmd: busy 720720SE7700x3810A0x50x60x70x80x90xA0xB0xC0xD0xE0xF: address %pflsc_dma_intr: csr %x stat %x intr %x flsc_intr--inactive DMA flsc_dma_intr: short transfer: dmasize %d cnt %d dmaaddr %p dmasize %d stat %x flags %x off %d per %d ff %x intr %x bzsc_intr--inactive DMA bzscbzivsc_intr--inactive DMA bztzsc_intr--inactive DMA cbsc_intr--inactive DMA cbiisc_intr--inactive DMA drscdrbbc: ROM %02x %02x%02x%02x%02x%02x%02x %02x (DraCo sernum %ld) cnopen: no console devicecnopen: cn_tab->cn_dev == devcnopen: unable to get vnode reference  consnot enough chip memoryno mainbus foundAmbiguous boot device no mainbus%s at %samidisplayccwdcpccarda1k2cpauccrdb bad checksumNetBSD disk label corruptedrdb scan I/O errorno rdb foundpartition scan I/O errorpartition block with bad idpartition block bad checksumbad partition info (environ < 11)WARN: more than one root, ignoring WARN: more than one swap, ignoring console_deviceAmiga 4000Amiga 3000Amiga 1200Amiga 600Amiga 500/2000LC/EC/MMU m68851 MMU/FPU m68882 FPU m68881 FPU no FPU/FPU will be disabled/FPU disabledDraCo rev.%d68%s060 rev.%dm68040m68030m68020%s (%s CPU%s%s) dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable. device bad device not ready area improper i/o error succeeded empm0rebooting... The operating system has halted. Please press any key to reboot. FPU software emulation initialized. memory segment %d at %08x size %08x unexpected trap format %x (vector offset %x) from %x straytrapremove_isr: handler not registeredintrhand: unexpected sr 0x%x, intreq = 0x%x trap type %d, code = %x, v = %x trap: wb1 was valid, not handled yet uvm_fault(%p, 0x%lx, 0x%x) -> 0x%x type %x, code [mmu,,ssw]: %x UVM: pid %d (%s), uid %d killed: out of swap Bus errorAddress errorIllegal instructionZero divideCHK instructionTRAPV instructionPrivilege violationTrace trapMMU faultSSIR trapFormat error68881 exceptionCoprocessor violationAsync system trap address %p not a valid page pmap_init: can't allocate data structurespmap_init: kernel PT too smallpmap_init: cannot allocate KPT free listpmapplpvplpmap_init: No mmu_load_*() for cpu=%d mmu=%denter: out of address spacecollect: freeing KPT page at %lx (ste %x@%p) pmap_collect: mapping not foundpmap_enter_ptpage: can't get KPT pageptpagevmapbufvmapbuf: null page framevunmapbuf_bus_dmamem_map: size botchpcmio_bscr1 is not defined (/usr/src/sys/arch/amiga/dev/gayle_pcmcia.c)pcmio_bssr1 is not defined (/usr/src/sys/arch/amiga/dev/gayle_pcmcia.c)/usr/src/sys/arch/amiga/dev/gayle_pcmcia.c: unknown kind %d of PCMCIA memory attach failed (no virtual memory) attach failed, config_found() returned NULL %s: can't create kernel thread pccard kthread_create() failedARGH! see /usr/src/sys/arch/amiga/dev/gayle_pcmcia.c pccthreadwdc_amiga: Catweasel Z2 : Buddha : Buddha Flash couldn't map cmd registers couldn't map ctl registers couldn't subregion cmd regs wdc_buddha: Phase5 PowerUP on-board bus CyberStorm Mk-III (sn %s) CyberStorm PPC 604e (sn %s) BlizzardPPC 603e (sn %s) BlizzardPPC 603e+ (sn %s) p5bus: PCI config area, %d kB : PCI I/O area, %d kB : PCI bridge, %d kB : PCI memory BAR, %d kB p5membar: CyberStorm PPC/Mk-III SCSI host adapter : SCSI controller : BlizzardPPC 603e+ SCSI adapter INT%dp5pb: %d kB PCI memory space (%8p to %8p) couldn't map PCI configuration space : Phase5 CVPPC/BVPPC PCI bridge : no PCI bridges detected : Phase5 CVPPC/BVPPC PCI bridge (44.69/44.71) : DCE G-REX 4000 PCI bridge : DCE G-REX 1200 PCI bridge couldn't map PCI I/O and memory space : Matay Prometheus PCI bridge couldn't map PCI configuration data space : ELBOX Mediator 1200 SX/TX Power Manager couldn't map power manager register trying soft power-off... empmempm at %s: ELBOX Mediator PCI 1200 : ELBOX Mediator PCI 1200 SX : ELBOX Mediator PCI 1200 LT2 : ELBOX Mediator PCI 1200 LT4 : ELBOX Mediator PCI 1200 TX : ELBOX Mediator PCI (unknown) couldn't map PCI configuration & I/O space couldn't map Mediator setup space emmem0empmdevpcibuscouldn't find memory space, check your WINDOW jumper empb: ELBOX Mediator PCI 4000 : ELBOX Mediator PCI 4000 MK-II couldn't map PCI config space couldn't map PCI I/O space couldn't find memory space, this shouldn't happen! em4k: ELBOX Mediator PCI memory window, %d kB emmem: Thylacine USB Host Controller can't map the bus slhci_zbusfailed allocating virtual memory : Individual Computers ACA500 (rev %x) CF cards present: BOOT AUX wdc_acafhgencp_acafh: ACA500 CompactFlash interface couldn't map regs in_cksum: out of data RSVDa7sfcdfcaddr:brabsrdisp:pc@(####(pc)bfchgbftstbfsetbfinsbfffobfextubfextsbfclrabcd @-,@-mulsw muluw exg cmpaeoraddxsubxunpk divsw divuw subqaddqbchg btst bset bclr addisubieoricmpiandiandib andiw eorib eoriw ,sr,ccrrtm movpcas2l cas2w caschk2cmp2movsmovq #INVALIDvbrcaarcacrmspitt0itt1dtt0dtt1mmusrurpsrpbuscrillegalbgndrtrrtetrapvjmp mov tas pea nbcd mov ccr,mov sr,jsr notnegxmovc rtd stop bkpt #extw extl extbl linkw linkl movl swap unlk trap #movml movmw lea chkw chkl sccdrpcrpfmovcrx #fmovfmovmfabsfacosfaddfasinfatanfatanhfcmpfcosfcoshfdivfetoxfgetexpfgetmanfintfintrzflog10flog2flognflognp1fmodfmulfnegfremfscalefsgldivfsglmulfsinfsinhfsqrtfsubftanftanhftentoxftwotoxfnopfbfdbftrapfsave frestor pflushr ploadpflushpmovptestpdbptrappsave prestore move16 @+,@+@,UNKNOWN COPROC OPCODE [%s] pcsrbadbacd1d2d3d4d5d6d7a0a1a2a3a4a5a6fpiarfpsrfpcrfp0fp3fp4fp5fp6fp7wswcogtogeogluequgtugesfseqnglnlenltngtsnehivckernel: trap Caught exception in ddb. kernel: keyboard interrupt trace: pid %d lid %d faultstkadj(?) %s) at %x ) + %lx %s: pid = %d, lid = %d, pc = %s, ps = %s, sfc = %d, dfc = %d Registers: %d dreg: areg: Kernel stack (%s): User stack (%s):syscallscsiverboseperiphtapeprinterwormcdromscanneropticalchangercommunicationgraphic arts pre-pressstorage arrayenclosure servicessimplified directoptical card r/wobject-based storagescsipi_dtype: impossible device typescxsplunable to create completion thread for channel %d scsipi_channel_initURGENT unable to allocate %sscsipi_xfer DEFERRED ERROR, key = 0x%x , requested size: %d (decimal), retrying, cmd 0x%x, info 0x%x, info = %d (decimal), data =Sense Error Code 0x%x at block no. %d (decimal)request sense for a request sense ? we read %d bytes of sense anyway: request sense failed with error %d adapter resource shortage QUEUE FULL resulted in 0 openings xsbusygeneric HBA error invalid return code from adapter: %d polling command but no adapter resourcesWARNING: tag %d greater than available openings %d invalid tag mask 0x%08x scsipi_execute_xsnot polling, but enqueue failed with %d should have flushed queue? polling command not done scsizzzsoft error (corrected)not readymedium errornon-media hardware failureillegal requestunit attentionreadonly deviceno data foundvendor uniquecopy abortedsearch returned equalverify miscompareunknown error keyscsistrategy: No matching ioctl request found in queue physio split the request.. cannot proceed cmdlen too big passthrough: adapter inconsistency unknown error category %d from adapter Check Condition on CDB: SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x)Diagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02x ASC/ASCQ: %s FRU CODE: 0x%xError in %s, Offset %d, bit %dError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d SKSV: %s Additional Sense Information (byte %d out...): %2d:No Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedProgrammable Early Warning DetectedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due To ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressATA Pass Through Information AvailableConflicting SA Creation RequestLogical Unit Transitioning To Another Power ConditionExtended Copy Information AvailableAtomic Command Aborted Due To ACANo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is In Process Of Becoming ReadyLogical Unit Not Ready, Initializing Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Structure Check RequiredLogical Unit Not Ready, Security Session In ProgressLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Not Ready, OfflineLogical Unit Not Ready, SA Creation In ProgressLogical Unit Not Ready, Space Allocation In ProgressLogical Unit Not Ready, Robotics DisabledLogical Unit Not Ready, Configuration RequiredLogical Unit Not Ready, Calibration RequiredLogical Unit Not Ready, A Door Is OpenLogical Unit Not Ready, Operating In Sequential ModeLogical Unit Not Ready, Start Stop Unit Command In ProgressLogical Unit Not Ready, Sanitize In ProgressLogical Unit Not Ready, Additional Power Use Not Yet GrantedLogical Unit Not Ready, Configuration In ProgressLogical Unit Not Ready, Microcode Activation RequiredLogical Unit Not Ready, Microcode Download RequiredLogical Unit Not Ready, Logical Unit Reset RequiredLogical Unit Not Ready, Hard Reset RequiredLogical Unit Not Ready, Power Cycle RequiredLogical Unit Not Ready, Affiliation RequiredLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (Ultra-Dma/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultVibration Induced Tracking ErrorError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWarning - Background Self-Test FailedWarning - Background Pre-Scan Detected Medium ErrorWarning - Background Medium Scan Detected Medium ErrorWarning - Non-Volatile Cache Now VolatileWarning - Degraded Power To Non-Volatile CacheWarning - Power Loss ExpectedWarning - Device Statistics Notification ActiveWarning - High Critical Temperature Limit ExceededWarning - Low Critical Temperature Limit ExceededWarning - High Operating Temperature Limit ExceededWarning - Low Operating Temperature Limit ExceededWarning - High Critical Humidity Limit ExceededWarning - Low Critical Humidity Limit ExceededWarning - High Operating Humidity Limit ExceededWarning - Low Operating Humidity Limit ExceededWrite Error - Recovered With Auto ReallocationWrite Error - Auto Reallocation FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataMultiple Write ErrorsDefects In Error WindowIncomplete Multiple Atomic Write OperationsWrite Error - Recovery Scan NeededWrite Error - Insufficient Zone ResourcesError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongInvalid Field In Command Information UnitId CRC Or ECC ErrorLogical Block Guard Check FailedLogical Block Application Tag Check FailedLogical Block Reference Tag Check FailedLogical Block Protection Error On Recover Buffered DataLogical Block Protection Method ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Re-synchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUnrecovered Read Error - Recommend ReassignmentUnrecovered Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestRead Error - Lba Marked Bad By Application ClientWrite After Sanitize RequiredAddress Mark Not Found For ID FieldAddress Mark Not Found For DATA FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Corr. & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error In Primary ListDefect List Error In Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationMiscompare Verify Of Unmapped LbaRecovered ID With ECC CorrectionPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access RightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictIllegal Command When Not In Append-Only ModeNot An Administrative Logical UnitNot A Subsidiary Logical UnitNot A Conglomerate Logical UnitLogical Block Address Out Of RangeInvalid Element AddressInvalid Address For WriteInvalid Write Crossing Layer JumpUnaligned Write CommandWrite Boundary ViolationAttempt To Read Invalid DataRead Boundary ViolationMisaligned Write CommandIllegal Function (Use 20 00, 24 00, Or 26 00)Invalid Token Operation, Cause Not ReportableInvalid Token Operation, Unsupported Token TypeInvalid Token Operation, Remote Token Usage Not SupportedInvalid Token Operation, Remote Rod Token Creation Not SupportedInvalid Token Operation, Token UnknownInvalid Token Operation, Token CorruptInvalid Token Operation, Token RevokedInvalid Token Operation, Token ExpiredInvalid Token Operation, Token CancelledInvalid Token Operation, Token DeletedInvalid Token Operation, Invalid Token LengthInvalid Field In CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeInvalid XCDBInvalid Fast FormatLogical Unit Not SupportedInvalid Field In Parameter ListThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledInvalid Data-Out Buffer Integrity Check ValueData Decryption Key Fail Limit ReachedIncomplete Key-Associated Data SetVendor Specific Key Reference Not FoundApplication Tag Mode Page Is InvalidTape Stream Mirroring PreventedCopy Source Or Copy Destination Not AuthorizedHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectSpace Allocation Failed Write ProtectZone Is Read OnlyNot Ready To Ready Change, Medium May Have ChangedImport Or Export Element AccessedFormat-Layer May Have ChangedImport/Export Element Accessed, Medium ChangedPower On, Reset, Or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed To Single-EndedTransceiver Mode Changed To LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedPriority ChangedCapacity Data Has ChangedError History I_t Nexus ClearedError History Snapshot ReleasedError Recovery Attributes Have ChangedData Encryption Capabilities ChangedTimestamp ChangedData Encryption Parameters Changed By Another I_t NexusData Encryption Parameters Changed By Vendor Specific EventData Encryption Key Instance Counter Has ChangedSA Creation Capabilities Data Has ChangedMedium Removal Prevention PreemptedZone Reset Write Pointer RecommendedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination Of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsNot ReservedOrwrite Generation Does Not MatchReset Write Pointer Not AllowedZone Is OfflineStream Not OpenUnwritten Data In ZoneDescriptor Format Sense Data RequiredOverwrite Error On Update In PlaceInsufficient Time For OperationCommand Timeout Before ProcessingCommand Timeout During ProcessingCommand Timeout During Processing Due To Error RecoveryCommands Cleared By Another InitiatorCommands Cleared By Power Loss NotificationCommands Cleared By Device ServerSome Commands Cleared By Queuing Layer EventIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedWorm Medium - Overwrite AttemptedWorm Medium - Integrity CheckMedium Not FormattedIncompatible Volume TypeIncompatible Volume QualifierCleaning Volume ExpiredMedium Format CorruptedFormat Command FailedZoned Formatting Failed Due To Spare LinkingSanitize Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedEnclosure Services Checksum ErrorRibbon, Ink, Or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventThin Provisioning Soft Threshold ReachedSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-Of-MediumTape Position Error At End-Of-MediumTape Or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorRead Past End Of User ObjectElement DisabledElement EnabledData Transfer Device RemovedData Transfer Device InsertedToo Many Logical Objects On Partition To Support OperationInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has Been ChangedChanged Operating DefinitionINQUIRY Data Has ChangedComponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableIscsi Ip Address AddedIscsi Ip Address RemovedIscsi Ip Address ChangedInspect Referrals Sense DescriptorsMicrocode Has Been Changed Without ResetZone Transition To FullBind CompletedBind RedirectedSubsidiary Binding ChangedRam Failure (Should Use 40 NN)Diagnostic Failure On Component NN (80h-FFh)Data Path Failure (Should Use 40 NN)Power-On Or Self-Test Failure (Should Use 40 NN)Internal Target FailurePersistent Reservation Information LostAta Device Failed Set FeaturesSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service Crc ErrorPHY Test Function In ProgressSome Commands Cleared By Iscsi Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorIllegal Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutConnection LostData-In Buffer Overflow - Data Buffer SizeData-In Buffer Overflow - Data Buffer Descriptor AreaData-In Buffer ErrorData-Out Buffer Overflow - Data Buffer SizeData-Out Buffer Overflow - Data Buffer Descriptor AreaData-Out Buffer ErrorPCIe Fabric ErrorPCIe Completion TimeoutPCIe Completer AbortPCIe Poisoned Tlp ReceivedPCIe Ecrc Check FailedPCIe Unsupported RequestPCIe ACS ViolationPCIe TLP Prefix BlockedLogical Unit Failed Self-ConfigurationTagged Overlapped Commands (NN = Task Tag)Overlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedMedium Removal Prevented By Data Transfer ElementMedium Thread Or Unthread FailureVolume Identifier InvalidVolume Identifier MissingDuplicate Volume IdentifierElement Status UnknownData Transfer Device Error - Load FailedData Transfer Device Error - Unload FailedData Transfer Device Error - Unload MissingData Transfer Device Error - Eject FailedData Transfer Device Error - Library Communication FailedSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceQuota ErrorMaximum Number Of Supplemental Decryption Keys ExceededMedium Auxiliary Memory Not AccessibleData Currently UnavailableInsufficient Power For OperationInsufficient Resources To Create RodInsufficient Resources To Create Rod TokenInsufficient Zone Resources To Complete WriteMaximum Number Of Streams OpenInsufficient Resources To BindUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request Or State Change InputOperator Medium Removal RequestOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (False)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandIDLE_B Condition Activated By TimerIDLE_B Condition Activated By CommandIDLE_C Condition Activated By TimerIDLE_C Condition Activated By CommandSTANDBY_Y Condition Activated By TimerSTANDBY_Y Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedATA Device Feature Not EnabledCommand RejectedExplicit Bind Not AllowedSubsidiary Logical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorInsufficient Block Count For Binding Nonce RecordingConflict In Binding Nonce RecordingInsufficient PermissionInvalid Drive-Host Pairing ServerDrive-Host Pairing SuspendedDecompression Exception Short Algorithm Id Of NNDecompression Exception Long Algorithm IdSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedRMZ Extension Is Not AllowedNo More Test Zone Extensions Are AllowedCD Control ErrorPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullCurrent Power Calibration Area Almost FullCurrent Power Calibration Area Is FullRDZ Is FullSecurity ErrorUnable To Decrypt DataUnencrypted Data Encountered While DecryptingIncorrect Data Encryption KeyCryptographic Integrity Validation FailedError Decrypting DataUnknown Signature Verification KeyEncryption Parameters Not UseableDigital Signature Validation FailureEncryption Mode Mismatch On ReadEncrypted Block Not Raw Read EnabledIncorrect Encryption ParametersUnable To Decrypt Parameter ListEncryption Algorithm DisabledSA Creation Parameter Value InvalidSA Creation Parameter Value RejectedInvalid Sa UsageData Encryption Configuration PreventedSA Creation Parameter Not SupportedAuthentication FailedExternal Data Encryption Key Manager Access ErrorExternal Data Encryption Key Manager ErrorExternal Data Encryption Key Not FoundExternal Data Encryption Request Not AuthorizedExternal Data Encryption Control TimeoutExternal Data Encryption Control ErrorLogical Unit Access Not AuthorizedSecurity Conflict In Translated DeviceNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume Overflow%s(%s:%d:%d:%d): killed probe(%s:%d:%d:%d): sync (%d.%02dns offset %d), 32-bit, 16-bit, 8-bit (%d.%03dMB/s) (%dKB/s) transfers, tagged queueingtagged queueing ATA command abortedATA volume overflowATA illegal length indicationunknown error code %d %s(%s:%d:%d): wdc_atapi_done %s:%d:%d: flags 0x%x wdc_atapi_done: scsipi_done atastart from wdc_atapi_done, flags 0x%x %s:%d:%d: reset failed wdc_atapi_phase_complete(%s:%d:%d) polldsc %d wdc_atapi_phase_complete: cold%s:%d:%d: wait_for_dsc failed wdc_atapi_intr: bcount value is %d after io wdc_atapi_phase_complete: wdc_atapi_done(), error 0x%x sense 0x%x wdc_atapi_intr %s:%d:%d %s:%d:%d: bad state %d in wdc_atapi_intr wdc_atapi_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip=%d wdc_atapi_intr: c_bcount %d len %d st 0x%x err 0x%x ire 0x%x :PHASE_CMDOUT PHASE_DATAOUT wdc_atapi_intr: bad data phase DATAOUT wdc_atapi_intr: warning: write only %d of %d requested bytes PHASE_DATAIN wdc_atapi_intr: bad data phase DATAIN wdc_atapi_intr: warning: reading only %d of %d bytes PHASE_COMPLETED wdc_atapi_intr: unknown phase 0x%x wdc_atapi_intr: wdc_atapi_done() (end), error 0x%x sense 0x%x wdc_ata_bio_kill_xfer: unknown reason %d wdc_ata_bio_kill_xferwdc_atapi_scsipi_request %s:%d:%d wdc_atapi_probe_device: drive %d not present wdc_atapi_get_params: no xfer wdc_atapi_get_params: ATAPI_SOFT_RESET failed for drive %s:%d:%d: error 0x%x wdc_atapi_get_params: ATAPI_IDENTIFY_DEVICE failed for drive %s:%d:%d unbusypiomodedmamodewdc_atapi_start %s:%d:%d, scsi flags 0x%x %s:%d:%d: PIO mode %d rejected, falling back to PIO mode 3 %s:%d:%d: DMA mode %d rejected, falling back to DMA mode 0 wdc_atapi_start: not ready, st = %02x %s:%d:%d: %s timed out %s:%d:%d: %s error (0x%x) atapiscsibusdetscsinitqcouldn't establish power handler : SCSI bus : %d target%s, %d lun%s per target scshutsccompxscmdfailed to init channel %s-dunable to create discovery thread for channel %d timeout-inforemovablefixed target %d lun %d: <%s, %s, %s> %s %s%sLUN %016llx ignored waiting %d seconds for devices to settle... scsidlyApple iPod CHINON CD-ROM CDS-431 CD-ROM CDS-435 Chinon CD-ROM CDS-525 CD-ROM CDS-535 DEC RRD42 (C) DEC DENON DRD-25X GENERIC CRD-BP2 HP C4324/C4325 IMS CDD521/10 2.06MATSHITACD-ROM CR-5XX 1.0bMEDAVIS RENO CD-ROMX2A MEDIAVISCDR-H93MV 1.3NEC CD-ROM DRIVE:502CD-ROM DRIVE:55 CD-ROM DRIVE:83 CD-ROM DRIVE:84 CD-ROM DRIVE:841OLYMPUS CDS620E 1.1dPIONEER CD-ROM DR-124X 1.01PLEXTOR CD-ROM PX-4XCS SONY CD-ROM CDU-541 CD-ROM CDU-55S CD-ROM CDU-561 CD-ROM CDU-76SCD-ROM CDU-8003ACD-ROM CDU-8012 TEAC CD-ROM 1.06CD-ROM CD-56S 1.0BTEXEL CD-ROM DM-XX24 K1.091.10TOSHIBA XM-4101TASUNSLCDIBM CDRM00201 !F0724ShinaKenCD-ROM DM-3x1S1.04JVC R2626YAMAHACRW8424SCD-ROM DRIVE:222MICROP 1588-15MBSUN06692217-15MQ1091501EPSON OMD-5010 3.08ADAPTEC AEC-4412BD1.2AACB-4000RZ55 (C) DECEMULEX MD21/S2 ESDIA00MICROP1548-15MZ1077801HZ2PC372IBMRAID 0662S0663HIBM0664DXHS36DDXHS18YH3171-S2KZ-CDFRSS2FInitio JMicron Generic MPL MC-DISK- MAXTOR XT-3280 XT-4380S MXT-1240S XT-4170S XT-8760SLXT-213S LXT-213S SUN0207LXT-200S MEGADRV EV10001991-27MZMST SnapLink D3847 0307PiSCSI SCSI CD-ROM QUANTUM ELS85S LPS525S P105S 910-10-94xPD1225S PD210S SUN0207ATLAS IV 9 WLS0A0ARODIME RO3000S SEAGATE ST125N ST157N ST296 ST296N ST318404LC ST336753LC ST336753LW ST336754LC ST39236LC ST15150N ST19171ST32430NST34501FC SX910800NMK538FB 60271924FUJITSU M2266M2624S-512 SX336704LCSX173404LCORACLEBlockVolumeIOMEGAZIP 100J.03INSITEI325VM MT-02 QIC CALIPER CP150 EXABYTE EXB-8200 GY-10C SDT-2000 2.09SDT-5000 3.SDT-5200 TANDBERG TDC 3600 ARCHIVE VIPER 150 21247VIPER 1500 212472.2GPython 28454-XXXWANGTEK 5099ES SCSI5150ES SCSISCSI-36WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2MT-2ST/N50 RICOH IS60 1R08UMAX Astra 1200S V2.9Astra 1220S UMAX S-6E V2.0UMAX S-12 V2.1ULTIMA A6000C ESG-SHVSCA HSBP M15SYMBIOSLITRONICPCMCIA CDL1100 SUN SENA Virtual CDROM scsibus at %s channel %dscsi_subr drive %d: <%s, %s, %s> %s %s: %d targets atapibus at %sALPS ELECTRIC CO.,LTD. DC544CSW03DCR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00HITACHI CDR-77300008aMATSHITA CR-5741.02Memorex CRW-26421.0gNEC CD-ROM DRIVE:2734.21SANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25atapibusread_cd_capacity: extra large block size %u found - limiting to 2kByte optical mediacd_setblksize: trying to change bsize, but no blk_desc cd_setblksize: trying to change bsize, but blk_desc is correct MMC close/finalise passed wrong device type! (%d) mmc_do_op: unhandled operation %d NEC CD-ROM DRIVE:260could not sense element address page could not sense capabilities page %s: waiting %d seconds for changer to settle... %s: offline %s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: warning, READ ELEMENT STATUS avail != count SPECTRA90000200cache synchronization failed preposterousunsupported%s sector size: 0x%x. Defaulting to %d bytes. no door lock %s: waiting for pack to spin up... %s: pack is stopped, restarting... unable to restart pack RBC size: mode sense=%llu, get cap=%llu %s: fabricating a geometry %s, %ld cyl, %ld head, %ld sec, %ld bytes/sect x %llu sectors (%lu bytes/physsect; first aligned sector %udrive offlineunformatted mediablock wrong size, %d blocks residual %d-byte tape record too big for %d-byte user buffer Sense Key 0x%02xfailed to write closing filemarks at rewind, errno=%d error %d trying to rewind failed to write closing filemarks at unload, errno=%d error %d in st_load (op %d) WARNING: cannot revert to default density already open mount error (sense key=%d) - terminating mount session CAUTION: file marks/data may be missing - ASC = 0x%02x, ASCQ = 0x%02x cannot set selected mode bad request, must be multiple of %d bad request, must be between %d and %d quirks apply, drive empty density code %d, %d-bytevariable blocks, write-%s TDC 3800 SLR5 4/8GB TDC 4200 VIPER 2525 25462SANKYO CP525 ANRITSU DMT780 VIPER 150 215315525ES SCSI REV7263HSTK9490SD-303590T4000s OnStreamADR50 DriveOnStream DI-30NCR H6210-STD-03-46F880 Seagate STT3401Ahp0atxast_scsibus_ops: invalid opst_scsibusfpu_explodefpu_implodepcmcia_childdetached: %s not found %s: error %d detaching %s (function %d) (manufacturer 0x%04x, product 0x%04x) function %d: %s pcmcia_function_init: function is enabled%s: card appears to have bogus CIS pcmcia_function_enable: function not initialized%s: couldn't map the CCR pcmcia_io_map: function is enabled! pcmcia_io_unmap: function is enabled! pcmcia_intr_establish: function is enabled! pcmcia_intr_establish: already done interrupt establish failed pcmcia_intr_disestablish: function is enabled! pcmcia_intr_distestablish: already done Drats! I need a skew! CIS checksum failed %s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: unspecifiedmulti-functionserial portparallel portfixed disk(ata)video adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx-%lx; memspace@%lx; maxtwins %d mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS %s: using CIS quirks for SVECFD605 PCMCIA EtherNet CardNDCPCMCIA MBH10302ep_pcmcia_attach: impossiblecouldn't configure controller failed to allocate I/O space ep_pcmciacan't alloc mem for enet addr can't map mem for enet addr configure failed, error=%d can't get subregion for asic can't match ethernet vendor code cannot set power mgmt handler unable to establish power handler PCMCIAAmbiCom IncAMB8002TAmbiCom,Inc.Fast Ethernet PC Card(AMB8110)PMX PE-200UE2212D-LinkDE-660DE-660+RPTI LTD.EP400RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212EN2216-PCMCIA-ETHERNETSeiko Epson Corp.P/N: EEN10B Rev. 00TAMARACKCNetCN40BC EthernetPCMCIA-ETHERNET-CARDUE2216ASIXAX88190DFE-670TXDMELCOLPC2-TXLINKSYSE-CARDDE-650I-O DATAPCLAcorega K.K.corega Ether CF-TD LAN Cardcorega Ether PCC-Tcorega Ether PCC-TDcorega Ether PCC-TLcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDcorega FEtherII PCC-TXD(CG-LAPCCTXD)(HardwareFirmwareVer.)SMC8041TX-10/100-PC-Card-V2LNT-10TNCF10Base-EthernetDYNALINKL10Cne_pcmciaunable to detect chip! aic_pcmciacouldn't establish interrupt MEGAHERTZMODEM XJ2288com_pcmciacan't subregion I/O space memory mapped mode i/o mapped mode wdcattachDigital Mobile Media CD-ROMPCMCIA Portable CD-ROM DriveNinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI AdapterFREECOMPCCARD-IDEIO DATACBIDE2 LOOKMEETIDE CARDwdc_pcmciaunable to get Ethernet address sm_pcmcia%s: impossiblecouldn't get ethernet address from memory couldn't get ethernet address from i/o couldn't get ethernet address from CIS FUJITSULAN Card(FMV-J182)Ver.01Ver.02LAN Card(ITCFJ182)RATOC System Inc.10BASE_T CARD R280mbe_pcmciacom at %s slave %d%s: slave %d pcmcom%s at %s(*)unable to allocate memory space unable to map memory space mhz3en%s: unable to get Ethernet address from CIS %s: already enabled %s: already disabled mhzc_attach: impossibleunable to allocate space for Ethernet portion unable to map I/O space unable to find suitable config table entry sm_mhzccom_mhzcPCnetMobile:failed to attach controller Am79C930IcomSL-200awi_pcmciacannot map io space HCI attach failed cannot allocate io space BT3CPCC.binCannot open firmware %s/%s insane firmware file size! Firmware read failed (%d) strange ISR=%04x out of memory Unknown packet type=%#x! %s: invalid state %d! bt3cbtbc_waitbtbc_resetbtbc_enablecard eject? unknown interrupt: isr=0x%x btbc%s: not supported %s: status=%s %s: (error not notifiedwddump: device timed outwddump: drive faultwddump: DMA errorwddump: wddump: unknown error type %xwdioctlstrategy: No matching ioctl request found in queue physio split wd ioctl request... cannot proceed device faultdevice timeoutrequeuechannel resetwd, xfer %x, retry %dsoft error (corrected) xfer %x ST506wd_get_params: bad return code from ata_get_paramsIDENTIFY failed SPLIT_MOD15_WRITEquirks %s drive corrupts write transfers with certain controllers, consider replacing drive supports %d-sector PIO transfers, LBA48 addressing LBA addressing chs addressing %s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors (%d bytes/physsect; first aligned sector: %jdWARNING: block size %u might not actually work wd driver settingshwcould not create %s.%s sysctl node use NCQ if supporteduse_ncqcould not create %s.%s.use_ncq sysctl - error %d use NCQ PRIORITY if supporteduse_ncq_priocould not create %s.%s.use_ncq_prio sysctl - error %d standby immediate address mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectedobsolete (address mark not found)no media/write protectedinterface CRC errorST3120023ASST380023ASST360015ASatacmd_to48: illegal 32-bit command: %drecalsetmulti%s:%d:%d: timeout waiting for DRQ, st=0x%02x, err=0x%02x %s:%d:%d: not ready, st=0x%02x, err=0x%02x drive fault error (%x) %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: polled transfer timed out (st=0x%x) %s:%d:%d: intr with DRQ (st=0x%x) %s:%d:%d: read intr before drq atabus at %swd at %s drive %d%s: unknown child %patasplatainitq%s: channel %d busy, xfer not possiblexfer %x freed while invoking timeout xfer %x deactivated while invoking timeout %s: unknown type: %xunable to create kernel thread: error %d %scnfunable to create config thread: error %d %s: ata_xfer_start() unexpected rv %d%s: queue_freeze w/PRIO%s(%s:%d:%d): using PIO mode %d, DMA mode %d, Ultra-DMA mode %d (Ultra/33) (Ultra/66) (Ultra/100) (Ultra/133) (using DMA), NCQ (%d tags)%s, WRITE DMA FUA EXTtransfer error, downgrading to Ultra-DMA mode %d transfer error, downgrading to PIO mode %d 32-bit data port drive supports PIO mode %d%s DMA mode %d%s Ultra-DMA mode %d%s WRITE DMA FUA%s NCQ (%d tags)SATA port multiplier not supported ata_hlatabusatdrnqidlataactatafinatathinvalid checksum %x for READ LOG EXT page %x READ LOG EXT page %x failed to report error: slot %d err %x status %x %s port %d: device connected, but communication not established %s port %d: PHY offline %s port %d: device present, speed: %s %s port %d: unknown SStatus: 0x%08x sataupport %d is SEMB, ignored Unrecognized signature 0x%08x on port %d. Assuming it's a disk. no negotiated speed1.5Gb/s3.0Gb/s6.0Gb/scompat_aoutm68kexec_aoutlocal-bdaddr %s %2.2x:%2.2x:%2.2x:%2.2x:%2.2x:%2.2xdevice-type%s: %s '%s',remote-bdaddrservice-namebthubHID reportid %doutput report too long (%d)! truncating HID report report id %d, len = %d ignored auth failed encrypt off insecure (GOT INTERRUPT) (NO CONTROL) (WAITING) (CONNECTING)reject int newconn %s%s%s%s (GOT CONTROL)reject ctl newconn %s%s%s%s connect failed (%d) disconnected (%d) connect (#%d) l2cap_attach failed (%d) l2cap_setopt failed (%d) l2cap_bind_pcb failed (%d) l2cap_connect_pcb failed (%d) vendor-idproduct-idlink-modesecure unknown %s control-psm invalid %s interrupt-psmdescriptorreconnect no %s no reports found failed to create input thread bthidbusfailed to listen (%d) bthidevmajor %llu minor %llu %s: unable to register line discipline, error = %d %s: unable to register cfattach, error = %d btuartbcsp controlsmuzzled for Link-establishment Layermuzzledtxcrc for Packet Integrity Layertxcrctimeout for Sequencing Layerwinsize for Sequencing Layerwinsizeretry limit for Sequencing Layerretry_limittimeout happen at unknown state %d le-packet transmit failed link-establishment terminations failed %s%d at tty major %llu minor %llureached the retry limit. restart the link-establishment received reliable packet with not support channel %d received unknown packet received an unknown packet at shy received unknown packet at curious received sync! peer to reset? received unknown packet at garrulous received unreliable packet with not support channel %d sync-respconf-respbcspusbevtusbrhxfer: USB revision %s, not supported %s: can't register softintr usbreausbtskusbtask-hcusbtask-drunable to create task thread: %s usb_create_event_thread task%s: need usbd_xfer address usb xfer: %p pipe %p priv %p buffer %p len %x actlen %x flags %x timeout %x status %x callback %p done %x state %x tm_set %x tm_reset %x %s: need usbd_pipe address usb pipe: %p xfer = %p%susb_doattach%s: root device is not a hub %s: unable to create event thread for usb_create_event_thread%s: root hub problem, error=%s usbusb at %susbxferusbxferlistpre 1.01.13.03.1usbd_transfer: not doneWARNING: pipe closed with active xfers on addr %d usbdetusb_detach_waitold: didn't detach %s: bad descriptor %s: descriptor length too small %s: descriptor length too large hub-addresshub-portsubclassvendor-stringproduct-stringserialnumberusbififusbdevifusbverbose port %d configuration %d interface %dvendor %4.4xproduct %4.4x%x.%02x%s (0x%04x) %s (0x%04x), class %d/%d, rev , addr %dusbdly%s: bad descriptor: too short %s: bad descriptor: too long %s: bad descriptor: iface desc %s: no desc found usbd_set_config_index: illegal index %s: device addr %d (config %d) exceeds power budget, %d mA > %d mA usbpipecbusbroothubif%s: port %d, set config at addr %d failed usbd_new_device: cannot find HS port%s: No free USB addresses, new device ignored. %s: at %s (addr %d) disconnected NORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDhub not fully initialised, but child deleted?illegal enable change, port %d port error, restarting port %d port error, giving up port %d port %d reset failed strange, connected port %d has no power device problem, disabling port %d multiple%s transaction translator%s hub depth (%d) exceeded, hub ignored %d port%s with %d removable, %s powered no ports, hub ignored setting hub depth %u can't set depth no interface handle can't enable multiple TTs no endpoint descriptor bad interrupt endpoint uhubexcannot open interrupt pipe port %d power on failed, %s uroothubuhubuhid at %suhidev%s, iclass %d/%d could not read endpoint descriptor endpoint %d: ignored no input interrupt endpoint no report descriptor %d report ids uhidev_intr: bad repid %d unexpected normal completion of async xfer under lock: input=%d, output=%d, feature=%d uhidreauhidClear PME# now invalid transition from %d to D1 D1 not supported invalid transition from %d to D2 D2 not supported dev %d function %d dev %d function %d (intrswiz %#lx, intrpin %#lx, i/o %s, mem %s, no quirksmultifnsinglefnskipfunc0skipfunc1skipfunc2skipfunc3skipfunc4skipfunc5 skipfunc6 skipfunc7 quirks %sSkipping broken PCI header on %d:%d:%d detect an illegal device! The device use reserved MMC values. unsupported state, continuing. pci-bus-get-child-devhandleno spaces enabled! i/o spacememory spacerd/multwr/invrd/line okpci_set_powerstate not supported unable to wake up from power state D3 waking up from power state D%d MEM32%s: bei %u props[%u]=0x%x %s: unexpected type; wanted %s, got 0x%02x %s: 64-bit IO regions are unsupported %s: 64-bit memory region inaccessible on 32-bit platform pci_io_find: bad requestpci_io_find: expected type i/o, found mem pci_io_find: void region pci_mem_find: bad requestpci_mem_find: bad 64-bit requestpci_mem_find: expected type mem, found i/o pci_mem_find: expected mem type %08x, found %08x pci_mem_find: void region pci_mem_find: 64-bit memory map which is inaccessible on a 32-bit platform pci_mem_find: reserved mapping register type pci_find_rom: rom data ptr out of range pci_find_rom: bad rom data signature Secondary status register: 0x%04x 66 MHz capable %s: %s User Definable Features (UDF) supportFast back-to-back capableData parity error detected DEVSEL timing: fastmediumslowunknown/reservedSignalled target abortReceived target abortReceived master abortReceived system errorDetected parity errorMemory Space, Prefetchable Resource for VF use, Memory Space, Non-Prefetchable Resource for VF use, Memory Space, Prefetch Behind the Bridge, Memory Space, Non-Pref Behind the Bridge, Memory Space. Prefetchable Behind Bridge, I/O Space Memory Space Unavailable IO Space Unavailable Entry Unavailable for use Reserved Enhanced Allocation Capability Register EA Num Entries register: 0x%04x EA Num Entries: %u EA Capability Second register: 0x%08x Fixed Secondary Bus Number: %hhu Fixed Subordinate Bus Number: %hhu Entry %u: The first register: 0x%08x Entry size: %u BAR Equivalent Indicator: Behind the function Not Indicated Expansion ROM VF BAR %u Primary Properties: Secondary Properties: WritableEnable for this entry Base Address Register Low: 0x%08x Base Address Register high: 0x%08x Max Offset Register Low: 0x%08x Max Offset Register high: 0x%08x range: 0x%016llx-0x%016llx Advanced Features Capability Register AF Capabilities register: 0x%02x AF Structure Length: 0x%02x Transaction PendingFunction Level Reset AF Control register: 0x%02x AF Status register: 0x%02x Serial ATA Capability Register Revision register: 0x%04x Revision: %u.%u BAR Register: 0x%08x Register location: in config space BAR %d BAR offset: 0x%08x MSI-X Capability Register Message Control register: 0x%04x Table Size: %d Function MaskMSI-X Enable Table offset register: 0x%08x Table offset: 0x%08x BIR: 0x%x Pending bit array register: 0x%08x Pending bit array offset: 0x%08x Less than 64ns %dns to less than %dns 512ns to less than 1us 1us to less than 2us 2us - 4us More than 4us unknown vector (0x%x) %sGT/s Secure Capability Register Capability Register: 0x%04x Capability block type: IOMMU Capability revision: 0x%02x 0x%x(unknown) (IOMMU) IOTLB supportHyperTransport tunnel translation supportNot present table entries cachedIOMMU Extended Feature Register supportIOMMU Miscellaneous Information Register 1 Base Address Low Register: 0x%08x Base Address High Register: 0x%08x Base Address: 0x%016llx IOMMU Range Register: 0x%08x HyperTransport UnitID: 0x%02x Range valid Device range bus number: 0x%02x First device: 0x%04x Last device: 0x%04x Miscellaneous Information Register 0: 0x%08x MSI Message number: 0x%02x Guest Virtual Address size: 48bits Physical Address size: %dbits Virtual Address size: %dbits ATS response address range reserved Peripheral Page Request MSI Message number: 0x%02x Miscellaneous Information Register 1: 0x%08x MSI Message number (GA): 0x%02x Subsystem ID Capability Register Subsystem ID: 0x%08x Debugport Capability Register Debug base Register: 0x%04x port offset: 0x%04x BAR number: %u PCI Vendor Specific Capabilities Register Capabilities length: 0x%02x HyperTransport Capability Register at 0x%02x Command register: 0x%04x Capability Type: 0x%02x Fixed Address Low register: 0x%08x Address high register: 0x%08x Address: 0x%016llx yes PCI Message Signaled Interrupt MSI Enabled Multiple Message Capable: %s (%d vector%s) Multiple Message Enabled: %s (%d vector%s) 64 Bit Address CapablePer-Vector Masking CapableExtended Message Data CapableExtended Message Data Enable Message Address %sregister: 0x%08x (lower) (upper) Message Data register: Vector Mask register: 0x%08x Vector Pending register: 0x%08x x4x1x2375 mA PCI Power Management Capabilities Register Capabilities register: 0x%04x Version: %s PME# clockDevice specific initialization 3.3V auxiliary current: %s D1 power management state supportD2 power management state supportPME# support D0PME# support D1PME# support D2PME# support D3 hotPME# support D3 cold Control/status register: 0x%08x Power state: D%d PCI Express reservedNo soft reset PME# assertion: %sabled Data Select: %d Data Scale: %d PME# status Bridge Support Extensions register: 0x%02x B2/B3 supportBus Power/Clock Control Enable Data register: 0x%02x Lane Margining at ReceiverReserved Encoding Receive Number: Margin Type: %x Usage Model: %s Margin Payload: 0x%02x Data link Feature Register Capability register: 0x%08x Scaled Flow ControlDLF Exchange enable Status register: 0x%08x Remote DLF supported Valid Precision Time Measurement PTM Capability register: 0x%08x PTM Requester CapablePTM Responder CapablePTM Root Capable Local Clock Granularity: Not implemented %uns PTM Control register: 0x%08x PTM EnableRoot Select Effective Granularity: Unknown Cfg Request received UR CompletionCfg Request received CA CompletionCfg Request Completion TimeoutI/O Request received UR CompletionI/O Request received CA CompletionI/O Request Completion TimeoutMem Request received UR CompletionMem Request received CA CompletionMem Request Completion Timeout(reserverd)Unsupported Request(UR)Completer Abort(CA)an unmasked uncorrectable error Downstream Port Containment DPC Capability register: 0x%04x DPC Interrupt Message Number: %02x RP Extensions for DPCPoisoned TLP Egress Blocking SupportedDPC Software Triggering Supported RP PIO Log Size: %u DL_Active ERR_COR Signaling Supported DPC Control register: 0x%04x DPC Trigger Enable: %s DPC Completion Control: %s Completion Status DPC Interrupt EnableDPC ERR_COR EnablePoisoned TLP Egress Blocking EnableDPC Software TriggerDL_Active ERR_COR Enable DPC Status register: 0x%04x DPC Trigger Status DPC Trigger Reason: Due to %s DPC Interrupt StatusDue to RP PIO error DPC Trigger Reason Extension: %s DPC RP BusyDue to the DPC Software trigger bit(reserved) DPC Error Source ID register: 0x%04x RP PIO First Error Pointer: 0x%02x RP PIO Status Register: 0x%08x RP PIO Mask Register: 0x%08x RP PIO Severity Register: 0x%08x RP PIO SysError Register: 0x%08x RP PIO Exception Register: 0x%08x RP PIO Header Log Register: start from 0x%03x RP PIO ImpSpec Log Register: start from 0x%03x RP PIO TLP Prefix Log Register: start from 0x%03x LN Requester LNR Capability register: 0x%04x LNR-64 SupportedLNR-128 Supported LNR Registration MAX: %u LNR Control register: 0x%04x LNR EnableLNR CLS LNR Registration Limit: %u Process Address Space ID PASID Capability Register: 0x%04x Execute Permission SupportedPrivileged Mode Supported Max PASID Width: %u PASID Control Register: 0x%04x PASID EnableExecute Permission EnablePrivileged Mode Enable Latency Tolerance Reporting Max Snoop Latency Register: 0x%04x Max Snoop Latency: %juns Max No-Snoop Latency Register: 0x%04x Max No-Snoop Latency: %juns TPH Requester Extended Capability TPH Requester Capabililty register: 0x%08x No ST Mode SupportedInterrupt Vector Mode SupportedDevice Specific Mode SupportedExtend TPH Requester Supported ST Table Location: %s ST Table Size: %d TPH Requester Control register: 0x%08x ST Mode Select: No ST Mode Interrupt Vector Mode Device Specific Mode (reserved value) TPH Requester Enable: Not permitted TPH and not Extended TPH TPH and Extended TPH TPH ST Table Entry (%d): 0x%04x Dynamic Power Allocation Substate Max: %u Transition Latency Unit: 1ms 100ms reserved Power Allocation Scale: 10.0x 1.0x 0.1x 0.01x Transition Latency Value 0: %u Transition Latency Value 1: %u Latency Indicator register: 0x%08x Status register: 0x%04x Substate Status: 0x%02x Substate Control Enabled Control register: 0x%04x Substate Control: 0x%02x Substate Power Allocation register %d: 0x%02x Page Request Control Register: 0x%04x Status Register: 0x%04x Response FailureUnexpected Page Request Group IndexStoppedPRG Response PASID Required Outstanding Page Request Capacity: %u Outstanding Page Request Allocation: %u Multicast Max Group: %u Window Size Requested: %d ECRC Regeneration Supported Num Group: %u Base Address Register 0: 0x%08x Base Address Register 1: 0x%08x Index Position: %u Receive Register 0: 0x%08x Receive Register 1: 0x%08x Block All Register 0: 0x%08x Block All Register 1: 0x%08x Block Untranslated Register 0: 0x%08x Block Untranslated Register 1: 0x%08x Overlay BAR 0: 0x%08x Overlay BAR 1: 0x%08x Overlay Size: Overlay BAR: 0x%016llx Address Translation Services Capability register: 0x%04x Invalidate Queue Depth: %u Page Aligned RequestGlobal Invalidate Smallest Translation Unit: %u Alternative Routing-ID Interpretation Register MVFC Function Groups CapabilityACS Function Groups Capability Next Function Number: %u Control register: 0x%08x MVFC Function Groups EnableACS Function Groups Enable Function Group: %u Access Control Services ACS Capability register: 0x%08x ACS Source ValidationACS Transaction BlockingACS P2P Request RedirectACS P2P Completion RedirectACS Upstream ForwardingACS Egress ControlACS Direct Translated P2P Egress Control Vector Size: %u ACS Control register: 0x%08x ACS Source Validation EnableACS Transaction Blocking EnableACS P2P Request Redirect EnableACS P2P Completion Redirect EnableACS Upstream Forwarding EnableACS Egress Control EnableACS Direct Translated P2P Enable Egress Control Vector [%u..%u]: 0x%08x Configuration SpaceMemory-Mapped Space Root Complex Link Declaration Element Self Description Register: 0x%08x Element Type: %s Number of Link Entries: %hhu Component ID: %hhu Port Number: %hhu Link Entry %d: Link Description Register: 0x%08x Link Valid Link Type Associated RCRB Header Target Component ID: %hhu Target Port Number: %hhu Link Address Low Register: 0x%08x Link Address High Register: 0x%08x Configuration Space Low Register: 0x%08x Configuration Space High Register: 0x%08x N: %u Func: %hhu Dev: %hhu Bus: %hhu Configuration Space Base Address: 0x%016llx Device Serial Number Register Serial Number: %02x-%02x-%02x-%02x-%02x-%02x-%02x-%02x %s %s Arbitration Table: %s Phase[%d]: 0x%x 100ns Virtual Channel Register Port VC Capability register 1: 0x%08x Extended VC Count: %d Low Priority Extended VC Count: %u Reference Clock: %s Port Arbitration Table Entry Size: %dbit Port VC Capability register 2: 0x%08x VC Arbitration Table Offset: 0x%x Port VC Control register: 0x%04x VC Arbitration Select: 0x%x Port VC Status register: 0x%04x VC Arbitration Table StatusVC VC number %d VC Resource Capability Register: 0x%08x Non-configurable Hardware fixed arbitration scheme WRR arbitration with 32 phases WRR arbitration with 64 phases WRR arbitration with 128 phases Time-based WRR arbitration with 128 phases WRR arbitration with 256 phases Advanced Packet Switching Reject Snoop Transaction Maximum Time Slots: %d Port Arbitration Table offset: 0x%02x VC Resource Control Register: 0x%08x TC/VC Map: 0x%02x Port Arbitration Select: 0x%x VC ID: %d VC Enable VC Resource Status Register: 0x%08x Port Arbitration Table Status VC Negotiation PendingUndefinedData Link Protocol ErrorSurprise Down ErrorPoisoned TLP ReceivedFlow Control Protocol ErrorUnexpected CompletionReceiver OverflowMalformed TLPECRC ErrorUnsupported Request ErrorUncorrectable Internal ErrorMC Blocked TLPAtomicOp Egress BLKTLP Prefix Blocked ErrorPoisoned TLP Egress BlockedReceiver ErrorBad TLPBad DLLPREPLAY_NUM RolloverReplay Timer TimeoutAdvisory Non-Fatal ErrorCorrected Internal ErrorHeader Log Overflow 0x%02x: Single Root IO Virtualization Register Capabilities register: 0x%08x VF Migration CapableARI Capable Hierarchy Preserved VF Migration Interrupt Message Number: 0x%03x VF EnableVF Migration EnableVF Migration Interrupt EnableVF Memory Space EnableARI Capable HierarchyVF Migration Status InitialVFs register: 0x%04x TotalVFs register: 0x%04x NumVFs register: 0x%04x Function Dependency Link register: 0x%04x First VF Offset register: 0x%04x VF Stride register: 0x%04x Device ID: 0x%04x Supported Page Sizes register: 0x%08x Supported Page Size: System Page Sizes register: 0x%08x Page Size: VF BAR%d register: 0x%08x VF Migration State Array Offset register: 0x%08x VF Migration State Offset: 0x%08x VF Migration State BIR: BAR%dunknown BAR (%d)pciverboseLess than 1us 32us - 64us More than 64us %dus to less than %dus reserved for greater than 300WW Power Budgeting Data Select register: 0x%08x Data register: 0x%08x Base Power: PM Sub State: 0x%hhx PM State: D%u Type: %s Power Rail: %s Power Budget Capability register: 0x%08x System Allocated2.5GT/s unknown value (%u) %sGT/s reserved value (0x%x)Preshoot %sdB, De-emphasis %sdB-6dB-3.5dB128bytes64bytes PCI Express Capabilities Register Capability version: %u Device type: Legacy PCI Express Endpoint device Root Port of PCI Express Root Complex Upstream Port of PCI Express Switch Downstream Port of PCI Express Switch PCI Express to PCI/PCI-X Bridge PCI/PCI-X to PCI Express Bridge Root Complex Integrated Endpoint Root Complex Event Collector unknown Slot implemented Interrupt Message Number: 0x%02x Device Capabilities Register: 0x%08x Max Payload Size Supported: %u bytes max Phantom Functions Supported: two MSB All three bits Extended Tag Field Supported: %dbit Endpoint L0 Acceptable Latency: Endpoint L1 Acceptable Latency: Attention Button PresentAttention Indicator PresentPower Indicator PresentRole-Based Error Report Captured Slot Power Limit: Function-Level Reset Capability Device Control Register: 0x%04x Correctable Error Reporting EnableNon Fatal Error Reporting EnableUnsupported Request Reporting EnableEnable Relaxed Ordering Max Payload Size: %d byte Extended Tag Field EnablePhantom Functions EnableAux Power PM EnableEnable No Snoop Max Read Request Size: %d byte Bridge Config Retry Enable Device Status Register: 0x%04x Correctable Error DetectedNon Fatal Error DetectedUnsupported Request DetectedAux Power DetectedEmergency Power Reduction Detected Link Capabilities Register: 0x%08x Maximum Link Speed: Maximum Link Width: x%u lanes Active State PM Support: No ASPM support L0s supported L0s and L1 supported L0 Exit Latency: L1 Exit Latency: Port Number: %u Surprise Down Error ReportData Link Layer Link ActiveLink BW Notification CapableASPM Optionally Compliance Link Control Register: 0x%04x Active State PM Control: L0s Entry Enabled L0s and L1 Entry Enabled Read Completion Boundary ControlLink DisableRetrain LinkCommon Clock ConfigurationExtended SynchEnable Clock Power ManagementHardware Autonomous Width DisableLink Bandwidth Management Interrupt EnableLink Autonomous Bandwidth Interrupt Enable DRS Signaling Control: not reported Interrupt Enabled DRS to FRS Signaling Enabled Link Status Register: 0x%04x Negotiated Link Speed: Negotiated Link Width: x%u lanes Training ErrorLink TrainingSlot Clock ConfigurationLink Bandwidth Management StatusLink Autonomous Bandwidth Status Root Control Register: 0x%04x Slot Capability Register: 0x%08x Power Controller PresentMRL Sensor PresentHot-Plug SurpriseHot-Plug Capable Slot Power Limit Value: Electromechanical Interlock PresentNo Command Completed Support Physical Slot Number: %d Slot Control Register: 0x%04x Attention Button Pressed EnabledPower Fault Detected EnabledMRL Sensor Changed EnabledPresence Detect Changed EnabledCommand Completed Interrupt EnabledHot-Plug Interrupt Enabled Attention Indicator Control: blink Power Indicator Control: Power Controller Control: Power %s Electromechanical Interlock ControlData Link Layer State Changed EnableAuto Slot Power Limit Disable Slot Status Register: 0x%04x Attention Button PressedPower Fault DetectedMRL Sensor ChangedPresence Detect ChangedCommand CompletedMRL OpenCard Present in slotElectromechanical Interlock engagedData Link Layer State ChangedSERR on Correctable Error EnableSERR on Non-Fatal Error EnableSERR on Fatal Error EnablePME Interrupt EnableCRS Software Visibility Enable Root Capability Register: 0x%04x CRS Software Visibility Root Status Register: 0x%08x PME Requester ID: 0x%04x PME was assertedanother PME is pending Device Capabilities 2: 0x%08x Completion Timeout Ranges Supported: Completion Timeout Disable SupportedARI Forwarding SupportedAtomicOp Routing Supported32bit AtomicOp Completer Supported64bit AtomicOp Completer Supported128-bit CAS Completer SupportedNo RO-enabled PR-PR passingLTR Mechanism Supported TPH Completer Supported: Not supported TPH and Extended TPH LN System CLS: Not supported or not in effect 64byte cachelines in effect 128byte cachelines in effect 10-bit Tag Completer Supported10-bit Tag Requester Supported OBFF Supported: Message only WAKE# only Both Extended Fmt Field SupportedEnd-End TLP Prefix Supported Max End-End TLP Prefixes: %u Emergency Power Reduction Supported: Form Factor spec or Device Specific mechanism Emergency Power Reduction Initialization RequiredFRS Supported Device Control 2: 0x%04x Completion Timeout Value: 50us to 50ms 16ms to 55ms 65ms to 210ms 260ms to 900ms 1s to 3.5s unknown %u value Completion Timeout DisabledARI Forwarding EnabledAtomicOp Requester EnabledAtomicOp Egress BlockingIDO Request EnabledIDO Completion EnabledLTR Mechanism EnabledEmergency Power Reduction Request10-bit Tag Requester Enabled OBFF: Disabled Enabled with Message Signaling Variation A Enabled with Message Signaling Variation B Enabled using WAKE# signaling End-End TLP Prefix Blocking on Link Capabilities 2: 0x%08x Supported Link Speeds Vector:Crosslink Supported Lower SKP OS Generation Supported Speed Vector: Lower SKP OS Reception Supported Speed Vector:Retimer Presence Detect SupportedDRS Supported Link Control 2: 0x%04x Target Link Speed: Enter Compliance EnabledHW Autonomous Speed Disabled Selectable De-emphasis: Transmit Margin: %u Enter Modified ComplianceCompliance SOS Compliance Preset/De-emphasis: Link Status 2: 0x%04x Current De-emphasis Level: Equalization CompleteEqualization Phase 1 SuccessfulEqualization Phase 2 SuccessfulEqualization Phase 3 SuccessfulLink Equalization RequestRetimer Presence Detected Downstream Component Presence: Link Down - Presence Not Determined Link Down - Component Not Present Link Down - Component Present Link Up - Component Present Link Up - Component Present and DRS received DRS Message Received Root Complex Event Collector Association Association Bitmap for Root Complex Integrated Devices: 0x%08x RCEC Associated Bus Numbers register: 0x%08x RCEC Next Bus: %u RCEC Last Bus: %u Resizable BAR Number of Resizable BARs: Capability register(%u): 0x%08x Acceptable BAR sizes: Control register(%u): 0x%08x BAR Index: %u BAR Size: %s incorrect (%u) Lane Margining at the Receiver Port Capability register: 0x%04x Margining uses Driver Software Port Status register: 0x%04x Margining ReadyMargining Software Readyneither upstream nor downstream?(%x) Lane %d control: 0x%04x Lane %d status: 0x%04x Advanced Error Reporting Register Uncorrectable Error Status register: 0x%08x Uncorrectable Error Mask register: 0x%08x Uncorrectable Error Severity register: 0x%08x Correctable Error Status register: 0x%08x Correctable Error Mask register: 0x%08x Advanced Error Capabilities and Control register: 0x%08x First Error Pointer: 0x%04x ECRC Generation CapableECRC Generation EnableECRC Check CapableECRC Check EnableMultiple Header Recording CapableMultiple Header Recording EnableCompletion Timeout Prefix/Header Log CapableTLP Prefix Log Present Header Log register: Root Error Command register: 0x%08x Non-Fatal Error Reporting Enable Root Error Status register: 0x%08x Multiple ERR_COR ReceivedMultiple ERR_FATAL/NONFATAL_ERR ReceivedFirst Uncorrectable FatalNon-Fatal Error Messages Received Advanced Error Interrupt Message Number: 0x%02x Error Source Identification register: 0x%08x Correctable Source ID: 0x%04x ERR_FATAL/NONFATAL Source ID: 0x%04x TLP Prefix Log register: 0x%08x Secondary PCI Express Register Link Control 3 register: 0x%08x Perform EqualizationLink Equalization Request Interrupt Enable Enable Lower SKP OS Generation Vector: Lane Error Status register: 0x%08x error: failed to get PCIe capability Equalization Control Register (Link %d): 0x%04x Downstream Port Transmit Preset: 0x%x Downstream Port Receive Hint: 0x%x Upstream Port Transmit Preset: 0x%x Upstream Port Receive Hint: 0x%x Physical Layer 16.0 GT/s Equalization 16.0 GT/s CompleteEqualization 16.0 GT/s Phase 1 SuccessfulEqualization 16.0 GT/s Phase 2 SuccessfulEqualization 16.0 GT/s Phase 3 Successful Local Data Parity Mismatch Status register: 0x%08x First Retimer Data Parity Mismatch Status register: 0x%08x Second Retimer Data Parity Mismatch Status register: 0x%08x Lane %d downstream: Lane %d upstream: unknown (XXX) Base address register at 0x%02x not implemented %s %sprefetchable memory base: 0x%016llx, disabled size: 0x%016llx base: 0x%08x size: 0x%08x %d-bit I/O CardBus socket/ExCA registers Capability list pointer: 0x%02x Reserved @ 0x14: 0x%04x PCI bus number: 0x%02x CardBus bus number: 0x%02x Subordinate bus number: 0x%02x CardBus latency timer: 0x%02x CardBus memory region 0: base register: 0x%08x limit register: 0x%08x CardBus memory region 1: CardBus I/O region 0: CardBus I/O region 1: Interrupt line: 0x%02x Interrupt pin: 0x%02x (pin A)(pin B)(pin C)(pin D)(? ? ?) Bridge control register: 0x%04x Parity error responseSERR# enableISA enableVGA enableMaster abort modeSecondary (CardBus) bus resetFunctional interrupts routed by ExCA registersMemory window 0 prefetchableMemory window 1 prefetchableWrite posting enable Subsystem vendor ID: 0x%04x Subsystem ID: 0x%04x legacy-mode registers Primary bus number: 0x%02x Secondary bus number: 0x%02x Secondary bus latency timer: 0x%02x I/O region: base register: 0x%02x limit register: 0x%02x 32bit I/O base upper 16 bits register: 0x%04x limit upper 16 bits register: 0x%04x range: 0x%08x-0x%08x range: 0x%04x-0x%04x range: not set Memory region: base register: 0x%04hx limit register: 0x%04hx range: not set Prefetchable memory region: base register: 0x%04x limit register: 0x%04x base upper 32 bits register: 0x%08x limit upper 32 bits register: 0x%08x 64bit memory address Reserved @ 0x34: 0x%08x Expansion ROM Base Address: 0x%08x Bridge control register: 0x%04hx Secondary SERR forwardingVGA 16bit enableMaster abort reportingSecondary bus resetFast back-to-back enablePrimary Discard TimerSecondary Discard TimerDiscard Timer StatusDiscard Timer SERR# EnableValidation not supported Cardbus CIS Pointer: 0x%08x Expansion ROM Base Address Register: 0x%08x base: 0x%08x Expansion ROM Enable Validation Status: Validation Details: 0x%x Reserved @ 0x38: 0x%08x Maximum Latency: 0x%02x Minimum Grant: 0x%02x AGP Capabilities Register Revision: %d.%d RQ: %u ARQSZ: %u CAL cycle: %s SBAhtrans#Over 4GFast WriteAGP 3.0 Mode Data Rate Support: Command register: 0x%08x PRQ: %u PARQSZ: %u PCAL cycle: %s AGP Data Rate Enable: L1 PM Substates L1 PM Substates Capability register: 0x%08x PCI-PM L1.2 SupportedPCI-PM L1.1 SupportedASPM L1.2 SupportedASPM L1.1 SupportedL1 PM Substates SupportedLink Activation Supported Port Common Mode Restore Time: %uus Port T_POWER_ON: L1 PM Substates Control register 1: 0x%08x PCI-PM L1.2 EnablePCI-PM L1.1 EnableASPM L1.2 EnableASPM L1.1 EnableLink Activation Interrupt EnableLink Activation Control Common Mode Restore Time: %uus LTR L1.2 THRESHOLD: %dus L1 PM Substates Control register 2: 0x%08x T_POWER_ON: L1 PM Substates Status register: 0x%08x Link Activation StatusNon-bridgeECCN/ABridge bridge devicesimple device PCI-X %s Capabilities Register 64bit device133MHz capableSplit completion discardedUnexpected split completionSplit completion overrunSplit request delayed Mode: PCI-X Mode 1 PCI-X 266 (Mode 2) PCI-X 533 (Mode 2) Error protection: %s Max Clock Freq: %s Min Clock Period: %s Version: 0x%x 266MHz capable533MHz capableData Parity Error Recovery Maximum Burst Read Count: %u Maximum Split Transactions: %d %sStatus register: 0x%08x Function: %d Device: %d Bus: %d Device Complexity Designed max memory read byte count: %d Designed max outstanding split transaction: %d MAX cumulative Read Size: %u Received split completion errorUpstream %s split transaction control register: 0x%08x Capacity: %d Commitment Limit: %d Downstreamclass 0x%02x, subclass 0x%02x%s, subclass 0x%02x, interface 0x%02x, revision 0x%02x (rev. 0x%02x): %s (rev. 0x%02x) +multifunctionPCI configuration registers: Common header: Vendor Name: %s (0x%04x) Vendor ID: 0x%04x Device Name: %s (0x%04x) I/O space accessesMemory space accessesBus masteringSpecial cyclesMWI transactionsPalette snoopingParity error checkingAddress/data steppingSystem error (SERR)Fast back-to-back transactionsInterrupt disableImmediate ReadinessInterrupt statusCapability List supportSlave signaled Target AbortMaster received Target AbortMaster received Master AbortAsserted System Error (SERR)Parity error detected Class Name: %s (0x%02x) Class ID: 0x%02x Subclass Name: %s (0x%02x) Subclass ID: 0x%02x Interface Name: %s (0x%02x) Interface: 0x%02x Revision ID: 0x%02x BIST: 0x%02x Header Type: 0x%02x%s (0x%02x) Latency Timer: 0x%02x Cache Line Size: %ubytes (0x%02x) Type %d (%s) Don't know how to pretty-print type %d header. Capability register at 0x%02x type: 0x%02x ( Device-dependent header: Don't know how to pretty-print device-dependent header. Extended Capability Register at 0x%02x type: 0x%04x ( version: %d next pointer: 0x%03x (incorrect) Extended Configuration Space: "normal" devicePCI-PCI bridgePCI-CardBus bridgereceiving an ERR_NONFATALreceiving an ERR_FATALDPC Trigger Reason Extension fieldenabled(ERR_FATAL)enabled(ERR_NONFATAL or ERR_FATAL)15ns10ns7.5ns66MHz100MHz133MHz239W < x <= 250W250W < x <= 275W275W < x <= 300WValidation in ProgressValidation Pass. Valid contents, trust test was not performedValidation Pass. Valid and trusted contentsValidation Fail. Invalid contentsValidation Fail. Valid but untrusted contentsWarning Pass. Validation passed with warning. Valid contents, trust test was not performedWarning Pass. Validation passed with warning. Valid and trusted contents32-bit-1M64-bitin the TPH Requester Capability Structurein the MSI-X TableConfiguration Space ElementSystem Egress Port or internal sink (memory)Internal Root Complex LinkPower(12V)Power(3.3V)Power(1.5V or 1.8V)ThermalPME AuxAuxilarySustainedSustained (Emergency Power Reduction)Maximum (Emergency Power Reduction)self-powered55 mA100 mA160 mA220 mA270 mA320 mA16ms64ms256msCalibration Cycle Not Needed1.2Advanced Error ReportingDevice Serial NumberPower BudgetingRoot Complex Link DeclarationRoot Complex Internal Link ControlRoot Complex Event Collector AssociationMulti-Function Virtual ChannelConfiguration Access CorrectionAccess Control ServicesAlternative Routing-ID InterpretationAddress Translation ServicesSingle Root IO VirtualizationMultiple Root IO VirtualizationMulticastPage RequestReserved for AMDResizable BARDynamic Power AllocationTPH RequesterLatency Tolerance ReportingSecondary PCI ExpressProtocol MultiplexingProcess Address Space IDLN RequesterDownstream Port ContainmentL1 PM SubstatesPrecision Time MeasurementM-PCIeFunction Reading Status QueueingReadiness Time ReportingDesignated Vendor-SpecificVF Resizable BARsData link FeaturePhysical Layer 16.0 GT/sLane Margining at the ReceiverHierarchy IDNative PCIe Enclosure ManagementPhysical Layer 32.0 GT/sAlternate ProtocolSystem Firmware IntermediaryBroadcast (Upstream Port Receiver)Rx(F) (Upstream Port Receiver)Broadcast (Downstream Port Receiver and all Retimer Pseudo Port Receiver)Rx(A) (Downstream Port Receiver)Rx(B) (Retimer X or Z Upstream Pseudo Port Receiver)Rx(C) (Retimer X or Z Downstream Pseudo Port Receiver)Rx(D) (Retimer Y Upstream Pseudo Port Receiver)Rx(E) (Retimer Y Downstream Pseudo Port Receiver)VPDSlotIDMSICompactPCI Hot-swappingPCI-XHyperTransportVendor-specificDebug PortCompactPCI Resource ControlSubsystem vendor IDAGP 8xSecure DeviceMSI-XAdvanced FeaturesEnhanced AllocationFlattening Portal Bridge0.0-6.0+-1.5-3.5+-1-4.4+-1.5-2.5+-11.9+-12.55.08.016.032.0Slave or Primary InterfaceHost or Secondary InterfaceSwitchInterrupt Discovery and ConfigurationRevision IDUnitID ClumpingExtended Configuration Space AccessAddress MappingMSI MappingDirect RouteVCSetRetry ModeX86 EncodingGen3Function-Level ExtensionHigh Node Countprehistoricmultimediacommunicationsdockserial buswirelessI2Osatellite commcryptoDASPprocessing acceleratorsnon-essential instrumentationundefinedDPIOperformance counterssynchronizationmanagementmiscellaneousnetwork/computingentertainmentTVvoicestandardFIFO at offset 0x40IrDAConsumer IRRFbluetoothbroadband802.11a (5 GHz)802.11b (2.4 GHz)CellularCellular + EthernetIEEE1394ACCESS.busSSAUSBFiber ChannelSMBusInfiniBandIPMISERCOSCANbusMIPI I3CSMICblock transferUHCIOHCIEHCIxHCIUSB4 HCIother HCFirewireOpenHCI386486PentiumAlphaPowerPCMIPSCo-processordigitizergame portlegacyRTCPCI Hot-PlugSD Host ControllerIOMMURoot Complex Event Collectorgeneric 8254EISAHPETgeneric 8237generic 8259EISA PICIO APICIO(x) APICparallelmulti-port serialmodemGPIBsmartcardHayes&16450-compatHayes&16550-compatHayes&16650-compatHayes&16750-compatbi-directionalECP 1.X-compatIEEE1284 controllerIEEE1284 targetgeneric XT-compat16850-compat16950-compatMicroChannelNuBusCardBusRACEwaySemi-transparent PCIadvanced switchingcustom interfaceASI-SIGprimary side facing hostsecondary side facing hostsubtractive decodeRAMvideotelephonymixed modeHD Audio 1.0HD Audio 1.0 + vendor-extVGAXGA8514-compatethernettoken ringFDDIATMISDNWorldFipPCMIG Multi ComputingHost fabricfloppyIPIRAIDSASFlashvendor-specificUFSHCINVMHCI 1.0NVMe I/ONVMe adminAHCI 1.0Serial Storage Bus Interfacewith single DMAwith chained DMAPQI storagePQI controllerPQI storage and controllerNVMEPCI: bus %d, device %d, function %d: id=%x: Vendor=%x, Product=%x Found dev 0x%04x 0x%04x -- really probing. skipping devices with Enhanced Allocations device is a bridge; not clearing enables Failed to probe bus %d PCI bus bridge (parent %d) covers busses %d-%d pciconf: too many (%d) I/O windows pciconf: too many (%d) MEM windows pciconf: too many MEM windows I/O BAR 0x%x is void pciconf: too many I/O windows Register 0x%x, I/O size %llu reserved mapping type 0x%x MEM%d BAR 0x%x is void MEM%d BAR 0x%x has size %#lx pciconf: too many memory windows Register 0x%x, memory size %llu Expansion ROM memory size %llu ppb-pmemppb-memPCI bus %d - no devices PCI bus %d: Warning: Total bandwidth exceeded!? (%d) Failed to allocate PCI I/O space (%llu req) ppb-ioFailed to alloc I/O arena for bus %d Putting %llu I/O bytes @ %#llx (reg %x) Failed to allocate PCI memory space (%llu req, prefetch=%d ok64=%d) Failed to alloc MEM arena for bus %d Putting %llu MEM bytes @ %#llx (reg %x) Putting %llu ROM bytes @ %#llx (reg %x) PCI bus configuration failed: unable to assign all I/O and memory ranges. Configuring device. Disabled due to lack of resources. Bus %d bridge does not support 32-bit I/O. Disabling I/O accesses PCI bus %d configured pci-iopci-mempci-pmempci at %s bus %dpciide_dma_start pciide_dma_finish: status 0x%x %s:%d:%d: bus-master DMA error: status=0x%x %s:%d:%d: bus-master DMA error: missing interrupt, status=0x%x disk controller disk controllerpciide: command/status register=%x I/O access disabled at bridge I/O access disabled at device couldn't map %s channel cmd regs couldn't map %s channel ctl regs couldn't subregion %s channel cmd regs unknown interruptcouldn't map native-PCI interrupt using %s for native-PCI interrupt couldn't establish native-PCI interruptunable to subregion %s channel ctl regs , but unused (couldn't query registers), but unused (registers at unsafe address %#lx), but unused (couldn't map registers), but unused (forced off by config file)pciide-disable-dma, but unused (disabled by platform), but unsupported register maptype (0x%x), but can't subregion offset %d size %lupciide_dma_table_setup: table at %p len %lu, phy 0x%lx pciide_dma_table_setup: phy addr of table 0x%lx create xferload xferInvalid DMA segment: seg %d addr 0x%llx len 0x%llx seg %d len %d addr 0x%x primarysecondarynative-PCIcompatibilitywired%s channel %s to %s mode no compatibility interrupt for use by %s channel other hardware responding at addressesnot responding; disabled or no drives?bus-master DMA support present, but unused (no driver support), used without full driver supporthardware does not support DMA%s channel ignored (%s) %s:%d:%d: can't allocate DMA maps, using PIO transfers Generic PCI IDE controllerSATALink BA5 register space enabled unable to map SATALink BA5 register space SATALink BA5 register space disabled %dMHz PCI bus , but can't subregion offset %lu size %lucouldn't subregion %s cmd base couldn't subregion %s ctl base port 0port 1port 2port 3Silicon Image SATALink 3112Silicon Image SATALink 3512Adaptec AAR-1210SA serial ATA RAID controllerSilicon Image SATALink 3114ATI IXP 300 SATAsatalinkne_pci_attach: impossible: %s Ethernet can't subregion i/o space couldn't map interrupt couldn't establish interruptinterrupting at %s Realtek 8029Winbond 89C940FVIA Technologies VT86C926Surecom NE-34NetVin 5000CompexProLANKTIne_pci: generic clockport pa 0x%x clockport%s: %d silo overflow%s, %d ibuf flood%s com: unsupported I/O width %ddevice enable failed timeout while waiting for BUSY interrupt acknowledge timeout while waiting for HALT update acknowledge 0x%x 0x%x 'ns16550ast16650, broken fifost16650ans16550, broken fifons8250 or ns16450, no fifotl16c750ns16750Au1X00 UARTns16650, no ERSOMAP UARTIngenic UARTTegra UARTBCM AUX UARTDesignWare APB UARTNXP UARTDesignWare APB UART, no fifois_consoleforce_consoleskip_attach_delaycan't re-init serial console @%lx fifolen: %s, %d-byte FIFO txfifo disabled Could not create workqueue: %d %02x%02x %d> extra data acb@%p xs=%p flags=%x dp=%p dleft=%d target_stat=%x aic_minphys selecting %d:%d %d:%d busy idle requesting sense aic_done resid=%d sense=0x%02x AGAIN aic: probing for aic-chip STACK futzed at %d. AIC found ID: %s chip revision %d aicattach unable to enable controller aicintr sstat1:0x%02x %s: SCSI bus reset %s: SCSI bus parity error sstat0:0x%02x %s: target mode selected; going to BUS FREE reselected backoff selector %s at line %d: assertion failed %s: selection out while idle; resetting selection timeout %s: selection timeout while idle; resetting %s: BUS FREE while not idle; state=%d unexpected disconnect; sending REQUEST SENSE aic_msgout retransmitting unexpected MESSAGE OUT; sending NOOP aic_msgin n=%d imess=0x%02x message rejected %02x %s: unrecognized MESSAGE EXTENDED; sending REJECT %s: unrecognized MESSAGE; sending REJECT %s: reselect without IDENTIFY; sending DEVICE RESET cmd=0x%02x+%d dataout %ld datain %ld target_stat=0x%02x %s: reselect from target %d lun %d with no nexus; sending ABORT aic_poll aic_request [0x%x, %d]->%d ready list: nexus: nexus list: aic6360: SCSISEQ=%x SXFRCTL0=%x SXFRCTL1=%x SCSISIG=%x SSTAT0=%x SSTAT1=%x SSTAT2=%x SSTAT3=%x SSTAT4=%x SIMODE0=%x SIMODE1=%x DMACNTRL0=%x DMACNTRL1=%x DMASTAT=%x FIFOSTAT=%d SCSIBUS=0x%x nexus=%p prevphase=%x state=%x msgin=%x msgpriq=%x msgoutq=%x lastmsg=%x currmsg=%x tinfo%d: %d cmds %d disconnects %d timeouts %d senses flags=%x %s: failed to lock interrupt %s: command %d failed %x %s: failed to access hardware awicmd%s: no recent beacons from %s; rescanning %s: failed to complete selftest (timeout) awitst%s: failed to complete selftest (code %x) %s: failed to complete selftest (bad banner) %s%02x%s: failed to complete selftest (no hardware) (lost interrupt) (command timeout) awilckFH%s: failed to get default mib value (error %d) %s: failed to set available channel %s: IEEE802.11 %s (firmware %s) %s: 802.11 address: %s %s: WARNING: unable to establish shutdown hook awideteeprom failed to come ready %s: erase pencil mark! wordaddress %s, %dKB %s-wide FIFO, %s Rx:Tx split 5:33:11:13:5no media present! (default %s) %s: interface disabled epsetmedia: impossiblewrote 0x%x to TX_AVAIL_THRESH, read back 0x%x. Interface disabled RoadRunner FIFO buffer enabled %s: RX underrun %s: RX Status overrun %s: RX overrun %s: TX overrun packet overrunincomplete packetdribble bitsoversized packetbad crcbad alignmentrunt packet%s: adapter reset epstart: no header mbuf%s: adapter failure (%x) %s: jabber (%x) %s: fifo underrun (%x) @%d 10baseT10base510base210baseT-FDX100baseTX100baseTX-FDX100baseFXmanual100baseT4%s: missing buffer, no_td = %d, last_td = %d %s: memory error %s: receiver disabled %s: transmitter disabled %s: overflow %s: receive buffer error %s: dropping chained buffer %s: transmit buffer error %s: underflow %s: lost carrier %s: controller failed to initialize %d receive buffers, %d transmit buffers Ethernet address %s %s: NIC memory corrupt - invalid packet length %d %s: reselect with invalid selid %02x; sending DEVICE RESET %s: reselect from target %d lun %d tag %x:%x with no nexus; sending ABORT %s: not IDLE (state=%d)%s: unknown revision code, assuming ESP100 %s: msgin: no msg byte available %s: phase change, dropping message, prev %d, state %d %s: got %ld extra bytes %s: tagged queuing rejected: target %d %s: sync transfer rejected: target %d %s: wide transfer rejected: target %d %s: unrecognized MESSAGE (%x); sending REJECT %s: TAG reselect without IDENTIFY; MSG %x; sending DEVICE RESET %s: reselect without IDENTIFY; MSG %x; sending DEVICE RESET %s: unexpected MESSAGE IN; sending DEVICE RESET ncr53c9x_ecb: unknown variant %d, devices not attached : %s, %dMHz, SCSI ID %d %s: nexus in reset state%s: illegal command: 0x%x (state %d, phase %x, prevphase %x) %s: DMA error; resetting %s: !TC on MSG OUT [intr %x, stat %x, step %d] prevphase %x, resid %lx %s: !TC on DATA XFER [intr %x, stat %x, step %d] prevphase %x, resid %x %s: unexpected disconnect [state %d, intr %x, stat %x, phase(c %x, p %x)]; %s: waiting for SCSI Bus Reset to happen %s: unhandled reselect continuation, state %d, intr %02x %s: target didn't send tag: %d bytes in fifo [%d] %s: target didn't identify %s: RESELECT: %d bytes in FIFO! [intr %x, stat %x, step %d, prevphase %x] %s: identify failed, state %d, intr %02x %s: no nexus%s: step 1 & !NEG %s: !MSGOUT (%s:%d:%d): selection failed; %d left in FIFO [intr %x, stat %x, step %d] (%s:%d:%d): select; %lu left in DMA buffer [intr %x, stat %x, step %d] %s: unexpected status after select: [intr %x, stat %x, step %x] %s: ICCS: : [intr %x, stat %x, step %x] %s: can't get status, only %d bytes %s: STATUS_PHASE: msg %d %s: invalid state: %d [intr %x, phase(c %x, p %x)] %s at line %d: unexpected MESSAGE OUT phase %s at line %d: no nexus %s: MSGIN: unexpected FC bit: [intr %x, stat %x, step %x] %s: MSGIN: weird bits: [intr %x, stat %x, step %x] %s: unexpected bus phase; resetting DMA active%s: timed out [ecb %p (flags 0x%x, dleft %x, stat %x)], sync negotiation disabled %s: unable to allocate ecb ESP100ESP100AESP200NCR53C94NCR53C96ESP406FAS408FAS216AM53C974FAS366/HMENCR53C90 (86C01)%s: large packet discarded smc91cxx_copy_tx_frame: negative lenexternalAUIUTPfailed to detect chip, bsr=%04x unknown chip id %d, revision %d, buffer size: %s MAC address %s, default media MII (%s PHY) EPH interface in low power mode default media %s receive interrupt on empty fifo can't allocate cluster for incoming packet %s: successful packet caused TX interrupt?! SMC91C90/91C92SMC91C94/91C96SMC91C95SMC91C100SMC91C100FDSMC91C111partialmb86960_write_mbufs: no header mbuf%s: got a %s packet (%u bytes) to send mb86960_write_mbufs: negative len%s: inconsistent txb variables (%d, %d) %s: transmitter idle with %d buffered packets %s: cannot empty receive buffer DLCR = %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x MAR = %02x %02x %02x %02x %02x %02x %02x %02x BMPR = xx xx %02x %02x %02x %02x %02x %02x %02x %02x xx %02x %s: SIOCSIFFLAGS(DEBUG) %s: remote transmit DMA failed to complete ne2000_write_mbuf: negative lenwhere did the card go? setup failed %s: token valid again. : link addr 0x%02x(%d) %s: intr: got spurious power on reset int %s: excessive token losses, cable problem? %s: spurious RX interrupt or sender 0 (ignored) 10base2, 10baseT, 10baseT-FDX, auto, default [0x%02x 0x%02x] auto 10base2 10baseT-FDX 10baseT atarst%s channel %d: reset failed for drive 0 drive 1%s:%d: %s %s:%d:%d: %s __wdccommand_kill_xfer: unknown reason %d __wdccommand_kill_xfertimeout not expected without pending irqlost interrupt type: %s tc_bcount: %d tc_skip: %d sataprbBSY never cleared, status 0x%02x atapollatadrdyatacnfatardlcan't hold the chip : OKI MSM6242B RTC does not work correctly Root hub%s: ISOC transfer not supported (see slhci(4)) %s: Low speed device via hub disabled, see slhci(4) %s: Reserved bus time exceeds %d! %s: USB Suspend not implemented! SL811HS/T root hub%s: IER value corrupted! halted %s: Missed transfer completion. halted %s: Transfer reported done but not started! Verify data integrity if not detaching. flags %#x r %x %s: %s done but not in progress! halted %s: no status! halted %s: overflow cont %d len %d xfer->ux_length %d xfer->ux_actlen %d (rev 1.2)(rev 1.4 or 1.5)(unknown revision)%s: SL11H unsupported or bus error! %s: Unknown chip revision! %s: ScanLogic SL811HS/T USB Host Controller %s %s: Max Current %u mA (value by code, not by probe) slhci_detach%s: Invalid root endpoint! VeriexecveriexecVeriexec verbose levelVeriexec strict levelstrictVeriexec supported hashing algorithmsNumber of fingerprints on mount(s)comparing hashes... fp1: fp2: Veriexec: %s [%s] Veriexec: %s [%s, prog=%s pid=%u, uid=%u, gid=%u] Veriexec: Unrecoverable error.No entry.Fingerprint calculation error.Incorrect access type.Not-evaluated status post evaluation; inconsistency detected.Match.Mismatch.Invalid status post evaluation.entry-typefp-typeVeriexec: Strict mode, modifying tables not permitted. Veriexec: Can't register fileassoc: error=%dorg.netbsd.kauth.deviceVeriexec: Can't listen on device scopeVeriexec: Can't create mountspecific keyorg.netbsd.kauth.systemVeriexec: Can't listen on system scopeSHA256SHA384SHA512Veriexec: Not adding `%s': Not a regular file. Veriexec: Invalid or unknown fingerprint type `%s' for file `%s'. Veriexec: Bad fingerprint length for `%s'. Veriexec: Contaminated flags `0x%x' for `%s', skipping. keep-filenameeval-on-loadtable%umntptfstypenentriesNew entry.Remove request.non-monitoredMonitoredNon-monitoredVeriexec: Preventing rename of `%s' to `%s', uid=%u, pid=%u: Lockdown mode. Veriexec: Preventing rename of `%s' to `%s', uid=%u, pid=%u: IPS mode, %s monitored. Veriexec: %s file `%s' renamed to %s file `%s', uid=%u, pid=%u. Veriexec: IDS mode, allowing unmount of "%s". Veriexec: IPS mode, preventing unmount of "%s" with monitored files. Veriexec: Lockdown mode, preventing unmount of "%s". Veriexec: Preventing new file creation in `%s'. Write access request.%s: dir offset too large on fs %s (mounted from %s) %s: dir offset too large for emulated program /usr/libexec/ld.elf_so%s-%scompat_utilcompat_40compat_50compat_60System boot timeoboottimeroute_purgeifroute_abortroute_accept%s: message too long%s: queue full, dropped message %s: unknown command %doroutecompat_70%s: called with wrong commandcompat_90compat_100compat_110invalid AES nrounds: %uBearSSL aes_ctKernel cryptographyAES -- Advanced Encryption StandardaesSelected AES implementationselectedAES is bustedaes: self-test failed: %s AES self-tests failedaes: %s %s AES-%u enc: self-test failed wasexpected%s AES-%u dec: self-test failed %s AES overrun preceding: self-test failed %s AES overrun following: self-test failed %s AES-%u-CBC enc: self-test failed %s AES-%u-CBC dec: self-test failed %s AES-%u-CBC enc inc %u: self-test failed %s AES-%u-CBC dec inc %u: self-test failed %s AES-CBC overrun preceding: self-test failed %s AES-CBC overrun following: self-test failed %s AES-128 CCM encrypt auth/ctr (16): self-test failed %s AES-128 CCM encrypt auth/ctr (48): self-test failed %s AES-128 CCM ciphertext: self-test failed %s AES-128 CCM decrypt auth/ctr (16): self-test failed %s AES-128 CCM decrypt auth/ctr (48): self-test failed %s AES-128 CCM plaintext: self-test failed %s AES-%u-XTS enc: self-test failed %s AES-%u-XTS dec: self-test failed %s AES-%u-XTS enc incremental: self-test failed %s AES-%u-XTS dec incremental: self-test failed %s AES-XTS overrun preceding: self-test failed %s AES-XTS overrun following: self-test failed %s AES-128 CBC-MAC (16): self-test failed %s AES-128 CBC-MAC (48): self-test failed Selected ChaCha implementationchacha: self-test failed: %s chacha: %s Portable C ChaChaxchacha_streamxchacha_stream_xorchacha core 1chacha core 2hchachacprng_fast reseed/usr/src/sys/crypto/blake2/blake2s.c0 < dlenkernel %sassertion "%s" failed: file "%s", line %d dlen <= 32keylen <= 32jA%AESŘOOLJ܈yLblake2s: self-test failedblake2s: self-test passed blake2sinvalid vap id %dvap id %d not allocatedinvalid channel freq %u flags %x invalid channel (NULL) %s: mode %u not supported (caps 0x%x) Unexpected mode %u%s: no channels found for mode %u Bad IBSS channel %ubad channel ignored; freq %u flags %x number %u vap table full%s: %s rates: %s%d%sMbps%s: no 802.11 instance! 11a11b11gturboAturboGAMRR increasing rate %d (txcnt=%d retrycnt=%d) AMRR decreasing rate %d (txcnt=%d retrycnt=%d) No cipher!%s: %s keyix %u flags 0x%x rsc %ju tsc %ju len %u %s: driver did not delete key index %u %s: cipher %s has an invalid cipher index %u %s: cipher %s registered with a different template %s: invalid cipher %u %s: unregistered cipher %u, load module %s %s: unable to load cipher %u, module %s %s: no h/w support for cipher %s, falling back to s/w %s: no h/w support for TKIP MIC, falling back to s/w %s: unable to attach cipher %s %s: no h/w resources for cipher %s, falling back to s/w %s: unable to setup cipher %s %s: %s keyix %u flags 0x%x mac %s rsc %ju tsc %ju len %u %s: cipher %s rejected key index %u len %u flags 0x%x %s: no key index; should not happen! [%s] no default transmit key (%s) deftxkey %u %s: control frame%s: WEP data frame too short, len %u wlan_wepwlan_tkipwlan_aes_ocbwlan_ccmpwlan_ckip%s: Invalid key length %u, expecting %u [%s] Missing ExtIV for AES-CCM cipher [%s] AES-CCM decrypt failed; MIC mismatch AES-CCM[%s] key id %u is not set (decap) [%s] key id %u is not set (encap) NONEout of buffers with data_len %zu [%s] missing ExtIV for TKIP cipher [%s] discard frame due to countermeasures (%s) [%s] TKIP ICV mismatch on decrypt [%s] Discard frame due to countermeasures (%s) TKIP[%s] out of data for WEP (data_len %zu) [%s] WEP ICV mismatch on decrypt WEP[%s:%s] discard %s frame, [%s] discard %s frame, ssid mismatch: %s information element, too short, len %uWME[%s] extended rate set too large; only using %u of %u rates [%s] shared key challenge alloc failed reassocWPARSN, QoS, protectionie too shortbad len %uERPid %u, len %uunhandledno scan.sp_ratesbad scan.sp_rates len %dno scan.sp_ssidbad scan.sp_ssid len %dinvalid channel %ufor off-channel %ubogus beacon interval[%s] erp change: was 0x%x, now 0x%x [%s] capabilities change: before 0x%x, now 0x%x no ratesbad rates len %dno ssidbad ssid len %dno ssid with ssid suppression enabled[%s] recv probe req recv'd rate set invalid[%s] recv auth frame with algorithm %d seq %d disallowed by ACLTKIP countermeasures enabled PRIVACY is disabledshared key authbad sta auth mode %uie %d/%d too longno challengebad challenge len %dbad operating mode %ubad state %u[%s] shared key %sauth request unknown stationshared key responseno challenge recordedchallenge mismatch[%s] station authenticated (shared key) bad seq %d[%s] shared key auth failed (reason %d) open auth[%s] station authenticated (open) [%s] open auth failed (reason %d) unsupported alg %dwrong bssid[%s] deny %s request, sta not authenticated [%s] no WPA/RSN IE in association request not WPA, flags 0x%xbad version %umcast cipher mismatch; got %u, expected %uucast cipher data too short; len %u, n %uucast cipher set emptykey mgmt alg data too short; len %u, n %uno acceptable key mgmt algnot RSN, flags 0x%x[%s] %s ie: mc %u/%u uc %u/%u key %u caps 0x%x [%s] deny %s request, capability mismatch 0x%x [%s] deny %s request, rate set mismatch [%s] %sassoc failed (reason %d) [%s] %sassoc failed (rate set mismatch) [%s] %sassoc success: %s preamble, %s slot time%s%s [%s] recv deauthenticate (reason %d) [%s] recv disassociate (reason %d) subtype 0x%x not handledmgtnull nodetoo short (1): len %uwrong version %xnot to bssnode %s, %snot to cur sta: lladdr=%6D, addr1=%6Dtoo short (2): len %ubss %s, broadcast %s, %sseqno <%u,%u> fragno <%u,%u> tid %uduplicateunknown dir 0x%xmulticast echounknown srcunassoc src[%s] power save mode on, %u sta's in ps mode [%s] power save mode off, %u sta's in ps mode [%s] flush ps queue, %u packets queued multicast fragm?demic errordecap errorunauthorized port: ether type 0x%x len %utoo short: len %ureceived %s from %s rssi %d WEP set but not permittedWEP set but PRIVACY offunassociated stationps-pollaid mismatch: sta aid 0x%x poll aid 0x%x[%s] recv ps-poll, but queue empty [%s] recv ps-poll, send packet, %u still queued [%s] recv ps-poll, send packet, queue empty bad frame type 0x%x[%s] %s maccompat_20link-layer statistics and controlsIEEE 802.11 WLAN statistics and controlsieee80211%s: sysctl_createv failed, rc = %d client/peer stationscontrol debugging printfs%s: sysctl_createv failed (rc = %d) vap%uvirtual APparent devicestation inactivity timeout (sec)inact_runstation inactivity probe timeout (sec)inact_probestation authentication timeout (sec)inact_authstation initial state timeout (sec)inact_initdriver capabilitiesdriver_capsconsecutive beacon misses before scanningbmiss_max802.11 mgt frame too large: %ubad beacon boundarybss %snode %s join %snode %s leave notify scan done [%s] %s replay detected [%s] michael MIC verification failed %s: load the %s module by hand for now. bogus aid %u, max %u%s %p<%s> in %s table %s: IEEE80211_LOCK not held%s: remove %p<%s> from %s table, refcnt %d %s: %p<%s> clear key map entry [%s] scan candidate purged from cache (refcnt %u) %p: mac %s refcnt %d scangen %u authmode %u flags 0x%x associd 0x%x txpower %u vlan %u txseq %u rxseq %u fragno %u rxfragstamp %u rstamp %u rssi %u intval %u capinfo 0x%x bssid %s essid "%.*s" channel %u:0x%x fails %u inact %u txrate %u %s: free all nodes in %s table %s %s table %s: %s[%u] still active %s: scan set:%s%u start chan %u %s: chan %d->%d ????ibss %c %s %s%c %3d%c %+4d %2dM%c %4s%c %3s%c passive%s: end %s scan ni != NULLrefcnt(ni) == %dic != NULL%s: fixed rate %d (%d.%d Mb/s) not in rate set%s %p<%s> %s: add key map entry %p<%s> refcnt %d [%s] no node, discard frame (%s) %s %p<%s> refcnt %d %s: %p<%s> clear key map entryneighbor%s: creating ibss %s: merge failed, capabilities mismatch %s: new bssid %s: %s preamble, %s slot time%s %s: no scan candidate macaddr bssid chan rssi rate flag wep essid %s begin %s scan in %s mode, scangen %u new [%s] %s%s on chan %u (bss chan %u) [%s] caps 0x%x bintval %u erp 0x%x country infokey map out of sync, ni %p nikey %p%s: delete key map entry %p<%s> refcnt %d %s: scan aborted %u [%s] station with aid %d leaves unexpected operating mode %ubogus long slot station count %d[%s] long slot time station leaves, count now %d %s: re-enable use of short slot time bogus non-ERP station count %d[%s] non-ERP station leaves, count now %d %s: disable use of protection %s: re-enable use of short preamble %s: %s scangen %u [%s] discard frame, age %u [%s] discard %u frames for age probe station due to inactivitystation timed out due to inactivity (refcnt %u)[%s] station needs long slot time, count %d [%s] station is !ERP, %d non-ERP stations associated %s: enable use of protection [%s] station needs long preamble [%s] station %sassociated at aid %d: %s preamble, %s slot time%s%s unable to setup initial BSS node%s %s table, inact %u ena[%s] send null data frame on channel %u, pwr mgt %s no ethernet header!not enough room, need %u got %lu [%s] enmic failed, discard frame mbuf already chained?pktlen %u mtu %ufragment size %u too big!%s: paylen < 0%s: npkt %d firstlen %d lastlen0 %d lastlen %d fraglen %d overlen %d len %d rate %d icflags %08x no WPA/RSN!RSN IE too big, %u > %zuWPA IE too big, %u > %zuieee80211_ref_node (%s:%u) %p<%s> refcnt %d [%s] send probe req on channel %u [%s] request encrypt frame (%s) [%s] send station deauthenticate (reason %d) [%s] send station disassociate (reason %d) [%s] invalid mgmt frame type %u [%s] encrypting frame (%s) [%s] send %s on channel %u %s: cannot get buf; size %u no space for 802.11 header?%s: traffic %u, disable aggressive mode %s: traffic %u, enable aggressive mode tim bitmap empty!%s: TIM updated, pending %u, off %u, len %u [%s] pwr save q overflow, drops %llu (size %d) [%s] save frame with age %d, %u now queued wlan: %s acl policy registered wlan: %s acl policy unregistered wlan_acl%s: %s -> %s %s: invalid transition %s: bogus xmit rate %u setup ostate %x nstate %x associated synchronized with %s ssid channel %d start %uMb NODS %s->%sTODS %sFRDS %sDSDS %s(%s->%s) type#%d WEP [IV %.02x KID %u] %dM +%d%s: %s [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s log2(cwmin) %u %s: WME params updated, cap_info 0x%x %s: %s chan [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s bss [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] beacon misswlan_internalwlan_xauthWME_AC_BEWME_AC_BKWME_AC_VIWME_AC_VOWME_UPSDINITSCANAUTHASSOCRUNreserved#0reserved#1reserved#2reserved#3reserved#5reserved#6reserved#7reserved#8reserved#9ps_pollcf_endcf_end_ackreassoc_reqreassoc_respprobe_reqprobe_respbeaconatimdisassocdeauthreserved#13reserved#14reserved#15Received Signal Strength adaptation controlsrssadaptEnable RSS adaptation debugging outputRSS exponential averaging controlexpavgctl%s: dst %s threshold[%d, %d.%d] %d < %d %s: src %s rssi %d avg %d -> %d ieee80211_rssadapt_lower_rate: %s rate #%d > #%d out of bounds %s: dst %s rssi %d threshold[%d, %d.%d] %d -> %d %s: threshold[%d, %d.%d] decay %d %s: dst %s thresholds , T[%d.%d] = %d%hu.%hhu%s:%hhunetbtBluetooth Protocol FamilyHost Controller InterfaceSocket Send Buffer SizesendspaceSocket Receive Buffer SizerecvspaceACL Connection Expiry Timeacl_expiryMemo Expiry Timememo_expiryMax Event queue lengtheventq_maxMax ACL rx queue lengthaclrxq_maxMax SCO rx queue lengthscorxq_maxLogical Link Control & Adaptation Protocoll2capExtended Response TimeoutertxSerial Cable EmulationrfcommDefault MTUmtu_defaultAcknowledgement Timerack_timeoutResponse Timeout for Multiplexer Control Channelmcc_timeoutSCO datascoCommandStatus opcode (%03x|%04x) failed (status=0x%02x) CommandComplete opcode (%03x|%04x) failed (status=0x%02x) unknown handle %d! (losing track of %d packet buffer%s) Warning, could not write link policy Warning, could not read clock offset %d packets completed on handle #%x but none pending! dropped incomplete ACL packet unexpected packet fragment Bluetooth HCI: cannot listen on device scopehci_initbtbusl2cap_reql2cap_pdu%s: packet (%d bytes) dropped (socket buffer full) %s: lost %d bytes on DLCI %d rfcomm_credit%s: too many packets completed! %s: %d bytes dropped (socket buffer full) igmpplinetInternet Group Management ProtocoligmpIGMP statisticslla_lookup: new lle malloc failed inmltplPF_INET related settingsMulticast informationIPv4 related settingsWhether logical subnets are considered localsubnetsarelocalAll zeroes address is broadcast addresshostzerobroadcastinvalid argument to in_lifaddr_ioctlin_controlin4pcbplin6pcbpl%d.%d.%d.%d%s:%huinternetICMPv4 related settingsRespond to ICMP_MASKREQ messagesmaskreplNumber of bytes to return in an ICMP error messagereturndatabytesMaximum number of outgoing ICMP error messages per seconderrppslimitAccept ICMP_REDIRECT messagesrediracceptLifetime of ICMP_REDIRECT generated routesredirtimeoutICMP statisticsRespond to ICMP_ECHO or ICMP_TIMESTAMP message to the broadcast or multicastbmcastechoSend routing message for RTF_DYNAMICdynamic_rt_msgICMP: redirect failed to register timeout for route to %s, code %d icmp_errorEnable forwarding of INET datagramsEnable sending of ICMP redirect messagesDefault TTL for an INET datagramEnable forwarding of source-routed datagramsforwsrcrtEnable forwarding of broadcast datagramsdirected-broadcastAccept source-routed datagramsallowsrcrtUse RFC1191 Path MTU DiscoverymtudiscLowest ephemeral port number to assignanonportminHighest ephemeral port number to assignanonportmaxLifetime of a Path MTU Discovered routemtudisctimeoutLowest privileged ephemeral port number to assignlowportminHighest privileged ephemeral port number to assignlowportmaxEnable receive side of Strong ES model from RFC1122checkinterfaceAssign random ip_id valuesrandom_idPerform IP checksum on loopbackdo_loopback_cksumIP statisticsNumber of Duplicate Address Detection probes to senddad_countAnonymous Port Algorithm Selection (RFC 6056)anonportalgoavailable algorithmsselected algorithmbitmap of reserved portsreserve%s: refusing to send from invalid address %s (pid %d) Maximum number of fragments to retain for possible reassemblymaxfragpacketsipfrenplrip_abortrip_acceptRaw IPv4 settingsRaw IPv4 control block listpcblisttcpipqepl(unknown)TCP: invalid wscale %d from %s, assuming %d tcp_pulloutofbandm_pulldown malfunctionConnection attempt to TCP %s:%d from %s:%d (unknown v6)Connection attempt to TCP [%s]:%d from [%s]:%d tcp_output REXMTtp->t_lastm == NULL%s: no template%s: %d < %dsackholeplsnd_una=%u, snd_max=%u rcv_lastsack=%u, snd_fack=%u numholes=%d %u-%u, rxmit=%u tcp_inittcpcbpltcp_new_iss: unreachable%s: impossible (1)%s: impossible (2)synplTCP related settingsEnable RFC1323 TCP extensionsrfc1323Default TCP send buffer sizeDefault TCP receive buffer sizeDefault maximum segment sizemssdfltLower limit for TCP maximum segment sizeminmssMaximum Segment LifemslMaximum number of entries in the TCP compressed state enginesyn_cache_limitMaximum number of entries per hash bucket in the TCP compressed state enginesyn_bucket_limitInitial TCP congestion windowinit_winUse interface MTU for calculating MSSmss_ifmtuRFC2018 Selective ACKnowledgement tunablessackTCP Congestion ControlcongctlAvailable Congestion Control MechanismsSelected Congestion Control MechanismUse RFC1323 window scale optionswin_scaleUse RFC1323 time stamp optionstimestampsHughes/Touch/Heidemann Congestion Window MonitoringcwmCongestion Window Monitoring allowed burst count in packetscwm_burstsizeImmediately return ACK when PSH is receivedack_on_pushAllowed connection idle ticks before a keepalive probe is sentkeepidleTicks before next keepalive probe is sentkeepintvlNumber of keepalive probes to sendkeepcntKeepalive ticks per secondslowhzLog refused TCP connectionslog_refusedMaximum number of RST packets to send per secondrstppslimitNumber of ticks to delay sending an ACKdelack_ticksInitial TCP window size (in segments)init_win_localRFC1413 Identification Protocol lookupsPerform TCP checksum on loopbackTCP protocol control block listTicks before initial tcp connection times outkeepinitEnable automatic receive buffer sizing (experimental)recvbuf_autoIncrementor step size of automatic receive bufferrecvbuf_incMax size of automatic receive bufferrecvbuf_maxEnable automatic send buffer sizing (experimental)sendbuf_autoIncrementor step size of automatic send buffersendbuf_incMax size of automatic send buffersendbuf_maxRFC3168 Explicit Congestion NotificationEnable TCP Explicit Congestion NotificationNumber of times to retry ECN setup before disabling ECN on the connectionmaxretriesEnable RFC2018 Selective ACKnowledgementMaximum number of TCP SACK holes allowed per connectionGlobal maximum number of TCP SACK holesglobalmaxholesGlobal number of TCP SACK holesglobalholesTCP statisticsUse RTT estimator to decide which hosts are locallocal_by_rttTCP drop connectionEnable RFC 1948 ISS by cryptographic hash computationiss_hashRFC3465 Appropriate Byte Counting (ABC)abcEnable RFC3465 Appropriate Byte Counting1: L=2*SMSS 0: L=1*SMSSaggressiveMSL Tuning for TIME_WAIT truncationmsltEnable TIME_WAIT truncationMSL value to use for loopback connectionsMSL value to use for local connectionsMSL value to use for remote connectionsRTT estimate value to promote local to remoteremote_thresholdTuning for Vestigial TIME_WAITvtwEnable Vestigial TIME_WAITMaximum number of vestigial TIME_WAIT entriestcptcp6inet6newrenocubicudp_abortudp_acceptUDPv4 related settingsudpCompute UDP checksumsDefault UDP send buffer sizeDefault UDP receive buffer sizePerform UDP checksum on loopbackUDP protocol control block listUDP statisticsrandom_startrandom_pickdoublehashrandinc(src=%s dst=%s tgt=%s)/usr/src/sys/netinet6/icmp6.c%s: sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d %s: source can't be determined: dst=%s, error=%d %s: ICMP6 redirect sent from %s rejected; must be from linklocal %s: ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) %s: ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s %s: ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s %s: ICMP6 redirect rejected; no route found for redirect dst: %s %s: ICMP6 redirect rejected; redirect dst must be unicast: %s %s: ICMP6 redirect rejected; neither router case nor onlink case: %s %s: invalid ND option, rejected: %s %s: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s %s: ICMP6 checksum error(%d|%x) %s %s: unknown type %d(src=%s, dst=%s, ifid=%d) ICMPv6 related settingsicmp6ICMPv6 transmission statisticsAccept and process redirect messagesRedirect generated route lifetimeNeighbor discovery prune intervalnd6_pruneFirst probe delay timend6_delayNumber of multicast discovery attemptsnd6_mmaxtriesNumber of unicast discovery attemptsnd6_umaxtriesMaximum neighbor unreachable hint countnd6_maxnudhintmax packet queue len for a unresolved NDmaxqueuelenUse loopback interface for local trafficnd6_useloopbackRespond to node information requestsnodeinfoMaximum ICMP errors sent per secondLow mark on MTU Discovery route timersmtudisc_hiwatmtudisc_lowatEnable neighbor discovery debug outputnd6_debugUse path MTU Discovery for icmpv6 reflectreflect_pmtu%s: ENOBUFS in icmp6_error %d %s: in6_setscope failed IPv6 address: "%s" is not on the network %s: a destination can be specified for a p2p or a loopback IF only %s: prefixlen should be 128 when dstaddr is specified %s: valid lifetime is 0 for %s %s: addmulti failed for %s on %s (errno=%d) in6_prefixlen2mask: invalid prefix length(%d) invalid argument to in6_lifaddr_ioctl%s: %s marked tentative %s: %s marked detached in6_cksum: offset too short for IPv6 headerin6_cksum: mbuf too short for IPv6 header%s: %s has too small MTU, IPv6 not enabled %s: %s is not multicast capable, IPv6 not enabled %s: failed to configure the loopback address on %s (errno=%d) %s: %s: got interface identifier from itself %s: %s: got interface identifier from %s %s: %s: borrow interface identifier from %s %s: %s: interface identifier generated by random number %s: %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: failed to configure a link-local address on %s (errno=%d) %s: cannot assign link-local address ::ffff:%s[%s]:%huinternet6Cannot forward from %s@%s to %s@%s nxt %d (%s) unspec/srcbcast/mcastmcast/dstsrc[%s] inzone %d outzone %ddst[%s] inzone %d outzone %dPF_INET6 related settingsIPv6 related settingsip6Enable forwarding of INET6 datagramsEnable sending of ICMPv6 redirect messagesHop limit for an INET6 datagramMaximum number of fragments to buffer for reassemblyActivate faith interfacekeepfaithMinimum interval between logging unroutable packetslog_intervalMaximum number of nested IPv6 headershdrnestlimitAssign random IPv6 flow labelsauto_flowlabelDefault multicast hop limitdefmcasthlimNetBSD-currentKAME Versionkame_versionAllow use of deprecated addresses as source addressesuse_deprecatedDisallow PF_INET6 sockets from connecting to PF_INET socketsv6onlyDefault value of per-interface flag for adding an IPv6 link-local address to interfaces when attachedauto_linklocalReturn the current address control policyaddctlpolicyPrefer temporary address as source addressprefer_tempaddrMaximum fragments in reassembly queuemaxfragsWhether to use the default scope zonesuse_defaultzoneEnable pMTU discovery for multicast packetmcast_pmtuAnonymous port algorithm selection (RFC 6056)Maximum number of entries in neighbor cacheneighborgcthreshMaximum number of routes created via redirectmaxdynroutesHow to send parameter changing routing messageparam_rt_msgip6_init%s: packet to an unready address %s->%s %s: off < sizeof(struct ip6_hdr)%s: m == NULLPIMv6 settingspim6PIMv6 statisticsregister_mifmultiple kernel entriesadd_m6fc: %s o %s g %s p %x dbx %p cannot forward from %s to %s nxt %d received on %s ip6_mforward: ip6_mrouter socket queue full assumption failed: hdr not splitmulticast kludge informationmulticast_kludge%s: Cannot enable an interface with a link-local address marked duplicate. nd6_timer%s: workqueue_create failed (%d) %s: duplicated ND6 option found (type=%d) %s: nd6_options: unsupported option %d - option ignored %s: too many loop in nd opt %s: can't allocate llinfo for %s (ln=%p, rt=%p) %s: failed to set scope %s (errno=%d) %s.%d: sockaddr_dl_init(, %zu, ) failed on %s %s: rt_setgate failed on %s nd6_rtrequest: bad gateway value: %s %s: %s: failed to join %s (errno=%d) %s: detected a looped back NS message for %s %s: DAD duplicate address %s from %s %s: possible hardware address duplication detected, disable IPv6 %s: invalid hlim (%d) from %s to %s on %s %s: invalid target address %s %s: a solicited adv is multicasted %s: invalid ND option, ignored %s: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: duplicate IP6 address %s %s: ND packet from non-neighbor %s on %s nd6_dad_timer: called with duplicate address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: %s: could not run DAD, driver problem? %s: %s: DAD complete for %s - no duplicates found %s: bad DAD packet (wrong ip6 dst) %s: NS packet from non-neighbor %s on %s %s: bad NS target (multicast) %s: bad DAD packet (link-layer address option) %s: lladdrlen mismatch for %s (if %d, NS packet %d) %s: duplicate IP6 address %s %s: src=%s %s: dst=%s %s: tgt=%s nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: memory allocation failed for %s(%s) %s: %s: starting DAD for %s %s: src %s is not link-local %s: lladdrlen mismatch for %s (if %d, %s packet %d) Raw IPv6 settingsraw6Raw IPv6 control block listRaw IPv6 statistics%s: assumption failure (non 0 ID): %s%%%d %s: no scope id for %s %s: can't set scope for not loopback interface %s and loopback address %s siteorganizationglobalUDPv6 related settingsudp6UDPv6 statistics%s: control but no lwpudp6_output: IPV6_V6ONLY option was set for a connected socket algs/usr/src/sys/net/npf/npf_ctl.csource-filesource-linetable `%s' has a duplicate entryerror-msgrprocsextcallsinvalid parameter `%s`invalid parameter `%s` value %dconn-listcode-typer_userr_groupnat-table-idnatrulestablesnat-rulesetruleset-nameerrnoparams-defaultsip4.reassemblyip6.reassemblyskip-toifnameruleset '%s': id %llu, key: npftblplnpf_ifmap_new: out of slots; bump NPF_MAX_IFMAP [IPv6]forw-keyback-keyalenstate.key.interfacestate.key.directionnpfcn4plnpfcn6pl%p: proto %d flags 0x%x tsdiff %ld etime %d dport key (ifid %u, di %x) %s:%u-> %s:%u gc.stepgc.interval_mingc.interval_maxnpfcongcstate.generic.timeout.closedstate.generic.timeout.newstate.generic.timeout.establishedstate.generic.timeout.gre state (%p) %d: F { end %u maxend %u mwin %u wscale %u } T { end %u maxend %u mwin %u wscale %u } state.tcp.timeout.newstate.tcp.timeout.establishedstate.tcp.timeout.half_closestate.tcp.timeout.closestate.tcp.timeout.time_waitstate.tcp.strict_order_rststate.tcp.max_ack_winnpfnatplnat-policynat-addrnat-masknat-portnat-algonpt66-adjoaddroporttaddrtport NATP(%p): type %u flags 0x%x taddr %s tport %d NAT: original address %s oport %d tport %d NAT ALG = %p, ARG = %p portmap.min_portportmap.max_portnpf_alg_npfgcxnpfgcwnpfgc%unpfbpf.ifnet-%slog-interfacenpf_ext_lograndom-idno-dfmin-ttlmax-mssnpf_ext_normalizepercentagenpf_ext_rndblocknpf_alg_icmpif_npflogunsupported size db_read_ptr: cannot find `%s' db_read_int: cannot find `%s' alldevsPRIVATEDEVICE_TUNITCLASSNAME%-16s %10s %4s %18s %18s %-16.16s %10s %4u %18xdullifnetaudiodevvirtualNo breakpoints set Map Count Address %s%p %5d Already set. All breakpoints used. Too many breakpoints. Not set. WAIT-CHANNELTYPEWAITING-FORCOMMAND%5s %5s %16s %16s %8s %16s %5ld %5ld %16s %16s %8s %16s %5ld %5ld %16s %16lx %8s %16s alleventsevcnt type %d: %s %s = %lld kernel_mapdump forced via kernel debuggerBad modifier Bad argument (non-string) Bad function Too many arguments Argument missing %s: must specify kqueue address reboot forced via kernel debuggerNo such command: %s Ambiguous command: %s Count missing aio_jobsbreakscalloutcondvarfreelistslockstatsmodulemountsmqueuencachepoolssched_qsselinfosleepqsockettstilesuvmexpvmemvmemsvnode_lockwatchesbreakcontinuedeletedmesgdwatchexaminehelpkillmachinequitrebootsearchshowsiftinguntilwhatisncpucpu_infos: = 0x%lx = 0x%lx %-*s%-*llx%02llx%-*lld%-*llu%-*llo\%03o%11s%16lx%8s%11ld%11lu%15loAddress missing Value missing Symbol not found Syntax error Divide by 0 Negative shift amount ^R db> %loBad character in number Bad escape String too long Bad character alllwp%p is %p+%zu, LWP %p's stack --db_more-- -%#qx-%qx-%qo-%qu-%#qu-%#qo%llu.%09ldcpu%u: Begin traceback... cpu%u: End traceback... Faulted in mid-traceback; aborting... allprocmawlnusage: show all procs [/a] [/l] [/n] [/w] /a == show process address info /l == show LWP info [default] /n == show normal process info /w == show process wait/emul info VMSPACE/VM_MAPUAREA *STRUCT PROC *PID %-16s %18s %18s %18s STRUCT LWP *FLAGSPID %5s S %3s %9s %18s %18s %-8s LWPSUIDPGRPPPIDPID %8s %8s %10s S %7s %4s %16s %7s WAIT-MSGEMULPID %5s %16s %8s %4s %-16s %s %-5d %-16.16s %18lx %18lx %18lx %c%5d %d %3d %9x %18lx %18s %-8s %8d %8d %10d %d %#7x %4d %16s %7.7s %c%5d %16s %8s %4d %-16s %-18lx usage: show proc [/a] [/p] address|pid /a == argument is an address of any lwp /p == argument is a pid [default] lwp_t %lx bad address %s: pid %d proc %lx vmspace/map %lx flags %x %slwp %d %lx pcb %lx stat %d flags %x cpu %d pri %d ref %d wmesg %s wchan %lx %-12s%s %s+%s [after %6d] invalid symbol table name%s:%smutex_syncobjrw_syncobjAfter %d instructions (%d loads, %d stores), Breakpoint in pid %d.%d (%s) at Input and output radixMaximum symbol offsetmaxoffMaximum output line widthmaxwidthNumber of display linesOutput tab widthtabstopsWhether to enter ddb on a kernel paniconpanicWhether ddb can be entered from the consolefromconsoleWhether to tee ddb output to the msgbuftee_msgbufCommand to be executed on each ddb entercommandonenterNumber of stack frames to print on panicpanicstackframesOn panic print stack tracedumpstackUnknown variable No value $%s %s = No map. All watchpoints used. Too many watchpoints. No watchpoints set Map Address Size %s%p %8lx %lx q not supported Unknown size = %s Nothing written. pid? sig? no such proc usage: show files address address == an address of a proc structure msgbufenabledmessage buffer not available msgbufpPanic string: %s sleepq=wmesg=%s collision=%llx klist=%p cluster=%p lwp=%p fdinfo=%lx sel_chain=%p BAD LENGTH %d Main bTag=%d Global bTag=%d Local bTag=%d default bType=%d %s: out of paper %s: output error %s: open: flags=0x%x lptopen%s: opened lptpsh%s: write %lu lptwrite2%s: closed mii_attach: phyloc and offloc specifiedmii_attachmiimiiautomii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmiiverboseoui %6.6xmodel %4.4xOUI 0x%06x model 0x%04xmiiautmii_phy_setmedia: MASTER on wrong mediano media present HomePNA11000baseSX1000baseSX-FDX1000baseT1000baseT-FDX: Media interface : %s, rev. %d DP83843 10/100 media interfaceDP83847 10/100 media interfaceDP83849 10/100 media interfaceDP83815/DP83846A 10/100 media interfacensphyter: %s (OUI 0x%06x, model 0x%04x), rev. %d : OUI 0x%06x, model 0x%04x, rev. %d ukphyrf_alloclist_plcallbackfcallbackvRaidOneDegradedReadDAGNilCmtTrmRpdRsdRudRrdRp SimpleDegradedWriteDAGXrcRrNWnpWndW NonredundantDAG/usr/src/sys/dev/raidframe/rf_dagffrd.cRaidOneReadDAGRmirLargeWriteDAGXr SmallWriteDAGRopRaidOneWriteDAGWpdWsdrf_GenericWakeupFunc:node->status is %d,status is %d /usr/src/sys/dev/raidframe/rf_dagfuncs.cdagnodedaghdaglistdagpcachefunclist/usr/src/sys/dev/raidframe/rf_dagutils.cGenerateFailedAccessASMs: did not find failedPDA in asm list Recovery XrReg XrSimple XrdqdbufioUnknown queue type "%s". Using %s component%dabsentIgnoring missing component at column %d pathbuf_create for device: %s failed! open device: '%s' failed: %d Warning: spare disk %s failed TUR Spare Disk %d: dev %s numBlocks %llu blockSize %d (%ld MB) Block size of %d on spare disk %s is not the same as on other disks (%d) Spare disk %s (%d blocks) is too small to serve as a spare (need %llu blocks) Warning: truncating spare disk %s to %llu blocks (from %llu) YesNoHosed component: %s raid%d: Too many different serial numbers! raid%d: Too many different mod counters! raid%d: Ignoring %s raid%d: Component %s being configured at col: %d Column: %d Num Columns: %d Version: %d Serial Number: %d Mod Counter: %d Clean: %s Status: %d %s has a different serial number: %d %d %s has a different modification count: %d %d Row out of alignment for: %s Column out of alignment for: %s Number of columns do not match for: %s %s is not clean! Disk at col %d: dev %s numBlocks %llu blockSize %d (%ld MB) RAIDFRAME: Did not find any live disks in the array. Error: block size on disks (%d) must be a power of 2 raid%d: There were fatal errors raid%d: Fatal errors being ignored. Error: block size of disk at c %d different from disk at c 0 WARNING: truncating disk at c %d to %d blocks Too many spares: %d Spare is in use %d absent_spare%dAttempt to shut down unconfigured RAIDframe driver. Aborting shutdown raid%d: Waiting for parity re-write to exit... raid%d: Waiting for reconstruction to stop... rf_ConfigureAllocListRAIDFRAME: failed %s with %d [Set debug variable %s to %ld] Unknown debug string "%s" rf_ConfigureDebugMemrf_ConfigureAccessTracerf_ConfigureNWayXorrf_ConfigureDAGFuncsrfocondrfprwshutdownrfquiescerfrcnwrf_ConfigureMapModulerf_ConfigureReconEventrf_ConfigureCallbackradrf_ConfigureStripeLockFreeListrf_ConfigureMCPairrf_ConfigureDAGsrf_ConfigureReconstructionrf_ConfigureDiskQueueSystemrf_ConfigurePSStatusrf_ConfigureEnginerf_ConfigureStripeLocksrf_ConfigureDisksrf_ConfigureSpareDisksrf_ConfigureDiskQueuesrf_ConfigureLayoutraid%d: failed to allocate emergency buffer! raid%d: failed to allocate emergency stripe buffer! raid%d: %s raid%d: Components:raid%d: Unable to allocate emergency buffers. [**FAILED**]raid%d: Total Sectors: %llu (%llu MB) raid%d: Using swapped-endian component labels. raidframe error at line %d file %sUnable to init mutex file %s line %d rc=%d Unable to add to shutdown list file %s line %d rc=%d Execution engine found illegal DAG status in NodeReady /usr/src/sys/dev/raidframe/rf_engine.craidiowrfnodeqraid%draid%d: Unable to create engine thread raidio%draid%d: Unable to create raidio thread UNDO of a node failed!!! node finished execution with an illegal status!!! Engine found illegal DAG status in PropagateResults() Queue lengths differ!: %d %d %d raid%d: Invalid sectorsPerStripeUnit: %d raid%d: Invalid StripeUnitsPerParityUnit: %d raid%d: Invalid StripeUnitsPerReconstructUnit: %d Unknown parity configuration '%c'RAID Level 0RAID Level 1RAID Level 4RAID Level 5asmhdrasmapasmhlepdafssvfplevple%d stripes total Stripe %d (%d sectors), failures: %d data, %d parity: Parity [c%d s%d-%d b0x%lx, c%d s%d-%d] SU c%d s%d-%d b0x%lx [multiple failures] [Failed PDA: c%d s%d-%d] Unable to map access because offset (%d) was invalid mcpairraid%uraid%d: config_attach_pseudo failed raid%d: cache flush[%d] to component %s failed (%d) raid%d: IO Error (%d). Marking %s as failed. raid%d includes boot device %s raid%s: devsw_attach failed %d %s: config_cfattach_attach failed %d Kernelized RAIDframe activated Serious error activating RAID!!WARNING: unable to register RAIDframe finalizer %s: cannot detach cfattach raidunitFailed to write RAID component info! raid%d: Error re-writing parity (%d)! raid_recon%s: WAKEUP CALLED bp->b_bcount is zero in InitBP!!bad req->type in rf_DispatchKernelIOWARNING: total sectors < 32 bits, yet numBlocksHi set WARNING: resetting numBlocksHi to zero. WARNING: total sectors < 32 bits, yet partitionSizeHi set WARNING: resetting partitionSizeHi to zero. hdfdfdisaspiflashRAID can't alloc vnodeRAIDframe: can't get disk size for dev %s (%d) RAIDframe: can't get wedge info for dev %s (%d) raidframeRAIDframe: can't get label for dev %s (%d) Searching for RAID components... raid%d: configured ok, rootable %d Autoconfig failed %s: rootspec %s %s: nothing found %s: booted_device %s, startblk = %lld, nblks = %lld %s: cannot find parent for component /dev/%s%s: looking up wedge %s in device %s %s: wedge %s, startblk = %lld, nblks = %lld %s: looking for wedge in %s, startblk = %lld, nblks = %lld %s: root candidate wedge %s shifted from %s %s: not found %s: nothing found for col %d %s: candidate wedge root %s %s: candidate root = %s, booted_device = %s, root_partition = %d, contains_boot=%d raidframe/single%s: set booted_device = %s %s: many roots=%d, %s raidframe/multiraid%d: raidstart not ready raid%d_%sraid%d: Device already configured! raid%d: New autoconfig value is: %d raid%d: New rootpartition value is: %d raid_parityraid%d: Unable to reconstruct to disk at: raid%d: Col: %d Too many failures. raid%d: Col: %d Reconstruction already occurring! raid_reconipcompat_raid_50raid%d: get cache for component %s failed dk_subr,bufq_fcfsCall counts for n-way xor routines: accessDebugcscanDebugdagDebugdegDagDebugdiskDebugengineDebugfifoDebugfloatingRbufDebugforceHeadSepLimitforceNumFloatingReconBufskeepAccTotalslockTableSizemapDebugmaxNumTracesmemDebugmemDebugAddressnumBufsToAccumulateprReconSchedprintDAGsDebugprintStatesDebugprotectedSectorspssDebugqueueDebugquiesceDebugraidSectorOffsetreconDebugreconbufferDebugshowXorCallCountsshutdownDebugsizePercentagesstfDebugstripeLockDebugsuppressLocksAndLargeWritesvalidateDAGDebugvalidateVisitedDebugverifyParityDebugdebugKernelAccessraid%d: cooldown %d out of range raid%d: tick time %dms out of range raid%d: region count %u too large (more than %u) Parity bad during correction Could not correct bad parity Could not verify parity Bad rc=%d from VerifyParity in RewriteParity SimpleDAGUnable to verify parity: can't read the stripe Parity verify error: byte %d of parity is 0x%x should be 0x%x Unable to correct parity in VerifyParity: can't write the stripe pssrfpsslk Parity Stripe Status Table PSID %ld RU %d : blockCount %d %d/%d/%d proc/block/buf waiting, issued flags: (none) under-recon forced-w forced-r blocked bufwaitUnable to verify raid1 parity: can't read stripe Unable to correct RAID1 parity in VerifyParity RAID1 reconbuffer submit psid %ld buf %lx RAID1 psid %ld %02x %02x %02x %02x %02x Buffer wait deadlock /usr/src/sys/dev/raidframe/rf_raid1.cBuffer wait deadlock detected. Exiting. /usr/src/sys/dev/raidframe/rf_reconbuffer.craidreconplreconupdateraid%d: ru is bogus %llu%llu%llu%llu%llu bogus ru in reconmapraid%d: %lu recon event waits, %lu recon delays raid%d: %lu max exec ticks raid%d: Recon read failed: %d raid%d: Recon write failed (status %d(0x%x))! raid%d: Forced recon read failed! /usr/src/sys/dev/raidframe/rf_reconstruct.creconbufraid%d: promoted read from col %d raid%d: promoted write to col %d RECON: all reads completed raid%d: reconstruction failed. raid%d: Reconstruction of disk at col %d completed raid%d: Recon time was %d.%06d seconds, accumulated XOR time was %ld us (%ld.%06ld) raid%d: (start time %d sec %d usec, end time %d sec %d usec) raid%d: Total head-sep stall count was %d Unable to reconstruct disk at col %d because no spares are available RECON: initiating reconstruction on col %d -> spare at col %d RECON: no way to reconstruct failed disk for arch %c raid%d: rebuilding: open device: %s failed: %d! raid%d: initiating in-place reconstruction on column %d rfevqrfrcwreventrfrecond/usr/src/sys/dev/raidframe/rf_states.craid%d: failed to create a dag. Too many component failures. raid%d: IO failed after %d retries. strplock[WARNING: lock table size must be a power of two. Setting to %d.] raid,compat_50,compat_raid_80raid,compat_80vcons_init_screen: dummy function called. Your driver is supposed to supply a replacement for proper operation vcons_free_screen: console vcons_switch_screen: disappeared wsfont: font '%s' bito %d byteo %d copied to bito %d byteo %d wsfont_unlock: font not lockedBoldfaceadosfs .. attempted through rootadosndplAmigaDOS file systemadosfscd9660noplRRIP with incorrect NM flags? RRIP without PX field? RRIP with incorrect flags?IEEE_1282IEEE_P1282RRIP_1991ASPISO-9660 file systemcd9660Encode Joliet filenames to UTF-8utf8_jolietfhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] CD001%/@%/C%/Eroot_devicecd9660_strategy: spectag VT_ISOFS, isofs vnode msdosnoplmsdosfhplloadvnode(): pcbmap returned %d deextend: file too largedetrunc(): can't truncate root directory, clust %ld, offset %ld %s: copy FAT %d (error=%d) %s: write FAT (error=%d) . .. msdosfs_rename: updating .. in root directory?MS-DOS file systemmsdosfsmsdosfs_sync: rofs modRRaArrAamsdosmsdosfs_write(): bad file typemsdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %llu, %llu puffs compat ops come in pairs/kern file systemkernfskernfs_get_rrootdev: no raw root device tag VT_KERNFS, kernfs vnode %lld %ld %d %d %d %ld copyrightloadavgpagesizephysmemrrootdevbind failed nfsvinvalnfs_doio: type %x unexpected nfsbioread: type %x unexpected ifupdown: socreate, error=%d ifupdown: GIFFLAGS, error=%d ifupdown: SIFFLAGS, error=%d nfsbifsetaddress: socreate, error=%d setaddress, error=%d nfsbtdnfs_boot: '%s' not found setmtu: socreate, error=%d setmtu: GIFMTU, error=%d setmtu: SIFMTU, error=%d deladdress: socreate, error=%d deladdress, error=%d nfs_boot: timeout... nfs_boot: sosend: %d nfs sndunlockshort receive (%lu/%lu) from nfs server %s impossible packet length%s (%d) from nfs server %s short receive (%lu/%d) from nfs server %s Egad!! receive error %d from nfs server %s nfsreply nilis alive againnfstrylatermtimectime%s: inaccurate wcc data (%s) detected, disabling wcc (ctime %u.%09u %u.%09u, mtime %u.%09u %u.%09u) %s: re-enabling wcc nfsiodnfsionfsiormnfsauth1nfsauth2nfskqpwnfskqpollnfskqdet%s: vp=%p error=%d nfsnodeplnfsvaplnfssillynfs_node_initnfs send error %d for %s nfsd send error %d timer starttimer stopnfscon sotypenfscn2nfs rcvunlockBad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad nfs server %s: %s not respondingnfsrvdescplbuild > MLENnfsumntNFS vfs optionsNFS operation statisticsnfsstatsNumber of NFS client processes desirediothreadsnfs_vfsops: nfs_statvfs would lose buffers nfs_args: retrying connect nfscn3nfsrcvnfssndnfsaionfsdisnfs%unfs_mountroot: mget soname for %snfs_mountroot: mount %s failed: %d root on %s nfs_mountroot: getattr for rootnfs_readdir: lost in spacenfs physio/asynctag VT_NFS, fileid %lld fsid 0x%llxwriterpc readonly vp %pnfsmblknfs: sillyrename dir.nfsAxxxx4.4nfs_remove: bad vrefcnt(vp)%s: cg = %d, ipref = %lld, fs = %s %s: map corrupted%s: start = %d, len = %d, fs = %s file system fulluid %d on %s: %s %s: write failed, file system is full out of inodes %s: create/symlink failed, no inodes free %s: bad block %jd, ino %ju %s: dev = %#jx, block = %jd, fs = %s %s: freeing free block%s: range: dev = %#jx, ino = %ju, fs = %s%s: dev = %#jx, ino = %ju, fs = %s %s: freeing free inode%s: group %d invalid csum (%#x != %#x) %s: can't read itable block%s: Could not unwind indirect block, error %dext2fs_indirtrunc: bad buffer sizerec_len % 4 != 0rec_len is smaller than minimaldirectory entry across blocksreclen is too small for name_leninode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentrymangled entryi_size too smallext2fs_direnter: newblkext2fs_direnter: frag sizehard-linked directorybad `..' entry`..' does not point at parentLinux EXT2FS file systemext2fsext2fsinoplext2fs: unsupported revision number: %#x ext2fs: bad block size: %d ext2fs: zero blocks per group ext2fs: zero inodes per group ext2fs: invalid first data block ext2fs: invalid block count ext2fs: invalid number of cylinder groups ext2fs: invalid block size ext2fs: invalid number of group descriptor blocks ext2fs: invalid inode size ext2fs: unsupported first inode position INCOMPAT_ENCRYPTINCOMPAT_INLINE_DATAINCOMPAT_LARGEDIRINCOMPAT_CSUM_SEED INCOMPAT_DIRDATA ? INCOMPAT_EA_INODE INCOMPAT_FLEX_BG INCOMPAT_MMPINCOMPAT_64BITINCOMPAT_EXTENTSINCOMPAT_META_BGINCOMPAT_USES_JOURNALINCOMPAT_REPLAY_JOURNALINCOMPAT_FTYPEINCOMPAT_COMPext2fs: unsupported incompat features: %s ROCOMPAT_PROJECT ROCOMPAT_READONLY ? ROCOMPAT_METADATA_CKSUM ROCOMPAT_BIGALLOC ROCOMPAT_QUOTA?ROCOMPAT_EXTRA_ISIZEROCOMPAT_DIR_NLINKROCOMPAT_GDT_CSUMROCOMPAT_HUGE_FILEROCOMPAT_BTREE_DIRROCOMPAT_LARGEFILEROCOMPAT_SPARSESUPERext2fs: unsupported ro-incompat features: %s ext2fs: bad inode size ext2fs_statvfsext2fs: inode %llu bad extra_isize %umode = 0%o, nlinks %d, inum = %llu, fs = %s ext2fs_valloc: dup allocext2fs_reload: dirty1ext2fs_reload: dirty2%s: file system not clean; please fsck(8) update: rofs modext2fs_mkdir: blksize%s%.*suser.system.posix_acl_accesssystem.posix_acl_defaulttrusted.securitysystem.system.richacl%s: map corrupted: start=%d, len=%d, fs = %s, offset=%d/%ld, cg %d%s: block not in map: bno=%d, fs=%s%s: map corrupted: cg=%d, irotor=%d, fs=%s%s: block not in map: fs=%suid %d, pid %d, command %s, on %s: %s %s: bad size: dev = 0x%llx, bno = %lld bsize = %d, size = %ld, fs = %s%s: bad block %lld, ino %llu ifree: dev = 0x%llx, ino = %llu, fs = %s %s: freeing free block: dev = 0x%llx, block = %lld, fs = %s%s: freeing free frag: dev = 0x%llx, block = %lld, fs = %sffs: failed to begin wapbl transaction for discard: %d trimwqtrimwqcv%s: bad bprev: dev = 0x%llx, bsize = %d, bprev = %lld, fs = %s%s: bad blockno %#llx != %#llx%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE %s: bad optim: dev = 0x%llx, optim = %d, fs = %sffs_realloccg: dealloc registration failed%s: range: dev = 0x%llx, ino = %llu, fs = %sffs_balloc: blk too bigspec nodes went hereffs_indirtrunc: bad buffer sizeffs_truncate: partial trunc of extdataitrunc: newspaceindiracct: missing indirindiracct: botched paramssnapacct: bad blockffs_snapshot: lost direct blockffs_snapshot: lost indirect blockffs_snapshot: list too smallffs_snapshot: %llu already on listsnapblkfree: inconsistent block typeffs_snapshot_mount: vget failed %d ffs_snapshot_mount: non-snapshot inode %d ffs_snapshot_mount: read_1 failed %d ffs_snapshot_mount: read_2 failed %d ffs_snapshot_mount: %llu already on list%s: unknown fs_fragshift %d%s: ACLs requested but not supported by this fs WARNING: %s: POSIX.1e ACLs flag on fs but no ACLs support WARNING: %s: NFSv4 ACLs flag on fs but no ACLs support %s: "posix1eacls" and "nfsv4acls" options are mutually exclusive ffs_modcmd: can't listen on system scope. Berkeley Fast File SystemffsdoclusterreaddoclusterwritedoreallocblksLog changes in optimization strategylog_changeoptffsinoffsdino1ffsdino2appleufs%s: dup alloc ino=%lld on %s: mode %o/%o gen %x/%x size %llx blocks %llx%s: ino=%lld on %s: gen %x/%x has non zero blocks %llx or size %llx %s: dirty filesystem?, not mounting%s: dirty1%s: unknown ufs flags: 0x%08x%s %s: dirty2%s: replaying log to disk %s: replaying log to memory %s: options QUOTA2 not enabled%s %s: log corrupted; replay cancelled %s: file system not clean (fs_clean=%#x); please fsck(8) %s: `-o softdep' is no longer supported, consider `-o log' %s: rofs mod, fs=%sufs,wapbl%s: %s: file size (%lld) non zero %s: %s: ufs_getlbns failed, error %d! %s: %s: unexpected numlevels %d from ufs_getlbns %s: %s: cylinder group size of %lld MB is not big enough for journal %s: %s: log not allocated, largest extent is %lldMB %s: %s: GOP_ALLOC error %d %s: %s: unknown journal type %d %s: %s: unable to cleanup inode %u %s: %s: vget failed %d %s: %s: try to clear non-log inode %lld %s: %s: fs superblock in old format, not journaling %s: %s: disabling discard to preserve log consistency mfs_initminiroot() called more than once%s: unlinked ino %lld on "%s" has non zero size %llx or blocks %llx with allerror %d %s: bad dir ino %ju at offset %d: %s not roundedmissing NUL in namenull entry%s: too big%s: nospace%s: newblkufsdirufs_whiteout: unknown opufs_strategy: spectag VT_UFS, ino %llu, on dev %llu, %llu flags 0x%x, nlink %d mode 0%o, owner %d, group %d, size %qdinvalid uio rw: %damapplcownowcownowpageamapswpoanonpllkloanpguvm_anon_pageinuao_getuao_getpageuaoeltpluao_put: strange, got an out of range flush %#jx > %#jx (fixed) uao_putuao_detubchashubc object hashubc_allocubc_faultubc_init: failed to allocate ubc_mapubc_init: failed to map ubc_objectudv_detachudv_attachflt_noram5flt_pmfail2flt_pmfail1anonget1anonget2flt_noram1fltamapcopyfltagain1flt_noram2pgo_faultfltagain2flt_noram4uvm_fault_unwire_locked: address not in mapuareauvmuvm_init: page size not setuvmfaultuvm_km_bootstrap: could not reserve space for kerneluvm_km_bootstrap: could not reserve kernel kmem%s: unable to allocate space in parent mapuvm_km_suballoc: submap allocation failedkm_pgrmkm_getwait2plpglivelockloanagainloanzeroloanuopgProcess vm informationDisable VA 0user_va0_disablefirst_free %p should be %p stale first_free stale hint (last)%d/%d gap %#lx != %#lx %s too large gap %zu nentries: %d vs %d maxgap %#lx != %#lx corrupt: 0x%lxx >= 0x%lxx lookup: %d: %p->prev=%p: %p lookup: %d: %p->next=%p: %p lookup: %d: %p - %p: %p vmmpeplvm_map%s: kernel object %p %p uvm_voaddr_release: bad type (first_free)MAP %p: [%#lx->%#lx] #ent=%d, sz=%d, ref=%d, version=%d, flags=%#x pmap=%p(resident=%ld, wired=%ld) - %p: %#lx->%#lx: obj=%p/%#llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d%s %p is %p+%zu from VMMAP %p Simple system-wide virtual memory statisticsvmmeterSystem load average historyDetailed system-wide virtual memory statisticsDetailed system-wide virtual memory statistics (MI)uvmexp2Maximum process sleep time before being swappedmaxslpNumber of bytes allocated for a kernel stackuspaceMinimum user addressminaddressMaximum user addressmaxaddressGuard size of main threadGuard size of other threadsthread_guard_sizeuobjwirepgOBJECT %p: locked=%d, pgops=%p, npages=%d, refs= refs=%d PAGES : <%p,0x%llx> uvm_page_numa_lookup: failed, first pg=%p pa=%#lx uvm_setpagesize: page size %u (%#x) not a power of twouvm_page_physget: called _after_ bootstrapuvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocatedUVM: using NUMA allocation scheme UVM: using package allocation scheme, %d package(s) per bucket uvm_pagealloc_strat: bad strat %dPAGE %p: flags=%s pqflags=%s uobject=%p, uanon=%p, offset=0x%llx loan_count=%d wire_count=%d bucket=%d freelist=%d pa=0x%lx [page ownership tracking disabled] checking pageq list >>> ANON DOES NOT POINT HERE <<< (%p) anon backpointer is OK checking object list page found on object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< page found on pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< UANONUOBJECTPQFLAGPAGE%18s %4s %4s %18s %18s %18p %04x %08x %18p %18pThere are %d freelists with %d buckets of %d colors. freelist(%d) @ %p bucket(%d) @ %p, nfree = %d, lock @ %p: color(%d) @ %p, first page = %p emergvapager_mapuvmpdlmtout of memory before the pagedaemon thread existspagedaemon: deadlock detected! fork pooldrainpgdaemonPercentage of physical memory reserved for anonymous application dataanonminPercentage of physical memory reserved for cached file datafileminPercentage of physical memory reserved for cached executable dataexecminPercentage of physical memory which will be reclaimed from other usage for anonymous application dataanonmaxPercentage of physical memory which will be reclaimed from other usage for cached file datafilemaxPercentage of physical memory which will be reclaimed from other usage for cached executable dataexecmaxPercentage of inactive queue of the entire (active + inactive) queueinactivepctpdpolicyreactanonreactfilereactexecpglac2pglallocTried to add RAM after uvm_page_inituvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX Boot time slabHotplug slab%s: unload attempted after uvm_page_init() uvm_page_physload: bad free list %duvm_page_physload: start[%lx] >= end[%lx]uvm_physseg_plug() failed at boot.%s: Tried to unplug from unknown offset %s: Tried to unplug oversized span %s: can't unplug() from the middle of a segment without UVM_HOTPLUG Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d, ncolors=%d %d VM pages: %d active, %d inactive, %d wired, %d free pages %lld anon, %lld file, %lld exec freemin=%d, free-target=%d, wired-max=%d resv-pg=%d, resv-kernel=%d bootpages=%d, poolpages=%d faults=%lld, traps=%lld, intrs=%lld, ctxswitch=%lld softint=%lld, syscalls=%lld fault counts: noram=%lld, noanon=%lld, pgwait=%lld, pgrele=%lld ok relocks(total)=%lld(%lld), anget(retrys)=%lld(%lld), amapcopy=%lld neighbor anon/obj pg=%lld/%lld, gets(lock/unlock)=%lld/%lld cases: anon=%lld, anoncow=%lld, obj=%lld, prcopy=%lld, przero=%lld daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, swpgavail=%d swpages=%d, swpginuse=%d, swpgonly=%d, paging=%d %s: swapdev not in listEncrypt data when swapped out to diskswap_encrypt%s: vnode type 0x%x%s: swap to sparse file%s: can't get vnode for swap device%s: can't lock swap device%s: can't open swap deviceswapmap%s: vmem_create failedswp vnxswp vndswapctl: miniroot copy failedswapctl: copystrswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap swapdrum_addswapiod%s: workqueue_create failedturning off swap...stopping swap on %s failed with error %d uvnfp1uvnfp2copy-cred-on-forkbufq_disksortbufq_priocscanNetBSD-CORE%s@%dELFexec_elf32#!exec_scriptvmcmdkillsextends/dev/consolewarning: no /dev/console warning: lookup /dev/console: error %d init: couldn't allocate argument spaceinit path (default %s)haltuse absolute path, "ddb", "halt", or "reboot" /sbin/initinit: trying %s exec %s: error %d copyout %dDetecting hardware...fork initcannot mount root, error = %d fork pagedaemonioflushfork syncer%s %s (%s)total memory = %s avail memory = %s /sbin/oinit/sbin/init.bak/rescue/initMaximum number of vnodesmaxvnodesMaximum number of simultaneous processesmaxprocMaximum number of open filesmaxfilesMaximum number of bytes of arguments to execve(2)argmaxSystem host ID numberhostidSystem vnode tableProfiling information (not available)profilingVersion of ISO/IEC 9945 (POSIX 1003.1) with which the operating system attempts to complyposix1versionMaximum number of supplemental groupsngroupsWhether job control is availablejob_controlWhether POSIX saved set-group/user ID is availablesaved_idsFlags from boot loaderboothowtoMaximum number of partitions allowed per diskmaxpartitionstimexOffset of real time clock from UTC in minutesrtc_offsetName of the root deviceWhether the POSIX 1003.1b File Synchronization Option is available on this systemSysV IPC optionsipcSystem V style message support availablesysvmsgSystem V style semaphore support availablesysvsemSystem V style shared memory support availablesysvshmWhether the POSIX 1003.1b Synchronized I/O Option is available on this systemsynchronized_ioMaximum number of iovec structures per processiov_maxWhether the POSIX 1003.1b Memory Mapped Files Option is available on this systemmapped_filesWhether the POSIX 1003.1b Process Memory Locking Option is available on this systemmemlockWhether the POSIX 1003.1b Range Memory Locking Option is available on this systemmemlock_rangeWhether the POSIX 1003.1b Memory Protection Option is available on this systemmemory_protectionMaximum login name lengthlogin_name_maxDefault core file namedefcorenameLog process exit when caused by signalslogsigexitKernel fixed-point scale factorScheduler exponential decay valueccpuClock ticks spent in different CPU statescp_timeConsole deviceconsdevMaximum number of pseudo-ttysMaximum raw I/O transfer sizemaxphysImplementation version of the POSIX 1003.1b Monotonic Clock Optionmonotonic_clockSector number containing the disklabellabelsectorOffset of the disklabel within the sectorlabeloffsetdisklabel is inside MBR partitionlabelusesmbrSystem-wide LWP informationMilliseconds to sleep on fork failure due to process limitsforkfsleepVersion of IEEE Std 1003.1 and its Threads option to which the system attempts to conformposix_threadsVersion of IEEE Std 1003.1 and its Semaphores option to which the system attempts to conformposix_semaphoresVersion of IEEE Std 1003.1 and its Barriers option to which the system attempts to conformposix_barriersVersion of IEEE Std 1003.1 and its Timers option to which the system attempts to conformposix_timersVersion of IEEE Std 1003.1 and its Spin Locks option to which the system attempts to conformposix_spin_locksVersion of IEEE Std 1003.1 and its Read-Write Locks option to which the system attempts to conformposix_reader_writer_locksPerform a crash dump on system panicdump_on_panicRoot partition on the root deviceroot_partitionList of all drivers with block and character device numbersdriversMapping of CPU number to CPU idcp_idCoredump settings.coredumpSet-id processes' coredump settings.setidAllow set-id processes to dump core.Path pattern for set-id coredumps.Owner id for set-id processes' cores.ownerGroup id for set-id processes' cores.Mode for set-id processes' cores.0 if the kernel supports SA, otherwise it doesn'tno_sa_supportName of config fileconfignameInformation from build environmentbuildinfoKernel message verbosityBytes of non-kernel memoryusermemConsole magic key sequencecnmagicusermem64Operating system typeostypeOperating system releaseosreleaseOperating system revisionosrevisionKernel versionSystem hostnameYP domain namedomainnameRaw partition of a diskrawpartitionMachine modelMachine classMachine CPU classmachine_archNumber of CPUs configuredSystem byte orderbyteorderBytes of physical memorySoftware page sizeAlignment constraint for all possible data typesalignbytesphysmem64Number of CPUs onlinencpuonlineHigh kernelkernVirtual memoryFilesystemNetworkingDebuggingGeneric CPU, I/OMachine dependentUser-levelIn-kernel debuggerPer-processVendor specificvendorEmulation settingsemulSecurityAccounting resumed Accounting suspended Accounting started Accounting terminated actwatacctwatchAccounting: write failed %d kcredplorg.netbsd.kauth.credorg.netbsd.kauth.genericorg.netbsd.kauth.processorg.netbsd.kauth.networkorg.netbsd.kauth.machdeporg.netbsd.kauth.vnodehardscheddivKernel clock ratesclockrateNumber of hardclock tickshardclock_tickshardclockstatclockclockinterruptpid %d (%s): %s write of %zu@%p at %lld failed: %d Too many CPUs. Increase MAXCPUS?cpu%dincrease kern.maxfiles or MAXFILESfiledescSystem open file tablefile2dup2entropy: ready entropy: best effort cpu0entropy intrdropentropy intrtruncWARNING: consolidating less than full entropy entropyentropy: pid %d (%s) waiting for entropy(7) WARNING: system needs entropy for security; see entropy(7) entropy: invalid seed length: %zu, expected sizeof(rndsave_t) = %zu entropy: invalid seed checksum entropy: double-seeded by bootloader entropy: entering seed from bootloader with %u bits of entropy entropy pool crypto self-test failedEntropy (random number sources) optionsAutomatically collect entropy from hardwarecollection`Deplete' entropy pool when observeddepletionTrigger entropy consolidation nowconsolidateTrigger entropy gathering from sources nowgatherSystemwide entropy deficit (bits of entropy)Number of bits of entropy pending on CPUsSystemwide entropy deficit (samples)samplesneededNumber of samples pending on CPUssamplespendingEntropy epochentsrclockentropy: no seed from bootloader unable to establish entropy softintentbutlerunable to create entropy housekeeping thread: %dnotifydepleteextract failimmediatediscretionaryfilt_usertouch() - invalid type (%ld)%s: invalid type (%ld)kqueue %p (restart=%d count=%u): Queued knotes: ACTIVEQUEUEDDISABLEDDETACHEDMARKERBUSYWILLDETACH knote %p: kq=%p status=%s id=0x%lx (%lu) filter=%d !!! kn->kn_kq != kq !!! count(%u) != KQ_COUNT(%u) EVFILT_READEVFILT_WRITEEVFILT_AIOEVFILT_VNODEEVFILT_PROCEVFILT_SIGNALEVFILT_TIMEREVFILT_FSEVFILT_USEREVFILT_EMPTY*fexecve*execargsshould not happensigcode kernel mapping failed %d pspawnlwpwaitnetbsdinit died (signal %d, exit %d)orphaned traced processexit1increase kern.maxproc or NPROCforkmxforkulimidle/%ucreate_idle_lwp: error %d%s: WARNING: powerhook_establish is deprecated dopowerhooks %s: %s (%p) dopowerhooks: %s done softresumesoftsuspendsoftstandbykthrwaitunnamedWARNING: kthread `%s' (%d) exits with status %d kthread_exit.note.netbsd.ident.symtab.strtab.shstrtab.bss.SUNW_ctfkern_ksyms: ERROR %d > %d, increase KSYMS_MAX_ID *ABS*gcc2_compiled.addsymtabksyms[ Kernel symbol table missing! ] [ Kernel symbol table has bad start address %p ] [ Kernel symbol table invalid! ] %s%c curcpu holds : %18d wanted by: %#018lx pserialize%s: %s caller=%pKernel locklwpplMaximum number of simultaneous threadsmaxlwpsigwaitvfork(zombie)lwp_exitswapperlink_set_evcntsWARNING: module error: Built-in module `%s' can't find built-in dependency `%s'Built-in module `%s' prerequisite `%s' failed, error %dBuilt-in module `%s' failed its MODULE_CMD_INIT, error %dlink_set_modules`link_set_modules' section not present, error %d`link_set_modules' section wrong size (%zu different MODULE declarations?)`link_set_modules' section wrong size (got %zu, wanted %zu)DEBUG: module: TRUEFALSEUnload requested for `%s' (requires_force %s)Module `%s' not foundModule `%s' busy (%d refs)Cannot unload built-in secmodel module `%s'Could not unload module `%s' error=%dUnloaded module `%s'Requesting autounload for`%s'Module `%s' declined to be auto-unloaded error=%d%s: builtin module "%s" init failed: %dmod_unld/stand/%s/%s/modulesBuilt-in `%s' failed: %d Module optionsEnable automatic load of modulesEnable automatic unload of unaudited modulesautounload_unsafeEnable verbose outputDefault module load pathAuto-unload delayautotimemodunload%s: %dModule `%s' pushed by boot loader already existsDuplicate bootlist entry for module `%s'Unable to load `%s' pushed by boot loader, error %dUnable to fetch_info for `%s' pushed by boot loader, error %dDependentUse -f to reinstate builtin module `%s'module_do_builtin() returned %d%s module `%s' already loadedOut of memory for `%s'module_load_vfs_vec() failed for `%s', error %dCannot fetch info for `%s', error %dModule name `%s' longer than %dModule `%s' has invalid class %dModule `%s' built for `%d', system `%d'Forced load, system may be unstableIncompatible module class %d for `%s' (wanted %d)Dependency name mismatch (`%s' != `%s')Module with name `%s' already loadedCircular dependency detected for `%s'Required module name `%s' longer than %dSelf-dependency detected for `%s'Recursive load failed for `%s' (`%s' required), error %dUnable to affix module `%s', error %dModule properties failed for %slink_set_sysctl_funcsmodcmd(CMD_INIT) failed for `%s', error %dRecursive load causes duplicate module `%s'Module `%s' loaded successfullyLoad failed, error %dAutoload for `%s' requested by pid %d (%s)Autoload disabled for `%s' Autoload illegal path for `%s' Autoload not authorized for `%s' Autoload for `%s' status %d%p is %p+%zu, in kernel module `%s' SOURCESIZETEXT/DATA%16s %16s %8s %8s %16s %16lx %8ld %8s builtinfilesysmod_hookLoading module from %s%s/%s/%s.kmodCannot %sload kernel object `%s' error=%d.plistplist load returned error %d for `%s'Loading plist from %snoautoloadautoloading is disallowed for `%s'kern.module.path=%s owner field : %#018lx wait/spin: %16d/%d locking against myselfMutexfileassoc_table_resize: inconsistency detected! needed %zu entries, got %zuphysiodphysioDevices without power management support:%s: %s is suspended by %s (delegator %s) pmf controlspmfdebug levelssuspensortransition%s: %s-suspended by %s (delegator %s) already %s: %s assumes %s-suspension by %s (delegator %s) %s: newly %s-suspended by %s (delegator %s) %s: %s suspension %s (delegator %s) removed by %s resume failed Powering devices:(failed)Shutting down devices: shutting down %s, skipped.failed.success.%s-self%s: suspend enter %s: class suspend %s: driver suspend %s: bus suspend %s: suspend exit Flushing disk caches: giving up Suspending devices:%s: resume enter %s: bus resume %s: driver resume %s: class resume %s: resume exit Resuming devices:%s: PMF event %d dropped (no memory) %s: PMF event %d injected Input idle handler called pewplpmfeventcouldn't create pmfevent workqueuepmfsuspendcouldn't create pmfsuspend workqueuefailed to reserve PID 1 for init(8)procplEnable exposing kernel addressesexpose_addressSystem-wide process informationMachine-independent process informationproc2Process argument informationproc_argspid table %p size %x, next %x, last %x id %x: slotpid %d proc %p id %d (0x%x) %s next %x use %x session %p, sid %d, count %d, login %s pgrp %p, pg_id %d, pg_jobc %d, members %p pid %d addr %p pgrp %p %s %s (pid %d) changing logname from %.*s to %s Per-process settingscurprocProcess PAX control flagspaxflagsCore file nameProcess limitsrlimitProcess cputime limitscputimeProcess soft cputime limitsoftProcess hard cputime limithardProcess filesize limitsfilesizeProcess soft filesize limitProcess hard filesize limitProcess datasize limitsdatasizeProcess soft datasize limitProcess hard datasize limitProcess stacksize limitsstacksizeProcess soft stacksize limitProcess hard stacksize limitProcess coredumpsize limitscoredumpsizeProcess soft coredumpsize limitProcess hard coredumpsize limitProcess memoryuse limitsProcess soft memoryuse limitProcess hard memoryuse limitProcess memorylocked limitsmemorylockedProcess soft memorylocked limitProcess hard memorylocked limitProcess maxproc limitsProcess soft maxproc limitProcess hard maxproc limitProcess descriptors limitsdescriptorsProcess soft descriptors limitProcess hard descriptors limitProcess sbsize limitssbsizeProcess soft sbsize limitProcess hard sbsize limitProcess vmemoryuse limitsvmemoryuseProcess soft vmemoryuse limitProcess hard vmemoryuse limitProcess maxlwp limitsProcess soft maxlwp limitProcess hard maxlwp limitStop process at fork(2)stopforkStop process at execve(2)stopexecStop process before completing exitstopexitScheduler optionsCache hotness time (in ms)cacheht_timeRate limit for stealing from other CPUs (in ms)skim_intervalMinimal count of threads for catchingmin_catchTrack CPU time for soft interruptstimesoftintsMinimum priority to trigger kernel preemptionkpreempt_prisched_enqueue: LWP %p has class %d RQSQRun-queue (CPU = %u): pid.lid = %d.%d, r_count = %u, maxpri = %d, mlwp = %p bitmap[%d] => [ %d (0x%x) ] LRTICKSTCILWPFLEPRI %5s %4s %4s %10s %3s %18s %4s %4s %s /- %d (%s) | %5d %4u %4u 0x%8.8x %3s %18p %4u %4d %u owner/count : %#018lx flags : %#018x Reader / writer lock%s: raising ipl to %d %s: raised ipl to %d, s=%d %s:%d: invoking "%s" (%s) crashme on %s failed! crashme plain old panic%s: locked once %s: locked twice %s: initialized %s: disabled kpreemption Crashme options%s: failed to create sysctl debug.crashme: %d Enable crashmecrashme_enable%s: failed to create sysctl debug.crashme_enable: %d %s: failed to create sysctl debug.crashme.%s %s: unable to remove %s from sysctl null_derefnull dereferencenull_jumpjump to nullenter ddb directlymutex_recursionenter the same mutex twicespl_spinoutinfinite loop at raised splkpreempt_spinoutinfinite loop with kpreempt disabledsigactsksiginfotrapsignaleventswitchsorry, pid %d was killed: %s sigexit 1sigexit 2sendsig: bad version %d proc_stoptraceWARNING: softint_establish: table full, increase softint_bytes soft%s/%usoftint_init_isr: error %d%s block/%usoftint_init_cpu: cannot allocate memorybioclksoftint_picklwpwedge:NAME=parsediskuse one of: %s[a-%c] none ddb halt reboot %s%lluswap dumps on %smd0 (default %sdump device (default %sb)file system (default %s): use one of: genericroot on %scan't determine root device unknown device major 0x%llx device %s (0x%llx) not configured sched_unsleeplboltdefer: critical sectionkpreemptdefer: kernel_lockWARNING: lwp %ld (%s%s%s) flags 0x%x: timecounter went backwards from (%jd + 0x%016llx/2^64) sec to (%jd + 0x%016llx/2^64) sec in %s setrunnable: lwp %p state was %dWARNING: lwp %ld (%s%s%s): negative runtime: (%jd + 0x%016llx/2^64) sec WARNING: pid %ld (%s): negative runtime; monotonic clock has gone backwards exceeded RLIMIT_CPUpid %d, command %s, is killed: %s /usr/src/sys/kern/kern_sysctl.cp->sysctl_child == NULLsysctl_create: rnode %p wrong version sysctl_create: attempt to add node to aliased node %p sysctl_destroy: rnode %p wrong version %s: rnode %p wrong version sysctl_query: rnode %p wrong version sysctl_locate: pnode %p wrong version sysctl_dispatch: rnode %p wrong version sysctl_mmap: rnode %p wrong version sysctl_createv: rnode NULL sysctl_createv: sysctl_locate(%s) returned %d sysctl: log %p root mismatch (%p) sysctl_create succeeded but node not found?! sysctl_createv: sysctl_create(%s) returned %d sysctl_free: rnode %p wrong version root %p left %d size %d content version %d type %d len %d: end !!SYSCTL_NEEDFUNC!! time counter informationtimecounteravailable counterschoicecurrently active time counterlog time stepstimestepwarnings%s%s(q=%d, f=%lld Hz)timecounter: Timecounter "%s" frequency %ju Hz -- Insufficient hz, needs at least %u timecounter: Timecounter "%s" frequency %ju Hz quality %d tcdetachTime stepped from %lld.%09ld to %lld.%09ld timecounter: Timecounters tick every %d.%03u msec dummythreadpool subsystem optionsthreadpoolidle thread timeout in msidle_msthreadpool job %p ran after destructionpooljobpoolthread%sthrdplcrpooldisppooldisp%sthplthrddeadjobnanoslppid %d attempted to set the (obsolete) kernel time zone %9d %2d/%-4d %16lx %s callout_init_cpu (2)late/%uwait/%uhardclock_ticks now: %d ticks wheel arg func turnstile_unsleepdevice-is-system-todrdisabled (not system TODR) todr_attach: TOD already configured WARNING: preposterous time in file system %s: cannot enable TODR writes %s: WARNING: cannot disable TODR writes WARNING: preposterous TOD clock time WARNING: no TOD clock present WARNING: clock lost %lld days WARNING: clock gained %lld days WARNING: using default initial time WARNING: using filesystem time WARNING: CHECK AND RESET THE DATE! Cannot set TOD clock time WARNING: Cannot set TOD clock time (busy) uihashuser info (uid->used proc) hashResource usage per uiduidinfoNumber of processes for the current userproccntNumber of lwps for the current userlwpcntNumber of locks for the current userlockcntNumber of semaphores used for the current usersemcntSocket buffers used for the current user%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02xRound-robin time quantum (in milliseconds)rtts%s: invalid tag (%u) acl_posix1e_mode_to_entry: invalid tag (%d) acl_posix1e_acl_to_mode: bad ae_tagacl_posix1e_acl_to_mode: missing base ae_tagsconfigure: `%s' driver %s failed: %dconfigure: attachment `%s' of `%s' driver %s failed: %d%s with registered handlerscfargs_canonicalize: unknown version %lu cfargs_canonicalize: submatch and search are mutually-exclusivedevice-attachdevice-detachev: %s %s at %s in [%s] cfgmiscautoconfDetach all devices at shutdowndetachallconfigintrconfigroot%s: thread %x joined with error %d config_devalloc: device name too longpmfsuspdevice-driverdevice-unitdevice-parentattribute-nameloc-namelocatorsinterface-attributesconfig_defer: can't defer config of a root deviceWARNING: power management not supported waiting for devices: done. WARNING: %d error%s while detecting hardware; check system log. config_attach: allocation of device softc failedFound %s (root)device-registerconfig_detach: forced detach of %s failed (%d)root device %s not configured detaching %s, unable to detach instance init rollbackfiniconfig_cfdata fini rollback failedfini rollbackblist_meta_alloc: allocation too largeblist_meta_fill: allocation too largeblst_meta_fill: filling unexpected rangeblst_radix_free: freeing free blockblst_meta_free: freeing already free blocks (%llu) %llu/%llublst_meta_free: freeing unexpected rangebuffer queue subtreebufqList of bufq strategies presentstrategiesbufq_alloc: sort out of rangebufq_bufq_alloc: no strategycallbacknist_hash_drbg_instantiatecprng_strong reseednist_hash_drbg_destroynist_hash_drbg_reseedNIST Hash_DRBG failed self-testIndependent uniform random 32-bit integerurandomIndependent uniform random bytes, up to 256 bytesarandomnist_hash_drbg_generatecpu_topology_init: asymmetric & SMT?? pkg1st%s has %d %s siblings:%s first in package: %s GAVE UPureadc: non-positive residureadc: non-positive iovcntdevice-get-propertydevice-enumerate-children%s: block majors exhausted %s: character majors exhausted writ%s%d%c: %s %sing fsbn %lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)no raw partition and disk reports bad geometryno raw partition and partition table is fullsectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectordisk-info%s: can't alloc vnode for %s%s: can't open dev %s (%d) %s%d%cKernel evcnt informationevcnt,%d/dev/nullset{u,g}id pid %d (%s) was invoked by uid %d ppid %d (%s) with fd %s closed extent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags = 0x%x 0x%lx - 0x%lx extent_free: start 0x%lx, end 0x%lx extent_free: region not foundhashdone: invalid table typekernel hash statisticshashstat KMGTPE kMGTPE%qu%s%c%sInterrupt optionsintrctl listset affinityset intrset nointrList of disk drives presentdisknamesI/O stats are being collected for these devicesiostatnamesStatistics on device I/O operationsiostatsiostat_free: iostat_count == 0ipiWARNING: ipi_register: table full, increase IPI_MAXREG kcpuset(9): all early-use entries exhausted; increase KC_SAVE_NITEMS kmem-02048kmem-04096kmem-08192kmem-16384kmem-00008kmem-00016kmem-00024kmem-00032kmem-00040kmem-00048kmem-00056kmem-00064kmem-00080kmem-00096kmem-00112kmem-00128kmem-00160kmem-00192kmem-00224kmem-00256kmem-00320kmem-00384kmem-00448kmem-00512kmem-00768kmem-01024not modularWARNING: lock print is unreliable without LOCKDEBUG %s: possible owner: %p, bits: 0x%x Sorry, kernel not built with the LOCKDEBUG option. %s error: %s,%zu: %s lock address : %s current cpu : %18d current lwp : %#018lx lock error: %s: %s,%zu: %s: lock %p cpu %d lwp %pklogSize of the kernel message buffermsgbufsizeKernel message bufferrunoncepercpupool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) Get pool statistics%s: [%s] %u >= %u page %p, nmissing %d, time %u %s: [%s] item %p not part of pool%s: [%s] item %p below item space%s: [%s] item %p poolid %u != %u%s: [%s] ph %p poolid %u != %upool item size %zu too large, use a custom allocator%s: [%s] too large itemsperpage(%d) for PR_USEBMAPpoolbusyphpool-%dpcgnormalpcglargepcachecpu%s: [%s] page empty%s: [%s] page header missing%s: [%s] %p already freedMust specify a pool to print. POOLCACHEPOOL %s:%p:%u:%u:%u:%u:%u:%u:%u:%u:%u:%u:%zu %s: itemsize %u, totalmem %zu align %u, ioff %u, roflags 0x%08x pool %p, alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p cpu layer hits %llu misses %llu cache layer hits %llu misses %llu cache layer full groups %u full cache groups: group %p: avail %d %p, 0x%llx %p cached by CPU %u%p is %p+%zu in POOL '%s' (%s) (null)[% 4jd.%.*ld] %s: table is full - %s %s: table is full Skipping crash dump on recursive panic panic: autoconfiguration error: mismatching pserialize_read_exit()exclusive accessspecificdata_domain_delete: not implementedspecificdata_setspecific*FOUND**UNKNOWN*-- more -- 0%oUnknown devno (max is %d) [%3d] at %s%d %s? ???change (y/n) ?] ? No default Unknown argument %s [Error unknown state Unknown command, try help Argument expected 8|10|16 expected Attr, DevNo or Dev expected command args description [count] number of lines before more8|10|16 base on large numbersdevno|dev change devicesdevno|dev disable devicesdevno|dev enable devicesdevno|dev find devices this message list configuration leave userconf don't knowUnknown command userconf: configure system autoconfiguration: Continuing... uc> basechangefindBOGUS %p: %llu, %llu, %d(%s) vmem %p '%s' freelist[%d] btalloc%s-%zuvmem-vavmem-metavmembtvmem_sizevmem_rehash%s: workqueue_create %d %p is %p+%zu in VMEM '%s' (%s) static spanstatic_bt_inusestatic_bt_countInvalid IPL: %dxclowxchighunicastcrosscallxcallxcall/%uaio_jobs_poolaio_lio_poolVersion of IEEE Std 1003.1 and its Asynchronous I/O option to which the system attempts to conformposix_aioMaximum number of asynchronous I/O operations in a single list I/O callaio_listio_maxMaximum number of asynchronous I/O operationsaio_maxaioserviceaio_%d_%zuaiodone%s: invalid operation code {%x}naio_process: invalid aiost state {%x} AIO: no current process context. AIO: not initialized (pid=%d). AIO: pid=%d AIO: global jobs=%u, proc jobs=%u AIO: sp{ total_threads=%zu active=%zu free=%zu pending=%zu processing=%lu hash_buckets=%zu mask=%#x } queue (%zu pending): op=%d err=%d state=%d uptr=%p completed=%d fd=%d off=%llu buf=%p nbytes=%zu lio=%p active threads (%zu): lwp=%p state=%d freelist=%d job: op=%d err=%d state=%d uptr=%p fd=%d off=%llu buf=%p nbytes=%zu file-group: fp=%p qlen=%zu free threads (%zu) aiocbp hash: buckets=%zu [%zu]: uptr=%p job=%pefdreadefdwriteeventfdfqabortfutexinvalid futex opWARNING: pid %jd (%s) lwp %jd: unmapped robust futex list head WARNING: pid %jd (%s) lwp %jd: exhausted robust futex limit sys_ioctl: _IO%s%s('%c', %lu, %lu) returned -1: pid=%d comm=%s memfdVersion of IEEE Std 1003.1 and its Message Passing option to which the system attempts to conformposix_msgMessage queue optionsMaximal number of message queue descriptors that process could openmq_open_maxMaximal priority of the messagemq_prio_maxMaximal allowed size of the messagemq_max_msgsizeDefault maximal message countmq_def_maxmsgMaximal allowed message countmq_max_maxmsgmqmsgplmqsendcvmqrecvcvGlobal list of the message queues: CurMsgMsgSzeMaxMsgRefFlagsPtrName%20s %10s %8s %8s %3s %4s %4s %4s %20s %10p %8x %8x %3u %6lu %6lu %6lu mqparkedptrace_commonProcessor-set optionspsetMaximal count of the processor-setspsets_maxList of active sets%d:1,%d:2Enable/disable direct select (for testing)direct_selectcompat_16Version of IEEE Std 1003.1 and its Process Scheduling option to which the system attempts to conformposix_schedMinimal POSIX real-time prioritypri_minMaximal POSIX real-time prioritypri_maxtfdreadtimerfdttyrub: would panic c = %d, val = %d not a controlling terminal no foreground process group empty foreground process group found only zombie processes load: %d.%02d cmd: %s %d [%#lx/%d%ld.%02ldu %ld.%02lds %d%% %ldkttypausettyrawttyrawfttycanttycanfttyoutttyoutfttyrefNumber of characters sent and received on ttystkstatTotal number of tty input charactersninTotal number of tty output charactersNumber of canonical tty input characterscanccNumber of raw tty input charactersrawccTTY input and output queue sizeqsizecompat_43ttyldisc_init: termios_discttyldisc_init: ntty_disctermiosnttytabletslipstriphdlcincrease kern.maxptys%s: Can't find pty slave in cdevsw%s: Can't find pty master in cdevswputc: required clalloc b_to_q: required clalloc Accept filtersaccfaccf_PF_LOCAL related settingsSOCK_STREAM settingsSOCK_SEQPACKET settingsseqpacketSOCK_DGRAM settingsdgramSOCK_STREAM protocol control block listSOCK_SEQPACKET protocol control block listSOCK_DGRAM protocol control block list%s: source too long, %d < %d bytesunix: inet: inet6: link: atalk: (unknown socket family %d)bad family %hhumbuf %p already freedmbuf control variablesmbuf base sizemsizembuf cluster sizemclbytesLimit on the number of mbuf clustersmbuf low water markmblowatmbuf cluster low water markmcllowatmbuf allocation statisticsLimit of nmbclustersnmbclusters_limitmbplmclplm_copydata: off %d, len %dm_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d)m_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d), len=%d (%d)MBUF(%d) %p EXTPKTHDREORPROTO1AUTHIPHDRDECRYPTEDLOOPNONE BCAST MCAST CANFASTFWD ANYCAST6 LINK0LINK1LINK2LINK3LINK4LINK5LINK6LINK7VLANTAGEXT_CLUSTEREXT_PAGESEXT_ROMAPEXT_RW data=%p, len=%d, type=%d, flags=%s data: owner=%p, next=%p, nextpkt=%p leadingspace=%u, trailingspace=%u, readonly=%u TCPv4UDPv4TCP_UDP_BADDATATCPv6UDPv6IPv4IPv4_BAD TSOv4 TSOv6BLANK NO_PSEUDOHDR pktlen=%d, rcvif=%p, csum_flags=%s, csum_data=0x%x, segsz=%u ext_refcnt=%u, ext_buf=%p, ext_size=%zd, ext_free=%p, ext_arg=%p pages:%s: len > MHLEN%s: off %d, len %d%s: m == NULL, off %d%s: m == NULL, len %d [!COPYALL]%s: no header (m = %p)offset %04d: %s: too short mbuf chain (%u < %u) %s: cannot read header ARP: AddressType = %u(ETHER) IEEE802) ARP: Protocol Address Format = %u ARP: Protocol Address Length = %u ARP: H/W Address Length = %u ARP: Operation = %u(REVREQUEST) REVREPLY) INVREQUEST) INVREPLY) Cannot parse. Cannot read payload ARP: Ether Src = %s ARP: IP Src = %s ARP: Ether Tgt = %s ARP: IP Tgt = %s ICMP: Type = %u(Echo Reply) Destination Unreachable) Source Quench) Redirect) Time Exceeded) ICMP: Code = %d ICMP6: Type = %u(Packet Too Big) Parameter Problem) Echo Request) MLD Listener Query) MLD Listener Report) MLD Listener Done) Router Solicitation) Router Advertizement) Neighbor Solicitation) Neighbor Advertizement) ICMP6: Code = %u TCP: Src = %u TCP: Dst = %u TCP: Seq. = %u TCP: Ack. = %u TCP: Header Length = %u TCP: Flags 0x%02x : FIN SYN RST PUSH URG ECE CWR TCP: Windows Size = %u TCP: checksum = 0x%04x TCP: Urgent Pointer = %u %s: cannot read TCP option TCP: OPTION: NOP TCP: OPTION: MSS = %d TCP: OPTION: wscale = %d TCP: OPTION: SACK OK TCP: OPTION: TIMESTAMP = %u, ECR = %u TCP: OPTION: unknown (%d, len = %d) UDP: Src = %u UDP: Dst = %u UDP: Length = %u IP: Version = %u IP: Header Length = %u IP: ToS = 0x%02x IP: Packet Length = %u IP: ID = %u IP: Offset = %u IP: Flag 0x%04x (reserved) IP: Flag 0x%04x (evil flag) IP: Flag 0x%04x (don't fragment) IP: Flag 0x%04x (more fragment) IP: TTL = %u IP: protocol = %u(%s) IP: checksum = 0x%04x IP: Src = %s IP: Dst = %s IPv6: Version = %u IPv6: Flow INFO = 0x%07x IPv6: Payload Length = %u IPv6: Next Header = %u(%s) IPv6: Hop Limit = %u IPv6: Src = %s IPv6: Dst = %s Cannot read option IPv6: Stripped Hop-by-Hop SPPP: Address = %d(ALLSTATIONS) SPPP: Protocol = %d(LCP) PAP) CHAP) IPCP) IPV6CP) IP) IPv6) MULTICAST) UNICAST) Keepalive) No parser for address %d, protocol %d %s: too short mbuf chain (%u, %u) PPPoE: Version = %u PPPoE: Type = %u PPPoE: Code = %u(PADIPADOPADSPPPoE: Session = 0x%04x PPPoE: Payload Length = %u No parser for PPPoE control frame. Unknown PPPoE code. ETHER: DST = %s ETHER: SRC = %s ETHER: TYPE = 0x%04x(VLAN) PPPoE) ARP) IPv4) No parser for AF %d IPv6 Hop-by-HopICMPIGMPTCPUDPESPAHICMP6unixpsemPOSIX optionsposixMaximal number of semaphoressemmaxCurrent number of semaphoresksemMaximum amount of kernel memory to be used for socket bufferssomaxkvaPrevent scaling of fixed socket bufferssofixedbufMaximum socket buffer sizesbmaxDefault socket optionssooptionssokvasopendfrbad initial sb_max value: %lusopendfreesoinit1 %dnetiosbappendaddrsbappendaddrchainsbappendcontrolsemi-panic: sbcompress sbdrop(%p,%d): cc=%lu%s: message too large %d could not acquire proc_lock mutex could not acquire fd_lock mutex could not acquire f_lock mutex socket %p: owner %s(pid=%d) INETINET6KEYROUTEIgnore empty sockets. use /v to print all. Don't search owner process. ---SOCKET %p: type %s Send Buffer Bytes: %d [bytes] Send Buffer mbufs: mbuf chain %p Total %d records, %d mbufs. Recv Buffer Usage: %d [bytes] Recv Buffer mbufs: mbsonamembcontrolmsghdrmbfreembdatambheadermbsoptsmbftablemboobdataunp_disconnect1uipc 1uipc 2unp_attachunp_connect1unp_threadDefault stream send spaceDefault stream recv spaceDefault datagram send spaceDefault datagram recv spaceFile descriptors in flightinflightFile descriptors deferred for closedeferredunpgcuipc_init %duipc_usrrequipc 4buf mem pool index %dbufhashbuffer hashforcing bufcache %d -> 5forcing bufcache %d -> 95needbufbufinit: cannot allocate submapbufplbioplbuf%ukbuf%ubKernel buffer cache informationPercentage of physical memory to use for buffer cachebufcacheAmount of kernel memory used by buffer cachebufmemMinimum amount of kernel memory to reserve for buffer cachebufmem_lowaterMaximum amount of kernel memory to use for buffer cachebufmem_hiwaterbufinit2: can't establish soft interruptbiolockbiowaitbiodone2 alreadyallocbuf: buffer larger than MAXBSIZE requestednamecachenamecache statisticsnamecache_statsncpurgename %.*s name not found parent %.*s dirhpldirhepldirhashcurrent dirhash memory usagememusedmaximum dirhash memory usagemaxmemdirhash_remove couldn't find entry in hash table vfs_op_descsoperation %s not listed in %s. vfs_opv_init: bad operationvfs_opv_init: operation vector without vop_defaultNon-specific vfs related informationList of file systems presentfstypesWhether "magic" symlinks are expandedmagiclinksFile timestamp precisiontimestamp_precisionlf_findoverlap: defaultchrooted pid %d uid %d (%s) detected outside of its chroot /../kernel_identruidrgidInvalid nameiop relookup: null namerelookup: lookup on dot-dotnamei_simple_convert_flags: bogus sflags %s: failed to start extattr: error = %d syncing disks... vfs_mountroot: root device unknownvfs_mountroot: rootdev set for DV_IFNET (0x%llx -> %llu,%llu)vfs_mountroot: rootdev not set for DV_DISKvfs_mountroot: can't get vnode for rootdevvfs_mountroot: can't open root device %s: inappropriate for root file system root file system type: %s WARNING: No file system modules have been loaded. Supported file systems:no file system for %s (dev 0x%llx)cannot find root vnode, error=%dmount: lost mountUnmounting fresh file system faileddanglingunmount: dangling vnodeforcefully %sunmounted %s on %s type %s unmount of %s failed with error %d unmounting done WARNING: some file systems would not unmount unmounting file systems... syncer optionsmax time to delay syncing datatime to delay syncing filesfiledelaytime to delay syncing directoriesdirdelaytime to delay syncing metadatametadelayinvalid specnode type: %dILLEGALUNKNOWNvnode %p flags %s %stag %s(%d) type %s(%d) mount %p typedata %p %susecount %d writecount %d holdcount %d %ssize %llx writesize %llx numoutput %d %sdata %p lock %p %sstate %s key(%p %zd)%slrulisthd %p VT_UFSVT_NFSVT_MFSVT_MSDOSFSVT_LFSVT_LOFSVT_FDESCVT_PORTALVT_NULLVT_UMAPVT_KERNFSVT_PROCFSVT_AFSVT_ISOFSVT_UNIONVT_ADOSFSVT_EXT2FSVT_CODAVT_FILECOREVT_NTFSVT_VFSVT_OVERLAYVT_SMBFSVT_PTYFSVT_TMPFSVT_UDFVT_SYSVBFSVT_PUFFSVT_HFSVT_EFSVT_ZFSVT_RUMPVT_NILFSVT_V7FSVT_CHFSVT_AUTOFSVNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADROOTSYSTEMISTTYMAPPEDMPSAFE TEXT EXECMAP WRMAP PAGESONWORKLSTDEADCHECKDIROPvflushbuf: not dirty, bp %pvflushbuf: dirty vp %p lblkno 0x%llx blkno 0x%llx rawblkno 0x%llx dev 0x%x error %d flags %s bufsize 0x%lx bcount 0x%lx resid 0x%lx data %p saveaddr %p iodone %p objlock %p clean bufs: bp %p dirty bufs: vnodecovered = %p data = %p fs_bshift %d dev_bshift = %d  MNT_SOFTDEPMNT_NODEVMTIMEMNT_SYMPERMMNT_EXPUBLICMNT_EXNORESPORTMNT_NOATIMEMNT_LOGMNT_EXTATTRMNT_DISCARDMNT_GETARGSMNT_NFS4ACLSMNT_IGNOREMNT_FORCEMNT_RELOADMNT_RELATIMEMNT_UPDATEMNT_NOCOREDUMPMNT_ROOTFSMNT_QUOTA MNT_LOCAL MNT_EXKERB|MNT_POSIX1EACLS MNT_EXPORTANON MNT_DEFEXPORTED MNT_EXPORTEDMNT_EXRDONLYMNT_ASYNCMNT_UNIONMNT_NODEVMNT_NOSUIDMNT_NOEXECMNT_SYNCHRONOUSMNT_RDONLY IMNT_ONWORKLIST IMNT_CAN_RWTORO IMNT_MPSAFEIMNT_SHRLOOKUPIMNT_DTYPEIMNT_NCLOOKUPIMNT_WANTRDONLYIMNT_WANTRDWRIMNT_UNMOUNTIMNT_GONEiflag = %s refcnt = %d updating @ %p statvfs cache: bsize = %lu frsize = %lu iosize = %lu blocks = %llu bfree = %llu bavail = %llu bresvd = %llu files = %llu ffree = %llu favail = %llu fresvd = %llu f_fsidx = { 0x%x, 0x%x } owner = %u namemax = %lu flag = %s syncwrites = %llu asyncwrites = %llu syncreads = %llu asyncreads = %llu fstypename = %s mntonname = %s mntfromname = %s locked vnodes = %p, %p,all vnodes =Locked vnodes ACTIVEMARKERLOADINGLOADEDBLOCKEDRECLAIMINGRECLAIMEDsymlink-target%s: failed to start extattr, error = %d%s: failed to stop extattr, error = %dsyncwaitfdescafsfstchgfstcntfstlwpFstrans locks by lwp: %-8s @%p alias gone - lazy shared %#x %d cow %d alias %d Fstrans state by mount: %-16s (null) owner %p state normal state suspending state suspended state %#x vcachevnode cache hashvnfull%s: cannot reclaimdead but not clean%s: bad ref countvcacheplvdrainvrele%s: holdcnt vp %p%s: cannot lock%s: neg numoutput, vp %p(mmap)vnWAPBL journaling optionsflush disk cacheflush_disk_cacheshow time and size of wapbl log commitsverbose_commitallow use of FUA/DPO instead of cache flush if availableallow_dpofuacount of bufs used for journal I/O (max async count)journal_iobufswapblentryplwapbldeallocwapbl_cache_sync: %s: dev 0x%jx %ju.%09lu wapbl_write_commit: error writing duplicate log header: %d%s: %lld.%09ld this transaction = %zu bytes wapbl_flush: current transaction too big to flushwapbl %p logvp = %p, devvp = %p, logpbn = %lld circ = %zu, header = %zu, head = %lld tail = %lld fs_dev_bshift = %d, log_dev_bshift = %d bufcount = %zu, bufbytes = %zu bcount = %zu reclaimable = %zu reserved = %zu errcnt = %d dealloccnt = %d, dealloclim = %d inohashcnt = %d, inohashmask = 0x%08x entries: bufcount = %zu, reclaimable = %zu, error = %d bufs =dealloced blks = %lld:%d,registered inodes = %llu/0%06o,iobufs free =iobufs busy =%s: forced dealloc registration over limit: %d >= %d wapblrecwapblinoplwapbl fsid 0x%x/0x%xjournal write totaljournal write finished asyncmetadata async writecache flushUnrecognized wapbl magic: 0x%08x Unrecognized wapbl type: 0x%08x wapbl_replay: corrupted records xattr-listsecurity.xattr-namexattr-valvop_setextattrvop_deleteextattrvop_openextattrvop_listextattrvop_getextattrvop_closeextattrvop_aclcheckvop_setaclvop_getaclvop_putpagesvop_getpagesvop_whiteoutvop_advlockvop_pathconfvop_islockedvop_printvop_strategyvop_bmapvop_unlockvop_lockvop_reclaimvop_inactivevop_abortopvop_readlinkvop_readdirvop_symlinkvop_rmdirvop_mkdirvop_renamevop_linkvop_removevop_seekvop_fsyncvop_mmapvop_revokevop_kqfiltervop_pollvop_fcntlvop_ioctlvop_fdiscardvop_fallocatevop_writevop_readvop_setattrvop_getattrvop_accessxvop_accessvop_closevop_openvop_mknodvop_createvop_lookupvop_parsepathvop_bwritedead fs operation useddeadtag VT_NON, dead vnode fifordfifowrtag VT_NON, fifo with %d readers and %d writers/usr/src/sys/miscfs/genfs/genfs_io.cgenput%s: bogus command %dgenfs: bad op%s: ACL_OTHER missing spec_fdiscard: not a device dev %llu, %llu spec_close: spurious pgrp refspec_close: not specialspec_ioctlinvalid specfs vnode type: %dspec_read typespec_write typespecioccd%dccdstopccdthrccdfictitious%s: error %d on component %d ccdiodone: countConCatenated Disk stateList of ccd unit numbersunitsInformation about a CCD unitInformation about CCD componentsdefault labelWARNING: %s: total sector size in disklabel (%ju) != the size of ccd (%ju) WARNING: %s: end of partition `%c' exceeds the size of ccd (%ju) %s: Interleaving %d component%s (%d block interleave) %s: Concatenating %d component%s %s: %s (%ju blocks) %s: total %ju blocks ccdinit: can't create thread: %d %s: detached ccdbufclockctlWARNING: %s: total unit size in disklabel (%llu) != the size of %s (%llu) %s: %llu trailing sectors not covered by disklabel WARNING: %s: end of partition `%c' exceeds the size of %s (%llu) dk_subr%s at %s (%s) deleted cgd%s: blkno (%llu) + size / DEV_BSIZE (%zu) > p_size (%llu) %s%u: unable to attach pseudo-device %s at %s: "%s", %llu blocks at %lld, type: %s WARNING: double match for wedge name %s (%s, %s) wedge:%sdkwedge: unable to attach cfdriverdkwedge: unable to attach cfattachdk-method-%s: method "%s" already exists at priority %d %s: unable to compute pdev, error = %d %s: unable to find vnode for pdev, error = %d %s: unable to lock vnode for pdev, error = %d %s: unable to open device, error = %d %s: unable to close device, error = %d WARNING: double match for boot wedge (%s, %s) firmwareDevice firmware loading path list/%s/%sfirmware_open(%s/%s) called too early. /dev/randomvndlckvndpcvnthrvndclear: null vpvndthrvndxplvndbpvndacBPF optionsMaximum size for data capture buffermaxbufsizeBPF statsBPF peers%s: softint_establish() failed%s: no bpf_if found for %sbpf_mcpybpf_change_type%s: bpf_setdlt: ifpromisc failed (%d) bpf_filterbpfopsbsd_decomp%d: bad sequence # %d, expected %d bsd_decomp%d: bad CLEAR bsd_decomp%d: bad code 0x%x oldcode=0x%x max_ent=0x%x explen=%d seqno=%d bsd_decomp%d: ran out of mru bsd_decomp%d: peer should have cleared dictionary ppp_bsdcomp%.*s/%hhu#link#%hu%s: %s: dropping invalid frame type 0x%04hx csum_flags 0x%08x if_%s: watchdog triggered ifaiflnkstifwdogGet active link-layer addresssdlPer-interface controls%s: could not attach sysctl nodes Interface controlsInterface output queue controlssndqCurrent output queue lengthMaximum allowed output queue lengthmaxlenPackets dropped due to full output queuedrops%s: could not attach sysctl watchdog nodes Interface watchdog controlswatchdogTrigger watchdog timeouttriggerInterface input queue controlsrcvqTotal packets dropped due to full input queueif_detach: WARNING: AF %d not purged DOWN%s: lost link state change %s %s-lshktoo many interfaces%s: recursively called too many times(%d) %s: m_tag_get() failed, recursion calls are not prevented. invalid argument to %sinvalid ifnet multicast command: 0x%lxseqid differstype differsdest host differsother reasonno first frag%s: got out of seq. packet: %s %s: arc_ipmtu is %d, but must not exceed %d %s: link address 0 reserved for broadcasts. Please change it and ifconfig %s down up %s: bridge_start() called bridge_rtage%s: disabling protection on %s %s: enabling protection on %s brtplether-get-mac-addresslocal-mac-addressThe multicast bit is set in the MAC address. It's wrong. %s-ether_ifdetachhooks33Ethernet-specific informationmulticast addressesInterface rps hash function controlrps_hashgifvarDefault TTL for a gif tunnel datagramgifttlDefault hop limit for a gif tunnel datagramgifhlimDefault Path MTU setting for gif tunnelsgifpmtugif global controlPath MTU setting for this gif tunnel%s: could not attach sysctl node pmtu if_gifip_ecn%s: invalid ifp (sdl_index %d) llentrypllooutput: no header mbufif_loopifmedia_set: no match for 0x%x/0x%x ifmedia_set failed%s: af%d not supported if_ppp/ccp: not enough data in mbuf (%p+%x > %p+%x) %s: got %d bytes %s: decompress failed %d %s: VJ uncompress failed on type comp %s: VJ uncompress failed on type uncomp %s: input queue full %s: unable to establish softintr %s: no compressor for [%x %x %x], %x %s: comp_alloc failed %s: decomp_alloc failed %s output: bpf_filter,slcompressppp_deflateppp_mppe%s: unable to attach encap if_stf%s: no carrier and not local if_sl-%02x%s tls \x%xIPv6CP layer down IPv6CP layer up IPCP layer down phase %s %s tlf authentication failed %d times, not retrying again setting MTU from %llu bytes to %llu bytes interface is going up, but no loopback packet is detected ifidcompressionipv6cp rej opts:received malicious IPCPv6 option, dropping ipv6cp nak opts: [suggestaddr %s]primdnssecdnsipcp rej opts:IPCP address option rejected %u.%u.%u.%uipcp nak opts: [wantaddr %s] [agree]mruasync-mapauth-protoqual-protoproto-compaddr-compsdpadcmpd-frmsmrrump-ssnhfmp-eidlcp rej opts:received malicious LCP option, dropping. peer rejected our MRU of %ld bytes. Defaulting to %d bytes [don't insist on auth for callout][access denied] lcp nak opts: magic glitchchappap%s(%#x) 0x%02x%s output <%s id=0x%x len=%dlcpipcpipv6cplcp parse opts:received malicious LCP option 0x%02x, length 0x%02x, (len: 0x%02x) dropping. [invalid] [overflow] [invalid class %d len %d] [rej] [invalid chap len] [not configured]lcp parse opt values:loopback [glitch] %ld [chap without MD5] [mine %s != his %s] max_failure (%d) exceeded, send %s %s invalid packet length: %d bytes %s input(%s): <%s id=0x%x len=%d%s invalid conf-req length %d %s id mismatch 0x%x != 0x%x %s id mismatch 0x%x != 0x%x and 0x%x != %0lx %s: ignoring RXJ (%s) for code ?, danger will robinson %s: RXJ%c (%s) for proto 0x%x (%s/%s) lcp echo req but lcp closed invalid lcp echo request packet length: %d bytes got lcp echo req, sending echo rep lcp invalid echo reply packet length: %d bytes lcp got echo rep %s send code-rej for 0x%x %s illegal RXJ- in state %s %s illegal RTA in state %s %s illegal RTR in state %s %s send terminate-ack %s illegal RCN in state %s %s tlu %s illegal RCA in state %s %s illegal RCR+ in state %s %s illegal RCR- in state %s %s close(%s) %s: in_ifinit failed, error=%d couldn't send PAP_REQ because of no name or no secret Welcome!Failed...%s up(%s) %s illegal up in state %s Up event (incoming call) Up event %s down(%s) %s illegal down in state %s Down event (carrier loss) %s open(%s) ipv6cp_open(): no IPv6 interface no memory for transmit header no activity for %lu seconds LCP keepalive timed out, going to restart the connection %s TO(%s) rst_counter = %d reconfirmedtluchap %s, next rechallenge in %d secondsipv6cp parse opts:ipv6cp parse opt values: %s [%s] send %s suggest %s IPCP layer up no IP address, closing IPCP ipcp_open(): no IP interface ipcp parse opts: malicious IPCP option received, dropping ipcp parse opt values: %s [ack] [addr requested] %s [not agreed] still need hisaddrinput packet is too small, %d bytes Cisco packet in PPP mode invalid input packet invalid input protocol pap invalid packet length: %d bytes pap request without his name and his secret being set pap corrupted input <%s id=0x%x len=%dpap input(%s) <%s id=0x%x len=%d name= secret=pap successpap failurepap failure pap corrupted input <0x%x id=0x%x len=%dchap invalid packet length: %d bytes chap input without my name and my secret being set chap corrupted challenge <%s id=0x%x len=%dchap input <%s id=0x%x len=%d name= value-size=%d value=chap successreceive CHAP success without challenge receive CHAP failure without challenge chap failurechap response without his name and his secret being set chap corrupted response <%s id=0x%x len=%dchap dropping response for old ID (got %d, expected %d) chap response, his name != expected chap input(%s) <%s id=0x%x len=%d name=chap bad hash value length: %d bytes, should be %zu chap unknown input(%s) <0x%x id=0x%xh len=%dreject IPCP packet because IPCP is disabled reject IPv6CP packet because IPv6CP is disabled %s.wq_cp%s: workqueue_create failed [%s, %d] conf-reqconf-ackconf-nakconf-rejterm-reqterm-ackcode-rejproto-rejecho-reqecho-replydiscard-reqestablishterminateauthenticateinitialstartingstoppedclosingstoppingreq-sentack-rcvdack-sentopenedsppp_subrsysctl_destroyv returned %d, ignoring tapreadsysctl_createv returned %d, ignoring %s%d: unable to attach an instance %s: unable to register cfattach if_tap%s: tunpoll %s: tunpoll q=%d %s: tunpoll waiting %s: read %s: not ready 0%o Dropping mbuf %s: address set %s: broadcast address set %s: interface mtu set tunread%s: open %s: tun_output %s: tunwrite %s: len=%lu! if_tun vethervlanlinkmib%s: unable to inject VLAN tagif_vlansession 0x%x terminated, %s alien host unique tag, no session found host unique tag found, but it belongs to a connection in state %d wrong interface, not accepting host unique destroy interfacePPPOE protocolTerminate unknown sessionsterm_unknownpppoe_send_padi in state %dfailed to send PADI, error=%d could not establish connection failed to transmit PADI, error=%d failed to send PADR, error=%ddisconnecting ethernet interface detached, going down ethernet interface detachedTAG RELAYSID ERRORTAG ACCOOKIE ERRORTAG HUNIQUE ERRORGENERIC ERRORAC SYSTEM ERRORSERVICE NAME ERRORconnected to %s received PADO but could not find request for it received unexpected PADO FATAL: could not allocate memory for AC cookie FATAL: could not allocate memory for relay SID PADO is too large, drop it failed to send PADR, error=%d session 0x%x connected received PADTwait for reconnect unknown code (0x%04x) session = 0x%04x input for unknown session %#x, sending PADT if_pppoe%s: invalid timer type pfilz_incomp%d: inflateIncomp returned %d (%s) z_decompress%d: bad seq # %d, expected %d z_decompress%d: inflate returned %d (%s) ppp_deflate%d: exceeded mru (%d > %d) 1.1.4z_compress: deflate returned %d (%s) zlib,if_ppp%s input: %s: bad char %x %s: bad fcs %x %s: too short (%d) %s: no input mbufs! %s: garbage received: 0x%x (need 0xFF) %s: missing UI (0x3), got 0x%x %s: bad protocol %x %s: packet too big %s: too few input mbufs! pktqsyncpktqrenqProtocol input queue controlsifqCurrent input queue lengthMaximum allowed input queue lengthPackets dropped due to full input queuecurcputoeplitztoeplitz-othercpusMask for route not entered rn_addmask: mask impossibly already in tree Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: Orphaned Mask %p at %p rn_delete: couldn't find us radix already initializedrn_initrn_init 2delayed rn_inithead failedraw_usrreqrt_timer_timer: rtq_count reached 0 [NULL]rtentry=%p flags=0x%x refcnt=%d use=%lld expire=%lld key= mask= gw= ifp=%p (NULL) ifa=%p ifa_addr= ifa_dsta= ifa_mask= flags=0x%x,refcnt=%d,metric=%d gwroute=%p llinfo=%p rtentryrt_freert_updatertentplrttmrplrt_timerrt_timer_queue_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 %s: unable to delete rtentry @ %p, error = %d %s: %s: can't handle af%hhd (%s) mZV%[Ag%=C+ˮ{0w-0 jB;rtfree 2PF_ROUTE informationRouting table informationRouting statisticsincomplete dynamic bit lengths treeoversubscribed dynamic bit lengths treeincomplete literal/length treeoversubscribed literal/length treeincomplete distance treeoversubscribed distance treeempty distance tree with lengthsinvalid distance codeinvalid literal/length codeinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeatunknown compression methodinvalid window sizeincorrect header checkneed dictionaryincorrect data checkneed more for packet flushzlibstream endfile errorstream errorinsufficient memorybuffer errorincompatible versionAddress Resolution Protocolnd_delayNumber of broadcast discovery attemptsnd_bmaxtriesnd_umaxtriesReachable timend_reachableRetransmission timend_retransPerform neighbour unreachability detectionnd_nudnd_maxnudhintmax packet queue len for a unresolved ARPlog ARP replies from MACs different than the one in the cachelog_movementslog ARP replies from MACs different than the one in the permanent arp entrylog_permanent_modifylog ARP packets arriving on the wrong interfacelog_wrong_ifaceEnable ARP DAD debug output%s: source can't be determined: dst=%s %s: %s not ready %s: called with non-tentative address %s(%s) %s: memory allocation failed for %s(%s) %s: called with duplicate address %s(%s) %s: %s: ARP announcement complete for %s %s: arp_setgate failed %s: bad gateway value %s: failed to %s llentry for %s on %s arp from %s: addr len: new %d, i/f %d (ignored) %s: arp: link address is broadcast for IP address %s! duplicate IP address %s sent from link address %s %s: DAD defended address %s from %s %s: DAD ignoring duplicate address %s from %s %s: DAD defence failed for %s from %s %s tried to overwrite permanent arp info for %s %s on %s tried to overwrite arp info for %s on %s arp info overwritten for %s by %s arpintrrevarp%s: mbuf %d too short for IP header %zu%s: offset %d too short for IP header %zucarp: state transition from: %s -> to: %sip_output failed: %din6_setscope failedip6_output failed: %d%s: master_down event in INIT state INIT -> MASTER (preempting)invalid version %d != %dincorrect hash from %sincorrect hashMASTER -> BACKUP (more frequent advertisement received)BACKUP -> MASTER (preempting a slower master)BACKUP -> MASTER (master timed out)packet received on non-carp interface: %sreceived ttl %d != %d on %spacket size %u too smallchecksum failed, on %spacket too short %d on %schecksum failed on %sCARP related settingscarpEnable CARP PreemptEnable ARP balancingarpbalanceEnable CARPallowCARP loggingCARP statisticscarp6BACKUPMASTERNULL pointer passed to ip_ecn_ingressNULL pointer passed to ip_ecn_egressNULL pointer passed to ip6_ecn_ingressNULL pointer passed to ip6_ecn_egressencapelemip_encap cv%s_wqinputworkqueue-based pr_input controls%s: could not create a sysctl node for %s Protocol controls for workqueue-based pr_inputwqinput input queue controlsinputqElement '%s' of type %s doesn't exist.Invalid type (%d).Unknown type: %d.BOOLNUMBERSTRINGNVLISTDESCRIPTORBINARYBOOL ARRAYNUMBER ARRAYSTRING ARRAYNVLIST ARRAYDESCRIPTOR ARRAYis-rootmodelsTraditional NetBSD: Superuserorg.netbsd.secmodel.susersuser_modcmd::init: secmodel_register returned %d suser_modcmd::fini: secmodel_deregister returned %d is-securelevel-aboveSystem security levelTraditional NetBSD: Securelevelorg.netbsd.secmodel.securelevelsecurelevel_modcmd::init: secmodel_register returned %d securelevel_modcmd::fini: secmodel_deregister returned %d Curtain information about objects to users not owning them.curtainTraditional NetBSD: ExtensionsWhether unprivileged users may control CPU affinity.user_set_cpu_affinityorg.netbsd.secmodel.extensionsextensions_modcmd::init: secmodel_register returned %d extensions_modcmd::fini: secmodel_deregister returned %d Whether unprivileged users may mount filesystemsusermountWhether unprivileged users can hardlink to files they don't ownhardlink_check_uidWhether unprivileged users can hardlink to files that are not in their group membershiphardlink_check_gidTraditional NetBSD: 4.4BSDorg.netbsd.secmodel.bsd44secmodel_bsd44_modcmd::init: secmodel_register returned %d secmodel_bsd44_modcmd::fini: secmodel_deregister returned %d secmodel_bsd44suser,securelevel,extensionsagrsoftcagrports%s: config_promisc error %d %s: if_init error %d %s: if_addr_init error %d %s: portinit error %d %s: configmulti error %d %s: error on cleanup %s: portfini error %d %s: configmulti_port error %d %s: agrport_cleanup error %d if_agragrmon%s: speed 0? media=0x%x nports=%d %s, speed=%llu, nports=%d active aggregator changed old %s active aggregator not changed new %s lacpdu receive lacpdu transmit media changed 0x%x -> 0x%x -> UNSELECTED disable distributing on aggregator %s, nports %d -> %d portfini enable distributing on aggregator %s, nports %d -> %d %s: waiting transit %s: no active aggregator port lagid=%s aggregator creation failed aggregator created compatible aggregator found %s: lagid=%s, refcnt %d -> %d aggregator lagid=%s %s: assert ntt old pstate %s new pstate %s %s: CURRENT -> EXPIRED %s: EXPIRED -> DEFAULTED %s: unknown statemux_state %d -> %d %s: aggregator %s, pending %d -> %d partner timeout changed lacpdu transmit failure, error %d %02X-%02X-%02X-%02X-%02X-%02X%04X,%s%04X,%04X(%s,%04X,%s)[%s,%s]actor=%s actor.state=%s partner=%s partner.state=%s maxdelay=%d ptmdrvctlfwucycomgpioutoppyamrlockstatputtersrtdrmaltmemtwacpuctlzfstprofisvdmhdaudiouhsorumpblkdtviiciscsitpmmfiseepromdtraceluaspkrhdmicecnvmeqemufwcfgautofsgpioppsnvmmkcovspiipmivhcivio9pwwancacpismbiosefisht3xtempviocongpioirqumcpmioemcfancttyptcviewiplrndwsdisplaywskbdwsmousewsfontwsmuxaicawimbeslhciioblgencpuhidbususbuspcmciabusacafhbusclockportbusxsurfbusxshbusgrfbusreportiddriveproductchannellunwsemuldisplaydevkbdmuxslavewsmousedevwskbddev%s: %zu bytes @ %p %s: invalid base %dunusedv6v7sysvv71kv8otherhpfsadoshfsfilecorejfs2vinumudfsysvbfsefsnilfsminixfs3vmkcorevmfsvmwresvpropstng%llipropnmbr?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDR %s %s SIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc: km:8021X-UNSPEC8021X-PSKacm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsCAPSINTS:NRATE%-*.*s %-17.17s %4s %4s %-7s %3s %4s %-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %s%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsbeWARNING: -G may create file systems which cause kernel panics 2easector size `%s' is not a power of 2.fragment sizeunknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo/dev/%s is mounted on %sno default sector size%s partition is unavailableApple UFS4.2BSDUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeblocksignals: sigprocmaskenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()atalkhopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipeshowssthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completemichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) routing message version %d not understood writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorSO_RERRORCannot allocate memoryassuming route to ifold usage of trailing 0%s, %sassuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s %s %s: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dFlagsDestination%-*.*s %-*.*s %-6.6s EncapInternetAppleTalk Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time format/usr/bin/wall%s -n%s: Can't find `%s' (%m)FINAL *** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipUsage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpusage: chflags [-R [-H | -L | -P]] [-dh] flags file ... HLPRdhinvalid flags: %sinvalid flag: %s%s: unknown mode. TYPE %s %sTYPE %sContinue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinaryasciitenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20251028NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTmoreMLSD is not supported by the remote server. pageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld STATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbellbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewerntranspassivepdirpmlsdquoterecvremoptsrhelprmdirrstatusruniquesendportsitestructsuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. Poll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dUsage error Error resetting connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %susage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. ftpgatehttpFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... Neither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpgetoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'KiBEiB%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAMiBGiBTiBPiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. passwordmachineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesftp_strdup: called with NULL argumentUnable to allocate memory for string copySIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %sY2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Name (%s:%s): Name (%s): Unable to allocate %ld bytes of memoryLogin failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'restoreOption %s must be boolean (1 or 0) Unable to allocate memory for stringlistUnable to add `%s' to stringlistInput line is too long (specify -b > 16384)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression error compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%fstat(stdin)can't read stdin(stdin): unexpected end of filedeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%ccan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gz%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: undefined label '%s'%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread commandbranch%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru-I or -i may not be used with stdinrename()fclose()works for regular filesin-place editing only%s: %s %s%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv%tdmalloc of linebuf for %zu bytes failedrealloc of linebuf to %zu bytes failedfailed to write temp filefailed to writefailed to write debug keyfailed to malloc initial buffer or keylistfailed to realloc buffer to %zu bytesfield numbers must be positivecannot indent end of lineillegal offsetillegal field descriptorfields out of orderrealloc%d.%d%s-k%sfound disorder: %sfound non-uniqueness: %susage: %s [-bdfHilmnrSsu] [-k kstart[,kend]] [-o output] [-R char] [-T dir] [-t char] [file ...] or: %s -C|-c [-bdfilnru] [-k kstart[,kend]] [-o output] [-R char] [-t char] [file] getrlimitsetrlimitbcCdD:fHik:lmno:rR:sSt:T:uIncompatible operation modesmultiple record delimitersinvalid record delimiter %smultiple field delimitersrecord/field delimiter clashtoo many input files for -c optiontoo many input files for -m option/dev/stdinignoring extra "%s" in file listCannot create temporary file `%s'Cannot open temporary file `%s'output file %scannot chmod %s: output left in %scannot link %s: output left in %ssort.XXXXXXXXftmp: mkstemp("%s")ftmp: fdopen("%s")unknown ACU typecan't open phone number fileunrecognizable host name call aborted disconnecting...hayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedhardbad flow settingbad parity settingmore than one line specified/dev/%sConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description file%s: missing device specdu%s: missing phone numberhdtbdvcmcudiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number Lost carrier. n r t fEb%c %2s%-2s %c %s %s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCK%s=%-5daccess denied out of core n r t bf record%s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234OKRINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgidDISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentchanging %s byteorder to %smvme68k%s: unknown machine typeline %d: too few fieldsline %d: syntax error%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %dusage:[-ABCFMrtv] disk%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=%s:t%c=unknown%u:b%c#%llu:f%c#%u:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create labelioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindercylinderstotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOaarch64/usr/bin/viMACHINE%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXEDITORre-edit the label? [y]: (to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64next68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipszaurusunusedswapVersion 6Version 7System V4.1BSDEighth EditionMSDOS4.4LFSHPFSISO9660ADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpd%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Unit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraAutomatically adjust partitions [%s]? Invalid answerreallocarr# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' %.40gc, %us, %.40gMStart offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table# %s: type: %s type: %u disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] usage: mount_ados [-o options] [-u user] [-g group] [-m mask] bdev dir u:g:m:o:adosfserrno != EROFS/usr/src/sbin/mount_ados/mount_ados.cuid=%d, gid=%d, mask=0%o usage: mount_kernfs [-o options] /kern mount_point kernfs on %sbcast%hu%d-%dActive ATALK connections (including servers)PCB%-8.8s (state)Foreign AddressLocal AddressSend-QRecv-QProto%-5.5s %-6.6s %-6.6s %*.*s %*.*s %s %8lx %-5.5s %6ld %6ld net.atalk.ddp.stats%s stats not available via KVM. with short headers %llu %s%s%s with long headers with no checksum too short with bad checksum with not enough data forwarded encapsulated rcvd for unreachable dest dropped due to no socket space net.bpf.statsbpf: %llu total packets received %llu total packets captured %llu total packets dropped BPF stats not available via KVM.sysctlnametomib: net.bpf.peerssysctl: net.bpf.peersActive BPF peers PID Int Recv Drop Capt Flags Bufsize Comm%-7d %-7s %-8llu %-8llu %-8llu %-8d bpf_dump not implemented using kvmIPsec stats not available via KVM.net.inet.ipsec.ipsecstatsnet.inet.ah.ah_statsnet.inet.esp.esp_statsnet.inet.ipcomp.ipcomp_statsnet.inet.ipip.ipip_stats %llu policy violations: %llu input %llu output %llu no SA found (output) %llu no memory available (output) %llu no route available (output) %llu generic errors (output) %llu bundled SA processed (output) %llu SPD cache lookups %llu SPD cache misses ah: %llu ah input packets processed %llu ah output packets processed %llu ah headers too short %llu ah headers for unsupported address family %llu ah packets with no SA %llu ah packets dropped by crypto returning NULL mbuf %llu ah packets with bad authentication %llu ah packets with no xform %llu ah packets dropped due to queue full %llu ah packets dropped for replay counter wrap %llu ah packets dropped for possible replay %llu ah packets dropped for bad authenticator length %llu ah packets with an invalid SA %llu ah packets too big %llu ah packets blocked due to policy %llu ah failed crypto requests %llu ah tunnel sanity check failures ah histogram: ah packets with %s: %llu %llu ah bytes received %llu ah bytes transmitted esp: %llu esp input packets processed %llu esp output packets processed %llu esp headers too short %llu esp headers for unsupported address family %llu esp packets with no SA %llu esp packets dropped by crypto returning NULL mbuf %llu esp packets dropped due to queue full %llu esp packets with no xform %llu esp packets with bad ilen %llu esp packets with bad encryption %llu esp packets with bad authentication %llu esp packets dropped for replay counter wrap %llu esp packets dropped for possible replay %llu esp packets with an invalid SA %llu esp packets too big %llu esp packets blocked due to policy %llu esp failed crypto requests %llu esp tunnel sanity check failures esp histogram: esp packets with %s: %llu %llu esp bytes received %llu esp bytes transmitted ipip: %llu ipip total input packets %llu ipip total output packets %llu ipip packets too short for header length %llu ipip packets dropped due to queue full %llu ipip packets blocked due to policy %llu ipip IP spoofing attempts %llu ipip protocol family mismatched %llu ipip missing tunnel-endpoint address %llu ipip input bytes received %llu ipip output bytes processed ipcomp: %llu ipcomp packets too short for header length %llu ipcomp protocol family not supported %llu ipcomp packets with no SA %llu ipcomp packets dropped by crypto returning NULL mbuf %llu ipcomp queue full %llu ipcomp no support for transform %llu ipcomp packets dropped for replay counter wrap %llu ipcomp input IPcomp packets %llu ipcomp output IPcomp packets %llu ipcomp packets with an invalid SA %llu ipcomp packets decompressed as too big %llu ipcomp packets too short to be compressed %llu ipcomp packet for which compression was useless %llu ipcomp packets blocked due to policy %llu ipcomp failed crypto requests ipcomp histogram: IPcomp packets with %s: %llu %llu ipcomp input bytes %llu ipcomp output bytes *unknown*ouideflatelzs3des-cbccast128-cbcblowfish-cbcaes-cbcaes-ctraes-gcm-8aes-gcm-12aes-gcm-16camelia-cbcaes-gmacskipjackhmac-md5hmac-sha1hmac-sha2-256hmac-sha2-384hmac-sha2-512hmac-ripe-md160aes-xbc-macaes-128-macaes-192-macaes-256-macshatcp-md5 %25s %-17.17s %25s %-*.*s '%s' not foundWrong OID path for '%s'failed to read '%s'net.interfaces.%s.sndq.dropsObytesIbytesMtuName%-5.5s %-5.5s %-13.13s %-17.17s %10.10s %10.10sIerrsIpkts%-5.5s %-5.5s %-13.13s %-17.17s %8.8s %5.5sIdrops %6.6sCollsOerrsOpktsOdropsTime %4.4s%s: %s: unknown interface %7.7s in %8.8s %6.6s out %5.5s %5.5s in %5.5s%5.5s out %5.5s %5.5scollspackets %10.10s %8.8s %10.10s %5.5s %8.8s %5.5s %8.8s %5.5s %5.5s%10s %5.5s %10s %8.8s %10llu %8.8s %8llu %5llu %8llu %5llu %5llu%-13.13s net.inet.multicastnet.inet6.multicastatalk:%-7.7s %10s %10llu %10s%10llu%8llu %5llu %6lluifnet: symbol not defined%-*.*s %-5llu %10llu %8.8s %10llu %5.5snet.inet%s.%s.pcblistasprintfsysctlnametomib: %ssysctl (query)sysctl (copy)net.inet.tcp.stats %llu packet%s sent %llu data packet%s (%llu byte%s) %llu data packet%s (%llu byte%s) retransmitted %llu ack-only packet%s (%llu delayed) %llu URG only packet%s %llu window probe packet%s %llu window update packet%s %llu control packet%s %llu send attempt%s resulted in self-quench %llu packet%s received %llu ack%s (for %llu byte%s) %llu duplicate ack%s %llu ack%s for unsent data %llu packet%s (%llu byte%s) received in-sequence %llu completely duplicate packet%s (%llu byte%s) %llu old duplicate packet%s %llu packet%s with some dup. data (%llu byte%s duped) %llu out-of-order packet%s (%llu byte%s) %llu packet%s (%llu byte%s) of data after window %llu window probe%s %llu packet%s received after close %llu discarded for bad checksum%s %llu discarded for bad header offset field%s %llu discarded because packet too short %llu connection request%s %llu connection accept%s %llu connection%s established (including accepts) %llu connection%s closed (including %llu drop%s) %llu embryonic connection%s dropped %llu delayed free%s of tcpcb %llu segment%s updated rtt (of %llu attempt%s) %llu retransmit timeout%s %llu connection%s dropped by rexmit timeout %llu persist timeout%s (resulting in %llu dropped connection%s) %llu keepalive timeout%s %llu keepalive probe%s sent %llu connection%s dropped by keepalive %llu correct ACK header prediction%s %llu correct data packet header prediction%s %llu PCB hash miss%s %llu dropped due to no socket %llu connection%s drained due to memory shortage %llu PMTUD blackhole%s detected %llu bad connection attempt%s %llu SYN cache entries added %llu hash collision%s %llu completed %llu aborted (no space to build PCB) %llu timed out %llu dropped due to overflow %llu dropped due to bucket overflow %llu dropped due to RST %llu dropped due to ICMP unreachable %llu delayed free of SYN cache entries %llu SYN,ACK%s retransmitted %llu duplicate SYN%s received for entries already in the cache %llu SYN%s dropped (no route or no space) %llu packet%s with bad signature %llu packet%s with good signature %llu successful ECN handshake%s %llu packet%s with ECN CE bit %llu packet%s ECN ECT(0) bit net.inet.udp.stats %llu datagram%s received %llu with incomplete header %llu with bad data length field %llu with bad checksum %llu broadcast/multicast datagram%s dropped due to no socket %llu dropped due to full socket buffers %llu delivered %llu datagram%s output net.inet.ip.stats %llu total packet%s received %llu bad header checksum%s %llu with size smaller than minimum %llu with data size < data length %llu with length > max ip packet size %llu with header length < data size %llu with data length < header length %llu with bad options %llu with incorrect version number %llu fragment%s received %llu fragment%s dropped (dup or out of space) %llu fragment%s dropped (out of ipqent) %llu malformed fragment%s dropped %llu fragment%s dropped after timeout %llu packet%s reassembled ok %llu packet%s for this host %llu packet%s for unknown/unsupported protocol %llu packet%s forwarded (%llu packet%s fast forwarded) %llu packet%s not forwardable %llu redirect%s sent %llu packet%s no matching gif found %llu packet%s no matching ipsecif found %llu packet%s sent from this host %llu packet%s sent with fabricated ip header %llu output packet%s dropped due to no bufs, etc. %llu output packet%s discarded due to no route %llu output datagram%s fragmented %llu fragment%s created %llu datagram%s that can't be fragmented %llu datagram%s with bad address in header %llu input packet%s dropped by pfil %llu output packet%s dropped by pfil %llu input packet%s dropped by IPsec %llu output packet%s dropped by IPsec %llu input packet%s dropped due to interface state %llu packet%s dropped due to TTL exceeded %llu output packet%s dropped (no IP address) %llu output packet%s discarded due to reject route %llu output packet%s dropped (broadcast prohibited) net.inet.icmp.stats %llu call%s to icmp_error %llu error%s not generated because old message was icmp Output histogram: %s: %llu %llu message%s with bad code fields %llu message%s < minimum length %llu bad checksum%s %llu message%s with bad length %llu multicast echo request%s ignored %llu multicast timestamp request%s ignored Input histogram: %llu message response%s generated %llu path MTU change%s net.inet.igmp.stats %llu message%s received %llu message%s received with too few bytes %llu message%s received with bad checksum %llu membership quer%s received %llu membership quer%s received with invalid field(s) %llu membership report%s received %llu membership report%s received with invalid field(s) %llu membership report%s received for groups to which we belong %llu membership report%s sent net.inet.carp.stats %llu packet%s received (IPv4) %llu packet%s received (IPv6) %llu packet%s discarded for bad interface %llu packet%s discarded for wrong TTL %llu packet%s shorter than header %llu packet%s discarded for bad checksum %llu packet%s discarded with a bad version %llu discarded because packet was too short %llu packet%s discarded for bad authentication %llu packet%s discarded for bad vhid %llu packet%s discarded because of a bad address list %llu packet%s sent (IPv4) %llu packet%s sent (IPv6) %llu send failed due to mbuf memory error %llu byte%s received %llu message%s received with bad version %llu data register message%s received %llu data register byte%s received %llu data register message%s received on wrong iif %llu bad register%s received %llu data register message%s sent %llu data register byte%s sent net.inet.arp.stats %llu reply packet%s %llu request packet%s %llu valid request packet%s %llu broadcast/multicast packet%s %llu packet%s with unknown protocol type %llu packet%s with bad (short) length %llu packet%s with null target IP address %llu packet%s with null source IP address %llu could not be mapped to an interface %llu packet%s sourced from a local hardware address %llu packet%s with a broadcast source hardware address %llu duplicate%s for a local IP address %llu attempt%s to overwrite a static entry %llu packet%s received on wrong interface %llu entry%s overwritten %llu change%s in hardware address length %llu packet%s deferred pending ARP resolution %llu sent %llu dropped %llu failure%s to allocate llinfo %u.%u.%u.%u%.*s. %-*.*s%8x %-5.5s %6ld %6ld%s reclaimed %.3fms%-5.5s %-6.6s %-6.6s %s%-*.*s %-*.*s %-13.13s Expires %-5.5s %-6.6s %-6.6s %s%-*.*s %-*.*s %s Active Internet connectionsState0x%lx is not a valid pcb addressTCP Protocol Control Block at 0x%08lx: Timers: %s %s %d State: %dState: %s, flags 0x%x, inpcb 0x%lx rxtshift %d, rxtcur %d, dupacks %d peermss %u, ourmss %u, segsz %u, segqlen %u snd_una %u, snd_nxt %u, snd_up %u snd_wl1 %u, snd_wl2 %u, iss %u, snd_wnd %lu rcv_wnd %lu, rcv_nxt %u, rcv_up %u, irs %u rcv_adv %u, snd_max %u, snd_cwnd %lu, snd_ssthresh %lu rcvtime %u, rtttime %u, rtseq %u, srtt %d, rttvar %d, rttmin %d, max_sndwnd %lu oobflags %d, iobc %d, softerror %d snd_scale %d, rcv_scale %d, req_r_scale %d, req_s_scale %d ts_recent %u, ts_regent_age %d, last_ack_sent %u CLOSEDLISTENSYNSENSYSRCVESTABLCLWAITFWAIT1CLOSNGLASTAKFWAIT2TMWAITREXMTPERSISTKEEP2MSLSYN_SENTSYN_RCVDESTABLISHEDCLOSE_WAITFIN_WAIT_1CLOSINGLAST_ACKFIN_WAIT_2TIME_WAITechoreplyunassigned_1unassigned_2unreachsourcequenchalthostaddrunassigned_7routeradvertroutersolicittimxceedparamprobtstamptstampreplyireqireqreplymaskreqmaskreplyreserved_19reserved_20reserved_21reserved_22reserved_23reserved_24reserved_25reserved_26reserved_27reserved_28reserved_29traceroutedataconverrmobile_redirectipv6_whereareyouipv6_iamheremobile_regrequestmobile_regreplyreserved_37reserved_38photuristcp6net.inet6.udp6.stats %llu with no checksum %llu multicast datagram%s dropped due to no socket net.inet6.ip6.stats %llu fragment%s that exceeded limit %llu packet%s forwarded %llu packet%s fast forwarded %llu fast forward flows %llu packet%s that violated scope rules %llu multicast packet%s which we don't join Input packet histogram: #%d: %llu Mbuf statistics: %llu one mbuf%s two or more mbuf: %s = %llu %llu one ext mbuf%s %llu two or more ext mbuf%s %llu packet%s whose headers are not continuous %llu tunneling packet%s that can't find gif %llu tunneling packet%s that can't find ipsecif %llu packet%s discarded due to too many headers %llu failure%s of source address selection source addresses on an outgoing I/F %llu node-local%s %llu link-local%s %llu site-local%s %llu global%s %llu addresses scope=%x source addresses on a non-outgoing I/F source addresses of same scope source addresses of a different scope deprecated source addresses %llu forward cache hit %llu forward cache miss %llu input packet%s dropped due to no bufs, etc. %llu packet%s dropped due to hop limit exceeded %llu packet%s dropped (too big) Warning: socket(AF_INET6)ip6 on %s: Warning: ioctl(SIOCGIFSTAT_IN6) %llu total input datagram%s %llu datagram%s with invalid header received %llu datagram%s exceeded MTU received %llu datagram%s with no route received %llu datagram%s with invalid dst received %llu truncated datagram%s received %llu datagram%s with unknown proto received %llu input datagram%s discarded %llu datagram%s delivered to an upper layer protocol %llu datagram%s forwarded to this interface %llu datagram%s sent from an upper layer protocol %llu total discarded output datagram%s %llu output datagram%s failed on fragment %llu output datagram%s succeeded on fragment %llu incoming datagram%s fragmented %llu datagram%s reassembled %llu datagram%s failed on reassembling %llu multicast datagram%s received %llu multicast datagram%s sent net.inet6.icmp6.stats %llu call%s to icmp6_error %llu error%s not generated because old message was icmp6 or so %llu error%s not generated because of rate limitation Output packet histogram: Histogram of error messages to be generated: %llu no route %llu administratively prohibited %llu beyond scope %llu address unreachable %llu port unreachable %llu packet too big %llu time exceed transit %llu time exceed reassembly %llu erroneous header field %llu unrecognized next header %llu unrecognized option %llu redirect %llu unknown %llu message%s with too many ND options %llu message%s with bad ND options %llu bad neighbor solicitation message%s %llu bad neighbor advertisement message%s %llu bad router solicitation message%s %llu bad router advertisement message%s %llu router advertisement route%s dropped %llu bad redirect message%s icmp6 on %s: Warning: ioctl(SIOCGIFSTAT_ICMP6) %llu total input message%s %llu total input error message%s %llu input destination unreachable error%s %llu input administratively prohibited error%s %llu input time exceeded error%s %llu input parameter problem error%s %llu input packet too big error%s %llu input echo request%s %llu input echo reply%s %llu input router solicitation%s %llu input router advertisement%s %llu input neighbor solicitation%s %llu input neighbor advertisement%s %llu input redirect%s %llu input MLD query%s %llu input MLD report%s %llu input MLD done%s %llu total output message%s %llu total output error message%s %llu output destination unreachable error%s %llu output administratively prohibited error%s %llu output time exceeded error%s %llu output parameter problem error%s %llu output packet too big error%s %llu output echo request%s %llu output echo reply%s %llu output router solicitation%s %llu output router advertisement%s %llu output neighbor solicitation%s %llu output neighbor advertisement%s %llu output redirect%s %llu output MLD query%s %llu output MLD report%s %llu output MLD done%s net.inet6.pim6.stats %llu register%s received %llu register%s sent net.inet6.raw6.stats %llu checksum calculation%s on inbound %llu message%s with bad checksum %llu message%s dropped due to no socket %llu multicast message%s dropped due to no socket %llu message%s dropped due to full socket buffers udp6%-5.5s %-6.6s %-6.6s %*.*s %*.*s %-13.13s Expires Active Internet6 connectionssnd_wl1 %u, snd_wl2 %u, iss %u, snd_wnd %llu rcv_wnd %llu, rcv_nxt %u, rcv_up %u, irs %u rcv_adv %u, snd_max %u, snd_cwnd %llu, snd_ssthresh %llu rcvtime %u, rtttime %u, rtseq %u, srtt %d, rttvar %d, rttmin %d, max_sndwnd %llu #0packet too bigtime exceedparameter problem#5#6#7#8#9#10#11#12#13#14#15#16#17#18#19#20#21#22#23#24#25#26#27#28#29#30#31#32#33#34#35#36#37#38#39#40#41#42#43#44#45#46#47#48#49#50#51#52#53#54#55#56#57#58#59#60#61#62#63#64#65#66#67#68#69#70#71#72#73#74#75#76#77#78#79#80#81#82#83#84#85#86#87#88#89#91#92#93#94#95#96#97#98#99#100#101#102#103#104#105#106#107#108#109#110#111#112#113#114#115#116#117#118#119#120#121#122#123#124#125#126#127echo replymulticast listener querymulticast listener reportmulticast listener doneneighbor solicitationneighbor advertisementrouter renumberingnode information requestnode information reply#141#142multicast listener report (v2)home agent discovery requesthome agent discovery replymobile prefix solicitationmobile prefix advertisement#148#149#150multicast router advertisementmulticast router solicitationmulticast router termination#154#155#156#157#158#159#160#161#162#163#164#165#166#167#168#169#170#171#172#173#174#175#176#177#178#179#180#181#182#183#184#185#186#187#188#189#191#192#193#194#195#196#197#198#199#200#201#202#203#204#205#206#207#208#209#210#211#212#213#214#215#216#217#218#219#220#221#222#223#224#225#226#227#228#229#230#231#232#233#234#235#236#237#238#239#240#241#242#243#244#245#246#247#248#249#250#251#252#253#254#255hop by hopICMPIGMPTCPUDPIDPIP6routingfragmentESPAHICMP6no next headerdestination optionOSPFEthernetPIMSCTPusage: %s [-Aan] [-f address_family[,family ...]] [-M core] [-N system] %s [-bdgiLmnqrsSv] [-f address_family[,family ...]] [-M core] [-N system] %s [-dn] [-I interface] [-M core] [-N system] [-w wait] %s [-p protocol] [-M core] [-N system] %s [-p protocol] [-M core] [-N system] -P pcbaddr %s [-p protocol] [-i] [-I Interface] %s [-s] [-f address_family[,family ...]] [-i] [-I Interface] %s [-s] [-B] [-I interface] can't use sysctl with dumpskvm error: %s%s: no namelistforcing sysctl usage even though it might not be supportedinvalid PCB address %s%s: unknown or uninstrumented protocolAabBdf:ghI:LliM:mN:nP:p:qrsStTuVvw:X%s: no PCB dump routine %s: no stats routine queue length: %d maximum queue length: %d packets dropped: %llu pfkey%s: unknown address familyicmp6ipsec6pim6rip6icmpigmpcarpipsecpimpfsync_mbstat_ipstat_tcbtable_tcpstat_udbtable_udpstat_ifnet_list_icmpstat_rtstat_unixsw_rt_tables_nfile_igmpstat_ip_mrtproto_mrtstat_mfchashtbl_mfchash_viftable_msize_mclbytes_ddpstat_ddpcb_mbpool_mclpool_ip6stat_tcp6stat_udp6stat_icmp6stat_ipsecstat_ipsec6stat_pim6stat_ip6_mrtproto_mrt6stat_mf6ctable_mif6table_pfkeystat_arpstat_rip6stat_arpintrq_atintrq1_atintrq2_ppoediscinq_ppoeinq_hardclock_ticks_pimstat_carpstats_pfsyncstatsmbstat: sysctl failed%s: mbstat: symbol not in namelist %u mbufs in use: %u mbufs allocated to %s %u mbufs allocated to %lu/%lu mapped pages in use %lu Kbytes allocated to network (%lu%% in use) %lu calls to protocol drain routines mowners: sysctl testmalloc(%lu)mowners: sysctl get%16.16s %-13.16scluster%30s %-8s %10s %10s %10s inuse%30s %-8s %10lu %10lu %10lu claimsreleasesoob dataancillary datapacket headersfragment reassembly queue headerssocket names and addressessocket optionsip_mrtproto: symbol not in namelistno multicast routing compiled into this systemmfchashtbl: symbol not in namelistmfchash: symbol not in namelistviftable: symbol not in namelistRemote-Address Pkt_in Pkt_out Vif Thresh Limit Local-Address Virtual Interface Table %s%s %3u %3u %5u %-15.15s %-15.15s %6lu %7lu Virtual Interface Table is empty Multicast Forwarding Cache is emptyTraffic In-Vif Out-Vifs/Forw-ttl Hash Origin Mcastgroup Multicast Forwarding Cache %s%s %3lu %-15.15s%lu%c %-15.15s %7s %3u %u/%u Bandwidth MetersMeasured(Start|Packets|Bytes) %-30sTypeThresh(Interval|Packets|Bytes) Remain%lld.%ld|%s|%s %-3s-%lld.%ld Total no. of entries in cache: %d mrtstat: symbol not in namelistmulticast routing: %lu datagram%s with no route for origin %lu upcall%s made to mrouted %lu datagram%s with malformed tunnel options %lu datagram%s with no room for tunnel options %lu datagram%s arrived on wrong interface %lu datagram%s dropped due to upcall Q overflow %lu datagram%s dropped due to upcall socket overflow %lu datagram%s cleaned up by the cache %lu datagram%s dropped selectively by ratelimiter %lu datagram%s dropped - bucket Q overflow %lu datagram%s dropped - larger than bkt size reg0mroute6pr: symbol not in namelistno IPv6 multicast routing compiled into this systemIPv6 multicast routing protocol %u, unknown mf6ctable: symbol not in namelistmiftable: symbol not in namelist IPv6 Multicast Interface Table Mif Rate PhyIF Pkts-In Pkts-Out %2u %4d %5s %9llu %9llu IPv6 Multicast Interface Table is empty IPv6 Multicast Forwarding Cache Packets Waits In-Mif Out-Mifs GroupOrigin %-*.*s %-*.*s %s %9llu %3d --- %3d IPv6 Multicast Routing Table is emptymrt6_stats: symbol not in namelistmulticast forwarding: %10llu multicast forwarding cache lookup%s %10llu multicast forwarding cache miss%s %10llu upcall%s to mrouted %10llu upcall queue overflow%s %10llu upcall%s dropped due to full socket buffer %10llu cache cleanup%s %10llu datagram%s with no route for origin %10llu datagram%s arrived with bad tunneling %10llu datagram%s could not be tunneled %10llu datagram%s arrived on wrong interface %10llu datagram%s selectively dropped %10llu datagram%s dropped due to queue overflow %10llu datagram%s dropped for being too large net.key.stats %llu request%s sent from userland %llu byte%s sent from userland histogram by message type: %llu message%s with invalid length field %llu message%s with invalid version field %llu message%s with invalid message type field %llu message%s too short %llu message%s with memory allocation failure %llu message%s with duplicate extension %llu message%s with invalid extension type %llu message%s with invalid sa type %llu message%s with invalid address extension %llu request%s sent to userland %llu byte%s sent to userland %llu message%s toward single socket %llu message%s toward all sockets %llu message%s toward registered sockets getspix_promiscx_pchangex_spdupdatex_spdaddx_spddeletex_spdgetx_spdacquirex_spddumpx_spdflushx_spdsetidxx_spdexpirex_spddelete2net.inet.pfsync.stats %llu packet%s discarded for bad ttl %llu packet%s discarded for bad version %llu packet%s discarded for bad HMAC %llu packet%s discarded for bad action %llu packet%s discarded for short packet %llu state%s discarded for bad values %llu stale state%s %llu failed state lookup/insert%s %llu send error =>%6d %8llu %6s%7s %.16s%s mask %6.6s %8.8lx : %8.8lx %d refs, mk = %8.8lx {(%d),%s , -> => %-8.8lx (root node)%srt_tables: symbol not in namelistNetmasks:net.rtable.statsrt_stats: sysctl %llu bad routing redirect%s %llu dynamically created route%s %llu new gateway%s due to redirects %llu destination%s found unreachable %llu use%s of a wildcard route -> %.*s%8lx %-6.6s %6ld %6ld %8lx %8lx %8lx %8lxnet.local.stream.pcblistnet.local.dgram.pcblistnet.local.seqpacket.pcblistActive UNIX domain socketsNextrefRefsConnInode%-8.8s %-6.6s %-6.6s %-6.6s %8.8s %8.8s %8.8s %8.8s Addr file table read error: %sdgramrdmseqpacketkvm not availablekvm_nlist%s missing in symbol table%s: short read at %p, len %zx cc %zxnet.inet.tcp.vtw.enabletimebasebinvtw_stats %llu inserts %llu deletes %llu assassinations vestigial time-wait lookup_connect %llu look %llu hit %llu miss %llu probe %llu losing %llu max_chain %llu max_probe %llu max_loss vestigial time-wait lookup_portfat_tcpv4vtw_tcpv4fat_tcpv6vtw_tcpv6SA(Address/Proto/Type/Direction)PortSource%-18s %-5s %-18s %-5s %-5s %-22s InterfaceTagUse%-*.*s %-*.*s %-6.6s %6.6s %8.8s %6.6s %7.7s %s %-*.*s %-*.*s %-6.6s %6.6s %8.8s %6.6s %s Internet6MPLS expire %10lld%c recvpipe %10llu%c sendpipe %10llu%c ssthresh %10llu%c rtt %10llu%c rttvar %10llu%c hopcount %10llu%c illegal prefixlen%s/%datalk %d.%d%6lld %.16s209|The file is emptyCursor set to nonexistent column%s%lssmcuprmcup[@~080|Unknown command name1bca1098|The %s command is unknown082|%s: command not available in ex mode083|Count may not be zero084|%s: bad line specification085|Internal syntax table error (%s: %s)lr086|Usage: %s088|Flag offset to before line 1089|Flag offset past end-of-file090|@ with range running when the file/screen changed091|Global/v command running when the file/screen changed093|Ex command failed: mapped keys discarded092|Ex command failed: pending commands discarded170|Interrupted105|No abbreviations to display106|Abbreviations must end with a "word" character107|Abbreviations may not contain tabs or spaces108|Abbreviations may not mix word/non-word characters, except at the end109|"%s" is not an abbreviation273|Entering ex input mode.112|No previous files to edit113|No previous files to rewind114|No file list to display111|No more files to edit115|No previous command to replace "!"116|No filename to substitute for %%117|No filename to substitute for #vfork118|Error: execl: %s304|Shell expansion failed289|Shell expansions not supported when the secure edit option is setfdopen119|I/O error: %s!%s 303|File modified since last write.120|File modified since last complete write; write or use ! to override121|Unable to find home directory location122|New current directory: %sscroll lines[line [,line]] ! commandfilter lines through commands or run commands[line [,line]] # [count] [l]display numbered lines[line [,line]] & [cgr] [count] [#lp]repeat the last subsitution* [buffer]execute a buffer[line [,line]] <[<...] [count] [flags]shift lines left[line] = [flags]display line number[line [,line]] >[>...] [count] [flags]shift lines right@ [buffer][line] a[ppend][!]append input to a lineab[brev] [word replace]specify an input abbreviationar[gs]display file argument listput a foreground screen into the background!ca[line [,line]] c[hange][!] [count]change lines to input!f1ocd[!] [directory]change the current directorychd[ir][!] [directory][line [,line]] co[py] line [flags]copy lines elsewhere in the file!scs[cope] command [args]create a set of tags using a cscope command[line [,line]] d[elete][flags] [buffer] [count] [flags]delete lines from the filedisplay b[uffers] | c[onnections] | s[creens] | t[ags]display buffers, connections, screens or tags[Ee][dit][!] [+cmd] [file]begin editing another file[Ee]x[!] [+cmd] [file][exu]sage [command]display ex command usage statementf[ile] [name]display (and optionally set) file name[Ff]g [file]bring a backgrounded screen into the foreground[line [,line]] g[lobal][!] [;/]RE[;/] [commands]execute a global command on lines matching an REhe[lp]display help statement[line] i[nsert][!]insert input before a line!ca1[line [,line]] j[oin][!] [count] [flags]join lines into a single line[line] k keymark a line position[line [,line]] l[ist] [count] [#]display lines in an unambiguous form[line [,line]] m[ove] linemove lines elsewhere in the file[line] ma[rk] key!Wmap[!] [keys replace]map input or commands to one or more keys!f1rmkexrc[!] filewrite a .exrc file!fN[Nn][ext][!] [+cmd] [file ...]edit (and optionally specify) the next file[line [,line]] nu[mber] [count] [l]change display to number lines[line] o[pen] [/RE/] [flags]enter "open" mode (not implemented)[line [,line]] p[rint] [count] [#l]display linespe[rl] cmdrun the perl interpreter with the commandperld[o] cmdrun the perl interpreter with the command, on each linepre[serve]preserve an edit session for recovery[Pp]rev[ious][!]edit the previous file in the file argument list[line] pu[t] [buffer]append a cut buffer to the lineq[uit][!]exit ex/vi[line] r[ead] [!cmd | [file]]append input from a command or file to the linerecover[!] filerecover a saved filec+resize [+-]rowsgrow or shrink the current screenrew[ind][!]re-edit all the files in the file argument list!w1orta[g][!] [string]edit the file containing the tag[line [,line]] s [[/;]RE[/;]repl[/;] [cgr] [count] [#lp]]substitute on lines matching an REsc[ript][!] [file]run a shell in a screenwNse[t] [option[=[value]]...] [nooption ...] [option? ...] [all]set options (use ":set all" to see all options)sh[ell]suspend editing and run a shellso[urce] fileread a file of ex commandsst[op][!]suspend the edit sessionsu[spend][!][line [,line]] t line [flags][Tt]a[g][!] [string]tagn[ext][!]move to the next tagtagp[op][!] [number | file]return to the previous group of tagstagpr[ev][!]move to the previous tagtagt[op][!]discard all tagstc[l] cmdrun the tcl interpreter with the commandu[ndo]undo the most recent changeuna[bbrev] worddelete an abbreviation!w1runm[ap][!] worddelete an input or command map[line [,line]] v [;/]RE[;/] [commands]execute a global command on lines NOT matching an REdisplay the program version information2c11[line] vi[sual] [-|.|+|^] [window_size] [flags]enter visual (vi) mode from ex mode[Vv]i[sual][!] [+cmd] [file]edit another file (from vi mode only)[viu]sage [key]display vi key usage statementvs[plit] [+cmd] [file]split the current screen vertically[line [,line]] w[rite][!] [ !cmd | [>>] [file]]write the file[line [,line]] wn[!] [>>] [file]write the file and switch to the next file[line [,line]] wq[!] [>>] [file]write the file and exit[line [,line]] x[it][!] [file]bca[line [,line]] ya[nk] [buffer] [count]copy lines to a cut buffer3c01[line] z [-|.|+|^|=] [count] [flags]display different screens of the file[line [,line]] ~ [cgr] [count] [#lp]replace previous RE with previous replacement string,312|%d: no such cscope sessioncd '%s' && exec cscope -dl -f %sCommand: %s (%s) %s doesn't match any cscope command cscope commands: %*s: %s cscope.outcscope.tpathcscope: %d lines%1[ ] CSCOPE_DIRS :309|Use "cscope help" for helpNo cscope connections. %2d %s (process %lu) sgdct efi310|No cscope connections runningfind311|%s: unknown search type: use one of %s%zu%s 278|No matches for queryAdd a new cscope databaseadd file | directoryQuery the databases for a patternfind c|d|e|f|g|i|s|t buffer|pattern c: find callers of name d: find all function calls made from name e: find pattern f: find files with name as substring g: find definition of name i: find files #including name s: find all uses of name t: find assignments to nameShow help for cscope commandshelp [command]Kill a cscope connectionkill numberDiscard all current cscope connections (line mode) (character mode)********** %s%s 123|No cut buffers to displaydefault bufferfilter readparent-writer124|The %s command can't be used as part of a global or v command125|%s/%s: not sourced: not owned by you or root126|%s/%s: not sourced: not owned by you128|%s: not sourced: not owned by you or root129|%s: not sourced: not owned by you130|%s: not sourced: writeable by a user other than the owner127|%s/%s: not sourced: writeable by a user other than the owner/etc/vi.exrcNEXINIT.nexrc131|No following lines to join132|No input map entries133|No command map entries134|The %s character may not be remapped135|"%s" isn't currently mapped136|Mark names must be a single character137|%s exists, not written; use ! to overrideabbreviate map map! 138|New exrc file: %s139|Destination line is inside move range140|The open command requires that the open option be set141|The open command is not yet implemented306|Vi was not loaded with a Perl interpreter142|Preservation of this file not possible143|File preserved147|Reading...148|%s: %lu lines, %lu characters145|Only regular files and named pipes may be read146|%s: read lock was unavailable149|No background screens to display151|No command to executescript-shell150|The script command is only available in vi modeThe script command is already runninngemacs:EMACSError: timed out; core dumpedUnknown signal: %d%.*s%s: received signal: %s%s%.*s%s: exited with status %d%s -iAbort trapAlarm clockBus errorChild exitedContinuedEMT trapFloating point exceptionHangupIllegal instructionInformation requestInterruptI/O possibleIOT trapKilledBroken pipeProfiling timer expiredPower failure imminentQuitSegmentation faultSuspended (signal)Bad system callTerminatedTrace/BPT trapSuspendedStopped (tty input)Stopped (tty output)Urgent I/O conditionUser defined signal 1User defined signal 2Virtual timer expiredWindow size changesCputime limit exceededFilesize limit exceeded152|shiftwidth option set to 0153|Count overflow154|Count underflow155|Regular expression specified; r flag meaningless156|The #, l and p flags may not be combined with the c flag in vi mode169|Confirm change? [n]157|No match found([ ]|/\*([^*]|\*/)*\*/)*\^.[]$*+?()|{}^.[]$*global -%s '%s'162|%s: tag not found163|%s: corrupted tag in %smunmap164|%s: the tag's line number is past the end of the file166|%s: search pattern not found165|The tags stack is empty282|Already at the last tag of this group255|Already at the first tag of this group292|Display too small.%2d ... %*.*s %*.*s%s%.*s159|Less than %s entries on the tags stack; use :display t[ags]160|No file %s on the tags stack to return to; use :display t[ags]158|No previous tag entered302|Vi was not loaded with a Tcl interpreter%6lu To see the list of vi commands, enter ":viusage" To see the list of ex commands, enter ":exusage" For an ex command usage statement enter ":exusage [cmd]" For a vi key usage statement enter ":viusage [key]" To exit, enter ":q!" The %.*s command is unknown Command: %s Usage: %s %*ls: %s The %s key has no current meaning Key:%s%s Usage: %s 167|%zd more files to edit168|Buffer %s is empty144|%s: expanded into too many file namesCommand failed, buffer is locked283|The %s command requires the ex terminal interface272|That form of %s requires the ex terminal interface274|Command failed, no file read in yet.173|The %s command requires that a file have already been read in171|No previous buffer to execute172|No previous regular expression230|This screen may not be suspended290|The %s command is not supported when the secure edit option is set284|That form of %s is not supported when the secure edit option is set174|Usage: %sVersion (1.81.6-2013-11-20nb4) The CSRG, University of California, Berkeley.175|The visual command requires that the open option be set%luz%c%lu%luz%c253|Writing...---------------------------------------- /tmp240|%s: remove241|%s: closeenv_createenv->remove242|%s: remove243|%s: remove264|File modified since last complete write; write or use ! to override265|File is a temporary; exit will discard modifications%s/vi.XXXXXX237|Unable to create temporary file238|Warning: %s is not a regular file239|%s already locked, session is read-only244|Read-only file, not written; use ! to override245|Read-only file, not written246|%s exists, not written; use ! to override247|%s exists, not written248|Partial file, not written; use ! to override249|Partial file, not written250|%s: file modified more recently than this copy; use ! to override251|%s: file modified more recently than this copy315|%s: appended: %lu lines, %lu characters257|%s: %lu lines, %lu characters258|%s expanded into too many file names259|%s: not a regular file260|%s: not owned by you261|%s: accessible by a user other than the owner252|%s: write lock was unavailable254|%s: WARNING: FILE TRUNCATED256|%s: new file: %lu lines, %lu characters266|File readonly, modifications not auto-written262|File modified since last complete write; write or use ! to override263|File modified since last complete write; write or use :edit! to override177|Empty fileex/vi: 079|No non-printable character found276|Unexpected character event277|Unexpected end-of-file event279|Unexpected interrupt event318|Unexpected command or input281|Unexpected repaint event285|Unexpected string event286|Unexpected timeout event316|Unexpected resize eventnviewonly one -c command may be specified.-F option no longer supported.only one of -r and -t may be specified.only one tag file may be specified.c:eFGlRrSsT:t:vw:-s option is only applicable to ex.window=%s017|Mark %s: not set018|Mark %s: the line was deleted019|Mark %s: cursor position no longer exists, %d: 020|Error: 317|%d files to edit021|new file022|name changed023|modified024|unmodified025|UNLOCKED026|readonly028|empty file027|line %lu of %lu [%ld%%]029|line %lu268|confirm? [ynq]269|Press any key to continue: 270|Press any key to continue [: to enter more ex commands]: 161|Press Enter to continue: 275| cont?271|Press any key to continue [q to quit]: LC_MESSAGESLANGVI_MESSAGE_CATALOG030|The file %s is not a message catalog300|line301|lines293|added294|changed295|deleted296|joined297|moved298|shifted299|yanked%ls=%ld%ls="%s"305|No %s edit option specifiedset %ls set no%ls set %ls=%-3ld set %lc032|Usage: %s033|set: no %s option: 'set all' gives all option values291|set: the %s option may not be turned off313|set: the %s option may never be turned on034|set: [no]%s option doesn't take a value035|set: %s option isn't a boolean038|set: %s option: %s is an illegal number036|set: %s option: %s037|set: %s option: %s: value overflow314|set: the %s option may never be set to 0039|set: %s option isn't a boolean047|set: the %s option must be in two character groups/var/tmp/vi.recover031|Unable to set default %s option040|Screen columns too small, less than %d041|Screen columns too large, greater than %d042|Screen lines too small, less than %d043|Screen lines too large, greater than %d044|The lisp option is not implemented053|The default buffer is empty054|Buffer %s is empty/usr/sbin/sendmail071|not sending email: %slseek-t062|Information on user id %u not found%s/recover.XXXXXX063|Unable to lock recovery filePrecedence: bulkSubject: Nvi saved the file To: From: root (Nvi recovery program)Reply-To: rootX-vi-recover-path: X-vi-recover-file: %s%s %s%s %s %s %s%s %s%s %s -r : to this file using the -r option to You can recover most, if not all, of the changes , when it was saved for recovery. on the machine was editing a file named , the user On %s%.24s%s%s%s%s%s%s%s%s%s%s%s%s%s%s 064|Recovery file buffer overrun065|Recovery file055|Files with newlines in the name are unrecoverable056|Modifications not recoverable if the session fails057|Copying file for recovery...058|Preservation failed: %s059|Modifications not recoverable if the session fails060|File backup failed: %s061|Copying file for recovery...recdir: %sr+efl066|%s: malformed recovery file%.24s: %s %s: No files to recover 067|%s: malformed recovery file068|No files named %s, readable by you, to recover069|There are older versions of this file for you to recover070|There are other files for you to recover072|File empty; nothing to search074|No previous search pattern073|Reached end-of-file without finding the pattern078|Searching...075|Pattern not found077|Search wrapped076|Reached top-of-file without finding the pattern179|%s not found178|No previous F, f, T or t search[count]^A^A search forward for cursor word[count]^B^B scroll up by screens^C^C interrupt an operation (e.g. read, write, search)[count]^D^D scroll down by half screens (setting count)[count]^E^E scroll down by lines[count]^F^F scroll down by screens^G^G file status[count]^H^H move left by characters[count]^J^J move down by lines^L^L redraw screen[count]^M^M move down by lines (to first non-blank)[count]^N^N move down by lines[count]^P^P move up by lines^R^R redraw screen^T^T tag pop[count]^U^U half page up (set count)^V^V input a literal character^W^W move to next screen[count]^Y^Y page up by lines^Z^Z suspend editor^[ ^[ exit input mode, cancel partial commands^\^\ switch to ex mode^]^] tag push cursor word^^^^ switch to previous file[count]' ' move right by columns[count]![count]motion command(s) ! filter through command(s) to motion[count]# +|-|# # number increment/decrement [count]$ $ move to last column % move to match & repeat substitution'['a-z] ' move to mark (to first non-blank)[count]( ( move back sentence[count]) ) move forward sentence[count]+ + move down by lines (to first non-blank)[count], , reverse last F, f, T or t search[count]- - move up by lines (to first non-blank) . repeat the last command/RE[/ offset] / search forward 0 move to first character:command [| command] ... : ex command[count]; ; repeat last F, f, T or t search[count]<[count]motion < shift lines left to motion[count]>[count]motion > shift lines right to motion?RE[? offset] ? search backward@buffer @ execute buffer[count]A A append to the line[count]B B move back bigword[buffer][count]C C change to end-of-line[buffer]D D delete to end-of-line[count]E E move to end of bigword[count]F character F character in line backward search[count]G G move to line[count]H H move to count lines from screen top[count]I I insert before first nonblank[count]J J join lines[count]L L move to screen bottom M move to screen middle N reverse last search[count]O O insert above line[buffer]P P insert before cursor from buffer Q switch to ex mode[count]R R replace characters[buffer][count]S S substitute for the line(s)[count]T character T before character in line backward search U Restore the current line[count]W W move to next bigword[buffer][count]X X delete character before cursor[buffer][count]Y Y copy lineZZZZ save file and exit[[[[ move back section]] move forward section ^ move to first non-blank _ move to first non-blank`[`a-z] ` move to mark[count]a a append after cursor[count]b b move back word[buffer][count]c[count]motion c change to motion[buffer][count]d[count]motion d delete to motion[count]e e move to end of word[count]f character f character in line forward search[count]h h move left by columns[count]i i insert before cursor[count]j j move down by lines[count]k k move up by lines[count]l l move right by columnsm[a-z] m set mark n repeat last search[count]o o append after line[buffer]p p insert after cursor from buffer[count]r character r replace character[buffer][count]s s substitute character[count]t character t before character in line forward search u undo last change[count]w w move to next word[buffer][count]x x delete character[buffer][count]y[count]motion y copy text to motion into a cut buffer[line]z[window_size][-|.|+|^|] z reposition the screen[count]{ { move back paragraph[count]| | move to column[count]} } move forward paragraph[count]~ ~ reverse case207|The Q command requires the ex terminal interface180|No previous file to edit307|No ex command to execute182|Resulting number too large181|Cursor not in a number183|Resulting number too small320|Unknown cursor position.184|No match character on this line185|Matching character not found186|No characters to replace308|Enter to execute a command, :q to exit187|No other screen to switch to190|Search wrapped to original position189|No previous search pattern188|Characters after search string, line offset and/or z command193|Already at the beginning of the insert191|Abbreviation exceeded expansion limit: characters discarded194|No more characters to erase192|Illegal character; quote to enterUnmatched %s202|Already at end-of-file195|Movement past the end-of-file203|Already at end-of-line196|Movement past the end-of-line197|No cursor movement made198|Already at the beginning of the file199|Movement past the beginning of the file200|Already in the first column201|Buffers should be specified before the command204|%s isn't a vi commandWindow resize interrupted text input mode205|Usage: %s206|No characters to delete235|Number larger than %lu212|Cursor not in a word[count]~[count]motion234|Only one buffer may be specified208|No command to repeat210|%s may not be used as a motion command211|Already in command mode214|Windows option value is too large, max is %zu110|Vi command failed: mapped keys discarded231|Interrupted: mapped keys discarded236|Interrupted319|%d screens backgrounded; use :display to list them ~ change case to motion%7lu +=+=+=+=+=+=+=+%lu,%lu215|Append216|Change217|Command218|Insert219|Replace220|Movement past the end-of-screen221|Movement past the beginning-of-screen222|Screen must be larger than %d lines to split288|Screen must be larger than %d columns to split225|You may not background your only displayed screen223|There are no background screens224|There's no background screen editing a file named %s227|The screen cannot shrink228|The screen cannot grow226|The screen can only shrink to %d rowsABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ 0123456789ABCDEFabcdefREG_0x%xREG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routine*** unknown regexp error code ***008|Error: unable to retrieve line %lu324|Conversion error on line %d007|unable to get last line003|unable to delete line %lu004|unable to append to line %lu005|unable to insert at line %lu006|unable to store line %lurecord not found009|Log file/usr/src/external/bsd/nvi/dist/common/log1.c015|%s/%d: log put error267|Log restarted010|Logging not being performed, undo not possible011|No changes to undo012|Logging not being performed, undo not possible013|Logging not being performed, roll-forward not possible014|No changes to re-doITEIOCSKMAPread kmapopen kmapITEIOCGKMAP%s keymap /etc/group/etc/master.passwdZ Pu___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumcntrlpunctxdigit646towlowertowupperASCIIA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSbackspaceVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4IS3GSIS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d /usr/bin/rshRCMD_CMD/etc/rmtCannot exec %sO%s %d R%zu W%zu L%lld %d I%d %d uappnduchgnodumpopaquesappndschgsnaparchivedsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshautoselectmanual10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]sysvv71kv8otherhpfshfsraidframejfs2minixfs3vmfsvmwresv%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sUTF-8Inkey wstate screwed - exiting!!!xxESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!csp != &blank/usr/src/lib/libcurses/refresh.c^Ikbs^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminal%s.cdb$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangeacosacosfasinasinfatan2atan2fhypothypotfexpfy0y0fy1y1fynynflgammalgammaflogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error log2: SING error log2: DOMAIN error kvm_getprocskvm_getfiles_nfiles_filehead%s: no such symbolcan't read numfilescan't read fileheadcan't read kfpinconsistent nfilesinvalid address (%lx)kvm_getlwpscan't read proc at %pcan't read proc credentials at %pcan't read pgrp at %pcan't read session at %pcan't read tty at %pcan't read tpgrp at %pproc size mismatch (%lu total, %lu chunks)_nprocs_allproc_zombproccan't read nprocscannot read allproccannot read zombprockvm_getproc2kvm_getlwps() failed on process %u clear_gapcannot allocate I/O bufferPreadalready has a dump headerdon't use on live kernelread %zx bytes at offset %llx for cpu_hdr failed: %sread %zx bytes at offset %llx for cpu_hdr instead of requested %zuinvalid magic in cpu_hdrno cpu_datasize %zu != cpu_hdr.csize %uLseekfailed to seek to %lldfailed to allocate headerno valid dump header(s)kvm_dump_header/netbsd/dev/mem/dev/drummd init failedexec file name too longbad flags arg/dev/ksyms/dev/kmembad namelistclearing dump on live kernel_dumpmagcannot invalidate dump - pwriteshort readkvm_open called with KVM_NO_FILES, can't use kvm_readno valid dump header_kvm_kvatop(%lx)short writekvm_open called with KVM_NO_FILES, can't use kvm_writekvm_write not implemented for dead kernelskvm_pwritesun3xvatop called in live kernel!not a kernel addresscan not read PTE!page not valid (VA=0x%lx)page not valid (VA=%#lx)invalid segment (%x)page not validinvalid level 1 descriptor (%x)invalid level 2 descriptor (%x)unknown header flags setincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeatneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible versionps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON/usr/src/common/lib/libprop/prop_number.c%llirpn == pn!((*cp) == '\0')/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist