ELF(@4J4 (@@zz__PM!"\\@0 6QQ O@@@( @0 fH!@P@Q?H3yР -L6j/P̀݀main() returned߀   ! X(@@T @@ 0/T (/// P-Lx@-@PL00S @0080 0 0 0 Ѝ__)5^P/00S 000/ܲA-@Mp7P @ލ0s ZPP g0 00`V  h@  0R(0R 4OoB M_edAG5^\ 4S/0!8 00 (   !/Hhl@-XP|0 !!X0T0P0H000, !  !;^x5^HhlG-bM0SpPpP7P lЍG$ @T SPQ   P PP 00 B4R  04!@a0C0 T b@ P@ $P  P TP P CGP|BPl=PP P 8$ 0@ @Ɓ5^5^8Ɓ M_@_5^l^5^@-<@P$P@ %7^5^,_5^@-l00: SdT 88S!~o0Y㙆@崉 00 ؉݀@B@-0@0PS@!@[-坉 4Sʀ0! 0    !B? SNiG`0 !! HD<8n0Mܲ-Hhl5^6^<6^@BJ6^ P00  /$@$0P  000/dPd<0 P0/S/0CQ/݀s@-@0S7`P`mP) hP' cP P0000 8PЍp@߁dLPX0` P0RЍp@_ @P8P0Ѝp\6^c6^j6^p@4q6^݀` @ @O-M⅁ $pP{ ?WKw!7GR  ETP00l'0d'd7!`' \7\'0QL7尤ᴴḔἄ e U `P& 6  ::f&fST6 S0媄.]6P Q "01%6PQ P!! *!x& 1t !p&pf0l6#6$1  1 @P *<s$1)0C$10!10C0PU0S 9#9S  @P :$1I)0C*$1,s1,!p1c001 1 @P :|5*$10C$1^ 1 @P :$1Du*0C$1P0! 10C01 @ P:$1t*0C$1=0! 10C01 @ P:$1t*0C$1*0! 10C01 @ P:$1lt*0C$10! 10C01 @ Ps:$1*0C$11! 10C11 @ Pa:$1)0C$1P#Fq㰃 uFW#F#Fx#xFp#pF$p`3`` \3!XT3 0C 0p 0F! 0I 0I F": F": Ft: F\: yF0p09 qF 0p0 :gFXp!JG!p0 F<I$1Q 1!0!>0>00!1 ! B"&$! 03/03/03/ 03/xY* 1G0zGvG010! ,1,! (1(!h$:'맫! 1"D Ѝw6^@`[@0 DSBO݀ܲﾭ\6^0AiP)i ` q6^??,l`?6^6^@hTހހ ߀ ߀@4߀H߀\@_̈_߀߀@H@x@@- @0 PЍO-p@㬱LM P 1 0LЍ001!4 S6QU1S1S1S* o@ TTU   ,0PP<0P 008@P`\  0<0 0^*0 00 \S 0 $ ``06/Tp0$ 0P5/`P?>$ 5/0$ 0P5/ 08`$ p@#8/݀` (p@-d.PT*U@ $ ``06/Tp0`$ p@/(/p@-0 P T@``06/0 ``6/`0p@ /p@-P@@0 T000S 0d00h00p0x0h0x0p@ S0d0i0h0^0 S0d0i0h0^0p0j0l0]0t0` ݀|)@A-0PST@ Sq > 6Bu 00 `0*b6/`P -  0@  0`p7/< `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0`pS0    07/0 `p 7/ `pt0 7/`` 0 6/ ``D0 6/0S000 0 00$0Ѝ@8^8^܀p@-P0 ` T@003/U U 0  p 003/pB8^|@-00  } Ѝ 0!< 04 0 (   !/Hhl\ P/0 !8 00 (  , !/HhlA-0`@TP Vp V hR00 3/P0T00 T0 `@4/A0T0 `@3b8^|A-0@PT` Tp @DT0S $ 003/@08$ `@#84/A~8^ 0o/x߀/0@-0M P@ 0P 000 Ѝ0d.@p@-0@Tp@ttx$0dP 5/0 dP5/0|0| 0p@|x߀<[8^A-(MP@D1P<4i0100: S$ 0A㫀p` 0000 (`0w?C$004  p,00 `0@ 6/0S (ЍA05p`WV xxp FWPd 0 0@0 0(Ѝx߀:6^݀8^pA1@8^l.@ 0!< 04 0 (   !/Hhl\ P/0 !8 00 (  , !/Hhl@-@:A-0@TA0P`dp 7/U 5|UA:|.|U*|U U 0dP5/'|~0dP 5/0 4P5/ x߀F[8^p@-0@TxxPpPP0 4P5/ 0 4P5/P{ {{x߀T[8^C-1M@TЍp`0` dP5/ 0dP5/P {{{~pPP p d09/0 49/ z~0 49/ 0 49/PU {{{0 dP5/0?<#x߀8^a[A-1@T  FPP0` dp7/ 0dp7/ T{R{Z{%~0dp 7/0 4P5/ ~0 4P5/ 0 4P5/P,{x߀s[9^O-,1P@`(Pz,Mz0Jz4Gz0p,z(z0z4z{{ { }@P0 z }(z }(z }[P0z z (z ,z0z4zOPzx߀0S@- S S@@W9^00@o/݀` @-[@PЍG-@Ђp2PRp`0CR`P2R 3C7CR0 0 $ Gx2RS 3C7CR008#8S800 0? &;1414$00L00P0$  Q  !%!b$ R!X $ %$ h0l0& d  ' !0 !  011/P008#8S308#8S0x`0 p h(`8p<151``5008#8Sy308#8SsSW HdHdA9^ T_ [9^@-@` P@h `0 0X 0P0 P0H000t04 4TP$ Ѝp[lI[L;@;@8^@-t@-@h0 0R/  W݀` [lp@-@ 0R * R< RU !0 1dPa05/x1x!dP 5/d1dP\! 5/<dP D!5/ {0d,!p@/ !0 1dPa05/0 dP 5/0dP !0 1dP!05/0 dP 5/0dPp 5/=dP !0 1dP!05/H0 dP 5/5dP[~ _f-/0/-/-/-/-/-/-/A-PpO`0@ 2/ p 0S0@0 @0000@A-P M@` t 0 0 0  p7/0P   p*7/0P    Ѝ "( p7/ PX 000 00@0,1 R `  @0X@p0$0:0d0 00!S   1 0 0S0h006Qd  Ր|0000100 0000 8/0$@0\0` o( x9^:6^9^9^9^|߀ zV^ 0 /|߀/$ R/P//C-p0MS *P`  9 @dP 001Q0000!T0    x40 00 a6/00@PPЍ0S   00C0/$ R xR R  /X R P0R/ ! !  _W@@W@AW@EW$o  R0"" //@- o:^@-@(00 S@ @݀[:^QA-P@@@DT@ 0S 0S`T p` 00  }z`T@T@p@-@P@  0`000```0P0 TPd 0| TPdZ 0X TP<P 04 TPpp@E :6^[߀E@7:^E@F@E@@-a@A@-[@@-U@ |0 0@-I0 0@r0 0@l0P/f߀@-<0@TP [0 0 @S߀0P/QJ߀p@-0@T/ 0S S* S& P 0 0 P PU, Pp 0%D0P0000C00 0P  pp߀RW SW 0o/߀///<0Q 1CQ/ 0Q0 /00 W@W@p@-PP2S v@vP0T00S,0upG-M`@P2`0p 봂 XPڭ 10* Rp "Sk pd2d P00 000!h8" p-PQPF 0 0$P(0SHP㰑0SKP 1@uP 1@uP h1@uP H1@}u@10S h ,嗃00h0 01@0b0!dЍ0!p P_ a` P0p 0uP0qw u0* R t0@@uP S T0@߀:6^݀K@` [K@8^G@K@8H@ XJ$[O@O@@-//G-s@dVʀ 0! $"0""   !P 0x uuP0S txP0SP0SDP0SK( ]0T Q0S010R0P"00 S]0 ?0y su u Ex0S {u IP0 Ѝ [݀Xgfff:0[Q@-Mp`@ p˪4P !ê  Hp10: SRZ e0s(sss@  1r@  1rP0P0P 00P0@fk 0@_k 0@Xk 0@Qk|0x 0t00 0@奾P <@00Ѝ]:^:6^W@W@݀V@HW@Y@DD}BX@-@-@<0 @0eX@-7@-0@P1 kp00200 kp0000 0000000000 ukp000 Ѝ0\ P/0 !8 00 (  , !/Hhlp@-P@`0 à  00CS0 00p0 SpA-`Q`pSP@P1W p0S0<000S0;,1UP 0 00000 0 000 0 000(020<0F0P0Z0d000000X0UP000000000000[ [[//s@-P`P@ 10: S)Q00qq@ 0EqP|+ 0@00D00<@H00L00P0墄0P |p0|0Ѝp00!00qq0 cLP,Ѝp@݀]@:^Z@l\@T\@<\@:^8^@-qP@-qo@- 00* R | SqQ@ y H000* R Sq݀` :^@-@q0@-C9!: ^SpP3 @4T004 0040606L00L000 0l4/@-@, D$0 0Z?Ѝ<]@;^G-P0 VPU0p`F@T qp YX!Q0S@p K@P \ HFH@ @S@߀;^+;^I;^A-` f`V@lPpSF@T 0Q`H0~ @,{ |F߀G-`0000p@0  PU x0(60\ (0S Z00NP, @\@ Ѝ"߀P/xN0@-M@P 0 P @  0k@Ѝ00@-M@P 0 P @  0b@Ѝ0@-P0$M000@R<` pE000SE0 P@ 80 0`0E@ 0 0P0@0E$Ѝbt߀0@-M@P 0 TP@  0H@~Ѝ0@-@0 ?P @  R@jЍ P@- R ZEZE߀0/߀p@-`PpPDTʀ 0! $ 0    !0 2/P 0!H D0< 4  , !p0߀Hhlp@-HP0PSp P@ `6/00  0p@/߀p@-x`0SplPP@00C00SP "0 `6/T 000pp@Pp߀G-pP`P@ P" P PV `FPE^@P P #P`UT00Y0S<4H `@Cp;^:6^t;^^/@-0,\ @T 4/Ѝ߀00S/ R//߀00S/ R//߀p@-@P. k.0p@80/߀ 0 S)p@-@0@` !P0 R  P RP V0S0@@ P@@00 , !p/ĂA-@0@p !`P0S#P ) R00 @T tt@PA0P !!P  0S R00 Ăh@h@ 0  )?)/ 0  )?)/^/@-@q dQ0P0Cq 8 q (q v;^;^;^;^;^@-H M@8 ^000 0 Ѝ:6^i@0@- 0@ ,MPr           0 040$0墵P 000 ⸹,Ѝ0h@/0/!//A-pQ`.0  P@ x0EP Hpp`@tT:80*0 C'J x@X[@-;^@-;^///1/8#81/1/  R/ R/  0s S40@o//0@3S0//;^p@-@0P\3/>p`S0Dp@/81 0$$# 0p@  /;^;^ [;^;^Q0 Q Q // ^;^;^_O-P`M 0 3/Ѝ03/@pyQ   0RP$ D 3/0 0Sp0 0 "R 3/ 0A0CS003/ 00u0d0Q 03/$.!3/(!0AYS000(c0C S#0x   0P3/ 0@3/@ 003/W  03/0 3/W0A CRS 000 0R3/07 t1p 2/0 30 r#0`3/ $>$(0". : S0 3/$&0$0$3/0 0 &6z R'zppF0$0l3/d60S T6T&0S H&ZD0<3/0,3/ Z0q03/$rO8pOS p $03/50S 5Z 2/5  0tt3/ZG 0D3/0T3/0zp! [  +S 03/ K R 03/ 0W03/0\3/ + $0`$0 $V0Q$80 0C2/$01?3 ?3!?#;00 2/@q0s00$* "0 : 0#$90"? :$#: `0PL#0$"@0007S0  S003/ 03/ 03/ 03/000}0x$3 0$2 t0$0d, R$PP03/$03/!t03/0|3/0p3/WF 00$03/$($0p 7/00t3/200pd$($0 7/$8$&$p00 0`;^0[P[ <^^<^:6^<^`[[A^u_&N_a^<^ [<^#<^j<^]^;^0<^/6<^O_^:_Qx_;<^@C<^M<^S<^]<^_<^U<^a<^[e<^i<^[ [o<^;^q^y<^~<^^<^,N_<^^^^B^=^@[H[<^<^<^ _<^<^<^<^<^<^ FP[//`!//` `! /0/c 80/c#c4 4#0/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ 0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/ R/c 8 R/ R/c#c4 4# R/ R/  R/ P r00 / R00/bs_notimpl_%s: args at %p$OU- mmap- r_1- r_2- r_4- r_8- w_1- w_2- w_4- w_8- rm_1- rm_2- rm_4- rm_8- wm_1- wm_2- wm_4- wm_8- rr_1- rr_2- rr_4- rr_8- wr_1- }wr_2- wwr_4- qwr_8- ksm_1- esm_2- _sm_4- Ysm_8- Ssr_1- Msr_2- Gsr_4- Asr_8- ;c_1- 6c_2- 1c_4- ,c_8P0 PQ/0@o//- /0/-/-/-/- /$0/@-`@P (pW @/ ,pW0  `//p@-@$0P`P U!0"8`<` H @ , H H L  H  0  (0pwwwwp@-@$0( S p@4 ,00,0/0 R,00,0/p@-(0c10@ T1PUpp@-2@02 P<0#0P20C22S }Upp@l2 p@-\0!C !2 Q02(0$! m (0$!p@R/L-, 0((((S l R B|R/xRi-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R  /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L-ȩ 0((((S l R B|R/R}-0 B RE@P`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p R@P / R@P`p@P@P`p R@P /@Pd R@P@P@P@P@P@P/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L- 0((((S l R B|R/wRh-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/ # ($0(000(/ # ($0(000(/< # ($0(000(/ -L R l\000Х000 R 0 4 8 <0 R  /R000Х000 -L R l\000Ѥ000 R 00#40#40#40 R  R000Ѥ000R/ 0 R0#40/0#8 80 R/R/ 0 R 480/0 R## 8##,0/R/0@-0#88@$HHP%XX,ȠȌ8 R0R/0@-0P8$#H$8#0@8%#X%8#0P 8,#, 8#08.#.8#0 R0R/C-R :08PHpX hx R R:x08PH R R:080 R R:0 R0#40R/}A-R:#H#8##H$%h%X%%h&''x''(,,,,.Q R R :#h#X#%h&$$x$'( R R:0 R#X#H#$X%0 R:0@ R480G-`PM0SV 0 S S SM !Spp W 0 @0 R =R DXP 0=S0@V20V 0  SR0T=Sp'p P@ y  P  ➐ ,EP Ѝ`[7@- 0@P P0P R Sp @ Ѝ0@-@0 }P ſ oЍx-2`? @C @P(PP`5P6(5?3`x/x-2`? X@C @(0000]ߍ`@P X@P0`(0 06PN@ @0 4/@6T5P @> 4/@6G8H?1 !0R$04$0//s@-`P@P!0P0sJX03/03/0?00?Ѝp 0P 0S00S 0@ S 0@PQ߀߀p@-AQ+ 0S R[ xh90_03/UC 00<000S: #: " 8! 4^#30 00C 300% %6 P"8 U#30   00C3000C0$00pB@e߀Ai!i @^1?/ //0 ?1@o/ጋ//0/////?  22//-P/6ᨌ N?  "2/!N80 Q @-*O@P O /65/ N N N5 N:6 N: N1,   P QOO/l  0 Q!N:O56!N:O6!N Q* : QO N Q* :65 QO N Q* :6 QO N Q* :5 QO N 6 Q N N//$04s@-0@S  5(00(0/O- R\bY I* b$\" %in_cksum: out of mbufs p 0 A2$$pgQ/pWq'2'/QRppA@Q@`  `  @  `  @  `  @  `  @Q@  @/ Q@`  @  `    Q/0@cQ@0  0  0  Q@Q /0a131 /!# 0(0000(0 # 0(000000(0 # 0(0000(0 # l0(00(0\ # D0(0!0(0, # 0(00(00(0H00S/@-@0  "!$0p03/0 !!h߀03 /0@-$@4 ⾿< 4 @ 8 L < @ 0 < /p@-P$@4 ⧿40 <080" @0<0 L0@0200< @  00p/$ 0L 0 00/1 1400 001!/$0</p@-$0` @ P         $  ( , $ 0 ( 4 , 8 0 < 4 @ 8 L<0@0MNp<0001X1070 0 0\1pO-81MpC0 40$P刢!.!n@ͪ0` 10178001gZ4` !.p4W ig0000 0 00 `L<`划0@0 0S101ߍ@00S/A-P@`q& @00S8$0            $ ( $ , ( 0 , 4 0 8 4 < 8 @ < L @  X)(31011013 0\! 6 SSO-0`@p0M 46CSЍO3t ,000 0$0L0 0C0C004pmdЍt!pppV 0  Z 0cQ  V J<!PP)1\Z 0  RvPP P0Wv  0  3/ ZPu U  u 0P200" 0 0 0L0 0C0CL0P@-0t 0@@$!0   80$ &08@1011@2/L00C 02/@ $0 " 00000 0 0$00(00,0000040 080$0D0(0 L0/S$! 0 S 0@-0ZCU lPC^   LL& &0/0pP 0@- @ |M l Q \\ QQSH0t S(0  !0 @pc|Ѝ00!R 10/p@-@P Pp 0 S   0@-4 0S$ @ O-2|Mp& &  , !`LP PEPELP`0F?oQ26  V@A! 1B T : V HX! 0"@H      "RD$  0YV#  j t ∨0  !0 Pb|ЍV@@ 0 ;/P t i0 !0 P$@b|ЍO_V@^^@d@@@$@@`BO-`P|T&B^[B^G-@Pp @ЍTᱮЍb2"0S@0j0O-@M<`N@N;@5TpP3:T#3p0 ;?oZ20S 0 0PH 801P;0; 0 X0TЍ`@ 0 SPTf0 0 0Q0 R0S 000 R!>S>0 jJDV:V: 0 xX[B^p@-PN@N@% 0  p@0~X[x@-0 PS@0S 0#G-p`@00hTЍ PZe 0 1UP! 000 P`@D@-P0,00000`S3 :RP00p 0p0@80$0p00P0,Pp`0 ЍO-p M, 0  (0P @0800T0R0S R(0p,000d1000ЍPU @0A#AR F   P P P3 0 0000s HP0` B0 0 0 H`P0``>0 BB6*a"*UbY Ԡ0 0  0 P PE 0H0 H B O-@P0,08p`00 SP Ѝ0W0P0S` 0 W10 0  pG0P,00000O-M Sp@`Q:LD0  0P0 T P%@g P @[H0@@ Y:S P%0:0PD0@S ¬ Ѝ2 O-@MLT) Pp` 㸰@0SЍ0S   0 00H0  0D0 0@00 0P `@H@ D@xP@-@P`U^p^0.b Q  0 0 ^ *4 0L0\!>00P@-//G-)0PS@XqM` $ R  (0+0  VPV0P00 0 }Ѝ R o *0VPV0P00  0 | b$ R U (0+0 VPV0P0 0 0[B^B^C^//@-M`@PT#L,'@0'4 UF/$ 2?0Rr ``p`@Q``` PPP T@%PP `1l p 000T0  @Ѝ@Ѝ;C^HC^UC^$(,bC^C^C^A-HCM`PხTxЍAtRh  !pŸ *Q   0"D3S0P 0Sl ∨X!\1L L < ,  g|WT3:WDT3rT3@mT3  hf1!0S 1*B0S. 1F@T/+0pW0x! Kh1 \T ? G R887T3 ,,$$.!1@TT 0 0 0 0  ~W P01GT Ѝ C^،^[^C^^N2_)D^2D^?D^D^D^D^D^D^:6^AXVD^[ ^^D^kD^wD^D^CD^QD^`A`A4l"5^D^D^#E^C-pᗭPᒭ@P03/bTD03/0L30HP3,G?07@s娭:2C 00޻2  00лd2  00ȻH2  00,2  00⸻2  00ⰻ1  00⨻1  00⠻1  00☻1J 00␻1N 00∻h1R 00※L1V 00x01Z 00p1^ 00h0b 00`0f 00X0  00P0j 00H04T ЍCd|` ЍC߀QE^^E^kE^zE^E^E^E^E^F^6F^JF^^F^tF^F^F^F^F^F^F^G^G^ P-`@P p!c pЗ!P  R $L@pL 4D 4/!`@S`!W , ,`! !oDЍlReset vector called, LR = 0x%08x-DMO-pBS `!W , ,`! q!oDЍN  0O   ! "`"Рo; T S3 RLDLOoB@ 0 u P 4(S$ [009" 0S00&R ! R &R l!l R `A@\1T@@@(0 0_pP0( 0S c R [ (0L0Ѝ0 t 0 Z0o Z ZA``PzO@0 q0 X 0(0^ 0Y ( X߀`[P^߀xHP^vP^P^O-PM1s0100S , !QL@5xxxT6 T*h10S0 1  00 `P6 0 oP/ t ~0 [0 0a`Pzo`0 0 c 0 0 0t ^0 0 0$  00@4@<0  P0 @TL@0* R @DЍ߀P^O-`1`d0P@3/tHHaWDʀ 0! $ 0    !U U( U1 ?oT20S00 0!t!0   , ! Ѝ ?oT20S00 ?oT20S00 ߀Hhl[P^00P (031000Co//!:!P/ 0 00S/@0. 04S/Q0 /0 @-鞘C.@-闘G-08M@pl00 00,(p$@ @@ @`Pl0,0L0 0D000000(p$@@ @`l8Ѝ_VR^0*4S/0S0 0 /000/߀*4S/@-0@03/0BN0߀Q(QT0\0 )Q/R0 S,0@0D0//S/0H0߀Q@-@ (4S80BNX03/00)4S0<03/0)4߀p@-@0Do A("(RP p$$Ph$! ,$" \%R 8A 00CS0p0 p@ @-@|0T0S$D 0SX/! 0S@@h!<0QD$   D$ @@DD@.0 04Ē Q884/0H4S/XT H$R A@-@@8P 084 $ 00u4x@A-P @`pTQ 0 "A2P 0`PR  V`p@V0A310030P/- R   B B  P^^ $ B$ , Q R!! B B!!P/0S0S/A-@P Pp/ 0`00 00  0 $  B$p 0V !SA  B!! SA  B  0S@0S//0O-P` @P\Q pQ00ЁU00SE R㴑; Ѝ ^^p1Q@` Wp0U0 WU0 `` 0!&Q0 !SL   0E&  @T00 ЍO/QᤠT ``  U [  R`` `!& 1!L0L  o@߀G-1pS@0!R00R0P  \  \ 1!aV0`0ó?0`QP 0  ^ ` 0S 0PR" S 6YY 0S 0h0hS 1S 0h  PU0S0`000[p@-0PPdL4S N@l $60L0V L0?4`003/03/+͕p߀p@-`Pܥ@#<@2t\[TP_X[_P`\003/`003/03/`\T4PX4P__p.߀p@-D@[PX_0``003/03/`X4P_p߀O-Ph4dpQLP4Q9 @䀟䠟fU*%*1Qh \ : 0010?0@03/@0Ph/%!1PLP L0^뚟@03/@Z߀ ^R^/O-p64M@00[6PH4S 0 ; 0` T0 01000X0000]m6T =0P0 +60$00$ 0(01,0(010Sp P p pV, 0S0PS0 4pp0V :]W @p&: :6S1!0P ` 0 &5?00 V:U 000 Uc0SP0P 4  4 0C4Z% 2P <00v  T[ 000 U00 1  Pj 4p pS  U0 0?$ 0?, 0?0?0P 400? 4Sk0(4S   0y X4Ѝ0.O-@p@P` ¢PP`<`7[   *60Q000  ԰ @03/00 3/03/'  0P4 0?PUP'S 0h<0孯O\T00  S  S80d5 ,0L42 S0`5߀`0@-0@D0PSM∑PЍ00 0P 40 U0*00ꄡ@O-@pZT:003/O\$ZZVUP!N`$5ᔠ?`U0 0C0P @0  <@0Hu 00?@03/003/J`߀A-p@`PtZC$4$*$00Sy[\(DF0@00V@U($<01S  2# R\>\$60T6\X 0S(H$HJ$J@L W000 00 p@- 0$@0P000Sp`H4S d0)$4$֥H P4Sh5hE000D40@@DDpR^O-`MlP@Y0I 0000 T : 0 S:0SMЍO[$jjf V `!vP@ p$5?pT*. , 0 ? ᚯ8뚯R0 p@p@p[.G-0X`TL4 :0?003/03/@`pM=P 0` S@03/@@@00?003/߀0' 70/O-xBMgV<*dZʀ 0! $@"08"0"   !7&j aw0W:Q<03/,03/03/f 0!!0 !!   !Ѝ!':'|00QU9 '0 Q P*0?P0.71p p00 R'  0 (P 0  Y) ' 7+';7pP P P h5 S7`67$ 0Hhl.߀hp@-PPP@}$F@0T0?@003/0p@/߀߀@-$^$!ʠ A@ ! R  L" !R  ," R !  $P/$0!10/O-$4$T$D,M w|T0 0=$4P L H `г~ !Q1 $ *P$  )  PVx㖠 `    ἐ ^ $3P$  Y 'P b<03/03/03/ 0 72|唗ЋP  )5? T唇\딇0PD](5? `X唇"0S70977'3C?6C0C#:%. "&0#2>0#6!' 7D h@t1q $4!*$010w,$020 0@01 0(1C0 0@@ @@@1 0000 @@0 0000@@ @@@+000@0@0 @@@ Z<0,ЍO/..S^S^S^T^߀`T^8@.߀@T^@(T^0@T^`@T^/@-80@ = @G"0H4O-$M,($ 1@`{PQPP(PE\ܐ(Vᖨ(:$Ѝ0 'h@P|0 0000009  mPpp@W T:`Ԋ 00JpHހxT^ހT^@0!S@0d4 S00h4 S$0;00;010?/p@-0`S0@LT!* Sp0PT S`0dUP0SHP,$EOM0?pT^U^-!01; 00? 000$O-~0PP04 p~R@p R R1!ěd`V Ѝt!l1d弋L\!T1h帋PV[#0$ ! \ /FVfF<R0 R  P $%/("(VR#  U뚿HXhF /JZjF;U^H[`U^|U^ !:!/ )A- p@P` X0 X000 0p_Ѝ p@-@P`++`%L 0+L$;;d4;hdkPd ;/0SPddkLd+;+ ;;+ ;0+0 ;;x;p;0+.l;0+U.h;0|+.d;,0t+`;$0\;0?00?p !i@@G-`@0匀pB00>0>0PT0?0?0000?$:[P($5?[ J꜌U^O-@ᨐ娀zT:00ЍO/ 06Sx`1`!'P$5?PT:0?L0 HS @03/003/ J߀0$4 /0  ")//0 !Р!/0 ! !/p@-PMP# @,`ᨈ~0t00 \ 1(Q$  ,0(&#,0 <@0?6/ߍp-ʈހP002'0 S#3/ހ 0P/ހh0qp/@-队P p< 0BS B 00-PO-@2@BM<03/ sr $R0S0  "S  & P1ЍO?+ᙜ`Ph 0Se T@tЍOiP;0Q@p1į0 00S\>0p00 I06SP1A 0 A0:0 0 0 00\ @X0`@Dp@ o00 PdL0000L0V^X[O-pRMP P`010000 P= 0 R. R6& DF Fd˃0 0 1/1/ Y @1FI UR0 `0/003/03/Y 803/ J$JQJd~ЍX[߀V^0/\0/0/T0@-@0 @RS ,0 Ѝ0000\l0P/0 S/@- ^@LS:0 0CS(0 Sl0P/0 S/@- ^@LS:0 0CS(0 S @-v0 0@/0p@-`!P 㷲@P$P`h00a{@p@@/A-餀`@Z0PU |p R0P R 0L  {z0$A ~@/V^V^7@-Pd000@T T 0PE0%VE$ @ Ѝ00S 0ES:@@/0-  0@P  0@@P  0@@P  0@@P  0@@P  0@@P  0@@P  0@@P \ 0@0/ 0 Q/0@-3@PdM *QLYdЍ0  00R( 0 z  09W^|[LW^p@-P!@0PS ?!600#Q0SP(?0` ; S00,0|0YZ2Xl0%XS40T10P3/P14 X3P S9@A WT00 00p Ѝ\*p@-L(0H@P#04X3 @t3$0S$@p@~\*@-`MtP$pf@cT 10'*"*0*00(00,00 $0$00Ѝ[p@-PP@^00$000P1 0P$P LM`0P1 V`p@l09SYS! 0C023 0t[QqPo0Sl 030 30303:303:33030400,0.04 ,$0 00$00202120080$0<00T!P 2/0P13= 3 00*00`aS_S<00SS 3 00000 ,00*0020 00#0- 0 00 0#4>`nW^X^11@@p@-l0( h@"6 0TX300$00p@fkP夑P p@\*G-@ᤑ`2PY P1ЍGY D0T`0"R0L0Sl r 0 00000 R!jhY 0S<00L0S,3d00!C=lЍG lq 0 P1 ?P *0E P17$qP R  qqqx3 d00xC0 00 2@0S *"*f0S 0S$00P1 q p40Cp4 ЍG`q[bX^5^xX^:6^GAW^SX^W^FX^jX^FAXX^p@-PT1P @0`3/P P P1 T1 0P3/T1 0P3/P` P PP10S p( L6a@00;000000 e66P1 pX^X^p@-M@ PP *l0B8#8S 00܍p:< 8000lP!Q     8@-M` PpP`-*0B8#8S) ' Q#P1- 0,00@400300r2T10P3/P1+4 P1` ߍ-`0u[@-@8  <t6> "(Y?0,0W?000X3@V?040?0  R   L?0 Q29#9P0t$@yp@-T1@0P3/PPX3VP <T1PP03/pX30;X3X^O-MpP`@ HQ=  0pdT10VP1 P1% P1  xcck=kkL PE  p`x%ỘҘj ƆP1  9 ,5,9P} PF~D00,(P$  `S0P 0$_Ѝc moH0Q Q P\ H H'D t4tQL1S /0T t$tt xL1 (0P!00P16 ?0W X3<X3n?0 X3@0X3X3lq |n2 $”`!Rp#p3?0) R pt   -/ pjt 0s?`9 Si&i `!<#ĠhlÄ tt #Y?ⰰX3岠@0  ?~0t# dt W tPV  084t#0X0P0S`  ` #fBQ ,@Ⱁ X00X0 `@帔0YP P!!0S`ЍJ80 ,,ĠჁ ~R`0ЍO~ЍOЍO 0000100000` 080,041 P0`` `\*vdndQ|HApIAA-`0MX@p `P\ $0HMzP 40 000p0`0Ѝ`\*R/00S  00s  @o///p@-P`P10@,0`02X0!40T10P3/P1  HP1p@i[^@@0uh[O-pᡌ@ 0 ĕ`P[x'p>Pe1 !)0   0 P܉UR T1߿P 03/  g =g  g 鿄g  g g  ᘕ᧕tTU T0t4 FS 0P!0P!0 Ѝ@?A[t[@-4T1@0P3/P WT1P03/p@-PT1@0P3/P00>pY0   " ""   00H00D000h0[p@-2RP0@`2 R R0L00QP0 <0L 6#p@ /0L00P0 \^E\^p@-P@` Pp0D02( 02<06# 2/p@ , 0    , /  A, 0/ @  /O-@`DMX(h000 P<0 $0g YH 0 \0p 0+ p t0S 3/0 $ _02\ 0:/ &2@ QP8 7P  ၒ2@  T7ՎP80!0d R2  R00p + 1\ h0_i\^r\^X̜CW[_\^[\^\^\^ ]^A-0<`"Pc&@p? 0S +000 ; 0 0S0L0+ {c 0 00X0'<0ÌPX ` Ѝ000(00 x0S 3/ hP 2  0   p@07/8(0< ,0(000,4000 04 @ 0000CS00ӝڰ2Ld ]^C]^_]^]^p@-@P/ g  pR/ 0 0Rs00#/ 00 0/Q@-@  ]^]^Q@-@ 0]^]^A-@PᖈD0S0D08 R0p`8 RSW O< `V< < 0< X X <00<00 R p0]^A-R@p 1SD R8 < #" R0Q ޤ`P\p`00PPs 0A; 0D p@-@ ]P0 Rp   l00@-@MXP 0T0 00p@@Q0 @0B -Ѝ0]^]^ 0!< 04 0 (   !/Hhl\ P/0 !8 00 (  , !/Hhlp@-  MP@0 `w00 00 0w@ Ѝp蓺^ppA 0/@-@ 08 0(0!3R@-X /@-@<P80080<0A-`nPDP@p80SI 0Aop0 0ATAvP <00Q@Q<00P vP XyA-80@SP <0Sxpƣ`<0S<` ὣ0(S8P<  @< 00A-P@h003/P` P P=Ah003/pW h003/O-0P`04@T p p 4 ЍO  0S0 00ٶ 0S     0R <0X2)QA    Q!PX <<h}P 0\ R 2/P \   0  0;; 00X0S000 0,\ $ ` @$( ?Ppq (    PP X 0R{ R\ ` $ @` [^^a+p@-@P`! 0B 04@0 0Up@0`0S 3/ 0 pp@媱p@-@P 0<X00X 0@0 00S` p@(00X0S0X  0@ 0 0 048 0 0 00 R0S 0=@Sp@A-`P@0pSDaaP 0\ ; 0`0R`0$0`0\ 0( ?S0010(000C0 0 <׵AA-@p`p0<00P P h0 03/<0P0 ⱵyA-@`帀0,! ,1Q 0 @:XMb-  2 05S=00 a`09#80 8802 0<<0A-@`Pp<`3  A dG-`@PP@  㴞,pr0S S8 @᧞@ D1. 尓 ,/ 408p<003/3 3@ -0#S0RR00R0S @ 00R80KS 40\$ $ S 0&$ $ S ,@ 4"4T0 NEFXPi'TDG-p`P八@PP 0,00202?Sb40003/S3 PP>O-M MP0` @0MpP00SM000J/<,Pw <00090度`bS00T2Z< :  R+00d [fd R  PWW tad R  QH000 0SA R* p0S'=pW*0@ Q G@000S0S00ąÀp 0p0p00S ۍ ЍO$p[*Wۍ Ѝ t` tp0pGWpX8`LHD@Wꐍ^T_^Jk^:6^B_^o_^~_^[_^_^_^_^O-x@4MPp580S<0:l=S4k08$QD`V< #" R<Z嘸D`08 R(ʎ80 S,d0S 3/ `80SN{l R00 ` |D dl>< #"0^0<` `00SQ  00  `0$p0 00 00o< `V K<0 0`. <0 0Q Q<0` 0 _^_^pA`^p@-P@`S PUp0S \P0 P/ 0 /p@-@P:@tpp@-@`P-0 @Tfp0S \@ Pp@-P1 P#UDP3`0 P0 0 00(005@$ ,00$4<p`^`^!`^(`^@-@ڮخ4֮<Ԯ@D2@-@ ,AŮZ0S/`^p@-@P 00P`ZZAp@褮A- a@TpUʀ 0! $ 0    ![ 0  @ 0! T0t l   ! 00 0h0 03/@T \p P Hhlp/0S0!?S,0/8#8S00  R 0 0 000C00, 3,0/?Q0, 0,0/00 ( 0 ( /0( 0 ( 0 / 00(/0/O-ZW0P R @pnp n=,n0帢,<zpsL!DH1003/j#-  Ѝ_?0Q R 0hɴ100100100 0峴-/@@@5`^c`^G-@p`NzYh1H0 @H0P  0$ 0 0 XЍp@-XM@X  j< H0XЍ0@-P$@\M hư\Ѝ0X uj 0 010408020H0P 020a^2p@-$0PXM 塰`XЍp,0@S SQ 0R,@`X  @j0T1008020 H0iTP`  wP,@)b^Sb^@-$@00 3/ 40S 3/00 3/00 2/p@- 0@ `4P4P0480(0p P ii `PU 09 0P@-@p`M@0 03/ 0PPy99 0sU W 09 00<0S 3/ P0p03/7/PPh 0 4pW  7/PP 8危$0 儱m03/$0 PP$0 0 4PUebPP$0 0 0 $0  0 UP $C 0 QP 8PU4P0S pp 0 0S $0p p00 00 Ph PU 09 0 0 9 0Ѝ@W Ѝ@Ѝpb^b^b^b^b^b^b^b^AA-@`,H+eoLp@PU  0R0D0 0 TP03/XT0S7 0P  CP0  ) & #2!1@ \1 Tp00  0PP 0DEG?0 00P[  P @P P@  P[@pl[ 0 | ` PT   0@40  0400P~ 0 0 0P 0  0Pg 0P 0B ! YSWD گSoc^d^c^c^!d^Gc^oc^X[c^c^Cd^c^]d^wd^d^A-0@P`vw*0) 刬ow僬J0S V hɮ``wVPsZw2"8lSw $fAcd^d^a^^:6^d^e^$ X0R/0p@-)00+P@*0,,IJoNOP`xVPp(![C-OopPd`【\MBX  0S(0 0TP P0 3/ `PP, PP G꠆qe^e^A-@00PP 50000P80P0800 03/pP` H`0p`0808(0Se^e^@-000 00<Ѝ@-1 0 /ЍA-@00pP0 3/$`Q\@    0 03/P tϭ5`P Xǭ0001y  1\1\1 Q004`V 6/P` 塭 @T :w0  Э03/tȭyPp`P,e^e^Pf^(f^Mb6f^Df^0S/pp@-0@0PQ 0# WPL`0S 00A0P30PU*<p -XM_0S/p@-0@0P( 0# p@-@-0 03 0Ѝ@-!à0 0 Ѝ@-0 03  0 Ѝ@-!à0 0 ЍC-Pp`@X T 0  Ѝ0 P`@DC-Pp`@X T 1@0 0 Ѝ0 P`@DC-P`p@X T 3@0 0 Ѝ0 P`p@DC-P`p@!X T !3@0 0 Ѝ0 wP`p@D@-0000  0Ѝp@-0@0PS 0# p@Xp@-0@0PD 0# p@IG-pit0(0S P@P duP`@Vu `EP 0S00(0 3/0000@00p@-P0(0Sp@` 0R000 Q0 (03/0}p@z@- t0(0St@p@-@`[PU0 p@,0/0 3/Pp@-0@Q0Pp ` 2/P D$ @p 0`( "4`#/ 0 /\!\R TR /\@ Q/ 8 R //᠆,@ G-`0$ MP0K p  pp0@*4/@PD00p8@0 4/@PF<1@ 00@P8p0 X (lc0 Xd000p0$00(h`X0l`射@P$0 00 0֮ wP@P $0  <03/ 403/Ѝ rZp@- P@@@4X`TQpC-@$0\MPp`x( X  c< YD00010<@1`1d`H0$0 00p0 0 &P 2"0 2"P \Ѝ@ 0b0?o0cS2   $ $0` 1011SX b 010 80t0H0P X  b 01$0 080H`P 0  rr2 6$G-@$0XMPp`x@ ?0 S㣤030# 0 X  b011 H0P-X  pb< YD00010<@1`1d`H0$0 00p0 0 P 2"0 2"P XЍ@ 0b0?o0cS2   $ $0` 1011SX b 01|0 H0NP X  b 01$0 080H`<P 0  2222 6$21BP31 a1/G-0M01S`P`1 @o $0O p00 pp0@0*@4/@PG00p8@@0 4/@PIX1@ 0@0+@P;p@0 :X (a0od0@0h0l0040(0D00p0$00X0@P$0 00 @0@ u@P@P $0 @ <03/ 403/TDЍ rG-`0$ M@p0c   0P*5/PP@008P< 5/PPB,1P 0<㬬PP4< ỬX (1a0$d0R`>:pX  gW 0@ #0 01020D@H0@P X RW 0` $0!01020d`H0x@P X =W&0160 H0k@\Ѝ@A-@M@! `Pp 0 1pA?!0#@P !0@P 1 4Tߍ0 @k^Lk^2k^Qk^^Mb6f^^k^Df^A-PL@B`mP0n`啕As@- 1`QPpce@p:e_e000#<0RЍpm_HP 82<"0820 <"00P0t0L`000 01no1010s 10CS1nIevdDAp@-pPe@mopP P2""N0 0 pPP0P0 P1Ap@-p@dPmoLP#@ @@(0 @0 @1wzpBA-@`$0@PAN E KPm%U 101WUPA%7101A-pp@`PdoL!?R01 AWA-p@`@D0L!mϠQ  p a00$PPЍA60 $0+ |PP 0S:d0 0000llL 00 01S$0P0<0$8 0?ЍAhk^W^k^XHBp@-@0P$ mo $@1S1p@ 0!< 04 0 (   !/Hhl\ P/0 !8 00 (  , !/Hhl (0 R 0 0040/4O-P(p峚P`@\p!RWㅡ& W5 p@ P`p1S0 0@0 A\'0S0S  @ T  啘 R 0 00qT 0 Th 0S 0S0S 0Spk^k^k^l^@-0@S f0l S 01 0000S>@   Q Q  0PA-(S@`p0 100PU0S0 8/00PQU0S0 8/Pk^Pp@-P`0@0 P`00 R @p 4@0@ 1Sp R  R ,ԙ      0k^4Ol^@-@ R 040 @-^ 0/$0a(!"$a$"  b"!4b4#0/0@-0#? d@ ? 0#?00R0S0@#? u BP.?  0#? 00R0Su0@#?d AP.? 0#?00R0Sb0@#TSxAP.^ .?o2^0SP@^D 41PU @?o2T0SA@^7 0PU @?o2T0S20@#?) @P.? 0#?00R0S 0#?\p!?Q0/o"0#?S R000  Zp@-P@Q P p@0S@G-P@`pW XP @p@- 0 PX\l^@- @q <Q 0(Aq l^l^l^0@-4M@Pa000(00 0 0    , 0 0 MP 000 6Q4Ѝ0 B@-;  P 7(0  P  sTJ^l^l^O-4M`a@2`2020姙 00 P0 t5/0Ph  PH 5/0P <J pp P$5/ P0!0>0 4P5/0 4P 5/YP 0 4 ;/U ^ 0 !0  8/` PE(_CSea(/C#b?0E,aPᵣ1  P !  ;0P00 P(00 000 000PP 000 P (00 000p000wPP  P0 0l0 0QL4Ѝ<dm^0Am^0:! P!: P<: R? p@ P 0j=0:* 00 Ѝr^o^'r^Rr^{r^r^7B0A-SPp @ሀW@0000W0Sbv000S00 0@HA-Pq``@::S QL2ML8P`D01 HO-@  P4 pჟ0  Q ` ! PU X彎0pW㋰  } Ѝ '0`S V03/<0SNVU 00020L MLr0 D0Q @ P 0R \Q  R> @  3 r B"4AQ4 A!, 8\, ,0@8 @8  V 02/0 ::0:0P x1 R8 8  01Pn$}r^ 0!< 04 0 (   !/Hhl\ P/0 !8 00 (  , !/HhlhrhrA- 0(0C*s`Ѝ1 @P0 d0L`P pWQ XQ ,X`P,XQ WQ0<00D00 87 H0R. R/ WH01H0XH01H0 0ps8 4\0! @ 18 0@@0 0s S#4  4 \2H02,00@008000@@0 0S%40040A-@2PZD`q@pWA80@00S 80S0p 0sBPh 80S80S808   pDy(XDD-< :RD01 "0D20LML q @c0@0 ** * S#4AQ4 0,W 0,@ 0S#,8Q, 0 ,00000! @ 18 08 @@0 s^/-0*T00/-0 T00///- $00/$00/@-@$00 3/$0@0//@-@$0 03/+ s@->0`@ P  B` 0ŒQΌ Q @刋0T00 P05/P  0 Ѝp=s^p@-0P Lp00T0@4`X 6/TX0d` 6/p@IYs^O-,MTx @ d0SS0 p(а d0S ,ЍS CS 0C$0P$@(0``03/P-T 0PP0  (0`ǺP  p|s^DBs^p@-@$0 03/$003/ $00) 3/ $003/$0 03/ x$0 03/\XP$003/Pp}PUp3/$0 0 N'p@-0P`@ C0 0T @ ` BT0 0p@/0@-@ C T A-0@?@q`PU P P ᭺0 !  R00 C1y $003/P00P$003/0P RR 00`F(d0 U T0X 4P5/T0 dPX5/PXs^s^/O-@,M d1!Q Ud0S TX00 P0H 5/pP X,ЍO,d0T 0C?odP2X5/x d0SS0pd0S *?,ЍS CS 0C0(P` 0pPP3/0 0 0 $Ba h p@0 pM h00^^s^s^s^x$AB^?B?Bp@- R 0@P5/00 p p@-@9dP8 5/0dP 5/p@ i@-@@s@-@00 P0 5/PP \告00Ѝp000(` 6/ 0000s^G-`0 p9d":/d0":/0"d:/O`0dh":/0d\"0:/408"3/0d ":/40 "3/0d!:/40!3/d0!:/̡40!3/@B @0d!:/40|!3/0dd!:/40P!3/0d8!:/40$!3/d0 !:/40 3/ d`0 6/40 3/=d` 6/Z Z pWfdp9P 7/0dp< 7/d`0( 6/=d` 6/'G-`0 p9d":/d0":/@0"d:/`0d":/d"0:/40p"3/0dX":/40D"3/0d,":/40"3/d0":/40!3/@P 40!3/S@0d!:/40!3/0d!:/40l!3/0dT!:/ 0dH!:/40(!3/d0!:/40!3/@ 40 3/d`@0 6/=d` 6/ Z Z pWYdp9P 7/0dp< 7/d`@0( 6/=d` 6/'G-p0 ⁀9d`!6/d`0!6/@0!d`6/`0d`!6/0d`t!6/40T!3/0d``d!:/0 0 0 40 3/?d` 6/00 40 3/0040 3/dP <0l 5/ 00dP=  < <[000( 0"(Q[t^t^p@-@lM dP05/pp@-@_M0 4P5/0 0p@-P`OM@`00b00 p 0 7/P M Ѝ@$ +=`0p<SMHC8008080(040,0 Ѝ@* 0 00$09t^Lt^ht^ `B`B]B]B@-@PP0S00 0!< 04 0 (   !/Hhl\ P/0 !8 00 (  , !/HhlA-@L`0p4P 5/0P4 8/`?0 0%3?0 00 02000%VP4 P0A-PL 0 3&*?=0 `p?x0@xp5 x0@J4 F@".PpP0d 8/0 dP5/fd/// QX0S/X0@0/-0d$ /&t^ Q/0t^D0S <//L0S <//H0S <//@0S <//A-0@ 4P5/ 0`( Pdp403/0( 7/0dP 5/PX`0 4p7/  U 0$ PEU AʃXt^t^ 0!< 04 0 (   !/Hhl\ P/0 !8 00 (  , !/Hhlp@-P@`U 0p U ό0S X{@x0tdP 5/0dP 5/@p u^p@-@PT@h@@pp@-@P0d` 6/0d` 6/( d`\06/T00T0spp@-@P`\00\0dP( 5/p@`@-@$X H00H00X0@ep@-@`gP\00\0d`( 6/p@AQ G-@PQ10 d`?06/4 d`16/18 d`6/H0` ``` `@h0@`SlPZDpPp,Q  Ȃ0L0GP徂0 d:/ 0dp 7/ dp17/< P000!H 00`@00  00004040P  4参0L0H00H00X0( $00040(0(@0P0T `^T0XP0T0@`0dp 7/ d`x06/0d` 6/@`XpX 0V0R0SX0S<0 0 8`F1u^Ru^au^Xu^O-0@4P, 5/0P( 4`6/P PX0S   P0_ X0@0S X0<0X0H0@( X0L U l X`H0p+ L0p 0< 4:/04< ;/ 0 'X0L00 4p7/H0  <0% 0L0/ 0< 48/04< 9/04< :/H2$p 4 < (p,pLpL0S@0SP0<0cP ]PX0S  `  X0L P0 X0<0X0H0@(UAV\n \:PhV E1P` XpP X` `0HP0H0@% V P0S+;`P I gYE0T,0@ T09/`F0`F\T0 T 0D 9/VX0d`$ 6/@C-4MPEI@PZ廀 0P 0 P05/`P  `4Ѝ0p"P `0P P5/N02p0ltPP000XT0D 1 01xЍa^^<^x^p@- 0PQ@ `M ` 8{U < 0 {܍p^x^G-p`@ V@0s5 S20s/ PPE_oRP! Q FP P Q FPP Q FPP Q FPPY U @`FPY P 9/P@-@fC0@00/X0 @-.z(/y^@-UC<1 S  [ [ 0[, Ys [YcY   ,03/P   ,03/   ,03/P   ,03/   ,03/   ,03/0    ,03/PY- 0$000003   ,03/P   ,03/   ,03/P   ,03/   ,03/   ,03/0    ,03/P0 01P000P:00 0 00,p7/ 0p 00,8/0P000 0S 0 00,p7/ 0,, +  P1+ k 0 00,`6/P00 0 00,p7/ 0p 00,8/p 0 00,8/ 0 00,p7/P$[  10 01>  0P 00 R0Su  ,0   \=3/J0 Z㬠P1>  X  X,0   P3/J P0尠S  ,0   \e3/J0 P 0崠,0 0\ 3/   ,03/3/   ,03/   ,03/  00X 3/   ,03/3/   ,03/   ,03/  \ 3/   ,03/3/   ,03/   ,03/  pO-M$( ;8@@  03/ P400\00@; P5/P  03/Pߍ80`0<0d00X000 0= P%6R0P0$0(P3/0P 0) 043/P 083/`d,03/P\0P0 P X \`,,0 d3/P ,T0BS00\04\@0\00[08p,0 043/UO 0 S000 ;p8/80`0<0d00PS\0 0\00 0`\X ,0d3/PP&X \`,,0 d3/PT\ `X ,0d3/CP\ `X ,0d3/IP\ `X ,0d3/SP\0T 00\0ZP/0B?o\ `X2 0d,03/\ X@` ,0d3/\ PX` ,0d3/\ X@` ,0d3/P<0\0T 00\0%P\ `X ,0d3/\ X@` ,0d3/\ XD` ,0d3/\ Xp` ,0d3/\ Xt` ,0d3/H\0DH @00 S3 1* W 0X 0p*r`X d,0B"3/P @Y<@Q\ `X ,0d3/ 0#T pRhT($0P3/P \ `X ,0d3/@o\ X` ,0d3/\ X `0 ,d,0;/\ X` ,d9/ 0\ ,0`X  ,0d3/@P>P,0 [00St <1QU! !,p!;!  8/U\0 0\00 00@[z^@-@M. ) 010K/0  $!(! 111 1014!, p1>  ލ|BA-Pb9vn  Q'R Rkn@Q9en`0S_nF9(1$!Xn0aVKO0S89 AlJnhhGnV XBnP`>nV"9 ,5n$#0 S(0 +n 'n@T`n\0Sn80 m0S S||mtm 0SP0S Xmp0S\Q 4m0m0 m0 m0 m0 m0 m0  m0@ m0 m0  m0  m0  m0  pmmAwXmp 0S<mQ 0(Am$pmQ 0A}mQ xm,pz^z^{^d^:6^d^8}^{^1{^a^^e^^[O{^|^[{^B,_j{^v{^{^{^{^{^{^{^{^{^{^!|^J|^V|^_|^q|^|^|^x_|^|^|^|^|^|^|^}^}^}^'}^1}^|^|^|^|^O-P@pa$!0r0C?o20S (!0r0C?o20SPA Q> ;;P;P8 Q5 2;P2W10S 7 m R(mpW hZ@h W<0041@041CKC/H<0Bp Y `W ,l$plWl[T_}^:6^a^^ 0R  BR//G-(0PȀ!p0r@0C?o20S !0r0C?o20SP(㕉)Q :`P 1S P:P(㕀 0S\p@-@ 0P` P@HTppA-`P7X4S@ @Tt&@Pp@-0@@ ThPPP T[PP PT0P4p6C@-@TPTu0P4C-@Q4MT4P 0p`  8/P o4ЍT4  0   p  09/@PE |nPT4 0  2/0 , 9/@ TT4 0  2/}^}^A-@Pp`84 ,<8/p` W`VP `pE84 ,<8/` VO-Mp6@\Xnp PT P <ЍOn 0(0  RC> 0800P 5/P n @ 8$D0<4>`P2嬢42 4HV~nG 0 P Q CPP`P$0 PP 2 ,42<0424 242$42(484,;/P00@4$0 00  1, 041<4141$41(484,;/P00@4U 0S R !0R "0R@$R0\`6/2 ,`6/PP2 ,`6/pP0,4004040$4$0Py 嫴Pm0 塴Pm0X4Ѝ:6^гB}^~^BlCܵB#~^|CCCCCXCCCԸCCHCC,CC0CLPCPCE~^d~^ 0R R//@- 0 R0  R0 R0 R0QS 0 P ЍR0 \A-`p5BT P'@PAp@-a@0 PqmPpPP 011D 0(1S5Q  "$sCc^b@-@01p@-`Pf5@P  P p@4m 0t(0 ~&P p@0H1x0p0p0@1l0D15`Xm/P0P PɳP@ m0H102p@ꜻB}^ BpB^CCC8^ 0R  BR//0P Rʬ  R: //C-P @hp\ 0s'T Ѝ@0 T`1k#XD  &T09/P@D P 0C-P @hp\ 0s'T Ѝ@0 T`1k#XD  &儐09/P@D 倐 0p@-@`4|4S@ PJ7@Ptp@- 0 R\0S 0 000P00 ЍP\p@-P400S PpU@t 0  twPP xQ t0x4< 0pPxxQ txTPفCO-M`p]4@k` tP  P ЍO#l 0A(P0000h0 00S0404РE>L00 8/P ЍO~04 04 0S E> L00 8/PB4X 00 0| \6/P p`$ (,tx| d  0hl 0 Q Q 040C0T=X \S3: 8t `#8;/T=X \S< x `0;/X=oppT=``S>  0| \7/zA-BMPpj2U@a 0L#^P$  RPP $x0$=1S 0"P( P0 "T-X=\R ( 0`6/ X= R\``T=+ S  x26/T=X \S  ``X26/T=X \S  ``426/T=X \S ( ``96/PUiS  06/T=X \S  `P05/T=X \S  `P05/X 00`P \5/dQT-X=\R0 ` 0`6/8 T=X \S4 h `P05/T=X \S: t `Pb05/T=X \S< x `P05/X=P\@`T=S0> | 006/0 S0x x 0hBߍcPU$Q $]&C]^#E^T\G-`@}1Phh@ X P G@Hi 0( 0X= \ R R! R pWT-0R@  9/APqpP0,=T} 14f 0\ R`[0P xi G P )01h:6^B}^B?D^ւ^8^G-p@ `APCQR U010! A-P@` 0$ pE\: f X0 A\ ^G- P$`(p,00 N\:e AY Y@0 G V @ AT/C-@P@@0$M,c 0`Ѝ\-P p@-PH0 & @4 P t1  0p@9p\-@-@xPt`$0M\pP t1 0040 000p`00MЍ\-G-p0P 6 0`0x0@U  Z40 0 0Ѝ0 00:/p \-vd@-@( $0$$"6 0{@_\-@-@`Pp<<0$M(g(0 00၀Ѝ\-@-@dP`p$0MH`NP t1 (0 00>Ѝ\-0@-P$0M 0 0 啪Ѝ0LBB@-(0 0600ㆪЍLBB@-@/ 1R0@-80( 4@"6 0 $p@菫\-A-pP`@/^ T 0pA/@-/@s@-P`/AT 0( `4/@P eЍpvdA^@-o/@-p@-h/@R_ᾨt103p ^!]^ 0!< 04 0 (   !/HhlO-`@P0ȠY p3 ⩰ L` ᡑP U 0 0 @ T0 Ѝ^\ P/0 !8 00 (  , !/Hhlp@-@P Tk9S 9S 404 0@a 0 (p@BXgfffBD=S/p@-@=P0C==0CS=>3;3p@hBA-=PS`p @PVD=S@ 0[ &=@S蠆A-@p !P`P  0P Q- 0T  \@bЍ0A S  ,3b 0  T^z^@-@00PPЍ7@-P@@=S 0 1 00009Sd=000 PH=SQ  Z0d 9S 0Q Q   Ѝ0  D!]G-0Q@pP0MQ }0ЍQ u 4=3/|7S (Jh70?0?h70?|7S 0 0@a 0 (|7S H/ox"҈"0 \%  R # -0PYq -B^XgfffBA@-`M MP@P#EgeP0U0C0S0ۍ Ѝ S;U03Qd + Q  QG @=Sa2Q 0Q*$0CQ 0Q-0S00?600p2QY 0Q X{P2QG 0Q *0CQ@=S d= .6M04 2QF 0CQ0Q 5>8#8STp 8-0SSp E /  ("( E f@=S d=  0EIP6M0000@=S d= N@=S d=N0@=S d= N09S >S$[0SW*L  S* 0C#1L 00,H0QN0 pN0N0%*:iFA-όp` 0P@rP 0 `jP Ѝ!@-0  ЍA-`P0@p8=3/h7 T 5h72A9#9'@s@-HMPT0 S) S S@@S@@n R 3 0hh] \@Ѝp@ S S@ S@S@@@Ѝp!]dž^O-@lM@=S D=Sd?`< ,0=0>0$0=S >S3;3lЍ9S9 YU 0S990090C9Z0 06 p 0 P 4 0 03/039Sb.030@]  U\P303TW ?9SP.U PU 0S000000C0o Z0(P 0 S30 03/ pPW2 0 Nt ԖPP\"(0傿) 0Rd-! "D\ʔG  0 /D9Sㆍ P0S ` P 0!:> *00! 420a08/ᠾ(0"0D100 0$00KC195 S) 10170< :0G(0 501=0,0P(  0\!X^0d=  P 0 H0 0YXZ Z!0  b 0   0 PD10=   =0C== S-)0>0>p !]^p@-0=@S 3/`D]U'> PP `V|C^pT=X \S2 d 0``6/T=X \S4 h ``(06/ P Nb^C-CdMpL 3` <31`0 dЍP募 RU`@ 00D?o2P0S P嶟ᙄ  f*V00P`@UHP妟DH3@<30G-MMpG@ l$bPPnW`T$A0Vk  V7* V  V @-R  zu$VD ? V Vo  V@=S0W GS0N0A Sb*$AS0N08 S06M02 AS0N0,d#VP(  V * BV @ RVd=; #VT  BVd= 1A  )0 |0 ۍЍ \ R\P@-R 6  -) P Pd= ,S0N0 S0N0 VAS06M00 PwP 0C. P 0SP0@-:R s.0?T@=S 9S H=S S S!s0>0P30 G00PP00G G0@=S2Pw 9S#Ps 0P Pl P9S9  09b pPP [@ VF x9i*F%?- S/@-@pP`,M  @)"0 D,ЍC-3@@DM > H=S  CR})9 K L)"" CPP> <PP@ [0 l U C(@PU0@0 `P3@ > Ud=;d=DЍSP-1R  >  =H=  S9S PPn PP`0 S 30 Q ;S h`T{0 PP` V@pP * !(#J]$ 0d- /p7/@=S/D=S/QG-@@=S`떟p  43/=S-D]UT=X \S2 0d `:/> >P=0 .:^^XW3XR=3 ,=3/@]GO-@P@MX,=3/`P0@= #X>?oH-2R0S 9l&89d=0d=9S00`P  ?8< ?2989H-R%9" ;Sږo"#}> p ;dQ("( ;t0} 0'0 D9  )%( ~  d=   d=  d=6   d=  :S0?ӥ=x D9S H=S)> P @H=S (>$CN0\  ; 9S 3   9 : 00 0======H=St3X| >0 0Q. 3;@030)9R332 ̉T=X \S2 d `P05/X 9S HQ(  9S9xR:@+R S  - &@Q tPH=S 0 `Ѝ  H=S ?  00C0S0020ӕ Q1ڮ۾=-  P  PZ `DZT-X \R0 ` 003/ 1YY<`T-X \R" D 003/T=X \S4 0h `9/= [0=PS 0CS>02tVp@>S 0CS>02p@PH=S >S h^C-PpM!P@ `@P KЍ1Y0CYD1Ye 1Y 9 - 09 w94P@4 =#@=S M\1Y7 1Y. [@P#@= S7 9S    @u S 4 ቨ4P@3@ @K0 @0 0M@P4P@3@ UH=S@2iii9iO-@=@SdM P 3@  T=X S4 h `;\dЍO/0 000T-X=\R0 ` 0P5/P   T-X=\R @ 0`6/<00  0FP 0D+DX  T-X=`R" D 0p\7/=-0C==0=1 i& T-X R$ H 00\3/00` (0 P㖯) 0\*ThX= 0.^3 ;3@& T-X R$ H 00\3/<0 0` 0 P▯= 0)?X= 0.53 ;3 T-X=\R  0P5/` 0p`10)S { S  BS T=X \S=4 8h `P#85/= j3  d=0S "P !0=00 S0#( w0=T=X S2 0d ` 2 9S8t(8W9Sp02"'`P' W'0 .2$0< p0pQp(p320@@00` P! (Xǟ:|"!($΃.$ *00! " ( (.60 p07/0)0RSК >*P 3 "*8S00C8, vJᯄ 0^X,,lT 7_ 8⧳P 0/՝)` V0%a ~ pQp  G0H(མ=[)08%XW= -JZ%(W=0= Å0F&>=~)0 S$bXPp VW T T T T⼄៤ SVpSlS )W n`` pQ 0 /”p0G'བྷ=[)0#V~= -JZl#V=0= \0H(>=nf S0 0 012P#_0CSy0d=0d=9S9Sm `43/_cd=0d=_H=S >Sl"PS 0>P9SMd=09`S 4Q`PEUP#L뎄 U >^pP>PaB 0$ 0 0$ plB&00 02` S08#82́ 000H-Q0R RH RI V  0> hxP``:g>  &L0>YP 1>#F&V   01  ?& h"22?2 ?"LP0C.>2>2?5?# R #.P"D2!]|^"]"]̠ !]^^^·^48^^ ^,^@^f^:6^!]t^O- @$MP( R $Ѝ] MT=`X S2 d `P0\5/T=X \S4 h `Pl85/0D=,P0D=T_}0 0TP :(PXA  !%~R0p 00 pp[oRH}0wQ R)dR0SH=10S"t[R0H=0 000X0 0d1!42# 0L= CR( 0(=w p8R0H=0dp0 0 1!ᬆ2# 0H-P=R0&SS+ 000  P0@S0.S0-S0 S0H=0 00C 0 B2# 0 B2# 0 B2# 0 B0P=H=S% S% QH=帥帕S L}dd:9"a0@gtQPd :9ȏ"a@h 00Q ! )+5),|04p@04\r0404043099!= 0 YP T:0㠠 0I10S S2 ԊJ베YH0D 8PG0  SBQQ Q"< 1?0:H=S0 d=  0 P0 d0מ0d= d-H-R' R RB d-P#Qb?d= p#Qژ0d=`3)Q8<9 9<9< (S:ST/d-P-R j>0d=2R 9;998<92R 9<9<  : (0 P0S909 0 0` 0 ~Pe 0SbڴyX D >2 t= 2(x=6=⾀ᰀ,ҘKX44=4!8=141:1:141=1=1=1 =fM@p1X 0>9/   >pX1a  8 >p0T8 p@-@P3 3@0 X-0\`PT-R2 d 5/T=X \S`P4 h 05/pR2 d 05/T-X=\R0 ` 0P5/ T=X \S`P02 d 5/p( @/,4S //0l#R" /04S//G-@0Rbi?0ഐ(0 :/03\"0:/(0 :/0/ 00\"0:/\#0 :/#)4\:/(0 8/03"\08/0/ 08#8R0003ЍA-B肐P`,0 3/,0 3/,0 3/p,0 3/tpO-P8s@0S䢐Mhx&h'x0G`+0 L`F HH2$43/020024`Jp: [0@000,+Cx)C:C)C*C,CX=C5C^@-@4S@/G-3PA@,p0 <300 U SH֑bVH3<3㢞> - 2X>00`V  "P 3<300 UHGO-pPBbM?spHs 0(:/03"0\:/ 0(9/23H0\p$#7/0\p#7/0\p#7/13\p# 07/0\p #7/,3S 0\p#7/\p^3"׿7/\p0"7/6>\p" 0`37/0\p(#7/0\p#7/pp0 (9/03"A0\:/p(p0 7/p0 0\00 p:/W +pŸ0 \p/0 S 'b#]`?CACAC@C.Cƌ^^C0CC,Cp@-@P):pp@-@4P P]p$0 0!0 00 /Hhl-0 ,0/-0\ /@-00l@ 4/Ѝ@-0 4@4/-0d /A-Pp@`T d08/< S   S Co    / 0 /8$@- ? \+p@-d0@#0?HnPᄉ0 0110  00p@趉\+hp@- T?P@gH1S `P 0 p@0/p\+hp@- T?P@IH1S `P 0 p@ 0/p\+hp@- T?P@+H1S `P 0 p@40/p\+G-,0P#0? H1S@P0#`ᲒPhn0tp000!1-1-10-1-!03/0 P1UP!؀0!8/10C1101G \+@-~M@ň P` 98 4U,00VH0 EЍ萍^^Ԍ^@-<0DT 0 !0  !0@- ! 0 !G-H1@pT`(A- $0S)\0@3/# \03/\0P$3/00S "YZ x0| 00++R4Sx00x00 1 PtP\0@\3/ PU`0 83/00 (P 05/ЍGMH8߀I0 0 0L \00P00T0PCPC#]QCp@-@P 0X %S  05 0pp@-@`P 0X &S  0U6 0pU 0\00`00d0p kEHQClQCQC^ B/o P" RA-@`P' p@# pP_PP 0 3?.?00??CS0cS@@@-@`08 3/ `0$3/\083/P\0$3/8-lM40\0,0L `0$0$d0 lЍPCPCQC#]p@-81@S@00tP-1-!03/03/81SEt0\` 6/t0\` 6/t0\` 6/t0\` 6/t0\` 6/t 0\` 6/t0\` 6/t0\` 6/t0\` 6/t0\` 6/0p0-181S-1P0 0CS-10-1-!03/*10*1*!0p@/A-P` 0p9@@ 4D1S H!R 3/0H10@ 0 0 0=`e P 0 '0  PI|B̾ ȆpH߀#] *08'1Q0@   D-1/p@-@x`tP03/81 0CSp03/ 0 3/p@d`V 03/Pp@-@tP8!0R@  3/81S 03/0 03/1!03/81SS/10!tx4``8 #86/,!03/*! 0+!3/0.!3/81S t#0\` 6/t \`616/81S*!0@ 3/ 03// 03/*!03/ `!0 R 3/-!0p@/,!0 3//!03/0!03/,1Q@00,1&10/!!R !10!&1/d21S/*!Q00*1&10/!!R !10!&1/O0| 00Q  Q  BQ*!0 &10/!!R !10!&1/*! *!*!0*1,ltG-@ ?p(,PP` H1S`Ѝ1 P  0$` 06/p` 0  p` TF စ1TV 1T0CT 1 T 1?A3c0N\+\t]t@{t ȁߌ#]1@Xt@1(@jt@mt1(Mb31S/ !t       000 `0/p@-@^` 10 1@1  ``0d 0 `0d 08!@0 0-10BRS-10-1R-1@0-10-!t3/D1Sp3/0H1pp@- ?`P0@ @003/ᄔH1S & P 0@0Sp\+G-P0p#0?uH1S@ P 8!(pR  v`P⨏YȀ jp` $0( S S00@ 0990`1S@1S,@ 4,0΄B 00351+ dR? *!4  *! k R*!4 1!4!0)1( `1RiS*12!0i8!0Fd`R/1v00a R0 0 (0KS0ږ S~0A0R.1.10.1(0\1`10@1&10!!RE !10!&108@00 1 10 10%1ռ 1 10 18!0R'003/08v#!Rs #1oR*!1!4 *!*!*!  S*12!0*1 $0 0 068\+8O-t0 vpTM`? z@PpTЍ0  1S  P P0 pxP 06P0@0S`̐@1S 3/P (ApD0H1`0d 0h0S '؂0` dQShP0 h00&0-1@1 -10-181S-1P0 0CS-10-1t-!03/03/'$>  !; 90$@=K,!L0h0t L0H00, ), , (, ,06,00`1Y1810<1t1D1YB ҂ 111@1 01 10 1  ( 0 ⒏pP0  03/pP4 0@10S.+⤂bSu Rh00SZ=9 R =?A3c2#d S 0"#!0 "#1R 0 34ZsK\+L^MbȁH+8X]p@-0 `"6 0?hH1Sp@P 31S ^[V 1  10 ᑂp 10 10%1Q 1 10 1?\+O-H!R P %!PR %! A(0q 01pBR0  R<" 0"  @W`0@S @DWc AN!  BR!V: !K !  !-! -!8!R:-! -!90@`FS AV    R<1! 0 03/p !  !  !0@`S @D` BR-!`t6/ ! !  !$!R ~$嚁'a(A(ԁ5!@ 0 2/4!  #! #! , 2/"!R "! $  h0Am0,0 ЍO/ Ѝ8XUCO-H1S @Pz  tPU03/81` SP8f03/],!03/03/`81 S 0S @0Q 3/10u03/ 5 R $ Q Px |  Q $R0x0 x 8!R0 !e `V03/03/`h0Sd`V`?  Ѝ3/0>  3/,!0 3//!03/0!03/,!03/ 03/t03/ pW03/0p3/ 0!?0 3/0j,! 3//!03/0!03/,!03/V0 03/  &1S 0!&11!aV 0V`!p0!7/10C110103/`0 ᔀ%1$"!0 o 2/<20S  $0 R Q x0| 00 P04S x00IS 0x003/ Y 10%1 10 S 10 1 Y 10 181S3 0CS-100-1-!03/03/'at!`&`'  )! (! (!)! 0110$1-1-1 -10-1-!03/!1S0!10"1^Ÿj'H߀^Q^ȁ@-@L<4@A-p@P0S `S0C0`\0@3/`\03/\0`$3/h00S "SRD x0|00Q4Sx00x08H߀ HA-P0@`0 p0 7/pP ppU `0H3/ Sp` U<8 `#88/ z8 `8/ `0<3/U `0(  3/U`0;C <3/ `043// `0,3/ `0<3/ V `0H3/ `0 !0ES `083/ `003/`08 3/`0 3/F$`0 3/U@  3/ЍC-`ph@(h  0 jPP 404 x (lpph`t ЍH߀H^C-@0`pMtP 0``< Q E A =4p|  ~081@0f-10-!3/tt@P0 | Q S*  S  h ,a (60S t0h 0P 981 0CSt,0S« 0S0@0000081%0C S0000e00 㪫0K  \<0  0H0<M858eAl105Pp1(5t1 t 0 1 *10*1@ [ 6d#::d`{0l$  $00<x 㦵@1S0H1c0< 0Q0 Ѝ000d00@000d00000c00000 0003/c000 0003/ct Pt0 4`x6/  `R006/,cZ0 006/cR0 003/d03/Pb03/Pb`0`0081 S= b81 Sx03/0` 3/ 03/03/ 03/,,0 3/ 03/03/ 03/ > < @000;0a>03/ 03/ 03/03/P0,, 03/03/0P 0     0 03/0S` S`0 3/0@S` 03/;:6^u^^^yCH߀^'#]^ˎ^ߎ^@TC8fCnC#]zV^oC^^^,^7^Î^X^D^͍^^^^^^^ ^0@-P0tM 00@0L0d0@0L h0808l00 00tЍ0PCPCQC#]p@-HP0S p`@>P 0ST00pH@-/0 0 t3/p@-#@tP 03/03/pp@-@^j||p@-A-4@@000c"`\p0P7/2",p7/$  #002#,p7/ @&& 0\"A/p@-4@@000S"P\`06/"\`06/2#,`6/l20  R= 080#8S  ?00#\`6/2#,`6/l2#0@000\`6/"\`06/0\"p@/A-@0:03 \P05/2 ,P5/2P,` 6/ `U7 P@U! N7 P03\` &N6/0 I`xp0 `\VA{H07$P@ 4*70P,&7#P^^/^(C'C$$]5^>^#K^O-P \h ( ` ,@,4/ R@ Wdר0 0 ,P5/0D(0@0O-p\h@R`C$x102c000 0Z PPP Ѝ00$10P t0S 3/0 \$8/ 㑨 ,0,3/" t0S 3/0 \$9/ y ,0,3/U d0@ -PU PXT^\0O- 0Q0l5ph`  p@^ |0 3/}@0 ,p7/p +40\p87/   hpP l0 [ $0\ 8/0 ,P,5/t0S  3/0 \p$7/ 0 ,p,7/t0pS  3/0 $\;/ ,0,3/I YʠWWppPPpgP t0S  3/0\p $7/0\p 7/0 ,p7/P0\p  7/0 ,p7/P0\p  7/0 ,p7/P0\p  7/0 ,p7/0P ,p 7/P P t0S  3/0\p $7/0\p 7/0 ,p7/P0\p  7/0 ,p7/P0\p  7/0 ,p7/P0\p  7/0 ,p7/0P ,p 7/P Yp ЍW;6 t0S  3/_0 2$\ 0 w 0 0 0G-@`hp~|03/<08 PPUPR40S0P U`  l5 X6 D6@5p +\0x!40\8G/ᶏ^֏^ߏ^:6^ 0!< 04 0 (   !/Hhl\ P/0 !8 00 (  , !/Hhlp@-@`d 0p@}PwP\ 0T L0Dl2 0 0 0 00 0h0 03/^^^^&^O-\0`pQh@P t0S 3/ 0\$;/ p +40\8;/}0 ,8/p +4 0\88/ Wx0S 3/ OT(0,0000/@-@0\jlhA-`pP@}X0VP`|`hp}u`}}蘝C0 RD   R8  | R, |  R  X R X ,uДCCC[C@-@0Q !@\0@00A-`P@0S P 0q@P %PuPp@-P@up@p@-0`@hPP 0 \00 ,@,4/p|P 0 0 0 0h0 03/P 00 0pp@-@P`}p@0,cwG-P 10!Up0 0$C! $C1`(,H}T 0 S0 (ЍG$0 PЍtPP  0  P  0$_PUPXMbK^O-@MphP}lt`P ߍO|P% \0W%p00,$,0"Z:@<0 R80S@p<0$Rt|幢80SOʅߍht80S<0Qt0S 3/0 \p$7/ 㜢 ,0,3/p<00St0S 3/0 \$9/ ア ,0,3/<0 R@ 8 R4S@0",y0r0S{|<00  v|<0S( 0 ayP e|0"y`| < NyP R|<00 Rp    H|`mt0S 3/_02 \$0:/ X0\ :/0\ :/0 ,:/XP<000 ,:/P@ 0p<00 \0(0 2 \$C\#<;/. 0040p1 P3 3 p +4 0\89/3,   $r -0P00 pP* 00 0400Ba 0F3<3$Ѝ 4à@  P ^8pP pP#8 㚟MbX̜CA-P\ 0@ph`t0S 3/_02$\p 07/(0\ A/p@-@`y 00 0xPP 0S  0  0` vv08 vU P 0,ss p@sb^\ A-@P0hp`T T0  ,0A/0 0 8/@D@4S/-2 \#10/@-K2 ,@4/p@-P@@2 ,`6/”0P\0p@ /@-P`p@(@$0PL ps Ѝd$]@-P`p@@$0PL pt Ѝd$]p@-@P0 \`6/ƞ 0 \`6/㽞U0\ p@/PG-p@d尐PV㬀ʀ 0! $ 0    !&r 0!d!0    !0GHhlX7@-@ &^G0202020 DR2|0哇@4S0000 Kq2S " ᙇ" Ѝ0@蹇ꬳCCزCбC'C(C@-@ &@q@-&NrPp@-@P&xr2020p@-@4@SS&9r 0@X@-@&@wr/@-00 Xs Ѝ$]@-@@8Đ<0\ @/@-584< ,@4/@-00 r Ѝ$]G-p@d尐PV㬀ʀ 0! $ 0    !&r 0!d!0    !0GYHhlX7@-@&^ 0202x02p0p DR2h0҆0000 p2S " ݆" Ѝ0@갶CCCC'C(C@-@) &@.q@-&qPp@-@P&q2020p@-@&q 0@X@-@&@qP/ 0\R/@-@ 0^   \R@-@0U. V? &, Ѝ@*i^^A-PQ+ t@pT'hP cP `0d h+\0 @P 0t000 Z+Ѝ@͐^ѐ^^]^ 0`( "4`#/0@-PϠ ,@ / 00@-P@M0 00000 0 0 0 0R 0R 0R  0RPU @Ѝ0$]@- 5 Ѝ@- - ЍO-M@p0 (P $   `0 S p  .(P Lߍ      0 (p @0p@-@MP `  @ @@ @@ K }zw t.   ܍p@-  Ѝ@-@ ЍO-MHR@`L @5 B?<00p (008 <040,0$0? @L 9!0$ 00,0 0400<0 0 (00 000 8 @0 $ 0 "$ , ", 4  "4 <  "< 0 0T p (08 L @ `  @L $, 4<\.@E AߍO-MHR@` L@ 0(0 0008 00!p000 (S08  } zw.@ ߍ_00 X ( S 0 N 0 p$008,0040< V @L P8$`!;00,!4 *4!. $<! (@p@-@MP `  @ @@ @@ x  .   {܍pO-M`@l `hh2 00h2$p00h2(P 00,L  @ H P 0 X@\0T0L0D0@ `lx @@!H!P!X !,0( $ OZ`@ h$(,.` @ ߍP$0 (040,08 40<00<008%d @`0 H[ P W0 XR00 D 0L40 L0F8 TA

$;(8,5.` @ߍP$0 (040,08 40<00<008 @ 0 H P 0 X00 D 040 L08 T

00L0D0<04008p@`HPu\0 P0o0DS 8 0H0 D( ,0@LDHpDD`D@P0,!B( 0'= 0 &90%$04@@ 0J04*P0&4#000#0PeU1! 0< <0  P `F@09V@0 00``V 0  @0# 4[ i0<0 Ѝa+v 0P0000#000&<#00&8#00&4#0 00# 0C-P`80<@0CQp80 aX!0 P<$0 I<00S<0,@0 0`pPE<0U @00 0`pPU 0  %$- @00 

0  >2  >2  >2     Eߍ0@A S " /@ 1"à ?; 0 0  0"  0à "! 0?$0P0/O-0`hT ctPfTPnT' P%#lT% P%n'.* *nDjX%(P *hT$h*P%*bT%b*lT% P%jX%P.hT..aT%a.P%b.bT%l.lT% P% nX%!P. P".@$iD$a.@$i.lD$). @$ @$ .d. (i.f.f*. *b.*l.b*@& .**.j.# 0#i4#0#&iT%a.b4#bT%f.l4# `&lT%0#P%e8#00 !.a'b4#b.b!0# l!l.l$" !l4# ".!0# "a.b8#0 ЍG-` 0 ,Pp.p p!!!#0# "0# 0@( ,,(.  0!p0 P`,``!!#!0# "0# 0p' p',p  0p@-P`@PEUp@#! 00#0 00#0 00#0 00# 0 00#0 00#0 00#0 00#0/@ "1à ?< 0 0"  0  0"à ! 0?#0P0/O-p@`X:iObPa!e%a*ek!l,l., ,a, i)i!l!b"b$.0 " "a(" c$#c4.0#0#b8#0`4 `$"c("  b$"a4#.b8#j.0~000/L/00 0/L/G-@`pP0@M 0a800,($@ @@ @008 <0a,($@ @@ @֭T00L0000 0 9p 0@0 08 09/ 9P  0 ! 0 |tp` ($P lp0088( 00 ( pލD0]Γ^F^gTJ^̘^>^k^^۔^O-Mdße?00H0P L0d 00S`HV 0 0$0 !!2p0 03/0 @( 4/ 03/ 03/8@(00 d^G-@`pP0@M 0a800,($@ @@ @.008 <0a,($@ @@ @T00L00000S !&.8PP &> 0S !&> ⌫&>ş 0S " &> }P0p0 59/5 0S !x%`tP \5 0S !<5(( Vş 5 0S " 5 GP0p0 49/4 0S !$>P 4 0S !h4PP 8ğL4 0S " ,4 P0p0 39/3 0S !#P 3 0S !3xx `ßx3 0S " X3D< ۪P0p0 $3?9/?0 0S !? P ?0 0S !?0 ⴪?0 0S " ?0tl ⧪P0`B0&.088/&.P &>0 ⑪&>/〉P&.00!08/!P 1 s1!nP&.00l!0p8/T!8jP <1@$ U(1 ! PP&.00 08/ LP 0 70 2P&.00? 0@4/? H.P ?0P4 ?0 $Pߍ<3]5]^gTJ^$3]_^\3] 0@-ALM0 P0`5/(@ @P @0 @ 0P00 (p7/@ 8P @0 ٩@0xP0 (P0 p7/8 PP 0@, ĩPLЍ8]2]ǖ^gTt8]Ֆ^8]^p@-`@pMP߰  ޱ`a R ֱ@T#h pЍp07@-7P|@~ Q@00#47 b0 P Q0 Ѝ0r00#4p@-@P`\08M 00 00 P  l8Ѝp@-t @d0p0p@-0M 0@0 $0D0 (0H0@,00070P` P `@0p`0Ѝp@-@P7`ptM000 (, 8 40PЍP$` 80 p0 P@`pPtЍC-`p0MMPStX@pP `'0 (`(0(7 `$ ` `p N 7 (`VIM0bP 7 (Q G 7 (h `0 `07 ``2p 0b"!4b4# 0(0 7  (p0h 0p0` Mߍⵯ7 (⸰ ( `F O-M0@, ? R$0(@0 0$0 0p t 07 0001  E0Pppn0ERt  7`EPS0婠@k0C?o200U 00 Q @7 t0 4 t# t0P  U0Q00pp0 Q@0  7 t0@ 4 t0@7 P@@R tRY@0Z_0S0}$Ѝ9]|D]D]D]p@-l@P ?  7,ap0@-,M@P4\0 T ѿ  000Z?d,Ѝ0脼^ 0!< 04 0 (   !/Hhl\ P/0 !8 00 (  , !/HhlG-pP`4AXT <, LaT@! PU,QP N  0 0  0 < 005  ,QЍG\/@-$M `||p0 @P D0!4a000l  *$Ѝ脼\/0@- $N@ 兊L*D\/,D@- Ѝ@- { Ѝ@- Q@05/cw^ 0o`000S P0> p /베p W`0S1001^n80 Sd001c00N8fI0S00d0Q00@Sg/1!p113H\!01\(  1!66- R    R    R   "-" R   .R 0  S0@008Sh0 S01 1S  0310@0wM.1S(01ЍGa ^G]^DHD0.R  "-" R   wP/P/////|0R 0\ 4\ !8/P x7S0S/G]G]O-`@0弐u_0Pw>0S4 0!pㄠ儰0Sx@TP Ѝ P <0<  0W$ p긙^^^:6^^^p@-`@PPp@$!$.00007wnS000q 20|7S S S0< 0 0CS0|7Sx8D!0 0<00;080p0808070B;0;H]^G]O-@0`pTM 0<^0 _ *qw>0S9+ 3 a0 7_p7  0 /_p7  0 '_p7  0 _p7 0 _Y YpPP0S] (RD&_X 2 0PT TЍ\I0X0 S0   0P 0p ^p7  0 ^p7  0 ^p7  0 ^p7 0 ^0 0RʻP 70A  `P( 0 S0 `` ^p7  0 ^p7  0 ^p7  0 ^p7 0 z^pmH]@B00 S   P 01@/G]G-P@PT"Tl-\8 Q2 +Q  Q/ QwⴀXa` 0 S&100SP6 P Q$u?0XPpQ0Q Q 00 P PWP2q?0^ PP00p |p  ppWQX" 0S YP48S|74XS l0|w7h78 FI-J4`Vh78h70I]^J0000 000/s@-@d ^1 R S00#0 0S0:1D!0CR 0 D10D1! 0!0 0 0 00 0%00n\0D1S 0S00 000 R 0D10CD1! 0  R0Ѝp0!0 0  Q^^΀\Q: / AA!  ////p@-@8 MQ1P 00#!" 0 0000 `0V :3/P 1 0h p 10 18003/@ @08003/000<0 Ѝp豛^xI]^^J]G-@pl0l`^:d0媎`8`:/@PsEsEᾓEU,0:(0:$0: 0::J]0^D^D^D^D0S 00, QQ /I]^E^0S 884!RR   !/I]^E^P0P//QG-@p ڐ1 0" $10$1Ѝd`PXQ1I(10(1,"1h1 0O ,X  p7岠`71 0! `W p71 ! `80S0S$ `03/P1 0(!@ 베,10,1W1 11h0 00 8003/ 0`R ᤚ0 9/P 120!S 0! 0X  W㲠`0`4!S 4!n 0 Ht h0000I]y^xI]^^^R^5^^r^^p@-@P:3/:3/p@-@:3/:@/G-8p(MWu1@P` ᴐᲠ)Q0 0#!"!0 03/P1 000 0000 101(Ѝ \0R 1 8 @ 101 :(ЍG/ᱛ^ʝ^I]^;^C-`@ 1RP~P1US^1 P0 0p1p 000P Ѝ08 R<< 0 RppSh7p0pp 3SH0L RP00H0 00@Q$@0 00T 0(0 0(00S*r@P  # 0 3/P q@J] J]a^#J]^C-Pp(0`S!R# _ 0@ n0 0R@@@N@80S*qPU 00 0@ Ѝ (0 S*!R $ $ $03/P5J]^J]/A-`P@HM p&40%V   0EP0D00`0 0(0 0 00000 0d0HЍV 0 0>0?P0A-<0P 0S`M04@0S00Qh0000@04@0  # 3  4  4 "$  <@ p! !(``F@#j0 p *P`ЍLJ]^@-0<S !  4 0 h Ѝ0^^J]<?@-@ 0P0@00lJ]/O-P0 #`1# $ ( #$0  #(#< 0$Ѝ p0R@-P@0  <0`101(0 0C` %ЍpG-R@P<M0 % ` 1 01(ppG0G  0h aP 80R  $ЍMh$"P//O-@<`IMP 101p     000 S0 0>1Q X 0 0>0SC Dd(0HL@@00C pS0!@D\pW*T+ `1  I0 <΀ Y  ZIJY Ό \ ,ਐ, !,00@P^ ΂ a\aNL^Q !^UIߍ蘠^4Q]A-@` 1Qp W 0 0>0SC0 (p PpG@ BR !pG RQ+W, @1  &I0 %IߍP PQ#4%^QY  ZIQJY PP^PQU @ 00 >@1TQ QPQD1@AT00>01S0#0 #꘠^4Q]p@-pK00000h' 00.[  㠅  ?P 1 4Fd> T>!000e $"P$\ 1 >  0 =   0SH Q1S=Y 00 0 0S9x 0 $0P 0 P 1 $ 4E0P HE= =PJo[㪢Z  P   $PPm 0p000Z|7S0D00S0S !R 0(<0ppW9p090!% 05"# #^#PQ\ Rʐ 0  0 ;+pl000101p%0S4 SF 1S 0 0@; 0Sp10p180080|7S00S2S1D+ :04+ ;D10D10 q7/00` 00(0 0pP fP 0`00 0/ |78*`S*0X 1 8:8*\000 03  0   P1 909B0000`X0@00 h71 P909@)+$00$0101Xx8S1 9049)000 00 0 2S1 808(0 a6/ 2" 0 S!-0002021 HgD!= 0S!-00C02021  HQD!= 0jPQ1S} 3/z1  H;DP1 TU HQ 0SH1L1 P10CP1S0 900S000000  P001 01A `0@000t 0S0t0`0S*e`P0`  H0S0S0S0S0SXGaI0 0Sp S SLX R00 4(04$0$04SBe `Y (0 0C4!<0V0` 20%S ! (  0%400010100`00$00 붡$0 00SC Xe0X70倀07X 0! Z  ,0P,0  P d[ 101d000ma(`b(0 0(00嶡$0S )`|V0`1k080 R. ,003/P'1 30 #439101QG;a>L XHX `CZF`pPd000(00@S4 1 x20t"200000101WUa00$0 CfR , `0, H0\00Z000CC@00R  `0pU`pPGd 00k'?o20 D1R (00(0101 h10p!0h1(10/1!|7`Sh7 @T 2S30604lЍ0] AgP/ꗇ^^ԡ^xU]^^1_^"^8^Q^u^^^U]^^^^^^^^e^<^M^Y^^^^^£^ܣ^^^@^^:^^^^@p0<0('6*R67pc0 0 0 X6W c@h004 0/004 h X!P 2 x8P@@p.#W~ 000101000Sp0pp0p04`l1 p0 l11p  1!_00 0:4` R S 2! 00 0 @W Wh' 82 H'`A 0  pi|'R 0@0 W 1 2"02'!40040h7 1 202" $00$004 <P40  0@004tl0 0 0040a6/4b S   03#H10H1FHqW1 HWA r *L10L11S 3/0SL1H100PHP1X7S  H2A| M1S 3/ S  H!A0 ;09000000 0Spp0p 000O-S@Pp`MB "0S; S8 00 |7S7S 40040Q@S PS+ 1S ?/pS000@SZ S& S70CS40040300CSd 1 D?D/0( ?4L00L0!h7|7S2S 0J S1 >.Gr0L?!L00L0S 40040Ѝ, T0d0252 5 X$YX0Zp0S1 $>.Gr0>!D00D00J S*1 =-Gr08>!L00L00SS  2St *Sp 0S ! 0D=D-P00P0SPk xl00phQ1 <,Gr04=!L00L0~x7S 0450!0P0C2X00Z0Q1 8<8,Gr0<!oL00L0\x7S0X0Q1 ;+Gr0P<!XL00L0E0`0H5Q0[0 1 ;+gH00H0Q  04 8 <4,S0S TP |0S! *0Gr:!H00H0l0S1 :*Gr0;!D00D0 R1 P*Grd:!H00H0X VY1  )Gr:!T00T0YQ xQ 1  )Gr9!X00X0A=P:1  \)Grx9!d10d1xU !/ W101<00<0101|7hWSPm2Sj U   @Pd d7![0R 1  @ ?[ 71p!w. h7R7!66h7[071?%0#  1  @> ?w>0S)  45?|Q 2  P5`0S ;!0:1h7 0 000T0"08U l7 l78l70 000T0n"5   P! T +P 0`P00 0P  Wx8Xh'* 13/?S PT0 d=|wW 7S 40040  0 RY-1 $6X%05 D00D0BP*1 5%05 L00L0P 2P P00S ! $0T5 H00H0uZ1 (5T$04 wD00D0d0 S ! $04 fH00H0SS x R P 1 3  `00`0 p0L 4P 8P <S 0C?o020\3bqE0p01L.b |>儞!|0>T h W1.M >p._00Z 1.>= 0A@0P !1 ,?,/b0 G  00 Q 0  1l ?D<08 8 <0 HXB i pG p 1/? 0?  C !0pp$W%1 9 p0L 4P 8P <S 0C?o020\3bqE0p0 14) 09((00cWF01 441(  Tf80 40Q0F00D0 0C00A00@0080o,P ?"0,0,01S  T@8 ,0HP0<808T 0( a6/~x00x000 U/Ph7 1S  T8 7P0)0( a6/S|00|0b000040?,0?x80101x8M? M? x861610S @000D0049$0S 4202( 50P !0004P !$04020|7S7S 400400LS1 6 &Gr06!L00L0꺁xXX 1  T70W5 0x8U<10<1h00h0 ሕ 0\Q:1 `5D%Gr045!D00D0LP*1 4$Gr04!L00L02P  P P0Z   P0S! P$0GrX4!H00H00ḡἑ[ 1  T 70W 307x8 U<10<1|00|013/oX㺯ᴒM  pG 202-wh7Q / > 67Qh7 !, h7R7!66h71  T6h2Ÿ    0Ÿ0W 20  13/20276h7'0R40040 0CS 1 1!00 1L00L00q001 01⳻P400401  T60 |7S S 40040 1 3/x8U 0q00101 〻P400401  TN60 h|7S S 40040 1 3/x8U ^ɩ^ܤ^^ؤ^Ҥ^Ф^(^X^^^^}^^P ^^^5^^^^˪^^&^ -0@-@PM0 0 P6 0Ѝ0@Ѝ/c^A-p|7@S2S0!1R004 S00R  0 u``R8P`20100010020 0083/ ? 071 0围!GR # 哴D1"022222220 " 8,ℴ" ZN‴292S988-#87 0C2c70r0Q   h0   04Q   ]0PP0C03254G]A-P L0R8pL `@|'R">(R# #0 83/G?G/ @0?@D00Q0000L00 00 R  001H0O-`qF尡MT9 0 Yd (  壟00 4S! 0+ 0Q P0 S0#  "0 000083/? 0? 071 0ճ!GR # ͳ0S/S10C1ߍ(0 ⽳ 0" R 0Q   ⱳ0   0" R 4Q   ⣳ P0pG@G]@-1CMS@CߍP` P@P p  `P 0,#0Q    R,r!0R 1ŁI@p@-2@SP 0aS 0 6/p@03A0AS@-@e H/C-@px8 ATMBR h'0 01PTЍ"}07p7 ~0P00 ! U BP Q 0009h75S0 S0 S00!e R #TЍC7h7#20k70k7#1p7#81p71i72k71k7#200#8S >!0R1ā !@RPPa4VA  PP` 8. 0000000Q<<0 0 0000 P00' 䊲 0R 000U @ WPDVOxc nk    xW\_o`/R χ166S1 000P U0!01S 1PVTЍCTЍC"1S PP  `P !ZR !ā BPV2괁X PP  d`P 2 01 SP0} pl 04P1UP0UQ  `(#0PE("(!p7 0/A0S 0(( %=>000Q00000s#N90r":9?o2{N8y?wh78s"}0p:S| (0TЍC/U]W]4D02010?0x8D!0100"]00 j"]0h78h75^0x8?00h7#2^0n^0`P V C VP@`U0"0t"]0h7=$`B000i;0d 0} 4L 000XlV]V]V]*-O|ǁ8DG-p M@`'P`P0'XHS^ + BS*? S* S  S `@'?;CS00$'S?  Sj BSX0Sj p7 h70h7s&Sc 5, BS  BS&?;C0CS0&SDX @0SC00P0S Q>⪎0pⲐWC嶠C S ᧯@0Sp9%S BS6 BS  S7 / BS|7SR c8P`K 13/8x%S r S}`=0X SQ`4#=0   (h03A0ASXa0S^!V&R!X 1?0|8|7S3A0AS13/4P` XD3   R< X ЍR <3X100$S- p' & |'S|7x'Rp' p' X\08 w0S 㴀u?0Xp  R0\ Y "q?0Q  \ X "= w X "= q X0S p7  h78h7|7S7S03A0AS7S7S4`|h7y  8h7u h7 O ;X > h7 E 0X0Sx( 0•zh79 0Xs0S.0‘mXk W?B0CSe"= |7S! H  x7 ?op2X  0RQ ÑVP P6P   Q A0 S -V]%V]EOV]O-?@Q`|M pX3C>6CQ+ *3>6Q P?Q 70Q  |ЍO0 ?QL0 00 0p0(PPM.x0@FS00>Q >Q F0Q0 0CS*4PP/|>Q7S|'R h7   f0>Q $ QL >Q>|ЍOh>W0.|ЍO9=0S-S001S S Sh740 03A0AS[7SX4Ph740h7h740@S)!P& 1(-0CS0h70h701!x8 h750h7h750h75!0B8#8S"= Ñ P1Sʄ7w>0S3A0AS13/p7  1 CbR.0‘!1R7P!h7R00h7!h7R44!@R8PPH<0 SPo;XK=0S|7S=xh >PPYp:3/0= 8#PP <0S0#0$" 0#0 ㌘< XV > PP 3S>ñ:3/V 4U< ' > & `PPXqs`~!Rj8}PP8Q|7SxH⏵ 9P 1P|Ѝ 9 @P VQCt!*R;8NPP80SS*0|7S-9 iR B0<mPP" P>0CS|7S < @P 80S& < |'R R0<囲P  < @P 81#3/ @8 x |7S P'pP P !PP 9x!> J!h7R 331Sh'5h7Q Q%h'r Q5| n4y1S p7h7:qh7:m!h7R33g!h7R22P 60"p7 10h7FP!0B8#8S ȕypဦ1S7 W 0p' Wp WUPdP1S\& "0vT!0B8#8S ȕnL!18p7h1019q W> PPP 8+x7 ?o2x`QQ 6P  x@Q @A0 S |Q x0@`P|V` x01@0S S2 Q_P|Xe 8G03A0AS7SP U|7S cP 13/P]!R8zPPTW pP 03/P z186S003/1ZS$ 8#8SU $03/SU 0:03/U 4fPP 03/P Z0U 03/!R8PP  8 3 0P > "p7|  2/@0SX1X  pŸ&%-  PHŸ.  P  B"P9 919"p0000 9100000000 910 B"0k9990 9100 910?o200|7SS!0B8#8SN(ĕ|7SS1 C=R.201: !h7R 0 0h7w>0S 108p'1 S"-08|#8,C("(RiiiW]i9ii:ii8i8i(7io?W]W]) DW]W]9s^W]W]* *W]G]Il^hliH! 8PPj8` V#=0 ᬕ h9x! 8⣕7S (#8 9! 8PHx 8  0BS !R r39S0S0 p Q ARQz0W8@ j  R@ WpP:3/>00S 0H pH0P-PpW@:3/UJp媎0Sw@pX0 0CR00h'4PS4400Rh7@PP 0 0Ho-HtP h7~N#2000@000S@@T`' 0PP0T0 T'PP  > 0S p7  h7 ; h7h7 ; h7N50000> 0 ! nh7P:: x1($S,48 S!V&R! 1?08|87Sx|'R8$S x(0!Sm|8R8h x(0!R7S|7S||ЍO^,0 00 0p0PP- |ЍOHLn)P   03/P1|ЍO"Wꔥ唅唵Yʀ 0! $%0    ! @aRa/#v6PPWa/5 0!4&0 !    !0C-DM,00 `p\(00 00a00$  P<0@EhP0(0`0$  0T00<0 a ,3hP<  DЍv^]_^«^̫^W]@-  0H2$,p(`0/0,2  0408 ePv 0 00졟!18 $ 0,p(`40eP`0 00!18 $ 0,p(`40ePL 0!X18 $ 0,p(` 40eP9> 0 00!18 $ 0,p(`40leP$w> 00$ 0,p(`408 YeP0N@$ 0,p(` @408 GeP  <<TЍ^E8_ԙ^E ^^!^,^7^C^̫^X]cg@-@4P&p@-@`PUp0S00`00C0 p `G-@-0 0 Ѝ Ѝ/M^p@-PP UlU`C@P D0000 ( E@P@pR^q^EA-1P@`p x(0Qᔀ*& 0)x8 S ٤Ved0 BSЍ ʤV0 lg3Sꅬ^^^@-1@P` x(0Q|pp% 0lx8S 0 fS Ѝ@_ ᛤ0 hS Ѝ腬^^^@-1@  0@ iRꫬ^^O-1020`003/0900*= 20T100 0!` 0@0 00aS0@`PpЍA X]t^G]J] ) @0) 8408008,08089!= 01/EEx G" !@ Br 00# B1  }@0p p@GG?0@ Q  Ѝ7SD10A@ ݯ^^^X]^A-`P8p3/@P\00\0  s@-`8 P3/@P\00\0- 1 =!0 ; x 00x822x80!L0003/090020T100`ЍpY]3^J]A-P`8p3/@P\00\0  x8 0 0x822x822x⬟x80!x8 99p@-@P`W@pp@-P@P xG G℟1S 3/pA-P@p`000 l h d0?0?x80101 M? 061071 N? (Q 4$Q 0| 0 1SA/@-P ` pk@P 00 0r ЍA-|7PSS` h7M @ iN@p"0 R0S P@xHNA-|7`SSp@ h7] P i^P0S TAT10 R0S P@xH⺧0S i V1Sp1 0D D0 0P⟧AЍ◧$Y]>^A-pymP|7 `S 0 xH⃧T |7SS @P tL@1 0 000BY]f^C-P@@@`pzAT ݐ  ᶤP01SDP1 0, , 0 Ѝ@XY]^G-`X  pR 0S R@↤OoB@<PUv@ sP 0R01 S  R 0S R_P0 P0T@`C-p`@P HP@T< Ѝ0S 7PȦ1 #0t t 0    AT  P0S P @yY]Y]^A-P@U+ phP ЍA0S0S i V1S1 0D @ 0!~@P ЍAЍY]^@-@xP 0x8i <P 0<8HP0H8p@-|7@SP yne089,8xxXP 0 022220000990w>018oV|'R 13/p輰^A-1@` !ly^,|7S118889,8_  PPp  (# x8 """" 99>0?h7?0?x'RM?6!|7Sh7!QG4Q ⢥ASY]Ű^ ^^@-@xQ `P P P 1  <10<1Ѝpy+1 h\ \0   D@  ,h70SU? #~Q A1 0 `0Sp7  |7S 1 $!$qQ2+~Q A1 [0 Z0S1  Ph76h7p7  1 l |Ch767h7~V @ A3A(@^^Ų^^6Z]^>^]^^^O-P`|7MSS00 0 ppp1 p0" 0W  WЍO   @T 00Ѝ0W p|7S2  0S 4"|0 0P@;00x8S| 0 0C8C80Q Rn P1S: 00! 00 00HP 0SH1L100P10CP1;H1S 0 R B0 Y 1  0 1P 0Q113/0Sʐ1  0 H | 2S 0 ᬑ9/000a)Sʐ1\  T0T * \ NS@]OZ]̳^r^X߳^^;^^^C-2@SP`M !Ⰰ8#8X 0 q7/ЍCa< p 92<2<! !000w>0SA p!$20S hǔ   1WQ01S 3/9-8C800ᬁ0 8/: 0S 3/ ЍC? ~0001 0 GP202~0001 0 7S 1  h76h7? 1 T h776h7tps@5^^^^^}^^k^^jZ]δ^^A-|W`U U) U@w xP 83/@ ? 83/P@pWU!3@PwW 83/Pp@@PwW 29S 83/P@pp@-@1 0, ,1P 00Qp@) Z]@^p@-PiN@ @P`Rxh⮟VxHp 0^ 022220000990?p@R^s@-!]0!@S001 Ł<>HP1 00!1 yG   07H180$8<1m`Ug,884X uP10X 00 0in  Fh  d  0(' 0' 8' j^6D'@7<7Vsx8 p  p'    P ( D ) x8 r ЍpZ] ^s^AE^hE A-pʀjPrQ` 0ES  B2U U U ,U UPPH$H@zWpx@'x@@@p*0000>0h'0S0000@/p@-P@ s000 0t u"    @v w 0  " @x 0S @@pZ]A-0 0S@P p `*|7S00 0⨕  ⤕ ⠕003213030 0⑕  ⍕   ㅕ  ⁕ Z]t0/C-@`MJ4PP000v Ѝp0 `ݐ0=0 H02 |7S0000(001011 ` X0P   D 00L7SPP7HWLW0P7ꏵ^^^-206 2S 101 , ʠ,ʠ\ 101 S&0#*R0 BR00 \   0R"  R  (R  B/o"S0|'Rx  *60R R  R R  1 0S "N)RZ]O-0LM S< P@ 8”h7 |7S 808 7Rᘐ>0S 39S᚞ $7R.㲢 $7Rpph7 4@ppY80```& #RH L0S0P !0 >0'S 3)6R1 8>0 060000H  0C FR{03@P000 Vڸ h430Y000040  B    004@]4@Th 3U 0      $D"$  (00 #RH L0S0P  6@P000> 40H   CW0C00000 (0`0(00 0|7S000 0 >  80 0 00Zl 060S  S  S#:9S00w0 00#"!# #"0( RR0O+ +Y $3R h7 |7S8 3 R 0@0080 R  (03/P1 8h 81081 8 ⁓ > }x 0 08s  o >321303(Z !%*0$@00 00 0J(000( 0 I 0 0Z 1! Y0: P$`Y  3P`PPe2 I20 0( 0 010 1 00 0 0 I0, 02, 00(0080$0`0000 S0 000((0CH20 8000000C001!0110/1!LЍP`5Y0 S  04{5P 45@~5@[80[ 0 00徠SX ,@ȵ^J]Z]a^ܵ^Z]^6^G^ ^O-PP 0尀00(0202shpk,PP000 @ {x8?0 00|7h'S000  0 ;0xG  x'00R_000嘧    M? 0#40容 00#300᤹ 00P#3@0  6! |7S   0 0X w>0S h'0 n  0h000   [0  H)0IS0,00S0Y  R Yx(  B/o"Z00S  0lPP0 = S  岀崠 45 0,uY 1 4 0:0Z(110011|7S 0H   CR0C00000 `(0 0(00000=00v0  , R :01 o3 n0@001 PW|'R  [3Grq缸 0 嫿1 0100L7SPP7HWX0P7080LW2x@$Ѝ 30 2PP 0ᰀ00(0101)}8S>HHPP |7h'S000 (  0/  p' ; W00  . x ⩎G ozh'0  4 R  R0Q  ኎0 00 0C0(0&3bPP5 h'00  0  ;X00  岀0  " 101G(3h'0  4 R 0C0(0p 101#RH L0S0P  0PPꗇ^[]^۷^^3`^[]^^^A-`p,@P 00(0K0P 000p  p@-`P,@P 0; 0(0 `  pG-!=⼠p7p# 50`G@- PP 1S 0#000Ѝ sy0/ |'hR    0  + h  ⧍0 qw0S 00000   0>0  00|'RE00 0 ! h7   h72h7 Z0Sh8 00@10 @( #RH LQP  /PPȿ    N  0 00H   CR0C00(0p 0(00㲀0   북?[]4^Q^O-@fMP|7h'S000 0 0  ;0h7  9)* S09h7  h72h7|7Sxhgpe\ !PUP00!  ! 90 9R9S!  d!h 90 9BPSH(Q PU$-Q0CS*e1 S`0 `!  0W ``` 0 Ⱑ PH!h75h71 0l x08 S0R 0C00 S 0S00Ѝ0`[]m^^^и^@-`T1P!pR@MX1\!^0 X1\!1S 200 @E@1 0 0Ѝ@.. ?1S_PP00L1EUS0 `HaPE0PLaPa`Pa1 \ 0 4`ZV1Ѝ@/Ѝ^-^-0 /2S/p@-@Pa0 6/p@l 06 08880 8077090(10101/* * TwEDaE@-:@0S 3/ :S@0/p@-`@0SP0P    00T ,P1S 01pp\]P0/P 0!/@-@ 80@Y^0 R  +y^p@-<@P0S,]@T 6P@p^ Qp@-0@P PS l `0FUp@P B^R <`0FUp$0Ea^^^^C-1@pg 4!1000$4xX倇X0h4`FV`|7S S 0 8@:0S 3/ Ѝ0 a6/  J|7S S 0 a6/f|3V0|'R/I032+ H3Q' h7  ,1   Vh7  7 P2 t- d`0 1T"Lf^n^"_^^^^^^:6^^^s^{^^6^^^^O-@P`$M 8sP0  G/q?00 0 0 B     !R^0S^o 0 $ЍP1pW:pW q ppY [3P0 9 P9  BG !HpR)R  B Gq R [5p5xpqpPp|PppP !D1 0h7Q;;h71S//p@-h7w^6h70@S S|7Sq! h7R p' 76 67h7p0S/R@-,0 @ TPH\]A-`\0R\0C 2 P@ \pWX  d\]@-0@M 60b1c2d3eI{J|K}L~S|7ST 9 h7  w>0d!!p740!h  i j9k9 0 g901!\0x|7S!=0S* 9'w>0 01 9i9 00\0 ]|7S 93/1  |7X `S499Ѝ@Jx829009h72h7Ѝ\]\]ú^^^p7/p@-@f_qp@+p7/A-`Pp㠁Mw>@WAL WP WPx10@|'RL 5) 6) 7) 8)099!  089 079!069059000N9 O)PQ R   00 pWPx8S  19ЍAh 0: 0@T P 0590690790890Ѝ<&]]^]F^^\]]]]<^]@-h7"1 @ |Q7S8(00S8. x (0   Ѝ 1(Ѝ@/@ڻ^^O-pM`0`  P&0@0 00P 000 0_o`@BRPPU!R:"R :"R:0ЍC-MP 0`p` @0 0 00  00P 0 0@B?o2P0S R0 Ѝ0G-@M,00 p@P(0|10A0p$  <0`FPJ<1$ 0<0  A,p(FP91$ 0<0  A,p(uFP)0'00弐$00 00A,p( < `FP0$00 0l0 0`0A00,p0(0< KFP  ,,@Ѝ]_«^8^E^EA^^^]G-SP Lo `0@4p8à St# 00000SW w0` 01`P1 0b`0 d`徶Ѝ@0@T@AJ0^0P0᳐0Y:0ꐚK^@-  0 @!  Q3  4Ń000 P1#9P00T0bX耖C@BC-P`尀p0@ A0 ঃ0S HP ` 0` 00_ Ѝ萚t^O-P@0MP00p1W;*0S`0 S00qp0少  A$0 i[! wP p0PQ`1P  0 AbPP0p 0 0\Ѝ[ <QP 1 0CЍOꐚս^^O-@0pM00P@`Py 0SP S P S0P0܁ R@*00Q:0S  P 0 ≐00)  0a 0  D峵 A ቐ 0R 0 ؂0S0 P 0Pᘵ0S" P P0P G况@JG_P!0Rdu X@Ѝ` `a벰 0(eꐚ^^*^A^:6^I^@-@ ^]@- 4,4 8 #8s Ѝb^p@-@0M SЍp@P` 00 0ZЍpk^-$M840, (  0 $Ѝ0@-`plMF#@P@ !0 0  ( 0  P0000C0 p0!0?0 0C0000 0d@S2 001 00@0g'ۣH0L 0 H0L lЍ,00O-@DM 081 0,0@@$P㗤Ppl0 0000,P(p$@ @@ @`C0 00@40P,P(p$@ @@ @C040l0 0d0000080P,P(p$@ @ @`C 0ADЍs^/0z^^PER_O-\F,MPp h0 0 0 s0d#dh&hV *V0 0 0 a,ЍOU&0 0S 0S*t&PP :0 0 0 ,ЍOC00C0F>P #0 0 0 00C0000`P' 0S S S/ 0$ 0 0$ 3"0ZT$S (0, 0 (0, %< P ӨP  n0,Ѝ0V 0 01`S0300 000 P@ 0S0S 04S H2΀ @ 0SʠZ @T 0S 4S 0 SR0"0CS00 S ៀ"@ z @00n004 0 004 y30 R S Z80< 0 80< d 0S :P`0 0Vc Pc 00;@0D 0 @0D F0S 0CSQ00N0 0S0 004 0 004 +3 #70 R S 80< 0 80<   0SP`0 0  1P 00@0D 0 @0D 0SSS0/0^]0p@-00@4S 3P1 00'R0 0S0St娧P 000 01S0H00``:2@ap p/0  BR/ $R/ #/0 0S/c@-P@1S `p 0 @1 @T  Ѝ0S 0CS0@q 0S0 0S:00 Y @/@-l 801S@i R  R 0/@-@V D0Q  0TS   彨@I /03!"/03" /0M0P@Ѝ/0M0P@Ѝ/L@o/!4! #4! B#4!0 P/60S/p@-@P l!>000pp@-@`ǵP_@P pP/p@-@PP /p@-@P %@-@ 0;p@-@Pip@xQeO-$M`@Pu WpP u0$ЍT@ @ ` X0@00S @T T [00S 000S00 0T 00b90P` ` @Z 0 [0 TQ90P0T J90P ` 0 0`0/G-pP@0`P T 4 06 S H0S 4 R30 ⸆PP@P8 0x00PPH0hKWZv 05 0L6 06 V`SH0Y 0S 0C @ Q*  " 危lE^,0/@- 0MP3p0pp`hP@´ 03  ! #,0 , @ 0  Ѝ@# 0#000S2 0,0-jpᘴ 03  !",00,0 03  "P,00,0,0 0 0#GЍR E0A#$#"$#"4#/l0Sp p l p0 0S  0 00/A-@b}|`pP1hSl l0p W}ADS}0P1p00`0101S0@@`q@-60!0 0 0bЍ@-@Td$,d,lH,l $.` O-@`DRD2DM `00 @@I0A10A 厍垳>  再 E+F? |`pP'1 00a0,P($@ @@ @>000D1 0<1 00a4,P($@ @ @>1  00a40@,P($@ @@ @>0'40张0  00a80@,P($@@ @P>040p0 00a80@,P($@ @ @P>DЍ^z^E^n^^ɾ^@-@;0 0S 4P@\0X0S@L+!P d0`0S 갚p@-P@0 0DS P@ 00S \0X0S@pDP 00Sd0`0S D갚0S 00P0#///0  S /0C\ B /p@-鿲 @dPPRL0$!p@ֲ 0S  Q@D0R0 1p@-P@ i0!S <S21p@-@Y@> @-@> 500 @-@ IG@$PE0@s3p@-3@ P`D ]d@P{p00S0U 0Umph0U 0S d0S `0U X0U D=/ᰚ80S/@-3`A0ASM=p#DP P@?Ѝ@00S%120 000P0 R00+0 0003/PDЍp@-M@`߱DPP@Ѝp@00S0S 3/0000r+뺱PD@-@$1@Qvp@-@P 4z001Pp0S 0Sp@ p@- @P8 @P@Zp@P@A-pHQ`P000t@P=Ѝ0 p 000!>00H `P (P` {z1S0 d sz1@0H` kzA0, ez(10(11i0@-@MPPEUP xЍ0@!>00 T ( P0@PS   (10C(1⡣Ѝ02iC-0PSM 3/4 0`C @ *VP 00ЍCѰpPXTT TY  0#   Q @STX p@-@,0P `0,0E Qt x0Rx0t 1x0 0S  0 00G 4000p@ O-@,MR||`SpPp踰 0S YP R R0 00R0P00080S000 Y eP 30Sڸ0003Zʀ !  , ! (p !P3L3 H3@300  !ḠW㸠 00踰,Ѝ 0SP0 0 00Y00帰Y `P帠3 00 0St24d\0Q0d00\00 X0` H0403: $d0S00 0` 00\0X 00h0` 0# 2 `)VP0PP P. 03 8 pP,00,0/ W.,P0S  ` 0S0S  S > 000 0S$ ",0 ჯp3S0S|00`YU 0R pPN 03/JFdHhl O-<PQtM p!< R$ 35Q X@ 0M@XlWP<W26 @<@,0 S00$<Q 3C5CQX U D ;W +W !BW-`S R R   `E  @ TW" |;W 0 @e 0d60 0 `0i0 0  00R 0`㧮DP@ î1`tЍ|:W 0 00 RV  00 S D:|`W| y  y 0Q` R0`1 0`刮 we0 @re 0y| @y3 P yP y k0 0 XZ 0  tЍOb00000 (/@PJ 6060X`\00` C?```8W 6C 0CW 80Sl8W1CWi 080 S`@8W0ST 0?  .w80P@ 7'WW00W0S* T1`@ 0S0Z 0W0S00}0SZ|00SX婫Tꀠ0Z0SX6&WW| T600 W`0 0 `0p3PeTw@P7`o 0| 000?893 !>8% v000000S%500 0 0 P3TBw% SJ00\50SBt%S?00X|  `3 8 3   00  03 P *`P )T Y 0Oj,0  u p3 PYh0 r`Y ShvET0t01x0@t010S ؀SS P0؀ =YM`yV PP0Yd0'0 P2`0`V `000d0尳 !0S` 0S ` ` Y00 0 `3 !0S P 0ST  {cR0001 P  `@Y> `h0S 0S000PS 0 XPsZ V`[ 1  /``` W003 P R0``0@Q 0Si ii io_] i۾^iii@%iߖo?i@'i^oi_]:_]!i#i"i ˀ08 P R/ !  / !  IPO- MP@Dp `0@0<@@P1P@U ǫT100#Ѝ!>00  0 0`P H03HDP@$ ᡫT 0Y00C?o20S7 0S4 jhP"@ ᇫT 10@0L0S D\q 03 Pet@P 0  ^80S 3/@P Q0Q)@- 0@R0S b$",0S R  `P7 03 0Q+ /p@-`㻎P ~0@0L0`0D00@0 0<0(080,040D00040,000@pE@EEEEhELEE@-@@㑎0O-,M,00S@(` @P 0 0 0T1"T00XS%X@P  00 ")a! 1 00 $a$" 1040  0pP 0 F0 8#8 !0Ƞ$,, " 1., Ƞ4,< `8#8 !(R,B B8#80Z0$0$0Y C *,ЍY 0 PP  A0P0j0@pecV @^`PpCV`[P 0p0(0 4p*4 0Ằ 00p0x p 0c8##4 Ib4#00 1 00 ~0 0 p0 0`p@`A-`p(@P P PU@0 1PTC-0@SPP @A0S`Დ;pp0 p0 @4"40 0 60W  0  0 @ 0C"00 P00 R0("( ,00#,0 Ѝ 0 p 07@-0P 4!4 8A#81C / P,000000! R ݑ0  0o Ѝ0 0`( "4`#/03" /@-@pMl0l`0@@ @0 㰟DPD0 0@@ @0㣟Ѝ ^0$^@-T@drL0010P @PЍ0S 00 0!< 04 0 (   !/Hhl\ P/0 !8 0 0 (  , !/HhlA-P`@0p Pᛂ 0ᕂ0  Ꮒ?;$2020S Aj긚tE0p@-S/@@`ᰨP0SP y0P B0Pd0 1@¨p0@ 0R/!&   _ 0R/!&   _O-0PXQ p`H($H Ġ)$Č 4)4 Ƞ8,Ƞ#80  qW 0S0U 6S 6 S0V,8/pQS/A-p`P@T0S0S6/@A-@PP2 R0`0p0V0C0 0XP`U0F1 @-P@T Ѝ0S(f1P`(`00pm000W )1`pV (0@@-pDMW,8`P@P& 4  ^<00004 0000Z 40   000 PUDЍ0S/8p@-P@Tp0S 8`0P H R@O-` TMx@xoT$0'x0$04'40婒Q0UZS TP $P& PTЍPPP\V P ,S \ P 0V \ P0;/ 0$ 0Q  ;/P 0 R Q[QV [ ! SQ [ 0 V Q G-P,`X$0p0$0@븢! 4Ġ!Č*4 Ƞ8,Ƞ#80 1 !@T X $0S p 07/PP P  PVTЍ@0S  1S0@ A A-p `X6%XpD%DH$H00!1P0%@@1!P\\ Q \\\ P0S 0S0 $0SjA- 0@SP0S   U U2 P&,4"4 8 `#80 !R   0 1@&,4"4 8 `#800A&,`4"4 8 #800p&,4"4 $,$8(#8"(000`01S0 001@p&,`4"4 $,$8(#8"(0 000Aypv&,`4"4 $,$8(#8"(00 0p@-0P0`l1 QÝP@P 000S  \0$!00$ S00,P(`l 0  000Sd09d0@0 ` R00@&P4"4 8#8 !R   0 1 &4"4!0 A&4"4!0 1 0Sp7p$G-(p0@0SP,``M く ROd0" 0 0  0 P" P c  =iP]d0"@0d04"4 8#8260S   &4"4 8#8 !R   0 1 &4"4!0 A&4"4!0 1 0&0 04"4 8 #8 S0#03 00P0p哘P  0 P (00 0`ЍD0 X 10R@10S 0 9P/D00 X +0S 0 'P  (0R R  @!@1 0RD0  0 @1 H0(00 0^@-0S 6PS 0SQ@` 0S  @(000L0!P00!P00Ѝp0SG-0PShM;0S/70S] 0` R@( RS Xr   R R S"0 0 0S0C00匀(XG2#212(0 00p08^pP P1hЍs000S 0CS # 00*000P d0   1 က 60 0,P.L0+0SQ 0006l0S (000L00 00!1ZP\ 'P /0A-p(`@pPD0S   !R, 00! {hP $8p0SP Z 屵#0S0 A0$0S/@-40@0006(01@$@-0SЍ䳑S !>00 000080Ѝ8?@- <0b",4b4#  #$  #(  #< hЍ^p@-@0M SЍp@P` 4"48 #800JЍp)^Q<%cbxQ 0S0C0CS0#0/Q 0S0C0CS0#0/p@-@PT 1 !RR # BtPpEp@-40 R@  000 1  v  8 Ѝ@-40@ R  000   _  ! ЍX0 0&-$M840, (  0b$Ѝ0C-M 0P`` @mxp0 P 00 00 0 0@)?o2P0S B~Q Ѝ`C-PMp@ 0` m`0 P  00 000 0@)?o2P0SP @TP@P T @P0Ѝ T f 1`O-@`Pp3DM ,@0 00p(`$  P]-3ဃ ,@0 04p0P(`$  PJ- 0 0 0'!(3 ,@0@ 0 8p4P0P(`$ 3-0 400!2 02 ,@0@ 0 8p0P(`$ -0 0 0!2 ,@0@ 0 8p4`0P(`$ -0400 0 0!$2 ,@0@ 0 8p0P(`$ ,0 0 0!1 014,@ 0@ 0 8p0P(`$ ,0 400!|1 0t1 00,@0 08p0P(`$ ,0400 0 0!1 ,@0@ 0 8p0P(`$ , 0400 0 0!0 ,@0 0  8p0P(`$ , |tr `1T@T+DЍz^9^`>^pEG^W^c^$Eo^ER_|^^10E11p@-P ̈́@lh 0S Q 0P @@@040p@Pp@ 㳄01`0 ,,0O-PM@0010pC 6#21 2 P 0S `5 V#2!12 U Ѝ 00帠` i5010ZРJmΠZ  T@tPZ  R` 30 2 0 0S DCZK ᩠Z| YXj !>000 ( h408 P @VY 2`0000ZؠJ  # 0h0h0S ؠCZ T|Y  Z   T W`0X `P  `P 0"00 0SE0 f 4"40C(4"<00 0000 (0 B 0C(00 Bi* 0P,0,00  q!B pP0$#$("(B@&0 0C00000PP%S Y  Z  Z RDSS  S R 0  i0 00 IY ʗs aR R000 Ts,@- J104 &V,0?A`"b8"#b ЍQMbO-p`PLM @ ?V *p`9V0(p)`t#tx'xpGW U* 0$ 0 0$ 5+ $W$0S 0 3SH0L0SB @P HE 0$ 0 0$ LЍ00C0%P T(0, 0 (0, 00000C00(Sed݉090! !0d$0CSQ0PD4Ѐ É0 0 0 Ή?P#W 00S00 R0S 娉004 0 004 |PP0S @Pl   0Q ,HH(00<30#0S  $3/ t20S 0  lH0L 0 H0L 00a80< 0 80< 00! !cULWI004 0 004 020S 0  9P0T 0 P0T t00 1 0S W0 Cr 00 p P  $Z     R # 0 0 P10S #W  R1  0S R 0$,00 00(000(000 :P 0S  pl`P  8q0L8 ₚ8cP P(<0a] a]`0X_]1HE^p@-0P@娈1 01  p@豈0C-ᶐ`$M)@P 400   0  P Ѝ PP XXhu  @1 pW ЍC T)TX%XU d4"4` 8#8R* 1CS0RH0@0!PU:pWPX0\p JU:H @D P *0X0\T 0 @TtЍC`0d 0S S :\@0D 0 @0D )`Pdp03/@ꄛ1E0a]`00 h\ 0SQ HP/P %/QS  1 //0a] a]@- 4!o`8O-QpP00P B·0 0 0 ه02"0`0S 0XA0C?o20S  0R:!R\2S2 HB娇0 0 0 峇 ЍO   `P 4"4!8 #80CS@@0SV:V`!P U[èaŮPU@0 P(P2(X2 hL 0`r P(Q`1 01  i0RXP00 0 X0 XZ[ 8 #0 0 000 040000 0 0 000 PP slv0`ۿ^-$M840, (  0)$ЍD1C-MP@p 0` Ig`0 00  00P 0 0@ !#?o2P@@TPQPP=Ѝ蘛G-M 0P` @pg`0 00  P 0 0 p@"?o2P0S  0000 0-P00Ѝ蘛0O-`,Ml@s ,0 劆X0\ 0 X0\ 商 ,ЍO P 0St(1,!0 (1,!0 ` ,Ѝ!>00 `$`02[0 00P2bM0 0 0 X0 0$#$ (0"(DRD PP d P0$"0C0H0 S=40:0Z @ 0 0#P00S1 L 0d` 0S*@00! 0 S0!0 X X0\ 0 X0\ U, 1@ @ H L0 [H L ` d d` U` 0 `؅U 7X (X0P H0@`居0 @0 0 廅@D1@1@-!>@tPM `0@@啅p0 0P垅ЍL000n唅@1O-=Mm @P=ЍO`.X g 1$!0 1$!rhT=@@0D0D0S S R 1$!0 1$!]@S F0 0 0 Q@0 <   @P/0 0 0 0SXP@0@S 0 0 0 @AT 0$ 0 0$ 0T7PP@ 0S0 0 0 ;`( "$`$"",R a(!"4a4##<S3 @1, @000@S SԄ0 0 0 3 ;0S [ P 4"48#8T幄(0, 0 (0, e@(S嬄0 0 0 X Q0(0 CA@ @0;00 0000P(0@P 0@0刄1!0 1!40SP@G 00001S0`0 RP0@0U 00400S @0 @p0,P0$800010C 0 0STz 90S@s 0tPPm  t0@0Z Z\ 0S@10 0 0SRQDZ Z 0 0C 0PZ Z vP0t00u080S| $0S @E 0S [@@D 0x0ߘ<ty0P0<0Z.@0 tG0߃0 0 0  0R*+Z 4 0P $0d$0J* 0$0@K@ x dZt0P00$0  c ᰘ$0Sx00000@@@T@xLP Lc @ vO0t00u0,0Sx 0SJ Zz 0R: xcXt0PJ0   c p0000,0= hxLP@i L cYF 00C $RYFY0 #"  02R0; 0IS  S> S! @E@/ v'O0t00u00 0S 80x00P 0S H @Hb000t0 Nc 000 vN0t00u00 0S  x7cȗtb0P0  꺗S@T 30S@0@A@@$0p`201P0P0S 0CS# 2X0X0SD0CO ᷗ00SK Pm囂X0\ 0 X0\ G W T  X (  (  N #K0T0T0  R  Q W9 h W6 ` W3 X W0 R- H0\0\0S D0CS@p#@10S (0@S 0 0iDX0\ 0 X0\ O`004 S ?000S @o P@0S 000010p0t 0 p0t &,0 @0<01# 0@3/D10X_]O- LM @P`pp8 h8 (p000`,P$@ @@ @"' 8 (p0@04`0@,P$@ @@ @"4 0 07(p008`0@,P$@@ @P! 0 07 (p008`4P0@,P$@@ @P!0 0@7 4(p008`0@,P$@@ @P!0 064 06(p008`0@,P$@ @P!0400 06 (p008`0@,P$@@ @P!0400 0L6 (p008`0@,P$@@ @P! 040 0 05 (p008`0@,P$@@ @Pt! 0405 05(p008`0@,P$@ @P^! 040h5\ 0\5(p008`0@,P$@ @PH! 0405 05(p008`0@,P$@ @P3!44 04 (p008`0@,P$@ @P!040|4X 0p4(p008`0@,P$@ @P!040 0 04(p008`0@,P$@@ @P 0@ 040$0 03 (p008`0@,P$@@ @P 040p3 0h3(p008`0@,P$@@ @P 040$303 0<(p008`0@,P$@ @ @ 0402 02(p008`0@,P$@@ @P  (p||24  0pD08`0@,P$@ @@ @ ,2($0 200pD ,` @ @k p1$01D 00,`(p @ @W 1010D 0,`(p$@ @ @F  3\!\\0@S50@ T08!0@T % 1d@R>0 LЍ RPP CB! ,0 FD1z^n^^^^F^^^&^̚\7G.^:^$FF^ȚU^Ě`^k^z^^FR_d^^`G^؇Gԑ^G^0X_].КH@1@-@ @@ A-p@PP0S PP 0 0100a10 `0 0 0^0 0V *0HHQ0C00 @-@0SZ 00H 0 /H@-P(0dp`LM @ @ 0 VP@  0 LP@PP"   0 (02,0(09P@ `"0  ````(,0 ((%LЍp@-0P@1 01  p@ D103!"/03" /p@-@`͓Pe@P pd00S @-l P3<8 #8!R "00 /ἛHP/0P7@- Ѝ0P @R R00P0S0@-`Q00pPg8'#TgT%%< z@P@ ЍVPl\h00100S 0CS W @#R,P 000A-@M`p  XP@P%0 R@ 00S,UP' ( LJ!>00 0@@HPP!PP 00!1@ЍHP P@UP(1@P P00A-@ PRp   0P 0SRޒ`P1oP 000\ Q 4^0 0!0;0I 0!A-PS@` pPl0 A/4@}8!< 8!<}D1hP/A-p`0PPQPEU `f @ T T@ @T@  ]0PEpO-,0,M00@0104 4`Q : 01 $000pBpWʴSc}0 0 0 n}d(,Ѝ0000 000000#![< 0C 0((04"<00 00000@ ,0@0,0VP *0C SUR}0 0 0 (}0 0 0 7PU5PP(R}0 0 0 }V7PPTt70P000010 00 0$() 000S *000 0-0"> 00$ 000K1 08#80$!$ ("(Q: pB$#400  ( 4"<0 0P 0( 000@ /xP|0 0 0 |000:, ,0@ 0,0 00800`P@D1O-QM00@ذ (0 Pp `G4"48#80SY:00(@0000NC10@00O|x0| 0 x0| Z|0S( BH00!>,00000408000S 0 0S 0 0R %0$@Pn@Pi,!PP,0 0b m|0 p0 0 |`(0S004 3SH0L RP0/"P 0 0C000000<@0 @5\(0P 0(0-\000$#$ 8$#, kH0 00@V0g0 00Z0010k0R `%`P[{0 p0 0 {3P 0LZP [p{0 0 0 {@0000 0PTp @z0qS>q(0[     Y Zf{0 0 0 q{0 sR 0 W [U PR LP dZ`H{0 p0 0 R{@0`0S0` sR 0PP3 P 0PT@P H0S Yp{0 0 0 !{AP@0D 0@040 D 0  PW0p/T@PY`z0 0 0 zp`0H4PS0@0D L`0@00 @000D 0ppW 0OP0X    J0  #RV  3Q 0S# tPP Xz014!0 014!z1P80S t80,3/PP t0 0t  P* [ 0S% (PP 00SPP ,0 ,00,0000 , .0S 3 VZz0 0 0 ez([PW `2 0R>X L$KЍ 0S80S W `r80,3/`Pr `1p0 0 00S Uz0 0 0 hU6 3 lU z@1D!0 @1D!Y0  8Uy@1D!0 @1D! z P @4"4D 8#8Q ( %0%<#*Ty@1D!0 @1D!y(P( 0<00 (0(DQ ,   40#0 @0AWV Wp 0 ("50 @000PP(0Scy1 !0 1 !y`J`0<  )0 !><0 0 ` @0DPHPj`P/ 0P+0S( 0#p# 30S  t33"1`00t0&Ȓby0 0 0 myWpMpp3 20S ( ,0@0,0 (4"4 8,P#8S G04X 0R0  .y0 0 0 H1P00,0 @ (,0@0,0 3  10S 10S d(,00,00 ,0 0 0  P%3  10S 00S A( ,00,0  (VPP((Q Utx0 0 0 xtU (0   0, PpD1H1`ab]^ C-`!.p0MP00  @S00000DTЍ0S  Sp BS0S 0 00000 000B00SQ QR X0 SP R 000*A-PpU@(M \pPP7@2 000$30P0# 0CS0 @P0S@ `0P #R11@0S  2R`V\p`(Ѝ200S0@0 J@ 0 00S"00 0 P@* Q& 3S#`0VV;@ IaP 0007@00 0 K ^ R `1@ 0@ 0S 0 DP@`0  V1@ 1 e0 `aR0C000 0 S S Q ` -@Va]s@-0@ SP& S) S- T 0S000 Ѝp0SC`AP 0P0@000YP00P 0  0,0O-,M00P`Sd@ %S 4RN *P PG0$0CS00hP 0h0[5 A!pP7,Ѝ  C [ 0Z'`V&[$ZZV0DW `F` ,R0 9W`hpd@(V ,W`PpEP0`#0CS000000 CR0ŕ0S@@0S@@0S@@0S@@0SKKC}0 00+0 0p0P0SJJP0SJJ   Pn$0S 00 ]`$[P{1_P 00qp PQ} PK0SS @ģrS @n { P;gO0P CR hPX 0 P$ !0CS0 DD R R D0$00  0 p 00$ a]a]b]Hb]p@-@PP`p0Sp@\enPp@-@0x`S   !00C000C0PUp@8 R0 0  ؂PG- PApȀ`H@Tp@W< 00C@S@p0S00C0S0 u@0D 0 @0D u @1!  \PD1PO-<@`pP DM  0 0a0,@($   <  0 0a40,@($    4 \ _ 0 '.  a 80,@($ P @EpDЍPz^n^^p@-@`M0P0@@ @0 rdP r <@@T 0200 R00C1 2"Ѝp@^0P,@- PBA@XA-@S70"0R S  B! "2 2R'2S0p`P"0#Q00S qPP@UP#00C?o2PA`P,ěXO-Mp 4"4 $,$8("( H#8! CQD0Gt0 0 0 FCSC 00 Z V` "(?AT0&wt0 4化 0 4t ]`PEft0 0 0 qt8 Ѝ R:FSt0 0 0 ^tP R\ \ @ 嘕0`R 2t0 0 0 =th Q 0 p" 0 崡10T01A0000W2SS}$[@Px 0000 001<00 00 0010 !0 00001S0@0AL4000S0`0 ``0p `V 0000S0  !Rs0 0 0 s\0`X1p01W 0 !1Rp00ZY !ᲁ!HX ڴ!X  :!( !! B! RA10C100C0s80< 0 80< s ᗀ ~9!AQ ڴ! Q Ƞ,Ƞ B! ReQ  p q! B!  B WZe 0R ` ``d1S 0 0}1`p[ |0R  B   B  `  7X0- 嶀 q0(t"|p   y0 ! 0 1C00S,00V(`8 r0 0 0 r-00   Q   0D1PXP-//-/-/@-@-@-p00d0@ ` P Sd0 (00  0 Q(0  0S(  Ѝ1M   @-d^@-`^p@-@P0S 0S 0Pp0Pp*P pd!>C-@pPM0 0@@ 0 4!4 1C 04"40X1`V T, 0p Ѝ0S0S S0S  S0S ST@`gP 0 ], 0  02# |0R0@l@ +rh0l 0 h0p0l t 0Sp0 t rd0X_]YFD1-/ 0!< 04 0 (   !/HhlT0M000S ~S 0S/0S001Ѝ/ \ P/0 !8 0 0 (  , !/Hhlp@-@P<`0w2pdp@-P`@pp@-P`@pp@-P@ zpp@-@`P 000lp,A-@pP`y@P Z0@-S@ @p0`000S ~S 0S/@P0P d0  0S 31@2 Ѝ0(0@0 O-@`p\!DM 0 ( a0,$  @P70 00( 0 a4,$  @P$ 4 p 0 h (d  00 0 a8,$ P  DЍOz^M_0G#^dG-`pP$@T0S0S S 0S0S 9/P@@-0S0SP`0!0@PS R \ 808 0  Ѝ0 /ha]$Ed@-p`( PSQMp $ @o<0P PoUd (0F0S* 10H   CR30C0000Tr 0(00(0 0 () $   R  h 00` 08 PЍ#RH L0S0P  +@SASC 0 #RH L R    P@P+ 0( R($!, $!$ 0S(0DS 00 0 0`P0 0o0 0 0 o7P(P PPD1G-@pP`1W0 S8@ @P   04W@ P`S9@000,s@-aPU0@ QPd B% / P P d0R0;;d0ЍpU   Ѝp@5P P\P d0R00\d      0`( "4`#/@- 4"4!04"41@- O Ѝ 0<P   /  &G0M/ X+ 1M/ % p@-P`8P@Pp0Sp@ 0!< 04 0 (   !/Hhl\ P/0 !8 00 (  , !/Hhl@-@0:0@@-@0 :0@@-0 00   00sЍ+^p@-Pt@pp@-P@ )vp@O- MQ( P '    @TS   RK 00 0g 0R010 0! R010A0;S@T 1 R00 1`@ R00 0`R010 00C 0 01 0 Ai Ѝ HR@T  R1 ` p @0V 000 R / 00 000 R00 0R010 Wp 00C 0 V 00 000s RJ C\`C^L&\@Cm! ! !$ !$m  W `^K\CQ B CJ0 00000 SD0 000 R00 0R010 Wp 00C 0 1 a0R*sm1 !0 1 !~m t   W0 0H  00L0CS@`1@0 pWpP 202@m8!< 8!@!<D @![D (!, (!0!,4 0!405m0T0 @0S0ppp@ 0@0 00S0ppp 0h țG- @`$pP0P= Y YH ,  Q. Q Q 3 ,10S  03PR00@ 0@ @,(#(0 4 <8#80#Q0P @āl0 0 0 l,0 Q Q 0@ 00S  0g꬞O-@PDMpp4UXDЍ`0V V X `XV0CS0V  0 ;S0000 4"40HPV 0 ;S0@000Sg1h0 0#2S S . ,. g!0}g. r V0 0L yL 0 ;S0<00h1h00l1V 0 ;S<00S0 <00 b]5^?^Ğ@-00SJ@ R  a``  B BJ00C0@0CT~l^A-8AP`k80< 0 80< kPqW: AAdpT1WpT@dCAD@T@0PqTA0S 00S 00S01S *00PX!AQ1DAT@1T0@#H1;@0rAPqTAd\lXO-CM0O0 0pk0 0 0 {k Xf70 <D0< 0`0SP% 0%* h0P h0 QP%*8)~PU Ek1!0 1!PkCߍ PP 0P 0#2S S0 00S00  P0d#d 0h&h`F0P0000040 0#21VS(000%k1!0 1! k0S 0S0S0S 0S 0(``F 0P0000(0( R`F 00 RP 0 ( 0-P 0(  QxPPUy (00CD0080D0 S  0Sw<P  0@0X0m\j8@`(0  0  00`0P@0@@s00 S000P 00 pP0j1!0 1!j  pP0p 0h0e0$0e0 p00 h00mpPppWj1!0 1!bj0 D opP0Cj1!0 1!Nj;0S 0 SZhp%  $ p4"4$!$8("( #8 {x:xx RP| 0080f L @000$000000 00mpPdpp`i1!0 1!i0 DopPO0Ki1!0 1!iT90S 0 SZhp . qp.$ mp p4"4$!$8("( #8 . k. g0@ 0 @HX3 001HS00C8@ă#8"@ē1V0:8Sxi!@ ! !$ !$ip0`F001X00C @ģ1V/ wciX1\!0 X1\!ni_ 000 0 jS  0Rk(wFi(!, (!0!,4 0!4Kip0 0HX,v,iH1L!0 H1L!7i"i3i 0 0CS0S5 0R1i`1d!`h0 `1d!i p @  0Ro6 W'9000 00 00000`5 P000`00x0P0p 4  0"00 3S0H L0SP0\ 0X0<   0CS00S0 00040 HAp0060J R0 w Su 0 hPm xi p@Tg $ d13$0(40D1;S3`180S X00 00D 080  0" 70P00SJ S0703 0l1\0h1)  1R ;.0CS 0cP1T!0P1>/T!6040^;c0 0 0 co=00 0 !0R0000C000 0  0T R,;S+ 0C8#8S_ 0BSH00#V00Sn 1$ Sohch1l!0 h1l!scP 0Q/ 0;`80  BR0!0CSlxHc0 0 0 Sc]0`0`SY/4!40p 000C17 ;S;08C8S; 0  10C0CS103/P;S41,041jV0 P \1  BRm103/0(0( 010BS bp1t!0 p1t!bU0404 (0pCbx!| x!!| !b,0SC H!R 0L0CS86A 01R8*1 03/ W91X0C1_0 00    BR901!Wq0 CR 10 BR!0 BR1;P%0CS9083P(50!10CS0X1"10C11W0#4 500( 50C01 0S 1  Q 40?0 0; % 0S 0;841 0S 31V!0R1$ S *sb1!0 1!b$0$ 10101\1S$05\150 0 !$10BS$!% < US <0 W0P00J  0S0 B; S1 00S220 0S010;0 0;D821!H211 PFj00000`0_Vx p>W  R0Q^:@(Tf ;SX 0Hd1R$0 d 010S hw0 h0 0w0 04 S0 0P0000  hN- J-00S!>6 l 9&00090 S   hO:țb]X̛@-0  0'S(NP L@a1!0 1!a$0 sL 0`( "4`#/ 0!< 04 0 (   !/Hhl\ P/0 !8 00 (  , !/Hhl@-@0:0@p@-P!T1PB1AoP \sX1+8T@1D01@ xSx0 S 0; S0Ҳ;p^c]XO-0M@S 0 S/p`V 0S?(<(PP p( !R `0d  Sp3p# RppWO^hPPC 0S0S0S ᳍ PEUڼ; 0CS0!0; 0CS0!Z<0 0 0R0100 Xʰ\U 4_>00P4%4158U>00P8%8150<01@00D00S^ P0Sd P.P%p0'T00Sf 0 0C1!4!R4!480P00L00T000(00 :0Px  10S00(|! (  0B00  00!0CS41a-V`!;p0\00  ;SP0PJ000S Vo`0 Sȃ0Sq0P i ;Sf1S PC0 PE 3Ucڠ!410\ 0C 0C?SPȳ(̟0S" 0  0 !!R: !BP: P* B R +X 0S1 gP0;00UA(0SP kUP!=0PEU00(00H00S 0  000CsC Q$1S  A0CR0U,0 0U'1  @0D S 0 0S*0S\1U*0!00C ? ,0Se:, 0S 1,1 0C?SR\0B< SQ 0010CS  010CSPP8P90]&pwHp30 @P&QR P0S0S0S0s  `"?1S`pPpV1S\PE80P H0Q8S80P H0 8(@0D S8D!00C S:08P0 R<P 8P0STP 41R1'!0!0S01Q441r0\?0P0 !41\PRPePe1 _APBQ0CSP10B P0PCU000AQP180;V PF03 PE UV0k80P Pp0H00(000S4 P08P, Z( 0S(0<080``0 RR PP  K . 1`P0H   0% &$!$&  @ f1l`hdX50S?`0`d 0P p(WA00 00 5`p1`Fh@1SI ` [) 1$00p RA$  p(WA0|a   0000`K |aa[%`$ 6 `)V/5p0S 0 00C00 0#Ѝ1 @a0 40K0 `0  X `4000:80U040D3 G]00S0U0S- 0 0 0 3J]dpP 4 00S<n070b"]024"0 024"-] p`)V00/0CS202000000 000000 0 Z00400 P 10Z1  PHo0QAQQ0 3SH L0SP0\ 00<  0CU4 00 0000 Z 0 S 0 0$00 ($ QdXLso0 Pe4b]ĞG^#^b]3^Xc]u\0 0 0 0 80|\pP> x4 00S$0b P/ 0 0 0 1 0CS0 0 0 0 0 0 0 00400 80RLL o8 < Q pQ   AQ U 0 BRU RZ ȡ\X"\ X"\\ ( @0% 00   V  `:< & " <0,"!R R 0 ,e!@ Q P00S",0(!Q", " "! BR ! 0R !$!,!  00 S(0S0 40< ,00S000S00!0 CR001H1S3cL0H1[004 0 004 [`/P 0R 0!S S{ 8 P 0;t4040` 0(`Sy8d#l$0`(`0Sg0$ 000 000Sh!0 R 05P Pps 7P @0@2PS;S>l   '8P0S 040Q: Q6 @ Q1J0 A\-Pap G: C:0 c(#"$ c$"a8! #4 a4# CQ 0 CQBQPE`FPVpQ[4Ѝ QA0 B^0"A10IS1夑S CPP +0p IR GQ PUGPIQP0 CR 00 0AS0PP 1 0CSQ0p CRpp P0CS 0BS0 P 0 BQ000p CRppꜞp@-0@P CR@Qp00CS00CSp0@0CS@p@-@Q0  00/ 0 0C0 P 0 C\ C\ 0 0C0/1S/ AR/- 0 S ARR A^ 0  /|1 0/P/ 0`( "4`#/@-0(@+R@ A3QR> R+R. R d1M  0MX @p@-PUp@`D0P 4 U80Pp`d  H Q1Q44!<010p@p@-PUp@`[0P 4 \W[0Pp`d  H Q1Q44![010p@@-0 -脼 0!< 04 0 (   !/Hhl\ P/0 !8 00 (  , !/Hhl@-@0  :0p@-T0@00SDP@j xT$3Sp0p@T|J^F@- @FA-0pS@ S P0S S0S0S0s0S0S0sT( PU X( < 0S 00PP   ( # 0R` R: 6P 06 00001 @  00(100p 0;00S0 0001  (,!( 0"8S0SPT0(S 0$ 0 0$  00!/A-p`:PUAs@T P P (S0 0 0 (S~0:0aP@-@01S0010SfC-0`S,M(P@%Pt!0@ S 0\q\1 00 DLS<10S UA 0 Sp< ( 0R*T ,Ѝ p 0T0!  00VP@ 00dSP`00S H00@ C3SR p0/b] f] Hi]F0S,4! x!/@-@0M (<01,0 00 0R0ЍF f]@-( (0 帿*NЍ0FP Q Q@\ \2SQ Q @00P1Q0 Q(000S@080P1/G-P0S`(eA``"0R^ !QOd2S01q 1O@T@!A0S(VXA``2SN ̐ HS9P<dBT@pp0;PA` V pt00KT *0D00 T1pG#h"R l2S0Pp2S<0h2S lBT@GPpBT<@Xf]p@-@PPpP1S" R X0o@ 8fS0S03X1CffPa 0 08 X!F1T1S01S00p@Cz@-@tM0t2p S% `0PS N     82tЍTF@-0S6& ЍS6&d[^0b? S /A-@P(p[T0`8@ TL3K@D0S@D0S@DV x0|  0T@ D/X0 P1XVL 0   @T8A%815A80S0 S(00 b/ R /0SA-0`S0MUPSPQ 2q0@S0@?oR20S@Z P0@S PaQL |L0 000 0HP  0 00TP! Q U0`0@S010@Sʲ0TT#T1X%XS !0P90D0Ѝ  10CSa0Tw00000090P4 W R0( @Q+ Q 0p00 0dP00S @0G3WS "!>20 2 0 $0 80  兽W 0/ha]F$Ep@-0P@(P1 01  (p@PA-8pP(`@P1!01@@(AP 0`( "4`#/@-0l@ S \0C# 000S  , \0C#  B =0C=@-@P 0x;@0:CP@@ 0 \3\#  c]XFO-m0@SM S( /y`P@$00#.0#A0@.H>@$00#||, 0 00 PU `0S l4P  4PP%@-0@ 0@00 00@@R$$00S@ Ѝ^%O-4b@=PSPPm0S S8 > t00#.0#8.> p00#`, p\V 1  xQ6M1!0 1!M 6 T00;c1S 0 0A0 0g!P00@0@00=0=M1!0 1!M ЍO-0R:M1 01M 0SH 0 A SS0!\ 0 %̞A-P`ATAAp@O-Q<JP0T 0 P0T JPT1X! 1C1S01S01S0# 0c1S ;SI0 0 0 I01;SP!T11T10P1000110H1;S0;0103/._0Fc]Xp@-@Q0  p@V8bP ;` S0 D1 B00R *PT11XC1S014cR :Ix0| 0 x0| I<~IX0\ 0 X0\ I0000Ԟ@-@aMҞ0  Ѝ@ `pP HQ^I`0d 0 `0d iI;S6S00 (  1( 1S D  B0R#*>Ih0l 0 h0l II00  B !  )x01T01Ip0t 0 p0t %I<Xp@-@Pj0  p@裞`P 01; S !R D0D00CR:001R$X@-T@<rKH 04004 000n@03|Xx0 R   R-  R   R   R-  R/  / b /ԞXgfff@-@0 Fp@-@TP0==09#9S p@$0P 000@-@8`@0S-//A-P@ap &1`P1!`; C("(R1S00 111; SQ0A?0XC-MP00`0p0 0` @r( P  0`  00 000 0@K?o2P0S R0 ЍO-M0l4@3`r偱XVP 0 S0  J@DT0V0 00p020@35@`T0V2|p3h+0 S0 00(0 0000DPP -(0@D00S Se [030#X0S -(`P 3; ߍ(0 @ D  H d L 1P0 0T00S0+0X \00U(!  (@0 ( !( 0 `d (t0T0l Sh pq xy!&^? 0|10  @J0 0( 0(0 8( 0(0 @ D  H d L 1P0 0T00S0+0X \00U(,  (@0 ( !( d0 x ` ( t00 lqh  p &'T0S^0yx1&^? 0|10P0  @Ju0 0( 0n(0 8( 0g0 K =00Hs }@ -$M840, (  0L㦼$Ѝ7@-PQ@ PP ZL R #_P Ѝ000@-MBc0 嗴0P (P W PU 00 00!0 0O@P5xЍ Ѝ@@O-GMp!Z`@D1LR @Gߍ RP@ S @  R!JoQ 婒[ PR 00岛 0@ ,`(p 008P40$@@ @ 0!>4 ,`(p 008P0$@@ @d> 00!T> 0L>4p,`(p008P0$@ @}> 00!> ,`(p008P40$@@ @g"040= 00!= ,`(p008P0$@@ @Qx= 00!d= 4,`(p008P0$@@ @;(= 00!= ,`(p008P40$@@ @&040< 00!< ,`(p008P0$@ @ 040< 00!t< ,`(p008P0$@@ @ 0!0< 0<4 ,`(p0@08P0$@ @@ @ 0!;0< ,`(p0L08P40$@ @@ @; 00!x;0<0L 0,P($@@ @ 0 !(;B0 ;L$ 00,P( @ @ 040: 00l!: ,`(p008P0$@ @: 00 !:4 ,`(p008P0$@ @r040@: 00!0: ,`(p008P0$@@ @\0409 00!9 ,`(p008P0$@@ @F0409 00!9 ,`(p008P0$@@ @0040P9 00D!@9 ,`(p008P0$@ @0409 00!8 ,`(p008P0$@ @0408 00!8 ,`(p008P0$@ @0 400!L8 0 <,`(p008P0$@ @@ @0408 00!7 ,`(p008P0$@@ @0407 00!7 ,`(p008P0$@@ @040`7 00!P7 ,`(p008P0$@@ @0407 00x!6 ,`(p008P0$@ @{0 40D0!6 ,`(p$p008P0 @ @c040`6 00!P6 ,`(p008P0$@@ @M6 00!606 0<,`(p008P40$@ @45 00\!5 ,`(p008P40$@ @p5 00!`5 ,`(p008P40$@@ @ $5 00!5 ,`(p008P40$@@ @4 00!4 ,`(p008P40$@@ @4 00!|4 ,`(p008P40$@@ @@4 00!04 ,`(p008P40$@@ @3 00!3 ,`(p008P40$@@ @ 0!300T 0a,P($@ @W4 040 010 f1 SRBA>0 0 0 >0;0`1 0@ ɮ@P a "A@P T0Sӯ7@S=0f1XG-PU@ p@`R000S S @ Ꮾ@( @@P0S0S0s000A-PU@ `#0pS 0S Q @@P Q 0@; Q@P p@-@T P0`SDpS=pp@-@T P0`S0S\=ppA-0`SP@p0S9@@+0S ;2XR* 0R 001000@0x7@A-`@pPؒ000S S/@X>2D@>4Aϟ 塪@P0S p@-P_@5:@p/0S) A-@P`pLT0S1@ 0 `1 &!#00a!0 `10#`11<1/A-@0S `pTP 0S   @X[^@0S p@-@`1P Mp/A-@`>00p0S 0S 1;10;0PPPQ011PPQ7PH0PP [0 1Sx01G-p0M0@`0S6@ЍZP V V @|  @@  h`Y`r Yt3HX@P 0R000@P0S@+S; @P@T 2TA @P@T t2tTA @P@T (2aTA @P@T 1NTA1HXg00 0S;   ; 0= S00 000`0`S0e00d10200q0 000:ED1 P@@1T#3=P012|=T0814X0\1 l0 1pp|00t00 p x0200002020M1111*@ \c]Xcc]T@-;@SS8#8S TS0 T @0;@0;;S0(P ; S Q 00?0 S0P 0PD00  P $00  P X;S{p@-0@(P0 Qp@%@P p0S p@-P-@p/0S/p@-P@p@p@-0S@ `@Pi@P ]@pO-QM⸀ 0S S4 Ѝd1p`1`\1@X1P 0` +0 0 00  00P 00 0 00?o2P0S0S*  BR 0p0`0@0S`` S`V WpS0 0SPP/CjRP#US@@Ӗ/CjR@#T̚ȚĚlc]xltp@- @ v_z^\^a^p@-@\41P!P301108480pp@-@\41P!w00P300x104Q88Q0pp@-@04Q8!0 S 0U0C:x!0S30C x15x1%d!d02S414pL R 0!QP!U:09ꨞ;S/0H @-0@0@Tw (0S w @^A-;@S0;)`! AR80;p4QR H0  CPPP 00!0C,2#41000&ЍA0404Q0GS0pP0PE<P4Q0!81 BR<10041,000x10   10BS!;S0;/814!R41,000x10 / 10BS!/O-4!81PR$Mu;SrP1200m 0!aq?A3c 2#!0C01' At14X6' $A$A! T@T(#3#  p0p [(1!20  0 [@ @0`FB`Fd1 #<S01R4!41$Ѝ 0 0  0 0$ЍOMb̫gfffA-p@`{Pf  R78 0S34 0S/#0R+#0R'0 0 0 004 \1@0545\1@55p P PP50305 <,ЍOV   @P d]O-,MBP $X 0 L0 0qW `2`P1!0 1!N0000$0VZ0 S:p0*b 0`& 0 0$0  d1d ! 0!!aPPL 5PB  R;#0R7#0R3 D#P- 4P'0 0 0 004 \1@0545\1@55p P PP50305 <,ЍOJ   @P d]dO-$M@ZPP $ЍO+10`V 0 0a0`2 Vz 0 r08800000W  S R  Qd:f"` 0'O 7"0WIt 0 0 00 H1 !0!!PP4 ~P3 E R$#0R  p  r0 C P 1 90C P 190 Q 35 5Uyv   p    4 P000@` d]PO-%0 @ x#000`0$PQ 34 8Pp0'r0sGs 0 S*06 $ 0"!" ! "  R' :#'(0( 00 0   QQ$Q-S$  (( 08800000$0 PP 34 D0 P:~ yPPp匡'r0sGs 0 S)05 $ !0!@ ! Q&#7880000 0   PQQ+QS+  (( 0880[000%0 0%00S0 0C00000 00 Ѝ0 P:@ d]\< C-M@pP `؀0S  S*Ѝ% %0 0R z\UP RQ 0RW0 0 0 P0 /@p@-PP@p`0@`TV@@Q= @%0% P 0 0%0P*0%0C0000}>0`0"#0 0 5/0`2Q 0S@@iV0 =A0 A 0 Mb@BA-P` Y@|pG M @I(PU@T D0D 0?8cL~Ѝ 0@0$@XgfffO- S@Pp0$DM0aV[: R7 0K 00p`00! 0  "  p 0S' pW* '078!800$0#1S<0P%1P%PDЍ00a d]p@-@P!t `0D0034 0 0 %0 0%0p@p@-@Pt `080034 0 n0 f%0 0%0p@p@-@`?PPpP 0V 0 10 V& Zp0% 8 4 &#&#(    % ( %    % (0 @10(0D`04`06% 36 3(00000%0(0% 0 000%0e 00#2%0(0@10(0RO-@PlM3 $00 8%P !  ( %qp P$ 0`@  KPP 8<% 0 ! ! % 0 0`48(0@$00$0lЍX   %`0!&bPP` 8<DT0 4D0%0 010102%000(0C-MP 0`p` @0 0 00  00P 0 0@?o2P0S00D DSS  S00 Ѝ茞@-@l 101H00H0101p00p0101000 20 2000800 u$00 o@,_G40!( ( "P @@ /-//-/-/@-$0$ ݚH/ 0(-$M840, (  0( 㙤$Ѝ@-Au^@-A^@-@ᴱᲱ-託1M/ A-P0p`0ش@P& d0 0  0 4& 0PP@僱偱(t.004 0 004 (.Ѝ@-@(0((0M @Xl@-@0S 0S <kP0 0  0 TP -/ 0!< 04 0 (   !/HhlQA A-P,p@`10 00S S S ,00S @$!,0( "(0P x@(-0 0 0 (-҆3 40 0S 0 7P/\ P/0 !8 0 0 (  , !/HhlA-@pP` 6@PoA-@`pP @`p@-@P<`0l̚'Kpp@-P`@ə=pp@-P`@˙1pp@-P@'pp@-@`P101Ξ 000ڛp,1S/)gG 0O-@P`DM!2 0 0 0`,@(P$  a 0p!t2 0 0 4`0p,@(P$  L40 0 00'!2 0 08`0p,@(P$ @40 0 0!1 0 08`4@0p,@(P$ @0400 0 0!l1 0 08`0p,@(P$ @ 0!$1  0 08`4P0p,@(P$ @0400 00!0 00 0 08`0p,@(P$  0!x0 0p0 0 08`40p,@(P$ DЍO9z^^^^^^0G#^gGR_\ 0 \ /JKxG-DhM (`_,0 0 0 (i, 0Sp * 00⬱P  00 Qp%p *T ?W (=,0 0 0 (H,hЍ  ~P p 0S 4"4 8T"T#8X%XU (,0 0 0 (", S A੫0  PP !> 12! P0 P $00S"(P,PHpWh P 0Xp  L0;P L0 Qp%p :W 00USx 28 Ⰳ&0 N3T⼄&04` 0L 0vp 0(P\j +(0, 0 (0, ዄ$P2!0$0劙PP4(+80< 0 80< (+"$T͙PP$P0S&2R0S $ S0S  S &1R (0  (0P0u pqtpW x00( 0 7/p P 0 0R: (0 PX =+ 0$ 0 0$ (H+ 0 PR P~^@-0S0SP0!0@SP R \`0  0 0 00wЍ 0宗0ha]iG$EA-0`0P@Xp X/@0S  N0S  ᠳ@ЍV0dS*@PI@P0S S @d0Xp0 0A0CS0 AAQ  ^0 V.QP00C S0 pApGW0pC-S W0ApCW 00 PR0 B |ǁ@-`P@M 8p.-( .h`(( .$( `p02Ѝ^0@-ASS!0CS0Sf X!B +1QO!A 0 0 0 BF!A 0 0 0"=!A 0 0 0 04!A 0$ 0 0+!A (0, 0 (0, "!A 004 00 00 Q Q!B 0 0 0  !B 0 0 0 @!Q Q Q B B B B Xe] e]O-M @0(`PPzpPQ 860S ,60S 0F00V <)P 1  Q3YE  8$(0 8$( Pߍ0P0@`0 h PhP 0S!00S 50S  .8'$0E20S 40S  .''00$022DPk C 0$ 0 0$ u h40P2 0 R 0S 40S 0  #02 ԝ P! 30S  .&0  |#01\30S 0  <#0L ᨝@0S 30S 0  ~"0|00@` S1 Ko0P [ 20S{  00 _x"0]0 ((C]TlTP<20S 0  H"081P< R 50 00Sၡ  10SG  .d&0  5&J!0h140+000 0VP[?hht1X10SS</uᔢ f   }0086lBύdp0‐0 0 P ttD0Bύ1喛~^XؠJe]^^]^^^@^^^^81HGO-PM'U@|50S p50h5h%h0(0000+U(UL p0( |(E⻞0/S0F@PE ( pd((0K0:00p\(`)1P440P,0( HDP PPPH0 p,'PHޞU 440S .p%$$Pp000/S0@PЍ/PPL 0`00:00pPW |1000p3P( :0,PR 0 <0X30 P0#1 P,FP0: S |!  |!  V )V `F|!V.`2xtPp0PY3ptPP 0P` p3UcP200S F  R("`F|1V,`  [ w|1 000n 000f 000^ 000V 000N 000F 000>1!0 1!60!  ! . 000& 000 000 000 000ؠZ^_e]&^x^8e]e]O-(PWM@PE~wP |1 00U0 8$(0 8$(|1 0 00  0'S(Ƞ@P 8$(0 8$(|1 0 00 @00000 0S0% %` * D0̢P D0 Q`%` *@0@V   娠@P 0 0`0: 0P,0 ,>0S 0P. `#,00-0P.4(8,(0 (8,(*0夝B?! !1X10HS$`=0S 0p. #0J. #200-.0SN,0H S00,H|1X1800S 000 R0  04P 0 Qi:Y X<0mdPPj  000;[3 00/Up 8$(0 8$(᨟|1 000  0040004 0$0[ 0$A [A z8(0 8( (0,0[(0, |1 80<0[80<㜢PPP @ 0 R 0 3SH0L0S 0 ᚡ`P0@`EP@0 R0  H0⍡P H 0Q:00S U  88<(0 88 4<($$0 4 $$!T#|1 @0D0@0D[ U%|1X0p t p t3P Khx | x |K|1 000U084(0 084(WT80S U8 UP 0P0S0%0 * L0P L0 QH: 000S 70P0`!rP*0S00S# 0D0S[ ᵚPP 0  3S H0L RPp\0p0pG4pGWz000 0 4"4 (0)Y0C$0pC0IS `p<00SW 00S S4 ` 0 SW`` W  0⛚ tP  ;c0S<0 P` 0 S 0IS50 %0IS00|5PP 0S `Js  0S  0R`%` *  P0S`P P0 Q``V 0W0 P XW$00C (0R0 RQ0H000p \ ?^R$00CSĝ\HX R(\0P8 40JP8 40 0p( CR G0 Rʅ0pG00SpH3```-Pxp`bp8`᧙PPk ^X((  (Y0 Y Y )02s0 (0ddbV88<(0 88x4<(|$0x4 |$[( ^000<(0 0 ?o2R0S (Pp'`/100T0TpW^ 0 00~G940W00/p P2X00PX$0XDHX$0S: Jv0/08 X`p00S(0S `$0P0$0`6aP P P 0  0 40S PH0\0\X DH0 0  00 01`0`pW ~G pp<`J0MX~^ؠme]^^e]4e]8e]Be] xǁ|ǁlYg]HshY)024 80C)0 280`0yP 0S(0 0(008 )0 (  00E0 #R HL R\0P  0800B00V0080$00 ^ V.V4810d0dY~I0(0 00980Y 2h0hpW DpGWV1p0pY~I(0 0#R00 S( ,00S 0(0 S  0S 0 0H0l0lpS`000h`P P P0  0 80S 0S2<24.Jq,0800u0 0 0 000 < 00< P0000߾00CP10 $;$0 0`59a$00$000C0,00,0ppEp[3( 0Wp ( 0 4G04pp(p2U|1 H0L0H0L0S|1 P0T0[P0T0US ؞P 0Y Y|1 X0\0[X0\U῞P =V;V|1 `0d0[`0dU᧞P QQs|1 h0l0[h0l'UwᏞPXV\[Ug00`0S0% % *0 t0⌝P t 00Q:00S 8$(0 8$(* OWߍPp00,W0{ AWC +W_ 0V`0 0 0\P 00 Q:``V ,0P0K 帰0 0  _P0 _0SU ,(3W <W R00  x0P x 0QO:00S  3W Q  Qp R00  |0Px | 0Q1:00So  [00  0Pa 0Q:00SX ,Ro P,0@`:0000000P쐍Sp00,P9 T92#0Sp  3/kx9`V"U d 90S(00  0 y-ݖ(0 L0S(hy750S80:S50S0S0S0S  P#0S0S0S0S  P R 0!0# U 5pPP`d ;0S(00  0 -~(0 0S(ؙ֙00K̙P0T 0S P0T [ 6\ 0O-@P`DM! 7 ,@0 0 0`(P$  Զ 0:p!6 ,@0 04`0p(P$   0!6 06 004,@0 0 8`0p(P$ 婶D6 00'!,6 ,@0 08`40p(P$ 呶0405 00!5 05 ,@0 08`0p(P$ y0405 00!5 ,@0 08`0p(P$ b0 4004!05 ,@ 0 08`0p(P$ K 0400 0 0!4 ,@0 08`0p(P$ 4 0400 0 0!|4 ,@0 08`0p(P$ 0400 0 0!$4 ,@0 08`0p(P$ 3 4@,@ 0 08`0p(P$  0403 00!|3 ,@0 08`0p(P$ ٵ 04083 00!(3 ,@0 08`0p(P$ µ0402 00!2 ,@0 08`0p(P$ 嫵0㔢40 0 00!|2 ,@0 08`0p(P$ 哵040 0 0 0!$2 ,@0 08`0p(P$ |0401 00!1 ,@0 08`0p(P$ e0400 0 0!x1 00 ,@0 08`0p(P$ M0400 0 0!1 00 ,@0 08`0p(P$ 57D NjTj0@P0j傴DЍa^^,GR_c^Go^^ ^^$^2^A^M^]^W^8f^t^ؠ^^^1XGp@-P ` @ljh 0S Q0P@@@040p@DjP?jp@ F 018PG-S@`p0 0 0 0  z0 0 0 {X 'R 3SH0L0S(㕗@PG  0  RV WV R R R R 0S 00) 0+P,0:S) 0R% * 0⍙P 0 Q% *D'Q  8$(0 8$()Ѝ0 #0C?o231 GP (MQMa⣓  #RH L0S0P  0@0 0 0 o0H   C/R00C00000T 10S q?!%0( 0 (  /R 3SH0L0S0@P  \ \(`)p0, 0`1 01  (Y{X~^TYؠze]^O-0p'S(,`(㴖@P  P [ P |[P  0 ЍO@ЍOlЍ@-0  勳XC-0@4M02`PPQ7P(RrhݒV 00SS*4ЍChh 01`1 dP +[0S  ,(4Ѝ)(⪐@P 400   0 TP ᚐhh@T;hP XXQሐ@Uh ጒhXT 40 X`0d 0S S :H0$U0*`B 004 0 004 `Pd03/@81GXO-ppP70S . 0(0000%b1尷S 0 qbǟhp`Lp DdxH\MUPD Њ0P   0P 0 Ċ4 -X0007`  ఍1rP ~H U  0( 0HP᥊0 >0PH60Sh  .0000H&H0 0Zb! 0R 1bZ 5 % 0 3 P 0 L>PBx50S  .|0000x%x0 N0L00 M0[0TP EP  SP! ;4 X0004`  ఍1P a1xS 0 +bH0U  ᔉHP 0 =Pl a1S 0 bCP 3(0,0<,0ukP/ dp p,0) 81# <=40$0 00}~~0PT`P X#X=V P=<3`U FWpKY @5a ~;P $0S(P[ 0SX0S `P H0S 0S PpPԀ pH0S 0S  PP H)0S  0P (h0s0 0000s0 000d0 8Q00 00 jP 10S000d0 00厱[ Z 0Xz W ``z D `P XX H0W40꬟ؠe]^&^]^Y4YXIYe]}^Xe]^e]xǁ|ǁȟ@-p@`Q0P p@' Ѝ@-@`X @`p@-dP@`0SA?C p@@`!R1S A?CSP YY@-@D P0QQ  00S 0R  4Q DA-@p`P@P ` A-PpA``P@  `P U p0SP_AYp@-`DP@Tp0S  iPUP $4RPD@A-@p`P@P _D@-rP0 R R 00SDjp@-@`sP@P _pp@-0PS0S0S 0S, 0S00S% RA 8P@np`00#d00#h00# l 00#RpAYp@-P#A`h @PT>p `P0 1pA@Y 0 S 0#/00P/Qp@-@p@ LP 0 SRp00g01p^e]SRG-Mp4PQ@ $Q !BQ-P+ R  R RR RR P  `VY` 44Y] ~0`9  $ Pw1PЍ@X$ (0S,0S0 $bp H 8H Y0X0 0\00S d Y 0t0 0x0 $]Y;00`00008 900P Z09*  `H $$0 0$0 (0$0(0 ,00,0 000 00Po DP`1P;!Y  $x0S DZ"1YX; p H 8a X H]L d Vd R0008  FIQ0 $00 000 000 00 0P0 X (}PPP30  rPP P -00 d^iikii O-pl8@QP`M #P8Q 6C0CQ 5C577Q 70S&6 32 -$6U 6U 6US#6U W 6U 6U037U d60SW 0 f460S5[ 1U0  5U7 0 U5ꌥ UE5U946`0U 77CQ0CU,03@5E04C@T 0S@  R7 HOP @$5@U/ 046U0UZ %7CQ0CUU 4D04U @4U0CU+0CU 40S40SO|4[t U* d4U1U '0CU0CU:TR1d$4U 4U 0U 4U3U3#0S00T !3R/@ Uq 3U] d0.h@l 0 O@Th@lp@t 0 F@Tp@t.0@0 0X Ra 3y\U 3 @X@N `   |1\:`.|1. 1!Q 1!)x 0F0/h00l p0/0t x00|0O[ 1 OyH[00TU `@TK 00TF 0s SP@@P0A @PA @t 0P T A @P0A @PAUiikiii miHsi iViWiHMi >ojuPiku( iJi(?Ni0Ki i > i ~$niji ߖ>> i i %i Qi Ti Hi e]ixˀO-pMD-P@`UT D" P5TX@@0S0 00SDPsM PT v ` Z` `$4R@@00S0 800S DT@ 4Q@80S/A-3`A0ASHMpDP@$THЍ00S1Z0 000S)dP% 00000S .` n  0{0 00Pd0EPZD@0@ȟؠf]^X@-@9@A-HM`RpvDP\@T L|1S  00 0HЍ00S!}Z~E00S .`  P P00000@PeZD+@ؠf]1^@-@|1@nQCp@-@P P oppp@-`~PPzPvPu9QL m0@0L0`0D00@0 0<0(080,040D00040,000m@pGGGGGG G00000pp@-@P 00000000p@-@ M Ѝp@-@OPPPp@-@0Q$MG 'R`l P'RXh("($( 0t0  0 P *Q- R00S"!10!0!0!0!0 0$Ѝ@#PAQ R000CS1I^u^A-`pP@200SD0CS+3XP 40GSFV`#0F0H PB  P< V? `030#S00 D o`( o\Q\ X ^ QPQ `P H000S D0CS #S S Ѝ%S000 00 00 00 00 00000V0S  0000X`QRI p@-`@M 0 C^.^ P?R1 Z 000 C0PU'X X X XXB w`0 0<000 qKP`ЍpA ER PPC/C-40@SOM  S|1 0 0 0|1 00 0Oߍ R@D  Q *40S $0OߍCS S #3R x40S l$p0|1 0 0; LT, >`P2 p  ί4Bύa`a`001411 0``1P x30S 0x#x|10 0(0 SX#2q12L PP ` ≯2P<2034P09P 20S 0"jXT pPO\20S 0l"pW020S 000<"D000000 00000000> JP1B110 0141P /P h10S 0!Q3"p'qr ;`10$0$PU ~_EUTX `B`; 1 `  !> 0H00S0 qSP,d0)1PU  PP 0@0Ѝ R S 0S0S0S d0GSP 00e]0SE0@-@8P<$MP 0S$ 0R ||P|P0S0S0s!.0  |P $Ѝ0 &PS0S ,0 @@O|/8P|O-p$MPhX$ P $ 0 00帤&h00 00000 0 #0 " "0# !! *! &!   ATX $ R  0 8/$Ѝ R9&R6& R3 R R R R'  P! R R R R  P0  {R 0  0sRd   @0O-M0 00S PЍ0`S0S/P0S& 0@Sp(00S 00t4 7l0` x0(0t 00` 0kdP 0S10 0 P_04 @4帐3 ?PQx EDS0,%S 0S0S0S 0 0`Pc0`0S0S 0sS0SQF 56l0S (0t00L0|0 t7P +]i 00000S a0`( "4`4# :000[ S! PU1P iP P1P0PğO-p((T"\P ,w\M0 0X " %X " app@T W% Pa@TFЍ R0S d  &R&R W d   PD @ R(E a0@1T  R0S d  &R &Rd   P @ R0S d  &R &R W d   PP @T R R @@f]0S/ 0@-S0S   Q Q> (0# ,0# 0#$.$ ("(0  !R   0 1(0# ,0# 0#$.$("(0 0 (0# ,0# 0#$.$("(0 0 10)0# F0# ,0#$.$$("(. 0  " " "0  !R   0 1)0# F0# ,0#$.$$("(. 0  " " "0 0 )0# F0# ,0#$.$$("(. 0  " " "A-0@SPM0S0s  0 0j!0] Ѝ0:p|PPU1\Q:  Å0S0CT* S 5 A%CUPP`V\Q:Å0S:350\Q0``ÅQ:P0PC`RQP&b`Å0V0`RS``5U0X0`RS&`5U0X0`RS``5U0X0SPp50^f]p@-@08M S8Ѝp@uP`.p 4"48 #800 8Ѝp^ 0 /ဟ>@- @(㖠dFC-C&<A-P0H RP' @0D 0 @0D `p\ Q00P0SP 0S @@XS  00YG-@Q M`@pI YF 0S BPX`0d 0 `0d c/@P Ѝ  0zxPP 4@@ W &x 6xPA50 0 0 @A@ H-PH0S |1 X0\0X0\0S1 0S.0s+ 7 0 PA40 R=`0d3l 00p0S/ 0 d>P), d>P#0 ,0R030S `0 @$0eP``` 0s 0@0P1<0(   p PJS0 0 0 ^|1 0 00 0F>9)0 9)R @ 2=02F?! !2S"28(0 8(8(0 8(0'S(@p0 `R 0 0 0 |1 0 00 1 R  RQ Q$Q Q  \| R\ |0 0 0 |1 0$0 0$ oy0'S(oP _ p Y00! !0(  oP <,0 <, 0` 4P 0 0 0 4 P 4 P}40P0:m0 00S1|1 000P4:pWP pR0 0 0 @0D 0 @0D W|1 80<080< $l99LD00H00 \0 $0D]l$0pSB "pph5l%0 h5l%7@<Pp0@0Tp겠PT(/ "R;( ,Ϡ ( 8 ,< 8 <`0d 0`0 h0d l 0h0 l ,0<0  .@P .@Pd@ T0 0 0 x $Ϡ  0 $4 0 4: 1<02 88#8CQ ##*3'$ ,.P C0 0 0 @` 8#(#Q@;( <s.P $0R (0R(0, 0(080 , 0< 800 < a ((@K004 0 004 VpeP "0 00(00ylP :i0 3SH0L RP0H0 0AaT KiP (@(@@42P@TL00P0S pP0 0S @03#"ku(pZPbG- M@0S;  U+ . LP. 00;#0P0|;<3 0&&'0 x000C0吠Z Pᐠ唀"Q  4e !. NP" $HP|;<3x0S00C0xP唀R P|P; .H:@P q:@H0 >|Ѝ0 d0# 0# 0# 0# 0# 0#$ 0#01q5 %0 5 %W5%h0 50%$%0 0$%,P 7 P $P0S p   |ЍOngPP,0'S 0 3SH0L0S(IdPP 00# 0# 0# 0# 0# 0#$ 0# 1q0000W O,Pi,c P $P0Sp0( .fPL,c P2PLpH0082`p dR lR5 8,c 4, =  0010p8#8Wp WpdW  lW0 H ppVh5l%0 h5l%, 0 @00a5%0 % 5{ 0@$0 x00 a000310吀00 0P0 pS  R 00D%0 00D%+Uc 0p0hYП^^pZ_Pb^O-B0`0/0 0 0 :(ppGW 0 0 0 +!c"0W0PP 0RPP 0heP 0 PRPP0 0 0  ЍU 0  R 0 0 0 0S00 g>P 0 0 0  [A 0$ 0 0$  0R*`./W0 0 0 (0, 0 (0, 00`S 0S 00 d@Tz 4_0<< Ì0SJ@  "pZ~^Pbi]03" /A-p`P^@P7U^0_ P峿@A-0@(S`p}^PPTb70_(D_( 0(0C00(00@ 叿@@A-0@0t0Pt00`0x0x0|0|00S v*PO 000S g*PA  b80S ppqX*P82  8S<0S ppqI*P<#  <Dp0S ppq:*Pp  p5@0Sppq)*P@  @$P <*P 8*8P 4*<P 0*pP ,*@P7&*-l 0/G- @XPp b`P @<,0 <,a|10 0 a2`3 0  GhY7@-0@ Q)R*SP S uP0sS  Ѝ0 :R0S00:Su@- @C00t0x0|0qp@-``.Q00S@P P )00/U00S00=U00S0t00U00S ^P )001U00S 8P ~)080#U00S <P s)0<03U00S @P h)0H@0]2U`VppP \)0p0pA-`P0 ,0@p4(ЍR GR*S # GR$1R # GR V R  R R  R  R R.c\00S 0S0S0S 0S0S s`q6PP(PQ  ˽SV0  R0V0t0V0  R0 000 0 00PxV0 Vr0So R/lSi0S 0S0S0S] 0SZ 1$PU0(P 7I0 000 0 00P>V1q V8 00V41_(P 80 000 0 00PVR V 00VჁ#W<`p`<(P kV39V0 SRx03V\0 R000&V0 R|0i]j]@-@0PS`pM(P7 a,0 00000(000Ѝp@-P`'@P J [P (@p@-@PF@'G-hMP pሠs@P0S( 0$0 @@@0 0P @ P 6P@9hЍRsZ ᡼0S @( @@0 ,0" r!.$  ,00( $@4\P@@ \`P H0 5@\@\Z 0(<$0G- pMS@P  )S *@B pGWP P @9p}d@4pcP P*0+`0G<S000 000 0 00d@PLs@P9WgWl;pGWp0  R0@pЍ d0R88d0\ A/0 d0R88 d0R77 d0R77 d0R66 d0R66 d0R33V  d0R116S0S0S|0Sy0Sv d0R99 d0R55 +0 @@0 0@P d0R55 Pr@P A0:Pr@P A0 &P9 r@P &m A 0h@`@`T q&@P 8@`0`0000( 0CS0 PtrP`PP  3P 0'3Sб100S@7 0R;0S8@T5M&@1POrPP0  R00sh700 0rP0S0ĕ07#2120 000P $0 (P &@$0( 0 ,0s pDb Pn3  `V 3S100 $"PpW0 $ P 0S 0 000V $P p4 qPr408 0<0spafD\ 53P` P  K"PRpWO V 0S P p 5XpTP04P h!P`5X00 *-0Eq@PN0S S Sd04M d044Hd044Dsq@P7WW > 40SKW$p#0GS##pc`V S19@ 38`8p40 00@=0 0 pG=g' !4gt# q @(0`0(000 @0R] TQ 0# 3SH L0SP0\ 0p<[ VP V0 Z`0d 0 `0d u< 0CS00S  00 ·qZ 0000 000(4"<0 @  <  R  T     0Q T < 0Q T{ +  @ @z3(`Th0`0T `0d 0 `0d P ` @0S 0S0S0 000 `0 0 -P@Yp+0S `0 0 0 X0\ 0 X0\ <0S 00(  < X; @0t SH0<0R800 0 S 0 b8 4b:#000s 0@0x8000S 00< D0PP`0D0H0B00Sx1S800X 0Sx1S +0P D`@V<gVPP \`0d 0 `0d gm0P?o20T00S |1 P0T0P0TD0S`dp H =PxؖPm H0Ritp H $P_ܐpPU H0RQ3{Uyh d00l 0p 0q  >ⰐJύd0v,P^ Ԑ[  Jύt0f,oᩒYL 50S .d D53X%X1`00>\u`0d 0 `0d V |1 X0\0X0\Y1P@ DL P@ Dg `_)P T`0d 0 `0d P?2QD0 S 4 R000<0R00o @ 0<01 S@<0SD 3Jύ$ 1T0 P08UP T`PH00U@P  Up3\3:$R*PX&D0S 1U U0X x0S 0SX x0S\ 0S L0(0@ 1P>LPpm0 @GGP@0S~R p<,0 <,U@ T0<<0 |1 0003S$R0 0 0 T |1 X0\0X0\3P P x1S 0S  @I0S 30SR00SN @1 0R00S  @ P @WD<T<0PT-[ -0%UߍT@PUPe\c X ( ,0 <#  W lP0 0 0 (P@^ܟؠ6k]^lZ hY$" 0@/D0Q0*$ PP]P0<1 0.PYW=0S RG 40P0P @ $(  $H@ 1,PP0 3  10S (10S n@ ,000,0D0 00 p^lS Q 0 0 0 P U*Q0 0 0 Ts |1 h0l0h0lj00S p0(0 0} 0,pGT2UpppW@00(00S1 0  , @P,00 #  " R 20S @P,000,0 8#8 0 0C400ZT, |1 `0d0`0d#0S ,0R  0    0RP@#s7`0d 0 `0d 0@0 pV@PWTlp0t 0 p0t w0 0048900(0@0(0l4 000$0( 0S0 XP 0X    @P 80CS0 r*0P0X0%U?0T000 P&10@T ~ODTXhHr @-4 R0R 0 086 Ѝ䴟H0S%p@-PX0\ @06S &P `I6S000c0#06;-J00C0p/@-0@0,M`S6S 6Q0C?o20S ;,Ѝ@ J@0 P pt0\ 00 00P p$pR\III|1\6p@-0PM@\`P ^(0(S00 P 000 |0 00@X0<8@400 `4 L@ \PЍp0  @`Zf]C-1嬁嬑1!$M088"#2a12t1P00@TAOD43"`&ab`"$Ѝ10p WAG!0s! r0@0P P "_ P !˽="@TP  !@T!0s vr0@0P000[0 0ꔠXTHsYG-|1P`p M0K SK200S D0CS#@fT3  p  0  0 0 3 -@LT p Ѝ  R   ` Ra R H0 0 0@ 00 03 S Đ#212 00 020@T D@DT 3"(00S ! P 000  H00@r^0@-M< BH%"00000 0|0c00j@P  ``XP0P $0@ Ѝ0@꜠2rs]H^rTk]^XhHTHp@-PN@0@0d0060?00:<0?00 0400S 40S3 !0 0p0uh0p@-P P@zU0 @@@D@H @Pp@0Sl G-@`qQ@ R HQD0PP ZDY1`QRC 0 0 0 \P G01 0S@0@H0C Q+Q! D R   0L S H0`S@A 0 0 0 &D0S L PD R ( 0H0S /Ak]X]k]^N^^Q|Q/P/3p@-@P p@G0@-@PP0$M @=G|1 03/PG$Ѝ0p@-0 M @`KHPG|1 0@4/@lGU :HT06 Ѝpp@-0@SP M 00S:P  P0@o Ѝpd`D!P 0U{ P &GG0P 4   H RGG0P/@- Hk@:@-|1@PH2`PM 0CPi 0Po 7C0CPVP 0P00PЍ1PC '7C 0CPB 0P0  $PP  4`PP 6(06 06$0Xp\00p pp,pF<1P 0P,0S0pW 0W p0'u?0040 0S0$t8 ߕ0-00,0000 0 0$0000000 000S0`V 0V `Z0&e?00400S0si WiHliHC-@P0,M 00px0嬀P`0PPTPx0P$P[FVEx00Cx0,Ѝ PP 0 `O-pP 40` 000S.t @P( 0`00>T 0pP0X 50 00 S 20S @ .I500T"0 {P 20S .w!,0u 0$(0,0 QjX 40" G  ZQ- 00C?ot20"0( p0, /l1@ P0ppSp00 p'0S03 2@ O) Q 00  0S 000 0  00``S`0 `&0S032 @0@ ~^Xؠk]^^^^^^!^_^@^p^^e]@s  8sG-0P8M ` . 0 08Ѝ` R008ЍGN 03 X[xq@h `P T X8ЍG}T .`  00 0wPS0`` 00``0@0@0S `p.` `y0 pY 0h |1 00T 0H @aw<R0 $ ^ȟ8s ^ؠk]T^XMbI@sp@-@D <PPp@ 52p@@sO-@Mp`,<PP- 0S # Rp @` .pp0.   0"\X XD P20S ",%SB0 00$ 0( 0  0R p0DP p0 QP FMA! 8$(0 8$(,,Ѝ0S00S |10S .@\!l@0\aX!XT10    0R  0DDP 0 QP F Tz R 50 00Sa  l00S .@ppXl005 `FLX, @0U`0 00)^ؠk]^_^~^Xt^^q^^-/1 -$01019/e]/-/-/-$M840, (  0U4$ЍDs@-@xAvA-@-p0`0d 0@0S P(00   0=(0 dY0S(`@XNALA?(0, 0 (0, J Ѝ1M  FXDs@-Ľ@-ӽu@-80@0SP Ķ00@P/ꈠ@-X-/p@-@4Ph(垾᮲ؾpHs@-@X@-0SP0`000S1P Ѝ~S 0@S0VPP0S 0S0s 0pS 0S 0S 0S@:0P 0 1P -/ 0!< 04 0 (   !/Hhl0O-TM$0`1`0(0(0SP ~SN 0PS/@?0S@;00100@P0#212$0,p<∀0 p 80@P $0P0 Q S R` W $#2!12TЍ @P @1@  0O-@p`\DM!h! 0  0,p(`$  @PQ] 0!! 0  40,p(`$  @P<] 04 00! 0  80,p(`$ $] 0!| 0 t  84@0,p(`$ ]  H8㤽$0DЍa^^Hs0G#^)IR_DsO-PcP4Mᵼ0 0 0 忼 30,QpP0@ 0M ?4Ѝ0SD0S S?0S0S0S0S  )P-0S0S0S0S  P0s. g0 0 0 r (0QX0 0 0 c@TW P 0 0CCP ⢷PWpxBP 0 (0 0 0 30   0$ 0 0$ &;Y ?@ P0T 0S P0T g`@P Tp |1" 0"0 UDshY0SGC-0`SM3PP00@PS/P@ 00S% T, 0p 0S0U0S   0RP Q AoZ `0 0 0H iЍ@0(p0p/i]Hs H f]O-M0(000406#@21,2`000S % 0 P  PP0016 pPPp00:S0P 00S >@P7@0P0 0 i0H   C'Rk(0C00(00T 0p(0(0(00$080(00 0<0040000 80JPS4Q [H$0000`00040&<404000:S80 Rx BRu:(p03 80,>@P ( 0K 80>@P#RH L0S0P  (=@ $P =/0s08 80 `  ( J00:S80S |U-U#BP坺101姺0S PR=4<d2, 2 "12ЍdŸE|Q E Q<E|1Q- R|1000000000000000000000101}0  u000m000e000]000U000M4@0040004NXk]k]Dsp@-`1@P M R8@ 0 0 3P@R9@ 0S/@0S@ < Ѝp7@-Q@T0 QP   JP Ѝ0P  QP0S)T   Ѝ0@s@iTdTT Ѝ0@k@DT\ Ѝ0@U\ Ѝ0@{ A-PpW 00 00000@P& dVʀ0! 0     !0 0LV@PhQ(@P Ѝ0Pp0 ͱ HhlHss@-@P` 0R0%0 * 0d>P  0Q0%0 *S @0 0 0 x R ! Ѝp@`ܸ0 0 0  0<~^hY@ Ʉps@-@@" " 1@-0@S00S SS000C0S@  0HP0SDl]f]0S0S0S R @-01/psp@-@PTQ @P 0S  00SU`SP spS 000CSpg8D#L0@0p@-0@S8M  .00 00S 00S0T#TX%XU `P 9S 8Ѝp 000CS+0P0Il]^@-@3P P @0S00S 8#S000CS/@-|1`SPD PP 10SЍU8 0 Sp* ( 0R*T 04T 1!00̸ P١100!L< 0,01 0 ;?<3Q#3?P [@P # [P0  R= 080#80C?o2S>^0 7/,0@ 3 #R(0\\Lp劂0 0,00 <0]Xx^IA-@( 0  R    RA| ` p  UP ,]@[  [LiI0 8/,0@ (0LP>0 5/(0LP60 A/m]^7@-@(0HP' 05/0<0(0LP0 5/040 Ѝ07@-( $ 0# 0@ Q 0HP 05/(0HP0 5/04 0R40 8 S0S 040 Ѝ0s@-,0@!;90(0LPс 05/}_(0H`ȁ0 6/0S(PU 0S , P(0L`峁0 ;6/Ѝpp@-,0@00(0L`v 06/6S  0"Spq]@-bP q]A-Ppv@`S&  ⾮pp<0 00(`0h0<0$00,0$003/(00Hiv0 8/3 03Aq]*^=^s@-,0@!;90(0LPNv 05/}8dP(0H`Cv0 6/0S*PU 0S , P(0L`.v0 ;6/ЍpA- 0pP(@@pD0(0 `Hv 08/(0Hv 08/(0Hp v 07/0@00@0(0Hpu0 7/0  D00D00@0Ѝ D #D   D0 0 00D06 D0D0D07@-@P B 0R  0"S.. 0"S (0HPu 05/(0LPu0 ;5/ Ѝ0$03 ' 0"Spq]@-ZP q]A- 0pP(@@pD0(0 `H}u 08/(0Huu 08/0@00@0(0Hphu0 7/0  D00D00@0Ѝ D #D  0+ 0 D0 (0H`Ku 06/(0H`Cu 06/ D0 R60 R R6 0R R6060D06A-PpDu@`帬  Ppp<0 00(`0h00$00,0$003/(00Ht0 8/3 03A~q]*^=^p@-@ (0LPt0p@ /7@-@P B 0R  0"S99 0"S (0HPt 05/(0LPt0 ;5/ Ѝ0$03 2 0"Spq]@-eP $r]A-Ppt@`V)  p<0p 000 0C2?000(`00h0H0$00,0$003/(00Hat0 8/3 03A$r]*^=^A- 0pP(@@pD0(0 `HEt 08/(0H=t 08/0@00@0(0Hp0t0 7/0  D00D00@0Ѝ D #D  $ 0 D00 (0H`t 06/ D00Q0066D0 D00D007@-@P B 0R  0"SPP 0"S (0HPs 05/(0LPs0 ;5/ Ѝ0$03 I 0"Sp r]@-|P |r]A- 0pP(@@pD0(0 `Hs 08/0@00@0(0Hps0 7/0  D00D00@0Ѝ D #D  0 0 D00 (0H`ts 06/ D0  0  0D066D00D0A-Pp}s@`  ≫pp<0 00(`0h0$0$00,0$003/(00H4s0 8/3 03A|r]*^=^7@-@P B 0R  0"S 0"S (0HPs 05/(0LPr0 ;5/ Ѝ0$03 x 0"Sp8xr]A-Pps@`|p<0 00(`00$00,0< R AtǪp0,0B$003/(00Hr0 8/3 03oA=*^t^r]^p@-@(0LPr1@S0$0|0x$0`J$003/(00Ho0 8/3 03wAETs]*^=^s]s]^7@-@P B 0R  0"S   0"S (0HPo 05/(0LPo0 ;5/ Ѝ0$03  0"SapPs]7@-@ 0S ,0 (0HPao0 5/0  Ѝ00F(0LPRo0 ;5/;금@-P s]A-Ppao@`զ  mpp<0 00(`0h0`0$00,0$003/(00Ho0 8/3 03As]*^=^A- 0pP(@@pD0(0 `Hn 08/(0Hn 08/0@00@0(0Hpn0 7/0  D00D00@0Ѝ D #D  ( 0 D00 (0H`n 06/D0 Q6  60D0 D00D0 6 0 6007@-@P B 0R  0"S 0"S (0HPn 05/(0LPn0 ;5/ Ѝ0$03  0"SZps]@-/Pt]A- 0`@(P@`D0(0 pHRn 08/(0HJn 08/0@00@0(0H`=n0 6/0  D00D00@0Ѝ D03D00D0A-PpIn@`彥  Upp<0 00(`0l00$00<,0$003/(00Hm0 8/3 03At]*^=^7@-@P B 0R  0"SJJ 0"S (0HPm 05/(0LPm0 ;5/ Ѝ0$03 C 0"Sp t]/G-PMPm@뺐 Ir?p`0D wP D 0SA 0  ˥,<0` 000 0C2?000(000$000,0$003/(00Hpim0 7/3 0 3 P(02H`Zm0 6/PЍ 0 劥w^*^8t]^7@-@P B 0R  0"S 0"S (0HP)m 05/(0LP!m0 ;5/ Ѝ0$03  0"SpZ4t]p@-P0@ P@tT0 0psp@-@X0S L墍P0@` P$P(P,00PbP00@@p@dIsp@-$0S 4ˣ@,PM R00 p@^ssA-@ 0S p`7P@UTn P T 0R: $ $0R@pP@@p0<0 0S 0 0 ` 0$00$0Bss@-@D0 000(S   0$00C$0@)sp@-PPL@T  0R 00 0 Tp03/s 0!< 04 0 (   !/Hhl\ P/0 !8 00 (  , !/Hhlp@-4@P0 P0  D psIp@- 0P@48<0 00 ` 000@ 0@0 0 ,0 0@0,00000003/ 0pP 00 p@ #^A-@pP R00 0`0C 0 0p0 0 00 00S PP90p 0@@@p 9AZ 0 *$s@- 0 8 00 00 D  0 Ѝ^sA-p0S `P 呜@P D [X U PP 宜@ 0@P4 0`s@- 0@ @0@ 嗜s@-04 00 ( $  ͓0 0Ѝ^sA-hp0S@ @`KPP @ s@P 0@0 @Ps@- 0S @@˖^sp@-P`@U@p 0R9nP PE @-N Ѝ/ 0p P/0S ///$0\1(0`10@1/@-T 0S 0S 0S 00 @0 4/Ѝt(00S @- 3//tpp@-LP@0 S   R 2/$0Sp p@/tA-P`P 0003/Dpo@p 0 R @Tj$0Aht]A-@4P. 0S+ 0QP0000`0 `06/#P`p0*0 ܙ0P00U000Ip@-Pyj0@ Kj _  p^p@-P@`U000000wp@p@-P@ ``啡UPEPA0@00}00 0S up@rR^D_/^:^ _|p@- @l!`P}W0LS  1S P 0 p@ 0/ppp*A- @!pP`pYW0AS1S  0p 0A/*C-pp@` @`!(4WPP 0S8 ЍS C0QU? @T8 0ll10А p1@0PP@ Y0810<1K<@10D1=`1\1o0 00003/PY 0 R 0YO000000 00 0*II+p@- @!P`V\ p@8\  1S P 0 p@0/ppp*p@- @!P`V\ p@8\  1S P 0 p@40/ppp*A-P`0`%@ Lp|V0S 01S 0S  A*L@- @<!aV0S, S ֟0P*I^i^A-`Pph0ȠP @R帟0P巠P0s$尠040000U0 40S R p R@0X 4/#P P A[000 A^^^^tIA-`Pph0uPЍ@qU00004P Q[ !R YP000U00000SL0 H0 0S800 `8/#P  ЍAc^7^\^ItA-`PpSh0'P@Q P P0st040000U R000 0 000 At^^^^n 0!< 04 0 (   !/Hhl\ P/0 !8 00 (  , !/HhlA-@0 A`!((U00QU0X<000hp 0`0h   8/`P 00h  P 5/0P00P 0<00QB*XQA-Iq@PT`B 1Q@ 0S= 0 8 n40S0400O 0 0Pp !0 R   8/0 800@ 0 03/ 倞Ѝt^A-P.g`@P p0S`Vdv P @-@0   00@A-pQ0@`P VP0QjP `O-Q4M`0I@PT`C P= 0   +@ 'k0@000,  ( @$0 4/`P# 00$0 0,0(0 @ 0 pS0 @ P 0  03/`4Ѝ0@00 ;/p 0 T 0 P?o21 0 @40pS  0 8/04@_ `O-RM@Pp8; S 0 0//uQ/p@-0@P 05/0 00 p@/@-P@ $`$ 0 00' 0 0,00$(00400p 0$7/P 00 004`$00 0(0`0, 6/P400 Ѝ0$0 0(000,00 0S 4 3/BQ;Q%Q 0Q0 .0 /`0<AQ0 .0!0 .00 .00 .0/t]5Q0 .0!//0 A Rh0 S / l0#"l 0 S 0;Qh0 $Q  /1A-3A@Qd0SЍ`0 p 7/P0 U:D0C` 6/0` 0d0P`d`VpPPPEu0V:0` 0d00 00CR00p 08/PED0 P0 5/`@ 0  E08/`0SP 0Spp`Ppt]@-0@000\P e0\0`P _0`0P Y00P S00P M00P G00P A000T@94u\Q@- /6Q@-/%Q& 4A0&S0&Q  @-0 .0!/  /t]9Q/Q$Q !0AS h00 S 0;Qh0 @-&Q>0AS/h0 S l00A!lTX 0 AQ  R 5` R  R  d    BQ / d /O-`<0@@PpM  d03 8/V䒟䢟0 0 0S<0@  d03 ЍO/`JK[۰ 0 S(0080S0C 0<00<00\ d0P22,c R0 A S:0Q0a BQ00000V ǒ0 S0 0h0S  RG <0! !R[00<00<0  2 R. . !R p q d 1`Q A02 ";/0 Vd0#0@000;/0 d2!cR 0 . !<00~1 03/JЍu]$u]^0S 0S Ҡ /tQl0S0000 /`0@-<040@@0D00TH0$0L0 0P0 0X0\P  0 00  00 0 2M0 R\ 0Q Q Q/@-@0 00<@ @/@-0@ S;? 00 S;?0@cQp@-@6Q 0A R p27A,Q"S00p|Qg nQ` oQ00}Q[ ~Q00P( hPlLYp<0<<00000@00D00H00L00P0001010 1010001<0  00000@00D00H00L00P01010 1010001<00<0<0000%\ 000000}00T S tS0C0`0S  0S 0d00 00CRb0`0d0]( hlPL p'00(Ap,Ap pp:u]u]@-PP@ p`E(0 0 000@($080 x\ Ps`dP n j f b ^ Ѝ4u@-0 @04 80\0`0d000000 Ѝ4up@-Q@<0 Q Q!R0 ,R0Q *Q !R0 ,R0!R0 ,R0<0p!R 0 ,R 0!R@P ,R@PS00 `@06/Q/!R<00 ,R/<00<0/A-XP@U`1P3p1:PEU`p0T 08/`0S T ^0T D08/`P T0 PsK`0S  0S 0d00 00CR00d0A-X`@VP1p1:`FVPp0T 08/`0S T ^^0 `TD06/`0S T 5K`0S  0S 0d00 00CR00d0Q@-@( Q`Q Q>d 0D32aP2"5/ PPEPEU+0 pD07/`P!  00J R 0PD05/`P  J0Dd 0P2 5/`0S  0S 0d00 00CR0 Ѝ0 PD05/`P  0d0Q@- Q Q Dd 032a@2"4/ЍD0d @02 D 0 @0C-0 @480tS$M ?SD*@0C4S00(*SS *S *SU  SW $Ѝ)S 8$ЍC>)S ! BS;  SPh`h0S! lP)S7 l$ЍCbPh`h0S, YPPh`h0S, PPh`h0S! |Pl$ЍCl$ЍCd7 l$ЍCkl0S 8 0hQ \PQ Rd80\(P   8 0 0l0d S031` SP1 P!01cQ2 `"6/Dd 0`2"6/^0T lR Q3 CQ0C` 0C0R 0S 0d00 00CRD0B0d0?X T0l0 0CS 050C2Q30CQ  `0 S d031bl0CQ3S   l 0R 3R0C0C0<00<0l0 S0C BR 0 l0<S03 TX AS` R  R p0d S031"S0!0C0< S0!C TPR:X`R*l0S03@S10B!0FL\X0T TPX`0d 0l1cP3 PP1 P!1`Q2 `"6/d D02!e`!1ClQ3$ЍCplQ3$ЍCld 0Q3D32`S0!2P"5/0S l0S ! 3\0P0C0 SS0t Qp\0Cl0S fll0 S0C BR 0\l0S SW \$ЍCH\ 0M hHPLPpHcHL\@0 0` ` 09/P3 `` 0` `  0` 00 ``009/P0@0 00S S 0PCP P^40@0D0HPLPpPPPPPPPPPC$P(pC pl0S0L!0 0 U  8l0S S S< 0T 0C 0 S S     l0 p S03S0!R 0CQccP< T0X00(v]J?u&p$c>^l?p$?^ST_^^^^ ^v]v]^$^;^^-^4^p@-PUpU- @\G0  RS\ 0  C00p  /R 0 B P S@S00S\ 0PC0僎 D^A-@P` 0!0`3/V0p4`e%n 0!0p3/ Wv]p@-@P 0!0P3/UPd` 0 0P3/ UP8` 0 0P3/ Up@x]y]; S h20/ <8#8SA3=8#8SA@A$210/>08#8S1AAP00/</ >8#8 S1A0A`01Q#0CQ 0CQ 0Q|1 /p1A+AQT1P1L1H1D1@1<1 01Q 0CQ1AA Q>08#8 S0AA Q0000/000000000000000Hv$z]/m^z]i^q^u^y^}^^^ z]z]^^^^^^^^^^^^^^^^^^p 0S S"0A(0,D R  Á(,//0A-@M(00 00p@P A<00,p$  `< 0PL  D    p A ,(p$00 0< @Ѝ^ ^<0S/@-@0%@SSA-@ S  pp lP`pP   03/@NT@@A[Tz]^K 0!< 04 0 (   !/Hhl\ P/0 !8 00 (  , !/Hhlp@-@p`PAp@@0S/p@-P @ 00 R PD  lr@ 0P4p :J@0S/@-@@Wr0@04@O-D0X S(@3=:Pp `0V. 0 V0lf`Cx @ WV`@0  @0@0000@Y 0S@ T`` 0@+`@[ L#@080 0( @P >^A-@PpOA@` 0 R@)A-PU 80p`h0@6pz] @-@80S 080~ <0S4@A-P0 @R <"p0CS3 :  `pWЍ0@ 0p00000P Q D0S/0D00/ 0p P/0S //p@- 0P @@ @ @  0@Spt Rpl p 2/ 0t@p@-@TT00@-T000p@- MP@l T`P 0 R V ,Ty ЍpRV RW SW lp@- \`PA0S@0 00P00CS0p p*@p@- 0@PAPP  p@p*8@- (@APP @*0 000/G-P`4TP0@x000000S0Sp 0pW50S1h0$ah00h뜐 M/ \/h0  @0l0 0p000000t0h0#P Ŋh0|0000(00,000000S 0$@X:TP SKW<S P h國0\ NPL 4P8G茋^LvVJ^(^P^:6^^@J8^^A-`MpP0SH4@V =84V ,4V $4V 4V l00 03V 3VU 3V|@0000 0 000g3V P< S0< S< 0ShPQ`3V] 0T3V $H3V X 0 pW`P  A Wh X2Vp 0V`P2VA 2Vr 2V |@000000000 0 0 000`1v l00| 0pЍA/i 0     0 0 000l000Af0 0000 0g`PlA ЍA @000000000@00000HA0 0000 0@`P@ 0S0 ЍAЏ0+h0 00P0`P3 PЍA ``W W @W@W @W W@W @W@WWW W W W WW(8@-@p`sR0P000T! 0CT( 0T 00 0@0TP0S# 001@0P R 00S0<0@00CS0  ЍP R 0 0q`@ @T@@~fvtA-@aP( c?0 pA*40( R/$ R R/  /Lv-4( \0^/LvT0Sp@- @RP 0]-l0p0p@//@- @ P@A- `-?PP@ @T@`V X0S PpW@0`P`p@P Pp*D@- 4?P@T  P * 0!< 04 0 (   !/Hhl RP RP }//C-QP `M 0q<0 0V@p# 䀖XW Ѝ0 8/P 0S 00p Wp04&08#8 S$=;G"0C S0D4W00G?o  2%`4W00G?o  2<4W00G?o  2 0T00 0W  00 a @DoQ] QZ > QW QTa @z 0T0 0 0&T 00#T 00# 0T00 0T 0 0 0T@0@0 0T00 0T<<T 0<#V T 0;# 0TP  Yt0Y S l0 0p3/tT  . @@a0D8#8S @DH$H>; S-< S* < S 0T0+ 00D8#8S00T0S >; S; 0 8T'.T T( 0 0@H$H* 01A c0C S@0{C 0@; 0/0D S0@@0D8#8:S@@DH$H@@AZz]01 z]$'*z]s@-@(0S1 $0S 0S+ P`40 CS4 ,0 0, !; S Ѝp0 0 3/Q Q 0 0 04,0 LvA-PqOx0UTPS@UTp W `W` 0 `U`RT0 0*l00p3/`PTPTpU@ !O ፆO ^^\ P/0 !8 00 (  , !/Hhlp@-@0Sp@z0PS 0p Sd :!m*T0S` 0Sh0T0`!XMb@-MPNX0@S `c*8*x0S 0$ tP`V% 00S" 0p0CS00 00P < p00` P NH儆<\S@N0 LЍLvX1^8^z]Q @-嵆/X^p@-`P0@ O  `P0(0pLvKJJJTJp@-P@PPP(PpLv@-Mp`PrN0@S 00)?0S$  hPP: TP0S4 S P0 0!! !1Ѝ@)h0.Uh0T(PP @ R 00`SPU0P00 P M كЍXMbd^p@-@  Q != ^Q‘ @@HPTlLoV  \Qڰ ԃA9^p@-0@SP S`Y `6 < Rp؜0000 0O-,M @ p P@DQa|t(,Ѝ0PU T PU0 Tx{0@  0^LAoY YPQ ` 00V@D"* ; S >08#8= \S 00 \ `:Q ڰ 0Co[ 0 S  02"^^p@-Pl@PTpP0S003/\@@-P@Tp@-P`l@TpP P0R003/P`\@@-@PG-(`pLPl@TUЍ0Z 0 :/PP\@p@-<0 0QP`?o2CP@,p贩@-  001P(@-  001Pk40 60 0 1Pn//@-P`x@fp0lpp000 P$Ⲁ0@@0 P0tp0 Ѝ^p@-PP@0S ``0Pp0p贩^s@-PP3 0XP\0p0@`0\0p0T0S 00S 3/ t0S 0 h `0t 6/PQ 003/P 0\ X0`0R`0p0`0\ ЍpWp@-XP@T0S 00S 3/\ `0R`0p0`0\ 0X0pP0S 003/O-`$M@HK3PV +>C 0CV 0CVP t300 h3VPz $ЍOH3V, P0ST0S c lpWX\ 3V0t02V" 6C0CVQ 0VlPUR 0 0RoJ0Pj;2V`lPpU``PP \r\\RdXVʀ 0! $ 0   , !0 00 0} 0!d!0   , !$Ѝ0S S S $ЍO{PL X0SP0S0 Q X0S$ЍO$ЍO\P Vp 0`00)J\PP R 00S0<0P 0 0q`w PP0S 00100  0;/\pP=vt`W~fWdWcWHhl$ 0괩p@-`P f`z@P   pPU X0S P0S 0PpppG-`QT@T` PI PlpWXPVI@ I <00S 3/PP\p^^@-@ITT0 TQ S S @Q @-嵁/^p@-@PX:9Pp^IP 6P X0SP0Sp@ p'^ 0`( "4`#/R/`0  B-"10 S0   ,(0 0//C-Pp@(`V Ѝ 0䐕9/@C-P@pW Ѝ 0䐕9/`p0S@`A-pl `R$:Pp@Q:AQ  A8/ 0| 00CS%p 0 B BR%&<0 19 Q*Ѝ0 A-`l PR :pp@Q: BR B8/ 0l 0AA%\a&P0Q0 R*Ѝ0P Q   @-:#:^:,\:( 0 /||]A-Pp`@@0@Dp@0@L$<#@`W K0pG`@A-PlL0pLALA$ `@`W xK0pG`@O-T@ L P0   lA 0A`Pp2"0PS0VpW* Ѝ pA0 A   Q  0 Pe `Fh !$ X F!Y P0`!pW:X  QY Q  WL 0P||]S/G-` p P#"Y@PX J0S  ,L00H@PR/G-PQ0Fh pY@p`V8h L0S h L@pG-Pl @R`T  Vp P匀`#801U  0S  K0`0PE V hp `G-@ p,Ƞ 0P  XPW 0S  K00pGPp@-@P0PQ@ R   RQ@ R   Q C@Q@@R 00pA-`T0@Pp 13/UT0LpP` 0T01A/0T0A-@p`0S  cPN p A c Q0000000PԩQO-P`p@@DT 0 <p0 SX Ѝ0 'p0XC-RP`p(@@DT00  000 0 X ЍQO-P`p@@DT 0  p0 SX Ѝ0 p0XC-RP`p(@@DT00  000 0 X Ѝ 0!< 04 0 (   !/HhlO-`P)@4pS0ʀ0! )0))   !@WpVP`P 400 $b0@04 00$00 , 0 4 00CS||} ЍTb40, PR@0 00 P  [  H ^0  L X0SPTUP0000V` W p0``00V `Wp `dp0@ JvG v lGp1ʡhPL|00 10000000 P 0 Tp ` 0h`Waf`` {G`Fd 00C0c& 0R0 0C c&0`.0` 0RS0C2x05A05t0|50x50t50p50l511 WX%00L%W 1* W (T R><@GSA S S  @<Π` P BP RY 0 S< b0B)2 $ ,. .8S<Ƞ4,<(8N"( #8PE Q ἐḐ Ḑ  ^  [꼐 ἐḐ Ḑ唂01 `@380!A!Q Q ^: 0 0S  z `Hx@i{l( 4g`0p>FlpGW< wTP    Bτ000000000000PTP  Bτ00|00x00`00\00d0Hhl|].^uJsJLsJPuJtJvJqJ  P""$,  Ϡ0 0<  P 0"  048"$0,0 00S $ A0`0PA]T]Џ]00 00000100/ᤔJ8JĈJHJO-MQ@8@Q\2 C\.*P`!!)( !p), !V㜠P` S(P p "(& 0$p(|'"([$* 0t 0c xpPR`)W:ЍpS0S  A0 `0P[:004!48#804pQ 0S  gA0 `0Pό\00PE0 S 0S 0 `FLApGO-Q@,M@Q\ C\*P`!!PP V`P"! p S P ", (* 0$ ($2 *    0  0 YR:0E 0=S0S  @0`0PY<:0  R0$ R0! 0ba 0X0A0cQ[0$00k0僲 Y0K0c[3\;$;`ZB$aR!]100 0\0S  @0`0PP0 0t 0c xPR`)X,Ѝ0PE0 R 0S 0 `F@H|]T00  ,0X00500\00/\JJO-@PM@P\e C\a*PP!"UP8 S0"( !i8 剈`", !)$`p l& (ተ0pW0: 0 `S0S  6@0P00 $4"4 8#8$04  ` R0S  @0P0pW*80 0t xp0c `RPWЍP00`F0 S 0S 0 PE?pGO-@Q,M@Q^C^*P`!!P PV"!)`P P p S", 净!( 0$ (2    0  0 YS:0E 0>R0S  ?0`0PY=:0  R0% R0" 0ba 0X0A0cQ[0$00k0僲 Y0K0c[3\;$;`ZB$aR!]18#80 0\0S  S?0`0PP0 0t x0c PpR`X,Ѝ0PE0 R 0S 0 `F.?H|]X0S  0R   Y  Z0X0[ 50 0\00/JJ,00S/  R 0|vA-`PV0@P0# (( >0`0p $>0$p;ةP`; 8 0`000  @@|v"/p@-P$0@Tp5/@|v\0P/ L  \/-  , "  |vةA-p`^@P P@@@ @S PU$R : ^V WQ .=P@^T0 N^@D@D\'LD@D BR@D@D\ @ N!N'O-Pp``08@TV#2 Ѝ 0 U`P@|vp@-P` 0@Tp 5/@|v@-P0P0P`@P , 0< 0 00 20Ѝp|vO-PcTHHCUDsT# ;T@ p&  Ѝ0QCM?0@0S0P?06?0H$H`pG@00C Q4#0@CW` pU@D 0 w0P6&0`FS A CR R a DR @DH$H@DX ^@;@T@ػ]O-8P@Up=04<P0XY`LLV 0 @X0` ACP  50 R ;SU0T.SPEP ЍY\ SeP#ʠ?0,̀0@P  P ?#?0<<00P 00U?0P0Pػ//O-00a040,($@@ @<Ѝ^ػ^@- 4 Ѝ@-0 R  @ @b `@ 4ЍЀp@-P@,000 080/0 0 !""##$$00/0 pG-@ MP 4`ЁEZ@ M P $(` 00 c2s~ C1|8Q [-eFp Ѝ4, RX[X! 0C#000 ? pP [ e0, 0 0 0S [t  0 dcH _L0 0P0001@00rh0SA 0;  R8 0p 0A a320! r0  P 8 5 8 #61S0SS$ 0S 0];`0H @R000@0@v00 WSX000L000)}0L ;;v^8^[^s^w8]]wwP P /ܻ!)p@- PE%@P`0S }DR ]@L֞000:0pp@-` MR@@P30  `$!1/@P 08SLF@ Ѝp7@-P 0 CN@PQ@P L00 Ѝ0s@-P@<`F` 0ЍpC-0000`00CSʺ0 V0  =# C!Y. R4P 0S = C!P0S c> Pc>O-P 0 00$ $/ S h0S)B.0_# 0 4P 40000 P4000S 0 ,00/ 0 S _R Qr͘4P e> 0X&  ( , P B R   ,0d,0 $ B~ 0 h R0 `2 20S00(< 8$+ B/o0" 00!000 #200#020-4S S 200h0S P .0-400 ,, 0`60A00hH^T0T \/@- 1"\0?0A@P輼,]0@-PQ0USL0R @@T00APES Q T03=?00QS^T ?6?0000-A\\^CS0Q Ӂ0ѳ 0ҁQ/0C-P0M`00@V5p w 0R  (: {>C 0C"4T0 0  ?d @;c U l0<#U \0B#V*ER*@@Ѝ0U00T0;k_kų@-@PM`(p! P `40{> 0020 050 02?0@  0 @ v@Pod*0PЍ耖0@-0S00R0100 ^ P^ @R@@A@0S*? ^ .H@0 ^ RP000] G-@`0A S0 00.SR0 .QR 0@0S ZP00VPPЍ \.\ B p0P^)ZSC QCBP A R\(\P0CC\ ؑRSp6SPR_0 0S00U^ V X .XQQ0 pW UP^  BP R00 0S B.Q Q P Q Z pW UPQ BP ?))0g W1 `V 0 B Q  HcR0b~  @Wm*00p  V[]C-@PM0Q s.R R 0E $2 `S YA pb0 0 2`P 0P 庁$+   +  +Y@PPĥߍC-M@@B pS pߍ 0?H `T ) P)U0@ PE UP *  * *`TF`% @P TT@@ YV@@@$T P 0!1RX 0SRR]C-P@?00CSLM`LЍ@0 `p0R * * * 0 /Q 0S*h0 pS  0 A\0S  '0\ \Q^ AB 0  ("(R ! @ B) T*\ Q?,? Q, ? ) 0 #  Q/@-0Qs.\ \ R 0 #@aAON/100S/0 00/0M000Ѝ/ 0P @/0P0 0@-@|P|0M P0x0d @@MTPP0P 00 @@M(% Ѝ0@ў^w^]/@-Q0@Q@Şw@-Q|L lDЍC-@$M` )0pS rBL S?xx3O@x ; !08p 00$0$0 0040X& 0L00!s0X0P0"L0X0\00M0400X0SV  0Pfd 02\0H00$  0 PP \P$ЍP @G)0 H0 0I0 0J0 0L0 0M02/,)&#X&)0\0800sX 0L000 rBX0@0000H0H @0P0`g< 0O0@0@Yw!!y] ^ 0Q0A-` @ P80 rGLppF\P:_[pd@ E 02p `0S7:0 00 P 0 \-Ѝ\` 0\P;00 00H0 C2 000\0 >0>00C00>0\ /ЍA-^O-@L8`p0,MP 0s @$ Y,Ѝ0 /\0S* ppd0Ep7sUGPX0XP 0000 h c SpO $ld0T 0C@ BÌ)0@ @3)`<0"$P$0p 00 B 0$ - \P 0 ;P> r 00 0Pd0;0hl0 Q! 0LP  AH B"     \P0 00S\P00#SdF^p@-@PS P -A0 0`f`&Opw@-P`ۜ #@PbM@Μ0 000 001 0!?#00Ѝpwy@-P崜L"@P4Ѝ #Nypyxp@-0`P@ R@ 4 Rʈ0@@\0S  0@0$ 8@0|@0 0C?o20p@@-D@m<"P$奜FЍ0 0垜ypy@-0Pp0 0Sd"@TH劜Ѝp 0S (*#`I#kN@ypyxG-P@|xp$X `D2 H.W L R ! V x$x 0 y-   11 1`00C`0`0  0`0 11 1/@- & Ѝ0M000Ѝ/0@-`@TPPtPU \ PU*x^\  0O-`0<4M(00X 8@0000( XPQ)L00" d0\PV l 0CP 230Y l0CL30V00R d\01CpS04ЍVRp0 00 00p0JS 0%0 p00h0000Z00#Sk(P wY l0d H BT02000V`pd000 0SNX\0S*(P U $$00,0  0[ $ ,0(R:P <(P 50(l ,0 B$"P 00s000p0pD 0S (VpP  pGhplgy h00\ %S/A-@PP`M/ `0S 0"!0#0\.0l 00p02 B"0$0GPpp`0 00z%0 {0%0 0808?<r0"\!o0C00/D0l `$0 B"0$0d$ 00%0 T0P  PPVp.0S pB P VЍ]^^O-R4MXP0v\0@Sq: "# 00$0 0(l $p0 B$"`P5( 0 z/C 0 0! $1Q- q5 :CQ0 8 8 #8#40 (+0(00t0(P 4ЍZ  R 80 #8R#4P00 0RP ,,P$`@-M`pP0 0 0q@P ЍU 00@-@  11 c0?o0c0CS1! aQ\51: Q030# P03S 1S c0?oAQ1O-P`p$0l ,0000000 B"$0P0!YQ00(@% q, *BQ000]   (0"(\"$ @@(@(0[Y 0E0 8ᴣ#8#400000+0" 4  4$@O-`Q@p$M ?R H0p00?0Ce\ 9! P 0[* 0R3:U& H0Z 0 0p Aq  o B X0 H0p00 $ЍUP11 Aq  o B  X0H0 0p0UP1 1 mNA0C-P@q崁,M00T\0S*Q]. F!00 0 B` V n0S. s8 S 0@Q s0l 000 0 B"0$0P ,Ѝ00 Z00:0 2#4@000 I0@020000 5 2@$ $0# 50C-@$M0\ S :0P(a`0\0pS*W?5 0 x WQ 0p0w#PW p 0 p l0  0Cp  $#0RP $ЍW O-X M@Rp@8`L0P1 R hhhq Rh0p0l0t0WP l  l  0PP ЍX0 Ql00qPP0[pG00X RX0 00l PP h  0C h  00Cl0 L0 0 CS  dT00l0$ BL,p 0C#0P$ 0 XPyM!Ѝ/O-0lM P00L0 `圠  8@0 K@P )0,    CR@lЍ     P 0@OoB@;NP@M@0  . 0.S+R R'0.S$0pbD0 Sr L0R, R' v0  JK@PX 0'rRppW ;0@0\P PD PJ@  0p$00, ` 0'p0S  0R4 (`0`0\0<`S H00 (D0P P$ P40Sx 40Su  J@Po[0`[ 0Gb0G@,`00d  >0p0p$0l0TP C)CL@H)0c"$<3P<0 L`H0S^(00(000    QQ[0`Q'K0[ 0S0 00 0 0 00 8P $0S  \_'P 000 dU'P 08 ,`SR0p00pG0p 0BB00 p0p04 B8LQ0R S`bD0L00D R` 'Q  R 0 v  ;J@PX 0'rRppW@ 0D@X 'rRppW :0000 + 0D@P O-8@LM00 \0pR`:,p Ad01000 0P\ 0  LЍd00 \d800000@ P00lSh0 A)A )0aD@48"03$P4 h0@0P 0 P8 H0 0I0 0J0 0L0 0M0 0L0< 0\0<0 800s@0 00S00p0 0$0p00(000,00 C00 , 0R$:04S 0S{ L0 X0r00L S000 S<0 0P0<0 00^h m04S4 `d8000@ 9PP,l@ A)A)0aD48"03$.PP4 h00P 0P80 0($ 00 0 I00DP 00gPP pd80@ 7P^l@4 A)A)0aD8"03$PJh0 pG 4000 0 Q 04S= 7 PE0PPi h/04S& d0@ 7Pl@ A)A)0aD8"03$P 40h 00 0 pG  P  0CO-`p8$M000 L@P @DOoB$Ѝl A)A)0a"03$P0P [ pQ Q @ 8+%P $%%P   P^^A-@Pld Qpp0 BT A(`P15"^h05L<0 L)L)lp1<"$.PV 0h 00P00Ѝ@- 0$ 8 ЍO-8@0800S 0s \ S00\ n(0$000 0QPP30$010,000t010(0@1c 110  00 10:0000l0$0d0 0bLЍx |e00P@8P CT P CA00#^(^D]-^@-0Ms0P@ { @PT L10 00 |00 0t@x@`@T {Ѝ@T bl ˁ^-^貁C-PRM@Ѝ R `  R@ @@ptx| 2|000x00000S0x3 p R0 -@   @P 0S0 $5= 00` 0&000n?@bCT0100S 1 u@P0S 0@0c0S0@0HML50 @`0&00 0;?@/CT |0g0'ppm5 o@@CT0 @P@P GlQ5 d@CO0$ 0R 5@00 0 0@+]G-@0S0s!sr"sr00s(sr(srx0s` 0Ps8p  S0s  S0SЍ(,0 sq 0   0P08< rqHL rq0 000 )W@ 0?P00 8< rq 0 R 8$sr 00 T0V HL0 0L00000 r 0 0  W,0@>P L000L00000| r 0 0 V,0@>P~| L00 0L0000ЍG?0Sk iC-0M@p0S   RP- 0U0P S 80 \p`H@X!V0 =P 0`F`80l A)A<>)a21, Ѝ8 d0l 0C 3 ?SR`O-`,MPP,Ѝ 0SPPp\ Q00S8* 衟 Q@ \@ @T0Q0  R H0C200 00 0@P 000 0 = SO P@d 0h @b<p@ RS"$ \ @DSQT@!\  R0R0@0 PPl A)A)0a$ "03$PP p00 0CS0! 0F@jT0PSTTPnO-`$M0S S@ dG 0pP 8 0 \000 0 P0S@$Ѝ00S\0S0000 @\0/0S00-p0d P l0  \RQ B01@ 09@PV 0 \ r\ >0>00S H0A0x0000 0H0  C200000 $@P[; 0S0\ 0T [ ǰ000D 0 0 >0 .0 02A@0T002  0 - 0  H0S 0 h@Pp c 0* I(C8RP 厰p000 #8 *(80( 0@P @ [B$ЍOo@<@:3^M!Ѝ/A-0 @p0`SP , PW-s-G-` P@U}-@P pp, @P 0/ -00@ $F-B@s@-@0P000CSF#SR`88 d0l 0C S c10PQ0,`P 0##sr$ 000#sr  Ѝp@?8l A)A0<)a21 #0ЍpR^@-0P@"XaD0@8 4#, #$0UDSDЍi^^:6^00\ <0X 0C S0 0 ! /+ 0 0 0Th]G-0 S*S* P 8pL  PS  P;0S2  I00 > `!IR 0;S   ЍmO-0|M0(0L0 0@00S<0@ p(08P<0!00~0`S0040 0#240#~ 022$0(0X0S rwL St@T000H00G0s L0ld0S A A! a,3 1T$0 0 #0X 00000,, I000SF:  PF0 @pS  @p   4 R70X@0#d Q a30PQDh00 808p00CS0!H0(0\0HX<T00(X0` Pl0d` C)CT\H)0c03"$0PD0\ T00CS0H08 S  8 \8 000X :0 L0TRQQ 0S0  00R0 0p5 0 @ p X 0l00m0~00l00m06d8l @T4L0 @ `0S  .3,0$0  0#0 0 0P2  l0 lt0 0u0 0v0   ,0S*\ld0S A A! a.3 1T?002 0D 0  P+ \P,0@ 000 000< 0C( 00\ @TpTp0S [   0|0P0P| |Ѝ 0,00000S , 0     4 R00 0H0000 00,@0p?L0@0,@0p0"@0,@0p0D ZH^H^A-@Mp0@P`00 R@@00V T0L0 0L0800"0 VT@`00R 0 W@T@M00N0P w000Ѝ@-0`P pMX0S, \0R@#0*x P @P&00h@l@!0 0\0!" 0080H00 0 0p 0, v@P  0 000 Ѝ80 000 m7@-@P'P ʄ+ Ѝ080 000 V0C-0@P8`rr eL dl0 T@d X0S 0S @ `.3,0 2# $0L0!10P  000 00HpX0000(0""p 0 8080B  0M  00|0L0 8|0080xp000h \0000000 Ѝ 000  0SL 0S @ `.3,0ǃ 2#$ 0mA-`0M0P@ N80 000p L040S {P3 @PH0 0I0 0J0 0L0 0M0 0L0\pp800s  Ѝz@- `P@T P 0   0L 0 0<031009 0P ЍpvdG-0p` M8P0X0S, \0R@#* 0@P~x A0PP(0(wl0dT A@! 0C#p00$?a@ p 0&@ 0y 00!e  XpLP:!0.e2-8640q."@* X #@P&0d00t@p0!# 0, $00@P 0 Ѝ 000 |@P (t] 0`( "4`#/p@-@(0Sp0PSͱP 0 R@TpO- DMhR/@lp0-`p0P00`$,`@P $ @P#Wk`Fhp &h$ 0@o V㨂X@P T?Pb,`$HDЍ$ @P P0`t< 0P0 8 <\$ }$ #  R( p0(@ 0,00(000 $00 @P(`0@T \PI@ PH@P@0 @P M0@SI@H@ R BᏭ(0W0 ,000,0^hKC-萟M8P Qo<01 @`p000o, 0 < 00 0 0 )P0SP7 000ᰰЍ蠆A-PPP Up`㫬U@ լ0@P0  A-0Sp@㪰@P 0`PP`P0 PǬ00`p@-@m004P0 pp@-0`S@q@P P0S00  |ɬpG-0`@ `PpL@lT Ѝ 4 `P0 00@0`6@`0@XO-M@Z0`@P %1 1PPF0Z00008p+08yp0 WP8.W(8p ([( (( (  (YP6pPhl PT0RPp X0R 0S!0 AP O-@,M0S`;p808`8444P`0 000  10  i(0 ! 0&0 `P 0 0 ,P *\ݱp喁`,Ѝ00 0S`000 1\0:Q`0#0 0 0$00$08 080 0 [05 5  .$ Qࠓࠃ威x R 0\$$82X4" H0C20000 0G`P $0  hX S R  " . 0[8 Q00 0#  "ta0/0 ǧt 0lQ    . ?(8`QbVH0 [ 堧t 0lXQ   . ?8`%S虁 20S~ G-`00@PP%u<00<0%#0 3!0yLVP0@8003!0I@T#%X:>0 SC&P02#@ 05:"0P0 @ 0000000$000 p5@ 0 SS$ 0$R00S0} @$0刔pC 0Sjs@#!P$$(00D 0(0#00$ 0A@P$p00ʿW0~!P"Т3" R 0P03Py 30p 0Pg@P 0! 0K"@0 a0  0U80(, <00PQȥ0 1 000$00 100@p0@$0  0@ 0 0gT8<$p 000~$0/0 0 !P"$0/0 0 !P (p$,0 pW@ 2 30p 0f@P0S ;!@0~ƥT!@@i0 R幥 P0R 0! 0pe! 0  41T 8@@8081T#\ q~厥#0S . 0S倥I0p~!I!R~ 0\ Rg 0  8@@808虁^41uO-DM00h08 <00S\ 0PS` 0SDЍ0地0083$000  01$00 $Q!  0 0\:Q0p@(0,040 00 Q0 DЍO<0$ 0P Q QE Q'0008000S  0 Q:Z0 0 _Q Q Q 90S S 1H0C200<00 0P  0 P0*&00000$0 0;00@Pap| 060QP CT0 ;cS10! 0p$00:0 @P 060 %.P  ! X- 0 0$00 "$Z 8S  0RP a$0 (000J ( RY#QQY*  R, ( RNڸ \RD  00$00 _($80080000070 pP 00 p p8Sn0RPh #000  I ( JRY ,   J Q 13 145  0(0<00,0(0Y*0( 0Rp* l 0 $00CZ00 0( ,0)!00 ,0( 00 0 0 0(,0 G% 0p0 %,(SR0 ,0 (0 000H10S0|0S8S$00:0 P 0 5Ѐ0600  P) ,0S )!00 AL000  0  0   gX0(0\0,0p^7B(00,0 040S W X0SZ%Q虁^LO-P $@p @@DM $c T<✐0娰 ` 寣P  0 DЍ`&W`V ``P  0 0$3 0壴  !f B8P+X 0S68T08h0TSJT巢0S 0{ 0 R #1 TOX T堢 0V  01 Cr T 0!,{!X!{P0 ! !0Bq  H@o/@-M@P`  0 0P @P 6Ѝp0@  4/@P2V@002d0  4/@P Ha6 ZV 000( (00^i0^iN^Xl^KC-p` 0TM P p嵺@P 96TЍ. ": !>V4D`Y2!>3`04\@ 0$p 4/@P 86 (00 0s^i@^X^ԍKp@- P0@@`<04 @ 04/@P 5 僺^i:^@- 0 0000 0Ѝ @-0 000 00 0Ѝ@-!>0004!4 0׸ЍO-@Pp`LM$@WplG5X ፪P0 7 |8/P $E LЍ ``  4:/P #5 $/ $`,88000`8 `` 0( $;/#PJZ@T<P|p0 3/Pt0 Sx0S $0x 00$0P^f^ 0EꌌKp@-@P$ Bp@ 0`( "4`#/O-P@P00 3m@P@Pf #P Pz R R 00U>000 C2H)10S@0   @U. p)2000 8Aᤠ4/P#P  p000@P@ Ro 0R  CU800000008A ᤰ4/@X0#T00S 0 #T T0S0S0@1T@0 OoB0CB001 tbã00 $Y @ 17匀00008A ᤠ0 4/#P@L  @P #T 0 T0C00S @T@ @卣0 00 S00  P  wt60Q &(10(1Thud6@Ty 0S0Y @0 00000H60S: 8, 5,6P:# 80  <0L P0C1001008 ؕ 0`000d0嘚*0<00L 0  !  000h5 000 s 00bR0d`0Y L  P:dd0 00 0`0542(8p  ,?$<'Xy,XX0ra0HS^@2 00?FV;000S  0  0,( 댐48$ <8<@|@00!>0 R03.: QZ# Z3#8#(,  PU0 :8<V0 0 0) <0S<Ѝ8< '8    08 08  0`H]8]]<0@-@ P0 M0   0CD T P  0 mЍ00@-PM8  @:8;0 00 i) (Ѝ0@;Ѝ0S} O-@$MTEP`L Hp RQGPP0UPPӔ0U  QS 0Q P:`0S00S XQ0R@3 q1 10!W?Q00 00U0P00H0 00000`00X0!-181qq$ЍP0PP\0001 1pWÏ`0Wlq1 <U,181q/k^q^Qw^^C-DMP` p >g <  0$ 00 0@ "4^00 00 0 '0|0 0 P0 S  8g P 4gDЍL\ 0 \0? 0 0 900 0 0g 0@-8@ eh0l P 0UP3<P<#/G-@$q`0d 00000`PD`0d P Z000Pp"SR \ R3#. ~: : 8   088  H@虁 0`( "4`#/O-$@ pj&0q00~p0a@S 0F  `pF` pp0 S  0 `@pepPU- 00pH[po?0尡Z | Q ! |! BR!'p V@p0S 1S10C1tp0S np -p+p0S hep 0XS  0 [pYp&p$]]%^yzļ @-o0 00yp@-<@Po0@S2pp 0R@yC-@M@oT010#P,q,a 0 0R0U0S; Ap  0@\PoU    0SP@T  0 刮0 R0S   0 of&o00C0 oЍyļL^lKX^@-@oyO-@Pp`0l儰1 ' ;1ke>0,0000m q删!!  *P!X& le! ,++:10 0 Ὥ4 ;P !*!0l 0 ᬭ4 *( 40  ++!)X^^G- MP  p@` Q?@T ЍF CZ@sʟZ R00 00@@dTP0T00PP' $ P0Q\(0  S  @0 0000(0O-@,MP0p T0P`X S0 T0 0C S 00   @P EZ? 0 0P0? P!KpC!0 SH080@   004005000@@?0 S0 ?0 ? @?-Q P@ 0P 00T 0,Ѝ@0S   R00   S  @P ~Լp@-@Pn0 Ep@PnG-1Ms nQa0S 00$?nЍ@T0S_@4n[  PD 00 0'n0  $~P! c"$" S R- Z03H0 $0X\ RP(0` R  X000 R 000m 040 0m$@0HL RP0P R 00 !/ #z̼zXQp@-@ @QD\0@$0@0$0ppPwm$@mTp\0$00$0$@p@-Q@pP @Q}D@p\md 0$ 0S (0, 0@@md 0$ 0S (00, @@p@-p`P8m@T 0S4` 00S0C04#0S00  0S00@cp@Um"@̼z@- m@0"z^@-T@0S l00#,"0S.m l@"zzA-pM0S S\1 @#P1P!PCh0 q4a4!U!#l R100 0Y@P lЍ̀`V@0@0P `X0 h00|400"0@00S`000pP4Q#l@ꄲ]p]z ^hK̼*^z- $\/p@-@PP 0SH0D'Up@$633^]A-@P`pNW塓0 Aa/Up0@-@P0M 0 @0P@*h0 `0 @0P@ 0D 0@0<@@U;P ()Ѝ0G^ zQ^{KY^|b^@-@ @; zA-P`p@ @V50L00唀@0 0L 0h,hjd`dPTPo533 0& L 0 z@{]7@-P0g@P @T00  Ѝ0@-@p0PS` H`HV 00|03 70 2008o<080S 0S  V 0 : Ѝ zp@-P@Z"0S  0S x 0 @QL\PP P 0S0Hk4wp蠙{ z 0`( "4`#/7@-@00P4k000U  Ѝ0@ Ѝ0ekA-$PU0@$041  k` pv1SJkA蘫!! @-P 0`S4 R13U  @Ѝp $`V@ 0@ 冘@ !00 0C?o2 104A04/@P U 7T0S 0@0 0 0 0U>0' T 0(T@0 0 07T0S  H& DR2320   (T @p^^O-@MpO84@P0S0[0@0\5`4IW00 Q, 3Q00 3`0 0 00C0@@0SPD0@H0`2 #101Ѝp#0 00\30 0400D300P0@0 00  ntZ @Ha^[ @ R20 030000 3SH0L RP \0 㴓0@`00_ P ,00 B R  R@0 00  `!H0GS5040v400 3SH L0SP0\ 0 r0`@0 <  0CS00S0$000 $ `J430W0B 0 3SH L0SP0\ 0 @0`@0 <  0CS00S0W00  4ę虁̙]@-8@P(0, 0(00 , @d|@-@ HIi7 ` X00PL0, D00(00% ,00p0Ѝ|4K^e[_^^@-4M,"$0@HiP(p@|0/|@-@Hi00H@Mi|@-Q0   0P0"3 ti 0ЍA0C-P4 " @ 0弧@P }s0  000000) 0㱫@P ,t2h"1ᝧ@P 00 X9@  ᵱ1 $R00S 4 `P 101>@Qq0 A0!0!0(0S+p@x0tT@1eeO∀@ @P1@010@00@1#:\@LHD@X@T@P@d0`@h@<ЍS p@x0tT@1@eKN∀ @(0S %  000000t &0 R00tp@ሀ@M@X^O-P`1 @jpᐑ吡!@P4|qdVʀ 0! $X!0 P!H!   !,g0S2g 0! d0    !tT# 000 i@Pr8o?P 0 R (@- 0@XHhl||^G-0@@p` !4#Q!PPC2 |2 0<0:t0p0x00008|0l 0 0X 00"Pk4p 0 (00,0'S0 c0?o0c 0$(0SP :000 05PK0 TPJ!`o 0  0Sqp " !  0 q=J P0S00000 \0 Pp0p p A  P { {T  o v~ z7(ȼ^^^^Xؼ^G-PR M 0GS p`0 V Q 40p E@P!00(0 0,00000  t p $ x ( 8 , < 0  4 | <08 l D0H0@ 0@ Ѝ0SK@0 J@p VS  7<$(, 0 00@SD@J @P6ZJY `0 @P)Z `ZJY 0D@PZ `000郣@P 000 s@ II I@@A-1Ms1NP@G<P0< !0 0OBPT@P B Ѝ0( ,(0$!    a}@P&  0p0X0 0(0"@P( R( '?l 7`p0@`=`!(pd W 45ˁST_e[_ؼ^^A^貁M^ 0`( "4`#/@-0 $0S\ 0 B @B24 b1> 0S& p@-`0 CSR!0@P P  h0 P  ^0 0# =Pp 0&p pG-p0M0`0@8 ;8$PPi "\D00D0 D 0a U@(w 8QPPP# #RH LQ\P AQL0S0P0\ 0  0CSR|U3F, BUDL (PP00$ 0 0 0 013PP Q 00 0,,PPK C0Ѝ(0000(000000#000EQ QE1(LuQ #RH L0SP0\ 0 |( 0   ( <  0CS00S0   0 0,00S00  R,0 U虁b^O-0lM 0H)@P|0圀\0|0D  0 p,0 @@U`< 8P  " Q.HLP\P@@ @DZL0S0P0\00C Sy{ZHu AZkL ,<K@P P<0000<,00, 00 0,0r000J! !B1(L<8 @@@ #RHL R P \  BT|H L0S0P0\ 0  0CS V{T<0000<,00,000,00DA AD*00010(L}TP QH L0SP0\ 0 '{< 0   <, <  0CS00S0 ,  L 0 ,0N<0 D #RHL RP \ ;z< 0   <, 8, BTL ,<@PDY2P~?@ X808 00U0@00S0T0S@lЍ, BR  R ,  0,0 0r<0 B #RHL RP \ 9 0 ,<E@P@004000080 0 &@P AU 080 X0000CS000( (  PP(  4`~@P, B[ ,@  0,0?0 0K1 1C! 2P 0 0 XxPPX0 080 P000CS (  `P(  4 ~@000(2 0R$78 00 00CS000 (   t`P(`X\` `HL`'S R00$00PS;#S R7800C?o2080 Dp000CS000 (  ;`P( PP" 0 0D`PDp[`$0S0S P00`X0 `?o2X HP 4}P0%'TZ虁b^ԙO-0pdM00 ,0`0SPdЍlV$HH&圀t00t0 $0   ' V@8u 8QPPP# #RuHL R \P   BUL0S0\ P00  0CSPFyU` , BUBL $8PP )}`800008$00$000$0 000EQ QE1(L\0SI }`?P V8080 0Uw,00S0U0SPqQ #RH L0SP0\ 0 x8 0   8$ <  0CS00S0 $  0 $08 ? PHLPP\ 6 $8aPP~,00(004 00 023APP mQV 4( `000CS0(0&  @P  0||PP  @Q0$P000$0]000A A1 2 0R44 (0 00CS0(0   @P 3P T.X+'' SR0 000HS# SR80Co4( # C,0!0 0 0H03!O@P  08ЍG>TG`]虁b^k]ԙ0 X-7@-P@0LP! "0S, ,00 13/ Ѝ0^4], :6^@-@0S )@C-`M @P- 00 0SS S pj0 S2 I00>00 P 0   0@gЍO-p0PDM,sr`l90V0< 4%P00P0H $028 `@@8@C #R7H LQ\P AQ9L0S0P0\ 0  0CSTqTHh)0 P@ X@ @T@ T0S@DЍR 0, BTQL $8@P2 u TT0S ,sr 0S 0T00 0 @800008$00$000$0000DA AD1(L480 3SH L0SP0\ 0 p800008$0 <  0CS00S0$000$00P# @04 R S 0(0400 0 0 013C@P A4( <000CS0(0 ,  `P,  0t@fRSiP 0 0<`P<T 0htTN0K 00G 0S S@A4( 000CS0(0 ,  `P, 4 @DЍOsS@  0@0T 虁b^p@-`P@M8  ;8PP00   08 H@   0 013/Ѝp]8 @-p`@M8 % ᎗   P00  0H X@  0 013/Ѝ], p@-@ `(MP0x 0 0$00 000 PS@P A s(ЍpO-dM000/H0p0H0 <D ` $0J X@4r 8QPPP# #RaH LQ\P AQL0S0P0\ 0  0CSMioU/, BU?L $4PP LsX400004$00$000$0.000EQ QE1(L4$^0q  R[ 3SH L0SP0\ 0R&o400004$0PQ #RH L0SP0\ 0  o4 0   4$ <  0CS00S0 $  L 0 $0440 3SH L0SP0\ 0n400004$0<  0CS00S0$000$0h<004 0q s R> 3SH L0SP0\ 05n400004$03R 3SH L0SP0\ 0 n400004$0 <  0CS00S0$ 000$000<  0CS00S0$000$0:00 M40q u R> 3SH L0SP0\ 05On400004$03R 3SH L0SP0\ 0 8n400004$0 <  0CS00S0$ 000$000<  0CS00S0$000$0900(,4q|0 } R> 3SH L0SP0\ 05m400004$03R 3SH L0SP0\ 0 m400004$0 <  0CS00S0$ 000$000<  0C S00S0$ 00 0$0800,(80 ^0P3l:0S#S$Pe PPe "z؀(,x1 3̾PP!  0e E0CSHL0sq 8<0sq0 r0sP0 0"P""0 3"srP P P0$sr#sr0s Q003 PPЍPO-00$`pT0DM|0T0 D $0" WP8 8Q@@@# #RH LQ\P AQL0S0P0\ 0  0CS_AjT@ڔ, BTQL $8@P00000H3(4  3@P WA 4( <000CS0(0U ,  qPP, L 0m@DЍ800008$00$000$0000DA AD1(L)Q #RH L0SP0\ 0 i8 0   8$ <  0CS00S0 $  0 $0P 0 0<PPT 0m4( 000CS0(0 ,  @P, w P 0m?@R 0 @P@T4( 000CS0(0 ,  @P, M P 0VmH@\WAT!虁b^O-0 0p0/PTM:0`<0&0SP0,0(00P 00[M%X00X0p0( [ 0$0400 @SHt 8QPPP$ #RaHL R P \  BUH L0S0P0\ 0  0CSNhU , BU@L 4HPP! l 1TЍH0000H400400040000EQ QE1(L H0A 3SH L0SP0\ 08hH0000H403Q #RH L0SP0\ 0 hH 0   H4 <  0CS00S0 4  0 40<  0C S04 00 0400$ ,0W0PS5 QN0!0D008@0 00 023PP jQ0LSf D8 000CS080 <  D@P @-lPM,P< P 0 0D0LY@PLU@4D8 000CS080 < 8 Du@P< D8 000CS080 < 8 D]@P< p0@P@kHP0 0D0L@PLP 80DP @k P@k 0K0 00S Oo0BS@T@$0TPU虁b^O-M<00PD  L n`0 @0/P:0 <(000=00(0PSX040H00L0g0$P40 ` 0SPVڠ+t`H\00\0 0S`1<0,`S    T0(0 pSd 0Q8PPP$ #RHL R P \  BRH L0S0P0\ 0  0CSh6gU/ڐ , BUZ TdL PP: k 4l<0S i=00C00Syʐ=[=ED0$ U 00Ѝd0000dT00T000T00EQ QE00010(L-d0\ 3SH L0SP0\ 0Sfd0000dT0QQ #RH L0SP0\ 0 fd 0   dT <  0CS00S0 T  0T00 Ld0 3SH L0SP0\ 0fd0000dT0<  0CS00S0T00 0T0^[XD0PSP <0S~ Pbf HL <PP   T\`$ A# d XP`0 0C0000 00C00 0 0<000<  d B"00X0 0`00\000 00X63PP Q(0Sn `X p000CS0X0- h X `pP$ \i P<  0CS00Sb0T000T0 } T0dPP h D5 0RK` X0 0 0CS0X0 h X `1Ph8 0pt|x8 x\^00@000\04\^8HoᨂhlP\0p 0B?o200080@08`X l000CS0X0 h X `Poh YP0 0X 0`0lP_80lSp @0S*X P00pX0?o2 pP U`S` X0 00CS0X0 h X `pP \)iPP0%'hP\iPV0`F 000,0C0 0000 0S/0 $0pS SPpp R;a? `>a` ;$p[ P0hH0\hU 0, V0C 040040b 0 L`0$0, ?oV20SV 0 F000 0C0000000 0S 0 89$0 KP  $0Sia`0X 0`(0‐`P \hPyꀐ(`~PUd^^虁b^LNLԙO-dM000&@`p0圐l0p0$ H pp  $0 8@%VP4n 8P  " QHLP\P@@ @D[L0S0P0\00C SJEd[  A[<L $4@P (h`400004$00$ 00 0$0 000K! !B1(L[ZD h`?@ V8080800S0T0S@dЍP QH L0SP0\ 0 c4 0   4$ <  0CS00S0 $  0 $04p0i 3SH L0S0\P00 0CW_L0S0P0\ 0  0CS cWe400004$00$000 $0000Gq qG 1800,000(00  0 @P KAV 0( `000CS0(0  PP  ,Yg@. < 0CW 0 $4@P 2 0R p50 (0 00CS0(0   PP pP TpXP@Dp'SR0000HS#SR8ppGor0( <000CS0(0  kPP `P 0 0<*PP<YP 0SW P00PX0?o2P @OP ,fP0%'Wv[虁b^ԙ0@-00 : ЍO-p0@0lM$ `H  x00x0000000 00 @@  ,0V[P<{ 8P  # QHLPP@\@@DZHL0S0P0\00C SVubZ ; AZHL ,<@P Xf `<0000<,00, 00 0,08000J! !B1(LWO7f `?@ [808 8080V0@00S0T0S@lЍP QH L0SP0\ 0 b< 0   <, <  0CS00S0 ,  0 ,00<@0 3SgH L0S0P0\ 0  0CT}H L0S0P0\ 0  0CS aTW<0000<,00,000,0000DA AD $1< [ P8@@@N QHLQP\ATDHL0S0P0\00CS aT <0000<,00,000,00DA ADX00010(L < 0CT0$ ,<@P ATL ,<@P0S 0<@0 3SH L0S0\P00 0CSL0S0P0\ 0  0CS !aT<0000<,00,000,0000DA AD 1J@0000 08004000 00唾@P A[g 80 p000CS000G ( 0 8HPP( > `4d@P QHL0SP0\0 `<0 000<,0 <0CS00S0, 00 0,0 0@ < 0CT),<J@P 7t 0Rp`p58 00 00CS000 ( 0 8PP(e`X\` ``]L`HPXP'SR0000S#SR8``Foobp8D0 000CS000 ( 0 8PP( l.P 00 08DtPP`DWP 0S&V P00PX0?o2X HP 80 `000CS( 0 8PP(  4d@`P0%'0000 R p58 00 00CS000 ( 0 8WPP(pX\p `LpHPP'SR0000S#SR8ppGor8D0 000CS000 ( 0 8 PP( `P 00 08DPPDZP 0SW P00PX0?o2X HP 4cMP0%' `TT1T Z虁b^ԙ@-4 0Ü   ЍO-p0\M0 0@ 0 00圐$<S0  D0 00,0*0 00, <00 `SPu 8QPPP+ #RH LQ\P AU!L0S0P0\ 0  0CSP_U  0 x0?R*`b, BU:L <PPP bP0000P<00<000<0000EQ QE1(L.P0[ 3SH L0SP0\ 0R^P0000P<0PQ #RH L0SP0\ 0 ^P 0   P< <  0CS00S0 <  L 0 <0P0o 3SH L0SP0\ 0f^P0000P<0d<  0CS00S <0    <                0@xJ00L00H0000  06 3PP Q0SZ L@ 00$0CST0@0" D  L`P H)bP\Ѝ<  0CS00S0<000<0D P 0 0LTF`PT0$0UHL@ 000CS0@0 D @ La`PD 0000L@ 000CS0@0 D @ LH`PD `PFPL@ 000CS0@0 D @ L)PD  Z#3PHa[0k 啪0 08#800C0 0C00 00 0 0C0V` !8888YL @0 0 0CR S 0@0 D @ L`P?DZW(T0@S`H\aHP1S0@0 D @ L`P D;(,kX04 004 0000C000000C0  A0XN0 [p(00`Ḁ 00 L 0C00 00 0 0C0 @0UP Ha PH`0 H 0 0C0000 00C0L @0 0 0CR. S 0@0 D @ LNP H`PL @0 0 0C R@@L`P`DV$ 01  S0@0 D @ LPDV  000S U虁b^O-0M0@00`p$ h,00+000\ 0088 PPDP+ #RH LQ\P AU!L0S0P0\ 0  0CSYZ\U" 0 x0?R*, BUCL 0DPP$ 5`,P Y ЍD0000D000000000000EQ QE1(L`D0 3SH L0SP0\ 0  \D0000D00 <  0CS00S00 00!0000 400 0 0@000 000000 00x0p00<00$0 08 3cPP Q@4 L000CS040 8  P <_Pi8 P 0 0LԿPLU<W@4 000C S 040 8  P8 0000dPGP@4 000CS040 8 4 @P8 F [#3P<L_ 0Sc0 80 08#800C0 0C00 00 0 0C0X !8888@4 000C S 040 8 4 @Pm8 0 00@S<_HP0,cX0 0 0000C000000C0  A000XV0 ` 0 000 S0Ḁ00  0C00@ 00 0 0C0 40 P <^ P0 H H ᧧0 0C0000 00C0 0000@4 000C S 040 8 4 @P <^ PR@ 40 0 0C R44@P8 X 01 00CX@ 4P0 00C SST040 8 4T @P8T ⚻@4 000CS040 8 4 @P8 'PQ @4 000CS040 8 4 @P8 0@?S@ 40 0 0C R 4  8@4yPG88 S> LP8 ,Hp0 ,⻼X H0,P0 11x C60 0hd,P YK p0,0@4 000CS040 8 4 @:P78 M<0 H0VPH0T0,0S040 8 4 @P8@ 40 0 0C R4մ4@P ]UK虁b^]O-00p L0DM✠0L0<$ H 00$0 P ,0 `S8^ 8Q@@@# #RH LQ\P AQL0S0P0\ 0  0CS9JYTڜ, BT+L $8@P -]800008$00$000$0000DA AD1(LaW4]?@Pl0SQ #RH L0SP0\ 0 Y8 0   8$ <  0CS00S0 $  0 $08@0n 3S9H L0S0\P00 0CSdL0S0P0\ 0  0CS XTv800008$00$000$0000DA AD 1p00(40  h0p 5@P Al00S0T0S 0S> 4( 000CS0(0 ,  @P,  0i\ < 0CT0 $8@P )I0@?S`0Q\H@Pl00S=T 0l 08 U6 3 `4 (p0 0 0C R (  , @P,pl00SQ  TP 0 0 Li`p 0 @P  0 \DЍ 0@QL 0 L  LK 0h`L0 0 0"  0--@lЍ, BT3L 0@@P &[@0000@000000000000DA AD1(LZ0S;[?@` V8080Q #RH L0SP0\ 0 V@ 0   @0 <  0CS00S0 0  0 00@ + PHLPP\ " 0@m@P@V0  R- 3SH L0SP0\ 0$V@0000@00"  @Q00@00000}0A A1 з<  0CS00S00K000 00;^@0q E R 3SH L0SP0\ 0 `V@0000@00 <  0CS00S0000000:00+@0> 3SH L0SP0\ 051V@0000@003R 3SH L0SP0\ 0 V@0000@00 <  0CS00S00 0000000<  0CS00S00 0000000@0 3SH L0SP0\ 0 U@0000@00 <  0CS00S00 0000000@0 3SH L0SP0\ 0 U@0000@00 <  0CS00S00 00000008<@tz R|TZ@0  \ #RHL RP \ |U@ 0   @0 , B R  R 0  000408G@DHL@tz |TZ@0  \ #R HL RP\ A Q :U@ 0 @ 00  00040HP00CS@0 3SH L0SP0\ 0U@0000@00\ #RHL RP \ T@ 0   @0 , BR  R 0  00040@0 3SH L0SP0\ 0 T@0000@00 <  0CS00S00 0000000U k\ #RHL RP \ T@ 0   @0 , BR  R 0  00040]@0 3SH L0SP0\ 0 rT@0000@00 <  0CS00S00 00000001<  0CS00S900000002 +0#0$<00480 00 0|2 3ȱ@P `AV <4 000CS040Y ,  <{@P, P 8R 3SH L0SP0\ 0 S@0000@00 <  0CS00S00 00 000D1R011 0008@p 0B`HP0s0 ?@c<4 PP000Cg S040 ,  <@P, 0@?SP8WH@虁b^ܙؙp]]MbԙP < 40 0 0C R 4  ,< @P,e00 H0@P]H0VT6 <4 000CS040 ,  <@P,  8GW`Y> ;.[PP <4 000CSST 4 T <f@P[UPP% 0 0<XX[@PXV <4 `000CS040 ,  <wPP,  8V@[@(00@2300 h@P(0Tl2 0R 7< 40 00CS040 ,  < EPP,PX\P `LPHP'S R00 00S;#U[7800C?o20<4 Dp000CS040 ,  < PP, `P" 0 0<D˶PPDp[P 0S 0S P00PX0 P?o2X HP 8lVT# $0 [P0%'T+p@- P`0 PP@0 姑p0O-M , H0 , R 0 ЍO (00 $ $8 RL ( D <  @ /``00`0@0D   L0 0 PS`y 8Q@@@) #RVHL R P \  BRH L0S0P0\ 0  0CSSQT0$00, BT@L L`@P U`0000`L00L000L0000DA AD1(L0SHU?@80VT00S $0S S V@0S T0 Q #RH L0SP0\ 0 Q` 0   `L <  0CS00S0 L  0 L0` , PHLPP\ # L`@P` 0Q  R- 3SH L0SP0\ 0$CQ`0000`L0"  @Q0L@000L00A A1 g<  0CS00S0L000L0$0S]40`0 3SH L0SP0\ 0 P`0000`L0 <  0CS00S0L@000L0jh00P0 0\00X000 0:3m@P A 0S \P 000CS0P0f T P \ @PT ] X$`0q E R 3SH L0SP0\ 0 P`0000`L0 <  0CS00S0L000L0T900d`0? 3SH L0SP0\ 06jP`0000`L04R 3SH L0SP0\ 0 SP`0000`L0 <  0CS00S0L 000L0,800<  0CS00S0L 000L0700`0 3SH L0SP0\ 0 P`0000`L0 <  0CS00S0L 000L0,700`0 3SH L0SP0\ 0 O`0000`L0 <  0CS00S0L 000L0|6008p<@tw vTW`0 S \ #RHL RP \ O` 0   `L , B R  R L  0L0408|@yHpL@tw KvTW`0  \l #RHL RP \ cuO` 0   `L `\ #RHL RP \ ]O` 0   `L , BR  R L  0L040`0 3SH L0SP0\ 0 0O`0000`L0 <  0CS00S0L 000L000, B R  R L  0L040HP\ #RHL RP \ N` 0   `L , BR  R L  0L040`0 3SH L0SP0\ 0 N`0000`L0 <  0CS00S0L 000L000R 3SH L0SP0\ 0 N`0000`L0 <  0CS00S0L 00 0L0 81R01^ 10000 08U@p ,C`LHIP0s0{ ,?@c?t;\P PP000C S0P0 T P \@PT "0@?Sp`PX(RH@z虁b^ؙ]ܙMbԙp `P\ P0 0 0C R P  T\P|@PT[00 h0✸@PSh0T00 0S+ \P 000CS0P0 T P \Y@PT 8WPP \P 000CSST P T P\ @P!WUPP* 0P \x00x0@Px00 0S \P `000CS0P0 T P \PPT  XQ@pW@H00,2300 @PH0T0d2 0R04\ P0 0 0CS0P0 T P \PPT\x|p VPRlh0Mpx |00\R  4 RI0 4 QSD80I?o200(0S> &QW;pppGor\P d000CS0P0 T P \PPT 0P<0& 0P 0\dWPPsdY`40SZ00S P00`X00(pp?o2x huPp ( <0R0(0XPTA80$ R00S x@t#sr8$srH(5 3 -@P/09 ,0 @0  808(0S0ЍP0%' TO-@ 0lM/00p0@@P0\@h00h0噪   U (0 L0  <  (0< U`<x 8Q" #RH LQ\P@@@DYL0S0P0\ 0  0CY\LY@", B RL (<@P ?PP`!<0000<(00( 00 0(0000I I 1(Lq00SKPP`?@0D?o@2Q  RTT0SQVt U8080lЍQ #RH L0SP0\ 0 K< 0   <( <  0CS00S0 (  0 (0< 0 PHLPP\ ' (< r@PyU <K0q ` R/ 3SH L0SP0\ 0&K<0000<(0$  @Q0(@000(00A A{010 Ϭ<  0CS00S0(000(0:00]<0> 3SH L0SP0\ 05cK<0000<(03R 3SH L0SP0\ 0 LK<0000<(0 <  0CS00S0( 000(000<  0CS00S0( 000(000<0 3SH L0SP0\ 0 K<0000<(0 <  0CS00S0( 000(000<0 3SH L0SP0\ 0 J<0000<(0 <  0CS00S0( 000(0008<@ty qTY<0 S \ #RHL RP \ J< 0   <( , B R  R (  0(0408y@vHL@ty HqTY<0  \l #RHL RP \ crJ< 0   <( `\ #RHL RP \ ZJ< 0   <( , BR  R (  0(040<0 3SH L0SP0\ 0 -J<0000<(0 <  0CS00S0( 000(000, B R  R (  0(040HP Z 0 <0 QHLQP\w 0 (<⍾@PU<0 3SH L0SP0\ 0{I<0000<(0y\ #RHL RP \ I< 0   <( , BR (  0(040<0 3SH L0SP0\ 0 I<0000<(0 <  0CS00S0( 000(000v AR( ( J0 0 0C11C!0 嚪t<  0CS00Sz0(" 00 0(00(1000 08 @p 1B`HP0s0 !?@c @004000,8 0 0D13学@Pp UAn T`8, 000CS0,0 0  _@P0  4L`"PPK 8, 000CS0,0 0  B@P0 0@?Sp 4L`H@P虁b^ؙ]ܙMbԙ8 ,0 0 0C R ,  0 @P0``H0 8@PH0T` 4L`8, 000CS0,0 0  @P0 nU P-@8, P000CS0,0* 0  ػpP0 ! 4_L@P 8, 000CSST , T  ኼ@P 0 0XX`僬@PX` 1 0R88 ,0 00CS0,0 0   㜻pP0X\ ` LHpP'SR00$00S#XW8Hoᨂ0 00 0$08, D000CS0,0 0  ^pP0 PP 0 0DpPy 0DSp $0SX P00pX0?o2X HAP 4KP0%'@ 0  0X0X00,4 3 00 0@PX0T`00@`T U`YEUO-@ 0tM/00p0 P0,@\0U 0d0<0d0$ H 0<@  00 & U`H_ 8Q" #RH LQ\P@@@DZL0S0P0\ 0  0CZ;FGZh , BZ-L 0H@P )KPp H0000H0000 00 000 000J J 1(L[0S3PKp?@`]Q #RH L0SP0\ 0 FH 0   H0 <  0CS00S0 0  0 00H0[ 3SJH L0S0\P00 0CXQL0S0P0\ 0  0CS FXtH0000H000000000000H H10 HU0 | KqU R$ 3SH L0SP0\ 0FH0000H00 < 0CX 00 H@P 9<  0CS00S0000000:00BH0> 3SH L0SP0\ 05HFH0000H003R 3SH L0SP0\ 0 1FH0000H00 <  0CS00S00 0000000<  0CS00S00 0000000H0 3SH L0SP0\ 0 EH0000H00 <  0CS00S00 0000000H0 3SH L0SP0\ 0 EH0000H00 <  0CS00S00 00000008<@tx ilTXH0 P \K #R HL RP\ A Q EH 0 H 00  000408d@aHL@tx) 3lTXH0  \o #RHL RP \ f]EH 0   H0 c \ #RHL RP \ BEH 0   H0 , BR  R 0  00040H0 3SH L0SP0\ 0 EH0000H00 <  0CS00S00 0000000, B R  R 0  00040HP<00@0004D 0 043n@P AU( D4 000CS040 8  "@P8  @H`pP U8080<00S0T0SpV ,003 3 00 0@P,0T`0K?o 2R0S@  00@`\ #RHL RP \ eDH 0   H0 , BR  R 0  00040fH0 3SH L0SP0\ 0 8DH0000H00 <  0CS00S00 0000000:R 3SH L0SP0\ 0 DH0000H00 <  0CS00S00L! 00 0000,1000 08@p 1B`HP0s0 ?@cD4 P000Cg S040 8  %@P8  @G0@?Sp`@GH@虁b^ؙ]ܙMbԙp `D 40 0 0C R 4  8 @P8 @|G00 P0@PP0UT`2 D4 000CS040 8  ж@P8  @WGp`BWP D4 000CSST 4 T  z@PWX 0 0```q@P``@U D4 P000CS040 8  ጶP8  @G@jp`02 0R $4D 40 00CS040 8   hP8`d hX' SR0 0$00S#YX8IoD4 L000CS040 8 4 D2P8 PP 04 0DLPLZ㜀 $0SY P00X0?o2` PP @FP0%'T V [  tЍ XZLO-p M0`ҁ0 00SB$ @hA3 1 H`P媣 0 081   E"   E$EVP  0P 0P3 00 P" [ 3 000 0IVPP PU 003 00 0H@Ѝ000zS0P婼$᲻^^f]G-P `Mp2PL0S@ (P 0L003 P@( 0U&2sЍH0S0 RP@AP @ P0SH0S300 30 CS 8:8+^G-`@0 S_Tp  SXǹPڜ0H0S0S 0 P@1 3 00000 00 0 P UU0S 00   T 0S 0ᯀTT ˻ ޻ܻЍ0 PỻO-0pdMA@dЍ%`000D $0۳8 P@@8@# #RQH LQ\P ATL0S0P0\ 0  0CS@T, BTzL $8♵@P D800008$00$000$0000DA AD1(L80V 3S HL0SP \0  B R @800 80$ $ 00 0 $0 0(0400 00 002@P ]A4( 地000CS0(0 ,  PP,  0oD@B0,2 0R `54 (0 00CS0(0 ,   ³PP,;`P T`6X3P@D`.'SR0000HS#VU8``Foob4( 40)l"0<  'Px0q d\%<3R=Sd0#S\$0( 嵏0 $0 (塊 RP$0 00 S21 00S  0IB˱ Q!lP   lP P@@ 00,, PE000  x cP_oQeP?$00P40S 00 勊4000P0x RH0x0T3S !!!$0$  ?00 1>  00C 040S4L3,0A`0 : S 0003#0 #L#32024P tt0rt0$0<Ѝ(0 (0 0"t0P s4P sTU T]^^@-003!z?` 0 Ѝ^0@-qPM:Ѝ0@@80@ 3P@z?00`0 Ѝ0^C-M8`0@XP:@DŔ  8TAVp pϬQ @$ @P@ `8Ĕ< Rd`Ѝ^7^U^O-,M 0%!@ 0gPP``uc\%1R=Slc \1R\0 嵟 Op1>0S100! 0 $r=$SP 01000W 00p50 00Tp4$04L3 $2   :  S 00C03#0S #L#320C2T3S! !,ЍOTU _^ ]^O-]O-TM|00@ 00sc000P40`0x Cs cq6rc4D $`<0p@$!c 0 m`pVp0 00000P T2 ( 00 00 0 00tt0"VT0,0 0S  ?8p, 00`2@0(0C$0L3T 2 0$QS8$0<4Q4 0000400S S<0SD@$! 0  $ 4P`pd7` 000 0p40P0`0080S 00S" 0 0 0 $0 0Rh  h    $  0 0000S! T0H C)C) c1<62 8<0"kH00( C0H0F H0 ,  H0 00S@;H00000 00lPW TЍ08S@ 0<0 ?D0 0 0/0S 0/<S X0T0(0P  7Ϡ "\Ŗ %\    0 T0/ LL    )pL)l .300^33 0^ ?001>,00  ,0 $00C$04 0S4 L3@0 @ LP .h(!b  $  iH000$ ~H0 H0 , DH0 00S  00S  O00R<0D@$0C!d 0 L~$ 40`R0A00S x 2006@4X"G, 0S Hg^(^J]^8MTU T^P^%^R^O-p`0P4M 0 ?~0@00 !0\%0$01R 00@ ``&!! X0 00<P@? j4*!, ZS QS:jP ,l 00\ Ó\ vg4Ѝ $0 R  X   !,gTX]U O-P0@Ḡ $M}0\ `#,^ 00 0T ? A)A<)a>21,, X:@ 0@PjP l 00Q Q g $ЍH  0 0 PgTi]^U O-PḰ@ 0$MG}0\Ŕ00`0!\   ?  ?` a2! Q,S QS1, X:@ 0@P8 1jP l 00Q Q f $ЍH  0 0 P+gTv]^U C-`PḀ@p 0M| 0\Žß0.S\! 00 Q    ` a 00T40 1<0&$40 `001`0 0p0$0d0 01010000 $P 0 PUP0s40\pdT80< L31)l< QR>QR!<`0d 0001 P gf40P 1`dP<040 pL `l\0<726, @ P0Hd6:0000@ (0 00hP0d0(nT0(d C)CR)0c\1S"8 QR!<`0d 000100T<0 &"40 `0010 0Ap0$0101 0 "p `@ H0PP0805@U50P%P0L05P000T40 `001 0 0p00101 0 0PPfd001Pp 0 0T0 C)C)ct00<21 ( 0cP0 c0S C\1^1 U  U `  Rc ` < #.36,P Y*85@%00L 0404 00R  Q RH 00T~\%40 R  !!p0p01@ @ 0 0Pp0$01 0101000040 0@0 0*PP <0 B2 b061")(!጖''0001S 1' e X0P 0 PL< l52>p, ᇱV Q0:1S 000000 0(gMb8U@e8 L0PP`P`U1S 00P000T\% 0 R qq p0@01 0 0@-p0$01 01 01 0` 0Pp@Pu''000Q0805@U50P%P0L05P000T0 p001 0 0p00101 0 0PPJ1S 01Pp 0 0T0 C)C)ct00<21 ( 0El0000 0(*P(l00Cl00 01 0g00Tx1 P  0 p001 PH000 0 0 LPPx0gd000 000g0T0 C)C) c1062 *(PPddPP0 0ap0T000400`0  0 F Ϭ 0f2fubd000 00 00  0OPd0+ abpG?o< 2R0S R&0 T 000`p<0嘐l0Xyd  0 ` 2( $Pdvara< 0(bd0000000%FdP p;H0p`d10 `b040E" 000 00;R.1S0!0Y3 P0 c0S C\1^1 U  U `  Rf ` 4 #.36,P \*85@%00L p00W00W0SN 00T\%0Ra !<  (001@  0P 0p0$01 01010000<0 0@0p0 0P~P 40 P B2 b061b 0`` 00( 0p !0001S P 1 a X0P 0 PB2 b50>" pPG Q0 :1S1 !< ^8U@e8 L0PP`P`U00T\%0 R qq(0@01 0 0@Gp0$01 01 01 0` 0Pp@:P0p Q0@558 50P%P0L05P000TT0 (001 0 0p00101 0 0PbP1S 01Pp 0 0T0 C)C)ct00<21 ( 0l0000 0(u'Pl00Cl00 01Sb00T1 P  0 p001 P@000 0 0 HPPx0d000 000p`0T0x` C)C)ct02160" *(PPd`PP0 0a0T00|0400`8P<0d000000(0!0  0 F Ϭ 0f2f3_d000 00 00  0 Pd0) _pG?o8 2R0S R$T0 000`p80嘐l0Xd  0 ` 2( Pd6^2^8 0(bd0000000%FaPd0H 00d^|040n 000?N00cTO-@Pᢅp(,`PT: [0 S0S #PZ@V 0000000@@000@ @O-需TMpP0S@TЍ@PUPTPU z"衒( 0  (04 0D \ 0S,0@0H*: 00@0地<0 08000  R0%0%d*@|P# `2P P\SQQS8$0`AV`!QI ӈ@  1/@PE$0  00V$ 0s$@80< \0/\ \00 U0 P0P \0 @A!$ a5.QϠS =0P000 PEUP0 _o@RTP$]U000@@T9  @ ZQ ;Ã9ˁ0T @0 R 0@PPEUPPPP;8%P@5PL0PAO-p|M00-P `븰[ 000P|Ѝ0 00\@000S/ :0 80P0X00 \00&2T 00PT@h@p0l 000<0h0@S < `\P/ d U$4$Q4 P@P \U lP n9Π ^RQR.L N @n 18E \H(@@NUO@&0@( ,,00 IY!$? Z40 0$Zů $00:@  $ _PU@7 _\0@0(@@@ @L @ Q  N. n*< Π U 0 D   L @   D  H  $ @H_( LP@% 0@D TTw 0,0 X PU@m\V 0080\0000!Pi0   R  R*4 R @-a^000S -/0   R Q   -//@-P`00S-@! < 八@P@P 0@0 0 P]@ 0S R 冀@ ЍpO-P$M`00S 00CS 00S  R 000@mY0   P A> a2<! R0:0 7@P 0ST 0S@Pu@PL 0pI@p p G pp@ =뼰0@0 0  Cp 00 @W  A K&@K0P L" l1. Q*1  S0 S 0 S00@$Ѝ 0p@ 0 嵂 p᱂  嫂  q  @P   z  zq弰帀  @-@@A-P@00S= 00CS9< 刪PP0Sk@p?oV20#S 00W: 0R R 0000@0` R p@@-A-P`00SE 00SC 00A0 <@P 0S 0S@Ѝx@PTp Q뼀 0@0 0 Wpa ]@ @ A H8HpP ЍAp-@@@O-dM(00p400$00 0080@0000Q.40S$005 0 4$|p8H\0`0P00 00 P (0 P6\0 44#T20T20$ ;60 0Rڼit ?0:# 4080$0H0(#00\1X@P\@P \YdЍ\0000S00$00?@D0@0S@@T @ 0\00 0堄800t RY\oZ0 @0S 00004L0?tPP0(0`E 0/#\00000,< 1P(080< SH007D0 R00S 00S`0 1`0 0 400$0C0 0o T0 C)Cba)0c9c00, `Pg  R !00 R(  ) 080S03 S300S P" 00 00m00S01 0( A0L 0 0P 0 ,0 0,000 000<0`V0<0(00C(0~S 0 00T0C00 T0 C)C) c0<;2 , 00PPT 0U0T0S 0S P0 _o$0R_P@0S \YUS^@-`Pp!0MV @ pC0 W p0 P  $0 Q D 0  0V `0 P ( ,0 Q @ @0D 0 @0D 0  U P0 P 0 40 Q$ H 0, 00:00Ѝ    O-`0Mpp@P0 s00Su 0@ 00@`p\%1R,5S0 0 0 n0 o."\哞T1`Z 0 ?  Ϡ ,2 0 `x 0mn`0 C c00T0 ` C)Cba0)0c"03m[P0000x 0`0Fn\0\%R ,тW XЍ0 aX TTO-]M 0 0$0@ C0CSR ]ߍ0S1  ;100P`S00|hp 0\5pSB\\?@5D0L 04; pW SØ,.1  0 Su0R: pSWk00S(pn 0)PY 0000 0 Df8(\$Q?00 \0#[&/ 0[& 0 0 0 0Pr  P$P$8ŕ0 @L (Q`Y!0800<00PS 0F)R 0V:0 0 $00 01 $0加S 0 0kP0$ c2# S,P!Q  RQIp S1Q\Q\3PR= $08u< p 0 H0pß $0YW/  0210$0  W 00 $ 0Q P 10$ 0X #H0P$ p  ~p. ? 00 S100 0! P 0u0S @0 000 0R    0娈00 0/SP0 c0 SRQR3000Z,00004000 ZP t0T RX  R?&4D00\h p BW, W pq0S*0p ,Y ! !X4@X Y   !0 C 0[00 0 0pQt1(( R@ 0pPi1XXϠ R$0 0 0p0 0R$       0 0000*y0P0[0 S0&t 0( 0Sp0 0St0Sx0|\% 0R  P ! P01@ # 0@0H  p 0T0 C)C )0c8Ì"h0 30P(0@0S" 00 0 00 0S(0 01H0DL0H0LpW* p,0S40 0,04 rs \%5R,00 0!!0 ,0 S400 P00 L ᜐ pl̠: S?:0p000000S00000 00,0 S400 P00 A1ᜐ a8:<P0%:00S-j8%$"6600Q 00Si 0_P 0 b R320 QP1Q SQ ☐ pBᜠ b<  YS:0 B z'z b~3p2z0W p11$0 吓S 0  0H0$p5 5C20000 0G00)=0 p 0~pY 0X%0'00 0P 0 S100 0P 8@ŕ L     1ptpt1p@0S(0#S [ 0(0$ 0历$0(80 0<080 H0<00 0R8   < < L   0 Rh  Bh    R  000c\%P0R !0 !08 P L@ l0 ^85@50%00L508Q Q0(090 0S 0 01H0L0H0LpW8up@5pL0p85@00L0T'^N^pGWm8Q Q0(0 TS1 p?H0L0H0LQ 0 R !/P !!0/00S1/P11/@-PM`0pP B2> b<1^Î0"7@P 000 K~9ST@ЍQG-p0 `$PR@000 0$0` B2 b>6<bT H B)B<>) b62l@`8`D0<000 "000妀wQPU@-`00pdPUK@ 0 Up@ T = Ѝ9T80< @31)` Q0R 0008<Ĕ?eP0 C c00 0 ∛P `2 0#0X  0 h 0S000 0`,``000l008 1$01B0I> 0008<Ĕ?dP0 C c0 ,$0FP `V0L"ϫ0 0 40h00000R^^^^^DMG-p0`@8 PU 000oW Gh R 00 0h Rh-9S000SNDMO-P0@`H00/85L0<%0/@5D%014%0Q0Q 455405S944S@04TO- ,MRPr p$`W0@: ,0W0:F,Ѝ\0Q.0] 08T @)@)`"30JPd 00\ Ó\ GxG0哸+0[0: 0 TU p0Sp/0@-@0M 0@0@ @@@B|P|0 0@0@ @@@4L0 00@@ @@@ ' Ѝ0@Tn^Du^~^8 p00CSp0/@- @ 圞嚞@藞TD@-0 R  @ @0b ` 0qЍЀ-M TzPpoЍ^O-0,M G P000 jpƝW PPP@?n /h+p+ 0 $+4?JP   0q % ! % F\%0R004\5 P   ,Ѝtl4RR  h0 S 0R$%$5R, ,0R`FL3 L3P3 P3H3H3=0T3T3jq  Ὁ000k0P0<(%0 0R@0@0 0T`0$ZS> ) %> 1S 0DD@30Vc0P4T$0X4S E>0X4t#40`AVL V$5S0P=$5bt $]b`P PGP/ J80HL0S40pH0pՓT0 C)C)0c"03pIPO  0p  E80`$%!0, R0 h0PPl \0\ἠ_<#| YP  0 ?<#Ή p 0Px 0\`0 C c00T0P C)CRQ 0)0c03"IPP ἉP$a"  Eᬉe]]^8 TT^^^^0O-PRp@0[Y@ %   ' 0S> ) %> 1S0T$0P40X4S E>0X4h04 SD0400P008T0<P C)C44)0c03"H0P440$ R:D4 5Ҡ  0 Z00C?o200004圀AeT$%,0R00彇L0Yh$5S0Pœ, H[4lS944S@040T3 0P1Zb110 1<(%0 0R@0@00P :>0 $  * MPg 0L0倇0T h0y04P 0DUp P h$c00c000,20V'0700080 H0S0L0 C40œ T0 C)C4)0c03"gG0P4 0,0n,04 C,04080f$%0 , Rg 0`p0(0 0t0D0t 0b0?o0cH0T0 0CL08048P0凸Z 0 <Ѝ\4S  5  0t |000V`0 0\* _@dbh]8 TT 8T^^^^^@-0S0iP@  `@0T  Ѝ 070@T _^070 c`0u/PpY0Y VT<C^;_kˁ^^貁A-P00`SP p_@P _@PH\0  弘`@ЍDC-@p3$M/P++  h0$+4`P6T0h 0m.0 51 50@0\%R=S04, 030304040 50m0" " 200(0\5WC`$Ѝ@T8 O-,M@40ARp PL30U/o[" R ,Ѝ80HL0S40`G0`ՓT0 C)C$ `)0c"036P$ 0om0$000S@C8 P@G-pMR R`@A ZP   hPV!P4 S]PP0 RPq0CmP V 0S 0 0R\h}V 0\P 0]N0 P@0&00 0PU:040000 0iPP,V,`P``) +PؘU0 g0PUp`{   庘 Kp`=S0 Po04=S:0 0S0SNP(0 aPPP 0 0S 50ó 5y=S  0  PP Ѝ0 5< 0L!L000V81 000C?o20000\4S Pu/V8 5 0 5=S# UTPH=S 0 1C>00z|0SUTƜ010hPVPT]^^^^2^A-@`L1pPP 000' pPB=TSEP 0 <=50S 㹵= S/$%0,RL1#h P V000:0O-P@`=$MS =S  +\T㠡T00p@0 \P9\T 00T RdXX T  PpfTx=S+ 000CnP$Ѝ ᙉ P ᜄT 0P{ p 0   ꘿]n^Mp@-@  # Tp  Q000P05/M-@Mp#Ф!0P  ` 000X S%*9  0000'0ᄓP 9 ;909  000&00PqP 9 ;90[ 0 }00p!1/ 0  J0S 0  Ѝ0Z } W0 0 00ЍM/O-0\M0(0 0 0 ) 0% 0 000 ) S RQ0Sd0$0$ 00 0 ^0X:$0S$> 00嘠 =4000H 圐  0800Z08@0 @0<5 L <$ ` V p ࠱pZDppHpDP ``:` pPkYgQ VYp,pp8 p` P<nj pQ^njQ^,P V- p  0`p W V%  0q80 V 0(00 0 0P40S +#H0 .`np`` ? 0:P00S P0S 0)/ 0p0`085< `F V`!V"40S #H08<Ř  Ÿ   . ?\xD HLW  < W Q  #&&  "00`0,00,000"R0 0 00TqTQQ80@ 0(00 ?P;H0 C2 00000 0&",R0 0 00p[@0Sh0'C( 0C8RP] t000 #8 '(80(0PK $00(0 +\Ѝ0( 0 8 @  1/[!p@- @P߭ Pp0p@0@-@Pp9S ʰ;S  0"!`PQ 0 SL0L0Ǖ᫧0P0@ 0 幕 ЍLPHO-pLMP4  P3s:Pp R00`5M:eP @`> $ PS!QS0 @ @`98E R@(@@D@\ @@Q:0@(,,0N X !$[0$ [ $ D:8@%AP80' @DXT $@0,0 $|bY8 =080[ 0 0 0 \$  0 $ R0 8P = 43LЍ(@@@ @L@ Y @  `9 \*(L @ 8 <@@<@O-@P `R0 pM0 ЍO> 0 P0?:P= 0 6S ЍO0\0:  ЍO㠰0 00S Y  0) R 0P0 1R H0C200 00 0A% P ЍO-需,0 0/\*0 ,\0 0 ) n,0 V00P `0 B2>@ b6<bP0:0`40 00`FV` Pa@P 4q<" 0 @P4<Ѝ8e@5``L0`(04S =oobT`V 00 0S:<@-P`b@P0 0@P   0 00Pn0 PЍpvdC-0 P0`\M0 0 0S  \ЍC0 ?mR p p 0 00000.0>000 k@P9 W000 04@P, 0S) 0 @@T0S3 00S00a@P  0  0@3 100ڐ\Ѝ2 9pP 0   0,09@zǀvdA-@P0@P l20 p\4SQ^Sl4L@ ^`P @Dő L0 ? 8<őH 0 ?00@-i ^`R`    O-Mⴀpᜰ0X@P尐`00  0000`0@ 0 T 0X*Y   R  L \ B Pb<P" P VU Y PP\H 0  BUP$7#L A1 a<20! 00000P Cp R 01!01/P 0R0*@0 @!0L A1 a<20!  U@PY<  0Pw0 \000X0,00A0 0P00S<0 00$00 0(0( $0WT UcY000 &R00S P0Y0uL0 C# c 9!300 m0 6Sn 04 UD0 000000$ 00(0$:PP 0 =$05L0 C c#3800 9!600< 0S2#T20T25P $97 Ѝ`)(0$ h54Da40SU %7!700 Q00 R, Y   R 0@ D0T00 S 00!1 001/P00C0000Q0@p00 R ,  R0@ D0T00 S0 1 A1/P 0@p00  X  R@ @ CP R ' '1/P 0000ǀ@-0S    P (000 00 0 <ЍN p@-0@00P`06/ 000`06/P z00pO-PLMt0pp,00@ 0S 00,00 0"R 8 01/0eÿ `"80<n0>`0E&0S R #6:RAƠ 0401$0fyPEP0W(0,0ů _ޟt1 000040 0 0kpP ՟$DyLЍ0x 0 | P ( 01/P῟0@ 0 p 01/H4QkO0pUp(6*C/Q @ ?QD   00ã 0PPMMM\C-@p`P(圀0 0001/P#P)SR Ѝ@- 0\ \ 00 0 00 ЍA-Pp@` M9S% 9S0 0 R( 0)9+ 00000 0000 8/9 ?o209S(0 0R  RVoBh 0! dd0`ÐLP奒 hQ Ѝ!]c_X^@-0,@00V@"4/ЍgTnT_0@-@0@000@@PD @DPPP0 0 P: 08S00P0000_____p@-@`P(0P0  _ P b\K000@09#60pO-P@p0KM 0`@`0U0:KߍP1 00P0 0 >0!Q \0:V&0'0S(.^S(,0S ^ P\)0.SP PO-P10DMp @0! 0w 01 0w 0d0 8 "1/ d:41 TU2Q D$ d( /UTI, Q$ 8( 3$ \<,V  R 00PPV! 400p0A 0000000 7@P0 h 40R 0 h`F ` l 0Jw GwDЍ@O- p`0MP$00$ 00@0000D000 t0SP @"D0900 00 0KS@$00|00000 9P |0S080$0@OoB@ЍPM@`00 0`0|0S0800`0007X000C?o270L00000L0000[00CT0T R ?R5:0X80@040X0  <00 @0C0?d00?\00\0I0H00,008#8@0 0h0X0H S80S0X0T0 H00(80TX <0t@P t [XT0 P B30X t00?@Pq0 00(0t0(P0000ഐYg & R   0 P 0\  R Rj 4 R      IRLXP^P`z( ( (L R  A, T R? 4 R  R8 l0#dPl014 RB  R?\0XH800,0tP 2`0Sw [08S 0$00 ?:d$X 0h0@0 C 0)X @<  X 0S (<  ,  8 R\0;04 XR@@)@@@@R0*#f @圐 0R@ @000Px2X0[00SW 0 cX00T0 0 儀0"XQvx`$0x000 9{00S6 9S3 D0  徆P@0S 0d \0H0L@X9H@Piᔆ[0 @<0@J,0,@0X[Q@T[=00S X0  <  C 0L 儀0"XQNvx` xpg@P9  0 0ᕝ 0`p`P @v! x0w@Px0$ 0@X0[00Sf D0  @P@ 0 儀0"XQ@  x0`w@Px0$ 0 x0Rw@PH00SR@_ _@A-Mp@ `0- 0?PP$ 0 T 9 0C8C890000W0TP00 0 9S00003/Ѝ0 B?PP 0R    A-Mp`0@8PP$0  @@  9 0C8C890000 0H P000 9S00003/ЍO-,M00Pp`0 0 00 P *0 P0 000000 00$00 ?}@Pm@00$0@T  R@@@@@`ᴰK [00S S%  bP[ᴀǑ"$$: @ `@ T@ 0P@@@@@B [0[ᴀǑ@Ƒ`0S 4"40 [ v0@P00 R ?R *  1/,Ѝ]_'_O- ,M@RP0Sp0 P刐`0I $$؍0  ?1/P6 0 00P 00000)b@ 4"400 00C0 0   ![ @W0 00`06/T,Ѝ ,ЍO]3_-DMLH ,  0^DЍ]@-0"EP Ѝ@-0 \ 0 00\岗ЍA- MP8@<`P^0yᨀPPP)0P p@`婗 Ѝ 0 @-)@0ڗ Ѝ@- @ 0  0)0 Ѝs@-`@0 0JPPPP wL0 00 ЍpO-_@-@0Fw 0 0O-LM`p@PYJr` (0, 0C0r @p0P@$00 0 `0 PP00@BCZ 4 S 0< "QP᱄PqLЍ $0(isPqU $vPP$@ q0S qP 0 0qP..妓\8N/@-@ 0 $01/P 00Ѝ7@-P 0 0s@Pv@P q00 Ѝ0-/0@-@MP0  $ 1/P PF Ѝ0 ^ 0Q ^00sq F@-P 0S 08 00 000 B (0ЍHT_t/ 00CS0/0堄HtP@- P O-M000@`00 pGsPP8vPP0 :qЍ 0@0)000Q 9  h1P1 00*00)0 PUP 00 0 00Qd0X0 000P05/PP  B  0  P`2P `U000 !40 90000p]t7@- 0@ 00L jPP0h Ѝ07@- 0" 00L Y@P000 000Q Ѝ00  0/ @o/p@-@)nPڈ000P0 5/pC- !0PM R`p0 R0R0 5 0/S@P( 0S2 I00@> ʠ,ʠ`@*0  @R  @ Ѝ@P@$A-`@0P00p0 7/"!""9:#:0900 000"" 0 0CR=S0  0(0 000/< 8000@000/L H000P00 0/\ X00 $0`00&0p00h0+40 0x00|00S; S8000000$)S 00'(0"#0D0@00"$0@0P00#%0H0`00#&0L0p0 0 $+O-PM0SP0sM!srI"srE00sB(sr>0s;x0s8|p q`0$E @100&0! DLQ# 0 K#͖0 0 p~@PX0|0#880'00 Rd0X00$00|0 *P\P=3Ѝ z0s8 0@@z 0 { J@*0 pc~@P 嬰0 Rt 娠0 Rp000*P\P2"sr AQ@e@P#sr` $sr&srxG@00w0FG 0 @@ 0 p~@Pm#sr 00000$sr 0   00hl rq 00S08< 0p L 00H 80@04/@P <0010 P *y00)0 p}@P# 9  :(090*P\PV2-@@@@]A-`p0S t 0d0 0 0P0 Lc@P90V1nЍ@nO-` 0M0sPR@X1)RP##G*D1 0PA@0 0K}PPP79 08C890 000000p07/P =p 0 L- [[ P ) B(B()    zU $ ЍtC-` @PpTLp T, T4000S-@ Ѝ贀 @00@ WT   b? 00 0P @   070 @廆t[_O-30S00000000C0GD  !! !R  !1   0 S  B!800CS0000$00Cs0 DT0HPD0@3A-P$0@S`p000$00Cs0 A6O-P`H@,MD0 P0 0C#& #6&& 0! `0p $0s  }0  BwU  R!$00Cs0,Ѝ 0 ` 0 pB`FW 0K0D$00Cs0  0SH$U0@ s 0R0 B{ $0H sF q  K0 $ 0$  K `F!7  J0S 000D 101PXÕd 10$00Csp  odp  kd  gd  cd0 RS00P0S W Ud0S Od0S IdZ  Dd Y0 U0B$00 0V  !K0U0 00Z  ! K$0!t7U V  !K0W$0j UP  !K$0!Y7 0$pR0 B 0H 0 P 0Q c cc0Is c0 `C0 R ! B!0 0!0 tK  0 !0 0 !eK0 C 0$p 0 0H0`F0D`Y0$0U A-`MP `pP1@0%T00S`Ѝ,0(@0P,0(0,0(0SX , X00(P\0P<1 <(0SX@ @S , , , P0X0S\ , \ 0VP0SPn0! 0 R00R0S"000P0000SH(0X@S, , , 0X0S\ , \ 0UP@3_ 0 !6/ ! !Jp@-PS`@!V 01P 0  0ap0 1 Q000 !  !AR !  B /A-p@P`0 00A0p@-@P`0S00p@S000 p@0{ /-@ $M0 4  *( 0 0 00t$ЍzN#_ @-vP00A-P@T* 0S' 0p; 0S `PpJ@0 L+ 0S 0 ; 000C0U*_ p@-@6 P pP MPp{| PP `rO0 09666KV Gpp3_@-@ PUO0 0p@-@PT+ 0S Q 0`˾00C000 000@p@ Lsv 0 0 0p@6 0S*p@-P@ 0 0 0<6Pp@ 0s/ aR0( $ A\ @-4 00A A"1S@ ^\01,0//O-(0`9p"AR0,0Paq04`0AAbATW" n@P 1@ S0@A 4PQW`p V000 YZ @`W``fV00C00S0S   Fp3O-tMp0圀P@`@, ` ;80 S6 ?}8P 480 `oᩒ tЍ(P,0PU0%VZZ+8 00`0 < 0 8 V 8,0J0 0G8P "SR 0 !W570S G8 0J0 00p7 `$6:00@ 000R  0  0 0f6P:Y% 7  N{Y PM5V 6 !37h0S7 0Jp@0 00`vC_K_|1G-p VZ`'v& TA0$pp P(00@0?o20/ $ AP0# pB"   40qV0X >"(00(0XHZ`$p@p P(p@O`,V0h )m/Y L@/DP @18@AS8 80< <@@(@]34@/0@-`0ML@T LPL   @Aɼ0 0,0 0X0@@kЍ03W_ @-VP@1MO-plM $@6 `@ lЍn @`  t!@N@ S * 0L0"x$ @$F 6 J0 0 06PP6"R0   46l 6Z(`,  [tty ZM44Y4j 0Sឥ(0,#6~X4`__\]_ A-?Pp M     6  %:&p` @$T @0 ЍP 4334 0D0 06O-$MH L $P!AYpZ `4!C20(2>B"  YV[ pf$ЍO'(0 AT  QPP SPUR QP  RQ  R R  0Rm0@P 0 L000 A`P X0P`@ď T0,0PL`@$Ѝ蠠3 0s/p@-@`Mv' [OP1q'<s800`S< < # 婻 5j 0`5PP50  R $0AQ0%4 0T-H^`Ѝp5ᖤ 0 P 2r59(0,#6iC3,o^4_C-Ap @QUV` Ѝ<0@8PU {F "AR0@4 R`001S B XWP Q00P `<ZV U T,0!X00W0S `"V0P `庺U34O-@M ` @VsC f %  ! . R  11  0SI!ۡ4    BR - 00> r$!*ᅝỡ  ( R,,(, 8 R<<< 8 #, R0 4, @, 4 ЍO0 @ |<P 02 1 <2X    0 ,  4 @, X[G- P@t pU `D`(00@0$V0:Pp$01SY0 H0L 0 H0P0L T 0P0 T %R0XP5\p5`P(0p__O-4MX傉 8d娉0:hR 0P?)v%t(0$ 0AT,0@T3 0B!0U QY (@ 0`0DC3f0S   $0D#0* 0尜 $0(0S, , " 80S< < # 0P 02( $ (( P( ,A( $0p1,00S8 80< 0@<00\"S040Q,400400`0 0000000\0$0`09 0 *"*0 # 30 #6: ,00$07 0! 0 0*Eh0 d!/l!0 \    ,  d . 01/pP6 `4Ѝ 0`0DC3fd0 R  R Z \ B,d~2Cx 6>d0$0 6 0/0 彜p,0W & 0h 0 0,00X_X[O- 00S #6:(00  $ (01/#P1 0B!A0S@(06` 0f 0T:0屟<Ѝ0@s 0,  e0J0S Y5 "P0,,10呟_590$0L2P,/$0   0 ᅙ,0,/,/, 0, Z 00 0 0X_0@-,A,Q0  Mo*D[P & <[0,0,  P0 5Q0$( R*0 000p0&P pIu ,#004 ,0  $ 0,,Ѝ0@]QLd]_8#x_0N_/O-pP@4P 0%i6 Ѝ&d6810*ȗ0.J_O-PM8@0pH.0`0 0}+0VŒ 0  `P Y w,j,),, G3P ` 1`Ѝ0S ^,D,j, 0  .(0, #60娛 !6P A,,M,U_O-p00@`0PH"+0 2 00 0吕`P  ,,,, 3P ` A1` Ѝ0S ,+,. [ @6P ++,a_p@-`$0S 0$0P@P   05p 05pO-`P 0M52 p3RL"H"  L"H"U =0@T 0S o@T; 00  0\5 Q, w 0P":+> R [i WQ PC0 0  ; Y HW;p9@!Pa 0U 00  @@`C,@P  6 0&52PK <0 ( 05  Cp`+Y  Ѝ 0 2++*<+ 0D0 0-YU  0DABV  0 4SpMp pm_v__O-`pAM$ P@\)0h0i0j00$0Xp%>0S .82<082$1<0S$10|$1}: R$ R l 7<K<@D0H@T0 @HP J P<< 0"4P@0T  BRT 50 H $@ H@L   P000 <8 x/H$ | XY p X 0h0h R 2˟`A&f, 0V`!0CFA#60CS  00`00\@d`h0YpD 00|0| P0 D=PP0V200C?o20S6 Y 1S Z 0 ) ) * VX P x(0,p0 06?  0 1/Y Q0F\@0C0`00d0 pP0H0(00d`WMZ <0!P0rH@a <#PP |p P0 @0S k0Sl00l0 0SP0XHp0 <P P@q < d< .0`@\`0d`0_X0bcX0P0x0g(0S [00p0W0 `V 0S  <0 aP3P0SL)?)X) 0#2<04(l0[ 0ÃQ 0  ᠒ MP uY i7 0/ O0 X<0Pe Gk0S* 0S'0P 8`t0H 0X<P6 02p00 80<p) P P680  B  X<P 020 Sl0 0Ãl00$PU XZ B 0@ P 0<5/ PPP0P <;x 0"w20P@800 " 0 R002` 81/80S1O E q Gr  Y R; 6(0<0嘕P3*PZ2P0S|(o((0 $,2l0Z0P 0   0 ,0R< 0 0(0T' ,0( Ƒ 0 SZ <0字k0ASTt0CP0@`X Hp,`F( 2<`0 0 P ^ < 3!#L20L2 010 800 8  4  @ 04@1/PPN #UIX3 X0/ 0@t03#H20H2t0S0 1P000v l00l00S k0Sl00l0 P0X<Hp0 P `Pf <& 01x-0@ X<0P000#10yuP<jW``V@ |40x P4'4'4'40 0  V P@ 0DAP@ <t@4 0 0 0'4F'4'T4@T  0'914' 1 R"Pt'('' 0@0 0P0X<Hp0 uPp00 80<bp PZ8`t 0 10 ᦘ0u0XSjزء_]_X____(]C- @ pP)l0 P RSPP P ?,P  P 0@0S ŕ5`P '&'JT03P5:P  Ѝ_p@-@P`b  p@$QG-@ 0S`pPU@# * 0 @P U  ZX 0 xX 0xA-@p@`@P" ΄0 A@x@- .    Ѝ0.   Rp@-P@ 0009p@贝00괝@- 80000  0 ;  cd0ЍP_D 0 eD 0 eD 0 fD / /A-D0Dp0Pc00S@xᔕ0000dA @-,0@ ,0,0t ,0 1,*,*U%& 00S:K%0@ 6, P0T80@-\0CR0h0H0až]C1(@W+0 ]X_0 0@-#@3@-@0SZkP Oy$+0  1$r3PQ덙!H( 8|Q0]C46 : \wЍH_?_O-P$MU p0E0`#*DW`$ЍSZEQE(PEN1@@@TH# p 0 0U 0 00`P 0F?o T20S 0@ TJ3DQ! R2`PE000 pP  Vx4 0S/(0(0 S;3S8#0/t,C-pbDMPA  p101U 00 1 000! P |j 0  0P$P(0PD1P 000  P  0 ! B)1PPp]000P P0:PP00 yP00Pgz0 00x(0x0)0:00 T P_ypDЍtp?hX['%_xZ_h_ TPTEP_̦OA-, N0RǠȠ̌' @N@  0 `p0PP ||j000嶔UOP(0 <00 0 P iЍ]__G-p`0P00@ @@ Ae0 y T0XhG 0 $pP 0 d #E$P$qW I$J`htX[_O-DM@p xT:DЍ!Z`VU3#:E V@P`2$X[@-. .   Ѝp@-N@N@`P@ | p@4  O-@@0,M^$00h10 NP  ^P  $P0$`.00@p5A00pF0Y 0$`0S #+P (0  r$0P 0S  $0`,Ѝ zI q"@0 fjhtX[_O-N@N$M@0`SwPP$p`AfX0巒000  1$0PV ly(`0 P  w$Ѝ H +"@0  zX[_tp@-P`N40@N@ 0| p@{wtX[p@-8PPpy@y0P3#pt@-@P  0, o  0R 2 0,A-p`V@0 0SP%PU! 0B0 0S0S 0  B;  00S 0S0S"U !`FPYP0 _A-Pp`VX+ @$A0S0S"000e""`0 0@X @$Tp@-0Pp0 5"@k"0S 7"t"B"Rp@-@P U Tp p@O-lM(,$0 0Z @p (0TdL0,0P0(0X00PX` P LXl@$0 SV 0 RP0`PX000 00Cd Sd05$0000 S0X00\0d080D0<0H0S  0` 68 4000 R 0F 0H0S ZLX/9Sl `0< IpPe 0@ P 0  Q 0S `0L$ Hs@lЍ-000pD`0 HL P r #RM4 0/x [p 404 J,00,0f@0S `0LHE$0 S@ $ 0CA0S!000_!!@ 0S `} `0R $@Hp0Q L@@`0 ( I @,0DHD0H 1/Pc L`0H (,0 I HD 01/P #Ph2 d0/ vL(WX 1D0 @,D0 0 &X `P 0DA=P LD 0 !D D!D 00 0Y D 0  !Y<Y 0 |D;PsKD00^0 B H@1 0 pP0 pp0p 0!pP 0D00 0  y  0K0@000l0\0 LID%LP T  H'X__䩁 _O-4M$0X0 P\!/@lX0T)X0 `CV6`  $ ?0\0q 0 ,  p 0,`1/P #X% T \n4Ѝc,X Y , !!  !0 / >@X_/;@-$/0 @5]䩁@-`@ 0 ```` PP " 0@0 0b 00 0 0S6!ЍpC-`M 0 ````p @P 4 P!2m"W' 0`0C0@ 0; 0! 0WD0 0tW1 0S1  T 000Ѝ 0; 0pІ 0S:0P//0 R:P3#//p@- P@ဧ00E^p@踧 2_0 @0 7p@- ` H0@SP`B   DD00 $p@3;p(0, 0 (0, $0Sp0Spp@/0C-00p0(`$@ @`<Ѝ O'_dN_G-M 0p` @`1P0 P 00 0 0 `@?o2P0S0S 00S00Ѝ R 0000 0YP ꀾP @-[^P010$0@- P 0@T @,6,\ U@ 0C \0C0060* 0 0Q0P3#0\0R 0B  UL b  00H 0R  S01 R  S0100S/0/-0 0R 1Q 0^ S01^ S01R 10 0  S0p@- 0 P 0@0C0000 S   B ,0Sp@A-Pp`^@P #10H10@0P 0A!&0D$P 00S 3/000L00 @ 0@A-00@SP  Sppp 0X  S```,0X   B ZWW 0 R 00W L XGVV 0 R 00VA8A-@lp`0S #S Pᵥ0S [000p@-P@;P 0S p000p030/@-P w@5-@ $M0 * , 000 00P Z$Ѝ._0A-P`pP @R00 1000000 @ 0@AA-P`poP @40010 000P 0 0 @ 0@A-00\ ^^00S Q : Q*0000G- P`(PЍ@p0S 0X  0S0S$0SH0SV $ 0T`0  00 J0 `000V Y ,0pGp00000@l `0T00T0000C0 00 O-$M 00@`pVPX\0@p` @$Ѝ< R:0[0*=) 0K& WHk8W R@W@% 0 0 CR:0CS`1`! 0 @p`p P 3  0/P0 SW0@@@`S@ 0 0S:0CS:0 @0 0 @psp P W 00 S0 `V 0S %@# : 0W 0Q:T  Q*Q%*Q Q@!PR*Q \:`PT \Q*Q Q*@ RR#Q W 0CR00R: 0 `pp: Pc 0S:W@?0BT. W 00 00C0@ 0pp Pp 0S*W00W @0S  R*0S*W00@0W 00 00C0@ 0pp PF 0 00CS0!0 0@pp P4 W00 T@@ @T@@%PvQw*Wq WO- 5;@00CS@0Y pA-P@pUPP0` 000 PP00`V D#&R  p@0S 1 PU000pЍ4 R @ R  00B W $6SV X130PPV40S @0S00 80$0S0 0 0@00@0 P@0S P080 dpP 04 R@  B@  0VP`U40S @00CS@0  `HO-P@4M0`<0UP!@0, T@1T@!Ptp4Ѝ,` 0 Upt230c0 000C0Uv0  TpQ @ R Kp U 0 R H$Z 0  0 U01 C00 0C00[ C$& U1Y ( ,p  0Qp   D @J0@@ 1/p @ `D $ 0P P  $R  0S0S 0S   M 0 S K\P 0 0  BR @-` Pp6P@0P  Ѝ\ 0S400@ T:p@-@P0!30000p3O-Hp Wp1 @00 P$ 00S` A0BpP00S  P0 'n H R  R0 R1 1 "$ R44 Q88 Q<< Q22 Q@@ QZL ( ,(  R,Q RsXH ? QXH0 Q Q0 Q1 "$ R44 Q88 Q<< Q22 Q@@ QZJ ( ,(, Q RXI @QX5H RX  P*Z   R 2/"" 0 00U000U0000C0 00 wX D0D0H0H000000p ЍXXX  P>Z   R 2/  U   U    B    AX D D H H 0  0 pA-@lpP`f$00LP0PP@@P  g@008ЍU 8@-00Aʌ .  oЍ@-@x]/P0s0 0020P0S R 3/0`S \P< @ 0 P z NV6QЍp@>Ѝp耾O-M Q@ 0| ЍOQ 0QSp-0ISP#X*WZ 0P UPQ #Y PK3 00 0PP@04⇨0P04 vWp  J>0P`ph@00(0(0V,S4s0s 00,0S` Y 01 0!W@T # 2RW 0P0S  >PЍ pWg 0 0CRb00l"hD$0Z00l $P" 0000H00SU4 C08 !2O, Q ,0P S""D00<00+!D%"D%!D$0 00 0dh00\`0"%D@0L D0<0<,020@0400808004000>/L 00C100L0 @  0L0 ! 0L00 00FN `@` r0 S0 S00P0$00 0 0H00  FQ 00SP3_ !0P0P `@IPZ0sU P3h(]]@]@-@pP`MR  0p?n P Ѝ@/ЍG-0@P0`Sp0S 00S R 3/000嬁 <@  < 0 0070SX@`@@Щ$@ 0@00@(0 B0 2@@ R"` 0p0?U0 0S?#03@, 03030300ߍHhʁC-MP@P`` p0  N P寓H1 R*Q, @! 0L CT04 ,  0000<0@0D0H008  00000000^Ѝ1L0 ^ ^ N^ ȠLȠ^ !P0202 $00P210221SQH0a/Q/0S //C-Mp0@`00 0` P+0 P 00 000 0P?o2P0SdQ P0 04?2c0ЍQ0 a/Q00@-0>00G, R0" R:<0Sb^ 0 B 10^ 1300,0堰0#3[ I: 0$ S80@4600 0 0 KP Y 0 03/:#:SSX  0 . 0D %6SP0S 0P 46S[0 x00 0Po 0 iX[H0ʠ,ʠ 0C00S >0 0>00@<0 # 3P 3 Q0!03S/O-@$M:#:S0>0>0 T*!`#600 0  PP   [P$ P 0 0$Ѝ R* P R: R ! 0 $p  TR 0T :0 0000Q R:^J`H[ UW P0W00[! 0! 0 (,0 D 0P6J` 0T:W 儸[ 倸 DD@P QP]O-LM$ 0qP,04 0LЍ   P@D @\ 03:N@ @@v 0C,00 #@3 S:<0S03:QT0P`0 008040 { OP 0 0(0S 00 0<00800400 0 @00P0C-0$M@؄SP`p0 0Lp@07/p ` P ,0 `00000 p00s$Ѝ@-0@SP`p0$M0 0Lp@07/L0, `  0 0  0 0O$ЍO-,MP\  `P0Tp@000:X#:SQQB,  R Y :< R ,ЍZ P I   RPZ (0$080$000 GP'Z0 ! 0L @0:/ 0   P 0U 1 !00 P0 hUh*P}$ PG $ 0UV 0RR$0SOH0SL4YI00[E 0UB$P ( , 0\0R !  R 02/ $$(,0 00 0001001040408080<0<020@ 20jY ZX 00 0TZd t  0SXZ   R0OK 0S]X[0IXU E0 P0'X0p@-`MPD@T@ HΌ00 .   `P@@ЍpRp@-@`P 0D00 Pp@p@-P@3U 巵p@p@-P@P T@@pG-`@P $e T0G趴 0pM YJPO-tM@$0$0圀@T` E0 $$FJ0H0呴p T 000@  ,00 000 000,00 0 1/pP  $0tЍ Pp,0Q P,Q,0,0@TÏ6 ÿQ Q00   "0P000P07` ۳0S P   p_  @-" "&*C6P Ѝ@-" "&*C6 Ѝ@-" "&*C6 Ѝ@-" "&*C6kP Ѝ@-" "&*C6j Ѝ@-" "&*C6v ЍO-A11 0R tqs\0\ ,R 0 (R 0!L P ᇌ` Ѝ P @`V2 QE A00S00S  R 0  b\T PP\ /P101101@@@Uꄡ5HG-` Pp7P |0   ( $ ( $Ѝ@0 @@0 pP@ T@ T 0p@- @P!  ` 0( 0S‹H0;H00 P0R=P  0.b  0+^  0< 0000p(] 0p@- @P!  ` 0( 0S咋H0;H0/ʋ X0R P 0.2  0+. 00C0 0< 00 0p(]7@-""&*C6@PP 0 Ѝ0 0!< 04 0 (   !/Hhl\ P/0 !8 00 (  , !/Hhlp@-@P@"T@Pp5p@-@P@VT@Pp5O- s@0PSDM@0S^ D0S@Z b10  B0S#0 0=.`0@`F`0`0@00-0S @0U%DЍO%. ?@@D @00r@P j0 Q"0p`0[) 1 pW1 @  P T -DЍP 000  00Y+ RQ3 . R!: R*  @0>."    !P@@ 0 ATQQ@E   H0ġ_@-T R*0B 00 (GR0\ H_A-`Pp@P @P0SPD0S TG P  &P脡=_A-$aP0AS s0!>00000000 81Pn 6810`U 0CS*MG뤀p0WssW000N@N@W\0qЍP< 0 mJꐾHh__X[_O-B2 ApP LD P⎉U@@GpGG`@NP$Q(@少!T@0D 00`@061@A0@e0C@@@ s0 ᄠ0S 0QPDP`E3@0   S0P    @P 0>0000000x (0D0 , ` `F H뛦*@7_HB}0/p@-`P@M,0`P @ p0@ꄡp@-PU@Fp@x0@QX00 1Ġ  S0 Rp@mFL_H _ M @- 0pt0Shʁs@-P@ ` `"""&*C69 00#  0+0 0Ѝp@A-@ PP` ""&*C6! U`" 0pᆈ P(,`0p S 0: ` S 0; 0᱈`P k᥈(]@]@-@`P0p[0:0崯0 p Ѝ0 /@-@K0:00M0 Ѝ/"&*C60S/P 0S/T 00CS0/@-@<`@-@U P@F @-0@S000`0S/@-@= P@2 0Pp@-0@0P*p@@-0@ R0 @*00'@ A-@ P ""&*C6l0S7 0Շ P , 0; 00  0:0 08$0 00S) 0SA0S 0 00C0 @ 0 ; 0(0W 0 00 0S0SPU 0┇P `V' 0S 0x0U 0  :0V281` 0 >>⣂R P A 0S 0 `(0` 0p 0s1QR9 0 6 &! R  010@ 0"61@ 0"601008 00000i`5HO-M 0DP @@pH뤲2 a  00"603S P0 PYYHP T|DY  : PY ,"($($ W     " "| 0׆0W @(0 0p,0<  0+ $ X  Zg0L PY 0 P0 PE ЍP  0,P0SX  R * |R + 0`὆  P w ᱆ Ho_(]@]A-Pp`VUAA0Ds 0 0 0P 0P( 0  0 0b`0 00BIPp@-0@ RP0 r@00 R kTpP00b00^TUpp@@-@@gp@-@P0p@f@-  @-  @ @- 0S Q P0Sp@- 0P p @nP T  0Rp@pp(]000 //000/ S0/000/G-@0 P0LS#%p"&A6 ppYl`Q ` p*6/P0U00000Ѝ pY`Q`*6/ZZZZ@-@QPЍ@Ѝ /A- @@Q pPW`/ Q 000  0 +P(P0@/@! R!/! !A]T xP 00S 3/Vpnp@- 00S@ SP` Q @p[nYn@@-|@|p0 S 0R``&0!000P0Q &0( Ѝ0Hx0@-@t0tM@@@0 @2LP @τ @4P00S 3/@TЍ0蘾x080]O-ph1,M`\1PLL1H! 0006001 Z,A   0 00 0 $$P Z嘄 0S 0 -0 0Ʉ0 6$0$pU0k$,Ѝ dz0X 00L ^0 ShPEzHD08__@-PfMh0@k0 06S L0 0KЍ@胄p{p 0 hP9 0S  p60p P PЍX[0H8O-P0M  R0 Q @K `p0Z00 0Z$[ T{ WЍU Z `@ p ( , "&`p@ `p@` T@ 0S0`ڪ 0200 0S QU  0@ @0 0T  0 Q00S+ U 0S 0 0 0 U  00 04d T 0 P0  (,,Ơ  U ,U {ꠠl@-0 nh ЍX[G-`@M@fo p P娂EVW0 0  *V0 H*僃@ЍpC-@PpȐ4`V97947P@`pcV 0 t@_h0@PK`XEm@M:PTPE_o@RPIꜾ@8@_Hǀp@-P 0?A3c S 0 S<` , R0L <0`ODS0@ @@@?CD0pHQмVUUUH7@-@L0SH@P˂0#L0Rp00SdU>`0@AX X 00 0,0 004O Ѝ0@ꄡ_@8H_X@̡X@-X0 < PD嗂@@0т@0PpPPH@8̡\P/@-aXTxH0, P<s@(嬂,@ R j0 0\@8H̡@A- 0@S0p# PU# P`ጪዂPG 0S `U 0S 0  ; 0 B 0SoP0S`ᅩPcV `p@- 0@  P P 0 0p p(0, #6 P vO-EM 7 5@5 ` o`P p^?l5lEp#d5 DL ,ׁ 0S 0SC0S@50%0f000 00 0RV `N000@0 0 0S#1_F_/////// 01>.2h !0S000C0< 0S0 00 00000/ᄡ@-@P R00 O-TMPx0 @S@S#2[@T U0!:3A00C 000|00  U00 Z0Sl 7 '(0, 0P90SZ H0L00H#6$000c,0x00c(0E|0J600P @0$#6CP0#v0P,0  $0$ 0S[ @jTЍ6$0Pv0#fVnWj* @)P@!@1 V`!x0@D @#60c@(00S00PIW@1@!@D @P`1,@x0S (00C $ 00C 0@0D 4 B Q 4 R00C@<08 8<0 F A0|00Z ~Pl 0 vPR 08 0H0S0H0L0Hx0 pS00R0S<D ,0P`s 60C00 0@G @D@ @T@1T@1x0S (00T@1d0VSP1x0S (0px0pUP! E R %p# 6`F :  T* 804  80 $4  Q* `F$ R 0U:Z @PZ@HP b{$ p 0 p R0L0 0P@8 0|000|0 R0L0 08 0|bS @ 00#""(0, 0P@0#0P00S 0S @0T 0S^  P2[+X'*PPUP1[`! `1EpV.PppW PFE0 S0 0Z" l@XP1P!pP`1gEp 0  |Z PP @|uA J@hHy__ Vzꨬ04 S/P @- 70@9_/0@/@9/0 \/у0P1@9A-@p`H1ƒ RL R^!^D*   R `V`F`P7 E@V P^@o#PA A B R`V`F` V P L@@9_p@-P@y2 Q*    0R p`VH;7`F`V @ LPp@9_O-10S 7쀟`Pp U@250 @+5)5W00 Ѝ/ Uڌ2Sᅢ \ J 2PW@` P @ KH_@9_0 _c _0@-@X0S0/"R\:@\*QL0@0C?0@9@- pP 02 0  Ѝ@9p <0 P 0 D R 2 P///@9@-P@-@@-P 0@9@-P 0@9@-P 0@9@-P 0@902P 00 /@902/@902 /@9@-@P02 @9O-pPP夠R I W6` @#&G$0<`@`D`H`L`#Q0R* 00 00 0000xp@9H@-@PL0"D0S 03>4000,02Ѝ000ꄡ} _@9 _@-0XP`B 0\`R 00P@0 0 0 Ѝp@9s@-P0@D0S 500Sx TlP: X5`A P<54`P@Ѝp脡D] _H_ _ _ _@90O-M`  0p0P0dd300ЍZ04 0,,Q0D0BS0S Z5*5P .0\P Z`Vu50`F`@V @ DpD @Rh 00C 0R P 06# 08 P 00C 0V]6 __ _@9 __D9HO-,MPP@P U.` 0pP 0㤠N@T P,Ѝh ``F&&$ $    01/坞 00`@0/@- P00 QPC-(P@D Q0 3S 0!  U00P`\ ࠱P` \ 0 CQ: U 0 00P`0S6#P `0 S 8P`P`P `0 Ѝ U00 Y  0X^A- p$@P` 0vw6 00DlЍp0 P/0S  4\Q 8< Q < < 8H  BH /80ுH P00S/P 0 (Q, Q/8ு0P  /p@-0@` PU` S R   P00 `800d <0@8@@H00H0pQ0 P0S  00ுHP0P/@- T000 T0 @SுG-@0Q00P00CP0vIP'P""R,40Xq0S)4D140P !*QvL00CL0$ T00CT04;P3 `?v000P00P0vv`0``FV` _Y _t _| _ _ _dб帙бS QN//O-@0CM`S$@X7H00CߍP8,@0$'0CS0 7 03/@凙 p60`B>  50 0000 0%@P0 S 0h d )`P!L6pN,P /@0S %$0P0%00CSm00h`P0S %h4 |$0T T0,0h0X 00 #\,`Vh @@p0S@0P5 f4_v`PqP`  `qV @%P04p00`S 00 4$ ) mq^P qH%@ q$ 0$ R0P0 . !h340X !w%`PY$ Yp0`0P h30X !p%"q[qHIa%^@l!h%`P0 0 0@0S0D0?d4;&fj0S0F0Yg 0I/0@21P0X10 0 4C#"#04>0CYC 0[}  IW, T,뀱t!(0<Pdk0S !0S    0 0(!?P .(0,`(0p00000L L P P p`VpvPdp@0Hp @@Hбl]-Ɓ貁 _ _t]= _ _L _ _ _; _ு U _b _O]j _1 0S/G-H0Sp+NEpPU+|pG嘗@T P 0  4 b ` L\#pV  T+#R<00# H00CH08@H _б=ுyW_ _G-0H0SG0P SQ@ 00opW R00S0 00@T p 0$  0 0S0!p` #R<00# 0800X<0@800 00 0T0 0T0p(08@ oH=ு@-T@L0S@ DodX40 0P@T@@oH=p@-@4Po@e$0 0$0p@o=p/p@-`LPo@( 0F 0 0C 0T00CT0p@o=H000#1 7@-@HP7t@ ,0 6@Pg Ѝ0褠@-@aM }0PBo@  N@@ ,0D $\030#R0#02S jo `Ѝ. & R \o`*t 0 DL`P Ko 0 D"60 B+ 0 B"6C00S("06BS-XN, !004 0 #6:S"& :///R/>0 0 @-@nH0 0@n =&O-$MPH0TQ@`LpP0#0@ 00S 0S塕0S R0  0`P60 0 H00\XTPLp$ЍO%O-Mp80hTPU p0S0SP phP  0S 00 p 7/p|hWPdhP  0 ;/4 h[ @@S _>ELF(?4 @>OA-0`p0 Pc#!c!00=R?c#!$c$" 0 R0 0 0C 0gPN@Ѝ @0 4/@gTgP  0 8/@g?A-@`Q@Mpz 0@H1(0L1,00 @64000@68006<0M1@P@|gP  03/g뤀ogPN@@Ѝ @0 4/@rgT %1@P<`TgP  0  3/@\g>?@>O0000/ر000/-AM 0 R 'R R, R 08P#8S$  8 00C8#8SAߍ ر0A- '@pP` '\"  \ \ S*0 S: Q@0 pPS*S* Q@0 S*Q0ر O-p0Ms0@D0Q PAa PC\Z%Z 8P0C`0@Π@@0IP0a` S`=:00N@@T R 0 `0 B>00 0 0RЍl ` 0 ,` BPT  OdO OP Q /CCꜿO-|MP`x Dh@ pT PF 000000 0 000000 00($00(0 000040 080(2<0}>@00  1DH00LP00 0TX0\0/S@)@T& 0`@hP`0 vF0PT00PE 0009 @[+P @@ S+P0@00|Ѝ`Ps@-@P`AP Ѝp@rЍp@- L@P 0S 1(S2S P _O-0|M3S `PP1S S2S @$f$@P $|Ѝ22 0h 00 00 0$pP $@E V 000,080402S-00l0@T D0D0 04/@PD7Z\ 0@SB T!3P Q*J J@D@0> $@"R)0&0CS$@ 0000 0$>@P $0SW00CP $@"R"T@10 @ " 0TL000@ @,@2S0$o0S(0 40s0N@N@4@800XSB 0tp<1W00 @P tp0t00S3 @  C0S S0,0p 00D00$@0 P h@D0480 ,p 0P*,00@0S0000@!@P00( 0;0@P40〰 0D0@PDP5S7S 2$0B $00` 0w@P[ 0 x400 \%Q ß>0 l0 4 0  @L40038/<000 0'T$  0( Rc@dPS01Q PJ[<4 qP0b B 0 0<0@0 0 0<0'P# @0S4 $00 . Q 0 0A B0\ 00C \ 0@R:0R5 B0<00<00@ @@ 0(@1!00L0 0H0T ,0 S0002 02000x0h@|0l0$03/@P! z0@H0 q0@0@ OOA-PpU@` U RQP  Q V0P Y R@T 8P t]0O-Mx02 CR@#2` 0"00 00 0$V@P  p2 S Oo BA Ѝ0S%P U"0P0 0$1P PEPPE0PPEw@ U @-P@`pP  0 00.PX0@0X0 ЍG-X0 `Ѝ0@S P F`P 0PPPS*0 P000 S S S 0  R   R R0 R 0S `R p@ wPpr  偼Z`  g  v`{p] 000X $p0 $0X 0  0<`P0 ;` X0V X  R! !4 X0`P 0X0 0\0kR 00dX0a"Up^W L ! pP  _P P PM??//Ŀ@-0`*p"*0C00@ 0 `0 8q> 00. 0.0 0 (03100 >0#60ЍЀA-P@U 00 ` 00000pU`  T`A- $0p0 $0 0@R`P:    U@` P 00 00$00x @0D0@0D0S/p@-@P`0Sh000p P QPA-@T1  0`/ @+ P!p@P0|* 000B0 q 0  0 0@P 003/Ѝ@@-$Ma01@00 0000 PP0p  `IW 0 00 .  00qP$Ѝ0@-PMP  @:#: B   B  X0  00. 0.0 PЍ0@Ѝ0 -,M $001040 00000LP$P,ЍA-X0 00$@0#,C04@ R1D@(2Dp<`C0PB` R 0 00000H0Es 0 0000 000H0P 000 0 PPЍ O$0 0!0 00 /Hhl@-0`iM0 0 DP 0 iߍ@P p0 tpPd  +U00> !0(Ɓ@Ɓ0Ɓ8ƁedA@-<0DT 0 !0  !O-A`z Ma S0S a2D PD202 000*0P rQ0  |00 l 0  \  AT HDDPp(DPd|PXD P D0/SY0p00G pD@-0 0ġ s0!00 "0%PQ  0T 0 h 0  $P9 K4/,0D0P@  88<@0$P#$ ,wB00   P0T0P0Sp z ApT00heЍS_Sز]G _ _wT _n _] _ _,_B^^ _ __ _ _-_0@- ! 0 !@- @0S 0@@Ɓ8Ɓp@-T0PO`d !0 UF Ϡd 0!T@!p,@-0`M0@ 0 Q00 00M  5@`T#ʴ@Q   4/0 0 &#: 4/?&6 :  X 4/`ЍH@DزgT3^_5^"5^^X^sT4^D2^<^,__^0O-P`p'DM,00> 0 00P(`$ p0,0> 0> 0 00P(`$ p'0 !d> ,0  00P(`$  pϪ 0 ,00!> 0 > 0>00P 0(`$ p幪 0 ,00!=0= 00 0 00P(`$ 墪 0,!t t= 0 00P(`$ `卪0,0 ,= 0  00P(`$  py0,0< 0 00P(`$  pe0,0< 0 00P(`$  pQ0 ,00!D< 0 00P(`$  p=0,0< 00!;0<$ 0 00P(` p&S0,0 0$!; 0; 00P 0(` 0 ,00!P; 0 00P(`$  p0 ,00!ʟ: 0 0 0P(`$ 0,0: 00!: 0: 0 00P(`$ pϩ0 ,00!`:0X: 0 00P(`$ 庩 0,0: 0 00P(`$  p妩 0R!9 ,0 00P(`$  `咩R`: 00,!t9 $0 04P0p(` p{R, 0 00!90 $0 04P(` pbR00$,0 0 00!8 0 04P(` pJ%0,0p8 0 00P(`$  p6&0+,00! 8 0 00P(`$  p"(0,07 0 00P(`$  p)0,07 0 00P(`$  p*0,0@7 0 00P(`$  p+0,06 0 00P(`$  pҨ,0 ,00!6 0 00P(`$  p徨-0,0;$0\6 00!H60@6 0 00P(` 姨.0,06 00!6 0 00P(`$ p咨10+,00!5 0 00P(`$  p~20,0|5 00!l5 0 00P(`$ pi30 ,00! 5 05 00P 0(`$ S60 ,00!4$ 04 00P 0(` <70 ,00!4 0x4 0 00P(`$ p'90(,00!44 0 00P(`$  p<0,0$3 0  00P(`$  p>0,03 0 00P(`$  p?0 ,00!P3 0 00P(`$  pק0,03 0 00P(`$  pç@0 ,00!2 02 0 00P(`$ `宧A0 ,00!l2 0d2 0 00P(`$ p噧B0,0<$2 0  00P(`$  p內C0,01 0  00P(`$  pqD0,01 0  00P(`$  p]E0,0L@1 0  00P(`$  `P_P_@__P_pWW_R_'_5_=_I_ܲS_DP]_f_t_LPz_h P^]____________XP_ __]_P _LPv_4PM_(_0_@_L_X_H!P^dPe_p_~____ __tP_$P_P__ _첁_P ___Pd\^_3^*_3^5_DP?_pF0,00 0  00P(`$  pӦG0,00 0  00P(`$  p忦H0,0 1 00!01 0 00P(`$ p媦J0 ,00!x1 01 0 00P(`$ p啦K0 ,00!101 0 0 0P(`$ ~O0 ,00!2 0 2 0 00P(`$ i 0!`2 ,0<00P(`$  `U 0!2 0<0 (,P$  `C0$02 00!2< 03 (0 0,P p-;(8$0 0 00!T3<0`3 0 0,P 0(0; 0 0 0!3< 0  0,P$ p0 (00!3 0 00P,(`$  p徥4 00!4 0 00P,(`$ 媥5 00!(5 0 00P,(`$ 喥 0!h5 0p5 0 00P,(`$ p傥DЍO- 100a,$@ @@ @P 0(00 00a,$@ @@ @P 0(0l0 00a,$@ @@ @PМ4Ѝ___-g_^[Z^_{q__'__^_P ƒ #60 P *R  P 0 / 0CA-0@`P  P(0p, UP1p1:PUp0S S0 0!d 0 P*0d0 L0 0!d 0 P:00 _+_@-L@P 0S  @00P 0000p@- kx@`PUpPx>00ST 4x<0 80JxA_U_Xl_0000 7x0@-M 0000P 0`@PP8 b@P 0 @@0@ 0 @P 0Ѝ0S  @!!@P @0Dp?  @Sp!@@Dp@Pp w`0S@|;x0000 @P L0S00p 00=@P s_3PO-RM0SP@ AXK w0SPs,0 Ёa,0zXP08 0($rP0(@8(0H> C'ġ(HP(1P01QZ=P 8 (0<0, 0H0 @L lPP0= @ @H0L PD!@!$0<$0 ( $0,03!@0<]|x|@P`00Ѝp@-@0Y 0 0 @0@ S D \ DSR///@- 0@ D  H  L P  T QR #X z ЍX R #D00P0 00@-D 0R  ЍP 0PRpX0S` @W ,0S ` 0 D  P  X R # \!00@00H00L0 0T0000/03/A-pP `V@P PuP uV @000V 0 `@ 0S 0 00 P000 @  u0@-@PMpu0@0@ @@@0 R=     t d T  D $4(Ѝ0_0__J^____4_P/H0 R R 0f R R p@-@`SPlu*@PT_uHp0`0 00$P 00000@Lu@@-@Pt 0S 0 0S0   L00C03u@ 0S 0S 00  @-$ P P UPЍ@-  Ѝ0@- 0 Ѝs@-@PM`k`M0 0Ѝp7@-@ၹfPP|PP8P 0  Ѝ0@- Ѝ0s@-h` P0@0@PDPHPLPPPTPXP 0PPЍp7@-P@0@@0D0@ D0H0H0L0L0P0P0T0T0X0X0\\.0 00P Ѝ0p@-P@pp@-0@S P@p@- IЍB=@-p@`MZ1 P@0@0D0D0H0H0L0L0P0P0T0T00P6 ```1 00pP  ZЍ  $@- $Ѝ@-0 0 0$Ѝ@-0 00 0 0$0Ѝ8 0(  R@0/HP 4/@-  @((nP @ tP@Ѝ @-]L0 000p@-000@S0S00 TL0P0p000CS0/0L0@- LP0/@-p0M`0@ 00P0$00|0 0, S00` (0 ` 00 000000ЍTPX@@-000S ,0 R@5Ѝ@Ѝ0M00Ѝ/@0G-aA8Mp 0yPU Ż<1忻P1?0P噝QP0S  R00RC20@4  0,00$0,1P0$1`|00 (`000 P PpyP0,00$00(``00 000 `P Ppd8 "; |8 0S X; P8ЍG8ЍX@@BTPK_GPX_\b_HGPr_|_T0 / 0T0$0! R!/ R  /@T0 / 0T0$0! BR!/ R  /@P0/RA-(b0S  (B 0x R x0t0S*xsP0PQ K00S-T0  1SL t00CSt0ڑAJK0 001 S P0T 0 P0T 0Ut0H0L 0 H0L U 1ST0  $0L t00CSt0U 4S32@ U 0 0 0 `0d 0 `0d U 0 0 0 X0\ 0 X0\ h0l 0 h0l @@-`@P@sAo0S]0SD00CSD0O0D0p00CSp0()00000冞 Ѝ@@A-l0p@P`X?P0 1#A$'@P@Q@ XMA-@pT0 Q]P`PJ fPp0 lJЍU]@0p@- AM@P6JQp@oJ Up@-P40 AM@#JQ  p@YJU/@-, 0#@0 n@J]p@-4 0#P0 ^@Ip]p@-@4 0#P0 K@Ip]p@-@4 0#P~0 8@Ip]G-@0 `0p0 0#`% CPPP `0 @pnP ? 0 RS  W: 0 Up p^3  0S 0S 0 XG-@0 `0p0 0#`% PPP{ `t0 @p$P ?῿0 RS  W: 0 Up p^3  0S 0S 0 X0S/ 0S/P/0PP/8]/Pp@- P- pO@>8N>NA-p@P0 MW  00  0 0p`P0 PW!`z/ 0 80`0, ' Ѝ P0P0`x^{q__O-`M Ap0P{HyH 0,06:/S `#P#!+*L0  3`V |c,Pа [HV`P0S.0P HU`?P /o`P$0000SPSP|HzHUVW 2 FR<PX W sЍ%S) n BR$ t"z?0JP`Z``0D"104"J000(0> CJ "0?P.001P PP0SPPSU`P P 0 0=0d1  PP 0S @ TPP 0@P80S_] 0!< 04 0 (   !/Hhl\ P/0 !8 00 (  , !/HhlA-P@0`0@0Vp @0pp-G0@TeGAl70S2 y7 AP V @0 l7<JG@00@0AP 7SQ@@-@@00@0@|A-4a4q0Q: a@1Qp 0H!L1P!h1 P0Abl1PP0T313!>VcDዯ0 0!4104 00000м4_ȼؼ_ܼ/00S/ؼ7@-PQ@@0 0S0 @%U h000\ 0@ 0 00R Ѝ0@0 000C\P[Pܼ@-P@$`UF1UP 1CUW 3C7CU( X1 03/?@1U( Pؼ$10S&P" @000@000800<000 0D3$0P0 000@0 0 PP00P:PdLFЍppP QrP@0S RS 000cc,4м@0/@``@o/@ /@ @0@ @P/Q-//0 60 2/@-`|0@T L0S p]E0!PE@P P$`0 Ѝ@Sp@-@Pn@PU p@E@-@ .@s_p@-@/#  zE011>101?1?11` P@V@@pp@-@HPgE@080C@00S  0 Ep@REN@-!2 !@!$!!!r!E0!311Sp@-0@P0`@ PE̻-E @0 PUdEttp0@00\PS 0  P@ E403CEJEpмN@_ _N@-@@DTp@-!2 A!R!!r`!U!,!P!,!001SpA A2S^ 20Q 0RQ Q !p0C B 0 Q2-  a>Q 0 "Rq0 o`/O-M AQ( <0@@|WЍOݎQQ(0pS<0(00 0 00?o 2?B0HS?0 $00H?oR20S50H?or20S.^X[D`xW01x0#L0SD4`P(000U L0S:Z0S7 $0S`0$ S0=D0@0 P 0,@oDT`?D0k`P cD `=,0D1@4008040 0S`,QDDDlkP80Z80 0T0T@T XH3$ 0R 0 S030#R0S 0H0C`0H023X`x `›V`@d0X `X@\` 0lVh0(0p000t040x00儐0X00X \` 0V㔐0X00X \`ϑ )0V㤐0X00X \`(0S V0000X00X \`少"+0V0000000X00X \`坑H0000 0000|0C,CL00 `@ `,iCVR00000 00C 0X0 0$000000Cs  0005X @00S0000PCX<}C3(0S 0 '" <0 Ѝ`lƁS@SO-p3|M3OWW3@03?0 |ЍZ0@Th3 0,,00,@P 8C4B030JP`U L0SVZ0SS B0 0000P 0@!CTA? 0wjP: C =$0B1@0000 0S  0S  0000@T  B00S $ 0R B000?Z0F 0B $BB iYWP13V@ 80 #0S/ 0@0 0D00H00L00P0 0X0$0\0(0`0,0d000h040l080p00S<0t00< t⊐ B@0 8P0@J@`$00 @w0 4r40 HD00k0 LfP@00S0x000 yB`FvB`/NlƁS@SG-@8M 8 B010Q0q@,1P@0 1@@ 0 0@ a1 00@@ 00@000p`P\,00 000(p$@ @ @`PxȌM0,0l0 0d000`0(p$@ @ @0嶌8ЍN _0bPcPN$bP|bP!_lPഁ\fP*_s@-@ `]A1 RB@Ѝp@1S 00@T `A00000AA0@-@P$MA000CS00 AP$Ѝ0A 00PU 0  0 ! 0 0 05/ PU 03/P0 5NO-1,M 3쑓1]00AgA0 0 `V ]v&A ,Ѝ0001SppGp J/pFW pZA 0S = 0$03/7A01$_L0 000S 0@!!$@`A@ 0 0p 07/A PAe s@-0P31!1  SA0S0C0Ѝp@|0` @ V PЍp7@-031! Q@APT 1S000 Ƭ00@T Ѝ0p@-@P0P ( R p R p0pp@-`P@P (0S &p00p p@- ЍO-@ PM @1失0,0p10Wp!0`1V1!0020[ 00 0p@'  T0p@ BZ0a0S1 S 0A`@@ЍV `3`#w@@O- P$M1@00p1W2Ӈ010m "ɒ0ȂX`@ò @  1 0X@000= 0@1 W A@[A $ЍO=!  00 C0 BWڜ!0R0[ 0 !j s0  !j iX 0A1`徫0 1$ЍO?$Ѝ@-@`Pp?00000? 0P100Q磫@ Ѝ@- `P1 @00}1 ??T 0 Ѝ@E ЍNG-p`ܐ3 PP 0 @P  PU03aP  0 `W? ル?0 ,00 @PN@-@@ 6?@-@4?@@~@-@P 40 @01 N031 0ggO-l2M 31 T20@1=0?q1WPPӄaՇ0cU.  >`P n  J ↵PR0?Sòʂ?1?1P1`11Q1儡U?ЍSP   Z VX  Y P(P1SQP`>00>U00002q EŠ0 3 1NO-13A1LplgQPP\g넁`pU0^U \8 Q020?SP !011QPk?QQ? ڴ ?10 ЍO[ 00P 0SW ( R 尐uU bP00 ЍNs@-0Sa @1S@ @A1S1S Pk?P10``1SЍp0S  R R    gPQ p@-@T 0`QT@dPT\=sIPHPP=UP@pT 0d3yIPvtS1MR  !Ѝ/1MR  !Ѝ/G-pPt3a @P    T<@@-M@`Pp0P @# W#!!  0@@ @ 0  @C  0  @P@ЍO-%upWpMH@Pl3졓1 0 00S?o` "= 210030 10 .11 R`` I=%+ W- T^X 0\P0 03 9V 7Ѝ3 #=0P g < {0_0Q`/wt@A-@PxM␀ Pp`x ^dp` P<T gHP  Km,<xЍd`HP 0 hmSA-P`h0hp@0 0"+ - 0(00  03 b3Q-//-//-/-/-/-/-/$0 0!0 00 /Hhl0M0 000  c P0 000 cP000Ѝ/0M00 P000Ѝ/ M0 00#0 $0  00#$0Ѝ/Q7@-P@ h(<`0 R 0SP D00000S! 0"PT P< Ѝ0Np@-XP`@ PD03 1pV T( P p#pNO0 100S/INM@-@;08@<N@-000S ᄌ 0#  ЍM@-@0S0 RS000000S 0s0000S0St<00ddPVPX00SLb$A@80 0 0 ЍN5_E_]贁MOO7@-@P  ԓh04t 0w00l00p0000 Ѝ0|Pp@-@P, 00 00 0X0$00(0tp@U꬇P@-@ 喧@@ =;`@7@-@`P}z0 0 00h1S\0\PZ_00 @00 0 $00@0 Ѝ0_[_`_q_p@-QAM0 0$0 0S$0 S*:01S< `10X00a01(;V  ‱0   :!(0,0(0,] K   0R1!0CSQ B0 00 bUP tD.S1! B0C 0:0  4tyON(PXOPNܲ]__A-P`P p吀H0L,A0 U P#H0LTp0    0S:|03/0Sf:@NM@-<0DT 0 !0  !p@-00P@00.pO0@- ! 0 !A-p@d` PP0S C C0CS0#T P$ h0l0h0lAN@-00@0O@-(0 @0 0"Ѝp@-PHM` P@  (_P P`9(  ( $   :HЍpN0@-A4MP000S 9b0S)  BR/* # t͋00 000X!h0l0h0l810000S0P=P4Ѝ0 Ro4Ѝ0@9 ,aR !00/ 0 000p 0`P / / `10/ 0!#4#0 !Al ///x00CSx08VЍT `[ _A-pP `P' 0   ( H @ _/h8J@-`0@@@%+3 1 03Ѝl]'_A-PU@d0p00`h0=/B,w/]p@-@d0`P,/3,p@e/p@-@Px0Sp8UpA-@P pP/X0 @ 0P  G/x0SA/p@0x`X03V00  5/0/-/A-R@P` |p.h003//h 0 * !01 0 R) p .X0$ @00C@0 R 00 X00X0. .h00 lƚA!#4#0!10  .p@-@`P 3@0 1p0@00F=00`'t` pA-A@ `p{.@0Q0@a+. #$ #7 P 402 /,0P/0 0R03 0@2#/ p@- @`0PT 0T@)0,)@P"Tp% PP  P0Tp(A-P,hAT h0pS ``,\0$ 20S$0 ,@A,@]A-Ppᘀ,ATA,h0S ``,\ $00$0  tP$00$0$0S ,@@]G-p㔀oATPPu,P0 C;00",p4(0 0\ 0 0$0!0$0X00X0101,0S 0h0/]O-M( 0$0 ^0P 0 (0S $0 Pߍ3S 3 083/PP803 000000 0S 0S| (0 P $ 00S0#003 @04/PP0`3,00:00 p` RP 0S< MSP3S 90?00P03 @#04/PP30C3000 Z 'S P P  +1 1 R!Z @Վ0 d0 000 0lh0 0\00`00 00!)h0SS  Q  R0Q @>0!#4# 11 | pt+h003/PPp@CpP |+0 0PX+X00X0+0 PK+X0@0 X0Ry0X008 0@@0@@0@0$<(f0 R 0R @T @k +Q 0#$# AT  S Q Q @ P 11 0R!ŃVP|9+0@*X0@0X0H7300-+ pERW Y U0@,0@`S 0 0C 0000P*X0@ +P@0X06300x0S  ** * P* 0\00`0; P~P|3Sp< 5310 0P3S7 H@Xp0s0( 7PӀ h0`0xPz*00@017[@*s@ 0S 03# @04/3pC(0PpA 8s@P @0!S3S XHPt@ #T@0p00h t0 p00r*s耍0 -*+* @hTX0x# @00 00S R 8 U*0SZ 8K*H*$k 0Q 00 0h0T83S 4*{X0 X "0X0@00C@0 "*|00) (0*)X0 0Z!0X0@0 0C@0h0 0S\ 0 @0 0X0O @ X 8" 0@0#X00 @00C@0)  )) 0S@ 8]) ) 0#03 @04/@ ))0耍000 0pW00T0SH 'R 00'@ 83) ) 3/  $!0X0@00C@0 !00 00X0 0 0@@@0r| ?)000h0 0S 00401)h P 5/P40f)U b) `)6(]@-,0 00000 00Ѝ]p@-P@Tp`QP ~@G-`p3aM(1 PUG.)P (p@-P@``( 0@I @p@)p@-@PP( 09 0p@)00/A-@P@pET|`(h0000h0(@ ]00/0S00  0S00o/p@-@PP(X0d`)P(iX00X0F(p@(0 9@-@L喜PP@@-@8X0 0dX0h$`03$!$H@ pP tP @8 0'J|8 0[|8O-p`@嘰  HQ:/PDPWe \   0P ?P Ѝ0S 40A3/0`@00@`ƁO-dMZ@$ ` +^0T L0P $0(`:T ῡ`P8p$p* dЍ P&`P$0p$p3 "1 00H`V /P 0Sy@!.PPt!(>PPn00i( 0;0!PP_P1 00 0000 0 {PPN|0$ 0C0:P0 1 T01 R L! ` !l  2/`PH0T S *P S:00S18 ,0 0Rn pP ptP tX0Z `x\P Pi`R8G-M@` 8pzYP+00P@@0/S WIЍ 0 0 S?@# ,* bŰ0 C /  C1$@ N00<`00 ْ` TNV@ k`F ᤰ0W@C0`F`-O-`4Md@q̔ 0L0 ?0MX) 叮-4LP0 0/0 0,0p p00 000P ろ,0/pt0Q0*#P,00 0`PP,0L 0P0P000 PhP|P00(0L0 C5<0X0pPtPlPxP $sM >^PP X0H(``QcX0S X0,X0X` 0,020(0PP`1, dQ0`1\0S p20` \(0,PPTd,0d(0l H000C0`1\1 $  BX! 0D 0TRm:D04Ѝ(PH! E'b$ f~$ R!0 R $0f_$0P(PD`10`1Q\`:X00X0 4P\`,X00X0X0 0dX0_$!$$ H P pP tP dM<M`0 0R0U0S \{ 8ST__PL^RL^RƁh00S/ P 3/ှA-P0 `p00l 0 0010 (@0UP Ѝ MP'0yP 0@00 0 0CS 05P`V pZ+Pp &P'0RP 00@0G-PM" @@ (0S; $ X7 `V6 bg0Ԑp03/ @0^P00^P 00` 0 ҈`P &003/Ѝ z D+ 0 ](0p`003/x _P/(0S/P/ R  00/G-Q @DaK08( Q!P( U Kp PU PU ^Kp R(0 u @` jpP nPU *\~K(0P(@S0`(`(@0S   0 PG-PQ pK@(`T `(䀟VPK#t! 0S&$@0S LPPt$d6Kv"(@T 0Q S   0 U `@PS(]A-@`PpU 0S A  0S S?P@-@ᖏb{P]{_#hP lP 0@A-@`H00Sʬ匏#Ѝ0 0 0cPP:0 0,0pp00 00 0QP ,0/pt0Q0!* QHO- `0  0屙 RR  00 q$1|pqL0 48<0L0 1 111"  "Ip h#Jp <0<0a$,0SE,p,[ppPpulP`0<1xp8p"N4"P P0$(, 0P0"T0T0(G(`0pQ h1d0l1=0c?0h0040083pp0 `040q40pW 4pe40q40q40!0R x"40p"0, h001h"10 0S [0[00[0x0Sp p0t 0x@t00H05`0`Sl 505`0@1d0Sd d0h 0d@h01 R @0@8e 1\D03/0"(Jqs4u0004Z0Kcb"@`"1S' AZ"{uIsI(0 T 5@ "5`0`S D"<ЍD'40?40p=Wev $!  xS @wDITBI !"BY }s#@@-_W[_4_PS@SP0O-,MpQ #0A`P#@t@T ,0〠X2 Po@PP T P` X !P P`@#0SKj媍V 0U> :$@$ 8@PB `0V): `V 00 ` @P0 00# $ 00`00 @PQ  $#@0@,Ѝ 0S S+$0*@P X x$x$ `qP@QP|0S/@-@h3/0|0h0O-a0#6040080>0#60D0>0#6000<00@00寊x80S ޵M 0/1000L09L0!5@ 0 0  0PpW(pWL0<L00P +. @.`1Sp pPe0  0  pW Ppq!0R g p :T0  X  [0 lO 000[  [ 0H6p30pGo r$| FqP q$$0 1 p0Y0#03W0S$U!$h$AWpW /7xz hxD DD0ĐN  I嚖`1H!<1d1D1l0 $p $07/pP[T!@X0A  81((0<1,0@100D140 pPGn l0 0,03/l00S 3/4l0 0$J(0Sp Zn Yk 00Lp @07/(0 03/3 0000 ( 0 0ՃpP(01J 0 03/F0ShF X L#嬰^H< pP tP 0Sm  pW  00 0003/p0xxr8Hdw1S r l0q 00S p0Sв$@6F$0p  $@F0tp0P _ 1S 8 R l Q 2/l0 000S 3/l0 0 1l !D03/@10S iX^F0S,YFX 0"#  "p xPP0. pl 000p(p(p ,pK 0 0Z000C0- X 0 `^(0S 8K>p<ЍƁSP8_ST_T0@-_MP P@P0 _ߍ0@-(000000 0ЍP@- $0000000ЍPO-dlQX (Xͧ0Ph g>10S`10$0P `k]p@-Pa|@T 0Sp 0P T  P06P0o 0S P0 P08P0]A0C0  l0S/Z B\R R  B 000T00S0H0`0<1p0St t ' x0Sp p0t 0xt0l/ಁH-wA0`SM P0P:P00Sړ00P0*  2IPv|530l 0\000Zhq 00C0 ^g 0 [0 1111I0Z0z0S ~H81S ?뒏C y"6$婅0$04hG1僟` 180S 3/)>mT0  o[0 00[ 0 [ 010S2 [ ` 0`Z0|`` 0 0S  }LH +8 `0 000 0 V u& [ Ϳ '"*5 x `V 1S!! !1 0S   l3 R @@00l`Z0000x0S p0St t ' x0Sp p0t 0x@t0L0 `Z`H0S( x l%0@ ( H R( S0,02 P   , @0`080i(0< 0 D0(00H0K0(0 <}91S "'W S 01501 b 0Z0C0000007TBl l0V D 1 0 Z4Z$9F1 P 0PL 0S 0S5p@ 5 =5l0Q Q*00pM `* x0S d`JಁC_TSSz_@Sb_p@-a@PP0   !O-M00S`؀   X h80S0r 6Z3qYY10$0 Px0 HS,0 0 0 0`, p P [;,02 H0S5P0,0,@Ti U5  Y5y %P0 Z0S 0W| 0 `0Ps $0 R00SDh PP f%@H0SPT,0Z R R ,0 RP  !P  00C0X 0000PB ,0Z R R%@   B X /  5@00PPUPP0,0 ,0p0bZ0S000lP030dP00 P0 0Ѝ0W 0 `0SP sZ0S000W 0 @0AP aP5l`@? 0V< k5 =5`V2`H0S& x 0%0@ @ H R@ S0D02 P   D X0`0P0zT(0 0\0(000`0I {\|p(;(X|;((Xx;0S X (X (0 0020Z00S   00C0p0St t ' `%D&% a P-,<(>b`P !D僼  ?$; B/o"S R0 400P%`0 _0Z 0RP B+ 40 0? S@SSಁQ0@-q@M QaT0P0` ,0 TP X ‣Ѝ00@-P0dM 0 0@S0 0S0 Q  G?o 2Q0S X =dЍ00@-@0P SMS0R  0 0 0000?o2Q0S  ?o2Q0S ?o2Q0S  Sߍ0p@-5lP@0U5Pp@0`P *P^5<50 Spp@K@-X0C50S[0  I 00S @ZQƁO-`$10|0L048<0L0 !80 !!L0?! 0Y  U^> >;0 0? 00^1P DP  㷺D+ <0<0, ڀ,0S(<:0[00,00[` P055 l`0<10x080jB4P P0$(, 0P0+AT0T0(< ( ghx4[$ =0c?0h00400h0 0`00,00? 40!! 140S  3/10 0S [0[00[0x0*Sp p0t (0x@tH05AAQ  RB0BS  R ly505`0@1d0Sd d0h 0d@h03 R @0@Y 1\D03/2022! Z! ! ! ! !20C22S Vd20S OP1211S  ZXT0  Sp(Jg?4pP04B 0 0Z 0000 l0S `0l 000n5AAQ  RB0BS  R  5A0AS l0k G@ @ $80pZ0"W0S5D0DSXT+l0 pGQHh8_'___W[_4_ಁ|QS@SƁ@-0  000Ѝ@-0  000Ѝ@-0  000Ѝ@- ! <  S 3     1S 1S 0 0000 Ѝp@-QC 1@1f@00@00 00 !!0400000, !  !;.<P 0 RT@0[g<PZ<P3S ̼Hhl@-@0M 00000 p0PP `pP00P0D00S 0 0222v01Ѝ_"Q_A-`|p0PS d9 @P U < p0S0@U@` K<|%Qp@-P`@0`S LT ;PUTpp@0<0 3/|%Q@-; 0;Hp@-PP@ ;0S   Upp@ < 0@-0@0S R 2/| 0@-(@ P0S   |$0 0S/ R0/0| 0_PP z 0OHH jH 0>LLp@-X@P0`S @s8A;@Tp@ ;03/@|%QL 0_@-0@T0 3/@|A-Pp ` @P  p `cl00 (R $@ @0@0q|_ R 0$0 |PA-@`.PP0q$0 PU(0 S 0 m0 3/PS 0X `0 3/00P(0U(0SAOp|t]__^p@-`P@  ` k000p@-@P|@ض0S   жG-P`X 0003 0@T@T. 0pSW00  嫶@pW @ 7/S0SpW H W @@ @@yA-Pp`y@ ``p*0S0@@PaA-P`@p0S 0S   WAI00 00S<0 3R W p8Wp@-@P@)Tp@- @0PU_O-`0Sp,M@PTXidP ` x/o 00 00P0" 00  `00 @00 @`P Xd,Ѝ[  $ \0 $$0LwZ`p?p  UU 0S $  0P 212 2<22@022 02SY 00@@-|0C0P $l!Q`2  PX1S  < ,$1^_f_PT_0@-@D0;0810S qЍPTp@-40CnP0[;P0}UKpp@-@00S\P00#;#P0kTpp@nK-0 0/_ 0!< 04 0 (   !/Hhl\ P/0 !8 00 (  , !/Hhl00S/A-@`&ăPq"PX`00S *P oP P4 0,,( $ فM_]_-f_mq^_0 0 0/@Q\O-`PC1(S 01O000O~㌐0I0SOa岀pk}@n0S p0I0SOa岀a X}OU}J@QG-霐P`VU`P@@ t@]0!0C8R#8 @< A0@72S Q B!0-@Q0@o/@Q 0P/,dQ0@- 0D0R@00,$00SP s C-p0MP0 0`` @0 P 00 000 0@W?o2P0S  R Ѝ=@-@08M@@忷0 00@ 00@@0@8**0|0 0000,00 (00!P0 0H0$@ @000'> @00~[8ЍQ,4QH4Q_Q=4Q_@-p p@p@0@@SC 1X01ur@ Hr@@k<<h80@{QQTR_( _A- 0b@SPpbc|b0@X4100S 40 !!04L0H0@000, !  !Hhl@-@Q't T 0310,0|P0#P[ЍxT 00SP 00S t T0 #!R `0SS@-P 00Sp@-P@aPpTUp7@-P@{00 Ѝ07@-P@{00 Ѝ0@ 7@-@00PNP 000U  Ѝ000/0@-P0M0@000TЍ00 0 @P 0 P QPp@-@Q 0S p@0Z0P01P00Sl 00C00Sp@P?0S P00 0000@-2 @0 0R  R@\ 0CS00S$@o0 C 5]p R/00/0 0/p0?Sl ?R0|S/ 0S/@-0@3S{@p@-PP@W t PpP0 l t BR 8P08P0P0 P8P0MP]p@-@`Q- P08P0Z0S P0S 0 000C0.p@ O41041/41!0CS41/p@-@Qp@p@-01Q@101`41Sp PP/@P/|0S/@-P1SO-頓MsQ[0`J`V  00 0C0`>8AT㵱@ a0`` 0c81S-8A[Z.  Qh`0 !0L @0;/2 00  00wr`P RsЍo*u8APU 0R_ `0SNPX^Pܡ  2/0@ ! * 0 0=r`P <XD  2/ `0*5l`P * 0*sX- 0000@ :0<`0q0S0P0 PP0 0Q!R 0b0?o0c#"! 2 B P !  10 2020 20C22S* *N'#x#1[  00/p@-@8aP 0PE 0Q"000P50001S 00S  R0 0 0S0@0 @@0p@ A-,2Q@Up` 0S 咽2t20Oy0u1 00$nV;0 0 `!`0  0 0 0 004 00 0(00{/1S ! !! 1 00C000C00100C0P  G P g P90S v9Z0S YP d00$P 1A^W,0 Ѝ?FSQO-PM`pDT 3RU @s,0 \ *00 0 0P 0妿P s #@T  ᠰ5/3L h Q4p 3E 2 @,@ l p PWp t x | " ဲ"/ⰰ0S00P0 010S DL0P0<P0Xu:n nZ0-20H0S@y1 1]X@00#]0 c@p50100qcτ00P0P Q469390P0 0 ! !01P00 1!1111|0SG/1 !0|@ 10000000S ?P e00LP 00S # | x p@0@@SC 1\0100 1<0SЍ3/QTR_ _] SQQ A-0p3a 8Q@T0S 00(q 081 0*~qX@x03hl2/@-@1 0S@HA-Q 2@s| 0  BR 00 1@0S 3/iٽ[m^ 5P0PSX P0   1hS!!1 ! H  P01 P  !<4 @P0#Nu0$ 0P+00C00S  Z qW\0  JX(1S,1S |`V J8[a徒S__G-@QdqLP00`P  衔 'P03P07 KF7S  <P >  00C0  }0 JJ $  0 000P00P0Ѝ O-pA000,P0   P  x W& PP_ 01^0USS [G  m`W P (1 S0(100C00,1)|PW !Q, Q0 U! 0ae 0W( Q( Q0,1(10Z0C010s $ Q 0P 0R `P ` ```A- Pp`3@2::P@1@!<`JPP   㒀0@D@P0Q @@ p@-@PPp@U``FUPP@p ῔  B PR / t0Q   0RL     / Q ``p@-P00@Tp0 AP @`p@- P0Sp8 P`@ʬ0 QV  Pp!!0p@-P@㵬@0$P0p`@-@000P ᡬ@@㝬`C-MP00`0p0 0` @60 P 00 000 0@P?o2P0S R0 Ѝ7@-D 0ݬP0PP0@EU Ѝ05 )_0/`-@-,00 ЍЍ/9_:6^O-P`С,M @TpPP VPp 唒P @W0 hP,ЍQH 0 P @3/ PPP9  )! 0S ,S0PU,UPP K R #a0S 0 PP 0x P ݫ0 000!R00! 0V0C0@`Q_`__O-0@!T0TX qᶫP `1 !R  !t1 `V` ` 10 VP `P `V@&0Q@D0 P `Y0 `  S      Xͻ@b Ѝ`0   0P (( `V]``]_7@-P p 0Ⳬ@P X Ѝ0Q000 $!@ $_5_f__-@-<00S 0,0bj] ЍЍ/Q_:6^G-`2Q " @PpX  p$0S00SpQp @W 003/pP  X 03/p80S 8T$0S Q0 0C0!R 00! 0S% P $`X!P ᢪ Y0000000@0@@000000!00C0___6_L_g_`_`_A-0a0Q˺,q@T ׺$ +@\$0S- 0* G~<0P000@03/ P R00S % 80S (0, 0 bW"P<000@ 0"  ``HXQ__0 /$/@-@RP` Ѝp@L 0 0 00 0㲹P Ѝp@-Q`M P0 ( 000㠹@PI @P TЍ?Xp PU@ 0  F@P0P S  !  00C0``O-DMB,0RS20,0_ m002"@000S200 "' xxQtBT:0(00p<`@PH"0  < 0A ,0p,`$  < Q<0 SX ' 0 01< 0A 0,p(`$ Q0 01 0< 0A,p(`$ P|1 0< 0AP,p(`$  PD1 000<< 0A 0,p(`$  @P0  00A00,p(`00$0 0< @PX@s0000DЍ ^P 0 l@n`_ly_xt5^'_QQJ^x_V_ԶQ#_]_B^ _tdSQo_]<_@- @0 400`$0 P Ѝ]x_[Q]_@-<$0 0S@G   0`@o/@-P`ζ0 H 000u@P@*Ѝp@-@000@@-@ 00C0@G-`PAqT:pW @P P  0 PP  : 0S  P.P0 Ph p0PP ݨ 80p0@@@x_ly_]`____0   ˨`@-$@ 0$00̻ @?`XO-M00`00W0p4p Q @p8 00(0 0a00(P$@ @D@0젟,00 0a00(P$@ @ @P0@/0,00 0a00(P$@ @ @P`@00,0`0 0X00a00(P$@ @ @P @8Ѝ@`QO'_\Q'_^'_Qd'_000/p@-00CSP0@@$P,SU YTpp@(SS A-0 0 2#PU 0`S@T Al3pd0S R@D($ 0R @TA$SS@-M`pX@P00` 0 0  00@00T0S@1 0 0S _@ЍZ 0S 1S S@-@P0`0` 0 0  0 0 @00T0S@ 0S@Ѝp1S1S Sp@-P`w  0 0@0T 0R0S 0S @P4Pp@QZ 0SSS"DBD 0  !"P/ R0S//SQp@-@ @PX0Td0P1@0P !0@@T@[pSp@-P(@p`LpSp@-`P`\ T `@00  RAP @p.pSS `0S  0  /S 0 咫Pp@-@Td0QDSh h h0d 010Sp@p@SA-l0P1@Q`p 0SR 0 0 0[00[0xPU1T  R Z BRQV [  [  pP0CS 0j  BR bO-SP ` (㼖`㸖pm"0 0*@T 0 SV`0S Q0P @,`Q l UVC! R=T R8L  P @[ 10S, P(1 QSV00@#fboYQVT T R S+@0`00@p@S V `0P @$00@01 00001}[00[0@`@`p `p * &d0Sh h h0d 1 RA0Sd d0h Ph@x @V (W SS@-1PM?@?@`pL0P?oP20S`ߍL 0RP S@0@6/P0S   0Sp@-L0@3P1S P0 00S0S000ppp@-P0PSA,00S aaPpp@ϤXG-0PPpa|@P @T P03P0ATAU lYL0<L0oWᣤTG螤 0 P09P0@LPs@-xR    @ 8 | (2(BRG !"|0 ! " 0QQP1 #"10"RR"Chh0 1d D03/i  0 R0d1`0S00#0H1``0S/00 /0 h/6& *P 1:h@ 0g0`0/0? ?,0l`00000NCSt0*|`cS4  s Ѝp@YW[_4_P<S@R@SD@H=X@X[л0@圲P@-H0 0@Z077pp@P 0 @夲P0 @帲Ps@-@Pp`mVi`jVh`iV 00_ mP0SЍpBp@-P- R@ *B B0 0CS0 B " p2`/V+@,Tp\02S SMp8000CPp]Hp@-L0@P P` Pp@#* p@0(v 03/@"pCO-TM@  0 000ZQ  PwT T r(, $Zp`H f0 02/P0pUV @ *  0  :0#::c4 <@@00D@8Pt 0B@P ?0 QF R  QR03@0B  x0G9 <1@11S7 Q4 0D1R? 10$01[0; 10 R6 0L10S00UP10T10 U= 10 00S0l1R0l11 F0ZO000Ѝp0 =0!0 =0L1O-pSMP@   0$ 0$0, (0(04 00,0< 8000D @040L H010T P00 %(0W`00d0`00` `dps=`h`H0l00p0LW=p00p0PQ=p00p0K=p00p0[E=p00p0Tl?=p00p0`0t0<1x0gbgb]`募(0B(-R #妟- . A. 001Wa1`00` Fdp=`1 1mRy qVy`0`0Z0[&h1Z |bx"1k1"04P B+ 000 0z4F 1 /F0/h2p0l"/`2 Z0S CSY 0) 00 $! ! ! ! 園"&" 0夒 &0B2]0W/p2t"0 00`00` dp< 0h1P<p00p0T0000 0S00@00Cip0j10S  bE0W100`00` dp<`00H  |0S ,101D04H0 (L  @J@5y PNPTX\`-y10S7 $0 |01f0010 0Sh00h0100Sh00h01~E1 0=[0 100S R  W 0X00\0`00` Xdp<Z 0BRS00 0#0i-( (!!( 0!!0 w00X 080`00101 01(01(x`^ @"D !HL  $ (,8"04<(h X00` p R=)B0 -BP2T"Ѝ0`` dp; 0` `00dp;$0` (`00dp;(0` 0`00dp;,0` 8`00dp~;00` @`00dpv;40` H`00dpn;1` P0dp`00e;儰 ` 匰 吰 1 004]h]]]]]@B@-@P`t Pt tCPЍpt L90 00000 00PP t 0'SO-Q4MX@dp|4ЍO17QT@@Z`P: J[q@EZ5 @P; >0 0O0$@ 0;00 X@ T VJ8@y 0ߏ5  x@P DATy @y54Ѝ+tV@y 0X01  0@P0X@0 Z 010@P0Z@W5hV P% P[00 @@00>P@ VJ0700Z0 CSRL0 k@꒟ @bT@ ]0J0 H@P Z$0,0 00/0@0 f00 0p`K@SPQC-M p#@P0S !PU  A,` 0 Jq@P`P !Ѝ@@-@0 000 0@0㿞oЍO-LM00|0 P80;@3p` Up0s 80 `|000xtpLЍO50S0000(00S40RU YU  U00=04 ȎP Î1L0:`@t40@A0C?o2<00$0000,0T0So l:ATk 00L0SZ0S T0 00080@ 0BP  @U 00?09Yb 00`PP110$[0x0/S 10 R 0S0SL 0S0`0`@ 0(0Z$<0 R0S H 40SW; 0000  aW000  9 a aW& 0 000000000 0 0$0$0(0(0,0,0000040408080<0 <0@`aH0WH0L0L0P0P055[0[0T0T0Z0Z0\0\0`0`0' d0d0h0h0l0l0p0p0t0t0x0x0|0|0000W0000000000000& 0000000W0000000& 00000--....////1W1 1111 1 111111111 1 1$1$1JυJ?W81810N/Nh8<1W<1@1@1D1D10Q/Q[8 RR-u1 1%uW  11222/W22!2? !. (2W(2,2,20/*80 DB0Z 01$ 8-[ 0S%PS 10 Rx ?RQ X, 2`P00 70  70 70 70  70$ $70( (70, ,700 0704 4708 870d d70l l70p p70x x70| |70 70 70 |70 w70 q70 l70A/Af70B/Ba70C/C\70.W70E/@R7@0F/F10K70G/GF70.A70/;72@0@ 0 Dp370/70 00C0$0 0$0(0 0C(0,0 0,0 0S @T00 Y00S $0 C00,0Y * !=@,00 U=0 1 LЍ R@R]S1`00/1`<10/1<10/p@-@Q100pSp@-PP`@V11 HP@ 10$00@pSp@-PL`@V11 /P@ 100@pS@-@᪘p@-P@ᢘ塘p@-@ᚘ@-@ᗘp@-P@Ꮨ厘p@-@ᇘp@-@`Pᮘ PpR0p@Ƙpp@-@Q0` `00p R0Q`R /O-MPp8堚`u@w5xGuYw ;PWx   +P @ 'P  0 ؚP  ЍP  P  PP    P   PPP Ru ؗP ԗmNjN널I˗ikN hNϗx Ηw Ǘ ᷗPzO-MpP`8w@u6vHwZu ᡗPXvl   ᑗP @ ፗP  0 7P  ЍsP  lP  hP_P    XP   TPKPFP ᱙w Hv Gu @ 0P@- 0  Ѝ"0@-00  Ѝ@-0t`q@uP$0P 000 Ѝ7@- 0  < Ѝ"0@-00 2 Ѝ@-0t`qߖ@uܖPז$0P 000 Ѝ71M000/s@-@`00 0P@PЍp@qЍp@-@PT@#a8f1  Tq /ЍpS0A-a(M 000` 0PC@P p0 1@P ?T@(Ѝ91P0 ` $0R   aP 0p0z/`00 {0 00z=USn'_(0310S/00S/8м@-d03" " R @" B"2S &@T*P p@-P@Tp &000000@p@-\03Q0S m@T 00@  TpG-@`T; T[ T[VY h1*ERU:0CVQ p81`3  1 0S`} P U* W0@ ƈ@03A }s @T@0U00CS  @00J ᣈ@@(A-@ `u60 0S\ PZ0S=Ɍ ͌pWX 0 S RQ   ЍS@-@M `PG60 0S ^ p0S PQ S 00U0Us00Ѝ@-pP`#@P 0 |0| 0 00 ᧈ0 P#3S<0 R00Q pJŁMܲM^فȁ0@-M 0000 0@ᯗ0P     塬P ЍBA-@ `$P B  pؔPՔUV#3ɔPȔU V VX031S ( ,02 0P03#7P A-q`pQ TdPP<@ ovB PS@-QM`@ეP0T  R 0@ 00 0@`.PP PiP gpdW ^p]WP Ѝ"MO-QM@p帰Q @PH0P @@0P 0@P:00CS@5 aL0` 000 0n0 00P 00 0 0 p*0@?o2P0S` 00 0Ŗ@P  P0R00P0 Ѝ]O-QM⨠崀:p0PS5` =@P0 @@0 0嗖@P⒟ Ѝ 0` n0"00  P 0 0 _*?oZ20S@ @@O- DM_ 0!. Ppa B, 0  0p ,`(P$  2.0 000@!. 0 .  4p,`(P$ @L.+0$ /!04.  ,.00 0 4p,`(P . 0!- 0   4p0@,`(P$  - 0!- 0 4  8p0@,`(P$  H - 0!L L= 840 0- 0ʟ!:4 00}0@0C0000   0 S p0C-@`Pᰐ1qS21 0! 28. h R R R ' 劗X0@00P0#*1S0Ap@0 0@00002S000000SP ЍCTC000@t(_@@-@0( R (   B "R    B \!R A 4. R Ѝ!R b /o" Q AG-0@Sp00SW GSP0` 00Q2@E`　T`W p ᤤW 3U  GݛP 0SԼ@p@-@P- p@//// 0\ CSR0d 00P0Q#7Ó7P00d0\0Bp@-TPCH%0C0\0(@T@ 0S 0AB7Xp@-W 0!0@@C0  /(_0/000S/@- 0 00}} Ѝف#_bD]00/00//O-H`Q@S 0p0202  [0D3" B"2S1 ЍO_p `00S; ; 0  [ ;0 40;V 00S 0 Ѝ]G-P@0 pspD EY ảUP;`P WVV `XwD 0G-<nD0 XeD0 QA-Ppp `D0@c`  |TLD@A-PBD`@ g@V`I;pX# X@P;0 "S LV@0 A;<;p@-P @H0c   50S@Dp0 S pP/0S#/P/ 00@o/P/P/ /p@-@Pz@0000p]Ӆp@-@Pz@P 0000p]Ӆk@-@CkPC@z/O-1p {P{W%N@ \[`R03/@ Ѝ @PR  03/@0 @O-1p {P{W%N@ \[`R03/@ Ѝ ^@PR  03/@0 @\/00/0@-003/ ЍC-0`M00pP@TЍ 0R@ 0` b0 P 00 000 0P?o2P0SP00S 0 0044嘒03/P u ŁP8](_(_@-k )_@-P P d``{PTLv Ѝ (,lgŁ!)_Q]2)_D)_@-[i]U)_@-@ xxRt4Qڀ  !P H@, ! 6]o)_Hhl)_A-P@Mp1 p`@T,0@400000 ,00(00!0$@ @ @00 000'>0<0I!@P<0W0 00PSPDT`@Ѝ `Pp@@PŁRŁA- @M$C 1 000p<`@P0<0A0,p(`$  !0P  ‘@Ѝ<     '.A 0 ,p(`$00 0 P HT妑PL@sP 4圑PU@Ł)_])_P)_)_X*_s@-`P 0@T T0@T  S  0D 0 0 B"P ((l$o`ЍpŁP]L*_Łh0#(1< /@ ρP PQ00@0!!#/ 0S(0, 0 (0, (0, 0/ B@- @ iP 0S,031!10Pp@-P`|@Tp 0SP0 `00C0A@- Lp@-Q@Z0S P0S00C00 00 Jp@ \/Ɓp@-@dP<F⊬p@up@-@803Q 0dP 0 0+Fuep0P/ Ɓ0S co `/P0`o@`/p@-@00C"0!300 P p !A\  Q` _000PUR0(00@@@#p0@-@0M 000@0@@@|忊0tP 0h00@0@ @@x㰊<6 4,6 ((Ѝ0@螆#R-+_T5+_S8R<"R_p@-4` Q[ yhpT0(@  0P8+_`Tp@-@[~@chPpy@w0p@ 2Tp@-4`8SpP0P @  [+S_084@p@T0O-4`@ q@0D0H0L000000000111 1P    @@D   Sတ 8  S%  0 Q31?Y$ ( , 0 4 P00P00!!!! !$1|0(!,!0!4!p!!!!!!!!08 0@ S]p@-@T 0 R X0 iPP T x ^0000@pt fJ0T0 0S/0 zTO-pPP`@U#`V0[00 U00 t  ^` @T 0S V x 'J00p@-@0PQp R00  3T0@-@PPM RS   PP P 0   <PP  E2 1"  P0E"0A 30Ѝ0Qp@-!0 P`00SpQ LBA L ^@P00000 00 0 0 00 00 0 0p@-@`P|@Tpg AG-@M04`pP,0 000"!       P0?S$P(P,P0P4 PЍ L0QQ 8QQL02 SR|0p!!!!!!!!0S Ѝ]@-Pa@>i?,10!(1T00!41  1 00000110010 0 [@Ѝp0D"! 0#@0A-q01P0c?@0010!(" !0 & 0`0(0 ʝAD10101A-0P`q t( C@.T  0@P 010 10010-A!  !!! 1P $P A-@ 0S Pp`@P0 8P0L@0D"0!!#  0SW00S@ p0>S? 0 0CS#0T P@G ! 0 S 0 0000@S P@@ @@]O-Z0M0C/1@S FⅨP3 <00Jp"@03 qp[`) `P hP p #@k!QP @Ѝ! 1 0S P 1PS01ąpp`$ 0 0    0S @1S Z RP Rp Q.  70P pQ   BV *V /`P [3  @P gP= 0@< B "Vx1Sp` 0[ 0p!x!ZR|||!x娇tZ0SP RU <0|POoBU  0Q?o22P L Z  R Jo ⪢ᢢ S0Sl00C00Z0P0U1P0R /1P0jW]@TTG-P葐lp@U" PP1@T' L0S` ZR`y 0  ``kPX P@T P @TUЍ`0SL``M 0  ``?PX Z0S 0CSPxd@S@Sp@-xM@?x ` PF0U0000`0 0Y(0$(P lP, 000RP0 gHxЍp@-P0@1P00Z00l 0000l@ ⼆A-p`@T$ L0SP0S @\0SP`PU , UVA1P@SSSG-1`pAZ0S'P\W :P0SP0SP;0S|PP0S G&0 QU 1SS0@-|M@t PF00Pn |Ѝ07@-PRQ0@2  0$100\ P P P $G Ѝ0@A-P`p@TW [0  d@p@-xM@`Pt E0 0 0`xЍp01 10/O-`P1Mpp0ALP0  @(>yuS654c@㇒) l 0R[0"? R (`pap0` 1RY PX 1 ` ^0% ЍO/0G" 0# ?o\20S d20 d2ЍOWYP k` 0 0  2ЍOЍS>+_O-p1|MSA僿P0  hXN T׋%@4|ЍO R (alSFDt D0! Rp 40堀尐1!` p$!Y0  fWl$`0ST]P 1`@T 0c/ 4/|ЍSI+_p@-@HP`50S 8p@5@!p@}SO-p`PA죟$MZ0S P R }U 0 cSZ [Pi?!0000!0!00000!00 00000P0Pg8J?X~ 2         0000  000 00000 000kPPνP04P0޽ptq$ЍPPp  㸅0E⣒@0 !!W QA p R!` QX !!  Rv UX [  l Q W   0 0?P}=pPPP p402S SU 000 000 000 000S0X 1C HQL!`0S7ڜ01 [ Q - lP) %0 ?PP01 P03Prp S]A-`@Q` 4R{p|C2! !! ! ! !! !0 0F"0Q!V31 $0110102A]p@-@P0` $` هp@ &\+_U+_@-APP0  P08P0i  !p' :P0|`V0S 0 00: W00C0᲼VP08P0a7P00;/000X B0XHqL1' 䀟P&  03/`00S P n|z?V` 0 t`儈&VP02P0P0 :P0彯|`$ps+_}+_]@]]C-@1|MPCT!atR 40T!md2cX0d201S" H1Sx  B` RV1嬁p0P  1 ` X 0 8/Y0 gP  0 Lw |Ѝp@-@ 314020SS \=Sp@[<@P`Pp 03/p@+_@@p@-@P@`PN@  03/@p@?p@-@P@`PN@  03/@p?p@-@P@`PN@  03/@p>p@-@P@`PN@  03/@p>0A-PpZ0P01P0?`0Sl 00C0|@Tt 0SP0 ၻ RB AV  : ` p000G-`1SxMpA 1 0t A001Wpp00 0 0$00(00,0@ 0A0( S :P0  UQ0 R (! xЍ%@ S\`40` 㠐p0`1RU P 1 `@T 0c/ 4/Y+_A-Pp@ `0`V S R @0OXڰ0`00@@@0`0S 0 @p00/ 0RS/ S0 0 0!< 04 0 (   !/HhlA-D`DpP@O0S -00U@`00UŁ00/p@-0@00S00P00R -  P 0Q 0 p@$&b 0  ~&0C0d0N3P 20 0`p@]p@-P@*U Op@-TC\  P 0 P  &}`@3p@-@P R` Q00l=#0`PP0 ù p@P0=P0/G-1́`S0Sp YP@I DP@@D P @P0Y0>00P@ >됧W TRЍQfOP%LPYLPTLP!Lp |4WLPLT) 7>LP L$B^t,_,_,_^ M_^,_^@-03@M` TV 0   n30S& OP B0 rs #PPP  ;0"0 !& 0! " @PPKPCXKP>HKP9<2$b0`K@K7:!#:  : 000@0QQ1KӃKPKP KP?a⾃p弃Ѝ>P@% gKP> KP9 WPP5 p{0 pz`n $yhV!NP=TU GK P`PN>KP;KP04 40 0000U=ܲ-Ɓ-,_,_ M_^.,_^:6^zd@,_O-M@0 S800880S hPP8 830:~QP:>@x8KPP l8dNP0ST @80 0 0S ~?CSJP\30w000000000T00 `) T JJP JP|JP 0lad`8>0P00S J 8n8KQڷ0 0R`A*S 00B80 (0PP0 08(0PP (,00cJP/ 0#t|Z aJ\uLs8~`P'Z %0 +$6 006 #:: 00 40 `!#` 1$0$0[gJPbJPV8\MPG   008`P h# `5 %00[7H D)8~P9 jP`@?. 0 GP +-00_p@-D6+<0<@! a v```@ P 0?P8F. !  q!X  PPP Р   ( X# X X 0000P`1PP0@p400 80<8@PP  ,=pYߍР010804 P00F0p<0,cP`B;>P H1R0!sR ~ |pPP1 00 400 80@8@lpP` `84p40SR40 8✦$@TR4`So` `0Y8 @T20@P @+PD0S1S X@T01X0| ;p@Pt  ?X@070l@ *00 0@0QP P0S p0 0R  O 0$0S !0(0, 0P$0 , *$0 ! >$0Y 0(0 0 0S W[  B % 0 0C 0!  1@0CP(  P0SQ 0 P0S@@ovP 0p 00_0_G1_1_0_-C-M00( 00P00q0PE 000 0~@P xT@ЍCЍ/ S?@X X` p *4X001 ``\    p @`$0$@`BPP804 \@\CRQ f%PU Q@R0 0P7@@`  R XP L0@:$@P 0$ X> 0 X@' A-`1V`04S nA`Pp`8@T 00S8@P 4p0p8pPPUV  0P 0p0 XP Xp`@4 802#T*0 R0 R P8@hƁv1_A-P0 Xn0 p RAPn sA S s `CXDn@H?n@8:n@0p 3nT1_1_<^^`^1_O-`PM PU (` #) Sᐨ00Ѝ    p @$G 1( P,00 00b P 0 10P0 00`0 0@$0$ Z 00 0hƁC-` $MPS@p@ ppY!00H0 0D0@00@)?oV20S @T @@U00$ЍA-pXP@(`m00 T @00$R01 @00-1_Q|P-//0 R/ 06S/`YR@- 0 a ЍHƁ@-@0 00 #3  0 0 0 0 00   0/ȁp@-P@03/0@0pp@-hP@0S03/03/@p Q \ :$0@X@-@ Ѝ@-@  00Ѝʚ;@-@  00Ѝ@B@-@TpM00PP`] 0YV P0SyЍX@-@  00Ѝʚ;@-@  00Ѝ@B@-0a @$ 01 0Q1*S10Q0 0kk`P0 @$00R000R 0P0*03/03/@FX Ѝ@2SD  0 0(kX0"2_Q2_ȁXȁܲy2_c0@-0@AȁA-PЭ1@ RR $0$ "?o2W0S A$@$ 0S p倀0x`000 0~\堭@THڭT 80800"#eȁXȁQMbSX2_0M0000Ѝ/XM-p0Mw 0 ""$ O!$" (@,$[`3# 0SP@S  }"! ,  L `I \@  Ⅽ R   4 0 !i0Ѝȁ K@xȁʚ;2_1P; @- 1CP2 1 @@P+0P@ 000P 17P$0Hp0 | 00  |0-/11(@1(|0:0 0|0/p@-H0@PP0P0!0 0 0P0 R00pXO-@Pp`.0$(0,0 0#   \$0 z$ $@ \ 3 Q\ P0 00"0(00(,4S0$P \ P \ P 0  L P0@ rPpQ0 jX@xʚ;ɚ;0 ,p@-d@ 0$ 0S 0pP P0S $000S4/p@ȁXȁp@- xͫp0p@Q0}/’\ \#3$0P4 8@#4i03/p@0/ȁXMbȁ@BX2_0S0/0C-DM@`p(00<  0 80a0,$@ @@ @PmP00H0000'>a0,($@ @ @<08 ZDЍ"3_R-3_C-Mp 0@P`` 堐c6t0 00  00P 0 0;?oY20S 0S0ńЍ80< 0S 800< /bp@-@B@0`0@0b,PU 80< 0 rap@*aPa@-@PP@fN@-P@`0S 44q4a 0S@0 Y( 0R0000 :`0 b㈘` 0SƂ 00"#! "#1`P&3 $103$!30 3/ͪ0 00000@000MbyX@-5h53_0p@-`Q@P0 _20`, mfupV20` p@cfL_ _0H-@`,M0噪P0S? T$PU? ,YO80< 0 80< Ū bP@ ``H p@R D1 pP000 1D H勗pdW  b !0  t,;`@0I4`p00 0P00000pap>x70S2 0R 0(0 0 ,P0$  R 0(00$P 0[=P`S| Q 0   P`?ᔗy]3_e3_L Ѝ0V @@0T@S 0 |0P 0P0 T0 0 U SL@ V @ȁyRRRȁ@-@h廨0 0S 00 @0S   $T[S@Kyp@-@7SPGSpp@-@PS@p0-@- p@ 0P` 0,d0`00_^PЍ@Ѝ/s@-P@o00`V ᦨ`L^ 0  0Ѝp@C^R3_p@-@8P團 3 $!嫘-<_00p0S/p@-P@ <:,0S  (0 0@0(0^p@i0 0R0000 000 @0S  Sp@-0P@0 0R 0(0 0 F;P^pp/p@-@PPp0Sp]@-X0@SHj@ ip0S/ R/h l00hȁDy @-( 0   x0@yȁ RDy0 ,P100S//姧@y@yA-xM⟧p@TէxЍ&Rl00& `吀0S p Rt00CJQ0S\00\0x t0000x0(0\0\P0 Sȁ0@-P0 4MQ003#:@ 0 0S$0 ( @P0S00  00U  0@T4Ѝ0yX0 0000 0@0ZP H0L 0P0S 0003/(@ʚ;ȁ0@-@,Mh0003/80< 0 @0S P00$,Ѝ0@YX0S P 08P@yX@-@ ?iP jЍ \QC/ɚ;0@-@MP ZiP0 Ѝ0P@-@ P P0 T0S000305: 0$Pʚ;ʚ;@-@ PQ  7jЍG-p`@M00  0`@uiP <PT 0 00 @Ѝ R  T@0@C0 #PPPU 00Sg  hP $ 0 S (0@P0R0P100Q:UGiP !S R(QQ\( 0 BR0 \00 \0 0 Q R^ 0 R R 0u{3_ʚ;0@-@,MP uhP0S00 0MPQ 0 ziP,Ѝ0p@-@(MP` Sh0P 0S000, PQ 00 00(Ѝp Qi0P @- R R S12S1`01 0:i Ѝ@-0@SM 0Q  00(i   iP Ѝ0@-R@P$M 1` laT U  gP  @04 S#*/00$Ѝ03_@B@-0 ЍA-@QP  0!l`Ap0 eR pW=) -` p`0UP0 S00 10\00 1 p 00 00\ @@S0P S0."? Aඁȁ@BZ{c /ȁ?B0p@-0M 00000` 0PW@PP  ag0P@0S!Q Q  gh@0ЍppC-P `0EQ@P XP\ ` e HUp0Sp0 0@S((0,0,0p0 pTRȁȁ0`0X00CS/@-@8}X0S000S(0S, , " @y@-@X00CS@;0@-@00S &R, l00& 00@qGȁA-X0@0CS8BPH0L 0P0S % 0S'H0L 0P0S 0S H LHPL`PR3PPpX2\C  R  @p S@0 00TTS  SH L HLP H LPPP QP H LP0Up RH LPPPL\P RH LP0 R  @HH LL RH LPPAQP R H LP0@yʚ;ɚ;6ep@-P0S H LA  R5k9 SrEUz $\RtbE#P0SRX Wp W xt 0xt00  0xt00W W @ a 0 00⌠A@ eP ]@-0 Ѝ䠃@A-1`P F?o2!R0S 0!RX00CS 0S 0SxxS 0mHHL@LpH@L@PPp^P@HL@P0ɚ;6eG-0M`P0p @?o2!R0SPkeP geP렡P`AT 0ЍW 8H0L 0P0S? X0 CRV9S H0L 0H0 PL  QP'0H00 L 0P0KV vH L0\ H0P L0 BRP d\0HL0PP0S p nS0 $0ɚ;6eʚ;p@-@HM` cP P1U(P0 0aPU (dHЍpA-p`?o @2!R@@TPP3P2-@-@ M P d ЍA-1@p0Do!S``V@P 1S0 S 00Q)p@-` MP@0S PP  0!  Ѝp 7!!04 ?A3c00?A3c0/Mb0@-@Q$M   P 9d$Ѝ0Q/ЍO-MP`&dP"dP@p0 0PW 01S 100[%T zC@W FpU0 @ U 0  0t pxP 40匐P@@Ϡ0H0L0P #0 RQ @ U U% p NT#1HcP H L d0H PL QP H LPC6e ]ɚ;C-P`U@p,M0S U obP ,Ѝ p01P  ?10S/p@-@`1PU V @T h00P 0003/@T ,00P 0003/p@Tp@-@`Pl0SpG-1C0(q_@@XP`X R00G蒟 00 CQ'Q QC400 0C?ƒ10Q0 0 QC400 0C?ƒ1 QC80#ꀼ@-0@ Q @?6@f;6p@-d`P@TL'| R00 (  03/"6֒ȁA-l`@pPU pW0P@@0@0 0RkP P @-aop@-@P" 0R| 0 00 0 0  @  1 Rp! 010 00p Qp0p@-0P0PT~P@ 0$ 0p0SpPp0 0  ꀼp@-P墒@Tp 0R000 P 5L6 L53HEH#l0S 00OD0S CD5:ꀼ]7_0@- @T0 Q POQ R 4OR        7_7_G-`( 0R7 P1@P3 0YppUP tP P g 0 00|~O^p Ps#  HP (03/PЍ(S8_'8_h^58_>8_px^8_@-D@ἑ0S Md (00 !@ȁXMb @-[@o00 00000/0@-@M 0 RP$U0S0S   Ѝ0 Q0 PPp@-@PP`D p0 RP @Tp@-`P@PpQ 0 R P0s @opppp@-P@Tp0 RP @ 0!< 04 0 (   !/Hhl\ P/0 !8 00 (  , !/Hhl7@-P@  0F |0|Pxg d0lPh \0< 880P@00@0<000<:HkZ4P Ѝ0ȁW8_^_`-S^7S\^ "_8_-|0 P 2Pf2 0@00嬴00a00h0l0@P0<043\0 0PpST U 0Wp0 0 01S PU 01S PuG~@,ЍpW1 00S 00C 00 00妏 2a 0S 0R `喏 2LR!  G!00S  50 Sp x0p%0%0 UC0PPC&P PE0S L 00"0CQ 0  XD$0  X0480080<00<00S 0P:2D0 D 010 D! 0H "HX HPUp  2L200SN PPK 00 X1 `P. 0S 0P0H  pP  i R c 4  0Z lY&  LH 0A P8_8_8_8_8_9_9_ T_9_#9_p@-@P`0Pp p@0/A-`0P@pz Q A 0P1 P P O-`p000,PUiX Ѝ@0SP  R@ 0S 0CSP  0\P P [ 0 ;/P  Ɂ0@-M@P Ѝ0O-@P`p||0S Ѝ P @pU 05/T PX^ "@-@ 彍0d000D@ȁA-X`P6X A/p0@,奍0p P0@@Aڍȁ@-@<啍P0 SP T0 0< X @T@<@@ōȁp@-40SXJP`0@4t00(0P `D  @D@p@觍89_ȁp@-h0P0Sp@/`0@4T00(0` PL  @L@p@臍Mȁ@-@LAP00CSP0 T X0,R( X0<0X0T C@mȁɁp@-P`&@Tp@p_V0  4 R SD   P 03/S0 0@ȁp@-@$P@Hp@p@-`H@Tp+z R0L0 L !P 03/<0(J0ьȁj9_A-0P0`SxpP@ 6/P0S 0S @T/@T0` P0TȁG-@P塌A堁80S-ٌQ0SJ`PPUJV0Ta0PPHEL1@0 X  倌0S PG巌T1TG  Hv@ @0R :<RP!`%`56/8pW 6//0t"#0^B6/Tp3/P0 3/P` R0T0  /ȁMb^ܲ9_^^9_XsT oT9_:6^^$0$$08S 0  bܲ1Sȁȁp@-@PHT 0S 0AT 0 0 @Dp耼@-@LO0A-P`U㰀q@-+0S 0@T 0 0d0S\0S #S`0S (0A̋ȁG-MP8 `p@PH3I 0S0 0,20SV 20SR GVQ$I]J01,XXpP]100 00Z/t0 03/HxT\>B4岋+$oP`嫋V<0 I5UЍxI oI JW 7/pP 0R  P0 4S 0S p9_ȁM):_<:_Ɂj9_H Ɂ":_3:_A- Mp` P @P 0 @@ ЍU H00S <00S 2Gs5/01,IȁM]^@-$M@P8 `p0 $Ѝp@-PM `l @P 0S0 0$0 03/8崊00\0yA f}ЍpȁɁH L0.ȁG-@pᗊPPU`0S23`0p0@PP \ŊUL倊0 0 4幊$x(`P>A岊PЍb 00 0娊50S0S<0K 0SH 3/PPD0e0<00<0Ox!L0|.h刊64P 0(0S 3/,Y.0S  H00`0@i 0U0C 0   S($0S%h-P  GP  0R P 0S0 4S  +00ȁɁ?^L:_p@-@Pp@A@-@P 7@-@/Ѝs@- P`@P 0 0@Ѝp/H{:_@-@P @-@hP@@-000 Ѝ(S@-000 Ѝ()S@-000 ЍZ@-000 Ѝ Z 0Q/P /@-00 0P Ѝ(S@-00 0P Ѝ()S@-00 0P ЍZ@-00 0P Ѝ Z0 Q/S/< /< /0@-S@p0S 3/P <00<0/<   /0@-S@t0S 3/P <00<0/x0S //x0<0pt 0<0/0p@-@Pp0t0<0`0<00Sʸ0Sp@-?>@-@e0P|0S@/|/A-`@ֈpȀ<0P 0S#Q003P0 000>00C0}?p@-@Pᮈ00CS00l?p@//<0 0S /0@-S@0S 3/P <0 0<0/<  0@-S@<0 0<00S 3/P/0S //00 000/0S/@-@3/00000/< 0@-S@ <00<00S 3/P/<  0 /0@-S@0S 3/P <00<0/)00/0S/@-@3/00000h0S p@-@`Ph0Spl01S 3/P/G-lP 0hpS A3+0`S0Y030#@D 0Shl`W + P0!!0A-P@l`hpT1S S@ R Th@l@zA*1GQ @p@-P @4P0P $    $  PU  U p@p巇Q P  80R 0 Q P 80R 0 ꀼp@-PV0 0S S, S@@凇p@P`F``V80S@@P``` 0V80S@ꀼp@-P`@P P p@@-0@Sl00@p@-A_Pp00l` `P@pr @DP(DPDɁ:_W%_O%_@-@=@}@-@0Ԇ,0@T $  B B $ @ꀼp@-M` P@P U , 3EЍp R 0 R L0 QS0  )PPPP :_p@-MP` P@ Ѝp U @P C-Mp `@T ЍTPo//0@-\# R P 0|@ 5S0P4C0200 R 0 @b34 P000T0B00 b B0 \ /-L \  QG-@0P00P00pP"!bHUZ :T0 JPZ T 0 T0A0U!O-@MPP 80P6#bP"ᆡ  80P 0Fp 080Y0S:PE pw V    r R:V  Ip 0 0CS005Ѝ 0 0 0X*6B p:_O-RMP`<p W0HЍV ,580R#"  80Q  HY p㛠!0I@ 080T R00C0 @t Y    0 CR1!p0TAY  p `F @ 0 0 0;_A;_0 b B30 @-A00 00/j;_O-Mp@0@#0S0PD0R    R# 0 p 0A | 00  @ Q'r H 됧# I  ` @ V RЍ JR1!qdwAY  0 PE1 `Q05 000 00;_;_A-P` pW:#'0@ `'0`rb@-@'@'7@-@P 0P S $p 00C 0 Ѝ0  7@-@P 0P S@ 0 Ѝ0HO- RMP8`<@x ЍOX Ѝ7  p WTpX RT:#p1 00I"00T0X0S 0s T :  @0 @D 0 P @  0`@@-@P 0 S 00C 0ЍpA-p@=`P0T@! X R BkЍAEp@-PPU@000p0  R: FP pC-P0@M 00`Аp̀W  0S" 0 00  00Ѝ  0  P v  0  Pp0 00 P `^^^G-@Ppl@M 囂0 0<00,p(P$@ @@ @P`<@k<0S 40p0 ,0L00D000,0(P0$@ @ @`S@ЍɁ;_ɁlS;_p@-@P$m 0 P @ 奂pɁ`p@-@\^ PU H嘂Pp8 0S00  0S00凂Ɂ`O-0Mp`M 0CS0?`(5$$P@TW- + + ra 0 SU  SۍЍW  P UP 0 RP@\U @ 040 05<%`@03/<_Ɂh`"<_(<_0/0/0/0/p@-@P0Pp$ P *@-@ 03/(ʁ  00C 0@ %Ɂ0/p@-P@Ppp@-@P$ I ᠁70 0p@<_@-@ᘁ@7p@-0 P@ᓁ0000@0@00p@Ɓp@-@PჁ`0S0S00 R00 00C0p@讁U7A-@`pf000堁V P[00CS08ᑁP U P0 3/0PP0`$0 0!0 00 /Hhl@-@pMP7 0H` @00<th$ c$0`07 +P <>8 h1 S(0Z?00Ѝ+_I<_d<_[_@-@+P j> 7$t@3$x<_@-<0DT 0 !0  !0@- ! 0 !@-PDMp@`l+ 7gIS+0 000007 +P >7 0`DЍ<_p@-P`#0@`  +ptSsSO-0 00!4 Ѝ0 0  (Ѝ/X[ S& @-0@(M0T (Ѝ@?@t03100P (Ѝ@?0  < 0 Ѝ  0l(Ѝ/X[G-p@ࠟW `PU0``0C00S 0WP1R 0S0 P0pG0000C00 0C000 0  cX[ 0S\* A //O-0SQ0+ P@p`V `p 0T 1!Q ϻ 0R  ^P 0 @T   0S  R `F P0 Ѝ  X[@-P`p@P0  @ Ѝ@-P`p@P0 &@ ЍA-@`pfzPPdz@ЍZzЇ@z,zT0 @S\ A?<\ 9? >G-`p0S0 0@P202E@P0 SE@20C22S 㜺1 0r/DD/D/DD/D/M0P PЍ/  /M0PЍ/@- P P R:H0R 0R  0RЍTVRPA-p `P@T X@0 8/P Ѝ00/@- 0  00 Ѝ//// /$/4/Q Q Q  <0@o/<9@o/</<!@o/D0/P@/@/H/P/P/@-oP/P/@-oM0 Ѝ/   /@-PMp`0 p@PV 04/Ѝ@-0`S@ 0S0000000HPP000 @0100Ѝp1  0S !S_.B"B(BPP OPT10L1P) =3;0P? 6;0P"`V) 0P" 0P`V 0P90S /P qP  00@T =_atadrbmngnts@-P @$Mp`TU80pP@ 0$Ѝ WP0P@-`Pp$M@  p PAP $ЍPUP 10SS 00T00p@-(MP`@ ` Ѝ P(0 0CS"00 "` UV000! R 0 1   0RS "(Ѝprbmn]p@-(MP`@ @` ЍP 0R  "30%(Ѝprbmnp@-(MP`@ q` ЍP0 0CS00 "` UV00 (Ѝp1  0RS "rbmn]@-0 0 0  00 ЍdЍ=_0@-@P$M & PhP$Ѝ0@-0@-@P$M  PRP$Ѝ00@-@P$M  PAP$Ѝ0@- Ѝatad0atad@- Ѝgnts0gnts0@-,M@P 40P 0PO@o,Ѝ0loob@-o@-@ P@Ѝ@-!o@-@ P@Ѝ@-0o7@-P @(PP@ Ѝ0p@-P M@`$`P o Ѝprbmn@-,MP`p @|0p ЍPP@,ЍrbmnHHHHHeH{HcHyHA-`PpP P1 10RQ0P W4 @0 00RQ0@ GV ` 0  0 0  0!W\P0 00  0!V@ ˁ@- _v@0H,ˁ=_O-M @ 8PRP@P t`Ov0ZV 0S $4$0S?0 SJ1 @*Q P 000V 0S000S00 0R0SRV SR !R @BvЍ# !RVO!RR 0 S  X 0S ,P  0 0R P 3 !2<0䲟 01S  0  a0S "2"0S 0 Sll81 @!RR 0 S  0S P ౟ 0R P 1 !jq1n<0刱 0Y@   010 0X 0!0 S @K P%  S! "+0 0P}  K㌰0 %P t00 P 0 0 0 0  @  ˁ ^]=_ ^ ]=_ p@-@Pu>p@:uˁqp/<0M 40000P0000Ѝ/qp/<0M 40000P0000Ѝ/ @-T0@00@ 0   PЍ  Q @-T0@00@ 0   PЍ  Q  @-@tT00Sڰ001S 000 \^  R @Pt@ 0DP8AT @tˁ  @-@P@PQtL0H0 0P@\@t 0ˁ  @-@P@P4tL0H0 0P@\@dt 0ˁ  O-PP' `@pt0S000Z.  P% 0 R 0 B RPUl1tPh00S\001S V  C0@0Dt Ѝpˁ  O-PP' `@ps0S000Z. h P% 0 R 0 B RPUlsPh00S\001S V  0@0Ds Ѝpˁ  p@-P@ Ts00S001S 00 0P\ 0S @P@lsPp 0\ RP !R P< J4L @sˁ   p@-P@ T;s00S001S 00 0P\ 0S @P@l]sPp 0\ RP !R P< J4L @Dsˁ  qpO-MpЍ@A Dpq2(10T10 0 010`V` 2V @T% 4/ppU 0000T0 00PU QU $@P @00 0;/ 0pS  ^ˁA-pP`P ^ 0pA/A-pP`P p0A/@- x@P00$0 0000/dA-pP`fP p0A/A-pP`TP p0A/@-FP(@-@P(@-@:0P 0S @/A-aP+P a0A/p@-P@Pp 0Sp3/pp$Ppp@FqpO-MpЍ@A Dp~1(10T10 0 010`V` 1V 0@T% 4/ppU *0000T000PU QU 4@P @00 0;/00pS  ^ˁ A-pP`P ^ 0pA/A-pP`P p0A/p@-P`P 0p@/pp@-P`P 0p@/pA-pP`P p0A/@- @ oP@0/@-@e0P 0S @/p@-P`WP 0p@/pA-pP`HP p$0A/p@-P:0P p@(0/pA-aP-P a,0A/@- P8@-P8p@-P@Pp00Sp3/pp4Ppp@$/ 0 6/O-@M(0嘱p#09ᡱ ⃡P@Dlqa` d"-`q0\!PT100 0@7/$08`_ >_H>_5>_M>_">_+>_@-XP0Sp@-@`P hJpt Fp0|0x0X0 0\0`dPp`@-@f  >`A-@tP`p'pP@T @ U@ 5/@Xp@-@`C P 0 0fT @P@-@toh@o`Z```LG-<@Y800P$A`Ϡp ?J V: `V p0 W$PO-@8<M Q00Ѝp0(  R:8 R ( X`Ϡ !R F f5 $8 0  / 0?V;; 0 4; $U *PU0P  X$P f PV FP< Ơ8Y X` : 0X*0 600 ( 0$8 0p@-( \:P80S @<4;$< 80(0$00600<085/p@p0@-@MS 0 0C?o2P R R R4 R1 @Ѝ008@P|@P"080 S  `"008S>__>_A-hfMQ`P! Q4 Q, sv 3Qe B3Q ,7C0CQ 0Q @tpn PUV` J`nVV@ 8@?fߍ00@ <# T2QQ1 f/ (R@E/y2QR 2Q 60Qr  fߍAVO1Qe  fߍAMQf/@ 0 S0;30?`aV! 0S 2     *! R R 0S fߍACO# YP :O<?`P3a:@pVp 0 tWp0pGd @]d@edAd@edA|dhd ydA-0`S<$0@b /o bX c0?o 0c\0 P$0 ," S  R Q 9$!p { R ("(n R ("(f$ R 0f< R ^@ Z tV  `^3U `  = 8VA%>_?_>_>_>_?_?_>_n_)?_0 60/80S/p@-(0@S ;;S0`s- P S  R8S|P peo(0aSR a#"P R 02UX[f/'p"2P 0R*pWEVs@-P p5 `@PA@6 #:@$:@ P  |y*x1 3!@P TL034k0 ,}( Ѝp M_]3?_@ P?_0p@-M0@P0( `!Pi0P X <2 CP*P0 Ѝp00 0 !Pzd@hd A-0(M pP0`!@P. 0 !@P&`'d0' pp)q ap ?(@0T p6(! * *U (Ѝzd@hd l?_^p0S/@-l0@ 0P 0 EP0p0Ѝ]@-`DM@{PP `& l0 00S p0StP rp0pS0l0@0 0p0,pP$0000m4`P0tpt0>DЍ00@-@A-P10M3$Pa 0S] 1 0 00S60\!}& $0+@P0pPE 0  @@0@0@P  *0Ѝ 0(   |! *PU$0S |jl@j`P%0 0z?00`0 z?80&j j@ @~s^y?_]S?_G-0` @Xjp$PU 0S   0jX 0}jHaPP00W   ' P  0́   @- @0 R   $ R 0 $0 00 0@ :70́p@-SP@^0S Q)  B  0S0@@Pp^  \B  Q `P^  0S   p@^ B   R @@0p@-0 00   00Ѝ?_0́G-@Sp P$`0  ; ,P00(@$ P$ ERPဠ ip0@T@@@Z0 000p0 $Q0$00$a PP?_p@-@Q I[i0pp@$ PU00 'O-0ASD0@ S@:`pP P) 07i0 R  Q p$0eiP 0S:    PP Ti Ѝ0 #PEi0 PO-LM@|P`x 0P @0% |0t p0(0000|0@0,0?o20p00c 0p00C00C 040h40t @Y i@LЍ0 R]S Q:tp@L@ @@Q $K8k<Et@p ADRC E$  3 # \  R [~ , R  B k B Yi \hE @#@3 \@T@ \ (0S^}|0 v p i@P h@Q*0  Q3# Q3 "\ [& 8< $LYJZ@#@3 Q@3T @ 0D@ @t@S0 @T\0AQ\N Qࠑ@0 P#3 TP e 0 RQNR @ 0   Ch0@@2!;h#@@0@-,( $ Ѝ@-00$  0  Ѝ@-($ @0 Ѝ7@-@PxC%0g0\00 R#PU0  Ѝ0@g D#P Ѝ0?_?_@_G-@P`pH:`P 0gQ 0g #$ 0S5: RBoSR 0S   GV BYSPR*SPE P  0PE 00 PS0``0 g)@_N@_P P @-$//l@_-p0R( >C 0CR$ p0R >0R >C 0CR0p 0S00 \PZ0L$PBU 0PZPp p@ 0 p@|f~fx́́A- pM`PZ| 0R( p@T1 00S 0E0C@S@1T( T@# p00S0 SphZ P@LjZT W 0Z#@ЍU@P Zx́́p@-@T P,0,h0LZ QWZpp]x́́G-頁@0MS㠠$ Ppx1 R0S! 5S-@Z@W 00@ Z ` P@U`1UZV @0@0Ѝ 0`` 0  00  00P 0 0Ӡ@PEUP!U @ 0@S 0 ET0p`FP@x́a0ƁQ/p@-P0 @AlP Q PP Q @ 00H0px́a0O-@P ЍੁX0 0xੁ00@-DM000,00(0L0 0D0@00P0<0A$ <0< iDЍ0+TC_@-\ l XX! S*l 48 DR  l  Ѝl]C_D_&D_O-BRMP `p YS@T S000[ Ѝ0ࠉZT0 0lT0☫X0p 0"t  ! "@ #H #L $P $< %4 %8 & k& l' l' k( ( m) n)  Q[ !F P$0 000S 0 T0s 1S0 卖RT00CST0 [ @0S ( , İ İ ذ ܰ ܰ 䰝 䰍 $ 0 4 00 0 0j́́p@-@PTp0!5/@GD_ 0!< 04 0 (   !/Hhl\ P/0 !8 00 (  , !/HhlA-P`p0t0@T @㿋@DT0V`00@ sT0ЍX]A-P0p01A`pQp 0 S 00000V 0 S 00000A|Sa40040Sa40040X]0@-0$M @ 00P0U: R 0U  000 0 0S 0S0 00 000  0 $Ѝ00 @ U 0!*  0 R 0 p@-0PS@ 00  0R :p 000 0 @p 0 000 p@-0SPp0@ P\ `R` 0 `7@-1PS0@ @0C0H00CH00S   t0@ 0D S 0 0l XX0S0P<00C<00000S000 Ѝ0~]hD_0S p@-E@ P0Rp/0-Q$M 00!  0S  0 R 0  0S   0 R 0 Q 0 00 000  0 $Ѝ O-M@P<0@U`8D0  Q0 Y$ $45%0SP0 S 0 S:00 0  P0 c0?o0c 00SQy V `@0p00800p ppppS@@T`臁 13/ pցՁG-p0 @0 0 P  (`,(0, 0/X(0, 0Q L000C00Ѝ 0$ 0 0$ P@  13/P oV 0 91PX]X[A-@Px`)L@pPEPE804P"8%< 40R:ARLop@-@Px` LH0,PU< 40R*p@;Lp@-@Px`K0Pp@1LA-`@xPpK? 00+0`@`PPPEP0pE8AL//\00S /@-X <!t  L  R0S @-K@ḰO-PP@4MAl4ЍO/lR7 pR7 cR sR SR0 RS 0S# 0,0,pW4/X0Z0l $ $00 0000000L0 0H00<0 0 4/4Ѝ`0`t(L4/X @4/<080804 ,4/P0 0@$4/4/00-4/X 0S 4/ 0S 4/ 0S 4/w0SE4/V|4/W P` 0FNQ  0 `$0P ZP4/ 0@4/4/Y 4/QUz  4/`p0W:P4/ r 0l4/p`\4/E_E_E_E_E_F_1F_dF_F_F_F_G_G_*G_:6^IG_kG_G_G_G_QP1 ! !1@11/ qQa 0 [ V 0 V03SpJ0 0 [ V 0 V03S00"    +]f]L]G_w]-0@-M PQ0$@ @ @800S @ @vFЍ0@Ѝ/́-@-T031[  1 0S 00 00 ZЍЍ/-@-T031[  1 0S 00 00 @ЍЍ/-@-0 0001Ѝ Ѝ/s@-P@`0 `"Ѝp@-@-   Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/ -@-  ЍЍ/ @-00S@ف@-@P`00 `TU 0P0F%07Ѝp -@- 00 ЍЍ/G-PP`M <!1 @P >`Ѝ  00 U00S`C 0S. z,@T@p T @@ 0R# T d  R  /A!b CQ00 0@!@ x @T 0 0 `ЍG?@1c  p U 0 <^gfffG_@-< 0 0 0,0" }@ فf] t@-@@-?@-@P0 @ @ @800S @ @!Ѝ0@ Ѝ/́0Q   H_H_@-`@P 0 P000S   Ѝṕ-?@-@P@P 0  000Ѝ0@ Ѝ/ 0S LP P@@-0`Mp@  Pr0 Ѝ0-@-0 000 ЍЍ/-@-@Md0 4 0 000 [Ѝ@ Ѝ/M^@-P`^|10S A3S  lPT Vp#T212@00@00A0S<$10SA0 00S 0 0Q000 Z#p0 Pb 0 pp0 0S `0` 0Q01]P/0 `فف́|́a0VH_ف^:6^.H_-@-`00/s@-@P`T 0 ,@J0 `Ѝp@ܲM^-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/@-@x0P0`ppT 0 H@ 0 `$00S Ѝ@ ЍܲM^ف-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/d008S/s@-@P`BT 0 ,@0 `kЍp@9ܲM^-@-  ЍЍ/-@-00K Ѝ Ѝ/-@-   Ѝ Ѝ/A-0@0`p ppP0T00 0 \@~0 Hy0  0SЍA)ЍܲفM^^H_-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/@-0@0Pp` ``T 0 H@/0 p$00S Ѝ@ ЍܲM^ف-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/ 0SA-aS_AOA@(p A01 010101/A-a(P!R Ap@1!#880Ro(A$1 q0$12020PA@@-`R( q@_@T0  (0!R@D!!!R Ѝ@@A@@ tP @a@ Ѝ0 00|P @€p00S/@-`0`@0S@0D 0 @0D @@0D 0 @0D @@فԼ€|0P-  !T LD.!      /Hhll 0CS@-T0 !< 04 ,   !/xH_Hhl@-IP 0Pp@-4 0P@4OoBPp$0 0!0 00 /Hhl@-<0DT 0 !0  !0@- ! 0 !p@-@P` 0S@ p R0@@-@P00/p@-P` @6 ?Pp@-@? _@00/A-@Pp` 300$0@p#0 <AA-P@`wp 0S00  0S00 "x0SA5A-@PpY` 00@000#0 A[0@-P@`xpM00Q ` 0 T9 0S0Ѝ9? @r?[Լ\yT?/0 0 1PS/ /@-e @?00@-H_G-@Rᜐ ? PU``1S `VA PQ pq  70 P00%?`{Tp@-@P>0S` p@?0U* `V 0a@-@@ >p@-`P>@Tp00>`0S   0S>p@ s`p@-@`P>@T 0S@A @>pP/0S /O-p`Pz>0S R 1 ЍO>>i>@X:> 10@X>@T R A>>  ЍO R !0  R   n>l>T  ЍH_@- M@ ` 0 R0 00CS0 R=9 = 0 Ѝ@- M@ >0 0S 0  AQ0S00  00 Ѝʚ;@- M@ 0 0S 0  AQ0S00  00u Ѝʚ;p@-P@P@ˎp@-PM@ Î0 `\0` p^Z\k` 0 R S Q 0 Ѝ\ 0S AQ0 0S00  00,ʚ;A-qP M3 Bq=T t13AT \=@ ЍI@^=000 ^==0 000@0 0B@P! /00B! 0㨀!!3Ba4=T 7-Pi=p@`^b=! @ 00P P@ፎSʚ;@-P@ 0 00   `pP10e 6 0S0  @P0S0 0  00Ѝpɚ;ʚ;C-@` 0M0RPЍ0 QPP pYP  R0 AQ@XPP0 00S2TP Ѝ000 @ 00@- X( b0A*(P Ѝ @- X b0*P Ѝ-:$M: 00A 000   0$Ѝ7@-@P3 X0P4 R0 40 Q Ѝ0@a0U -,^ :!!<  12QX0 0( X 0 p@-@P3`Qp@31S.A-@pP`m30 00@3ЍO-s,M@0`PVP`$ 0+t3B E3 A3  =3404#C8("<pXw/ 0C0CVp40 2p8<000Td0ai@PY `h 3d0H0> T`X` 0h0J1 Pp@W U P!T0L0X0$ P0\0 \0q``a a,Q吩1011410Q&3*`5WpF&8!U. P0`Pd PR0 r 0 PSD d0 $SP= F@,Ѝ`QH  B(`z`1QES 0 @APi h00<  W0O< @@ Q ? P q`F pఃd0 lL2( @,0,@SI$1((0(12 @ہH_T|TH_H܁L@-@`z0$MP00 00 0`0@pN0 00  0|0|`0@0p `0` (X00P0 `0@00 08$Ѝ @ہ TPTI_NN I_ 0I_-$M<840 ,(0 $Ѝ-$M<8ƌ40 ,(0 $ЍQ Q Q /1 !C//@-hI_00@-M00|0|@| 0x00c00PP  TTQ㽓 <80 0 Ѝ0@ғ]@ہġT(I_]4I_TX,,00 C#' ,00/м000 Q0000$  B',#  /0A-@PM` p1s0 0 0! 0?P W 0  \ \0P  PP j1TЍ$ 0  0 P+_T^p@-P@X1 P1A-@PM1t0 3R 0SP` p&!VU Au1S0G-0P3x0@  1p `V 00 0R1`03/V 10 0 0 @-@G@Qs@-0PQ0 7 0@S 00 `0ЂЄ 0S 10 @Ѝp@8TO-0Pp,0 `0@ `F`! P (0P@0 0 PP PUP@0p@-P@0000PPJp@0/A-z0P@0S 00 `06/j0 0$ 0 0$  $0RP#@€€@-L@L03/@K0`0d 0 RS`0d D@{0€€A-`pP30@"^\Up `0 0 P0 @0 00ATO0D0 000  0€€ 0!< 04 0 (   !/Hhl\ P/0 !8 00 (  , !/Hhl0@S@-50 /mI_@-DaP@MT;0 (H /1p0 @; @/D} Jg Eg  @g ;g0  00e0 0t0^00dV0 0T00000<0Ѝ€}I_I_dTI_I_^I_I_T\00S/QA-H@H@`PQG/p"R0:A~/%Լ€€ 0h 1=h€G-pP+/|@X\`&V\U0 X0LL0PTp/P 0`XPh0\`R/€€мC-`0@0PSX 4/X  Ѝ|0#2q12`03"p'qrX Ġ 0 0  ЍCԼ0@- @r괶TG-P ` @R 0Y 4/Y p0#2q12T03"p'qrY Ġ   Gc GVԼp@-@P.000CS00.p@p@.p@-`xMV 0@S x P 000(`(0i. ^.xЍpSC-M 0`p` @HP0 P 00 00 0 0@ u?o2P0S RR! %*ЍC-M 0`p` @P0 P  00 00 0 0@t?o2P0S RR ЍP  0R://O-!\ PU3 \\0\ PU0 0 0 @\ \0 PU00 R \\ PU  0 00@-@R 0Sb0S] 0S_0 R @0 R  R 0 \0000 R PU \ PU 0 \ \R  \0\  ^  0 0 0S 0 R  R 0 \000 R00 00 R @0  R  R 0 \0000 R \\ \ R R R   \0\  ^  0 0 0S 0 R  R 0 \00A-S`@1 \. P\P\ p^ 0S0S0SP RPP0P0SP^ 00SW \ p^ 0Sp@-@P$`+@ +(Wp@I+p@-`P@0U S0PP @ p@@]pp  P 0P@-@Qp Pp@-@PQpp0 P0@ 0R  R/P R/0P/ R / 0R  R/P  R/0P/ R /0S/Q 00O-p$ 4M* 0SPX *`%ꔰ[Y( @`@P  (@`$ W*0 0`P ( *4Ѝ@A$@(`&Rl00& 0T0C 0Q `9*h 0l0P$0hP P0$0m* @+*00 e* PU T`h0Sr`P@$`(Pp@-@ $*P0P@ P00P0H@PpO-pP`$)@T @,*T ) $*000p ),Vp) ЍG-@Q8@T80S <`)P@0U:)@8080D0@0))GL80兑P p W 80 0   Pp@-PL@y 0D0<8@0 <w)08 8  0 S  i)o)80S )p8@)A-@`P$p[)h`0l0@h00 00 00Q0)p@-@$P`F) @T)p(0S H0Sv)p$P 0)$0Si)@H Rb)h07@-P @P@P 80SQ)@ Ѝ0<00J)18P /p@-0P@ PP00 p@(I_@-@(@0 @- @(0 000A-`@p( 0S P 00 00(A(QU q(00CS0(`(@-@(X(@(@-@TP 0T0 @委d0@-p0 0lPP@`TV P Ѝ80S (V P@00TP TP0 <0@ 80(V  id18P /O-pp3TM`3@ P00?STЍ,0S 0S 0SV$0S S8 S `8P3 $0@ 8PH0P @@    Hp p'X L尵T!`P@ `P80S '00 000(T` @p`}D0<'80!0S0 80R1``80a8000''$y 1 P 0R,:' 0  @#T0T0姓W W  'T0T0TC0' p'0Y00000'1d0SS  S/@- @P1@8@- @P1@8p@-P`6' 0SS w0 000np@a'0AT '0S 00 000CS0L'`G'@-@'0TP0p0XT09'L$@w@- @2&0S(P@ $`d&#& QT R00 00C0(00C(0Q&(pW($G& && R 00 0 0C000@0@00/&,&%$pW $ %X &Rl0 0& $00C$0 &X .R00 00C0&J_O-@Q  } 0 03/@P0W0>   @ `3V0 0,Q * Q :@  0  @001 001 000       @u#000 S 㗎0㬎 00C 2 0 0 00 3/@PW 0  "  00 0 0 3/@P 00 3/@0@ 0@00 0| 03/@P 0 0 0 0@ 0 3/ 010 0 0 0 03/ 0@0 0 0 03/@  e(0`S10 0ሏP@0+@Q 0 03/0 0 0 0 00 @ ]@~f}f3{f@|f@-@P ip p@-@P0P @ 003/@p@-@M P Ѝp@-`@0P @ 040S-@  3/@p@-$M@P @, 00`V-@% 0 10 !0S! S S@ 1៍ 000 00p qᬍ 0 006/@i$Ѝ0A-@PP @ 08Q-@ b00 0`01/@MЍ@-0@0! Ѝ@-@  @nP0000Ѝ7@-@P 3nP P Ѝ0@-"0`p SB@ pP P`0 @  O-@oopb W T0!03SP (0S0P p(0SY @ 1!H  @@ PU @P-dM"h0 (00@#0 00 ,8sdЍ TA-0P`p@0 TЍ@- #ᖫ0@-ᏫG-pP1SA@>( `R111U @ T 1P Ѝ@-00S0;0 ЍO-`0#MPܰ" 0$0rP @Ѝ(0Spp@W @`P (0S0pWpWp-W @pGorV X_ @T    A0 0p$ %?\0?4H0PX``Pd0pA 0 00! "?,0?P (`0P40p@P  0 00!P pMATX X  @P 0 00000 00 -P@x  @q0  @P @g0  @PP ([1 01  010 0PPQ`0 @ @ T TEp@-0PS@`M  +P0 Ѝp0000 O-14M`@PX0`0CS: 4ЍqgP  (0S8[X\00X0 00 ` X .0 e#  0Z[ 4]O-0p IR@4M, [P  @P!@T  @P @  < @0` @P "@ +4Ѝ?@-@p0t 0 0x0 @ p@-d0d@P&r"0@3@#Vpp@-d0d@Ph0l (00, @@Vpp0p@-Q@ 1CQ 1CQ pPh0l 00010p00f@p@-d0@P0S S p80`h0pPsxp0@`D]X]p@-@d0Pa@hp@p@-@d0PU\p@p@-P@P1 /+@)=pp@-@P` є2&'00F= 00'`P000@0UX Rpp@-P@ A` h0l 0H0` &r0`3:0@3pG-0SP'@  pɢPP srF h0l Y^:0 h0l o$AЍX#x0S `P000p0t 0 p0t p0t `0Sp0x0 t S PP #`PA-0SP-@ `phl 0 y0S 0Q h0ln A$@  QPX!x0S PЍp0t 0 p0t Qp0t P0Sp0x0 t S PP #PG-50S`5 P`P-00p 0 0(00 0t@  x @00y0hl`Xn%+  @b(03P00Ѝl]MJ_UJ_0 0R0,00 0 0/̆s@-P`00@t  PЍpp@-P@L`U<<P@P PPP@ @pÀÀÀs@-@`00P EPЍpQ@-@ f@ HO-`pP(@T 0(  Y $Z  @ UIPW(@ X |$[  @T 0( k p,0H0@0,0PPj@-@YP@oЍ0P :0Q:///0/P$ Qp@-$PP $@*-p@*(0/P$ Qp@-$Pp@ZP $@*TQA-@`00PUE4P@ 0S 0S002T5 0`8P40S$p&(PU P8@ЍA 꽇 EPЍÀÀÀA-P0\!Qp# `!0  ᫄PP  PP0S Ѝ@׾@P P0 0$pPv 0r8]04P(Pt,0q0S``T0`0 sPP`(U0S GfJ_ÀÀÀO-STM@xp|N `PP#@E W 0S@P;0  00 0  R0 0200p f@P(P ,H4@L@$  P  D#@P ,TЍ,048@<0P80,0- +@`H@TK 4@TH VWm ``P0  RS> QQ< <`4@0p40S@  @004PD00$L0@0SD  D 040S8h@T0@P0S 0AQ 0S 0 ,P ' ,#P`,e`ɚ;6enJ_ʚ;>0@-@M0@d QP#!0  XP@   k@ T@Ѝ0A-PR  p@P `VP $.0 p|Pd(0PЍ@P/@-MP@`P V0 ! 000Ѝ"RS+ P `V $pP2U0!۟0P  RR   *ПP2U0!㻟P!SS@-,@  0@ݟÀ]ÀO-,MpP  S T 4P   X`\P% Y P00\XT  ,ЍO20P ,ЍO<0P 0 $07JY )P@/ [, $ @P&$P Y 0 0 0` )$`P ; P 7,Ѝ`P#@@`P0\0XT  00J/&>2  L+& &bR0@P} 0S4#,S  @P @P 0QS P @Pa0+ S0&%&b"x1Y, 0 $0ܞ@PM$ 0RXP 0 00)P[2 *"*kA 0 BQ    "70C?o2S0S0S000  P S00S00S tPP IPN@H]]]tJ_0@- 0@SP$M  =P 0 P     $Ѝ0 0 R  //p@-`Q0@0 Q_ePp00p 0@-@ 0P  P ЍC-@$MP P 1` z?0 0?$ЍP`p崀P`0S X *1` z?0 0x?V PPPYX V  J_@BJ_@-P04Mp3     1U`00@ P P$ (0"L 0 @ 0H4/@P U tT00#T0S@D0PE0S 0 @QP0P4ЍƁ@-P@`P 0 Ѝp0 ` O-R@|M PP 0 | @|ЍY 0,Q@! 0000 1/@P0qlX X@ᮺ` @P V ᢺ L8 `0P!,0#(0!0 0 X/(0S8(0 0 0 @ 04/@P( 0S tT00#T0S@0X0C 0 R   @P_ (( R LP0lPP H @Ɓ0@-0 0Y ЍC-4MP 000 0 P$03Up1@00(03`T 0 @ 0P4/@P 0U tT00#T0S@  T  0h3 ;GP 0PED00S 0 @PX0P4ЍSƁ@-P@`P 0 Ѝp0 ` O-R|M@ PP 0n @|ЍY 0,Q@ 0000 1/@P0qlX X@ᠹ`  @P V ᕹ?8 `0㔱,03100000(0X>d0SG(0 0 0 @ 04/@P (0 R tT00#T0S@  T  03 FI (0X0B 0 R  @bOB (( R LP0OOP + Ӡ@ƁS0@-0 0I ЍO-1PMp0P P @@ P @f x 0 03/PZ  ᠸQ@f [ $/   P 5/PP [ $/  P R 0 N  R0 S @2 0 0@Dub xz/  $4`` 0 , $(  @ T4If rdAedAedAƁ}f~fg~^^fY_K_G-pM7 Pる *0` SP 0 噔 尙@,Ѝ>    7f@P  07 000L☿P8'7 (P0S6  S1#U S1 #0 LĿP  7:@P0@7 L␿@P  7 ǀ0 @L⦿Pd Q@PU @UP0 AP @ꈼI<_<_<_00@-@0,MP 0 00!00T0@3Q100 0 0S N0@DT@,Ѝ0/p@-P@X rpG- P @`$pX X X@(0WPP@ L0 0@`020@`A-P S@`@TQ U20 Q@ Q  E 0 m\@#eRЍlpp~Np@W02: 0 @  01/@A-@`Pp 0@G-pP@` S!@"0R  2  00@ 0@T0"(0  ,0`$0 @A-@`pPq   2`p0#΅"^0@@A-QPp Q! Q`+j`@52` R`   Q`02`@20WC-Pp`2 H Ѝ S @ R0P0@A`0 00=[(0 #'d 0R P A-`Pp S@"@Q  0" R0Q@H0 00 [ 0@ "cЍG-XP5P` p @ OU[ 0 PP!c2 02PP 0 ( T @   00ЍV ᳵ]]G-` R P0S0R@9@ 㞵0+?@P)V  U @$P፵0p .@PP`@ P0 Z@ ţpW nkO-0TMp$00S00 0`P#`TЍ0 0`P0p  0`P;003 ``3 1P00Cp$`W[3pWb #0`op@⫲W[<3pWx4@T0,0 T 1 #0p$, ,0 @Tp00P00S Z 1 !, |,0` T00P00S U 1, l` ݴڴVP P 04P\{0`$`P ,PPp0`$`P !PPp  i R<  <` Ei`` P  R , ( ( $ , 0 0@@00 0$0000pu  i R<  <` Ei`` P  R , (( $ , 0 0@@00 0$00pOxP@tmP 0 03/`uNV`fJ`N``g4]`lDHK_ B @-/00S/A-@P`p 00P0000 0n?@r?v_` A-P@pA` $0SH0( ` $ 0R`0P p@-P80@T ,xPpAĀ0O-"LM@!2Pp`0 < 00p0,`(P$@ @@ @<D@L[10< 0D0<0p,`(P$@ @@ @P8[D0SU '`Q`1 P0D 0<,p(`$@@ @#[0 010D 0<,p(`$@@ @[0 000D 0<,p(`$@@ @[ 0 000D 0<,p(`$@@ @Zd0P00<,p(`$@ P@ @D ZLЍ RK_\K_cK_oK_{K_K_K_ QA 0 DĀp@-@PBoPPUP ,( P p@z R00 A-\0P3`q00CS@@0$B@T <{A-@` 0p PP Ѝ@P` 0 PP 0`P  `PȲP1S!!1! PU02075( t P p @Ā0@-@PM TP0RPP+0@Q@@T& QP0@0@ @@@0  ,xP0 @+X@Q PTTP0Ѝ0<060@0@]ĀK_0DĀ4UJ^hp@-@P`*0P ( R  pU  @@p@-pPPM @P @  @P0S00C>S@0`S@ 0S@ xę10 Ѝ0@-@M P  P ⬙ Ѝ0@-PM c@P  p@P @p0`S  ∙0W000Q  Z@ЍO-@$M 0Hp徱0` _PP ᵱPP<@/3 Psz@P   (  , ^ R !W$  RR R0R Pz|@ &@80j/ 0R( P 0W`0" 1 00 0 100EH嬡@]pP= @;  6P $⎄D1 00? 0@0 4<00000 P  Py0 00 pL0 T# $Ѝ0S@ P^vo^`rτn0X@Sk/1!p @@PFV0]K_K_o Ā@Ā0p@-P @`M P  BPAЍp/G- p0`^PP PK@n^ 0 Sj$0SD `V10 c /o 0b4 baQ  S  !R!0C31$00C$0 PL } 2U 40  ?oW20SP   P(ЍV   08P P` `0 20'0"20 #P<#(P@- 0000@uP 00Ѝ0@-@PP$M  P 0 _P 00$Ѝ0O- 3P MⰰR`)0S: S: Y`  @ v`P 2 = P `P  `Ѝ r]U(`; p 0S:$ 0REXc00 40h!  @ 1@1181$0 SfPU `x0S P x  |0 00$0080匰$00$0' A(i  NVU R  < [ 0c P `P  T P0 #R< # 0S000@@ P0 0  @@P(`(`lDĀS0@-00 Ѝ@-@PM  PЍp@-`0SA 1X03/5H0HSp< 5H0HS p@   !p@e=SC-$M@`pd]PP @ \0 0@0 0h00<0p `0000@0@P W]$Ѝ]HUA-`AMp 1PT _@P*0@& (@P! 0  0c? 0  0@P BU@TЍὮ@-10/10/G-Qp^ d`P @W0S P0  @%@P 5P @v <P P0P@@G R H@p@-PA %PPW p_tP pp@-@Q @PB @pIP0$P R V@3 N@1@s@-@Pa 0 I@ TQ  @Ѝp@-p|M?WP$x AP` ^00`0p 00$Xp0  pPP W 9P |ЍSp@-@aP 1S @T 0S 0QU00001501 0S pB PPO-03pP@`ᄠT P 0 S ,@ @ 0SPP02P0]C-p`$MRP0P P0C~P0 4P0%@ RP0 0  0D@P $Ѝx0x =@0 ` t@p@ #P U<@ ᡀ@U  ]K_@-`@V  PP  ` 0S  PQ Ѝp iP P0 [C-@MT;0 p0I S@#* aV PP p@P U Ѝ 4@A-p@Wq0P @P ?T0003a @P  ̬@Ǭ$q$Q W@ᷬ@-0P@3UQaa gPP Ѝp$Q  a  0R # L@-0S@P  ЍG-pW@ PP F0`0Si f[@P0S m@/p@-@1P 0c i$ Q$180pX`p@-`R" 0P1S 0@S P pP0   00p p////// B 0@Ps //Q 0S P 40 P0@1S///lA-@t03@`P |0S 0 R0`hd0P0U TpH0AD羫0Q00C0 R0 QSQlG-0@`p @M(0 0 <0a0,$@ @@ @P<@#S<0S% 0 00< 00a000'>,0(0$@ @ SX00P000a0,0($@ @ @< R@ЍK_l@YUK_LXU _A-@pQ Y0 P `㨀0 V:A᭏T` V 1@`Y @y0P(06 ,00 S+ eb4<09 PS <0D1 0 2/P<0 ,!P R 8!4 p 0P0S81 Fr81S 6PS 0`P 81; 0 ` ;0| (C;PP 81S00BRUbPEQᆢBDU"XOW[YgP @Pa ˧X g 80Pe Z  0弧0XWYPELD  0P 4P 0  0P 'P  0P P   0PT P   0PrT P   0PdT P  zW < 0PY 7  0P0 01 0 100/oX" R0  0/oW" R  0/oY" R_  ᕰ 0X mz  iz ]p@-P@U`0M  zPPP  qP P 000Ѝp@-@PP4M  [P0D S# *a/b(0 0 004Ѝ@BO-p0EM31, 0 ? S @3%:a V PᶦP %@P81 00H|@P -@ U ᜦEߍ\]@-0s0 H ϠNl/ / ( 0C00 ЍMb@Bp@-P@U`(M  PP P  P0(ЍpE/08!PR/p@-SP@HaoP@10D1@A `0p 0 pBDO-0`SP 0S 0@Q @280SP81^0S 8@0@ 0 a0p $ 000!   #88 !#4< !#2> !#1?  B pBw 0b8s!$%00   0 k9UT: Ѝ^U  0 L0Z  P2pp1   \ 0R 081<10<1     P    ЍO @ PHĀ(]A-`唀p?`@T|@0C0P@PEP8 0 F0 f021@& 0@@AHĀ0@-@( x@Op@-@N0Sp 0P R @1S0@1  0S0000p@:@-0M?SU1p`0@SPT:4 `P Z@@D@  V@@ S @Ѝ$`V00S @@0` 00㹴@P@T 0@Tt T T 0 d0 Ѝ@ 10@Sp@-@xMP` x 1x` LP0 xЍpp@-P@xM`x x001`0 0峱0$ uxЍpp@-@PaM. xd .. 0ލp0p@-MaP.  @P 0@ H /@T@ލpO-A$M>ZL`0R00pPA 0*V4U 0S31@0b w " h H0 00     WP   P L  `Q((L Q`Q''L  "!    apR Rdb 00000 0 0 00 -W`1 0110 0T0S|[l[1S L0  1 [" [#H0S 1Sep10Sa[)L#H1H0S ,1 ~[0(0[0)H0SP2  w2 020Y00008`1 01 1R 0  0-P P0 4P0 P0S ,$ЍP[H0 ]TxK_@@S0@-P@PphO1,0IS　HWV@-@ 0 P  PQ  Ѝ0G-M p 0@PM؁XP vP 00S@00S Y`P x@$PPDL0 @a0` 000 0@P|p U P ܝЍZ 1 S 0S qWYP ΝU ȝPPSA-0MS90PS5 f@P`P@p @@@1 00!P 1@aᕝЍdQ r1O 圝@ꪝ@p@-P@`Ku 0SP S00C00 xP|PU x0sP 0C0PFp?U p0PS ʀ000h0S x0UP@-D<0O-@`P |p@-P@P ;Pp:p@-@P q9000,03/@Xpp@- 2PQ@1 #2=C 0CQ 0CQ 1!0S01Q0#30I <i S01 01(p@03/1Q 0CQ% >+1Q>C/1C  Pp@P1QB 1CQ [?0Q Pp@{ 1R::1Ppn!0Q 0 0!0000\0S: R :SP0C BS000DKP s@d]s@~f s@-@R0 0 0h0B@Rp@-d0T@`R0\,0(@P@URp0Q/p@-t0@QP d0QR\0S0010Rp R0*R0\0pp~fTf@p@-PU @d0`(0p`h0Rp8Rpp]p@-@d0P{Rp,p@yRp@-P@PqRUUhpZpA-@Pp pZR\00tp00@`0QR00F= 00'`PP$' @-0 @0 h⣰p$@A\  \ R/ A-0SP(@ `Rhp\ 0R$S$X#P0S0 0 0 夯0 P0S00 S PPQЍP S QWP\0 JQ  l~P@yp@-A@ PQ\0S`V0p@dQpO-50S8QpP Q1 ܹ@P)00夰 0 0(0 坜`h6p,JQWKK0 TQ%+  `叻,03}00 Ѝ@]L_0p@-@PBP D0R p`pQUoQ p p]@- M0@ P ׼ ЍO-P4M`UXp޼PڼP P  81R ַ 4Ѝ@0QW U8H0L 0P0S XX0 S'JH0 L0 H0P L RP 0 H0LP Tp 0\0X0SPP0PIPᎷI]ɚ;6e@-@LM`p EP P0U(P~?oU20S  JLЍ B 0  @o/p@-dPp@da| 00C/(0, | 1R@0@@1B @@VpQQ03 0# 1Q10C2q0Cq0CQ0C0C3+C? R0//p@-@pP&-p@_p@-@pP!p@SO-M0(0P`p` @\$ X $  Oo0>BP@T$ЍOЍ-@-0 000kЍ Ѝ/^ 0!< 04 0 (   !/Hhl\ P/0 !8 00 (  , !/Hhl@- P@-@(080Y(W@Us@-Pn10@T H~_P4A(Ѝp@ DPЍpA-<1P@ "000000D1hzPVPTP U D1 _```fh !`F000000000U@!000000D12 !_ 0? R(  U P D00000 h#P  U  _?0S00hPS0CM_p@-@01111111111111S !1R 101! PSaS 8h(D0BX@`><:64p@v㔔S0 6?/O-鐒DM 0 ,듰h  X(@P`p;$ ,, (2 0 0a0P,(@$  @;(0 01 0 0a4P0@,(@$ ; 1 0 010 0 0 a4P,(@$ ;000,1 00 0<1 0 0a4P,(@$ ;00 80 00 0 0a4P,(@$ ;0 0 80a0P,(@$  @;|0 0t0 0h0 0'>a0,P($ <08 t;DЍFM_4UU_MM_TM_*_XM_^M_u_`UdM_- B 1011 S!1 0 !q 0$w)p@-@PXf0U00 00@1B  pP@-@$U0  (@p@-@P LQ 85Q 0 _? = 0>;0p0<0~|Q h$p@p@-@P 4 nc/0000`0001S 05V (pԥ߀SA-P`p0| @@ @@1B  lAT 4/0 #P@P p@-@0P#PP@ m pX@- @$^G-DaP@ 6|8$ 0 4 0 T 4 T ( ,8q U( ,1:00%<$ P - 8 < 8 $ < $  R P @t q nU <0SPLd@a P @14 0 LS 0000?Y$0!D1  L0S81  UP h9P000@1 t1S 3/P0000  P * 9\0+4 V1SSQ   ^zw090@W1SSQ D15 0L s D15D1IT9 P1SSQQ1SSQ ViP1 S S  b0 3  1T!U1R*,R1SSQ VG   U1SSQ 0<0}T1ST1SSQ D15D10<0 U  P < SK1SSQ 0S M< U@ PM1SSQ# _ 0 R P W  RQ $00"0S0>;6RF L1 S S RP N1SSQ/ e P P p\ p0U P P  lp0E P P V  "@ Z1 S S R .L 00 S   | 1R$T {  PX` U_ H1S I1S J1S* ( U& 0 08E0  :/0"H1 S S R  P PEUP#U  PE0 S = D]@1  p@-P@$bp/@-D1 M2D10@9000 00 P090 Ѝ@-D1@ D1L 0X1SY1SA-`Pp A@@ | 1R@ 0@1B @ TPT Q X @6p@-T@p`<?P,00(@@UpO-0DM S @0 Pp#48@3@(00D h1 Q/[ , S) d4P[01 0S4`DЍ n3`Vp<0Ya00VX0FS[`0#4 0=0 0PS!RRQ   R V`0# 0 # ?0cR81  TP hw P000@1 t1S 3/P000{"Q8 SQY0r=@0T0R@2 @A0.@!B +@) Y`qQ W=!008  R(00C?2cO 0@CdB$@FSzYL0S800q0)T0S 0  8'#`?0 `X1S#V V#VH /S0`Ph C0CU P<U D<U50 B <Q ]k0CQ$0CQ;0S 軟3!1PS D;U;U0CU;+0S00;U %40cS KS V0CSX{T :P 0 :/@zC { j%P 0  9/+/:Q ::0S[  S 1 0S [0 P X  l@ 4:P Ѝ:0AUE 9UPu z1 0R6[03 #PP9U9088 g0;b9U 0CU 0UiD XV10S 0RS&#9U 90SQ9U( 0CU I0CUC000 8U <8U 0U0508U 7U-@ 0SPz k\8U >0Uu >C0CU 0R000U(U d7Un70 S' S007U& |7U0Y_ ${P4  t K+,70Sd70S  P;H7U0pp1S 3/P  Lp8,|000| 0C0;PUPPMXvX0 0Z - RT 0H0HS ]PP  0D @0D 0P嵚H:cP ]!,ԝ,免|]Z@TU T ЍO, NC1CV %@3Vm 0 $p 07/pp{ 0 #ppr0o 2 Rk0S Y`v2V, 1\0CVh||2V" 0CV 0TR 0 00D0,2V0CV20S0S00 0R 0 py00u 0R 0 0P0E>SxTD1S0 008D|00D1  0 1V )1V 0CV X0@0X000S81< U1ST100C?o2 @ S) X0@ 0 0X0 p0V T00SSX0@ 00X0L`tUft_t u wt@pt tttut 0!< 04 0 (   !/Hhl\ P/0 !8 00 (  , !/Hhlp@-`@PU VBP0P0 0`p@-@P P 0SB׃000p@-@0SP \P 00AS  !0R30T000 0S00000CS000tpG-p@`V0SS00aI"U P PEVP 9k0 `F0C000S000p@-P`^Q@ V0@@DT @@D8p L@ CA\@ ^@\ A\ R\Π p@-@P%0S0000p@ S0C0LU0 Q BPE0 0U RR  p@-@`0 SpSP 0S\  0000`P  BR1 " 0010 0000S000pM_O-`QI@p0 S> S 0S4! 000 0R*PP P%PEUP ij R A00N \ᡡ:50C010 `F000p0S000Vc Ѝ@ ࡡ0030c00 [  N_0PQP/@P - Q^00@S0\3 X0P/-0^  0CS0\3 p@-@# RP 0 BS 0 \0C0P 0CS0Q30TR  pp@-@PKpp4031[  10 P #/-[  \ @- @ [0  P p Q  Q\1P!  S[ @ [ @@趓@@at Sp@-`d0@31[  10 PU 8ᦇ0 J@Tp@p@-`d0@31[  10 PU 8ᇇ0 @5p@p@-0@1[  10 PU 0j l@p@O-@p`\DM 0 0<0000<0,(p$@ @@ @`P(:00L0 00`<4,(p$@ @@ @(DЍz^#N_7@-@00P000U  Ѝ0@& Ѝ0@-@H$0S 420 S   0 'A-Pᔀ M@T igP$q\TPP` se  5 pB0S Ѝ@X(N_h0S/ȄXVA-tp@hP`V U0PD 0 p@(gP`X h000@-@AM,P SLA $eQ e, Aߍ0/01 p@-L1@SP(0:0p,18`S 0,Q0Q:01 01)"PLaPU 0S 3/P m j0$L13I/@-PAM@zU 0SAߍ@, `P Aߍ ``3pP` :0PS 0S / d0 L1S0Sp0LQ:03/PU`P   $HO-MRQB 0,P|ߍO'Q 0S 0 S 0 00L\0$00(0%P`P% pߍ003@00T 00PS, (0S)pW& 0( S"0$ 00S0 000,0p 0吏P0 S030#[0Sw X00S@00008S 0 0`023k - PR0 P 0T000X0@0\00XK 8P0p01 `00' 'QJ  g0S QE b g ) 0X 8p> "2 2" 2" 2" -8̟pJTPU000 W >0 =00 =C00Ks 0 0  )0 0 H)00P0001P0100 )00 *0)00 0)00 +0)p,i0S 02$ pNN@-8=0|=0$ =@0 = V Vp@-` P00P0T0@Tp@D0D=P0SX@$0S 3/,PdXp@-h T00T0\0@Tp@L0L 0?0c^=P0SX@ 0S 3/,PdXgfff0p@-X00@ X  $Rx01X0S 3/P0S P 0S00@ 08 04 0c0p0S 3/,Pd|O-LMD@p`\" 0  t 0p,@(`$  @P%H" 0  0 4p0@,@(`$  @P%" 0   4p0,@(`$  @P%0! 00 0 4p,@(`$  @P% 0!hh1 0  0<8p40@,@(`$  % 0!1 0  08p40,@(`$  p% 0!00 0  0 8p4,@(`$  [%D0 S @tPt`tpU:T 0LЍOP 0"S &@LЍ^^.N_8N_V#^z_4z_$P00 !XP/ P/ R/Xd@-P R0CoS \,0P @-@P0^ R\ T \RP \,0/@-@P @0S @/@-@P <0S @/@-PL@-P@@P0ӗ/]Qp@-@!@3PPP@p0S @-E d(]>N_p@-P@eP`  H0S p@/p@G-P0P @NP D0S G/p`W 1 !P @TjPF舐Y B BR !  jP @W1!V``@- @0P @p@-PP@p@ 10`S% S S  p@S S10\ FS! S S 弖|xS S p@0P L\ 1 p@ p@v p@tG_hN_N_oN_N_aN_wN_~N_^A-`p@0@TP0SX@0S 3/,PdA-PQpT0@T0 R X@`0S0S  3/,`d,0(0 0#1P! P #/t,0@ S /@-$0 @ͽPЍX[G-MⰠ P`p ` @c0P00SS00-ЍS0 000000@v?o2P0SQ $0S S S h 0QQP<0H 80(0$00,P6]($C-釟M|@P` pNp0p $  X0` Cc2 020202HX00ߍPDVp@-1@SHP嬕L0S0L0 (DHL lP UpH@0100p@ ؏DUH  L00L0H0P @0` ƏT^ p@X0\ /N_P 0!< 04 0 (   !/Hhl\ P/0 !8 00 (  , !/Hhl@-$M`0@T4Pp#2Q12000@T ~ODT3"P%QR 00 0$ЍP0SX@(0S 3/,P 0S 3/ 10@d P 0O-DM!3Pp'`0< C (PP00p 0,`$  <"3 0P(P?0l380  04p,`$  %"03 (P?03<0  04p0,`$  "0 000'Ȳ!2 (P 0  04p,`$ !0 000x!t2 (P 0  04p,`$ ! 0'!$$2 (P 0 0 4p0,`$ !0 000!1 01 0<(P04p 0,`$ !0 000!|1 0< (P04p 0,`$  !<1 041 08 0姌1 0@ 0< 嚌 & "0P &R+3'! P<0  H0$ <0DЍOi_PH]N_D]N_V,N_(N_$N_VR_N_pVO_ O_V,6]A-@`(pP$!$ A`PP 0 0S/p@-X0PP Lԍ@P 0 H@Q000 0pP@-PH00000 0$0(0,0004080<0@0D0@-d0Q@\` 奍PP0L00H@40 400;\00T0X0PG-0MZu0\ 0pWЍ@L\ T 0E0 0 ^P@T 0H0 0E0 0 D pK` `FV`!  `pG@0O_+O_XO_P/Q@- 0ࠣ @a0 RS000(00\ 0C L000RS ( 0A0B(00 ( 0R 0S PA0@-@P 048900H0000000H0\000 0C000/A-@PpPU0S@@``FV`! 7/P@PEQ0/0\/ APQ /p@-@TP PP@pp#$00$/$0S0$0/ 0S00/@-@ p@-$PUp@Qp@@-@0 ( 00@Kp@-@q0 0P0 p!R D100 倌N_P RA-@P;bS`:pc@P PU0P SA-@P;bS`:p_@P PUl0(PPp@-P GP@ V0@pp@-@PPlTp00 00FS0I_ 000l@3S @pHL0SP0\ 00CG-P0@0,0S *`V 0Sp@ATpP 0 `0 夐0J,R0TPUP! U P!0 ^0@DJ0000CS0000`VTT`pPO-pPU' `V':S`F' 0$ @P 2V2(0 0C(000(( 0 ` 6P(@PHV@` [@P 0 0l 000 000HLsgH0H0`0000+ }^0O-rMP`@0 ``(`0 0`S`F 80000U Vn0  ( R(|pPEWY80 fXp000<)0" 3SH L0SP0\ 0fX, <Pp 0% 3SH0L RP \0  <  0CSS10U 1 !I0PI00<,00 BX 1U  1Ip@Pp@ppWm 0j 3SH0L0ScU 0< pP7Ѝ<pP U)0& X븀V0008000T   #RH L R!X B/o" RX0@0C0pfV0 X 1S  0  00HAQ00@0Wp!S  p]000P`V PU @P@-P   Ѝ@-0000P7 ЍP/@-rPQp@-ppƏ`P@Pp0 0` U Pu]O_@-@P@Ѝ@-  0S  Ѝ0bSG-@9p`PP2 0 0 0  I,b0W`!V`! V `!0 \0pGI0000CS0000@TWW@xPPO-PR``Ap0PPPM 0@P 2 (`200V [ ^@P P Ѝ00pJWp!fW{  W 1+#  \ @PZP`F R[ 000R000 pPA-0@S" `;(0 S8ʸS C< 0CPHP[P (00 AQ(0000PP 0 ?0W@ (\OpP `(P0PEU0 U + (0A0PEUpP `$P/0S/p@- @PP [pA-@pP$`V@PW0$000@$@p`0@-P@ 048900H000$00@O-M@0r000?` 0T P"QPp000, vVQ@%U 0SPpGW0pUv    0 & P@ 0ЍS v(0(`0C(0 v B R ! 0> 0S000 0 00HL#dH0H00v p`F0Sp0P 0 3SH L0SP0\ 00<0Cv S0!0  BR ! [O_]O_O_@-R Ѝ@-L ЍO-0P0ppv RP@ Ѝ0S@PETUT 0S  #RH L R  YUP`C "XP 00 YP@ X0 P 0 0SP]pH^\\S Z QHLQP\ $ QHL0S0P0  A"Q \  0 p0000H 0CS00C R0 0000 FZ00C0P0PX!0 ZDPB ` (Z00C0 00 '000c00r]^G-0P 同p@P: ;  0 0  000HLbH0H0`夀VYPP P  0  0 00HLbH0H0`Yy@]O_/-/-/-//-/-/-/@-@a_-@-A-PUp1p!0@W`DS W c c_PW(0G-`P00 00@pP) X01 0!00000P XI Y 0 000P Y J0S@FЍ-/-/-/-/-/-/-/-//A-@$`P Pą@ p00  DXP  YWPp  Y`G-4pPPP8 `1@P 00 00 `P@ЍC-P0S`pM 2Q@0S @Ѝ@50T U @ 00040"0P 0  0SS20@T D@DT@0 Pb c1V> 1CV VO `@Z4TC@@ @T @H00@G0` @T6`1@00C?o270 T:0 #`T `V4 `V1 xrT`2`P @ 0 }n@0@T@#C  {4@@iiip@-@PPPU@` X`Pp Bp@- P`8@X}<0P pU}@0PppPp@- p0Pd00S P0pDP<@80 @fS0]ŀƀp@-P`0` 0@ 0AT 0S`0S @ 00 0pƀŀA-@Pp XC, 80R) 0 R *)`00<00@0 0$0t`|`p00S0x0 00P0:0`P@@A-P@p0`,PVU  AcQG-41p!,10RC*Q`= T PP<*P00 /R0S /TPPo@ $`Do@ D|/0PP 0,`8$0 Pa{|<~|@<3$`@P?ŀP_@-@P mo00@-@<2l/8 0S \0LS   h,P 0Oo@DGoŀƀp@- 0@0CS`P 040,PP_oR)U vpp@׊p@-@P 0S 80 31R00 pp@-P40@AT ,oUPp@ŀ@-0 00 0~P Ѝ0A-0SPp` x@dTP诊P (0S ႊ@ 00 0@Pƀ0@- @P ,0S@uT p aЍЍ@@-@ P$0 0[  (Ѝs@-` @P)P,0S(0S@ 00S |0 31R@O4T <00S Ѝp@Ѝp@訉@07@- k@P@P$0sT@ 0$0(0S ρ Ѝ0O-@PDM TP\DЍOlQ @A@AH1  5d @00|,ap0 !@(0 0 <00,p$@ @@ @0 00< 000'>,0(p0$@@ @0\00 P0< 0,(p$@@ @}@9 PP DЍŀƀDVJ^ P_P_d6_]p@-@P8m0 r@P mp0@-`PP q@ATP ЍPPp h P0XS   @00C@0 `V40040V!@ƀŀA-p MaP 3/@P⩊@P 0 (00 0<1R 0|@ Ѝ0 @P  l0 PQ"03̀1 0 8w@BP 0 @0@ 0QPQXG   803/@P   P]DRSPƀƀŀ@-00 0 Ѝ@@G-p`0 M 0*@P/@P  Ѝ0 (00 01R 0 @ D H03/@P% PhaP bUZ0@@000 P @  @ ET  ʼnP F`P 00 0V @x0!0R:@@1PPS0P1@01@Q00  P倉]ŀƀ@- 0000 00gЍ@A-Mp xP@$`'X``P$P @@$(0V0(0  0+@P  !@(0T0C(0  ЍW` #@0 0@-@MP 墋P 0S 40 R 0#P<Ѝ0ɚ;0 <08 SD @R C0BP// 800C80@00q@! !@-@q}q@zq P4:A-`TȀ@Upʀ 0! $ 0  , !|0 ,00d0 0!T!0    !/Hhl@-@Q Ѝ0l  R:` <P#!, i` @F!P 00@H 0TD@D0<0RH0G-RpP`0=  ( 08`w  0R<8 P/D @R+ @ BPS@P PPP  0H@L 40B300\00T0X00 %W00 DX0ST0S@L@T@PP_G-`Rp 0 PV T0SPLPT0XP0Dw@P  DUP`(0 0(0@Q`Q@PU7P_A-@R0 wp0 S00 S<8`^D@P\N0L^0R0ST0S@L@T@PP_A-`@PpTXUZ 0000 0RX 0SUG 01QT0S0T0`@U8  R0#&  3SHL0SP0\00<0CR1Q 0D 00080 080@P@0P00@pL@AtP_@-@P L0T0p@-@QpT0PS@0L@T@0Q 0 00000 p@rQ/T RT 0 0Sbp@-@QL0LPpS00S0T@@0Q 0 00000 p@D!R R0P00p@-PL@Q``U`QV 80 v0S0C0000800C80Q 0S L`L0SP0  RpT0pPEL`P_@-@@0S87@-@P1 < @;0D0 Ѝ0A-0Xp@P` U[<S !P  P71 S010S0PR 5A-4$P 4p0?RL1S(@8P ,1S 0,1010:01 01`B@P 00000111010044P0P041418181@1@1D1D1H1H1姸00 P =00111100!1.01 0.000003/P&f``& 2R 101vn@-L@Q0L00P0T0PL0SO-(ppP U [  s@`(/@P U U iPP  H@L BÌ\PTX0(> 000P - G-]P_@-P `@P   2BЍp7@-P@000T Ѝ0n00@*s@-X0,`0 ( P@,  (m0@00U Ѝp.m@-具P0P@-|P/ R/@- @@ỷ@A-P`X0@0X0ЍV,@p l@000W T l@#@X0, 0X0ms@-P`Q l0@00V yЍpl 00S/Ɓ7@-@00Pᡶ000U  Ѝ0@[ Ѝ00BSp@-P@`GyPP  $0S0$S0ĕ`pQ_p@- 0PS`(M  ,y@P- (Ѝp0  u@P0V" 0;;0@P R 0  R ! z@P  z@ 0 S@ R  x@P p%up@-M0000`P @P `v00Ѝp@-Pp`|u@P @t Ѝ0@-AMP@ fP Aߍ0s@-P`[u@P @tЍpO-`MpP8< tP (0S t&@Ѝ Dv@P t 00PY U00 v 0 !* 4S  #@k,v@Pd!401  504DT04U0S ‌0 Pds0J(0=0@0  0, 0  ::1@PePTP c0000圵s3 uJtY ~*.  w /w3 u-@1t40 3u@@ @]l_l]@-Pp`t@P'w1%@ @P 1 $@G@1T tT 101t@Qs Ѝ$ R 0@4 @ 0@-AMP@ NP Aߍ0G-L1p30Ma0$000P 0 @P/$0 (00000 0 @P*$0r,0 WP@ @T (ux@P , t( t0Ѝ, t ( tG-Pp|UUpW @0 S0S``F``T@PsP r@O-`RYPP Ѝp@0 T    R R @ 0xP0l UpW@@IYW 0JPp Q_O-tM  ᜀ^ 0X  q_ RL R(@WEWP RD 0!  0$ (\F! RL` 0 0 0$ 008A 4/ 0@0BPS 0C pP  #P ROV= H! R   @!W.0P lv@P 00U VtЍ0P  #J WP V `~>VT `0'0X` `@V@@Q_ƁA-PM`pr@P 400000 0>@LrЍ7@-Pr@P a@8r Ѝ0p@-`PV M  V00 R0S@"  r@P0UV ;0@0  G  u@P Nr Ѝp@-%50S@,M]32121P0 a p 0@PF0 000$000@P& (00(0(00(01:11:1010 S;305<0@ T C$  s= s $ r r 00$00,Ѝs@-`Pr@P19@ 00003/@wqЍps@-`Pq@P 00403/@`qЍp@-pP' c@0P0  uP ЍT@ 0 S 1H05 vPV00  vQ_0p@-M00000P0` H@P #0@P P`B` 0`,` 0 08p4($ P0 00!'> 0`,`0 08p4($ Pj0 00!'> ,`0  0 8p40P($ PS 0!'>X ,` 0 08p40P($ P< 0!1 ,` 0 04p0($ P&0 00!0 ,`0 04p0($ P ө``$@_ @0`@JP (fDЍ^^Q_Q_Q_pVQ_0@-00PSVP`. P0 C  SK010SG @P0S S S @ Ѝ @0R 0 0@0 @0R00 @0R00p0S S S *@@0@ D@@'00S @*@O-M`00CS@|#0Q0pK$@ 0 Rs $Q Y0 ! g@P ' 0[T^Ih(@T R 0P 0p P pY000/ ;h Y';0} 0000 p0g  j  j h  @4  B4 zf00Y$@yK0  BЍ@(@P/ dVO-@S4MP` 0S 5R0 SppSpWX%C+1#0 000<5!05 0 0SٝpP 2  y 0 01QM 00; 0S4*# pp 000YT[0 ] d@0 L00H@Pp4000 0J00p\0T X 0c[= @> 4ЍfP (0Sf pp$  (3( 0,,v*0044嬧$ 0 00[f[ x0SP 0S0S @ p  X@ @ @0 0@0 ⛥P P" 03/@ ᣥTz  P @0 ,00!0C00!, 0 (00  C@0 ( T q 1R0B S8BX P<0S=/ pPH!@0Wp  1N@0@0  >P  03/@ F0 P7sq 10 10S, )S9w0S S~(%d9@Q_A]Q_P P// R0@-@d ,0  000R  0 /0@-cMPa/,i@Pcߍ0R@-@ i0S R0a/@-@0  R 0  /0@-R@cM P cߍ0a/jP*,P0S p@-@`P4LOt 1]P\ps@-P` !@P @6JЍp00]00]s@-P`'e@P0 @dЍp@-IP00IA-@`p PY@P <N 1d]@\@-P` p @P0 @I Ѝ0@-00 Ѝ]0@-00 Ѝ]s@-P`d@P @mdЍpA-@`p\PN 1\@J\T @@-P` pV @P0 @}I Ѝ0@-00 Ѝ]0@-00 Ѝ]s@-P`fd@P @dЍpA-@p`7 P@Ph 1\@/@-P` p @P0 @)I Ѝ0@-00 Ѝ]0@-00 Ѝ]s@-P`d@P @cЍp@o `P/@-5bQ_ 0((00`O-QM0 | @ЍЍOQe0R 0 0p hW01h0#0@T_WPUY b\P\PPE0Pbp|oP@T d2`VPL墤X0 @ [030#Z0S@x 23~Ph  0 U0 0 00$00(0(0,0 0/00$04 /< 800/@000D H00L000 HPE#%$%0U  &H & 'L ')(S  gP U0S' 00S 0/ Am0  `PH0 h00P0 p00PL0 x00P0K000|@000Jsg#Pl@ǀǀǀ0P R0x/G- P@ U `ἀD`00@0$V0:Pp姣 01St0 H0L 0 H0P0L T 0P0 T %R0XP5\p5`Pl0pQ_Q_ǀ0P @-P8P/ 0!< 04 0 (   !/Hhl\ P/0 !8 00 (  , !/Hhl/P 0%%#3/| `0R 2"-D | 1# H LH RH P LR P ǀp@-`P@TQx^0S<@@ @DX  S d LB F0SpP!p_Q^_Q_x R_@-P7310! 0O-3#SDM  Ң ΢X#0S 88   < P`:`@$@P3 00@3@@ @@00X003 @@ @@00X Y#3 pBԢ(Eg V""0&5L^ V00 S"0  0 ,~QkVpzVW0@<"[x 02`  2;L0 ,00! ! (0 0 00`$ %@p'1少 01 00` 0,p(@$ @l 0lQ!h1 00` 0,p(@$ P @y 0E 0 0!1 00` 0,p(@$ @y0E 0 0!0 0 00`,p(@$ @yDЍO;0  dVǀǀ%R_x-R_,MR_SR_ YR_`R_@ǀV)R_lVgR_pR_wR_R_VQ_  @-0P?_VR_000U-P @P\^\ lp@-@堡P0  ءp~Wp@-``BBd X 0$000 0T000V0.:puT00T0p@计W@-@P`NWHKW 0"00000 00 t00 0R_R_!CeǀG-p`DRDX($0 S*ၡ X@P8 0002 S p0S `N0$ 0C#2 BS*p@TX@( 0`00W2003 DIE>, 00 0>P0` |@TX 0#0L0R    W@V 00 000$0l0 PSp  p p0l U 徠%ǀ p@-40P (a;X@P <UP00p@-@V`@Vp@-@000lZW05000  勠00;0à0)000 Q :0`P =>09#900S? . 0R9ڜ  I S `P 40083/P0` =V0 $$偠 W 0S 1pp@|Q t  | x x |000900000 0S"Vx0p@ WxS0000 |  @|    , 0C1p@V ǀpǀ@ǀp@-@POp@(ǀp@-@0  Y]<00 0@G PU 0 0 0p@/0 p@Vp@R_p@-Y  P8 l0Sp p p0l X  @P  0-P Hx E4 PllpA d0ic1p0Ϝ P00ǀ@-pM(ppP,`@P" 0 "0V060000S0#T20T20SfqP V 0 0 0 ЍV 0 0 0 @- (pP @ P@P $0 ;`P Ѝ`q0@0O-@0@Dp8<P @ PP4` T劜@P@0 Q;`P Ѝ |P Lt10 k,-@``10@0ǀA-P`p 0Z@P 0 p 0 0(90DAcA<ǀ0/202/@o/ 0R:****'-//p@-@|Pڛ0 dS(0 1D 0 D00@0D0(0(01@  B@ P00P0p@Ȁ@-P`pAT 0S *,P A030#A(0000S  ЍA- P$`@ZV Z Q+ a 0R010 ` "z0 S(0 1D 0 (00a@00C@0姛U *A> 0R010 0A SȀȀ@-@0MdL`2S D!0,0D2N0, N 40  N 84N8< $N$ @<(,N,(D@04N40DH<  8N<8 HL$$@DND@$LP((HLNLH(PT,,PTNPTTT X 4%0 00000Ѝ@ȀXȀp@-]@L !Pp@ PT0QP3Q/0@-@P|@0S0(@\DLP00L0P00CP0T00T00Q0ȀDȀ20C22S/0@-PR@X0\M0 0S\Ѝ0Q E0 XSX0# t0 0 P4/0O-p048 X001 0A S *0D!000@ Ѝ  0 0Y "!Wm0 0NPd D!00000  `VD!000$YX)0W0WPPU D!@000t @6D!@000g >P(U D! 00 0D!@000Q80Ȁ@-900pЍO-p0M0  $2` 0S *"D!000-ЍP G@0MY !P D0s: 1sT @@L 1R" I  .  @ : #:0 1!D7c  0DL P T  QD!(00(0 0PP T >D!000$`V4D!000Y T@0@`$D!000ȀO-`2P 0$MS ao@pH0S; 1s^@1CJ@_L 1R" I  .̡  :L #: 0 1!b 0VL P 2D! @(00(0c$ЍA81T ! !D!$00$0R2 @ *0.SY Y+0.S (0000S X 0 0CX:00"@ *# =@T X0 0000$ D! 00 0ȀO-Mp80 0 0S:RP0|b00T @ 0 S[`0cV`V``V:HZS 勘Wq O` $@ 0 80)0  **# 9V t& P0(  0P0D00`0D0<WT a_W 0 W7 .R4 .R1  ! `1\ ЍOX 0=0吿P0 Q L  L 00 L0 C9ٗ*;!R 01a@ЍȀȀDG-`0 S@Pap 㽾ZPp` Qq a G0S 0 0 /1M0Ѝ//0S/9@- 00 Ѝ]@-0)  0GЍ]@- 0  Ѝ]p@-@18M0@@ @@@0 @WMP` V0@@D00H@L0P KX9 X 0XQ0000,00 (00!\0 0T0000<$@0 @0 @8ЍpR_0ȀȀh WX,WR_@-0@00CW0b:D0@-@ a( <0 !1011 1]@-@ a@O-@`p a !R I 9V< P0 P : ЍO. P  f0P  * P0!;  ᾽ 8; U0  ᰽ ЍR_@- ,@P :ЍW@- D!000@ @- D!000@p@-9@@yt031$P@`uP :P :P :ỽ 0 000pp@-@031$P'*$Ppp@-@D)*PpP>@|:DP v:P r:p@|9$00S/p@-@P$$Pp@-@$0P@Y:,0 R P/20O-@Q1DM0 00 @@@ET1Ta 0 0 @@@D zI0A@(0000p0<8 00 40p,@$@ @@ @0 0<08 <0,(p$@@ @\00'>0,(p$@ `@ @<08 DЍ8S_S_S_S_ S_p@-@Pp0SpP`0S  ! GQPUQ 0L 0000 0C0p0S  ! G0p@-@TpP`Pzi 04R00 0 垕G00p8 @p@-@`T E@ 0 StPzD0S 0R00 0 0 8000R 0P0@k@p@8 @-@"0 0C0@[ O-`40@SPp0I  0SBQ  0RPCS 4 ! 'G$0 0S1z1000 0PS+!pEp `000000 00 00 00 A 000S 0 @ Ѝ R RQ 00 0R00 008 A-@p`PUdd/E0Pp `P00S 0 000$ 000 00P0A-@ `P]00pQQ0S0 R\S  ! 0< 0C0 00C 00 0C0 0pA'S_p@-@0PS`'00\ p0S0S 0S0 0S0/P: P/O-CM81 `Q1P$ 81100 0$0`V4`]8[8X00$0V@$0S  C$ /  C@ UJ0@TJ@0 S$0 0P 8U 88Cߍ*870 =P@@p@@0$ p@W`<0S J@T P$<  H@Pp81X10  h!H@P J0 0 :800<024 @00D04G@kJ T Xf p0 W|00 06 <@P 7 0 H%,,H0pLXp\z (0 H(I0@?oT20S 0@P'X0 0GS@%(Q  RRPD P> @T ^7 $00CX"#* $ J `6 @T($0S C$ /  CG701 P0CVS @@01ڀp41p@H X-<T(  eG@P" I0CW IL H^@-0 ,0  oЍ$0 1P$0o/Q /O-P$M U U@"@(Z@5`F F !p$@ ᭹0TC0@0 |@ T0 F fV@5$ЍC-P`M0F000Fp00 0a@P t@Ѝ0 C /  C07s0 0pB@6T8 1 !S X p . P000`F 900 6( @-@,9(0 R @0@o( @-@T(P00S@ S @R 00V0( p@-P8 40@Tp@E0S 3/@( A-@`TpH0PU4/ 0S  3/@PP(  B@-  Q &Q  GFP-/p@-@@P0S0 0S!0Sp00Q!4` H00`00Q \R HH ,M@O C0\S]S_fS_YS_S_p@-P@@0Sp0400P 0S!!//G-18M@P`p00 00a0,@(P$@ @@ @8)000,1 0$100a4,@(P$@ @ @P0'000 000a04,@(P$@@ @0000 000a04,@(P$@@ @@LB <<B )8ЍG -_, XWS_S_ɀS_](1WJ^@-@d0 0Cd0@,@ɀp@-|P@x`V`803/0@Sh h0l 0lPd0@,pPh`@@ɀp@-@tĐdPUh00 P Sh Rlll h00@03/`+p0SP@ɀ@-`墐\0@T@Dڐ<0S d0,0d0Ґ<03/叐d00Cd0h@@ɀA-@A@`npPK$VT H0T001S*@@348 Q8 0 8 4(@40 8 04000,0S((@0 0S 0 (00+V0 0 0 :"P 0a1!sr0  R 0`0` 00@0 0`00Ȁ] qȀp@- 0@ 0PP 0p0P00p@-P@ `UAPp0 S 2 A0/S$0/S  A 0 0C0070 R99 R999 0R .Q  .R:0p07:?p0/@-0@ P P10P@J1O-PMU@  =DPC R& R#     cP (1T R@1P@*+P W *pW`/oU" R 5 0Ѝ `P  0|*V O-p2`M0 @U Q Q 20S@0000-   R  5P Q P`` c0 P d/0P _/0001$p@!`0V  x.`C0 /RI 0S  0 0 ` 0 0S P/0 P K/0P F/000J0S =KP  `pR0"  ! P !PS 0 40 TP 0 S !" 00 `Sv r 0 T0000 00 R000 0: 000 00 0 /RL R 0T  X00090 000 0STP S0S .0S00T0.0 X.0T0S P X  Q   P S0S .X.0 0000000S 0CSg| G 0 00 00C08+  Q~  00x0d0 p0Pm pP\0 00 c03Sa d{ W.0T0p0-XX0S00TX0T ]XX0S R0S 00 S0X TP TP S0S .0 00000,00SQ 0N <0< (000000,00,0(H0(0b0S .P 0p0p00S 0  0UG U- .d[/ -TP0S p00Sp吰[ .P 0 pP0  .P0 Pp0p0 P00S0b 0P 0pP -0p0  P-XdPU ̰S-zX0 0T00 0S 0S0'0-00 0S S0S w- -0 00000[S009   R S R S0Y- 0T00US0S 0S0@0 00 0 0 0C 0D0S0bSf 0 00 40p6 0$0 S$ d ;2 000 40@ o=P ?2-B :,\0 p00['`0\pp0`Pt`P 40p  l? ?X ,ꀀx,80Sh50S 1@0,80/P$0 `@R0 r {R`" /U  0X P@0凯 N 0 S o*000/U  ` `0/P$000N0}P 0X0S 0/U00S 0S*0S 0VP0 SC*/U 0  L00/P [00`$0L0 /UZ Z2* 0S/ 4P) 0 S*/U  `0 :00 /P$ X$ R  $0+$0|+ 0 0 S:t+?//U  X X 0S P 0 S */U 000 ` s/U X X 0S `P @0 1  0 S */U 00/U [ [* 0S P 0 S *000/U   `6/U [ [* 0S xPh1 0 S*0/UP <1 `00g/U[ [* 0S ~P G 0 S L0g*/U00 000#/U4[V fP1870 d=C 0 S 00J*/U deL ƁPT_sT_@__UT_~_xǁ|ǁi_5^^\T_3^_tƁxƁb_"5^s_iT_n^nT_s_[ * 0S /U X @*P870\  dC 0 S */U00[* 0S /U X X 0S Pj8c7@ }U0 { /P 0R00Ǘ 0  0   P* 04 0 00/S9+ 00S0 00 .R  .R0/S0 0 00:+40 0 /R" 0 T0+0 00S* 0 00`pd0  P0p0gP 0  }  { -4 0 0 0 00C0S *wT00 0X  900S00@TP *T@T0 0X00(0S ,0Ѝ*6*Q** R 0CSP S0S *X*0 00000*00 RX RI=0S0 X R /a>P: X 0S /U[ tP}7x6:@-(0M00    0 00  @ Ѝ0@-M0(0000 000000000  @ ЍC-04MP@ P?Pq/`PPkP( ,00,00`4`p 0,0:4`8 @(`p$09PPK804 Q0C00 0,0ɀ,.Q .R: :9,0*0 0PS <00U0S R 0S ,0  0 PP )U`V ,0 .``4ЍA- 00S : B0pP`q900@   0S P )@00WP@.@P )T_T_0@- DMP ^@, 0^ 0^ ^P  LB 00 0u6U4PP00DЍ0@ ]T_A-P`pN@P P 0 P00 A-P`pE@P0 @Ѝ0 G-P`ሀ#p@0T00/ 0P0TՄ(P @ H,PV  6/P 00S0P00P0)P07@- 0P @P  V7@ Ѝ0T_p@-P`@`` TP@匄 @∄nE  ₄ ~ 0!p0 ɀW@-@w\Pr<0(E0864P p@"0 p@-P "@@ $"@p0p@-P"P@@@ "@p@-@ "@A-P`P 004p@Tm00 0S0PPP@ 0S@@XV P@ ɀ0 p@-@QP \00SpPT ` @ Vpl$ p@-P`U'@0 R000@00P0@pp@-@%P 0Pʃ/R 00/ 0P0p@k'0A-`@VP p᱃/R 00/ UP pᢃ0000@@@؃VAO-`M@'$P̡̱$007P7@!OCAd@ 0P p- 0 S   '4 pW ,PÚ 8pP# !(7p 2:W 'W' kPUPW00S XPrX R0 R 'P $P ڔ  BR;*'U'PW ЍXgfff@-@>|0 !!|0x0t0l000, !  ! 40 @Pw>U_Hhlف ^zW_ 0 C0 0C0 0(D0 p@-P`6  &0P0P0P@0XTP`0, 4婂0 0@0D݂pɀ0 A-Ppᔂ0`V͂@ g@Ph`d0l0d0徂PP @ 00 N/ V?U 0WI=.nP@ɀ0(C0 0 (C0 0 (C0 0@-0MS@PW@P@ 0  VP W@P@ Br&Ѝ00@-@P0VP0S# S  Ѝ0`< @P qp  0P 8`J&VUP0 P (`@0@ R/"A-P`@ 0Q30Dp6@0@ށ 0ShAqAXA Q TQ1@0100 ɀ< p@-P%000@ 00封,0$ R @@0@@pɀ0 @-@P V0嚁 R$ 0 с@$ɀ0 Js@-P`@P !0R!0RЍpA-`p@PPЍT$ P*R0*T -@A-sMPx% P P8 P L<@,@3 sr* 0" ">2qp>R PP* R5@7T <Ѝ@2P `P' PPf D0SO@ 3/@d00Cd0T\7`dPK0 (b90d00d0 @Pa W>ڀPU D0SK d00d0D03/@ʀd0T0Cd0<?U|开0S2hVd `G<%09<P0 1</ 0 T @|LDЍO 0@0P ^^W_W_W_X O-p`Q`PM@8<ԣP 0J4PP#W  |d@T`@T!| O2P P 0 tPP x |PЍx @0 t;P03 04300|h0 @ ǀ O-p`P0M8  A1 a062!Nn 0 00@  0 3PY|d@T`@T|)R0t0< P y l| ЍT @)R0t 0< P @ǀ p@-P@u P00CS 00 "`0St t0x 0`@x000p7@-@000 0RPo Ѝ0O-P`ᬐMv UЍ'J0J@V @ V h_9  0 ,PP Pz  G1 W_p@-@P{2p@{X H0 /p@-@DP{H0 49H00S0 1 . p@{P X p@-l t0@SP Sxxtx0t H0; Sd0S0000p@!CeǀA- t0@SP Sxxtx0t H0; S``d0S0St t0x @x` d`0TpS S PP  0S 0@}!Ce@- @0 0S0 S0?0S0 ? 0000;080S QP 0;0/O-$MH0S`0Q@`,` p{0PU W@@hP  V   L0 0` V`h{@$Ѝd0H0d0{  >`$zd0V0Cd0p@J@ɀG-Q-PBM:p(1SP5R`@1@0zN@P@)@ O?P@D  P Ġ Z P @Dz@Bߍ q N>PP H>PU  ^ @ʀ@- @000 0000p0`0P0@0x0|0p@-M`P@0(@0 0`Pr Ѝp$ p@-M`P@0(@0 0`P\ Ѝp$ P0/]X_p@-@M |0U `40 H0`0L 0/0 4 50$S-!  Q p r5\0 0X0i5T00" "a5= \50 00`pS5`P`0FSTK5 0HG5ݍp8B5]]X_ X_l^<^X_KX_uX_X_X_:6^X_^@-@P (-50S&5@0M^<^@-`00VM@YPᇠ 0 P0pwydPUyV0 600y R00S$P ЍtPOy@PT0SdPyU (/ǀ-Y_IY_p@-PH6yD0@T0oypPh@d00d0@ɀ0P/p@-P@ p 1Fx01000.%/&.%/&  N+VU +# + 1|0pO-p$ML@P`H NP0>WM 1U㤁$10S[  @?0P 0ӟ<T00 Y  $Ѝ_ P1 ! V 0[ V I08/P 0V+c0V  h0UNR@TPPP 05/P +` 0V8/P l@ZL 0@-p0MPU U@ UPЍ0Ѝ0@ /00Ѝ0@ɀ0 0 $ 6::70//0/P 00/]-/0 0/00/00/00/00/0 0/G-Q MWa@Pai x0p hq0S@0@0@T&lXY0!,1 (ȶ/x0  0 R8 R BQB03!`P` x!P0   ]-`w0S SV(!P XX _-0/0040/0H0/-L/0P0/T0S000/p@-T@ $00$0$@@T@Uwpvwt @-@pw0N@wt @-@,dw 0 0 00Nwt Q3O-M  @ (R0:@PBU1# (pU< ` P``0 p@P 0:@P( 0:@P  ,:@P@  :@`0V S0U MߍF`BPC-$M@`100 00(00@ 0 ( 0P1 0  !000p p1-p 0#.pP  # "7$ЍT    9p 9]p@-P@`M$ ? !|`2+Ѝpp@-@P`M< .!! +@s-Ѝp@-DMp `P@P 0P,@@00P'4>@P DЍ -@C-p`M!*PP*0@S+   0P0`'0)PK0  000`0&0)PK0S@! @*P-ЍyKxA-PpZ@Pzdu` 0/S J5@P0 z!Ѝ0 du@ 0/S 4@-`PRdvp 0/S "5@P 000dv@ 0/S 4G ЍC-1@3p Ma YP9+ 0=@P,@P'L10S 8 B0<00@00000&D@P (0S" ,<.,,(0P(@Ѝ/  qP @P0P0$0,( <0P0T0< P0+@P(,ƁZ_@-DMpP @P`P0i @DЍ ,  @0 0&4I@Pp0!0S RW# S+R@ , _+@F:R@, *@,+WE@+G-M⨀`P pO@P I@P0@00&@@P($pY +H0SD00 SD0 .R0.S 0t00S`280x00L0 0P0&L|@P}0d``PSx08x0V +0tS00.S @_S0 .R0.Si 0W@R0T03/@PL0 `@P<U `PU 0R'S)XD X 0S#YH 0RD@P 0 8 n*0@X03/% {yЍS@@UV 7+5+0X03/ *}U y8 * tr@@@8 @-P !M`#q x@P 0,00@0000^%4#@P 0@T ,*T @> @Ѝ"@0@0$0 0 00+8+D 00, @0*@P   A-pMpP`@PE?`00\@4@80%4d@T pЍHP0S@00000 00!0$0100! `(0 `3*@P !(@P 0`F0`@-Mq` P@P 0,00000@0$4@P 0S , *0P@Ѝ@0@0$0, 00:#:D0@0z'@Pu@-0J@ <(Pf0((0P 00 ((kp(P pP pG |0S 5$` @ 0000%P0 GP0r0 M85 0|0j 0M( rQ[x0S | c6 |[Br0S pIr $0  @002 00   0S 00 0P%P^ PY0Sr M8M( 0& 00001 0! 0 000 |0PW  2p [* 00M(  A +%R0Yr[0dV 0 pP V-040w    R Vj 0 SPb tV|-00|00 0$PO-]@]^t w][_,[_@- 0 0 0000 zЍA-`PMp@P0@00<@@0"Dw@T PЍ(P(0 @@0P 0$@P  0 0@ p@T(Ppq0S [Hqt s@-`@PЍp0WqP @00!.0@P000q@-P@pM0 0 `P Q! T@,0 /!bR 0QPU @00 Y@ЍQ[^XS[_lW@-@-T3\M`  @P04#P0 S0, `@P,  $\Ѝ P} @P 4@$ Pl @P$ ( P_ z3@P  @P(  pk3@P( e3@P  Z3@P@ `0@P@ @ D3@Pp@ `83@P @P@ 0000p@ `3@Pv @Pp  ,4`@  3@Pd @p+`2@P P @Z@D]0]@-@M 2P ЍG-@!MS$ ` p! WP0O80-PP%W$! >P?@0Sp 0<P0@0 P =U $Ѝ P@ Ȑ  P00/S S 80SP +4@+  L ST_@-PX0M`p @P 0 0 0{@ Ѝ]p@-@`L 0P@P W3@p @-PM p`.@P  04 00#0G@Z.Ѝp@-@`L 0P@P #3@p O-1MP`@0D`@ pu0 0P[0$0P 00 00P*U!@UT@H0@0 UT*0 0 0P@0 3/0P` P P@@0 3/0P 0K50Ѝ ST_@-0 000Ѝ @G-p`.@P.0  0S@ !5#PPY %$@@ὕ0S&   P  PP @-Ѝ 7@ T  j@ JTG-0Pq$@!@`ပP  PPPŕ{!$  G|0@-Mp 00000` 0@!@P-@P0`Pu0S@@!"@ %T#-Ѝp@-@MP `y@PU?000,@@0`4@T 2@Ѝp00,0S@@!w"@P$$0s@- Q@P $P@`(00FЍp0 0p@-M 00000P 0` @P0 @PBЍpO-5,MpT @P= a$$,.@P 0 00000 0P  000 0@P$0  -,Ѝ R  -$0  0@P$00P@Pj$$  -@ C-p0MR`P0'kP 0 3/@kNT T+ du40000 000@S ?,ꩦ@ @P0/S z,@P0  QЍB@-p0@ @`WPP @ (0 T@7 Ѝ@- 000@0 cP 00Ѝ@- 00 0@0P 00Ѝs@-@ PR000BS` E00S03P R30Ѝpt! ! C- pሐ(P@``V`31P01 0@PP  ЍS0p@-0P@0P 000S 0 p@Fp-p0ASG-Pp@ `C/PP00S!3 T` TS @P0p@-`M 0000 0PT@P@PT0P00L@$@(0T$@T j`Ѝp8`ep@fT  .@P`0 0S0300@P 0S@3:/@O-P0!M0#q` 0000 0@PcUPd  bz,@PX  a@PF@T0SG  Y@P   @P  4,P 0S-@+" f 0$  W @P  0k0X  X k 0 P@P" 0  +Ѝ-@@@- x Ѝ@-M pP 0`|@P @P`@ TP@Ѝ@-M@ 0P 7/ЍA-M P` 0pE@P @Pp@T 00 00@\Ѝs@-P@Pu 0`00@P .@ eЍp C-P0M 0000p0 `@P  X@PepP0 @Ѝ @ @0<4D@PZ(`V@&P~$0 00:#:T0> -: S'  S"  S0 0@ S+0  S0P00TS-sr@,<T!,P5V% "00 P-0T+S S ,P0< (@P ( ,<!@P ,<)!,,P0< (@-@# Ѝ@@YЍ@- c Ѝ@-!  Ѝ0 cD cp@-HMP\0  1 1 0,@P+X@P$0`800 @4`0 <G@P 0$S@0S 0R@4  @$!$]?YHЍp@4 $ 0PN P4]]@-; 000c0 Ѝ@- 0;0 00Ѝ0 c! 0c000@-DM #@P$P0@,P00004@P 0S00,_ 0P  P @DЍ0  ,!@P ,F  0c H0E0 c@@-0S@`@P(0P @ 0,Q@ 0P000 1/@u(ЍpC-pM`(PP 0d( @Ѝ 0,Q !!1/@P hQ@@G(00@-MA0 0@QЍ0C-pM`Y(PP 0,( @Ѝ 0,Q !!1/@P /R@@(00@-MA0 0@RЍ0C-SDM@`p.  E_U_`@@P#00P,@@0;|Q4 P&1'2 4P@T WNDЍV@ `c 5@P *@0@-0 c Ѝ@- 00 Ѝp@-@M` P@P0P,@@00P4@P @ЍpPi@ @-0 c Ѝ0@-MPP @@0cP F,Ѝ00@-MPP @0cP 5,Ѝ00@- 0MP00P0#@3P !,Ѝ0@00@- 00 c[ Ѝ@- 00S Ѝs@-P@0` 4@P v@G Ѝp]@-P`V'@P 0 pa@& Ѝs@-P@0` @P K@ Ѝp]s@-P0` D0D0 0@P C@ Ѝp]]0@-0 c Ѝs@-P` '@P0 &@&Ѝp@- 00 Ѝs@-P@0` @P  @ Ѝp]@-P$0` L0L0 0u@P@0 *@ Ѝp]]0@-000 c Ѝ@-PH0` }@P00 0@ Ѝp]@-P` &@P @0@H&Ѝp@-00 00 Ѝ@-P` &@P 0 00@*&Ѝp@-PD0` 4@P@0 @ [ Ѝp]@-PH0` @P00 0@ D Ѝp]G-M0`@S11\p @Tm0s_e 0s0Sp 0PPp?X !(YPP 0 SP? P0UPP([0 s` 0 s pUZ0!(00<PW  0S  U)PP Ѝ 0sP0PP]]p@-PM`%@P @0 @0c0 f@^%Ѝp@-  00 0000#30 SЍ@-0 cHЍC-LM@hPP$ l0S ((P(0 !R x S:LЍ/``0 1S<0Q*!!? 0  0@B@- 00 @0 Ѝ@-P` C%@P @0  00@$Ѝp0@-0  Ѝp@- 0MS@$P0` @Px 0S@ >@P!=@Pb #!T@ Ѝp]p@-P@$0P @ 0<Q-@ 1/@$pp@-PM$@P0L` 0 0 +@v$ЍpG-PM$@P2 0 @+ 000  0- @`@0! 0 J R@@`pXP0  @7@$Ѝ@p@-PM{$@P0L`i 0 0 @$Ѝp0@-c 000 Ѝ0@-00 Ѝ@-0c 0 Ѝ@- c 0 Ѝ0c00 c0+c@-`MPp"$@P 0 @ 0 @@P0 0@0@0S 0 .00#ЍƁ@-,0@31!$ p@-P`Mt  /@T0@&0S00P0@PЍp07@-<P @P@ Ѝ0]O- ` 0M&J0 S1 0C 0 p #@P 0  @ PT 0S@  0 c@9B#@Ѝ@G- `@ 0p%J0!S B   u#@P 0  @ PP_ 0S@  0A@  #Ѝ@@-@(d$0S( ( (0$ @Gdɀ@-@, 0c,0$ @R$$ ((04dɀ| 0S ( #P QS//p@-@pc 0S0\P 0 :#0Sp Q R$0ɀ| 0@-@ 0 #~@c| ɀ00CS0/@-@P $ 600C0@ | 0M, 0S*00Ѝ/| p@-Pp0 0AT 0S P 0SP@p0S00   @| A-p䀟3AT \c`Pc0S @000cPU PPhAcX0 $3`U3@103 P000 @ɀ| L031S  R R0SQ 0/A-`@P 0S00p"P P 00 ""V DbP 0$0 "cɀ @-0@M@ b b|'"0l 0 ` `0 X 00  , $0 Ѝɀ| m[_t[_TWW0{[_1S/p@-P`tbAT`b\@Q p0S `` ```@` $?ɀ| A-p` P0@PP0PpPP$kb 0 0! Abɀ| p@-P@`Zb0P 0 1S 01  0S 0 0000p@bɀ|  - * 'G-PP0S0C04q0S ʬ!0SB ! b00GXb`b3}?@T MbV @ $` R   R  R R R @ 0S  B 00 0003``}?00G!| ɀ @-P0S003@oѠ@-P003@oG-`P@# PpW@ Ѐa ` !@TW% V@ @00@P WtZ`a0U 0S  3R  P $@030| ɀ @-J0@-D@aʀp@-00S-@ `P3@P V\ aP#@Na@P (ap@@ @$ ʀA-@t`p6a0@00LmasPp `D0S0P0P0_ɀA-@`paP|Na+@TWHT0S0 R @S    ;ɀG-0 PP;0`0S5P $10S00@S00 P 0S' q ` 0S00`pW`0;00S0C06 0S W p`0h0kX`LP00G 0 3/`Pp0; $ ɀ 7@-PP00@1S  DP+T Ѝ0@-@- rRA-@`PPpczVP,(H035@A! 0P R05/p@-0@S`L XB`0SP P Q  - `=0SPE 00@0@@U04 @ V @ 08ַU@P@ 0R08<ʷ0S  B2@ S * p00Sd% 3 @0T"#!Оp@,6`0@(00PpV@ʀʀ DXMb[_@-@`!00CS4` ؆O7@0@ l p@-@@P0SSpP@-@ P BT@DpP P p@-0 l*@-5 ♆2`0p P6T@Plm0P00 00""00,p (]W_ʀp@-PX0t p0ATp 0R 0RP @ G- P@᫷ ৷U `ἀD`t00@0$V0:Pp9_p01Str_0 H0L 0 H0P0L T 0P0 T %R0XP5\p5;`P0p[_[_ ˀ0P/- R  0 RP <04Q0 4R/00C-@2 TMc刀pn0S @500_؅^H0   . b?zH0<9H0_ 00@SPP0S ^ P^c0 000P T BP 80S ;40789/0 00CSk3+5`P !0SP `0S h`a^0t p 1S01  0S00^0U H^t0 0000|^0HP00y2^TЍˀ][_ ( $ P0M0Ѝ/O-@`P㨃娓娣Mp 0R0S P001 U bV ?^]nPP 5^B`P00 ! P) [P X0S "d0S&U 1V ^]`P00P1S  EP(UQU \0RS~ЍL 3S00SV 1P ]]V P FV `P0 0 0oH0 0 U P]|s]PYH0   . b?H0\40 00-] p@$ ( ˀ/p@-M 1 Q 0<0\@0@00@00@00@0@ @@@0  ` l\ x0t0xdpTN8% <D0D <0<Ѝp@H$ @ʀ[_0 [_DTW[_X[_Xp@-p0P l-@!0 @00P]P30P0p (]p@-``P\@Hd\D00@ R000@00p@<@ʀʀ@-@]30@ l @-@-R 00- t\@0\@ʀA-`+\P@PPʳЍA[\p㈀Pp@PW 000S$% 3  0"#!Қ@ʀXMb[_@o/7@-@T[00zPP$ Ѝ0@\0S@ʀp@-PP ڼC@Pp[ p@@p@-@4PPp[ p@p@-@(PPp[ p@P\0S\/@- yP@Pʀ@-@[@[@-\0 S00 00CS\0[P@2][_ʀ@-@v[@[p@-@m[`V  9P  [p[8PO[Ub &p@-@Hu>[yQ  J @ C-@MoP$[_0S\[bЍ`0FSPO[0@؀G[ p 0S/P 0DP 7@-PP00@T  !P&T Ѝ0@@-@\00\0\0 0CR\0 SP [[O-p`M4PG@PTo0S`@0S*dЍxP %[P pP0S Zy@xZ눀JP ZTZP  P,tZ O6@ʀp@-T0P0LS  BBCaZP p@Z 0 *D@ʀ[_O-0M P0 0 F?Z P`P 0SnZ,ZiZEP p`;|`ZpP5yPĐȠ@PZ P,8!t0p 0AGZ0 (p 07/pP` Y0t p 1S01  0S00ЍT 0 000R4Y00Y WZZˀ G-04P0pR`PP 0  0 @ ,` 06/`P YVЍ0S pY P"0t p0p! AY0 0000LtYrY ,YY@fY Yˀ O-M ` p[D@  `SPȐ`İ@lGY P >Ѝ@0 t p0 P! A`ĀpmY ˀ G-M (8<p  `Y @ PYLYWp0ĠȐ t p!R !  R t  At `!R ! 0 R ЍGˀ 7@-@PX0t p 1S01  0S00P00000YP Dis Pl p0XT000000X  Ѝ0ˀ $ ]\_[_8 0S/T  BRT @- /@L]\_@-@P@oC-PpXPX Ѝ@Xx0S 0`XX0Px00ptp`t0qW P UHX 01Ct010qD@ʀ ˀp@-P@`X00p@X00/0S S\/ //G-S `@H@ VBQA<`IQpQY/ `PW,1X`V `$GpQ`n` N@PT0~0 (00 `$GQ] @-@P` p 0  Ѝ0S0S@-l0  C0 $ , 0 P *0W!W/S H /p@-@0 0P0:0P0<4P`0@ P P  p@ ppOpppH0 /@-@a~XWH0  .?H0WX0S xW~H0  .?H0 L0 H00 0 O-,@ 0!@L ( MKJP`Pp Y]0FoSVYT 0S [ YPT 0`Y@ 0 F00 0  O-@2M0L 2Pc0聖,000 -00UP48<40=  , L06   03 009pP * P RP[P2 PV UG@Z0@01[D00, 00@0P !y[y] " Ѝ4 ,0D0PK0S? 00S=  !  ) P ~SX  X S, 0P0[P0L P P@ 0&@ P -OY 1PZ- 1y 000 20 p@-PP@`e ,SX00CX0fS oPGp O-,M\@`ကP`dpP>0 0%!X0ЍS`! =P@V 0 0W@0/oS" R@X ,Ѝh0100 0SO-P@1H# 娡Gߍ@-PGM`p0 *@PL0 ?@P 0 0 0@cGߍ]@-PGM`p0 @PL0 @P 0 0 0@AGߍ]p@-PBM`0 @P 3@P0 T@ Bߍpp@-PBM`0 @P@0 @P0 7@Bߍp]p@-PBM`0 @P@0 @P0 @Bߍp]@-PM`p @P 00D@ Ѝ@-PP0M`p @P00,@Ѝ]@-PP0M`p z@P00@Ѝ]@-PGMp`0 E@P0 Z@P50p 000 0 00Z@xT0 -T0V@0Gߍ]@-PGMp`0 @P0 +@P0p 000 0 00+@IT0 -T0V@0Gߍ]@-PGMp`0 @P3 @P0@0p 000 000 @ T0 -T0V@0Gߍ@-PGM`p0 @P\0 @P 000 >@-TV@Gߍ]@-PGM`p0 @P\0 @P 000 @-TV@Gߍ]@-PGM`p0 m@P @P0@] 000 @^ -TV@GߍA-`0 Mp d@P'`00 0@PppU0PV0 `F000pP P@p!00m-TV@ Ѝ]A-`0 Mp ,@P'`00 0@PppU0PV0 `F000pP P@p!005-TV@ Ѝ]G-P M+ @P)0 000 @PV0`W0 pG00 0xP P@!00 -TV@ Ѝp@-PBM`0 @PP0 @P 0  @-TV@Bߍp]p@-PBM`0 @PP0 @P p0 @-TV@Bߍp]p@-PBM`0 ^@P @P 0@N0 @R -TV@Bߍpp@-P`!0CS@V Pp0Pp00p@-@P3L0 #p@iLp@-@P%L00PP]Lp0@-P0M 0 0P@P0 03/@Ѝ0 ]@-000 03/Ѝ(]@-000 03/ЍD]@-M0<00  3/@PЍ`]@-M@000  3/@PЍ|]@-4000 03/@P~Ѝ]0@-0M00 03/@{TP PK<0 0R 0"KЍ0]( @-000 03/Ѝ]@-000 $03/Ѝ]@-000 (03/Ѝ]C-0M p08@P% 0"sr`@ P`VK $K0 ,03/VP T 0"Y0 3:UЍ`$]@-M@0000  3/@PЍ@]C-M P 0@P @ 0 `K $pIK@0403/ 0P Y` X0#3Ѝp`\]@-( "!0 803/Ѝx]@-( "!0 <03/Ѝ]@- 000 @03/Ѝ]@- 000 D03/Ѝ]0@-P0M 0 0PT@P0 H03/@kЍ0]0@-P0M 0 0P<@P0 L03/@SЍ0]@- 0 00P03/Ѝ ]0@-T0M0 0 P @P0T03/@.Ѝ0<]-00$M0"!#!0 X03/$ЍX]0@-,M\!#!@0 00P @P0\03/@,Ѝ0t]0@-@0M  PP 000`03/@PU 0JT 0! ~ 0LJЍ0]@-@000 d03/@PЍ]0@-,M080\ 0<0 $0 0P @P0 h03/@,Ѝ0]@-M@00l0  3/@PЍ]0@-@0M PP 0 p03/@PrU 0IT0  0IЍ0]@-M 0400 t03/@PNЍ]-$M0(000,0 00 x03/$Ѝ8]@-000 |03/ЍT]0@-P0M 0 0P@P0 03/@Ѝ0p]@- 0 0003/Ѝ]@-000 03/ Ѝ]p@-x0M` 00P  00 @P 0 03/0@P Ѝp]7@-00P00 03/@ Ѝ0]0@-,M!80\ 0<00@0P 00 @P003/@,Ѝ0]@- 0 0003/Ѝ]0@-L0M 00P x@P003/@Ѝ04]@-000 03/ ЍP]@-000 03/Ѝl]@- 000 03/Ѝ]@-000 03/Ѝ]-,M 00H0400800<00@0 0D0$00 03/,Ѝ]-$M "!00 00 03/$Ѝ]0@-X$M 0 0P @P0 03/@$Ѝ0]@-M@000  3/@PЍ]0@-X$M 0 0P @P0 03/@$Ѝ00]@-000 03/ЍL]-$M0(000,0 00 03/$Ѝh]-$M0(000,0 00 03/$Ѝ]@- 0 0003/Ѝ]@-(000  3/Ѝ]@- 000 03/Ѝ]@-A^_p@-P@`P00@000000 0(0P0Pp8 0 //00// //0/@-@-@-@P 0P hP @-@0$ @ Ƨ@-__@-0n$0@@-0n/// / 1R *1 4SHP// 0 //0S  0S 0@-@@0S  00S  /0D 0C S 0 0( /, 0 0]7@-@00PG000U  Ѝ0@辏 Ѝ05Gp@-0@ R R p PT `h 0pPCX0U 0S __"__1 011M/ ⦉G-`@ PpY0S 00"0S00%0 `#db `0 00CS00 00CS0@-0@0S(>0 0 86)__4__:6^p@-Q@`pP 0S R0C BS0(0,1 @V p0( ,0Q0@@ Q0Ls 0@ 0 0@-0@0 UDD@٦O-TM `@(0|0 00pS0p0 @ "1/0@zS 0000 $0 00( [D00 X 0 SDT00T0XDa R x0 p000 $00X3p #H3PL0R0 70  0# "00#00000p( 0c,0y 07B, 0SB[CQ0 [3$0800H00<00$0 P9 0 00B 0S- &\r \dXBXVʀ 0! $ 0    !03/ 0!d!0    ! TЍ8$00 @,3<0S ZHL 0rq R x $0B $0   pJZ  ([W  Z  R 00婢 000 G40040$ B, $04 L@W b4LBH PX@Q@0L <8@X#< M$0HhlO-$pM@0L0?o2D00@ 0Zp0500#40040 80S200#809$0H000  C@CX 00SXjЍD0S00<00(0`0 0` 0$000P00  01/0 0, 6 ?R 01/0 6?Q 000Sj(0S `0S (0( 408 03/(s0000 0 00SZoQ00 0S 3/00SD ZC K 0000 00 0 0cP E P D 10Cs0 S0 !p0R00S/o" @ 0Q0EsP@0Si0 S 00˟ 0#0S !ϠUN  P b B  , PP/P P/P 0>^0PSP 0PU,0%V Z1 S\0<I0P0 A!┸00(0S#0(0Ag%BX 408  (0(\*40X803/P  0R \$0S40S  h"R 0$0S  0R \~ 0 V,0"&0:808 01<0D0 000<0000 0 0P $0Sf <h<< l0& $0SU P<` 0P0 0 0S8 00l08 Poo 0bp @4\  0P$0S+ 00, PYV`` 0U`V <\ ۷00D0 0000000,00P $0S h0`@00@PS 000 $0 P0<731|0L0S  E0PX0 @00`V,0P0U`PY0 `C@0$`6d0d 0` X 00 L R  PhI0   %6p1g 0@ X0 kI P YP,T0Vl 0 U,0"&0:H00H 1 0@P 0 0c5qs0 RZrQZ3h0000000 h0PJ   L0S4 00S @X/T0X00S 40S 0| d0  d / ,01/Pxg@0Sg$0S T < V?T001:#H P `VH h 00  B b320S V0# . R HH @ P! @;*"*X S0t00x0*sr0X0 C ᮶40St 3^P0x >0 PS 0%VZg0H 40U Sg0T0tPx`F)0 0, RS00V00S000 " 00 E; 00)0 C ch00172P pPpUP0 b7pr QSqQpP S10 8p<00P 00 0<00X 0##@0 080UDWY 0@ t 0  P0SfPwj)ၷ 0D0 0p0 P  0<!W$0SL4 L00 ]fX fw$0S0`0~ WZ__kOO-EMD081@ @$0<1(000@10008308L00@1 0H000P0000L00p,0_0`S P00 0 ?H0  d0SMI?W ,0S 408 03/[fPEߍW5@12 0 SpPP) GfDf`눀X `,0 0e 0p,08P @1 40/0\3/PP 0 0$0( 0` @1]V` @1 0S 00<0 ߸0@`D800 0 0 PP "$R( 0XP ϸ>X H0  0S0000 0S 3/H0  ṱP d0SeL0+ gH`>i&gfkWe ,0S 408 03/5$01(00 S0 0<0H0S00@S  @T0jX0LP (`,e~q8e 0`! 0  D1 SD1P P0  S 00(`,S XjXjt$婵(0 T0,0X0K040 V'X `X 80` 0S4`080D'8`P @ x 0(`,0 00p 0 h  01/9v0 )V. h0lS00V#6:`0d030 000x0*V0d000d[ `x0 A !^d` B[x0x0   5> !tPp k`  R  R"&*QNƠ  ` 0 x1*0`000ad `0 0`0`0 \0`0S"X# d (`,0C6`ïd0` x0P 05/P␷WdU 0xP`0dx0X Ự@0PD0  $0P(0 R \0S  R % 1`40S  v&  <0 0 S㍺ %0 S\ 101T0S@` T0S cZ____H@-0 000! Ѝ 0  /A-@0MPb  ,0F00 00vЍkOA-@0MPb ,0F00 00]ЍkOO-$@ @` pLM 00 0 00 0 0 0AOoBBLЍ06 ?\0c@@c|13100 000 ` 0`pVc 坷0S@_cQ(T 1 0@  @& (  6, ?(#<@$8] 0(@P8 R  ˲T 0@ 0 0Ṷ&`G-@0(MP3 聓0bEFa@Ѝ @! 0;T0 0T01< :0000 0$@ b62< RW1Q00Wrp @0u(ЍO-0TMPS@$0 8Q"'  "$ $ # Q $ R0,00S$0S 04 8 TЍO/4 8`#6/P TЍ0S0000C0H#Hc S``V 0 0 00 000000"R 0 0;;020S(00  p a 0Q2! QP#Q0q0Xp a8 QWQS1WqRk+p\b0 @20>00 0  .p0 P(0 S00 ,40啌P1~pp p,00 00pG<010801 1!&DWK8v"|1 0(0` 000 :#: 000 {8a"0   ,fXE00000C00 000 0C02DH8 40P)qp% D8 40 ?y#p{00H < 04 HX[Z__xH0gXp@-@P:0 p@:G-P`$0@p3/@PZ@00@800 4/@P 40T00S vmVx P P$03/@P P 0Sf P @0S|00S@0SP 00L0D 8/PP H0U00S @9@ 0W4 V4 P 0S t P 0P l 0S0S PP 0S P P ^<0 P0Ѝ0P PPSSA-`Pp@ T 7W 1AO-P @`TU  T 0 0 06/@  ЍG-销@0H?oP20p`PS V TXTYGO-DM,00000l h 0 @P QPሠ$0 3/@PF`V@@800@  ,04/@P680U <00@ p0l 4/P@<` P#<0Ux X880 R R<`VS <`0S0S VV8=<P @84DЍ8pW0S@; x0S@7 U l0 0Rl0 t@P*   03/@P0 @t 4/ 0tPp@P 000,0p 0@ 0 t4/@L00SF0 80S @@400 @ 0 t4/@P40S,80 0,0B 0<0 0p0@000l0P0 0 #P`@p 8p40<`S0 `p@4P Tt o<0 0p0 000l0@080 0,000V9`@ 0  4/@P`t0 @ 4/ 0Ptp +0@t@P000p00l0` 0,0 0@ 0t4/@Po00 00g 0R S@`@ 0 t4/PB@VS@RA-P `@0pO0S 0GW 0@T0S A050@-P @ \ 00 0O-pM0<0P0H00P0 8`@DL 0{@P& W0V04 P0Y04  0 ЍO  ^P0S UP @Ѝ /A-@` Pp?P W $0 Al<@- 00 00! 0!""##$$ ሾ@-77Qp@-@ Q  88PPpp@p__\]Qp@-@ @Q\0@$0@0$0ppPw7$@7Tp\0$00$0$@Qp@-@ @Q ~ppP]7 0"7 0"p@-Q@pP @Qf@pE7d 0$ 0S (0, 0@@v7d 0$ 0S (00, @@p 0S/S 0 / E/0S//0S-/@-__//@- G-`@0S 00s  r Pl 0 r 0 pW S S W  P UȀ- //@-0  @-   n^  ^o    B^]/@- ]@- 0   J^  v^o    ^]@- ]@-@M|^Pp^P/@-0]p@-@Pa]@p_]  ? Ra0 ? /0S S S00 /$0@-h0p0x]]]6]2]]])^A-`p@ PUP @A=: <900   kP1 @0<3@0<O-@`Mw0;*}.0ؠd 0ѠP"<[%@ 08P<000@P WY0* [@_ [@_ZYp㠐~@_p W0: 00C@_2 <0# , ! 0Q:;,O-Qkp0H"v@ ` 0Pl2 S n2@`{? _!2@T`0!U!:#@T`0!I!ƒ1# @T.`1 2d Z%0 PP[?T   P ?T )@.0 @0<  ЍT`@PT@`P[?T `T`0I 0@:QO::P/G-(p$`P@(Q<0S00$00V (`嘀?`aV $'0#$+4SP W8P< * %!  (h$0 ᜟ V (00100 @ D@-0@00$00rPp@-@P`R/㨟PP`䄯 ]Pp@-@ (0!( :@ @-0@0!80@(A-P?@ `!tpR( W\00\0  WX00X0%0S`00S 3/050(A-@`PP p(ⰸƦ(p@-0@pP(彦@(Tp@-0PS@p 0x 0000ᨷ\`(0 $A&(0@ Ѝ@ȈW^:6^0/G-P`t@c(U 1P0]s0SG(0S0p SڬP嬐UaPP C~(03/8( Z#Z P &3-00C0Z $00a((p@-@PPpp@p@-@P (00P 00$00[#p@<(O-M00pQ  (@`TB  0 O : 0H 3㡰t 0U0Ѝ0 @00D0 0(0 0S<0#T $&B! BT#? `kߍ#T# BT'B2+B B R!t  ቷp`83T| +16T !7Tz 26T `"T "T " "T !Be'BT%B 'B B T"T BT T d2Tt 7C0CT 0R550`H T @2Tf/⹜E/ p20S&0 700司`P1 TT *600 0!00 `070&&f 0R88@9S}E/Ű@%P`  ~`&0$0> 0S`: 0o`P3`%@T 00%T{ ѣxT @ Y{dЀwd~d(udd@d@gdmdyd|drdAgdedg~hd G-@P`tp - !%6000!0 0pP Pt` l}(0S00 3/}w0%  (ЍG0 (p(P  Wpt UPT<$',P * 8SЍR 0030#  P0l 0$0 "ǃ Q0* 0 (a `_^`_a_6a_O-@ᄠ?t`pP Q4$0SU`V` -% Ѝ`0S 0U%0 Y\ 50\0  YX 0X0%0``0$Q 00 001/`P 50 010 8Sr0SU/A-@PKkLG-`pC@0P c`PO00k)$01$a⧆帯ϯ0  z 0 t哢  0 'te$ x00Cx00S  . t$兢<TJUK 0!400KA$IKR8]d]xa_< A-@|`8 PΚ X0 0 1@01?::0 5:1<,Q@p`۬`  0xWp0Gʬ0A A-P@᠀{0 1)Pu`tp#lJdPIK($e ሳ#$ᚳဪ008^<  ɗG-(pP`,@렐X Ll0P0PP*>:2<.`DpP0 p0PpЍP@-p@-`Pp0S0X0S C\ c0RC .PTP1#p,_O-M`8, GtF, R 0SS  !៪ GZ Y F PZ)8ἐ0(, :P, P@嘁FU }x0P0Cx00S  .  k圝$qFz⍔PP$  $aF 0 4QFRx0 P0Cx00S  .  @q$FFO严@`ت0 SX0000D奥 ~w}Pt _\X< a_5^a_A-@`@FPp吀0T*0QU P ᱨP0嫨P (SFU AP@< A-0MP00p 00!t0  00 |@T`x00Ѝ0SP* ; (w 8⩩000  w*, w夒 (‣`V 00 0@G-PpE@᠐0U:ET ܓ0aV X $P T  0Pc@< -b_G-@pP^E@ T:tE@aV X 0PA,E@T@@ᐓ< p@-P5E@DP0Sp@0E0Q 0S @< _b_A-@PE E;P ؍PP  E`PPpU:AWEQ  R 00 00 0P S $L< ib_b_z_|z_H L b_<1L0S/0@-@(QM D P  - უ P P EЍ0  P R  }PU 03/P L P (P< b_c_?c_H nc_c_O-M 0Phpgl`V7 `l`@`p0 0T*  |60008000<0@@$0 00(,800<0 Z {@ :Vl00Cl0  nЍ  01@O-@p04P"D܀0U:sDT m Ѝ0aV! R 偣 ᰦP 0WSHZY T mj  }P@< c_p@-@lPd*`0$4SS @pDD$@ΐP nP 0@8]d] 0`( "4`#/O-M 90000 02PPs00  4+40#400$4"4 8#x#<00p4 8 40 80 < 0 0`$4"40#4 0 0$4"4 0#4 0 04 8 4 0 8 00 $4"48#8=S1=#*408#8 S&:3[ W0!<30C(r* 00r!0CR0C Z V <lP0@[' 8|ЍA 0P4 8 c 40 8 00 $4"40#4 00$4"40#400000$PP 4!404"4074 1 P.PT+TX(X\%\`"`ddhhllppt1tQ00 0sP |0sPIPh1 QP嬦!4"4!14"4!14"41 $0$Q 0RP (10 s s  8  s(PP0\8  p@P 0 400P7ERc_PM$d_4d_],_>d_d_O-X`@fuM} X0`p#00 0?PP)0P X凬0P P  R R0uX8⼂&  s, T 00S P&{uߍPX X  ,4L HZpzPFS {3 0帣PE^}pX P NΠ0 n :1 .sPP  V0#t P 0`☲c^ P X P& 0& X  T0 0P070㚳#, s r $(0, 0 0S 1!3S$ ?6.~`0S S*Q #?0000.V A00 Z00 Xr P 6XP.  Q#?0000Q 00 r Xr PpX0 oR 000X00 0@dPb ]d_d_d_'e_Ke_e_]^>d_e_e_T0Tp@- 60@@P P0S@@DJp*A-@Pf/pᛐ<(00`S3 #01 1@ ##:!#0<,8  Jq00 Dq0 H0<0 0008|0X``00``k8 h(0 0<0`0,0$0@000(040,0A辫*`_WEVG-1( @"6 0਍PP 0S00Gy꤀ $0 BR0 08 pRvW00 BR`!`1P0W  o'*{00C0*A-` P &0)`\@P@ |pY UT00T0  UP00P0%0SX0 @DC巟PT@PႼu*d G-`<1 0/D0R-/40R>0/P-/}ft,@{f@|f~fp@-@D P & 0 p6P$ pO-p@ 6 0o RQc 0Q0000C000 Sc0 0`S 0n`S PP HZ%ZeX!4!:  0 1`   d 0`S:#::cSP!P10S  VhP  0S00 Ѝ0S 0S00 ,0 Q #]@ˀDˀX[p@-l` d0 k@H0P*0 ,P.  0@jpx@ˀX[Dˀ0 60S#3//0 R@#0 Q /R.0h0//]0( #&0  R /E/00S/კG-`0 00000P@P< 0 @@@@p 㺹P@TT ,᱂ᬹY ЍG T1# 9@PW01H hWP0 CP @Ѝh 4!  \ / >: Nf_h $0 0!0 00 /Hhl0S  0 00/p@-|0pPd3@1`000/(0, 6Q 0/(0, S @@V*p@-@0 00R 0(0,000@p@-P`@P @ `T`0S $0CS@ R(08 8@@p p@-PU @`00p`h0Ppp]p@-@pPPp@p@-@P`0S$0C @P R8@ (@T( $0DS R @TP/oT" R  R 8 R 8  0 R $Uᤸp0 p@-40@SP 4G3\0,0S S 00 008@Tp`0 6/@ p@-@P` ċ%t 0P6 #::0t $00000@0`0CF: 0>p]A-Pp@3A`1`00 0S60S50S 0S E`LP Q 50S0 xv050 %Y@-@BD0S MP$@@-@50S0500S @A- pPPF9@0(0@P<1``00exmvP` 5LPPPPPPPP lPlBOg 00 0`S 0 Z, ` 0@PЍ@0Y Zf_]@-(@,000S S 0 5DP 0S Ѝ@?MЍ-\M0000Q 0S 3/\Ѝ G-`1@p31`00Pe 0RP[50Sx%v0550I:o멒B R  00 0S#P< 0 0 0 " ˜P0 0000&6Q  R  R   0 0  pPP #P 0SPU  P P O-1DM00P`p0 <0 a0,(P$  @(P0$ 0 N^<0400 ,00 0000a0(P 0$ 8^<0400 ,0X0 0P000a0(P 0$ "^DЍZf_h|.Y^f_-YR_+Yif_O-QdM@0 | PdЍdЍO]Q0 00000`0 KPPPV0/op"/8A  @T@DHX01H0#0TB0Z 3 #W R+   6 4 8 < $ ( ( <0 , 8 0 D@  RH  H 4k X  P `J@ GrpT @DP O-造Mx@P` pQ0` ᤝ00l ,1 0(10$10 1H00XuY 1?o2P0SЍ p2YC-M 0P`` @t|p0 P 00 00 0 0@LY?o2P0S  BP Ѝhp@-@PX@T $@DT\TpPP 0S(@0 ,0 0IP ]f_2Yof_A-0pP@TU,`T`1 @DP0f_D0S/0@-0 HC ЍA-@dp`P0S$0C(@@{ R (0S $0CS `PA1 f_p@-@P T-p\P C@<0@ @N$ } p Zf_Lˀl @-<0DT 0 !0  !0@- ! 0 !A-@`XpPU 00`0S 0U0  03/7? p@-@P0 0 0 0 00 0 00  p@O-Tp4M31`00#212`@T  0"0#!"4Ѝ00 030 b`P0S @D R 2x# P1  PT  C\0 : :0 @0S ( <X0000< 3SH0L RP\0307 sR k "Px"P`"PL"P4PPE_o("RQ :07z>?00A0Q01 0嫕P00 R o: :  P( U 0S40S ⚛81  00000C0( @D0P0*:>(  2 ~80S 40S 0 @PU 0 l@PP220:00lp\ 7/U P @p03/LˀD]   A-P4O,a @T @DT@T $@DTA~=0S 0Sro@0S&$008P0(00S MpP Z H<X080S00=(@ LˀO-@$Mp,00@T P8b8@DT$ЍL <0RVSM (⺣z0 0 0 兺 H0P: UGa000PPPE^0 0 0 iW  0R H/  0 S$ 0S,y90 0 0 DP0 0 @T @DS00 6P5Hoᨂ0 pQLa :/0X0  MbA-@p `PBM 2SJ@ @(@0 0@S  02 100 0 0P`5Bߍ/Y@-0  Q:0 0(0 0QS Q   Ѝ䀤[/Y00@-AM@0 0 0 0P00! ! 0@ CW >0W >C 0CW H4ЍOE$8$(0 S008(0 Sx007W 0Wn 0S 00`7W:> W^ 0S  ܗ`l7W  ;CW0CW5C 7C0C87WA H4ЍO6W` 97W >C0CW/`䖟 W 6W'`VfX! 0 W0@P0X  &0`W`ppxP$V  V L,6W! 17W 6W 000 RV 5pW $pGW`5W 00j h 0S0Sx%0 R01 5:S 000  ` XX  ᐯ `P ሯP `~00m/ Dj f( 0Sb 4 R6`P0400 R0S 0 S `00  0b  ` 0 j(00pW $pG`Ps  0S R0P  WS R (PU $PEU`4pr000IW  P040 H 0 B R`+0 E0 0A0CS…Q%X1 L`P,0(S(0SٮP ӮP`` ̮7`*} 0S S  000(pY1X*,1`E{@?P 01 1;{ P 0S 0 00( , 0 !(00,00z060w000s8000S080l<00S<0e0@0b@0" 0D0wt@HpB@~B f@pBXTzB LˀoB@|B@oB@P]l]fB@{B@}f|fvtgBBfBwBhf_@B/P/@- 0`( "4`# Ѝ0M0000# Ѝ/'&/Q02 //00@-0^PN^000@A\" \ @@T00 ^< ^  800000 00 000\ @-L\ 0 AS/P 0000S000/AP/G-Q@1 P`@A0pS S0P@S S S @S S 0SYS 0SQ|<0@TA00S p3/qX@dp@-@P`03/,`D 0S 08 000 0S0(D{gp@g_XG-@d@d 81@P"10U YT`@T1@U_@I00S00 000 @yGISUppQpWtD w=$pW 80S  3/XppW 80S  3/XpˀdA-@P(p`*R'7P20 0 0 7Uh可004 0  004  @0D 0 @0D h咯3 000SP0PP0P0A-P`pa@T  R    B gTp03/@-K 咶0 T[Y_YA-` @0 @0 P0p0pg x 0t0p@0P P D0 ЍA ˀ+g_ˀ1g_]cY5g_pbY=g_0-DM000,00(0P0 0H0000<0$ <0< ODЍpYDg_~@-0   Ѝ^O-|0DM S4|00^@S4p0`x400p,`($  <0NP` 0啿,40S OH=0S/ 8:` pe )f0@a 0(03 0p0`00p,`$  <0NP LYx0D#DDcSS<3x00000@000S ~_S#S1!~_O@oPDЍO 0!<0$   ,p(`mNP 0!2$ 0<0  ,p(`[NP{0 00!42< $ 0,p(`80FNPf0 00!1< 0'>$ 0,p(`800NPP0 00!10 ,p(`$ 80< NP@ <0< $  00,p(` NPg1000<0 ,p(`$  M0PU     '. ,p(`$0 @ 0< MPD @P1S ~?S?11~oS1O@naPaCaaq ag$aab ⛼bT8P! 0$ $14!0  s0`V!00 p䐟00S0 SW 凹pP0Q:0PSp`W !`2 AЍC'0ˀˀ h_h_@-@l@0A- P @0L ^U 0S J~`pY@hpT e 0S0@A8l0S [P ~G@ [Yp@-@`$P"@P 0 =pˀ@-Q@MP@`pPP@ \ V  @Ѝ0<S %0! ?@0A- P` @0L ^U 0S ֺ~p@ကT l0S PX0 ♻ 0S0@A~@ [YˀO-p0M#08PQX 6^0Q@t XhmP  03/@vNTdh^P   03/@fNTTGNP  03/X0S  Pօ `хPPPtG2P  0# 3/;0@gS8'SSX `V@` PTq?:~@IpЦW T8@X0`C`Ѝ< <0B PQ_0SCD %P `$qX` Vڐ PS@P0`FD@ P @ <ߺ~pX` ` RVڐ P+@P`F׹@D?@< 强3@73@D3P3k%Sl $ Rt (`Pf@W (0 00000 0@Y@ (T P 0S$@P4 <P <p@60$3/@@P 0S-@ <PP@ 3|`|0<M03/@P |` @ i@"0<#S 80#S %'B BS #S #S#W6 0 0 0` 0Ϭ@P* (V"S  S"S "S's |"Sx"p"S l$'a S `M BS[ BS30s P@0S-@ P[ p @0  4/@ NT0 0 (@04/@#00#  AprQ#0T00S @qP/  03/@[   0^{ S#B%B}e Sb O!"'S s[ SX *.lg2@d2@&iHGI@Azixi ˀxi  [Yiiiii{iFi@ui niii@IAIii7iiiG-Ppb~`q@|T l0 S 50S0 0 P80 i~Z@ [Yˀ0  ˀ0 {ˀA-p`P'@P 00S0L  l#PP v#@  ߴ%h_Ph_0 口 `Y^Y- x4`Yp@-P@X40x@XPx0D#0Uw0D"0Uv0D 0t0!E'D!E&D E&Dp@- 4@QPM `=1h0Q o0CQ 0Q 3QK `Ѝ3Q 3Q 1}0Q|0 00P0 0Y`P0@S?` SRp @i? p׺`P @`3Q 0CQ 0Q 0CQ00l2Q 0Q X0880R 3/`Q`31H0@0< !N D!0/H0L 2m0/QP @0D P @㱚qP 0?S@ Ѝ@/S``iui vi iiiG-h Qp`PM L1Q-@UV44巴남0 00 00_@P ލ@96T @5P  0R T렶DPP1@ Ỷ 0Q D<L@P W14  "41i i]h_C-qM@`@P)  03/PINU# 0S  ǁ ÁPp@0S   `m  0SЍ0PpP ᣁ Ix0/p@-`Q@P R 0 0 0 <$7p000SP0PP00p*R 7P#$0 0 0 U `0SP0PP0P0p@-^ 0p@/RP@  p@ PpiXi3 4 RA0ACo//1S /p@-3tP@ !P`M 0# R3  lR  PU3P%SЍpRip@-Q@$P U0$0 p0ES$0ʰP$Ppp@-@PP7p0@-@0M0S0h@P  UЍ0ϖoh_p@-Ph@w1 01  hp@耠@-p0$M03`A0AS P R R R1   %/@ Z#MRY R ⟀@ ⚀000 S( )04 0 #RH L0S0P  ;# 0 001   01^000000000 0 00000 006@P #T@$Ѝ3  =&0P0C@0@ 001 0 S"0 6< 04"48#80CS=10 001   \110000000081000 00@P @j0 w 0H   C Rw0C0000P( 0 (00(00   0T0 0 0 @P| Qx 5@u2@7@]33@-3A0@S AS S :<2@S 3/4P@-O-Q,M0 #21 2@P0 40S 000 " !",Ѝ0S22 20җ`H2Y HȗYRpUHp0 0pW0\80PPY0妗0 00 D @pP0p@-P`@Tp ~P xP @A-0PXMP- 00 0XЍA/`@p 1#`1014"410 0CH00UL 800(080@`, 0 0 0 03/XЍ p@- @08P|P 0 |@opph_h_\00@-:PL@0 R 00 C0.APAAꫪf]  0@-PQ@M 0 ,040060000 $0T l00p0 200P000 %U 0 000#*0PR,R02,t0HLR0h00 P(05/L 0 < DЍ0ဖh_dYYY] i_p@-@0|0DDx0003/H\RUHHHRQp0S  0 咖20C2(^R 40SD/Q/D00S/   ! """ ]00@-0PS0 O T  RQ7@-\70L QALQ 0,aL\(00L S A@LT 0aL\  0C70C020 ^0S?.S,S :S/ 0C70C@-@ 0R R% RB }0 } R }   ^           R R  R  R P} D3          /L]R]X]-i_@-`P@Hv  `P/`%0, 0) " P 00 0 P} L}0 024`S 0 0B0@202HT ጕЍp`@-@HP8  a`P/` "@P 00CS 004`S  0 2H0C2X`Ѝp`HO</@/l2p@-Q@`P *P2Qt D2Qg <2QT  p@ 2Qi M0Q 2Ÿ2 0\00-\0Sp4Pp3" p@J1Q 2?5Q1 20$201Q( &0V4"R= 0p@00Sp3A AR00S603P pFPpp@@PpL2!4<01p0 " $"S $2p@p@E8"Rp0S 0 0 8嶂Pvpi1iii2i(#iX8i(i^] 2 @-$2@0$20 P$20$2/(2S /@-$2@ 0$2 P$20$2G-@vpP(ᰀH((20(2p02P0H02](Z p@2S,`Yp`JV v H(20C(2,2S0S,2?02H7W /7 p 3/`P  0S0S0 0"p@-@Hj,2&jPU R,U 0S,2?02(20C(2HU @2S 3/(2Sap 0S0S0 0"PpA-@` Pp0H   CR0C0000T7@@#RH L0S0P  !@0(00(00S7@P  z0  $' ! "$ &$ "$ (?Q0@ a060d]@-0S 0 P0 P Ѝ $"$# &  $ "$  $"$# & yK0C-M 03` 0 SPdp0弐cS0 .00004PY 0@DC5( 0 0Yv 0 00S:0 3  00P  0P<<00  0:0(PhA(0, O0@,@(0hK I/oP"0#2 D)D NPP p0D#DH# $H)3  0 0࿀P0 8 PPU p0D#DH$H ꇷpzq Ÿ Io     3:#:SC1T Th & 1T (0Sf0 =00C S.0 S  s 0:0d1T?T  PP  z X 1T,  T 0T0@  '0T00S 0@0000@000 0 R r  P3Ѝ  G]d 5݆̀2P11O-0QDM@00`p(00 0<0a0,$@ @@ @<@9000< 0a0 ,($@ @ @w9 0$0\00T0000'>a0,0( P @< c9DЍ`] 4i_Y^Y:i_A-@`pP0S 0Q  6/P Pp@-@Pj0S| |0 @Pp@-@ g@d6@/p@-@P,03/ 0&@P@ D&!R @A000p6@/0S   6@ H0600C0/p@-@00`P 6/P !0S| |0 P@pC-@4 `lMPd540"p  8PPpC 0t hl 65;  & ;0040 0危P0p0 000lЍ$p@-@PT0SPPp`ET0P`P0CT0@-&@P -d 废 p@-6@ @& @0@03/POP OPx00Cx0x0PS L0S 3/H03/p0Cx0A-`pP_ 03/@T3@ @L0 8/@T x00x0A-@p5@TAl0S @ 0QU`0S꬀gpP` G-\@P`p @TG0[0S0 $9/@ p@-PL@P0  R 80<000@0,0$0(080$0H0p 0`Y̿YDYYDYp@-@ P0@0p@ 80/A-@`p@TP 0S @ 3 (P0U  07@-@00T P |P@03/0P |@ Ѝ0Yp@-@TPv0T00  0T00H0p@/ 0@-@M 00V XP |P@03/0Q |P403/Ѝ0Y<0/@0/40/@0D0///O-阳DM 0h0#@2lP12UnP@#U2!12P#0]PDЍSPURY YP5 0 3/PBPUPP&0 R0S P p0 3/0P! X \ W P,#2!12$0 S 010 9/PW  P05 0v 06 06&PVQ Q 0X0 PV\0W   0S Pp #t0010`V`V  0 ),`FV 0 S 0T 00`,]Ci_ @-@<0@30 0(0 00@@%Ѝ ci_Q/ 00$&/ @-@0Q   R@ x Q#S #` ( P0\ 4PS 0S S /iϖoiX(YL00S @-@3@03,0003/ / p@-P` @0 $030|0|0l0030U600`0@C080.H0 0P(05/3@03vp蘁HYHY O-p0 3P@` (P 2 008/2W2 40" 40 3Ah(p 0 0 000 4 000 4 ha0S Sb  ,/, R  20S  10S@ 10S 0,01弑帱a崡Xʀ 0! $ 0   , !  P: h屔0 0 0(0 , 0(0 , h嶔 0!!0   , !, R  00S 00S ᑓ0,00@00p0ht0 0 0 h7mi_ ] P1Hhl200S/4 @-@P T0 S/,P/0p@-P!P@` ( @0S@@*@ @p*@ 00S 0 0C0 0/@-@ \ 0 0 0@- Ѝp@- 0@SP 0SP 3/P 0S pA-P`pᇌ@;0 p`000@@AnA-pP`@V@D`A-@`P lpPP+` `㤤 `PPpDKP PP` 00PPP ApP(b p$UA)i_i_RPG-@  Q R"pS`F #B'BS 0PS ' P  0S 4P0 S` 1 VP  0S P P7 0PP `S  0S 0S?  0S000000000S 3/p0S, 0S,  PU UP ᦋZ X 0S $#?o W20SP P pፋ p?0px UQ 08i(p@-@P`' xP_ps@-`@P`Ѝ0S u  "U R `Q  `  0008P @0T00  7Ѝp@-@ 0S 0 00h0 S@- P 2S@#@ T 00^"]G-HbHHBTDrUʀ 0 ! $ 0  .!0Sa $ $  (0,0 (0, 0040 004 80<0 80< $@0D0 @0D (,H0L0 H0L 04P0T0 P0T 8o\࠳ࠣSp^ 0$0\@X`7pP@X@\`70T`!C`@0@0o(0@,0((@`x ]XYMbQ1]i_O-3SM⬠^ b &@ pt Q  L[ P`+ P`x RL R 2/ H 2/@ ` 4 $qf4 Rx x  Bx 8 2/`P2[v 0 4@4/Y 4Sߍ&R:[ @ P`& @`pP&r R W &Rpڰvp 5 HpHp, $2/x RlL R 2/ H 2/ 00 00 :/PPU@ @ p&[Wp@cPPTX \ @`p) &X \ ppVpW9 x  Bx 8 x 2/pP  & &`P@&p R @&vP&R@` @&& &p B x  B x H[@`Pd@ (]G-@0P 1@M@a3p` 6S06E6S0606;\ 5  R !*p p@Ѝ08#8S06đP0SP  0S0 S6T0岆0T00X#pW@p 40Ap@pX0\ 嬐06S(X&06  o,03/@,= N @00@ 4/,\PI0P0T00CT0 8 @-@P6S@0 L0!608#86 S0\ 6X00 @ 0/ 03" /0S S/S /Su//N/0H00̀G-`p @0S@RP P@ UL lo0DΤ!P P#n@00@0pbP<@PPP̀̀O-0p#MP2`12ͣ@0t0P D ᛤ@@0S  ᧤zЍ1 3/@̀A-P`p0P R@@L  o0Dk0@ \ QQ 0LQ  n@00C@0O@A2̀̀ @- 0̀i_̀p@-@x2dPS|"|"|2x" D․D|8DxDtp@ ̀, 0P/p"Rt"R/x̀p@-`P@P @pbtR N u$ 0@Sx2| 0|2p̀̀p@-@P0 p@A-@Pp`  W  OA-@`pP 0 x0@30   0@0@30 @0 034 p@-@P pO-@Qp00,MP 0 ~`P 0#212婢0P0`@0SƢc ,Ѝ褠D  mP㷢00@0S  wJT 000ᅱ  ;/0P0 R0SP̀Nu/0/@-@X000@-@@G@-@ @  ̀@-Lōp@-DP@Y1 01  p@b   @R0S`R0'SI/@-8@0S ATk00Q"мG-M0@P`` psm` YD崲0| 0S(,0 0$ \0000 00000000`4)ЍY@-0, ($ Ѝ@-0, ($ Ѝ 0!< 04 0 (   !/Hhl\ P/0 !8 00 (  , !/HhlA-<0Pp@`L双!0 1L圌Ap@-P@ E0DP@Rp@A-`0@SP @ p}PPwX@ ` 0\HP@DpČL@04@SP P0T T` P ̀lY0YLỲ@-@\P0PST T T0P L@D=H@XɄ̀0M00Ѝ/O-M8p ` @_lh`d!0S X!SD P!SC H!S0 00!P 9 0x00 00 000 0@hP!(oPQ0 S S S S jP @tpjPq00Ѝ0000@TY YY4Y@]p@-\0P@ih`4PP H.pмp@-HP"0pt((P@ pp@-P@UP0S00p@ P!P ш0P 8HP!  i_@-H@0S <և0@T@P@ ̀lỲA-Pɰ㻱\@p!ň`P @@TP@O-,1 ARF@0@S` pq᥃P0 SV0 H@`q`E0S ፃ᳈ i៙lU!wP媈` ,  80P мYi_C-M 0P`` @kPp0@ 00  00P 0 0@&?o2P0SЍO-@Pp  0 400 ,p$@ ` @*T00L00 ,p($@ ` @400 {*<Ѝi_Y~^@Ypg_`Ywg_0 @R/p@-P!A` ! 0RpC-aMPp‚@AᲯ0p 0` _j0 0000P@``000*:&PᢂЍLY- 0S0!Q\ S0!0 BS   " |0 S 0 / \P:/p@-|0P@`T   @PHlp U00 000P`0@|j_0 0R  0S/0 R/  0Q/-   QO-` @ 0  SR00N\ : 0P PUP 0 @0S 0#0JR㊁PPU @Y. 0 0S$PH 0 0SP *P  pW 0R  Z 1Pp[Pp@- 0 BRPNP0@ ` T00Q@:T:@ #pQ p R\:p0-S>"0000( $ #0 0G-@P`p-  0 0 R:00Y' 0A P! 0` `0S: 0  000 @ ``0 A@G-r@`0T@PRz T @(@ЍU Ezg Dug0Y`* sR `FU T`T BET` 0 ` @  nP@0@P  0 0+T Ag0  `0pS`P ؙ@U *PQ l Q`FBo B10P0 00 00TPÐʂ|;j_d]p@-@Q`P 0 h0P @poPTp0SpPO-P0M`Q@0  IpP ` @Ѝp0 0@S 0/ Q V Q P  P P [ T7@   P QPP0 0000@ 0V `0 0 000 00pS/PUP 0S$0S# RP0S000  P0SP0S 0 SQPPUV~ 0S{ p0S00R0SpPUgf0 S0 0 TԘVV 00 0PO P5PpPhj_A-P@l`P p   BmP TO  nP@ 0@@T  RQ 0S  : T4 R1 R; 0P\d T0WP0S#0 `P0 Q``(0`,0` 00 0#00#0@VQ P  BR  \R\Q9 0 Sl!0 SD$ 0S0S0 0 S0Q00 R Q RSR 0Q `U P0P0 RPPQ AQ  0 j_j_|k_j_0A-`pP0S l@PT 0 P 0 @6/P A-`p@0S LP@U 0 @ 0 P6/P <00S/p@-P@ q~0P@  p|A-@`pp Q( `0PX 0 0`0d0(0 0 0P0000 0|Z ZxYpZ0Sp@-@Pp0P 0pp/p@-Q R 0000Q R0PpP@?$X\ 0  WQ 000P:hP`P` @TpP@ 0 00}| k_d:k_Bk_Lk_A-Pp`@#)9"PP000q10S0@@`p@-P@0`S   00<(P}0S 'p@^1/1M/ G-`pP 0@T UK 0 PAG !0R"1S RP  nkP P  fkP 0SU P 3/P @ P 0 P GG/0 d0  dA-PS`p 0S @1W0 S00 0 3/@P 03/W@ e8@eS9@0S @-./gk_ B 0P//p@-@P0@UPP :^N3A"Up Ep@)P@`@@40 0 P/@-@M \ \S R   joЍ@-@P 0P P 00000 徨00SA-p@W 0S `ŘP0P 00ޘ0/@-0P00U-0  Ѝ@; 0$`po)W`0S   R0 0 8l03/10S0C0$叔@TPXhZrk_@-@(4|A-P @T@A0p 08Dt80S``X * (1LL0C(1H嫎\壎@̀H̀ 0!< 04 0 (   !/Hhl\ P/0 !8 0 0 (  , !/Hhl@-p@-P<@ 0 PR0n00p@7@̀H̀40+ 6p@-40@P@`L0S0L00x3P0 tP80S`P@T+p0嵌屌/̀@̀H̀̀̀@-40,@640@0DL0P0|@@@̀p@-P@+0P 000P 040pP X0 `d0  `d Q0`5d 5 p0@-@@p P Z 8f`T7 T T`,PU00Gy,fPP00<3`l_k_̀O-`TMP|pPq 0P0%3 &@PACZ @A20x@PT0L0S 'P 0S 0S40@ 31 4 I0P DP $`(Hp0UQ4PP AP [ Z RZT 0 0 0 P @@ P4 4 @3h "$  "$4 Hx0 80 0 $`(; TЍ@-@Pp`8d :40000 P X  YH \H 0  +Gl_G-p`) P@PG8de+@-@P`CMp,4p0  4Cߍvl_( @-[l_A-P@M@@AT0p` 0 S S( 0 0(0? 0  R:000P0 ( SP0 c00000 (P @Ѝ 0@-PDM@p0`S S' 0 0( 0  0;S 000(P0 0 (P DЍ(0;SP0 (#0000 0/S(0/S0/0S p@-@PpUsp@/0@- 2/P 00@- @ 4/P0@- @ 4/P 00@-@ 4/P 0N]^@- 0P  U ЍH8Z@- 0P  h ЍH8Z%P0/p@-000P@Tp0S 3/X@d 0/@-l_703" / 0 /t0 @ P //L00S/800ST(00Sx//]@DGF-/-/-//-/-/@-Ԍl_@-Ќl_@-̌l_@-@-"0@-`M 0B@pP>8PU 0S80<000@00C@0PoU 00, 0p bЍ(p@-@ $' $'  %(@ %( &) #& #&phPl`0 PU`P`pO-` P0S0M 0Xp@V V00 KQ   RpBpp pS G Y Y 0 ^E 0@ [ S  R Z" 00S 00S QP qq@`V7@ЍS 000@080S80@ 0S @-9/ 0S @-9/0"SKPp@-@B P pPP P *p0 S  \3, R:,(Q $qP$ qP$ (7pP 0C~\0C00  R( $ Y0S*Vp*/TppA-0@S`@M4 0^ 4  D0000000H00S 00 00$0H030,000 0 P:0S6 PU3 0S0400@00'$'$(%(%)&&#&#%"p圀0 qphplH0@2@@0 0@ 0 咑P@0 00@ЍL0P0  0  !P P  /$  $ /,  , /0"SS@- 0@SPM(0S? 0S;0 0S R 2#! 0C?o(`2V0S$ (0yS x0x$Pix 0B~S(x0Q:xx0]xp`V  @T x^PЍT@@D@@P*/-/-/ 0!< 04 0 (   !/HhlA-p 0P0`@ H00000#   20 000 P0 0S P7&  W@0 0400'$'$(%(%)&&#&#%"pP0 pPhplP0 0Ѝ"0O-_M00x 0$0(0#212P7@&_ߍ0`S`P 0  )(PwUp@PPpPXP $P W 00@700SU 3x 0HTtPPp7@PP0 r0Sp+@Pp3L14 `00C x0@L QTpp ^0  @@P! 0 R  B  0PT Ao\Q Q  a  0T0t0P0S 0$ST0S 0$S0( 00 0P@P,X0S P0%X@P V  JBX0\%0CS00T0S  R$ R R @T , P,00@ P0 R0@&@T x( @Pr ( (0P/T0S  R   00&0@00( @PO(0$P000T00X0j p$ 0k@P 0pS0P @ @P 0$ $0m@P*0S- P$@ \PX0S0S;@0Sn S S $k@P  $0X\X\ (, /  X\ 0?0::S $0PP $0PH@ R R |!$! 9/ Ir450", 00 Y Fl $ 0TP' 0EKS0 P,@K@m$0P000T00X0 p$ 0@P 0SZ& @-@p@@ >0UpW01X㾁V 000 uW"010 P(0S_`AUpXp㾁]^]\ P/0 !8 0 0 (  , !/HhlO-QM`p @tЍO\r^oܕ000l00p00t00cx0 0|0lPUU47[@@T@P@ m0@0 ER45004 0@53!"弉50,0,@00T1 ~OD0T+ ҉U p0S   0S lXP@0S T `l WPlFPP&Up0S "Si20000Sd DSb D8 ᖉ0 0 0(00l0P|0堰S8 [5 x0S2U U UH p'PI \ (0 l;/ -[ N[30S 2 030(90 0 ||P|0 0|0'0"4 4Z DJZA0000D1@0@@T^ ~ODZPP@ R  Q^ X$0$00U00000>800 l0kP%|0S" 0S x R " ,  4   R㸰 R԰8 |$ P|0$ 0|0弈X$ [$0 ؈DP  0 l3/ zH < p1GS ! R``B``00Q  FL0Pp W(0S0P0 Ѝ@]@-P@`pM4 >  >2 0w 0 qЍA-@PP`@pD0W 圃H0L P0 H0L >A0 `0<0SP@0P8P0\03@P8 1@P`0PpH0x0@P 0 T Ѝ000S/0@-@PM4 D> 8@>2 43H@0'08 0 00 'P H0SL0S 0 R000S  $)0 0$0:~<Ѝ0` ,`]m_p@-`@P@THp@0U@8$ #Hdp@p@- PS`@(M 0S0 @NT!>0000!>0000P @ 0$0N(Ѝp,Z@-@0S00@-0  @0T0S $ $0}Ѝ r]m_ 0 0 C-0PM  0!S1000}Ѝ褁X R00ЍC 03 H(dXq@5`VT8m p 0S10 000U`YT HЍC7d  "PX0`` 0 0``0`@T0 @S `p `=08 PpM}'nD0I 04 "ЍC$~]m_^ !n_T^X@uZ@-@MPU 0   0"S2000}`! R   04"<S02000Q2T0S 0!0|`V "Hc᤿Ѝ R% 03aA0AS   00  0Rm`,I0$! f" R%000T0S `p `0 p|000 0S0 0 00RT0T0S `p `u0 0p|]Jn_^m_ t^X@uZ^tn_G-P`M,PG ЍG40@@P0 P; ЍGR HpNPP!ЍGT|40!  $#21240 0 P 0  V ∿0S (!4.|3"(Ѝ5yZ:400204048<0S0HP4074040 0 0H00&+0PSPGT0 0H00&40740(0L0S 9]n_n_ @-`S`@RP!>00 @ @{$1 03/@ЍpO-`0Mأp P@P 6 6S 5 EJ@Ѝ3 T V@0T1l@$1 0@4/@X [T06/@i0 0 0 i@&P0! n{@꬀P d  $1 03/@XT0@ 0 8ЍO^_]n_^_O-M0( ~P0`pW0@ ⶀ0PP@ LEhi`0d 0 `0d sii0@P 3!  I7 $I00  {Bi004 0 004 Mi pW$pW@ ~;$ | IG ((P @P(Z Y!%~ 50R' {i@0D 0 @0D i h5 0 h zU T pQ Q ,,Up T pP}bpP T }W  ZhX0\ 0 X0\ h5 lOPYhh0l 0 h0l h h]h0 nzP4(4ጙ8က#80 0SlXhP0T 0 P0T h$Z  9hH L 9 H LhX0US 0S SZ00 & 0# PP U OP40" Ph xP 0 U`  0 0ݵ`0C  `00z 000 0S/hp0t 0 p0t :hX0S h00 ⫵\0h y$0S0 SbW h(0, 0 (0, hVȠ̐ 0   `00yG PZ6 X0`S00ʘZ5 0S ZS!.(000 0 PPc7$1 0P5/PY RU06 00 5 YNP 00 96tx gx0| 0 x0| gL0S  h= @h0NyN0  fPPl@00S }g0 0 0 gP0S h` @0 000`0$yag0 0 0 lgH0S  h 0Hh y5 G6 & [& [㸶US Y !>00 0@0 KPYD !>T00吠唠0PTLSg ?  0#gg 0 0)g 0Y0SZ06oᩒ0S&2 0S6EXRf 0$ 0 0$ f$QN0"cP  "G0 0GTӻ G $ G<0004 Q0N<<00000(018f0 0 00 00 f 0@aЍ!>0吀唀$1 03/2X 6ᬠ  Y  F F <00000Z:TYP1n_%o_ ^\o_o_o_o_ p_;p_np_G-aqQ嘻@PGл0y%f0 0 0 0f0SL@PA zP 40 ᐐIoᩒ S){Y f80< 0 80< {eX0\ 0 X0\ f00S@P  4"4X ;C RNe@0D @0 @0D èp_-/0@-(0,0@<,00S 0S 3/0000008004000 $ X R0@8xZ sZdqZ P/@-0 Hp@G-0S@@P 0 S 0 00S@PP 4"4D!;C R TzpR`P 3 ozGg40S 4(48#8SX _zG X\0S `0Sd0SP Z0 X0 KP 4E  {E0d0 0O-laMPd00TT `\08@P 50(p 0  5   EEP g0? 0#PY@d0\@S3  p)E \%EЍ00E0 <00⸰C Xp_A-8pP`@d1!01@@Adp@-\0 up^0 RP0Ƞ@,Ƞ00   ! 0 p@ 0, 04]p_p_0 p@-@`P< `0  p@O-<`Pl2M@0 0 0I0D2U5P0``3X!y`@P 4l衟< ljPP q00PU:0yЍ 0 S/ R 000h  y0S4pP0p y @$04/px@W  y W V hy y` 0S 0 S S Rh  yx @$04/xZ@  y00P Y V hy y`  ̀p@-P`PUpqx@@8Ay @ Dn0LP0p ̀p_p_p@-@0@TpP P喀` ᐀p O-$P2M@0p@ 0v/!>540@P吢H0 0@X0TxT DdP< d~`PH00`VMexU 0bh@Sw Yt  $09/ yЍ 0 X S R 000h  ,x0SDT0 8x $09/ xY  ,xY U hx ,y @P 0S 0 X/ Rh  ,xx $0:/wZ  ,x00`Z U hx ,x @P  x f̀O-$M pp@P0 `fP 0倐hS [  $0;/@ x$Ѝ {x @ ڥ@̀O- qdV Q ʀ !  , !p0"[@p s.00  0唀0 0$ h$x R #@ !d1000  ! ЍHhl̀G-P`U U9 $0ppZ@ Z0Ud0 P  wB sB$0h(P 0(0$0 00T0w 0< w}T`00`00<p̀0SnO-0S4M$PP!P@3 P 10S T. 0 0S0U0SvpD00`Vv 4Ѝ`` 0 lP 0h wcN0S" 0 S/ Rh0  0ew 0S  0R v 0 p$07/|vp hfw00`/i]̀A-d0Pxq@M0D 0S S2T1pH1p(@< }U`F00< <0}@PN~PĀvJ~hZwYpY@Ѝ`0< 0C`00(|<0S `U0P@S  0 h@u3ẁp@-H倶DP@`L@T403L0$ml@P 寶p@̀̀D̀@- @@f0DL0+m@@螶̀0L03@o/̀0 0 0 /@-@ YO-p 0M !P``  @(AP0m 0\ a0 000000@P?o2P0SЍ\ZO-,`tWʀ 0! $!0     !`@ȐPU` 0! t0 x   !00C0 00 0S0ε03/ gHhlO-dM0!P`@ wq Xp1!p0p@0c00@P s 0  p d 0 x` 0`pl!H1 0 0,p($  `<0UP 0 qdЍ 0!<0$   @,(pP=P 0!0$ 0<0  @,(p,P 0!`0@0X0,(p0$ @ 80< P q_]`Z]^Z q_]q_>q_Zwg_A-Pp`_@0S 0 0 0 A_eP 0@p 00S 0 0R000sQ @-s/Eq_@-1eop@-`$P= @P@pSq_p@-@P@D@ pp@-P`@PU`U`*0UPT p@DT@DTTp%@DT @D@DT @D@DT @D'T^p@-@`P@T`T`*\0T@H0PEU P p PEU p,^<^p@-P`@yPU`U`*(1U P@D T T Tp+T p@DTTT*T!@DT%TTT@ T@D&@DT,@DT @D@DT#TK^p@-@P#@TP TP 221#pp@-@P@TPTP*D0T @00CS p p]^@-@P 0  0O-@plPDM(00 0<00,p$@ @@ @`00<0 @,(p$@ @@ @P0 0H0000,0(p$@@ @`< DЍ[q_q_bq_T_/@- e@ |e tpe hd}e \ Xxe PLse @@neZ_HZJ^@Z_ԦZ_0Z_dZ_بZ4_@-8@e}e{e yeweue@reP@- P0@ P@ ` \ XX E@P HnЍ00,F@P nZq_bq_q_q_B B  B  / 0 0CS800S,00S/00S/ಁB  B /00CS 00S/00S R0 R0*@0 R  ,00S/00S/^$0000S//@p@-@0P P 00T@@@ppr_G-P0M`0 0` @p=0 P 00 0 0 p@?o2P0S 0 S$  Q0Ѝಁ 0O-DM(0 0P`! 2 ,`0800P$  @L80 <00!1 0<0 (`,P$  8 0'!0tqt< (`0 0 ,P$  p" 0!80 (`,P$  p0 00!08 00 (`0 0,P$ '(` `08! 0 ,P $  p` 0 ,00 ! 0 0P($ DЍ[q_s_Kr_Zr_T_@- R0R0 *0R \ \ 00S% `\ \ \00SL00S0 80Q L\00S^ R0 Rp@-0@P*0 R ៅP@D T00SpT j/P \0P0 SpSp(00S0 00S^ 0 /@- ttfcp@ lh`c `\[c T PVc HDQc 88Lc԰ZJ^Z_lZ_ȬZ_Z_,Z4_@-0@_c]c [cYcWc@TcP@- P0@ P@ dd d0 0X C@P HlЍ0 D@P l`Z7r_r_Wr_r_@- B 0RS d00S Q PQ @aP ,,0DPЍSq_q_@-B B  \03< x00S @aP PP0CPЍ$00S ao@Sq_q_ 0O-`Pp@DM(028 0p0 0`,P$  v80<<042 0p0 ,`(P$  c'~ 0쑟P Z#Z Z[Z ZUZ Z d>P ߍ Z#Z ZkP & ZeP  Z1Z} Z}\ @>P Z#Zn ZJP & ZDP Z` ZZZ ZZ >P Zq#ZK Z'P ZC ZC x>P ZY#Z3 ZZ- Z PZ% Z% =P Z<#Z ZPx & ZPr  ZPlZ Z =P` Z#Z ZPU & ZPO Z ZPG Z Z =P; Z"Z Z =P+ Z"Z ZlZ Zd {=P Z"Z ZP & ZP  Z `=P Z"Z ZZ Z K=P Z"Zy ZyZs Z!Zm Zm @0=P ^^,^<^L^\^l^|^^^^^^ P0C /-P, 0C A-Q`@PHM 0 6/|0 p10 0䀟2pC0DPTQ 0#HЍ0H  #QHBFpBGBH  CHpN_R.0#HQ 0@ T6/  00\H0 00A00A 6/w_f]^P/Q //  00  00  00  00$  (00,  0004  80<0/@-@=N@P @ !G-@MPXp @p P` 0@DS @Ѝ@`NN@ WpO-0Pp@<4U 0 i I3il8` Q`+ ZU0D0 ЍIP\80S   ZU@DDAD@P U@IyU@DDAD@C-\MpT@T @DT00\Ѝ``KPP@MP000//o/00//p@-@M P@ `@M@T@@M@T*@Ѝp@-@M@@`PpeP(00 0 Ѝ@-S 000ЍG-@XMp@@pPB`@@@DT00TXЍ P@ qMPPU @D@-PЍC-\MPP@gကTQ  X01H0 RX \Ѝ !W Q A  0CC10S 0 Y 1 R  Q*10X @-p\M`pp`Px@TQT0# X01H0 RT \Ѝp !t R Q A  0CC10S1 01:qW 1 R  Q* 1<0T O-P\M`P`pሐT@T   X01H0PP PQ Q\ЍYT D PP0CC10S @ 0 P 1PP T*10@Y O-`\Mp`pP=T@TU@ 0)   X01H0`P `a Q\ЍUT D ``0CC10S @1 01:P 1`P T*`1<0@U @-@@PЍp@-@XM``hP0SXЍp  0Cp@-XM@@Ph`00P@XЍp?#? 00 0gPEU 0 R/R 0^0R/@-0CA @R A@BT R LP^- @A0@S0 AC^ 0 S LPR/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@ P//8@-@P//8R0* \ A/Q :@/Q* @-000 0@0 ! 0#2 /UUUU3333 @-// 0SAS/0-$(0@# A  A A A0/p@-@P` VPpR00K/ B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/\ S?/\S?- ^ S@-0o @-@oQPO-(p@@@, P`T @o.`VPW:/@P WRQp@-@@P@T@ P`Q@L.PPPpQPp@-``` P@<.@T`PpQPA-`` p@P*.W PU`@@@-0 0(0000 0P 0@Ѝ(Z@-0 0(0000 0P 0@ЍpQ[W; 0]S8 S030#W0PR'&R' `0Sp0 R0 P P P p`0SW pЍ0B?o2^Lo  Sp@-@ "P P 0#<# "PQ Q Q &" p`04`@N8<#<# "^@E00("0$"00#[@-@!  /Ѝ@-@P $/@ (* 0")^O-@0$M(`00p 00P0$00D2 0@00  a/ $b8"#4b4# 0  0%e#","0    "0 '0&f!"f+"! 0YR  @Pl.  .ɠ,),  ! b..  & Ơc, .c,   00000 00 00 000000000 00$ЍppP`wpP` 0 )^\)^A-`P@. $QY ?PU(p8 0 8S($)8 cc `.7XPP0Q`pDa(!"$a$"  .0Uh ЍAC@S )@ c<8 7 )10(0G-PR2 p@q?p` @g(U: t. 0$ 0 @PE 0$ (P`p(,?XG? %3PUF  (U. 0$ Q0 0$  0$ @H< 0$ @ ?.  0$ @H< 0$ ?XG @-Z@-@P $&.@ ( 0" *^@- @-@@-@P @ ( . P 0$$@*^0O-P \M@000 0Pv00 8`$00,p@8R Q b.p o Q0P0G-PR< @p@qp` gPU: ,@0D 0 #@0D  H0L 0 H0L PEPP`pPU%+@0DQ0#@0D H0L 0 H0L @0D ;  SD @0*H0L 0 H0L 倀HXG 3PUF  P+@0D Q0 #@0D  +@0D ;  SD @0*H0L 0 H0L 倐IY Gp@-`P@ 9P P@U 7p@-@P @ (+ P+ 0$$-^@-Stp@-`P@ P P0U pO-M@ `]+0Oϟ0800000000 0<00<<0\0`0c$c< 0\ 0?8  " < " daa `!8 8 ahpaTa Pa.e!PPPlPede\ Pba. P`PgQ`&`pP`mete\ P@P@pbQ PpptbQ%Pntn pa bqx .btb, ]pfaa!&p| a!" `t` pe&aq ata $$p-npe.p`e!ftfl `(`(p ba.peqP``&`ete\ P,P`Pbq Ppbq'pnTn 0maQ b PP%Pbb,  4 4}faa!& a!" `` ]g&a -eQaa g% g. aDa b%g! $@ ,,@`,bA @σbA$ P @M,(P, P,Pn  _bQ@ ,P), a͌P% P%/oD `n!!  n!" ` 0-`&o&Hd! ?n1 @04l0#0#d,)?# 0 8;  +!!b,dq$@.( @`((b O@@O @( + p*i * p' n'ϠLσb $ ,뭊 "/"/"i.O@ ,(0@͌ @  $kA.i @$,@j4M )**k _,P_P )0P䝉P._%_%la 0k`& `4dAm . .$.(l$ +潋   i$ l fa͌ ..i&4 (@썈 (@  OP@kA&iq @$@DplM''' p kq,p'韃 pH`}o&$o&o&`h,oka) D`dA睉o&o&o&h$毠D毃 H+ ,, Pg$ *,齋_HP_hQ @Pi뭊_%(_%_%P_PL@g) ($@ꍈ!!kA)g @$@@jkq*_!_%_%p'@ $pLM!)})L?h*k1!,0/# 0/"0?"d! 0h!d1  6 0-   $gdg$h(, ((aaTag`d`@0mO O$bO$Xba g(p4͌ p $p nq(bqn(paqPp !p!!fqnqf pbq4 p"''lQ/4 l!f!P/n!PP ]"( +`/+, /P `!l!, /f! `D /" `/"`/"aa `aa! `ola H`-,$`,,eaaae o`aD`͌ ,*na*0Dean0`oaaH` l! )bA )Hbn@e@P@M!(P!!lbnL䍈!!0!`l`b@ o"o&o&dq/@ d!`!p/l!$pL h}", ! !/, h!d! /`! T ͌/" /"/" n!h!n /d!$@X /"/"/" g!n!gA @ /h!@T lM_"0 _%_%/0 l!g!/n!X 䍈/"/"`/"l L?`g1(p40dA`$?#p)?#p?# 0 p2lqPp,,,ph$,`q4 pn͌ ''ha.4 `&`Pm   POi.hA ! D@lO$O$O$ @i,O@(H@.ፈ..$fA,i@$@DaM.++fQ! HP%P,) ])h!!σf " @dAha$, `&-,$,,`!m!!e$ᯃh.@ b!(yZnܼb((pe"p(,@pO$O$$((@f" OeA0@nfq._$ @p' _%_%O@pL @}O"$ O$ O$h!.䯃f "0` `-&(`**ha 꿃`&L `m.._.g 埃h.4 b!((,gA"쏃P@$@   f"!g p4Mn!p !!$Pf!. "P /"(P/"/"80?d!. "f10 =00000`10<0d1 0\000Ѝ000,00(00$0 0 00000/#EgܺvT2A-0p! @` :   1?0 ?RP @Pc0 &:?0W00 GA&-@P7@-0@P S  !00"S  l0~? S U 0 # !1" 0S Ѝ0 w_@-^-0AL R.@@@O-p0LM 0@084Q0Q\<0 8 0 p 0%00#0(<$ $ !l(a8 $  , ǁ@ #  " (b%  0!00#p0<, ! pa " ,ǁ(p #  " b% 0!00#,p0<, !0a4p)NON " ,Dǁ #  " (b%0 : #R?0V FA#E@P7@-@P * !? 7R8 bx b8   X  Ѝ0@B-^0`( a!"$,a c"/G-P`8 p#T0.@``T%0  "! Z0DD 6ੑ  cZ&1000DDD0DpW@@@%T-M Ѝp@-@ P` !LNn! !@ApA-PP@#*p`P @  Z@P *0@PWP )P )PUP@@-MP@@@`@pT:Ѝ Pp0P00 Fz_z_00yara0tcid 0 - 0 -yara 0 -tcid\ 0/\ 0/yara\ 0/tcid0S 0 }/-0S 0 r/-yara0S 0 f/-tcid@-0p3AU+`P @ 40*.P 0@PP L[@P0(Ⴭ Ѝ /p@-@BPT)0PPptcidp@-@6PH) 0Ppploob@-@&@ @-@ @0 @-@@C @-@@Z @-@@q @-@@} @-@@x @-@@s @-@@n @-@@i @-@@d @-@@u @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ p@-@P((0P pP pgntsp@-@`P(@0P p P TpatadA-pP(X0P `ጌ@P  P @ឌgntsp@-@RP P(pp@-@P p@p@-@P  p@???p@-@P  p@000p@-@P p@p@-@P p@p@-@P4 p@p@-@PH p@!P0/-^^@-ZZ@@P\DTPP= P! P; P\ÀP0 P P\(:%P0P0 P0P 0 P@\0 0 P@ :\0:`0` SP $0 S 57$00$0/@-@$ P *  LkQP$00$0Ѝ  00@-S@ @$0,,0<000p@-PQp, @Rp$0( 0CQp>$ (0$  BR00C#$0$0,0(0!PpG-@P8MeY@ , `0a0000P ST ST S40 0 YP^`pP@TY FTl g:T =T *T # n@Q ( $00CQ*A$ #_ \$0,0(0W $0SR00#  C R00  R00  CT$@8Ѝ33 S R 0C# M0   Q S@0S00S > @ @@0 SbT& fT ?R0@SfTQ `p b6b` B@S7a7r  C# c,1 cp0 0 FT'0?Sq Rn  @  c4C C@2A@o 0  @T H  0  X=  0 f@00=0D?ofY20S3:0D?oFY20S fY*0 A B0C QR#_S!  0R WS-=T 0  Q  P @Y 0S X 0 vP  P@0  0S P @ Y $0SR 00#  C%#jo%ju%#jx00@-MB0@Ѝ0/p@-@P` #_Pp-@-@`P _P@ Ѝ/p@-@P E _Pp-@-@`P ^P@ Ѝ/A-@`Pp ^P-@-@`P ^P@ Ѝ/00/-0-P@  P 0S RP0/P*0    PP0/0/0R/ \/S/O-0KM0 0000000 00$0 0(0$0,0(000,040008040<080@0<0D0@0H0D0L0H0P0L0T0P0X0T0\0X0`0\0d0`0h0d0l0h0p0l0t0p0x0t0|0x00|00000000000000000000000000000000000000;0 800" <`!40" @0," Dp" HP"$ L@"( P"T,  "X`&\0#`+d*h(lp'pP%t@$x)| "`&0#+*(p'P%@$) "`&0#0+0*劰᣿(p'P%@$) "+ .0. 1 0+ό$10,000! 00 !όበ,ࢯ0 / "p0?0#`@P%p`$ @ (@$p@Op@X@`.\@q@+~AN\@@@Xp`,D@s@!$}C&M@``@pdp`$ @@$u${E&K@@p`,@w@!xGH@@p`(@z@"uJED@ @@p`($@~@"$rN&Bd@0@`p`.4@&~@+r$NB@`@p`$ @p@$yvIF@H@p`(L@t@"{DK@`@pp`$ @@$q$A&OA@`q@%`#w&yg$i(@%,@剭@#ढMB@@尠.@婫@+KD@@Ƞ(@)@"$D L@@%@ @#$D)Lဠ@p@(t@刜 "h@墓,#,l@娪@!JE A@,@(@!$AOA@@.+.$x@%|@媼@#LCA@,@嬡!P8@ P%T 0##:%6,

@p%@-hD[04HT<0U @@gĿ! 0GcW R B b 00E Xa0ESW0EA0ES.70ET+W PP/Q PPPSPPU&P!U P@\PQ PPPSPPUP! 0S ZF0 Ѝ0Sq/^%x_H-M 0ЍH-M 0ЍA-`p@P0 8#@T0P@7@-_/"Ϡ R# O,!0 P W P! Ѝ00  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/A-Q@Pp`S0V @P0RDWPV @ G @g@OoV @d 5Do/oAQV@@a P4B<@ XP^\0O RV0P@W(0B V00 X 0h0?o c0B0C5R?oo@pP!  R b42<P0@b4P^><?o/o0CS 0P 0b0<SÀ0 0S/-S0-S0>S/@-0\S0uS0:A@LT#87La@LTWL0L@ T 08P#80 (0 0C0S/13/p@-M@$P PPP$PPP(P0fSa "S6 [S0 +0C0S=!239 1tS2 {S1S.  P3/P0 0 P0 `PO PU# 0S P@1000"S0(010rS ``0 PP ލp0uS0eS0 00(0 00aS0lS0sS0eS0  0P`5/0 0`0 6/Po 00L[hw[؎[A[Ȃ[Q@- o/@-IM@ypP`V P0P P Iߍ 0P  PP 0P5/0 p3/P0 0 p0 jP ` 0 0P0 5/P 00/^A-`Q@Pp pEoᨂ0<S 0S !S0-S -R00S00P/S=PEU0SP ,P 0B0S^300/R>R '0HV0 S 9P0/S0(0U0(00>S0>S000 0$0PR0S 0S   0A0S0^30=Q00SB0"S0S 0 ~ "Q  @$ 0>SuQpQmO-0pS` 0@P0S "S \S0@0 uP mP bP /P \P "P }H3n@PfP 0000@ 0V WPU  0 0 0 P ;8#8 S:0Z Z 0͕l S P 8#8 S6J 5# ## < ,!  0  S*-"-0 #S * 0 ##:.10> #> 00 YPX@ Ѝ0S <S8 &S@ aQmQ!pQl;Qi@V Wd0 lQ"0tS\0;SY<0@0tSS0;SP>0@pQK0oSH0sSE0;SB'0@Y gQ qQ80uS50oS20tS/0;S,"0@|/^A-`[pWR SSS P PPP^{[{P(0SP 0p P V` P PP   P?x_Nx_9x_Hx_-_{ RC/A 0\R#R! R/Ao/0 P R   //p@-`P zPP@pPH5@P <0 P`000U z8/^($0S @-,@̈́-(e[@- @ 㼄  80^ieG-@pP`VU@ 0@焑QPU@ `F¦`@-@@p@-P@@ᐫwPpp@-@P X0R@jzPP@p,00$000@00 0/^lf[4m[ 0^0 0C0s@-@P 0U S `zSlz6Ѝp1PP`P 0 03PP0 0C0PP8A-p `Pz@P V  !V @p(zC-P0pS`@M>0}S "S z00Ѝ000"S 00  0KP 00S80"S0:S@@0 P  P 0 (P ,0Sy0h P ,0S(0S  ,bP \Pts[@^dx_p@-@P `\0 R@VP⒪ PPPV @pܪ/^O-0PS 00@ 0v0S Ȫ ЍO LP@ Ẫ Ѝ5P P 0X0 0:P  00C 0P R@U RP Q `p Vpp o` P 0S|~P 0 03/P  0R#PP Jk^$0^/^0^,_0,S<S5@0 @-@ ,p@-P@Pީ 0 0 0p@-G-@P 0R@ pǩPP`@ 0冡ᆁ!H F 0冁 0` 00V:000/^0P 00R@-0P   0//^p@-@P㎩000p@ީp@-@P ,0R@P{@ϩp/^p@-@P L0R@P`h0S@#*+@ᵩp/^p@-@PU@᧩pA-@P x0R{P@p0S `ᐩVP 08`P p/^p@-@P @0R@ P` v@lp/^ P /o00"\ RP0\`//^O-@Pi pl2 R0  .PP @xpw@L0S  )ҁ PP e 0Q=P8Z/ g P,U<UU p=2P` `; j 8P塁 ,PP 4؁PρU@ Ѝ` V P 0p000000 # P [K !! 0P F@ B!  0 P 0 0@/^-e[(,@0 40^G- pPW` VwW 00@ >P 0S0,S  0 G0P -?o<2 ^0S0P S//^@-@P+ 0R'P`0 @P 0 0 B! 00C0000{y Ѝ@8 Ѝ/^0P/?o( 2\0S/0P S//^0P -?o42 ^0S0 S//^P/ 0R/40^0P -?o42 ^0S0 S/40^PG-@6 @`TPp P* ᇧ ᄧ0 S @ԧҧ x S 000 01 0 01 $0 0P@ @0SA-pP`y@P (Q@4v0P@ A /$0^p@-P(0@P 0P0 0p0^P 0RR @-Wo//0Sb G- 0PSGt9 h@PR  pPWW(G0 0"!00 Pa#8<`P%c?P6 0.P0 `0(P* P0"P$ pGP唀W%10``P R0P&RP0 P Wa<`=0P =P/0^0^@-@0P u1O-`P@豟衟pQ( A R<QV\ Z"  P V @$ V/ V U T *`=Q0S V' V5 U  X @`U  X @`U T*  `@p<S S CR=SQ"0T 0<S@(0Y@SS 0CSR300^A-p`PV@PtPP  P `PQp@-@@ P`t@P0p  0P@ PTtPQPp@-@PP@PP @p@-@P D0R@00S T @P0000^P/ 0R /0^P/ 0R/0^\ ?o@-H 2^0S0 RQR { 0 /0^p@-@P D0R@ P@ ftPP@p _ 0^0P -?o42 ^0S0 S/0^P/@-@@T ?o 2^0So0^A-0S6 (P@U2`P& 0$!P( $0S%  M$ 00 Rp tPP 00  0{P t 0pPЍ 0X PP XtP@PP U s@7^^/P/?o4 2\0S0SP//1^p@-P00S $$ @U 0D@Yp-[ @-((K0@ 0E1^0 SB41^@-@P 0R@41^P/ 0R/1^0P -?o42 ^0S0 S/1^0S(0S @-0@ /D1^00C0/0 P R   //A-`P sP1^@-@ℤ@聤PG-@" @`TPp P*  0 SS 000 0! 0 0!@$0   @PN@p@-P@@P?pp@-@P X0R@rPP@p,00$00b0@00 0P1^[`[G-`0@S,0SG P@}P PP 00 0 2pP  00C 0ZP l@QP0 03/P  0R 1#MPJk^p1^s@-P@ T R prc`.ЍpADAP`@ 0 0CP@00C0@@A-p `P-r@P V  !&V @p;r@-0`SP@p0]S @0 @ P  Ѝ P 000$ aP ,0SL[Sx_0 /p@-P0@Q | 0 Q000pPpp@-P@PӢ 0 0 0p@"rqA-@P x0R@ ἢcPP`  @ 0q@ 0q`0V:000P1^@-P000p@-@P ,0R@P㐢@pP1^p@-@P ,0R@P~@ҢpP1^p@-@P L0R@P`k0S@#*@ḢpP1^p@-@PXo@᪢pp@-@PK000p@蛢p@-@P>@@@␢pp@-@P @0R@ P`*0S 0@AzpP1^A-@P `0 R@pP0@0S@\ 0 0a000 @P1^p@-@P <0R@ P`@9pP1^A-`PV p@Pe c 00^ 0Sy0,S00 AA-@P 0RPpᯡ0 0a A 0!1 0S0C0000A( P1^0P -?o42 ^0S0 S /P1^ 0Sp@-P`@P (0S p@:p/p1^-0!!00!1Q100 000000 0#0, 0#000!R0Q000! 00000p@-@P1S 0p`%T 00S 00S 0P0!  T# 0 P   R   R  00000p000Sp@PP@1S 0}!000p@t000 0/A-p`PU@@ @E 8/P QG-`pPUV@@@F@ @E 9/P `QG-`pPUV@@@F@ @E 9/P `QG- P`pX@0Q0000R0000@ @SA@@ @H :/P  1P@0R000000@@pP!R 0 000000T 0S001 S@o 000Q0P 0@/-" P  0P CR000S AA- P`@T0 \ R ^  0 TT 0^00AR"/o"!T0#00#000!00000\00!0000000T   0Sp  T`"P P- 3 T!, ,  1000 T R`T  0S RP/0    P/-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/0BR"SG-H5`P0@ pD TWpp-T@pP +T@P00T 00XS0 A B0C QR@P(V&0T ``g\ 00D \a0DSW0DA0DS70DV P   S  R 0 @`  X`EXR1^%x_  0S S/P/$(0#   @// / ////-M tЍQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ / Qs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/>  0RR! R/P/0@ 0A0S6*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R* R.0 \ Bє BÔ4 B24r- B R5:@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@* / R:@P`p@@P` R@* /@@t@P B@@P B@@P R@/ R$$/ 2R $х $Å/-\{F ,DP`pL%T\&dl't |@P`p B R*R:,DP`pL%T\&dl't |@P`p R/ RA2n:,D R L@*Af,HP`pH%XX&hh'x x@P`p B R*R:,HP`pH%XX&hh'x x@P`p R/ RA2::,H R H@*A2,LP`pD%\T&ld'| t@P`p B R*R:,LP`pD%\T&ld'| t@P`p R/ RA2:,L R D@*A /R $х $Å// 0 R/ ! 0O /0 #4<0/0 80/0 #<40/ "4"0/ 0 0/ 0 "$$#4 0/ 0 0/ "80/ 0"",$ / 0 0/0 #4"<0/ "4"0/ 0 0/ 0 "$$ #40/ 0 0/ ! 0O 0 0/ 0"$,#4 0/0 #( / 0",$# /0 #0#<4"$0 / 0 0/  !<0!40"440/ 0 0/ 0(#(0 /0 #$#, / 0 0/0 4"0/  "$,! / 0 0/  "$$! / 0 0/ ! 0O 0 0/0 #4<"$0 / 0(#88 0/0 4",$0 /0 0"##<40/ 0 0/ 0 !Ġ"ĠČ#4<0/0 0,8( / 0" (#8 0/ 0""#< 40/ 0 0/0 #<"4$0 /0 # #"$, /0 0,80 ( / 0 "ĠČ!$ #/ 0 0/ ! 0O 0 0/ 0,,$ ,#$! / 0( #8 8,0/ 0 $ #< 4,0/ 0" "$# ,̠  / 0  0 / 0 "$$ #$ <,$,!0 / 0  0#8 8,ȠȌ!0 /0 ,#88"(0 / 0"Ġ ",$#< 4, 0/ 0 0/ 0"Ġ,#$<,4  0/  "4 <0,4<0!! / 0 #( 8,8 Ƞ!Ȍ!0/ 0 "$$#< 4,̠Č! 0 / 0 0 /R4 R0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/0 P0/S0/ P0/S0/ P0/C/00//1A-M Rp @00S 3/P0`6P V 6/0p ^Pލ0 03/V@ 6/T T T 00P00S 3/`0@P T 4/003/003/P T 4/P0/A-PJM U0`0p 0`` 0R,0 @0 4/@P T p0  P$ 0 0 0PU00@0@  PJߍ0 000 003/ 0/0/@-@J@cp@-P0@Q cPp0< 0 Ppp@-P@AQpPp@-0@APS`0q< Q< <Q< >Q@ &Q@ 8 TT0DS0f@\P /T \T "T T0 ) P  Ѝr@t@b@n@@T(P1^x_x_x_x_p@-@P 0Sp wPpPQ@-@@ kPp@-0`SQ p@tp<@PWPpfP U>H DP VPp@-0PSQ p@Ip<@-Pp/%P 7P >p@-0PS`Q@p$@P QQ p@P<P@ P /P >A-`PPQPP0p 0SPUub@P  pbPb<WP0 Pp 0 03/P P 0S PP|PdbPabT T6P P(VP P1^x_42^p@-@P` S7Ppp@-@P H7Ppp@-@P`E =7Pp@-)x_011/A-@pP`P aPp` P102 P @-@\& P QRS  T00aLQ R S "  T  00 A-% M222ZNDX@|ý #*Ƴ YAq^VP'LVPK1܁kj1@T( k@zU 5 1 @10dt1W P. h-(dF&0 000rs/j!( A0( ?A3c01|pWj@Z 0'Zq0AD 0WPXxj00=!@jcu|D,@ N'ز8_MԼON_Sˁ.h Mb@S] _pOw_X__@8>@D>@\>@t>@>@>@>@ioexp_set_backlight ["$&'X4gklr'/57<?BCEGHIJKLMNORUVWZ[\^_:;<=>?@ABCDEFGHIJKLM/57<?BCEGHIJLMNOPQRSUVWXYZ[\^_[[ m1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & '(7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FKT]  1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & (7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FPQSTXY] F !#%'), <d b _ ] Z X U S P N K I F D A ? < : 7 5 2 0 - + ( & # !    JwGb@v_0^@0_@`@a@`a@H^RPb@Sb@ ^R IeRJ*MZ`i8qX$)u}lw|n3r>]2!!!!!!!5=lsllsrasrror <^<^<^^=^^=^^@=^=^P=^=^`"=^^_M&=^*=^P 0=^4=^8=^^@ <=^A=^P D=^A=^I=^N=^ R=^N=^V=^N=^ [=^N=^_=^d=^g=^d=^k=^p=^s=^p=^w=^p=^|=^p=^pP=^=^=^=^p=^=^pP=^=^5^^^5^^^p =^=^p 0=^=^p `=^=^p p=^=^P  _=^P =^=^P @=^=^P P=^=^- >^=^=^=^ =^=^=^=^=^=^=^=^ B^B^ =^B^=^<^=^<^=^<^0 =^Yv^00=^Yv^00=^Yv^00>^Yv^ >^Yv^>^Yv^>^Yv^>^Yv^!>^Yv^&>^Yv^ ,>^^ 0>^^ 6>^^ :>^^ >>^^ B>^F>^I>^h=^I>^<^ M>^Q>^ M>^U>^/Y>^.=^o\>^=^0/8=^.=^p `>^A^e>^j>^@m>^j>^r>^v>^@z>^v>^>^l^>^l^>^l^>^l^>^>^>^>^>^>^>^>^ z^>^ ?^>^ @@^>^ `>^>^ ^ _>^ >^>^ >^>^ >^>^ @^>^ 0>^>^ P^>^ p>^>^ ?^>^ >^>^ q^>^ >^>^^>^ >^>^>^>^>^>^?^>^ ?^>^?^?^?^?^ ?^?^0!?^?^@%?^?^P)?^?^`-?^?^p1?^?^5?^?^9?^?^=?^?^A?^?^E?^?^I?^?^O?^S?^X?^S?^ \?^S?^0`?^S?^@d?^S?^P+C_S?^`h?^S?^p_S?^l?^S?^p?^S?^t?^S?^x?^S?^|?^S?^?^S?^?^S?^ ?^?^ ?^?^^?^?^?^ ?^G>^0__G>^@?^G>^P?^G>^?^?^^^?^?^?^?^?^?^?^?^?^ ?^?^0?^?^?^?^?^?^ ?^?^0?^?^?^?^?^?^?^?^@^?^ @^?^@^?^@^?^eqnecsccmiplvsvchilsgeltgtlenv^^<^<^^^<^<^^^<^<^^^#=_k^0.01.02.03.04.05.00.510.0daiadbibedeafdfafafdeaedsdeppmzhl@pl@gT  "w!N_bus_dma_busaddr_to_paddr_bus_dmamap_sync3G^AG^AG^LG^ZG^hG^{G^G^G^G^G^G^AG^G^G^ H^VA%H^ [2PVA5H^ [2VA@H^ [2AVAI^ [3VAI^ [3 VA!I^ [3pA(I^ [3qA/I^ [3qA6I^ [3qA>I^ [3qAFI^ [3API^ [4D WI^[4D ^I^`[4i fI^ [4`RfnI^ [4 i tI^[4qA|I^ [4TrAI^ [4TtAI^ [4TtAI^ [4TAI^ [4T AI^ [4TAI^ [4TPTI^ [4T`A I^ [5TE`A I^ [5TE`A I^ [5TE%V I^ [5TEWV I^ [5TE iJ^[5TE $iJ^`[5TE0$i#J^`[5TE ,iJ^`[5TE0,i#J^`[5TE .i1J^ [5TE0.i?J^ [5TEAiMJ^`[5TE!iTJ^[5TE !i[J^[5TE)iTJ^[5TE )i[J^[5TE-ibJ^[5TE -i[J^[5TEAimJ^ [5TEAi{J^ [5TEAiJ^ [5TEA J^ [5TE A J^ [5TE`A J^ [5TEJ`A J^[5TEJ`AJ^[6J`AJ^[6J`AJ^[6ZK AJ^ [6KPAJ^[7ApA K^[7AAK^[7A/A$K^[7A?A1K^[7AA>K^[7A/AKK^[7A?AXK^[7AOAeK^[7AArK^[7A/AK^[7A?AK^[7AOAK^[7AAK^[7A@AK^[8A0AK^[8ApAK^[8ApAK^[8AAK^[8AXVL^ [`AL^ [XVL^ [?AL^ [@XVL^ [ AL^ [@X/VL^ [4U_%H^!H^*H^1H^@H^^^j^y}^~}^lU^^g^H{^^G^^^~^^^@IeII^^I0I0E~^^^^@&II  I^^~^^@"I0^^L^-/^ ^^'^^:^^N^^b^^w^^^^^^^^р^^^^")^^uE o@o @o @~^+^4^7^G^}^^G^@& 3BI@K^T^ @(#0^^TB ^- ^^&^2'E0^7^>^A^Y^r^z^~^^^^^^~^7^~^^^^^^^^/^6^VVwh^R^^f^{^^^^^^^^^ƒ^P8soo P q q sMklt^^tt3ۃ^^ hC^^ h&FILE: ESECSYM,T3.10-04,F3.10-04,01/17/2002 SECONDARY 22 240 12 54 ~ `c܀ `d`~d`d `#x`d$Ega#Xd@Pa"*2:BJRZbhpz``` `(!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`s`xih^d@@d@A@B@T@U@^@Z@[`b`4dЀ `bU`dЀ`Pb`.d`RbƂ `Pbd`Rcd a`c`>a`f`dXY`c`~a`f`dXYJ`c`adYc`*c `@a`~dXY`a˃YYӤ`c`eEK`a`e`deFX+FY`c`Na`deFX+FY`c`a`deFX+FYi`d `"b`eԀ ̄eDeD̄|c`F܄Ѐ`F `F܄ЀdcD܄P3D`|a`XOxFE`XOx`bfDed@*``vc d`e`cd`4b`~beD`0`P`y````EĄ$`0d%`E)``d-1`d&*`d.2`d'+`d/3`d(,`d04$Ą57d@Pcd@T@U@A@B@^d@R`:e`@* &`b`zbdD>`\e`@ &`bdDL`bdDFd@A@F@G`c`d`fcdY`Av`_xu``*b`d``0`x0Dbcdefl@AC@I`x0DdrD`Rd@@܀d@@H`@: g`ed@:dpmd@Kd@M@G"d@L&D@Fe`@&:hhddV`Tl@`DdFGg`\bdۜ d@&D@F'D"@Gd! d!=D@]D|@^=D@]`>D@^FG`d0Dd@@@D@C@B@A`d@N<`jd@M`Vx0D` d@@ d@K`edd@\` x0D``O`O`6C`@C`D`RD`4E`}E`XG`G`H`GH`I`I`J`J`4K`K`XL`L`M`M`N`N`@`@`A`$A`B` B` :\+t@:\+ t@:\+t@t@:\+1``:\'1``g`d:\0`g`d:\:\@'```0`g`d;\;\@'g`d:\٘`d>@g`Lbd d@H`d@Kg`Jb`dd@Li`qd@@`x0D(`eddd@FX(`XOx(`XOx)`XOx(`XO;x'`XOx'`XOx'`XOx=`/xN`aAM@`XOx-A`XOxOfD`Av`|`dٮ0`x,E?A0D 4C)D"&:*Dt )D@I$A`eŔ A@d>D&Ad>D*b dg`Vb܄g`bdd@IrR2{MD)D@Ie*`xd@;`_x`tDt@^E^@^|`"bXOXOXOXO|XOXO =D@]@]-`xe`Gc=D$@]4@]`G`Ac=D$@]4@]`G`Ac=D$@]4@]d@&Dt@^|`FbƂXO`d`T2D+D@^=D@]>D@^=D@]d̄>Dw@^D4E^&D@F d@LLN%dKt`xaFG`x>D@^F`}`>D@^FG&C*PCF*D# Dd@@rE܄`UeR$܄'܄(*D܀X2@*]`x-D & &D@F6]'D* @G-DX67d!&*$@Gd!*D܀X'D*@G'D*@Gd!'D*@Gd!`x&D* pDЀddP`xd"F)`ddd!`xdFG d@L) :`d`E`dĄ܄?k>D@^=D@]>D@^=D@]d̄>Dw@^"c*c(D& %D`Fa^+!F (D6 cD|@^=D@]`}>D@^FG`xd`fFB`|E5[`d܄ڂ܄`xA^d@F!FFELd@L&D@F.D `zbd@*fihD`E|ihD`Ge|ihDЀdD`G% 6676n6&|"5dW.DlC!~iÔg`^b܄d'D@G`xd@6`x|@En6576&6 6Z`d܄ڂ܄!c'D@G`t`xLH LHLHDžǃDžメLHǃ'σHCCLN|МӀ DZ`d܄'D@G`t`xRJpRc(DlE.D+ eDP*&D @FЀlDąЀa(D*@'alDąЀ2D*'(D6:d8d`x@LlDlD a(D+a`@@'ANlD(D666`xa@"1lD(D:Ha6(D:MaIaAMFNd@Le-D* -DI6H:e'@@&0e`x50elDlD`x5EN#D`C`xlDlDlD&A &-D"2@*P@Md`d܄'D"@Gd!H'D@G .D$@AFp@MlD a(D+a`@@+ `eC(D@H)d"#DAN &(@@'@C8lD#D+d@C8#G?eEL!pEԀd`PlD.D"&#AlD4TlD.@ *lDlD.@&#AlD7?lD72D*bFEڂlDڂlD#Ax|eaCрFE7dCс||;H#DЀ`C `xlDlD]>#A>||e%DՀaCE56`xbрFEa@&a\adCсDZ#ՀaC7bрFEDa@&a\adCDсDz lD|FEdlDZڷdA(D@+2D&lDD}@^d̄=D@]`k=D@]>D@^(D@+>:D+`:\+t@:\+ t@:\+t@t@:\+1``:\'1``dg`d:\0``}`>D@^FG/Xd?;D@'@`@*`xA`@'d@*g`cew+d@* g`c0en@+ d@*g`cee ``xd@*g`cUT`*e0/`AdCDaGD냓`eD`Ncǃe`@+\aнPYЀYЀЀeDT`Nc~e`@+\aнPYЀYЀЀeD =`LdăgD e""dD@[dG@[dD@[`G`AE7cBcd@: cZ݁`Ea_@[eG݁a_@[Z݁a_@[``d@:``3`d?8(d@IFJd0D@Q`x@*F`@&e)C'D`A;@+`Ww_Ɂ`Ww_% &c@J`F;=F8*F`@*c@&c`F+FJ`Ww_`G c@&c@JCIAGd0D@Q>|>=FDG`@& `x=F`edC`x`x`xL/~ =F>`xd0D@Q`0` `d>>@:D;D=F`c`|`xwD`W@J*1$D$F ,@D`F`\` ddD:D&u;D@[ -EԀZ`pd܄ڂ܄*D*#D<`@d@GXOSFCfC`\`"ddD:D&u;D@[*D"K"D`FFd@B@<`Fd@GXO+FB7"fC@*`$d:D&u$;D@[ *`$d:D&u;D@['B`F /X*D*!D`F<`pd@GXOFAfC`d:D&u;D@[4@&;*D :D* ;D`Ud@Z@[=d@J5@*$A@U, GXO(FDf\` d:D&u;D@[5@*#A@U`}x5@*"A@U`x5@&4@*!A@U@T?`ha'BLAN@E`F @K`^x+D N.X%F'CսFEcEdC`Ad۾eC%DaD aF%D %D'C`F fD.X(AXO.X(A@XO(AXO&XOV.X|c@EeeD܅`F@E3DT3D`|ddЀ/XfC%FaDg<~dd# acY/XL|aXOc,F%F,F%FdЀ dFgXO.X'C%F%D `F%D ܄/XLXO( GXO.XLXO GXO^.XLXO G'D %C cF'C fCdDX`F%D .X%F @G dC'Bڂ$ʂ`F cF( %Fd 'B̄/X%F#`F xgg%Fd%DXOXO'.X'C%F %D`F%D %Fd %D/X%D%F|d/Xa%D`FfC݁3EE3D/X%FЀdC`FgddFFEXO.XfFE)CfD%Ddae<`cCÍ`Vx&Ԁ`EѽDGDHDE`dD3A@E`F`|dM3DdЀ/X  Xee 0DP@Q0D}@Q?*F\g`Xbd`.d@D0DA@Q?0D@Qg`XbdBe`A #`E`A6aDd@&d8989܄8dD$܄`\aD9da\Ad@&`@*g`c0d@*`@* g`c'd@*`@*g`cF\"d`x`@*eG6`EąŅ=`NdăagDg`c``8d^@ZdG@Z9@Za\Ѐ0`E@ZeG@Z`E@ZeG@Z`EE@Zd@:aeG@Z`E@ZeG@Z`E@ZeG@Z`E@ZeG@Z@Z `g`b*=d`:\+t@:\+ t@:\+t@t@:\+1``:\' 1``:\+dg`d:\0`:@@'g`\bdE`d@Z3`??`2xd8~`GSQ`\PQRSdT) :SdDcc cUF\"`@&@!`EELĄ!,D)dd@:O'Vc))`Gd@*. "bcL4L)`@:v`@6n!̄`Ad́SUdA6dEbá$Ƃ(ւ́(*Ƃ`C`eddÁĄcEĄ@H`Eh`b`dh`beD(DpEą`XdĄ`AsEԀ dD68aEĄsEԀ.h`b` d d@\"d` x&(E`@:`dĄpEԀ`P`Eh`b`0dh`beDd (Dh`Eh`b`dh`beDg`Nbdg`Zb`b*`dѕdA) `@:q݁݁݁%`G`Ca@"#`XOJx`dݸ#`XOIx`d)`Eh`b``dh`beD"`dڎF\fD `xdhh`b`adF\`@*g`Xbd`id@D0DA@Q?0D@Qg`Xbdۙ:D+P' g`\bdE`d@Z3``xL?~)`@:Z`Zd܄`e"d`xdD`A`G`EaD脤`AeGaE.XdD`A`G`EaD`AeGaE.X`G`E@M`G`A-D́`EaG.X"`kx0D*G!XG?2D&WdEGS 2D&N'`T `:d@B0D@Q?2D&6dEG2 2D&-O:c>D@^@^ `dd@B0DD]@Q?2D& dEG 2D&!`;x `d@@ `d@A0D@Q?(``bg`bd"dڙ0DY@Q` d@@`xg`bd"dڙ0DY@Q` d@@`x!`d@@ `d@B0DD]@Q2D&dEG 2D&`e >D@^@^?2D&dEG) 2D&$g`bd"dڙ0DY@Q` d@@`x`ē'% `x `ux(``bg`bd"dڙ0DY@Q` d@@`x `xg`bd"dڙ0DY@Q` d@@`x)`@@+%>`@& :\d@@' d@+3` `x:\d@+&t@t@d!Ĵ!!`d@@d"0D@Y@Qh`b`pdd@&dh?d(``bd!* !dN`e"``@&`@*;D+@'`x&g`bd`@*`x<`db`Fd@:pdg`bbd@>>=Fd@)@+g`XdF~`CEeDF`@*#`xdek>Dp@^=D@]e`>c`"edHdG`A`J׀h@g`b|`@* @eD@^$`x D @@d&dG?dD+ `HeD`J eIdh^`\` ddie@Qd D *666 Dش@@ D@*$@@<`bڃaۂZڃaۂZڃaۂZڃa ۂZڃa`x@DbC Dԅ5$E`2dDCE D @@dCӽ+ dIhD%CCE D @@dCӽ@D+`HdD`Jh@dIhEԀ%C<`acY1YcY,YcY'YcY"YcYYcYYcYYcYYcY `x'`x'`xI`@666(:ZӜ۸`q̄eD`usD`b `b'`xf`b̄:D@Z;n`G#̄`G"dnhsAIՀ'pEą`XdĄ@M`AsEԀ dD60aEĄsEԀ g`|bddh-DpEԀ `P`Eh`b`1dh`beDdf`d̄v`EwԀԀ(``bdd=`b ̄ =`c`dЄ2D*0h`b;h`ā3 @@*d-dd`A D@@@$`daDde * `bЀ @@*g`|b̄1/dA"D 1@* ^DB!DL!EԀXO?<`4b`F@FH`bFg`rbd@7d@7ga#X(`cd۽۽d##d"%D#$%&'ga#X"(`c $%۽۽d#ga#X8d8`G?(`G q9+:,;-./0<1=2>3)RP<.Ѐ=/Ѐ>0Ѐ`AaDB=JCd@*(d@* d@&8`\dD`G@`G)9!9+:,;-1231:2;3+,-/Xd`eQd@*Dc)s`d+c)d@@'CK!Vad@'ba8DM`@&"ÁрcE dCׅELӀeec-D,E`AԄ߃aD)d`G),C-D -D+Eāрd.X+L`@&9+`AZ`AZ`AL:`XNx N D@^ cXOv~F=D@] cXO>>Dw@^ cXO4D`夅@^k`>D``\`d٘g#X<`bʂ"d;`x<`bd;`x<`bʂd;`x<`bd;`xee`Fce@*d;`xg#Xg`Pbg#Xg#XCDw@^ cXOlm>D@^`k cXO_=D@]=D@]`\`dMdG`MdD`M`G`MdD`M`G`MdD`M`G`M`CdD`LcFCO?`G`\e/FdCbڂɁ`Lb`M/Xj` x`bр`d+t` ``b` ddtudu`b`d ?Wg`b& eEHN`aAM@`XOx-A`XOxOd"`dZ(DZe<`b<`pdfDZ dZ+ET;7Xa`FN`.aAM@`XOx-A`XOxO!adX`.cd"`d#Hedѽۥ́څ<`b<`pdfDZ dZ+eET;6E`dDd1D@Q`b` d=`/x>`x`cӽѽѰ 1D@Q |` d>`x`Gā>`x1D@Q &`|b`@:ec `@:ecce`@6e`lb`|b`@:ec `@:ecce`@6eg`rb`Nb`A&e^a@&c^Zde`Dbd>`XNx&`c`xa`dXY`rc`@a`dXY`c`adY`d<`bʂd- `d2@&`bӥ`A6́`bNB`XO`xO=`/xfDWd@FNFE<`bdfDZ dZ+`XOxO7X*4`Db`E`b`E`Hc`a݁ԀaD`DbaEԀ`Ef`beD`:dD`b>`zb>.X<`Lb`Fb`G7:66 `bF`d<`bdfDZ dZ+NFE<`bdfDZ dZ+`XOxOY`d܄ڂ܄ۻ<`b<`FdfDZ dZ+Y`d܄ڂ܄ۢ :=`/x`b `d`e aXOdXcZڅ́`b`e?`cdZրZZZ`edZրZ/X`d@A`cdЀ áۣ`cdЀ adD́@BCDACXO`X"D#A$C!C`e׀ѽCA?`ddX@O)`@&@`.x`@6 `DdXOdD`"12Ѐ Ѐ3ЀA`vx`eԀdЀdЀ&F" g Ѐ&F"@g&F)`@ *\c`@+bcҽЀ\Ѐ҃XЀUd`XOZxA`Lx&F) &GcӀ`@:Z`d܄#:Z`d܄0:Z`d܄:Z`d܄:Z`d܄ `HdXO-`@: h`XNx&FA`XNxA`vxP: Z`d܄ `PdXO @:Z`d܄ `JdXOA`rx:A`XN}x `RdXOZ`d܄:n @@&2)12ЀЀ3Ѐp܄pdq `dnd@6PZ`d܄ `LdXO `NdXO= `PdXOA`rx`Bb)1Ѐ2Ѐ3 Ѐp܄pdq `dnY` d`@" h`XNxN&Fg`XOxO&FV)=`e dd@+h`b`0dA`XN}x^`EsDd@*Ԅ砖Z`d܄ `LdXO `NdXOf`b#A`XNx&Ff`bdۺ<`b<`jd&DZ dZ+d@FfD>`XNxVv`XNxdd`Xb젢(`~d<`b(`zddJ`b`dD`dZ/X`\(`~d<`b(`zddJ`b`dD`dZ/X`bdf`b܄dd e=`XN2x`cd|̄g`ve`@"3* `cf`e`EĄЀ% g`ve`E D@@Y`d܄NR`XOxO`b`dE`dZ/X`bdD`IxdGdDJ`bd `b@`dE`-dZ/X<`b*Dʂd-`b `dE`SdZ/X`bd۾`b@`ddde=`XN2x/X `Pbg`d `Hbg`dY`tb(`dwd"8d(` dd)f`b`4erDf`cd۽ۣqpG`dӆf`cdds9`bd^h`b`df`cd(`c9`|edGӀG`Dd[NR`XOxO`b`dE`dZ/X`bdY`d܄9`b K`XN+xF`xY` bc`@:n af`b@` ec$́d(`~b<`b(`zddJ`b`dF`#dZ/X`bddn9`b`Egf`b̄ۼY` bf`bs.dD:*eD&`bd@&`C(`~b<`b(`zddJ`b`dF`mdZ/X`bdE`xf`cӁ܄ۃssd^h`b`df`d܄G`x9`cсурѽY` ebEdA݁遽ѥڂ́bE:`&ca`E66 66eD̄`EaDa`E:`(ce@*d݁e@*d݁e@* d݁e@*d݁:`&caD`eaDڂbEӽ`Gڅ́́:`2c`b`EӆeDe`@&e`@&e`@&eY`hbeD`c`cنd`dbvf`XN:x`b*d *d*ddw./0123f`cddDJ`bd `b@`dG`bdZ/X<`b*Dʂd-`b `dG`dZ/X`bd۾`b@`dddh`b`pd D&e=`XN2x D@@`b`d`b`dG`dZ/X`bd=`bac`EeD&߃́cD =`b2db`@6`bd=`b̄=` b`bedjkmod@&J`x`b`df`e"l^d`b`d`b`dH`0dZ/XI`x`b`dی`b`aZJۡZn`@&2vd)c8"d!d`bd<`b<`.dfDZ dZ+`b`dH`rdZ/X`b`aZJۡZۆ/<`(b`F%@Hd@L<`*b(EԀ`F#+* @M<`b<`(dfDZdZ+d@L-D`F I`xdmI`x,D*(F+* <`b<`(dfDZdZ+<`(b`F+*1K`XNx`bd<`b<`.dfDZ dZ+`b`dH`dZ/X`b`aZJۡZw"&dmdo<`(b`F@H`FI`xlЀ+w`Ck*ci`XNxji`XNxefDiK`XN x`bd<`b<`.dfDZ dZ+`b`dI`RdZ/X`b`aZJۡZw"iFHi`XNxd!i`XNx#f`b܄ @H<`b<`LdfDZ dZ+(Ddo i`XNxi`XNx(F lЄ#`@"d`C(`~b<`b(`zddJ`b`dI`dZ/X`bdmmdjdf`b< E@@f`d܄یd*`b`d`b`dI`dZ/X`b`dی`b`aZJۡZE`xg`ve`@"=* `cf`e`EĄЀ& g`ve`E D@@Y`d܄ `PbV`SdNR`XOxO`b`dJ`JdZ/X`bd `Pbg`dqpddqf`bvDd*`b`d`b`dJ`dZ/X`b`dی`b`aZJۡZh`b`qdf`d ddpe=`XN2xf`e`ddC߃ЀHf`bd@| e=`XN2x `PbV`Sd`cd|̄E`x"f`bdpf`bdf`ddddh`b`pde=`XN2xi`XNXxG`xw`d+,- w+,`CdF,+(F-dF-d)Gc8"d!dd.X:`bC`A脐 aD dD *dG.XL`?xxQ`XN(xQ`XNxg)Q`XNxc8d":`XNxfEa}dd@&dcYdYڧ(`~b<`b<`.d~eDZ dZ+d]<`b(`zddJ`b` dK`dZ/X`b`d.<`b(`zddJd]`bdZ&F8`AL`0x}L`xe8ՀL`0xC&FQ`XN(x~d(g@g)+..+,//,-00-d":`XNxfEadcYK`qx.&F>`XNx DL`xO`x`dd]`bdZQ`XNx DL`xO`xK`x&F>`XNx DL`YxN`x(`~byQ`XNx`c'`da`cӽa`b`c`eӥЀ@GR`XNx `bdZf`edD`x'C`XNx `Fb`EՄ`E e>`XNxg`bd`bd `b@`dL`wdZ/X'<`bʂd-`b `dL`dZ/X`bd۾`b@`d D@@K`JxyQ`XN(xd)Q`XNxGb`dcaYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dM`$dZ/X`b`d!<`b(`zddJc]`bdZ&F=&F>`XNxL`Yx`d<`b(`zddJ&F>`XNxd]`bdZL`x`dd]`bdZQ`XNxL`Yx`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx'CaeǃY`d́X&F>`XNxddgde=`XN2xR`XNtx`b`d`b`d d]`b`dM`dZ/X`b`da`bd`@da`bd `dIa`b d^`b`d`b`dN`dZ/X`bdZd]`ba`b`ba`bN`XN]xde=`XN2xf`ed`XbdۥD`x` d c]`bdZM`x/X<`b(`zddJd]`bdZd.XdGF`e`cӣۧ(`~bٌeԀ `b`dN`dZ/X`bdZ`c'`dd`Zbda`cӽa`b`c`edAЀI@GXՀ`Ea`beD:d@*7Հ4a`bf`b'D>`AЀŅdDԀR`XNx'D`AсЀYhЀYdЀaN`x`bd `b@`dO`dZ/XFG`c<`bʂd-`b `dO`/dZ/X`bd۾`b@`dd`Zb<`(b`F `b`dc`b`dM`x'C<ЀN`x'C@`A>`XNx `Fb`EՄ`E e>`XNx`bd `b@`dO`odZ/X'<`bʂd-`b `dO`dZ/X`bd۾`b@`dyQ`XN(x` d)Q`XNxQ`XNxaGddYځY؂YYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dP` dZ/X`b`dd]`bdZQ`XNxd`ZbdN`x`d<`b(`zddJd]`bdZP`x`d"<`b(`zddJd]`bdZ&F &F>`XNxN`x`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx&F>`XNxe=`XN2xR`XNtxc`b`d`b`dM`x D@@K`Jx])dA`@: 1`b`d': "`b`d:e:e0:e `b`df/X'CdGYdA݁bD́XX`c-DȄdEdAAĹX--C`G~'D˃D,A `G~`É.Xg`Hb*d *d*dd.X`ef`c'B>|Ԁaae\f`baDf`b.X'B2ac$:: `@+e׀c: `@+ e׀c,:`@'cY`hbY`jc`@*cd *cd*cdcdPQa`bQ.X'C+1,2-3.X./0` dd(.Xg`fb܄(``bd(``bd.X'CeDž`GZeDž`GY eDžӀ(`b<`e?`d`A脥<`ed́a`c&F123.X'D`AC腔&& *`@* a\Ga`bP'Aa`cӽYЀYЀЀdd.Xf`cddۣg`cddۣ'D'DЁaf`caDۣf`bсaf`baD.XY`bf`*cd۽۽۽g`bd.Xd]<`c!Dd`bdZ`*c `@a`~dXY/X`b`d/Xz./0`bg`cӣe~g`bd|d (|`E-d`dxd`bd D&d'`d @*`bӱ=`LbdeDq @@&n`ez@~)`d[`Ce @&|dGdA݁bD́XX`c-DȄdEdAAĹX--C`G~[ڤ˃ @&dD,A `G~`Éz-D8f`bf`b`Zcq\`G`VbeA`EaDԀԄ`E`TbĄ@J`Xbd `ddT`xdR`~x`Xb`Zb*D܄d*D̄d@J`c @@&dD6 :`6c*DG`bd `b@`dS`dZ/X<`b*Dʂd-`b `dS`dZ/X`b@`d dW D@* `b`d D@"T`rxz{d":`XNx<`b<`.dfDZ dZ+`bdۯ(`fb<`b(`bddJ`b`dT`%dZ/X`b`d <`b(`bddJg`b(``bddS`|x`bd۱(`fb<`b(`bddJ`b`dT`fdZ/X`bdW.S`|x`bd۱(`fb<`b(`bddJ`b`dT`dZ/X`bdS`|xR`x(`fbٲ(`rb<`b(`bddJ<`b(`nddJ`b` dT`dZ/X`b`d<`b(`nddJS`|x`dW d <`b(`bddJS`|xW<`b(`nddJ`bg`cӣЅg`bԀeDg`bAd`bf`c Y`d܄`bd `b@`dU`$dZ/X~<`bʂd-`b `dU`JdZ/X`b@`d D"e=`XN2xV`x``cÅEM'`eEL@HY`b(DԄ脢-E׀eGeG eЁGaaD,BZZD(BJJBHD(D'`cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB`Cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB D<@@`b`d`bdZ/X<`b(`bddJ`bdZ/X`b`d/X`b`d/X @&``c`d#=`Lc`EDžc\d1PY2ЀY3ЀYЀvD׀=`Nc=`Lb`dЀhÃ%dDdG123`|8 D `Bb`@:d@*;W`XNYx`dЀ2-6f`d`C X`XNx`deDЀ`>`CaD`dЀf`bdۇeăddG`E;F܄dX́؃d@Mae@*dD-ZdG-́Z2cÃae@&Y ȲdYYYЀ2eăa`@"*`@: $::6`XNx`Va`c`TbaēdD|̄eD`Bb| `Pbg`d e=`XN2x`|X`exEMX`XNx`dԀ9cD"`GeԀ*X`XNxe\X`XNxgAX`XNx-DEMX`XNxeAX`XNxf`beDX`XNxf`beD-E`|dAef`b@N.Xf`b.Df`bZZ`C6ZdE`AcD"`G`\cD"`G`EdDɁՁaDǃ߃X`XNx`dԀX`XNxef`b@N.XcD"`G`EcD"`G`G.X/X`b`d/X(`b<`b(`ddJ`b` dX`dZ/X`b`d Gg`Bbo`dXO)O`b`aZJۡZ`zb*Gg`Bbf`dXO g`Bbi`dXOOHNdAAM@`XOx-A`XOxOZ`xg`Bd`Gf:YP[`8d[`:dل[`Bd[`Ddٽ[`Fd[`Ld[`Nd[`/Xg`EԀH`zc&Ag(Fdd .+/,0-./0Cd@*`G@`G)c(":`XNx~<`b<`(dfDZ dZ+d@FHo`_x+gDЀ8{ܠx`e Ԁ`dpЀg`clg` d܄Ѐ`Ѐ]\`d ca&eҡСdDՀف&FC`Gd@&@`G)~(d8d"(+,-./0`E&F3dD2eD1:`XNx<`b<`(dfDZ dZ+g` d܄o`x&Fk`x`dfE FKFI0eF0/Ѐ)F/.ЀeF.Ѐ)F.Xdh`b)`@64:dDeԀ/+dD DdD6&6'6(6)@6*6+6,6- 6(06)P6'6(6 6$6"h`bh`cdۣj`Bxr`xq`Zxq`xq`xq`xq`xq`xq`7xr`xr`Rxh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOxh`bdp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ+Ѐ,Ѐ-Ѐ.Ѐ/Ѐ0ЀVes`XOxh`bdp`xh`eh`cdaѥрp`xh`eh`cdaѣрp`xh`bh`cdۣFJ+Ѐ, Ѐ-Ѐh`bd +`dЀ,3Ѐ-0Ѐ-8(`DbdGЀ`Ac `Fd`EХЀeD́d@'HРdD`EdDԀ*Fp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxp`xh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOx.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ)+:+Ѐ,Ѐ-Ѐ@h`bBh`b@GVeh`aeCPҡЀҡЀҡЀ'D̄@G)'.Ѐ/Ѐ0Ѐ\es`XOx +&h`bdp`xh`bh`cdۣ8FJ`Ah`b6h`b6aDs`xs`x.Ѐ/Ѐ0Ѐh`bh`bh`b@G"\eh`aeCPҡЀҡЀҡЀ'D̄@G h`b:s`x8s`xh`b6`DbdG<9c`A`FdР́d@+*Р'`DbdGЀl`Ac `Fd`EХЀeD_́d@+ РdD`EdDԀMe~`GāaE&~`Gā&`GЀ-h`bh`b`AŅh`dā*F\cҡ۽ۣh`bd*F./0*Fp`xh`bh`b@Gh`aeCPҡЀҡЀҡЀ'D̄@GH/X`*b`d``c`f `{d̄`*b`d` `x! Secondary F's~ 8   $  F@p 4 ''dd'/  d #+ `xA`x`x`xCD`xD`xF`x`x`xLN`xL`xC`x`xF`xGB`VxC`VxD`VxE`x|`d)G` x@$XA!X"X `x"`vxE!X`x ` x`x@`xA`x%`-xC`x$`xE%`ux`x=`%x?`Gxy=`.x$=`.x=`xD=`.x=`.xG=`.x0`7x1`x(0`xD0`xE0`xF0`x|`d)G0`xoo?PgdN-SV8hXoooooooooooo h0313DD031303132323x==3F44645"4546"454545"45 4~7 45 45  45 45^45p4545:45D45F4540744f45j4545vg45499 4545 45a!45a$57%57&57'57#45(77*45+44x,48f-48.45f:45g)5<5^X45454540747Y45|45z45445454-8~47t4r74545/4504K814844J64L 64ZA6444844$44`44\44v44r44>$44 %44 &64t '648E44G44NH64lI64nJ44K44M64\P44YO64X64`446464b44 h64:!h64B "h64 #h640 @44A44 Y"B45C64D64F44 L44444444f64d64f*55596^mY0$\$Y$z#\$\$b$b$b$$%{#w$HH  \ "t$& (*,.0 246z8 :$<>@BD F&H[JL)NP R TVXZ\^`b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.eg\2e~Z~n*>Rfz"6Jz;;;;;;;;;;;0;;;c;q;;;;;;;;;;;;;;;;;;$ZBZFZJZNZZ>g>g>g>g>g>g>g>g>g\^Z>>bZfZ>gpZtZxZ|ZZZZZZZZZZZZ>g>Z[> [>> $[([,[0[46ێYYٞ>يٌ٦٨٪ٴٶپ٠٢٤lnFJLNP>8>PZ\>^pr>xz|~ـقلن:Z "$&Z*Z.Z2Z6ZZڪڬڮڰڲZZZZZZZٮ>gBD8>H٠>>`j>:d"bflZ>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>gٺΘ\`TVYY ZZRZVZZZZZZZZZhYjY,28DJhn̘aa`$ P[<_xbda*g8Yg4UYYYYZZZBZZZpZtZxZ|ZZZZZZYY>gYYYYYYYYYYlYFY>g8YY ZZZZZZf~@    $L~  F@PX~Z~&~   8 č~!ZFILE: EPRIMSYM,T3.10-04,F3.10-04,01/17/2002 PRIMARY 3 72 36 40 ~~d d d d d d d d0D`x DAdd@+d@Qd@Pd@@`*b`d``(b(`d(`1@&`U`"*2:BJRZbhpz!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`0D `dȁ>cdY`Av`>c`a`f `dXY`c`a`f `dXYXO.XO0DdceXOA`x`|c`da`F܄́d`eD@^ c`XNpx>D@^ c`XNpx/X.X0Dd@@C`exDĘ0D ``@`q`>exDĘ `cexDĘ`d`Av?`d`ddD+P`d`dЀ`d`#dЀ`dѺ`EdЀcG`C`d`vA<wD`W@J*D D@@/@@ D`A`daD@@@@dD? dDd`d`d`d?uD&& & & @&`e`d$g`\`d`d@E+@E`XOxXOJfPeRaQ @g&E@F`dP R~q&\`dٶ`e`d$g`\`d`d@E+@EXO<XOfPeRaQ @g&E@F`dP R~q&\`d%F&ADcՁc`FBaDŁcEŁ`EdԄeD/X%DЀЀЀЀH%Fg/X`q̃eD`u?ga#X@DDEDFDG? $Dg$D? `dDXCaC`E$D?'` d`du?`(b`4d$E'=`dga@ D ߴ@@`f`d`AcXY`&d`AcXYd@Pced@Pg`f`c`dЀۃ D@@d@Pced@P `x`dȁ>cdY`Av#X~`d$Ega#%E+ `pca$D'ӣԀ́$dXad"%DZg ӾԀ́$dXga#XbCdC`A܄"ZbDɁXga#X"bC̄ dAՀdCeAFdXɁga#X`d@KK`A؄"%D#fEHcȄ+FXeFɁga#Xd@E`d@Fw` /`b`XN{x%D`G~`XNx%D`XNxaa\ZdG`XNx,dD`XNx&́`XNx`z-$`XN{x~`XNx`XNx`XNx&E%DԀ@E(`dU`ga#Xw``XNx`XN{x~`XNx~`XNx`XN{x~`XNx/`b`aa\`XNx`G`E`XNx́Z`XNx`XNxU`ga#X``.X``.X c?@&σ.Xc`@*```?@&dd.Xc?@&܄``.Xt c7~@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@c        < t 8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.`_d`,dE`dG`d@ABCDE ~ G` d N`@99SA01000000Primary F's F3.10-0401/17/2002~~ &~~ ~ ~~~BLB0BBhey\L*JͬQJ}k-(*q8dڅWr65)\9:;Xacfm_kaÄn7Tm]4`Y ms  ׂ%b6ߓk @6 (] +] `)]+] 0*],]  ֪tүrڦx֫v d=h0tNɿlY iAG5>l2<詟PW"^9}U= kp_D MN&GC5ezT2Wh휾,NJM+0 XF\CTJXGHV\C@IMHCBXQU~AbE *K:b]fA rD~ʇ><aQi4|Q7*S |Cw~~/h`BT_#zZ=)R:`x',#خ2 3x q] sŸvĘΓrQD]@ޮhgmHoOuSsQVɧo)LlY=:uRGu'T9 ܐ_{ HRE/E`Ӈ0 M3d |Ta)yץdJ@%Aq%Zr NZfO~W+$y̿ y7xr _xx.'c&iX J?2ިM ~ig@2G0mc "`$aV]ZY  3x q]־ IMs>sh9؝ƌr}nB?TSx1WDGeGf;΍ g?}\JB:.ްy#d_V|\Iėx1<֖U`)$b/ KNMMWRIIGBII $y̿ y7}#$z4Ny1P&vkvP_>|-Fei7%7HQXM|%Ix)v:BN   !"#$%&'()*+,-./1AY&SX#bd3'A7Q tE'((EE#S`(tq5&bIwW$piYWIfv''GvH0ϦnK2%(}ӁnjCD_3V'ص@6ݴT2c*S 3%ߔz\Q,f`ΓfI"aF ΄kܛJvz ae^-RQ1tQ;:/wlpϛ?^H#W;]1vJfh?Dh 53EKWvlI ^pi*}!ԧAM_)a:uq#)*>z}}U\m }  !"#$%&'()*+,-./JwGD^expand 32-byte k^D D, DDD0D D@ABCDEFGHIJKLMNOPQRSTUVXThe dhole (pronounced "dole") is also known as the Asiatic wild dog, red dog, and whistling dog. It is about the size of a German shepherd but looks more like a long-legged fox. This highly elusive and skilled jumper is classified with wolves, coyotes, jackals, and foxes in the taxonomic family Canidae.The dhole (pronounced "dole") is also known as the Asiatic wild dog, red dog, and whistling dog. It is about the size of a German shepherd but looks more like a long-legged fox. This highly elusive and skilled jumper is classified with wolves, coyotes, jackals, and foxes in the taxonomic family Canidae.EYNHa,P/ ~Y*S鍍d@7[& #1< HW]M ,g;fosa'w :kXBH㩴ٍ ~z0{f31d$ l?OhD0V:D+HϦFKtB@|Cv`[hFnEu#aR ktjtFA^{*)*IWx R ?*j~h|y` HCHlˇ_ E瘚 H'QJm\bאc1]BIt8-d5!w.s+o &mZn9 t1=._Ÿ0^ASm0pxZip"˘jQƧ=v䓚!:oW o!q5W:NRDu{=-oqV8c^U(R=ؖ *w}؋If6U3mUؕ22UXoÌR )'5»;D!UhF/|,Əͳy2qٯMB#8VoD:Hm3Oj3mv[jUS_&)ûIt~._dyz,(4y:b,ia /A&"3DUfw̻wfUD3"-  J1AY'A;B'{BP}sՊtS.&E]E]]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& Nuy6Urwk=veKpm5?R/XS?pFRD+}!БwG"lF4v!/wZ}NJؓM^,|0E'w;>5tv0eF9pJ4)N~_I<@;ruf8) ^(P  <`*KO4=I|`U{V;QE],E]]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& ;0yfe}Xq@߾ށM"m5?R/XS?pFR|Z-*f:+KOyQ$:顂psq$c(N~czt;6DɆ'@ZzF|3@ 0bS:FȲc\Tn~.3h8}ȉ0Ͳt6ѽHE]E]DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)]رlbM*i֦n6۪;(;q{3n[.nZH/vy,c*ڌ}8HHq f@ZsyTHE]E]DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪlE˳#bk'ȆEœpÄEw'iR_ A0qYHuhhOިXr^>34 z3Ӑ3`X7^s50uRXȠ^(Q3X؛r%ߞ;6]6: {AD^q_eNNL4ʧ= 1@dO*T%SRQt@E],E]DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪ6̼W:6|5:)zflQLGK5uM} uwMai[#xv%43|G- O0dz,pgR'CY,Og2[6@Pq9+4;4t?GuW{Nl>2FLQiq{ŵ_rq^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,ieee80211_hdrsize0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-tkip_encaptkip_setkeytkip_decap^l{D`{DxDvDxD0DD0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-ieee80211_hdrsize^DDDDDDDD222*(*((C#'I`% < ieee80211_hdrsize JLPsgS5A\_b-/V13#%:]]]]]] kվmmMxxPUhv버***Nj*YV8CKPSw (4:@".4 ieee80211_sysctl_treetopieee80211_sysctl_setupieee80211_sysctl_attachieee80211_load_module_ieee80211_free_nodenode_reclaimieee80211_free_allnodes_lockedieee80211_node_table_cleanupieee80211_reset_scan_ieee80211_find_nodeieee80211_setup_nodeieee80211_cancel_scanieee80211_get_rateieee80211_tmp_nodeieee80211_find_rxnode_withkeyieee80211_find_txnodeieee80211_find_node_with_channelieee80211_find_node_with_ssidieee80211_free_nodeieee80211_create_ibssieee80211_ibss_mergeieee80211_end_scanieee80211_next_scanieee80211_node_delucastkeyieee80211_iterate_nodesieee80211_node_leave_11gieee80211_timeout_stationsieee80211_node_join_11gieee80211_node_table_resetieee80211_node_table_init$$hhu Pieee80211_encapieee80211_compute_durationPPPPPPPPPPieee80211_send_probereqieee80211_send_mgmtieee80211_mgmt_outputieee80211_beacon_allocieee80211_beacon_update>{4%$$ ^^^^^^^ieee80211_newstate  0 0   0 @ @ @ @ @ @ @ieee80211_wme_updateparams_locked       ^^^^^^^^^^//f/f////f/f//       ieee80211_wme_initparamsieee80211_rssadapt_sysctl_setupY^R[b]G)GGGGUGGGG <<К(F%F$F%FКCEEElb]4EКqGEEd]$nGК0uFEEc]PFTFFКYFEElb]КCZEElb]ZК)CZEElb]ZКsCZEElb]ZКCTEEElb]EE؝EКCYFEElb]^F-OOTOO)|OOO     }E#(D(@AAA==A*28;OOOOOOOOOO  ;% ?????HC  .   ip_output YFYFYF]FWF^F\[F]FX]FXFXFWF(]F\FWFXFcFXF\FbqA  #9L7Ptcp_outputS syn_cache_respond @@@@@@@dF$FLFF 1DW]e_ace!!/G6G+G'GpG)G*G6G7G-GGG+G+GT/G.G.G,,G,-G?G9GFN2:BJRZbjrBJh%YbxnJJicmp6_redirect_inputicmp6_reflect_icmp6_inputicmp6_errorNYin6_update_ifa1in6_get_llsol_addrin6_join_mcastgroupsin6_if_link_upin6_if_link_downin6_ifattachin6_ifattach_loopbackget_ifidin6_ifattach_linklocal)YHGG$G:CG@H@Hk]XGSI@H@Hl]tJIF@H@Hc]h@HTFF 0I@Hd@Hk]< G+>I,ЌGCZ`@Hd@Hk]Z)CZ`@Hd@Hk]ZsCZ@Hd@Hk]ZgC8Hd@Hk]8HC 0Id@Hk]d.I3!ip6_inputip6_get_prevhdrip6_nexthdr(@AAA==(A*/1cW\E[OT  D6 0$*<Y2DP %WWWWWW3WWWW-)!WWWWWW`WW9Aip6_output ))))))))nd6_initnd6_optionsnd6_resolvend6_rtrequestnd6_na_inputnd6_ns_outputnd6_dad_timernd6_na_outputnd6_ns_inputnd6_dad_startnd6_rtr_cache&.3;CKS[cks>I*I(I,It,I`+I*I(I*ID+I*I(I|*Ih*I(I(I;IT)I*I  sa6_recoverscopein6_setscopef^]_4U_4U_Z^4U_4U__^4U_4U_4U_4U_4U_l^udp6_output JIIIEI@HI`GIHI GIIIIIIIEIEIEIEI EI(EI$_IEIGIJwGDeI7^h^aIaI ^R ^R_IH^R`lUSTP ^RJwGlnI^JwGtI|^JwG$uI^     !A  !@@@@RRTRRRRRRV^^6^Y^|^^ ^ ^ ^ 3^;V^.y^^^^^(^4N^s^^5^6^ ^ %^ H^ <e^ ?^ ,^ -^ ^ ^ -^ =T^ :q^ ^ ^"^6^$^A^ e^8^P^##   1 @IDIIIIIIIIIII 22     * #hhu hhhA L^ضI@II) 2^^ >^]^`IIHI) 2^4III) 2U^U^U2^U3 ^U1+^IhI?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%##%##%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!! ,$0("" ^^!^'^-^3^9^?^E^K^Q^W^]^c^^^i^o^u^{^^ ^ ^^^^^^^^^^^^wsevent_copyout_events;J8J  KJLJ4AJ ^RJJH^RAJSBJ ^R ABCDEFGHIJKLMNOPQRSTUVWXYZkJ\cJcJ ^RjJH^RcJSHdJ ^R7@MUrasops_reconfigrasops_init@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? ????@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?&8&&P]H]oP]]                                                   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~]]a])]2-]_]`]ͳɿپ̴ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ᅠ%'-79 &PXPJJTF JJPNJRR8JCEJSTpJNMdJJCLJ0PLJ0RE J@RR8JCEJSTpJSLJRR8JCEJSTpJERTJCEJSTpJHX|]]|]JwGJ^ w]]|1W(]XD]01X`]01X]01X|]01X]01Xx]01X]01X]01X]01X]01X ]01X<]01Xt]01X]01X]01X]01X]01X]01X]01X8]01XT]01Xp]01X]01Xl]01X]01X]X]01X]01X]J]X]J$]J@]01X\]01X]tXX]01X]0J]\J]@X]X]01X4]DJP]ȞX ]Vw]]|1W(]XD]X`]X]X|]X]Xx]X]X]pX]X]X ]X<]4Xt]X]X]X]X]X]X]X8]XT]Xp]X]X]Xl]X]xX]kX]X]X]J]X]J$]J@]X\]dX]tXX]\X]0J]\J]@X]X4]DJP]ȞX ]Vw]]|1W(]XD]J`]X|]X]X]X]J]X]J$]J@]J\]Xx]X]X]tX]X]LX ]X<]XX]Xt]XX]X]X]X]X]X]X8]JT]Jp]lX]0J]\J]@X]X]@J]|J4]DJP]ȞXl]\J]X ]V]kX]X???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()+-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ蘴JJHX(J@X0J$XupdatefatsH0K.K/K.K/Kt2K`/K.K0K`0KU]JwGP:K-^   . .. y]]|1W(]XD]K`]_K|]X]X]`K]TVK]X]8aK$]HK@]MK\]pOKx]X]X]tX]X]LX]X ]X<]XX] eKt]XX]$SK]X]5K]eK]SK]X8]HWKT]Xp]lX]8K]K]@X]X]KK]?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~sSTVWY[`cihoru      "#$%&'()*+,-./0123:e,;<=>f,ABCDEFGHIJKLMNOE{|}PQRSTUVWX Y Z [ \ ]^_0123456789:;<=>? @!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O`abcdefghijklmnopqrstuvwxyz{|}~     1a2b3c4d5e6f7g8h9i:j;k<l=m>n?o@pAqBrCsDtEuFvGwHxIyJzK{L|M}N~OPQRSTUV--------- - - - - ------------------- -!-"-#-$-%-      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~a     ( )!*"+#,$-%.&/'8091:2;3<4=5>6?7H@IAJBKCLDMEYQ[S]U_Wh`iajbkcldmenfogpqrstuvwz{xy|}&!*!k+!2!N!`!p!a!q!b!r!c!s!d!t!e!u!f!v!g!w!h!x!i!y!j!z!k!{!l!|!m!}!n!~!o!!!!$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,0,,1,,2,,3,,4,,5,,6,,7,,8, ,9, ,:, ,;, ,<, ,=,,>,,?,,@,,A,,B,,C,,D,,E,,F,,G,,H,,I,,J,,K,,L,,M,,N,,O, ,P,!,Q,",R,#,S,$,T,%,U,&,V,',W,(,X,),Y,*,Z,+,[,,,\,-,],.,^,`,a,b,kc,}d,}g,h,i,j,k,l,u,v,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:ZCE[]_acegikv`bdlKKKKnfs_sillyworkerKKlK$X13/ @]]v]b]V]D]0]]]޵]µ]]]p]H]&]]]]]ܴ]д] ?BEF   F''FF''FF''F'' F''''' F'''' ?EF''' ?BEF''' ?BF''' ?F'' ?EF'''' ?EF''' ?EF''' ?EF''' EF''' F''' F'''F'' ?F'' EF'''F''  t]]t]JwGHLe[_ 8|]]|1W(]XD]01X`]01X]01X|]01X]01Xx]01X]01X]01X]01X]01X ]01X<]01Xt]01X]01X]01X]01X]01X]01X]01X8]01XT]01Xp]01X]01Xl]01X]01X]X]01X]T_L](XL]X]D,L$]rL@]4OL\]OL]tXX]d!M] K]K]@X]XL]01X4]WLP]ȞX ]X<]]|1W(]XD]X`]X]X|]X]Xx]X]X]pX]X]X ]X<]4Xt]X]X]X]X]X]X]X8]XT]Xp]X]X]Xl]X]xX]kX]X]^L](XL]X]D,L$]rL@]NL\]NL]tXX]\X] K]K]@X]XL4]WLP]ȞX ]V@|]]|1W(]XD]\@L`]$L|]L]+L] M]YL]X]D,L$]rL@]ML\]HrKx]X]X]tX]X]LX] K ]X<]XX]d!Mt]XX] M]PL]M]M]9L]L8]PLT]MLp]lX] K]K]@X]XL](+L]RL4]WLP]ȞXl]SL]xWL ]X]K]Xffs_mapsearchffs_nodealloccgffs_freefile_commonffs_blkfree_commonffs_blkallocffs_blkfreeffs_realloccgffs_blkfree_snapffs_freefileffs_freefile_snap   ffs_isblockffs_isfreeblockffs_clrblockffs_setblock]]]]        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~? NbN@XcN$Xffs_newvnodeffs_reloadMDMM`M MNN ffs_synch]]ȿ]JwGM^^Tп]]|1W(]XD]01X`]01X]01X|]01X]01Xx]01X]01X]01X]01X]01X ]01X<]01Xt]01X]01X]01X]01X]01X]01X]01X8]01XT]01Xp]01X]01Xl]01X]01X]X]01X]P`N] X]GN]HN$]JN@]_N\]`N]tXX]4N]"N]M]@X]X]lN]M4]0^NP]ȞXl]`N ]V]ML]8Mh]M]@M]pM]M]X]X0]XX]]|1W(]XD]X`]X]X|]X]Xx]X]X]pX]X]X ]X<]4Xt]X]X]X]X]X]X]X8]XT]Xp]X]X]Xl]X]xX]kX]X]_N] X]GN]HN$]JN@]_N\]@_N]tXX]M]"N]M]@X]X4]0^NP]ȞX ]V]ML]8Mh]M]@M]pM]M]X]X0]X\p]]|1W(]XD](N`]|FN]RN|]FN] GN]XGN] X]GN]HN$]JN@]N\]Mx]X]X]X]tX]LX]X ]X<]XX]4Nt]XX]\PN]PN]@BN]SN]VN]$dN8]lXNT][Np]lX]"N]M]@X]X]lN]\N4]0^NP]ȞXl]`N]DaN ]V]kX]X]ML]8Mh]M]@M]pM]M]X]X0]XL]JwG Nf_^hT]]|1W(]XD]X`]X|]X]N]tN]X]X]X$]X@]X\]Xx]X]X]X]X ]X<]XX]\Xt]X]X]X]X]X]X]X8]XT]Xp]X]0N]N]@X]X]N]hN4]NP]ȞXl]X]X ]V]Xufs_inactiveufs_dircompactufs_dirgrow8N8N(9N9N9N:N9N,:N@NT@NJwG DN^ ...x~NN\NȅNuao_putN NN@NNuvm_km_suballocNM8NdNuvm_unmap_removevmmapbsy@]](]d]uvm_page_physloaduvm_physseg_unplug UUjj:j$swap_offswstrategysw_reg_strategyuvm_swap_initswap_onL^RL^ROO ^RH^R`lUSTP ^R`O ^RO ^R ^R ^RľOOĽOOOJwGO _JwGO _NetBSDJwGO _JwGO! _ ____  A,@A#7$wx@g`8@O@cv@^'Xt&X,$XXX#X8,X`XP XXXDX<XX^_]^_]^_] ^_|] ^_t] ^_l] ^_d] ^_\] ^_T] x^_L] l^_D] c^_<] Y^_4]K^_,]>^_$]4^_]*^_]!^_ ]^_] ^_]^_] ]_]]_]]_] ]_] ]_ ] ]_] ]_] ]_] ]_] ]_] ]_]!|]_|]"p]_t]#g]_l]$\]_d]%S]_\]&F]_T]'<]_L](/]_D])"]_<]*]_4]+ ]_,],\_$]-\_].\_]/\_ ]0\_]1\_] 2\_]3\_]4\_]5z\_]6k\_]] ](]D]`]|]]]]]]$]@]\]x]]]]]] ]<]X]t]]]]]]]8]T]p]]]]]]]4]P]l]]]]]]]0]L]h]]]]] T_]( ]]l[X ]V(]XD]ZX]ZX]X@]ZX\]4ZXx]X]X]X];-^2IчH,_|nQn- q+,_ZIчH^|nQn- q+^SFU0eC쬍^IчHw_IчHa_-чHf_-чHa_SFH0eC쬶d_S'@ )Ѹf_*1@ )Ѹf_1x )Ѹf_3Dh&f_=rGy=iG} f_|nQn- q+'f_YЂQYY0YYYH^R`lUSTP ^RYYYY ^R,Y ^R2KaaaaaaaaSVYL^RYYYH^R`lUtYTP ^RYYY|YTYH^RYSY ^RJ3/////91?~~~~'~~~~~uuuuuuuu,"Y Y &Y ^R ^R ^R ^RH^R`lUSTP ^RZf_H(Y2YXAYP$Y#Y?Y!YP_bpf_mtap_softint_initJwG0YZf_f_suŇ! Ȗ" % ˊ 6 C Α Q ՚ ] j w{ MO 7\JwGLYf_ifaddrpref_ioctlether_outputd n;0&AvQkkXaM* ʚ;! *" T# T$ T% T& T' T( T) T* . + , - / 0 1 2 3 4 5 6 /P 7 /P 8 /P 9 /P : /P ; /P < /P = /P > /P ? t; @t; !@t; "@t; #@t; $@t; %@t; &@t; '@t; )@t; *@t; +@0 &`vH'`vH,@vH-@vH.@vH/@vH0@vH(`vH1@vH2@vH3@vH)`vH4@vH5@vH6@vH7@vH8@.9@.:@.*`.;@.<@.=@.>@.?@. `!]!`!]+`!],`!]"`!]#`!]-`!]$`!].`!]/`!]%`!]C =D$E =F$cde@B`Sا@BO[@T6nQ%l7Jc-7ey}vr}nd_set_timer_Yi_ Yj_Y j_4YYrt_initrt_timer_initrt_deladdr :qqqroute_outputroute_enqueuert_addrmsg0TZUZX;ZCZ;Z;ZCZ|VZTVZH;Z;Z ;Z>Z>Z(;Z0;ZUZh;Z8;ZxZ>Z]h:Zarp_llinfo_outputarpannouncearp_dad_startarp_dad_timerarp_rtrequestarpresolvetfZprZdZin4_cksumwqinput_createwqinput_sysctl_setup   "')  2;' +B#/49 JwG8Zq_ # # ## 'JwGZKr_JwGZt_JwGZxt_t_ pH^P Y|YLYYUdGDdJ7^^l^^^^^^^^^^J^^n^^^^?^^^^t^^K^^p^^^^=^^_^v_^ w_|^`^t^Iv_l^~^d^;^\^_T^5^L^k^D^n^<^m^4^ n^,^r^$^5s^^w_^t^ ^w_^5^^<8^^<9^^l9^^:^^X:^^x^^:^^^^Xd(ā L ܔ|ȑĥHУܗ8 \0ءT(k^k^w_w_^`^`^^ w_^^(w_w_<9^<9^2w_l9^Cw_X:^Lw_:^7^5^;^;^n^n^-|-\-<--,,,,|,\,<,,++++|+\+<++****|*\*<**))))|)\)<))((((|(\(<((p^^^^`^^^^\^(^t^^^ ^^H^ ^^4^v_`^Uw_L^7^P_L^^[w_L^cw_^a{^L^^7^2w_L _L^kw_dQ_w_^s^L^_(w_rw_L^L_L^n^P_L^7^n^x8_L^}w_L^<9^k^Lw_;^w_L^7^n^w_L^^L^w_L^w_L^Cw_L _L^nw_dQ_; ΔHWIn(l QrYTᯨg?RPQrYTᯨg?RP; ΔHΕ#w.jRmQ3h8UQrYTᯨg?RP; ΔHΌQ3h8U 5,+Kыͳw'F3   0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfag jgrn<:ORQhك[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHGw_,_w_w_d_w_w_^-^w_w_w_^^w_d_w_ f_f_a_f_w_^w_w_w_w_w_a_w_f_f_f_'f_  gnts8[;[h:[8[8[w_Ea^Ea^( x_x_(E[8E[rbmn8D[C[B[PC[C[H(x_strtoullstrtollSx_؎[Yx_Ȃ[^x_Ȃ[^[@^hw[x_L[w_A[tcidHg[0g[j[dv[Pf[Le[@e[e[e[ dx_Ea^Ea^@^S<^]<^^yekd m[ g[`d[8 hx_ qx_0<zx_@,x_atad$z[|x[0x[^ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/x_loob [[([D1^D1^I1^I1^truefalseyara[[[ [[Sx_L_O_^ x_strtoul#!% Hx_Copyright (c) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010, 2011, 2012, 2013, 2014, 2015, 2016, 2017, 2018, 2019, 2020, 2021, 2022, 2023, 2024, 2025 The NetBSD Foundation, Inc. All rights reserved. Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. INSTALL_C700src@cvs:HEAD:20251012194404-xsrc@cvs:HEAD:20250920171020 NetBSD 11.99.3 (INSTALL_C700) #0: Sun Oct 12 19:44:04 UTC 2025 mkrepro@mkrepro.NetBSD.org:/usr/src/sys/arch/zaurus/compile/INSTALL_C700 @(#)NetBSD 11.99.3 (INSTALL_C700) #0: Sun Oct 12 19:44:04 UTC 2025 mkrepro@mkrepro.NetBSD.org:/usr/src/sys/arch/zaurus/compile/INSTALL_C700 11.99.3NetBSDmd%d: internal %s image area match_bootdisk: can't get label for dev %s (%d) no mainbus foundwdWARNING: double match for boot device (%s, %s) boot device: %s ziici2c-indirect-probe-strategyThe operating system has halted. Please press any key to reboot. rebooting... REBOOT FAILED!!! ffuartbtuartstuartglasscpu not recognized!initarm: out of memoryinitarm: Failed to align the kernel page directorydos partition I/O errormbr partition exceeds disk sizeCD001BEA01NSR0disk label read faileddisk label corrupteddisk label write failedbad sector table I/O errorbad sector table corruptediso partition: I2C controller unable to attach PXA I2C controller i2cbuspxaiic: PCMCIA/GPIO controller %s: invalid CF slot %d%s: failed to map memory %x for scoopscoop_pcic_read: bogus registerscoop_pcic_write: bogus registerscoop_pcic_set_power: bogus power statepxapcic_scoop%s: not configured. can't map bus space couldn't establish power handler %s: not configured zssp: zssp_ic_send: invalid IC %d zsspSharp Zaurus frame bufferSharp Zaurus LCDw100lcdstd: ATI Imageon100 LCD controller failed to map config (errorno=%d) failed to map register (errorno=%d) failed to vram register (errorno=%d) lcdctl%s: this kernel is not support SL-C1000 couldn't register event handler zkbd: pseudo power management module zapmunable to establish nSD_DETECT interrupt unable to attach MMC controller %s: zmci_set_power(): unsupported OCR (%#x) zmcivfp fpscr trapscnopen: no console devicecnopen: cn_tab->cn_dev == devcnopen: unable to get vnode reference   base 0x%x-0x%x irq %d drq 0x%08x core %dmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!cpu_mainbus, rrx, %s r%d, %s #%dlrthumb insn und%s %08x %s%s , #%d#%d ; #0x%x[r%d][r%d#0x%03x#%s0x%02x%sr%d{r%d-r%d}^f%d#%s.%c%d, #0x%04xspsrcpsriep%df%d, c%d, c%d, c%d, c%dr%d, c%d, c%d, %d%d, r%d, r%d, c%d[%c - unknown]oshstoshnshstnshishstishcpsC!csetend lesetend beclrexdsb!ldmbisbsrsXnW!mrfeXnWblxmcrr#&mrrcstc2L#vstcldc2ldccdp2#ycdpmcr2#zmcrmrc2mrcsbfxdmirbfcdijbfidmijubfxstrtdaWldrtstrbtldrbtldrstrbldrbpopstmYnWlldmXnWlblimbimbrangeswistrhtldrhtldrsbtldrshtstrhldrhldrdldrsbstrdldrshnopyieldwfewfisevdbg!dmrsmsrpFmpF2bxclzbkptmovwdZmovtswpdmoswpbldrexldrexdldrexbldrexhstrexdmastrexdstrexbstrexhSdn2adcsbcrscDn2teqcmnmovSd2mvnSnmsmlaSnmsdumullSdnmssmullumlalsmlaladfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtlgnsincostanasnacsatnfpuopstfQLvldfPRgdfixPRdhwfswfcrfccmfPRghcmfecnfevandvbicvorrvornveorvbslvbitvbifvshlSINuqwvqshlvrshlvqrshlvaddvtstvsubNo support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcacheundefined instruction %#x in kernel at %#lxbooted_devicebooted_kernelconsole_devicecpu_archpowersavecpu_idfpu_presenthwdiv_presentneon_presentid_isarid_mmfrid_pfrid_mvfrsimd_presentsimdex_presentsynchprim_presentprintfataltrapsunaligned_sigbusWarning IRQ's disabled during boot() single-skdb-k-dask-auserconf-chalt-bquiet-q-v-xsilent-z%s: curaddr %#lxnot in range%s: _BUS_DMA_BUFTYPE_INVALID%s: map %p: unknown buffer type %d _bus_dmamem_map: size botchL%u %dKB/%dB %d-way (%u set) %s %cI%cT Unified cache L%u %dKB/%dB %d-way (%u set) %cI%cT Instruction cache L%u %dKB/%dB %d-way (%u set) %s %cI%cT Data cache sctlr: %#x actlr: %#x revidr: %#x isar: [0]=%#x [1]=%#x [2]=%#x [3]=%#x, [4]=%#x, [5]=%#x mmfr: [0]=%#x [1]=%#x [2]=%#x [3]=%#x pfr: [0]=%#x [1]=%#x Processor failed probe - no CPU ID %s%s%s (%s V%s core)unknown CPU (ID = 0x%x): %s %s midr: %#x %s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s does not fully support this CPU. This kernel does not fully support this CPU. Recompile with "options %s" to correct this. arm700swibugvector abortterminal abortexternal linefetch abort (S)external linefetch abort (P)external non-linefetch abort (S)external non-linefetch abort (P)external translation abort (L1)external translation abort (L2)alignment abort (0)alignment abort (1)translation abort (S)translation abort (P)domain abort (S)domain abort (P)permission abort (S)permission abort (P)undefined insn trapsundefined cp15 insn traps: disabled : disabled (uniprocessor kernel) write-throughwrite-back**unknown 3****unknown 4**write-back-lockingwrite-back-locking-Awrite-back-locking-B**unknown 8****unknown 9****unknown 10****unknown 11**write-back-locking-linewrite-back-locking-Cwrite-back-locking-DCPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10ARM10EJSA-1CPU_SA110XScaleCPU_XSCALE_...ARM11JCPU_ARM11ARMv4CPU_ARMV4CortexCPU_CORTEXMarvellCPU_PJ4BARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM810SA-110SA-1100SA-1110FA526IXP1200ARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM920TARM922TARM940TTI ARM925TARM946E-SARM966E-SSheeva 88SV131Sheeva 88FR571-vdi80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA27xPXA250PXA210PXA255/26xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1020EARM1022E-SARM1026EJ-SARM926EJ-S r0ARM1136J-S r0ARM1136J-S r1ARM1176JZ-S r0ARM11 MPCoreCortex-A5 r0Cortex-A7 r0Cortex-A8 r1Cortex-A8 r2Cortex-A8 r3Cortex-A9 r1Cortex-A9 r2Cortex-A9 r3Cortex-A9 r4Cortex-A17(A12) r0Cortex-A15 r2Cortex-A15 r3Cortex-A15 r4Cortex-A17 r1Cortex-A35 r0Cortex-A53 r0Cortex-A57 r0Cortex-A57 r1Cortex-A72 r0Sheeva 88SV581xSheeva 88SV584xstep 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step A-0step A-1step B-0step B-1step C-0rev 0step B-2step D-0(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step B-3step B-4step B-5step Bstep Cstep Dstep Erev 10step Gstep Jstep Kstep Sstep T*p0*p1*p2*p3*p4*p5*p6*p7*p8*p9*p10*p11*p12*p13*p14*p15Fatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=Invalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abort Kernel mode double abort! %d.%d(%s): trap: signo=%d code=%d addr=%p trap=%#x r0=%08x r1=%08x r2=%08x r3=%08x r4=%08x r5=%08x r6=%08x r7=%08x r8=%08x r9=%08x rA=%08x rB=%08x ip=%08x sp=%08x lr=%08x pc=%08x spsr=%08x %s: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x) -> %x UVM: pid %d (%s), uid %d killed: out of swap %s: invalid size (%zu)Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)kmpagespmap_bootstrap: No PTP for va %#lx pmap_enter: failed to allocate L2 bucketpmap_enter: no pv entriespmap_init_l1: can't get PA of L1 at %pfixup: pm %p, va 0x%lx, ftype %d - nothing to do! fixup: l2 %p, l2b %p, ptep %p, pte %#x fixup: pdep %p, pde %#x, fsr %#x pmap_pv_protect: page not pv-tracked: 0x%lxpmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_alloc_specials: no l2b for 0x%lxpmapplpvepll2dtblpll2ptpplCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L1 table provided%s: no L2 table for VA %#lx%s: can't find L2 table for VA %#lxxscale_setup_minidata: can't find L2 table for VA 0x%08lx dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console vmapbufvunmapbuf address 0x%08lx not a valid page pmap_pv_untrack: pv-tracking at 0x%lx: 0x%lx bytes, not 0x%lx bytespmap_pv_untrack: pages not pv-tracked at 0x%lx (0x%lx bytes)%s: not supported %s: status=%s %s: (error not notifiedwddump: device timed outwddump: drive faultwddump: DMA errorwddump: wddump: unknown error type %xwdioctlstrategy: No matching ioctl request found in queue physio split wd ioctl request... cannot proceed device faultdevice timeoutrequeuechannel reset, xfer %lx, retry %dsoft error (corrected) xfer %lx ST506wd_get_params: bad return code from ata_get_paramsIDENTIFY failed SPLIT_MOD15_WRITEquirks %s drive corrupts write transfers with certain controllers, consider replacing drive supports %d-sector PIO transfers, LBA48 addressing LBA addressing chs addressing %s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors (%d bytes/physsect; first aligned sector: %jdWARNING: block size %u might not actually work hwcould not create %s.%s sysctl node use_ncqcould not create %s.%s.use_ncq sysctl - error %d use_ncq_priocould not create %s.%s.use_ncq_prio sysctl - error %d standby immediate address mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectedobsolete (address mark not found)no media/write protectedinterface CRC errorST3120023ASST380023ASST360015ASwdc_ata_bio_kill_xfer: unknown reason %d wdc_ata_bio_kill_xferrecalpiomodesetmulti%s:%d:%d: not ready, st=0x%02x, err=0x%02x %s:%d:%d: timeout waiting for DRQ, st=0x%02x, err=0x%02x %s:%d:%d: %s timed out %s:%d:%d: %s drive fault error (%x) %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: read intr before drq atabus at %s channel %dwd at %s drive %d%s: unknown child %patasplatainitq%s: channel %d busy, xfer not possiblexfer %lx freed while invoking timeout xfer %lx deactivated while invoking timeout %s: unknown type: %xunable to create kernel thread: error %d %scnfunable to create config thread: error %d %s: ata_xfer_start() unexpected rv %d%s: queue_freeze%s(%s:%d:%d): using PIO mode %d32-bit data port drive supports PIO mode %d%s DMA mode %d%s Ultra-DMA mode %d (Ultra/33) (Ultra/66) (Ultra/100) (Ultra/133)SATA port multiplier not supported atapibus at %s not configured ata_hlatabusatdrnqidlataactatafinatathinvalid checksum %x for READ LOG EXT page %x READ LOG EXT page %x failed to report error: slot %d err %x status %x couldn't create dma map. (error=%d) mmctaskqxfer 512xfer 1024xfer 2048xfer 4096xfer 8192xfer 16384xfer 32768xfer 65536xfer unalignedxfer error "%s(manufacturer 0x%x%sproduct 0x%x%sstandard function interface code 0x%x%sat %s function %dcouldn't create task thread couldn't alloc memory (sdmmc function) sdmmcdelaysdmmc_set_relative_addr: SMC_CAPS_SPI_MODE set sdmmc_select_card: SMC_CAPS_SPI_MODE set sdmmc_select_card: error %d couldn't supply bus power couldn't supply clock couldn't enable card: %d couldn't identify card no functions i/o init failed mem init failed bad CIS ptr %#x CIS parse error at %d, tuple code %#x, length %d CISTPL_FUNCE(common) found in function CISTPL_FUNCE(common) too short CISTPL_FUNCE(lan_nid) too short CISTPL_FUNCE(lan_nid) invalid CISTPL_FUNCE(function) found in common CISTPL_FUNCE(function) too short (v1.00) CISTPL_FUNCE(function) too short bad CISTPL_FUNCID length bad CISTPL_MANFID length CISTPL_VERS_1 too short SDIO function unknown tuple code %#x, length %d %s: CIS version %u.%u %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: extended I/O error %d, r=%d p=%p l=%d %s direct I/O error %d, r=%d p=%p %s couldn't supply voltage requested by card couldn't send I/O OCR couldn't set I/O RCA couldn't select I/O RCA %d can't change bus width couldn't read CIS can't change bus clock %u-bit width, %u.%03u MHz %u KHz error waiting for data ready after ext write : %d switch error error waiting for data ready after switch command: %d can't read EXT_CSD (error=%d) unrecognised future version (%d) unknown CARD_TYPE: 0x%x card failed to switch to timing mode %d, using %d can't re-read EXT_CSD HS_TIMING set failed can't switch signaling voltage DDR52HS200can't execute MMC tuning can't enable cache: %d HostHost/CardSD_SEND_SCR send failed. can't change bus width (%d bit) switch func mode 0 failed failed to recover UHS card switch func mode 1 failed: group 1 function %d(0x%2x) can't get SD status: %d SD card status: %d-bit unknown bus width, C%d, U%d, V%d, A%d, Cache, %s self-maintenancecan't execute SD tuning setting cache enable failed: %d cache enabled can't enable cache: %dunknown SD CSD structure version 0x%x unknown MMC CSD structure version 0x%x unknown MMC version %d couldn't set mem RCA mid=0x%02x oid=0x%04x pnm="%s" rev=0x%02x psn=0x%08x mdt=%03x write-protected cache flush failed Default/SDR12High-Speed/SDR25SDR50SDR104DDR50SD cardMMC: <0x%02x:0x%04x:%s:0x%02x:0x%08x:0x%03x> %s 0x%02x:0x%04x:%ssdmmc discard countsdmmc discard errorssdmmc discard busyldsdmmc%sattachcouldn't create thread (disabled)%d-bit width, %s, %s cache%s, Cache%s,blkno 0x%llu exceeds capacity %d , retrying ld_sdmmcconfig_hook: invalid hook typeconfig_hook: incompatible mode on type=%d/id=%ld != %dconfig_hook: type=%d/id=%ld is replacedconfig_hook: type=%d/id=%ld is already hooked(%p)config_connect: can't connect with shared hook, type=%d id=%ldUNKNOWNCASIOCompaqHPHP Jornada addr 0x%lx-0x%lx intr %dPXA270Kernel is configured for %s, but CPU is %s : Onchip Peripheral Bus pxaip_attach: failed to map CLKMANpxaip_attach: failed to map MEMCTLpxaip_measure_cpuclock: can't map RTC%s: CPU clock = %d.%03d MHz %s: kernel is configured for PXA250, cpu type is %s pxaintcpxaip_attach_critical: failed to attach INTC!pxagpiopxaip_attach_critical: failed to attach GPIO!pxa2x0_memctl_read: not bootstrappedpxa2x0_memctl_write: not bootstrappedpxa2x0_clkman_config: not bootstrappedpxaippxa2x0_io_bs_alloc(): not implemented pxa2x0_io_bs_free(): not implemented : Interrupt Controller stray interrupt %d intr_establish: bogus irq number %dintr_disestablish: bogus irq number %dpxagpio_reg_read: not bootstrappedpxagpio_reg_write: not bootstrapped: GPIO Controller Can't map registers! failed to hook main GPIO interrupt no GPIO configured in kernel unhandled GPIO interrupt. GPIO#%d pxa2x0_gpio_intr_disestablish: can't unhook GPIO#0pxa2x0_gpio_intr_disestablish: can't unhook GPIO#1pxa2x0_gpio_intr_establish: bad pin number: %dpxa2x0_gpio_intr_establish: Pin %d not GPIO_INpxa2x0_gpio_intr_establish: bad level: %dpxa2x0_gpio_intr_establish: illegal shared interruptpxa2x0_gpio_set_intr_level: bad level: %d: can't map registers pxauart%s: Cannot map registersSA-11x0 OS Timer clock: hz=%d stathz=%d saost_countsaost: DMA Controller dmac_pxaip_attach: bus_dmamem_alloc faileddmac_pxaip_attach: bus_dmamem_map faileddmac_pxaip_attach: bus_dmamap_create faileddmac_pxaip_attach: bus_dmamap_load failedStray DMAC interrupt for unallocated channel %d pxa2x0_dmac_abort_xfer: channel %d failed to abortpxadmacpxapcic_mem_map: bogus kindpcic_attach_card: already attached%s,%dunable to create event thread for %d pxapcicevpxapcicss: %d slot%s can't attach failed to map MEMCTL unable to map register %s: Bus Error Detected Interrupt not handled 0x%x : Real-time Clock %s: couldn't map registers %s: using wristwatch register pxartcpxamci_dmac_ointr: non-zero completion status %d pxamci_dmac_iintr: non-zero completion status %d mmclkclock stop timeout unsupported bus frequency of %d KHz data not a multiple of %u bytes too much data couldn't start dma xfer. (error=%d) mmcmd: MMC/SD Controller couldn't establish MMC interrupt using DMA transfer couldn't alloc rx dma xfer couldn't alloc tx dma xfer couldn't attach bus apmsuspendpower management disabledunknown error codeinterface not connected16-bit interface already connected16-bit interface not supported32-bit interface already connected32-bit interface not supportedunrecognized device IDparameter out of rangeinterface not engagedunable to enter requested stateno pending eventsno APM presentreal mode interface already connectedAPM reservedAPM: %s event code %x get eventapmstandbyapmevioctl get power statusapm at %sPower Management spec V%d.%dunable to create thread, kernel APM support disabled reserved systemreserved deviceOEM definedapmdevpcmcia_childdetached: %s not found %s: error %d detaching %s (function %d) (manufacturer 0x%04x, product 0x%04x) function %d: %s pcmcia_function_init: function is enabled%s: card appears to have bogus CIS pcmcia_function_enable: function not initialized%s: couldn't map the CCR pcmcia_io_map: function is enabled! pcmcia_io_unmap: function is enabled! pcmcia_intr_establish: function is enabled! pcmcia_intr_establish: already done interrupt establish failed pcmcia_intr_disestablish: function is enabled! pcmcia_intr_distestablish: already done Drats! I need a skew! CIS checksum failed %s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) unspecifiedmulti-functionserial portparallel portfixed disk(ata)video adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx-%lx; memspace@%lx; maxtwins %d mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS %s: using CIS quirks for SVECFD605 PCMCIA EtherNet CardNDCPCMCIA MBH10302can't alloc mem for enet addr can't map mem for enet addr configure failed, error=%d can't get subregion for asic can't match ethernet vendor code cannot set power mgmt handler unable to establish power handler PCMCIAAmbiCom IncAMB8002TAmbiCom,Inc.Fast Ethernet PC Card(AMB8110)PMX PE-200UE2212D-LinkDE-660DE-660+RPTI LTD.EP400RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212EN2216-PCMCIA-ETHERNETSeiko Epson Corp.P/N: EEN10B Rev. 00TAMARACKCNetCN40BC EthernetPCMCIA-ETHERNET-CARDUE2216ASIXAX88190DFE-670TXDMELCOLPC2-TXLINKSYSE-CARDDE-650I-O DATAPCLAcorega K.K.corega Ether CF-TD LAN Cardcorega Ether PCC-Tcorega Ether PCC-TDcorega Ether PCC-TLcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDcorega FEtherII PCC-TXD(CG-LAPCCTXD)(HardwareFirmwareVer.)SMC8041TX-10/100-PC-Card-V2LNT-10TNCF10Base-Ethernet1.0DYNALINKL10Cne_pcmciacouldn't establish interrupt MEGAHERTZMODEM XJ2288com_pcmciacan't subregion I/O space memory mapped mode i/o mapped mode wdcattachDigital Mobile Media CD-ROMPCMCIA Portable CD-ROM DriveNinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI AdapterFREECOMPCCARD-IDEIO DATACBIDE2 LOOKMEETIDE CARDwdc_pcmciawiinitcouldn't load firmware failed to attach controller SMC2632WNANOSPEEDHFA384x/IEEENECWireless Card CMZ-RT-WPNTT-ME11Mbps Wireless LAN PC CardWireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11WLCFL-11INTERSILIntersilPRISM 2_5 PCMCIA ADAPTERPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN Adapterwi_pcmciaunable to flush cache timeout draining buffers failed to flush cache i/o blocked while suspended lddrain; first aligned sector %u%s: not drained dk_subrLucent/Prism/Symbol 802.11 controls%s: sysctl_createv failed (rc = %d) timeout in wi_seek to %x/%x %s: failed in wi_seek to %x/%x detect auto increment bug, try again command timed out, cmd=0x%x, arg=0x%x command failed, cmd=0x%x, arg=0x%x wi_cmd: busy bit won't clear. xmit failed %s: %d tx cmds pending!!! %s: cleaning outstanding rssadapt descriptor for %s record read mismatch, rid=%x, got=%x record buffer is too small, rid=%x, size=%d, len=%d %s: invalid channel %d %s: tx rate %d -> %d (%d) %s write fid %x failed failed to allocate %d bytes on NIC timeout in alloc tx buffer allocation failed %s: interface not running %s: device timeout %s read fid %x failed %s: null node%s bad idx %02x %s null node, rssdesc %02x %s txpending[%i] wraparoundtx failed, retry limit exceeded, max transmit lifetime exceeded, port disconnected, invalid format (data len %u src %s), status=0x%xwi_scan_result: unknown firmware type %u LucentSymbol could not establish softint could not get mac address, attach failed 802.11 address %s %s: using Unknown PRISM2 chipUnknown Lucent chip %s: %s Firmware: Primary (%u.%u.%u), Station (%u.%u.%u) using default channel list no available channel no supported rate list Lucent Technologies, WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEERF:PRISM2 MAC:HFA3841RF:PRISM2 MAC:HFA3841 CARD:HWB3763 rev.BRF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.ARF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.BRF:PRISM2 MAC:HFA3842 CARD:HFA3842 EVALRF:PRISM1 MAC:HFA3841 CARD:HWB1153RF:PRISM2 MAC:HFA3841 CARD:HWB3163-SST-flashRF:PRISM2.5 MAC:ISL3873B(PCMCIA)RF:PRISM2.5 MAC:ISL3874A(Mini-PCI)RF:PRISM2.5 MAC:ISL3874A(PCI-bridge)RF:PRISM3 MAC:ISL3871(PCMCIA)RF:PRISM3 MAC:ISL3871(Mini-PCI): failed to clear NIC buffer at offset %x - check configuration Ethernet address %s %s: NIC memory corrupt - invalid packet length %d device enable failed ne2000_write_mbuf: negative len%s: remote transmit DMA failed to complete where did the card go? setup failed %s: %d silo overflow%s, %d ibuf flood%s com: unsupported I/O width %dtimeout while waiting for BUSY interrupt acknowledge timeout while waiting for HALT update acknowledge 0x%x 0x%x 'ns16550ast16650, broken fifost16650ans16550, broken fifons8250 or ns16450, no fifotl16c750ns16750Au1X00 UARTns16650, no ERSOMAP UARTIngenic UARTTegra UARTBCM AUX UARTDesignWare APB UARTDesignWare APB UART, no fifois_consoleforce_consoleskip_attach_delaycan't re-init serial console @%lx fifolen: %s, %d-byte FIFO txfifo disabled 10base2, 10baseT, 10baseT-FDX, auto, default [0x%02x 0x%02x] auto 10base2 10baseT-FDX 10baseT atarst%s:%d: %s %s:%d:%d: %s __wdccommand_kill_xfer: unknown reason %d __wdccommand_kill_xfer%s channel %d: reset failed for drive 0 drive 1atapitimeout not expected without pending irqlost interrupt type: %s tc_bcount: %d tc_skip: %d atapollatadrdyatacnfatardl%s: dir offset too large on fs %s (mounted from %s) %s: dir offset too large for emulated program /usr/libexec/ld.elf_so%s-%scompat_utilinvalid AES nrounds: %uBearSSL aes_ctAES-CCM overflow%s: ctxt %u%s: tag %u%s: verify %u failed %s: ptxt %u%s: forgery %u succeeded %s: buffer overrun %s: tag overrun aes_ccm: self-test passed aes_ccmaescryptoselectedAES is bustedaes: self-test failed: %s AES self-tests failedaes: %s %s AES-%u enc: self-test failed wasexpected%s AES-%u dec: self-test failed %s AES overrun preceding: self-test failed %s AES overrun following: self-test failed %s AES-%u-CBC enc: self-test failed %s AES-%u-CBC dec: self-test failed %s AES-%u-CBC enc inc %u: self-test failed %s AES-%u-CBC dec inc %u: self-test failed %s AES-CBC overrun preceding: self-test failed %s AES-CBC overrun following: self-test failed %s AES-128 CCM encrypt auth/ctr (16): self-test failed %s AES-128 CCM encrypt auth/ctr (48): self-test failed %s AES-128 CCM ciphertext: self-test failed %s AES-128 CCM decrypt auth/ctr (16): self-test failed %s AES-128 CCM decrypt auth/ctr (48): self-test failed %s AES-128 CCM plaintext: self-test failed %s AES-%u-XTS enc: self-test failed %s AES-%u-XTS dec: self-test failed %s AES-%u-XTS enc incremental: self-test failed %s AES-%u-XTS dec incremental: self-test failed %s AES-XTS overrun preceding: self-test failed %s AES-XTS overrun following: self-test failed %s AES-128 CBC-MAC (16): self-test failed %s AES-128 CBC-MAC (48): self-test failed chacha: self-test failed: %s chacha: %s Portable C ChaChaxchacha_streamxchacha_stream_xorchacha core 1chacha core 2hchachacprng_fast reseed/usr/src/sys/crypto/blake2/blake2s.c0 < dlenkernel %sassertion "%s" failed: file "%s", line %d dlen <= 32keylen <= 32jA%AESŘOOLJ܈yLblake2s: self-test failedblake2s: self-test passed blake2ssysmonsysmon_envsyssysmon_wdogsysmon_powerWARNING: KERNEL TICKLE OF WATCHDOG %s FAILED! wdogrefWARNING: unable to register watchdog shutdown hook WARNING: unable to register watchdog critpoll hook %s: %d users remain WARNING: UNABLE TO DISARM WATCHDOG %s ON CLOSE! WARNING: FAILED TO SHUTDOWN WATCHDOG %s! software watchdog initialized unable to register software watchdog with sysmon swwdog%s: %d second timer expired watchdog timer expiredswwrebootfailed to create swwdog reboot wq%s: unable to attach cfattach invalid vap id %dvap id %d not allocatedinvalid channel freq %u flags %x invalid channel (NULL) %s: mode %u not supported (caps 0x%x) Unexpected mode %u%s: no channels found for mode %u Bad IBSS channel %ubad channel ignored; freq %u flags %x number %u vap table full.5%s: %s rates: %s%d%sMbps%s: no 802.11 instance! 11a11b11gFHturboAturboGAMRR increasing rate %d (txcnt=%d retrycnt=%d) AMRR decreasing rate %d (txcnt=%d retrycnt=%d) No cipher!%s: %s keyix %u flags 0x%x rsc %ju tsc %ju len %u %s: driver did not delete key index %u %s: cipher %s has an invalid cipher index %u %s: cipher %s registered with a different template %s: invalid cipher %u %s: unregistered cipher %u, load module %s %s: unable to load cipher %u, module %s %s: no h/w support for cipher %s, falling back to s/w %s: no h/w support for TKIP MIC, falling back to s/w %s: unable to attach cipher %s %s: no h/w resources for cipher %s, falling back to s/w %s: unable to setup cipher %s %s: %s keyix %u flags 0x%x mac %s rsc %ju tsc %ju len %u %s: cipher %s rejected key index %u len %u flags 0x%x %s: no key index; should not happen! [%s] no default transmit key (%s) deftxkey %u %s: control frame%s: WEP data frame too short, len %u wlan_wepwlan_tkipwlan_aes_ocbwlan_ccmpwlan_ckip%s: Invalid key length %u, expecting %u [%s] Missing ExtIV for AES-CCM cipher [%s] AES-CCM decrypt failed; MIC mismatch AES-CCM[%s] key id %u is not set (decap) [%s] key id %u is not set (encap) NONEout of buffers with data_len %zu [%s] Discard frame due to countermeasures (%s) [%s] missing ExtIV for TKIP cipher [%s] discard frame due to countermeasures (%s) [%s] TKIP ICV mismatch on decrypt TKIP[%s] out of data for WEP (data_len %zu) [%s] WEP ICV mismatch on decrypt WEP[%s:%s] discard %s frame, %s information element, too short, len %uWME[%s] discard %s frame, ssid mismatch: [%s] extended rate set too large; only using %u of %u rates [%s] shared key challenge alloc failed too short (1): len %uwrong version %xnode %s, %snot to bssnot to cur sta: lladdr=%6D, addr1=%6Dtoo short (2): len %ubss %s, broadcast %s, %sseqno <%u,%u> fragno <%u,%u> tid %uduplicateunknown dir 0x%xmulticast echounknown srcunassoc src[%s] power save mode on, %u sta's in ps mode [%s] power save mode off, %u sta's in ps mode [%s] flush ps queue, %u packets queued multicast fragm?demic errordecap errorunauthorized port: ether type 0x%x len %utoo short: len %umgtreceived %s from %s rssi %d WEP set but not permittedWEP set but PRIVACY offps-pollunassociated stationaid mismatch: sta aid 0x%x poll aid 0x%x[%s] recv ps-poll, but queue empty [%s] recv ps-poll, send packet, %u still queued [%s] recv ps-poll, send packet, queue empty bad frame type 0x%xreassocWPARSN, protection, QoSie too shortbad len %uERPid %u, len %uunhandledno scan.sp_ratesbad scan.sp_rates len %dno scan.sp_ssidbad scan.sp_ssid len %dinvalid channel %ufor off-channel %ubogus beacon interval[%s] erp change: was 0x%x, now 0x%x [%s] capabilities change: before 0x%x, now 0x%x no ratesbad rates len %dno ssidbad ssid len %dno ssid with ssid suppression enabled[%s] recv probe req recv'd rate set invalid[%s] recv auth frame with algorithm %d seq %d disallowed by ACLTKIP countermeasures enabledshared key auth PRIVACY is disabledbad sta auth mode %uie %d/%d too longno challengebad challenge len %dbad operating mode %ubad state %u[%s] shared key %sauth request shared key responseunknown stationno challenge recordedchallenge mismatch[%s] station authenticated (shared key) bad seq %d[%s] shared key auth failed (reason %d) open auth[%s] station authenticated (open) [%s] open auth failed (reason %d) unsupported alg %dwrong bssid[%s] deny %s request, sta not authenticated [%s] no WPA/RSN IE in association request not WPA, flags 0x%xbad version %umcast cipher mismatch; got %u, expected %uucast cipher data too short; len %u, n %uucast cipher set emptykey mgmt alg data too short; len %u, n %uno acceptable key mgmt algnot RSN, flags 0x%x[%s] %s ie: mc %u/%u uc %u/%u key %u caps 0x%x [%s] deny %s request, capability mismatch 0x%x [%s] deny %s request, rate set mismatch [%s] %sassoc failed (reason %d) [%s] %sassoc failed (rate set mismatch) [%s] %sassoc success: %s preamble, %s slot time%s%s [%s] recv deauthenticate (reason %d) [%s] recv disassociate (reason %d) subtype 0x%x not handled[%s] %s compat_20link-layer statistics and controlsIEEE 802.11 WLAN statistics and controlsieee80211%s: sysctl_createv failed, rc = %d client/peer stationsvap%uinact_runinact_probeinact_authinact_initdriver_capsbmiss_max%s: 802.11 mgt frame too large: %ubad beacon boundarybss %snode %s join %snode %s leave notify scan done [%s] %s replay detected [%s] michael MIC verification failed %s: load the %s module by hand for now. bogus aid %u, max %u%s %p<%s> in %s table %s: IEEE80211_LOCK not held%s: remove %p<%s> from %s table, refcnt %d %s: %p<%s> clear key map entry [%s] scan candidate purged from cache (refcnt %u) %p: mac %s refcnt %d scangen %u authmode %u flags 0x%x associd 0x%x txpower %u vlan %u txseq %u rxseq %u fragno %u rxfragstamp %u rstamp %u rssi %u intval %u capinfo 0x%x bssid %s essid "%.*s" channel %u:0x%x fails %u inact %u txrate %u %s: free all nodes in %s table %s %s table %s: %s[%u] still active %s: scan set:%s%u start chan %u ????ibss %c %s %s%c %3d%c %+4d %2dM%c %4s%c %3s%c passive%s: end %s scan ni != NULLrefcnt(ni) == %dic != NULL%s: fixed rate %d (%d.%d Mb/s) not in rate set%s %p<%s> %s: add key map entry %p<%s> refcnt %d [%s] no node, discard frame (%s) %s %p<%s> refcnt %d %s: %p<%s> clear key map entryneighbor%s: creating ibss %s: merge failed, capabilities mismatch %s: new bssid %s: %s preamble, %s slot time%s %s: no scan candidate macaddr bssid chan rssi rate flag wep essid %s %s: chan %d->%d begin %s scan in %s mode, scangen %u new [%s] %s%s on chan %u (bss chan %u) [%s] caps 0x%x bintval %u erp 0x%x country info %02xkey map out of sync, ni %p nikey %p%s: delete key map entry %p<%s> refcnt %d %s: scan aborted %u [%s] station with aid %d leaves unexpected operating mode %ubogus long slot station count %d[%s] long slot time station leaves, count now %d %s: re-enable use of short slot time bogus non-ERP station count %d[%s] non-ERP station leaves, count now %d %s: disable use of protection %s: re-enable use of short preamble %s: %s scangen %u [%s] discard frame, age %u [%s] discard %u frames for age probe station due to inactivitystation timed out due to inactivity (refcnt %u)[%s] station needs long slot time, count %d [%s] station is !ERP, %d non-ERP stations associated %s: enable use of protection [%s] station needs long preamble [%s] station %sassociated at aid %d: %s preamble, %s slot time%s%s unable to setup initial BSS node%s %s table, inact %u scanena[%s] send null data frame on channel %u, pwr mgt %s no ethernet header!not enough room, need %u got %lu [%s] enmic failed, discard frame mbuf already chained?pktlen %u mtu %ufragment size %u too big!%s: paylen < 0%s: npkt %d firstlen %d lastlen0 %d lastlen %d fraglen %d overlen %d len %d rate %d icflags %08x no WPA/RSN!RSN IE too big, %u > %zuWPA IE too big, %u > %zuieee80211_ref_node (%s:%u) %p<%s> refcnt %d [%s] send probe req on channel %u [%s] request encrypt frame (%s) [%s] send station deauthenticate (reason %d) [%s] send station disassociate (reason %d) [%s] invalid mgmt frame type %u [%s] encrypting frame (%s) [%s] send %s on channel %u %s: cannot get buf; size %u no space for 802.11 header?%s: traffic %u, disable aggressive mode %s: traffic %u, enable aggressive mode tim bitmap empty!%s: TIM updated, pending %u, off %u, len %u [%s] pwr save q overflow, drops %llu (size %d) [%s] save frame with age %d, %u now queued wlan: %s acl policy registered wlan: %s acl policy unregistered wlan_acl0x%s: %s -> %s no recent beacons from %s; rescanning %s: invalid transition %s: bogus xmit rate %u setup ostate %x nstate %x associated synchronized with %s ssid channel %d start %uMb NODS %s->%sTODS %sFRDS %sDSDS %s->%s) data type#%d WEP [IV %.02x KID %u] %dM +%d%s: %s [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s log2(cwmin) %u %s: WME params updated, cap_info 0x%x %s: %s chan [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s bss [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] beacon misswlan_internalwlan_xauthWME_AC_BEWME_AC_BKWME_AC_VIWME_AC_VOWME_UPSDINITSCANAUTHASSOCRUNreserved#0reserved#1reserved#2reserved#3reserved#5reserved#6reserved#7reserved#8reserved#9ps_pollrtscf_endcf_end_ackreassoc_reqreassoc_respprobe_reqprobe_respbeaconatimdisassocdeauthreserved#13reserved#14reserved#15rssadaptexpavgctl%s: dst %s threshold[%d, %d.%d] %d < %d %s: src %s rssi %d avg %d -> %d ieee80211_rssadapt_lower_rate: %s rate #%d > #%d out of bounds %s: dst %s rssi %d threshold[%d, %d.%d] %d -> %d %s: threshold[%d, %d.%d] decay %d %s: dst %s thresholds %d-byte, T[%d.%d] = %dexternal%hu.%hhu%s:%hhuigmpplinetigmplla_lookup: new lle malloc failed inmltplmulticastsubnetsarelocalhostzerobroadcastinvalid argument to in_lifaddr_ioctlin_controlin4pcbplin6pcbpl%d.%d.%d.%d%s:%huinterneticmpmaskreplreturndatabyteserrppslimitrediracceptredirtimeoutbmcastechodynamic_rt_msgICMP: redirect failed to register timeout for route to %s, code %d icmp_errorforwardingredirectttlforwsrcrtdirected-broadcastallowsrcrtmtudiscanonportminanonportmaxmtudisctimeoutlowportminlowportmaxcheckinterfacerandom_iddo_loopback_cksumdad_countanonportalgoavailablereserve%s: refusing to send from invalid address %s (pid %d) maxfragpacketsipfrenplrip_abortrip_acceptpcblisttcpipqepl(unknown)TCP: invalid wscale %d from %s, assuming %d tcp_pulloutofbandm_pulldown malfunctionConnection attempt to TCP %s:%d from %s:%d (unknown v6)Connection attempt to TCP [%s]:%d from [%s]:%d tcp_output REXMTtp->t_lastm == NULL%s: no template%s: %d < %dsackholepltcp_inittcpcbpltcp_new_iss: unreachable%s: impossible (1)%s: impossible (2)synplrfc1323sendspacerecvspacemssdfltminmssmslsyn_cache_limitsyn_bucket_limitinit_winmss_ifmtusackcongctlwin_scaletimestampscwmcwm_burstsizeack_on_pushkeepidlekeepintvlkeepcntslowhzlog_refusedrstppslimitdelack_ticksinit_win_localkeepinitrecvbuf_autorecvbuf_increcvbuf_maxsendbuf_autosendbuf_incsendbuf_maxecnmaxretriesglobalmaxholesglobalholeslocal_by_rttiss_hashabcaggressivemsltremoteremote_thresholdvtwtcp6inet6newrenocubicudp_abortudp_acceptudpchecksumrandom_startrandom_pickdoublehashrandinc(src=%s dst=%s tgt=%s)%s: ICMP6 redirect sent from %s rejected; must be from linklocal %s: ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) %s: ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s %s: ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s %s: ICMP6 redirect rejected; no route found for redirect dst: %s %s: ICMP6 redirect rejected; redirect dst must be unicast: %s %s: ICMP6 redirect rejected; neither router case nor onlink case: %s %s: invalid ND option, rejected: %s %s: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s %s: sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d /usr/src/sys/netinet6/icmp6.c%s: source can't be determined: dst=%s, error=%d %s: ICMP6 checksum error(%d|%x) %s %s: unknown type %d(src=%s, dst=%s, ifid=%d) icmp6nd6_prunend6_delaynd6_mmaxtriesnd6_umaxtriesnd6_maxnudhintmaxqueuelennd6_useloopbacknodeinfomtudisc_hiwatmtudisc_lowatnd6_debugreflect_pmtu%s: ENOBUFS in icmp6_error %d IPv6 address: "%s" is not on the network %s: a destination can be specified for a p2p or a loopback IF only %s: prefixlen should be 128 when dstaddr is specified %s: valid lifetime is 0 for %s %s: in6_setscope failed %s: addmulti failed for %s on %s (errno=%d) in6_prefixlen2mask: invalid prefix length(%d) invalid argument to in6_lifaddr_ioctl%s: %s marked tentative %s: %s marked detached in6_cksum: offset too short for IPv6 headerin6_cksum: mbuf too short for IPv6 header%s: %s has too small MTU, IPv6 not enabled %s: %s is not multicast capable, IPv6 not enabled %s: failed to configure the loopback address on %s (errno=%d) %s: %s: got interface identifier from itself %s: %s: got interface identifier from %s %s: %s: borrow interface identifier from %s %s: %s: interface identifier generated by random number %s: %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: failed to configure a link-local address on %s (errno=%d) %s: cannot assign link-local address ::ffff:%s[%s]:%huinternet6Cannot forward from %s@%s to %s@%s nxt %d (%s) unspec/srcbcast/mcastmcast/dstsrc[%s] inzone %d outzone %ddst[%s] inzone %d outzone %dip6keepfaithlog_intervalhdrnestlimitauto_flowlabeldefmcasthlimNetBSD-currentkame_versionuse_deprecatedv6onlyauto_linklocaladdctlpolicyprefer_tempaddrmaxfragsuse_defaultzonemcast_pmtuneighborgcthreshmaxdynroutesparam_rt_msgip6_init%s: packet to an unready address %s->%s %s: off < sizeof(struct ip6_hdr)%s: m == NULLpim6register_mifmultiple kernel entriesadd_m6fc: %s o %s g %s p %x dbx %p cannot forward from %s to %s nxt %d received on %s ip6_mforward: ip6_mrouter socket queue full assumption failed: hdr not splitmulticast_kludge%s: Cannot enable an interface with a link-local address marked duplicate. nd6_timer%s: workqueue_create failed (%d) %s: duplicated ND6 option found (type=%d) %s: nd6_options: unsupported option %d - option ignored %s: too many loop in nd opt %s: can't allocate llinfo for %s (ln=%p, rt=%p) %s: failed to set scope %s (errno=%d) %s.%d: sockaddr_dl_init(, %zu, ) failed on %s %s: rt_setgate failed on %s nd6_rtrequest: bad gateway value: %s %s: %s: failed to join %s (errno=%d) %s: detected a looped back NS message for %s %s: DAD duplicate address %s from %s %s: possible hardware address duplication detected, disable IPv6 %s: invalid hlim (%d) from %s to %s on %s %s: invalid target address %s %s: a solicited adv is multicasted %s: invalid ND option, ignored %s: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: duplicate IP6 address %s %s: ND packet from non-neighbor %s on %s nd6_dad_timer: called with duplicate address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: %s: could not run DAD, driver problem? %s: %s: DAD complete for %s - no duplicates found %s: bad DAD packet (wrong ip6 dst) %s: NS packet from non-neighbor %s on %s %s: bad NS target (multicast) %s: bad DAD packet (link-layer address option) %s: lladdrlen mismatch for %s (if %d, NS packet %d) %s: duplicate IP6 address %s %s: src=%s %s: dst=%s %s: tgt=%s nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: memory allocation failed for %s(%s) %s: %s: starting DAD for %s RA%s: src %s is not link-local %s: lladdrlen mismatch for %s (if %d, %s packet %d) raw6%s: assumption failure (non 0 ID): %s%%%d %s: no scope id for %s %s: can't set scope for not loopback interface %s and loopback address %s siteorganizationglobaludp6%s: control but no lwpudp6_output: IPV6_V6ONLY option was set for a connected socket %s%s%s%s at %s addr 0x%02xi2c-indirect-device-permitlistinvalid property type (%d) for '%s'; must be array (%d) smbus-quick-writesmbus-receive-byteunknown probe strategy '%s'; defaulting to '%s' WARNING: ignoring bad device address @ 0x%x : I2C bus i2cdevsti2c-child-devicesi2c-no-indirect-configi2c-enumerate-devicescompatibledevhandleWARNING: ignoring bad child device entry for address 0x%x i2cexec,i2c_bitbang,i2c_subri2cexeciic at %s bus %di2c_bitbangmii_attach: phyloc and offloc specifiedmii_attachmiimiiautomii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmiiverboseoui %6.6xmodel %4.4xOUI 0x%06x model 0x%04xmiiautmii_phy_setmedia: MASTER on wrong mediano media present HomePNA110baseT10baseT-FDX100baseTX100baseTX-FDX100baseT41000baseSX1000baseSX-FDX1000baseT1000baseT-FDX: Media interface : %s, rev. %d bgebnxphyflagsfailed to get phyflags chipidfailed to get chipid shared_hwcfgfailed to get shared_hwcfg port_hwcfgfailed to get port_hwcfg 2500baseSX-FDX BCM5400 1000BASE-T media interfaceBCM5401 1000BASE-T media interfaceBCM5402 1000BASE-T media interfaceBCM5404 1000BASE-T media interfaceBCM5411 1000BASE-T media interfaceBCM5421 1000BASE-T media interfaceBCM5424/BCM5234 1000BASE-T media interfaceBCM5461 1000BASE-T media interfaceBCM5462 1000BASE-T media interfaceBCM5464 1000BASE-T media interfaceBCM5466 1000BASE-T media interfaceBCM54K2 1000BASE-T media interfaceBCM5701 1000BASE-T media interfaceBCM5703 1000BASE-T media interfaceBCM5704 1000BASE-T media interfaceBCM5705 1000BASE-T media interfaceBCM5706 1000BASE-T/SX media interfaceBCM5714 1000BASE-T/X media interfaceBCM5750 1000BASE-T media interfaceBCM5752 1000BASE-T media interfaceBCM5780 1000BASE-T/X media interfaceBCM5708C 1000BASE-T media interfaceBCM5481 1000BASE-T media interfaceBCM5482 1000BASE-T media interfaceBCM5708S 1000/2500baseSX PHYBCM5709 10/100/1000baseT PHYBCM5709S 1000/2500baseSX PHYBCM5709CAX 10/100/1000baseT PHYBCM5722 1000BASE-T media interfaceBCM5754/5787 1000BASE-T media interfaceBCM5755 1000BASE-T media interfaceBCM5756 1000BASE-T media interface XXXBCM5761 10/100/1000baseT PHYBCM5784 10/100/1000baseT PHYBCM5785 1000BASE-T media interfaceBCM5717C 1000BASE-T media interfaceBCM5719C 1000BASE-T media interfaceBCM5720C 1000BASE-T media interfaceBCM57765 1000BASE-T media interfaceBCM57780 1000BASE-T media interfaceBCM54213PE 1000BASE-T media interfaceBCM5725C 1000BASE-T media interfaceBCM5906 10/100baseTX media interfacebrgphyDP83840 10/100 media interfacensphyDP83843 10/100 media interfaceDP83847 10/100 media interfaceDP83849 10/100 media interfaceDP83815/DP83846A 10/100 media interfacensphyterQS6612 10/100 media interfaceqsphyi82555 10/100 media interfacei82562EH HomePNA interfacei82562EM 10/100 media interfacei82562ET 10/100 media interfacei82562G 10/100 media interfaceinphyi82553 10/100 media interfaceiophy: 3Com internal media interface ignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYexphy100baseFX, 100baseFX-FDX LXT970 10/100 media interfaceLXT971/2 10/100 media interfacelxtphyICS1889 10/100 media interfaceICS1890 10/100 media interfaceICS1892 10/100 media interfaceICS1893 10/100 media interfaceICS1893C 10/100 media interfaceicsphyusing Seeq 84220 isolate/reset hack Seeq 80220 10/100 media interfaceSeeq 80225 10/100 media interfaceSeeq 84220 10/100 media interfacesqphyDM9101 (AMD Am79C873) 10/100 media interfaceDM9102 10/100 media interfaceDM9161 10/100 media interfaceDM9161A 10/100 media interfaceDM9161[BC] 10/100 media interfaceDM9601 internal 10/100 media interfacedmphyAm79C901 HomePNA 1.0 interfacepnaphy: %s (OUI 0x%06x, model 0x%04x), rev. %d : OUI 0x%06x, model 0x%04x, rev. %d ukphydmover_backend_unregisterdmoverdmreqdmsesdmover_session_destroy%s: emergency X server detach added (%s, %s emulationwsdisplaytty() on status devicewsdisplaytty() on ctl devicewsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch3: screen %d disappeared wsdisplay_switch3: giving up screen %d deleted kbdmux %d: console (%s, %s emulation), using %swsswwsdisplay at %swsdisplay: event queue overflow wswaitwsdisplay_noemulwsdisplay_emulEDIDdumb%s: ESC in kernel output ignored vt100[>24;20;0cP2$u%s%dP0!u%5\[?62;6c[8;%d;%dt[%d;%dR[?13n[?21n[?27;1nwsemul_vt100_handle_dcs: bad type %dOIOMOjOkOlOmOnOo[28~[29~[1~[2~[3~[4~[5~[6~[7~[8~OAOBODOCOpOqOrOsOtOuOvOwOxOyOPOQOROS[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[31~[32~[33~[34~wseventdefault_version%s: unknown version %dwsevent_read mux %dcannot load keymap: console keyboardattach error=%d couldn't register as input device connecting to %s wskdetwskbd_detach: %s didn't detach wskbd at %s%s: event queue overflow wskbdwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entrywsmux%s: disconnecting from %s wsbell at %swsbell%s: fontwidth assumptions botched%s: font stride assumptions botched%s: depth not supported %s: font table is empty %s: couldn't lock font %s: bits not aligned on 32-bit boundary %s: stride not aligned on 32-bit boundary ccwwsfont: font '%s' bito %d byteo %d copied to bito %d byteo %d wsfont_unlock: font not lockedBoldfacecd9660noplRRIP with incorrect NM flags? RRIP without PX field? RRIP with incorrect flags?IEEE_1282IEEE_P1282RRIP_1991ASPcd9660utf8_jolietfhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] %/C%/@%/Eroot_devicecd9660_strategy: spectag VT_ISOFS, isofs vnode msdosnoplmsdosfhplloadvnode(): pcbmap returned %d deextend: file too largedetrunc(): can't truncate root directory, clust %ld, offset %ld %s: copy FAT %d (error=%d) %s: write FAT (error=%d) . .. msdosfs_rename: updating .. in root directory?msdosfsmsdosfs_sync: rofs modRRaArrAamsdosmsdosfs_write(): bad file typemsdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %llu, %llu bind failed nfsvinvalnfs_doio: type %x unexpected nfsbioread: type %x unexpected ifupdown: socreate, error=%d ifupdown: GIFFLAGS, error=%d ifupdown: SIFFLAGS, error=%d nfsbifsetaddress: socreate, error=%d setaddress, error=%d nfsbtdnfs_boot: '%s' not found setmtu: socreate, error=%d setmtu: GIFMTU, error=%d setmtu: SIFMTU, error=%d deladdress: socreate, error=%d deladdress, error=%d nfs_boot: timeout... nfs_boot: sosend: %d nfs sndunlockshort receive (%lu/%lu) from nfs server %s impossible packet length%s (%d) from nfs server %s short receive (%lu/%d) from nfs server %s Egad!! receive error %d from nfs server %s nfsreply nilis alive againnfstrylatermtimectime%s: inaccurate wcc data (%s) detected, disabling wcc (ctime %u.%09u %u.%09u, mtime %u.%09u %u.%09u) %s: re-enabling wcc nfsiodnfsionfsiormnfsauth1nfsauth2nfskqpwnfskqpollnfskqdet%s: vp=%p error=%d nfsnodeplnfsvaplnfssillynfs_node_initnfs send error %d for %s nfsd send error %d timer starttimer stopnfscon sotypenfscn2nfs rcvunlockBad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad nfs server %s: %s not respondingnfsrvdescplbuild > MLENnfsumntnfsstatsiothreadsnfs_vfsops: nfs_statvfs would lose buffers nfs_args: retrying connect nfscn3nfsrcvnfssndnfsaionfsdisnfs%unfs_mountroot: mget soname for %snfs_mountroot: mount %s failed: %d root on %s nfs_mountroot: getattr for rootnfs_readdir: lost in spacenfs physio/asynctag VT_NFS, fileid %lld fsid 0x%llxwriterpc readonly vp %pnfsmblknfs: sillyrename dir.nfsAxxxx4.4nfs_remove: bad vrefcnt(vp)%s: map corrupted: start=%d, len=%d, fs = %s, offset=%d/%ld, cg %d%s: block not in map: bno=%d, fs=%s%s: map corrupted: cg=%d, irotor=%d, fs=%s%s: block not in map: fs=%suid %d, pid %d, command %s, on %s: %s %s: bad size: dev = 0x%llx, bno = %lld bsize = %d, size = %ld, fs = %s%s: bad block %lld, ino %llu bad blockifree: dev = 0x%llx, ino = %llu, fs = %s %s: freeing free inode%s: freeing free block: dev = 0x%llx, block = %lld, fs = %s%s: freeing free frag: dev = 0x%llx, block = %lld, fs = %sfile system full %s: write failed, file system is full out of inodes %s: create/symlink failed, no inodes free trimwqtrimwqcv%s: bad bprev: dev = 0x%llx, bsize = %d, bprev = %lld, fs = %s%s: bad blockno %#llx != %#llx%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE %s: bad optim: dev = 0x%llx, optim = %d, fs = %s%s: range: dev = 0x%llx, ino = %llu, fs = %sffs_balloc: blk too bigCould not unwind indirect block, error %dspec nodes went hereffs_indirtrunc: bad buffer sizeffs_truncate: partial trunc of extdataitrunc: newspacesnapblkfree: inconsistent block typeffs_snapshot_mount: vget failed %d ffs_snapshot_mount: non-snapshot inode %d ffs_snapshot_mount: read_1 failed %d ffs_snapshot_mount: read_2 failed %d ffs_snapshot_mount: %llu already on list%s: unknown fs_fragshift %d%s: ACLs requested but not supported by this fs WARNING: %s: POSIX.1e ACLs flag on fs but no ACLs support WARNING: %s: NFSv4 ACLs flag on fs but no ACLs support %s: "posix1eacls" and "nfsv4acls" options are mutually exclusive org.netbsd.kauth.systemffs_modcmd: can't listen on system scope. ffsdoclusterreaddoclusterwritedoreallocblkslog_changeopt%s: dup alloc ino=%lld on %s: mode %o/%o gen %x/%x size %llx blocks %llx%s: ino=%lld on %s: gen %x/%x has non zero blocks %llx or size %llx %s: dirty filesystem?ffsinoffsdino1ffsdino2appleufs, not mounting%s: dirty1%s: unknown ufs flags: 0x%08x%s %s: dirty2%s: options QUOTA2 not enabled%s %s: file system not clean (fs_clean=%#x); please fsck(8) %s: `-o softdep' is no longer supported, consider `-o log' %s: rofs mod, fs=%smfsidlmfs_rootmfs_open not VBLKtag VT_MFS, pid %d, base %p, size %ld mfs_inactive: not inactive (mfs_buflist %p)mfs_strategy: bad devwarning: mfs read during shutdown mfs_closemfs_initminiroot() called more than once%s: unlinked ino %lld on "%s" has non zero size %llx or blocks %llx with allerror %d %s: bad dir ino %ju at offset %d: %s not roundedmissing NUL in namenull entryi_size too small%s: too big%s: nospace%s: newblkhard-linked directoryufsdirufs_whiteout: unknown opufs_strategy: spectag VT_UFS, ino %llu, on dev %llu, %llu flags 0x%x, nlink %d mode 0%o, owner %d, group %d, size %qdinvalid uio rw: %damapplcownowcownowpageamapswpoanonpllkloanpguvm_anon_pageinuao_getuao_getpageuaoeltpluao_put: strange, got an out of range flush %#jx > %#jx (fixed) uao_put%s: impossibleuao_detubchashubc object hashubc_allocubc_faultubc_init: failed to allocate ubc_mapubc_init: failed to map ubc_objectudv_detachudv_attachflt_noram5flt_pmfail2flt_pmfail1anonget1anonget2flt_noram1fltamapcopyfltagain1flt_noram2pgo_faultfltagain2flt_noram4uvm_fault_unwire_locked: address not in mapuareauvmuvm_init: page size not setuvmfaultuvm_km_bootstrap: could not reserve space for kerneluvm_km_bootstrap: could not reserve kernel kmem%s: unable to allocate space in parent mapuvm_km_suballoc: submap allocation failedkm_pgrmkm_getwait2plpglivelockloanagainloanzeroloanuopguser_va0_disablevmmpeplvm_map%s: kernel object %p %p uvm_voaddr_release: bad typevmmeterloadavguvmexpuvmexp2maxslpuspaceminaddressmaxaddressthread_guard_sizeuobjwirepguvm_page_numa_lookup: failed, first pg=%p pa=%#lx uvm_setpagesize: page size %u (%#x) not a power of twouvm_page_physget: called _after_ bootstrapuvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocatedUVM: using package allocation scheme, %d package(s) per bucket UVM: using NUMA allocation scheme uvm_pagealloc_strat: bad strat %demergvapager_mapuvmpdlmtout of memory before the pagedaemon thread existspagedaemon: deadlock detected! fork pooldrainpgdaemonanonminfileminexecminanonmaxfilemaxexecmaxinactivepctpdpolicyreactanonreactfilereactexecpglac2pglallocTried to add RAM after uvm_page_inituvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX Boot time slabHotplug slab%s: unload attempted after uvm_page_init() uvm_page_physload: bad free list %duvm_page_physload: start[%lx] >= end[%lx]uvm_physseg_plug() failed at boot.%s: Tried to unplug from unknown offset %s: Tried to unplug oversized span %s: can't unplug() from the middle of a segment without UVM_HOTPLUG %s: swapdev not in listswap_encrypt%s: vnode type 0x%x%s: swap to sparse file%s: can't get vnode for swap device%s: can't lock swap device%s: can't open swap deviceswapmap%s: vmem_create failedswp vnxswp vndswapctl: miniroot copy failedswapctl: copystrswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap swapdrum_addswapiod%s: workqueue_create failedturning off swap...stopping swap on %s failed with error %d uvnfp1uvnfp2copy-cred-on-forkbufq_disksortbufq_fcfsNetBSD-CORE%s@%dELFexec_elf32#!exec_scriptvmcmdkillsextendscalls/dev/consolewarning: no /dev/console warning: lookup /dev/console: error %d init: couldn't allocate argument spaceinit path (default %s)use absolute path, "halt", or "reboot" /sbin/initinit: trying %s exec %s: error %d copyout %dDetecting hardware...fork initcannot mount root, error = %d fork pagedaemonioflushfork syncer%s %s (%s)total memory = %s avail memory = %s /sbin/oinit/sbin/init.bak/rescue/initmaxvnodesmaxprocmaxfilesargmaxhostidprofilingposix1versionngroupsjob_controlsaved_idsboothowtoboottimemaxpartitionstimexrtc_offsetipcsysvmsgsysvsemsysvshmsynchronized_ioiov_maxmapped_filesmemlockmemlock_rangememory_protectionlogin_name_maxdefcorenamelogsigexitfscaleccpucp_timemaxphysmonotonic_clocklabelsectorlabeloffsetlabelusesmbrforkfsleepposix_threadsposix_semaphoresposix_barriersposix_timersposix_spin_locksposix_reader_writer_locksdump_on_panicroot_partitiondriverscp_idcoredumpsetidownergroupno_sa_supportconfignamebuildinfomessagesusermemcnmagicusermem64ostypeosreleaseosrevisionhostnamedomainnamerawpartitionmodelmachinemachine_archncpubyteorderphysmempagesizealignbytesphysmem64ncpuonlinekernvfsddbvendorsecurityAccounting resumed Accounting suspended Accounting started Accounting terminated actwatacctwatchAccounting: write failed %d kcredplorg.netbsd.kauth.credorg.netbsd.kauth.genericorg.netbsd.kauth.processorg.netbsd.kauth.networkorg.netbsd.kauth.machdeporg.netbsd.kauth.deviceorg.netbsd.kauth.vnodehardscheddivclockratehardclock_tickshardclockstatclockclockinterruptpid %d (%s): %s write of %zu@%p at %lld failed: %d %.*sToo many CPUs. Increase MAXCPUS?cpu%dfdcloseincrease kern.maxfiles or MAXFILESfiledescfile2dup2entropy: ready entropy: best effort cpu0entropy intrdropentropy intrtruncWARNING: consolidating less than full entropy entropyentropy: pid %d (%s) waiting for entropy(7) WARNING: system needs entropy for security; see entropy(7) entropy: invalid seed length: %zu, expected sizeof(rndsave_t) = %zu entropy: invalid seed checksum entropy: double-seeded by bootloader entropy: entering seed from bootloader with %u bits of entropy entropy pool crypto self-test failedcollectiondepletionconsolidategathersamplesneededsamplespendingepochentsrclockentropy: no seed from bootloader unable to establish entropy softintentbutlerunable to create entropy housekeeping thread: %dnotifydepleterequestextract failpartialimmediatediscretionaryfilt_usertouch() - invalid type (%ld)%s: invalid type (%ld)EVFILT_READEVFILT_WRITEEVFILT_AIOEVFILT_VNODEEVFILT_PROCEVFILT_SIGNALEVFILT_TIMEREVFILT_FSEVFILT_USEREVFILT_EMPTY*fexecve*execargsshould not happensigcode kernel mapping failed %d pspawnlwpwaitnetbsdinit died (signal %d, exit %d)orphaned traced processexit1increase kern.maxproc or NPROCforkmxforkulimidle/%ucreate_idle_lwp: error %d%s: WARNING: powerhook_establish is deprecated dopowerhooks %s: %s (%p) dopowerhooks: %s done softresumesoftsuspendsoftstandbykthrwaitunnamedWARNING: kthread `%s' (%d) exits with status %d kthread_exitcurcpu holds : %18d wanted by: %#018lx pserialize%s: %s caller=%pKernel locklwpplmaxlwpsigwaitvfork(zombie)lwp_exitswapperlink_set_evcntsWARNING: module error: Built-in module `%s' can't find built-in dependency `%s'Built-in module `%s' prerequisite `%s' failed, error %dBuilt-in module `%s' failed its MODULE_CMD_INIT, error %d%s: builtin module "%s" init failed: %dlink_set_modules`link_set_modules' section not present, error %d`link_set_modules' section wrong size (%zu different MODULE declarations?)`link_set_modules' section wrong size (got %zu, wanted %zu)DEBUG: module: TRUEFALSEUnload requested for `%s' (requires_force %s)Module `%s' not foundModule `%s' busy (%d refs)Cannot unload built-in secmodel module `%s'Could not unload module `%s' error=%dUnloaded module `%s'Requesting autounload for`%s'Module `%s' declined to be auto-unloaded error=%dmod_unld/stand/%s/%s/modulesBuilt-in `%s' failed: %d moduleautounload_unsafeautotimemodunload%s: %dModule `%s' pushed by boot loader already existsDuplicate bootlist entry for module `%s'Unable to load `%s' pushed by boot loader, error %dUnable to fetch_info for `%s' pushed by boot loader, error %dDependentRequestedUse -f to reinstate builtin module `%s'module_do_builtin() returned %d%s module `%s' already loadedOut of memory for `%s'module_load_vfs_vec() failed for `%s', error %dCannot fetch info for `%s', error %dModule name `%s' longer than %dModule `%s' has invalid class %dModule `%s' built for `%d', system `%d'Forced load, system may be unstableIncompatible module class %d for `%s' (wanted %d)Dependency name mismatch (`%s' != `%s')Module with name `%s' already loadedCircular dependency detected for `%s'Required module name `%s' longer than %dSelf-dependency detected for `%s'Recursive load failed for `%s' (`%s' required), error %dUnable to affix module `%s', error %dModule properties failed for %slink_set_sysctl_funcsmodcmd(CMD_INIT) failed for `%s', error %dRecursive load causes duplicate module `%s'Module `%s' loaded successfullyLoad failed, error %dAutoload for `%s' requested by pid %d (%s)Autoload disabled for `%s' Autoload illegal path for `%s' Autoload not authorized for `%s' Autoload for `%s' status %dmod_hookLoading module from %s%s/%s/%s.kmodCannot %sload kernel object `%s' error=%d.plistLoading plist from %splist load returned error %d for `%s'noautoloadautoloading is disallowed for `%s'kern.module.path=%s owner field : %#018lx wait/spin: %16d/%d locking against myselfMutexphysiodphysioDevices without power management support:%s: %s is suspended by %s (delegator %s) pmfsuspensortransition%s: %s-suspended by %s (delegator %s) already %s: %s assumes %s-suspension by %s (delegator %s) %s: newly %s-suspended by %s (delegator %s) resume failed %s: %s suspension %s (delegator %s) removed by %s classPowering devices:(failed)Shutting down devices: shutting down %s, skipped.failed.success.%s-self%s: suspend enter %s: class suspend %s: driver suspend %s: bus suspend %s: suspend exit Flushing disk caches: Suspending devices:%s: resume enter %s: bus resume %s: driver resume %s: class resume %s: resume exit Resuming devices:%s: PMF event %d dropped (no memory) %s: PMF event %d injected Input idle handler called pewplpmfeventcouldn't create pmfevent workqueuepmfsuspendcouldn't create pmfsuspend workqueuefailed to reserve PID 1 for init(8)procplexpose_addressproc2proc_args%s (pid %d) changing logname from %.*s to %s curprocpaxflagsrlimitcputimesofthardfilesizedatasizestacksizecoredumpsizememorylockeddescriptorssbsizevmemoryusestopforkstopexecstopexitcacheht_timeskim_intervalmin_catchtimesoftintskpreempt_prisched_enqueue: LWP %p has class %d owner/count : %#018lx flags : %#018x Reader / writer lock%s:%d: invoking "%s" (%s) crashme on %s failed! crashme plain old panic%s: locked once %s: locked twice %s: initialized %s: disabled kpreemption %s: raising ipl to %d %s: raised ipl to %d, s=%d crashme%s: failed to create sysctl debug.crashme: %d crashme_enable%s: failed to create sysctl debug.crashme_enable: %d %s: failed to create sysctl debug.crashme.%s %s: unable to remove %s from sysctl null_derefnull dereferencenull_jumpjump to nullmutex_recursionenter the same mutex twicespl_spinoutinfinite loop at raised splkpreempt_spinoutinfinite loop with kpreempt disabledsigactsksiginfotrapsignaleventswitchsorry, pid %d was killed: %s sigexit 1sigexit 2sendsig: bad version %d proc_stoptraceWARNING: softint_establish: table full, increase softint_bytes soft%s/%usoftint_init_isr: error %d%s block/%usoftint_init_cpu: cannot allocate memorybiosoftint_picklwpwedge:NAME=parsediskuse one of: %s[a-%c] none halt reboot %s%lluswap dumps on %smd0 (default %sdump device (default %sb)file system (default %s): use one of: genericroot on %scan't determine root device unknown device major 0x%llx device %s (0x%llx) not configured sched_unsleeplboltkpreemptdefer: critical sectiondefer: kernel_lockWARNING: lwp %ld (%s%s%s) flags 0x%x: timecounter went backwards from (%jd + 0x%016llx/2^64) sec to (%jd + 0x%016llx/2^64) sec in %s setrunnable: lwp %p state was %dWARNING: lwp %ld (%s%s%s): negative runtime: (%jd + 0x%016llx/2^64) sec WARNING: pid %ld (%s): negative runtime; monotonic clock has gone backwards pid %d, command %s, is killed: %s exceeded RLIMIT_CPU/usr/src/sys/kern/kern_sysctl.cp->sysctl_child == NULLsysctl_create: rnode %p wrong version sysctl_create: attempt to add node to aliased node %p sysctl_destroy: rnode %p wrong version %s: rnode %p wrong version sysctl_query: rnode %p wrong version sysctl_locate: pnode %p wrong version sysctl_dispatch: rnode %p wrong version sysctl_mmap: rnode %p wrong version sysctl_createv: rnode NULL sysctl_createv: sysctl_locate(%s) returned %d sysctl: log %p root mismatch (%p) sysctl_create succeeded but node not found?! sysctl_createv: sysctl_create(%s) returned %d sysctl_free: rnode %p wrong version root %p left %d size %d content len %d: end !!SYSCTL_NEEDFUNC!! timecounterchoicehardwaretimestepwarnings%s%s(q=%d, f=%lld Hz)timecounter: Timecounter "%s" frequency %ju Hz -- Insufficient hz, needs at least %u timecounter: Timecounter "%s" frequency %ju Hz quality %d tcdetachTime stepped from %lld.%09ld to %lld.%09ld timecounter: Timecounters tick every %d.%03u msec dummythreadpoolidle_msthreadpool job %p ran after destructionpooljobpoolthread%sthrdplcrpooldisppooldisp%sthplthrddeadjobnanoslppid %d attempted to set the (obsolete) kernel time zone calloutcallout_init_cpu (2)late/%uwait/%uturnstile_unsleepdevice-is-system-todrdisabled (not system TODR) todr_attach: TOD already configured WARNING: preposterous time in file system %s: cannot enable TODR writes %s: WARNING: cannot disable TODR writes WARNING: preposterous TOD clock time WARNING: no TOD clock present WARNING: clock lost %lld days WARNING: clock gained %lld days WARNING: using default initial time WARNING: using filesystem time WARNING: CHECK AND RESET THE DATE! Cannot set TOD clock time WARNING: Cannot set TOD clock time (busy) uihashuser info (uid->used proc) hashuidinfoproccntlwpcntlockcntsemcnt%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02xrtts%s: invalid tag (%u) acl_posix1e_mode_to_entry: invalid tag (%d) acl_posix1e_acl_to_mode: bad ae_tagacl_posix1e_acl_to_mode: missing base ae_tagsconfigure: `%s' driver %s failed: %dconfigure: attachment `%s' of `%s' driver %s failed: %d%s with registered handlerscfargs_canonicalize: unknown version %lu cfargs_canonicalize: submatch and search are mutually-exclusivedevice-attachdevice-detachlocationev: %s %s at %s in [%s] cfgmiscautoconfdetachallconfigintrconfigroot%s: thread %x joined with error %d config_devalloc: device name too longpmfsuspdevice-driverdevice-unitdevice-parentattribute-nameloc-namelocatorsinterface-attributesconfig_defer: can't defer config of a root deviceWARNING: power management not supported waiting for devices: done. WARNING: %d error%s while detecting hardware; check system log. config_attach: allocation of device softc failedFound %s (root)%s at %sdevice-registerconfig_detach: forced detach of %s failed (%d)root device %s not configured detaching %s, unable to detach instance init rollbackfinifini rollback unsupported blist_meta_alloc: allocation too largeblist_meta_fill: allocation too largeblst_meta_fill: filling unexpected rangeblst_radix_free: freeing free blockblst_meta_free: freeing already free blocks (%llu) %llu/%llublst_meta_free: freeing unexpected rangebufqstrategiesbufq_alloc: sort out of rangebufq_bufq_alloc: no strategycallbacknist_hash_drbg_instantiatecprng_strong reseednist_hash_drbg_destroynist_hash_drbg_reseedNIST Hash_DRBG failed self-testurandomarandomnist_hash_drbg_generateslowfastcpu_topology_init: asymmetric & SMT?? pkg1st%s has %d %s siblings: GAVE UP%s first in package: %s ureadc: non-positive residureadc: non-positive iovcntdevice-get-propertydevice-enumerate-childrendevsw%s: block majors exhausted %s: character majors exhausted writ%s%d%c: %s %sing fsbn %lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)no raw partition and disk reports bad geometryno raw partition and partition table is fullsectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectordisk-info%s: can't alloc vnode for %s%s: can't open dev %s (%d) %s%d%cevcnt/dev/nullset{u,g}id pid %d (%s) was invoked by uid %d ppid %d (%s) with fd %s closed extent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags = 0x%x 0x%lx - 0x%lx extent_free: start 0x%lx, end 0x%lx extent_free: region not foundhashdone: invalid table typehashstat KMGTPE kMGTPE%qu%s%c%snointrdisknamesiostatnamesiostatsiostat_free: iostat_count == 0ipiWARNING: ipi_register: table full, increase IPI_MAXREG kcpuset(9): all early-use entries exhausted; increase KC_SAVE_NITEMS kmem-02048kmem-04096kmem-08192kmem-16384kmem-00008kmem-00016kmem-00024kmem-00032kmem-00040kmem-00048kmem-00056kmem-00064kmem-00080kmem-00096kmem-00112kmem-00128kmem-00160kmem-00192kmem-00224kmem-00256kmem-00320kmem-00384kmem-00448kmem-00512kmem-00768kmem-01024not modular%#018lx%s error: %s,%zu: %s lock address : %s current cpu : %18d current lwp : %#018lx lock error: %s: %s,%zu: %s: lock %p cpu %d lwp %pklogmsgbufsizemsgbufrunoncepercpupool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) %s: [%s] item %p not part of pool%s: [%s] item %p below item space%s: [%s] item %p poolid %u != %u page %p, nmissing %d, time %u %s: [%s] ph %p poolid %u != %upool item size %zu too large, use a custom allocator%s: [%s] too large itemsperpage(%d) for PR_USEBMAPpoolbusyphpool-%dpcgnormalpcglargepcachepcachecpu%s: [%s] page empty%s: [%s] page header missing%s: [%s] %u >= %u%s: [%s] %p already freedMust specify a pool to print. POOLCACHEPOOL %s:%p:%u:%u:%u:%u:%u:%u:%u:%u:%u:%u:%zu %s: itemsize %u, totalmem %zu align %u, ioff %u, roflags 0x%08x pool %p, alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p cpu layer hits %llu misses %llu cache layer hits %llu misses %llu cache layer full groups %u full cache groups: group %p: avail %d %p, 0x%llx %p (null)[% 4jd.%.*ld] %s: table is full - %s %s: table is full Skipping crash dump on recursive panic panic: autoconfiguration error: mismatching pserialize_read_exit()exclusive accessspecificdata_domain_delete: not implementedspecificdata_setspecificbtallocvmem%s-%zuvmem-vavmem-metavmembtvmem_sizevmem_rehash%s: workqueue_create %d static_bt_inusestatic_bt_countInvalid IPL: %dxclowxchighcrosscallunicastxcallxcall/%uposix_aioaio_listio_maxaio_maxaioserviceaio_%d_%zuaio_jobs_poolaio_lio_poolaiodone%s: invalid operation code {%x}naio_process: invalid aiost state {%x} efdreadefdwriteeventfdfqabortfutexinvalid futex opWARNING: pid %jd (%s) lwp %jd: unmapped robust futex list head WARNING: pid %jd (%s) lwp %jd: exhausted robust futex limit sys_ioctl: _IO%s%s('%c', %lu, %lu) returned -1: pid=%d comm=%s memfdcompat_80posix_msgmqueuemq_open_maxmq_prio_maxmq_max_msgsizemq_def_maxmsgmq_max_maxmsgmqmsgplmqsendcvmqrecvcvmqparkedpsetpsets_max%d:1,%d:2direct_selectcompat_16posix_schedpri_minpri_maxsockettfdreadtimerfdttyrub: would panic c = %d, val = %d found only zombie processes not a controlling terminal no foreground process group empty foreground process group load: %d.%02d cmd: %s %d [%#lx/%d%ld.%02ldu %ld.%02lds %d%% %ldkttypausettyrawttyrawfttycanttycanfttyoutttyoutfttyreftkstatnincanccrawccqsizecompat_60compat_43ttyldisc_init: termios_discttyldisc_init: ntty_disctermiosnttytabletslippppstriphdlcincrease kern.maxptysputc: required clalloc b_to_q: required clalloc accfaccf_seqpacketdgram%s: source too long, %d < %d bytesunix: inet: inet6: link: atalk: (unknown socket family %d)bad family %hhumbuf %p already freedmsizemclbytesnmbclustersmblowatmcllowatnmbclusters_limitmbplmclplm_copydata: off %d, len %dm_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d)m_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d), len=%d (%d)%s: len > MHLEN%s: off %d, len %d%s: m == NULL, off %d%s: m == NULL, len %d [!COPYALL]%s: no header (m = %p)unixpsemposixsemmaxksemsomaxkvasofixedbufsbmaxsooptionssokvasopendfrbad initial sb_max value: %lusopendfreesoinit1 %dnetiosbappendaddrsbappendaddrchainsbappendcontrolsemi-panic: sbcompress sbdrop(%p,%d): cc=%lu%s: message too large %d mbsonamembcontrolmsghdrmbfreembdatambheadermbsoptsmbftablemboobdataunp_disconnect1uipc 1uipc 2unp_attachunp_connect1unp_threadinflightdeferredunpgcuipc_init %duipc_usrrequipc 4buf mem pool index %dbufhashbuffer hashforcing bufcache %d -> 5forcing bufcache %d -> 95needbufbufinit: cannot allocate submapbufplbioplbuf%ukbuf%ubbufcachebufmembufmem_lowaterbufmem_hiwaterbufinit2: can't establish soft interruptbiolockbiowaitbiodone2 alreadynamecachenamecache_statsncpurgedirhpldirhepldirhashmemusedmaxmemdirhash_remove couldn't find entry in hash table vfs_op_descsoperation %s not listed in %s. vfs_opv_init: bad operationvfs_opv_init: operation vector without vop_defaultfstypesmagiclinkstimestamp_precisionlf_findoverlap: defaultchrooted pid %d uid %d (%s) detected outside of its chroot /../zauruskernel_identruidrgidInvalid nameiop relookup: null namerelookup: lookup on dot-dotnamei_simple_convert_flags: bogus sflags %s: failed to start extattr: error = %d syncing disks... vfs_mountroot: root device unknownvfs_mountroot: rootdev set for DV_IFNET (0x%llx -> %llu,%llu)vfs_mountroot: rootdev not set for DV_DISKvfs_mountroot: can't get vnode for rootdevvfs_mountroot: can't open root device %s: inappropriate for root file system root file system type: %s WARNING: No file system modules have been loaded. Supported file systems:no file system for %s (dev 0x%llx)cannot find root vnode, error=%dmount: lost mountUnmounting fresh file system faileddanglingunmount: dangling vnodeforcefully %sunmounted %s on %s type %s unmount of %s failed with error %d unmounting done WARNING: some file systems would not unmount unmounting file systems... filedelaydirdelaymetadelayinvalid specnode type: %dILLEGALvnode %p flags %s %stag %s(%d) type %s(%d) mount %p typedata %p %susecount %d writecount %d holdcount %d %ssize %llx writesize %llx numoutput %d %sdata %p lock %p %sstate %s key(%p %zd)%slrulisthd %p ROOTSYSTEMISTTYMAPPEDMPSAFE TEXT EXECMAP WRMAP PAGESONWORKLSTDEADCHECKDIROPvflushbuf: not dirty, bp %pvflushbuf: dirtyACTIVEMARKERLOADINGLOADEDBLOCKEDRECLAIMINGRECLAIMEDVNONVREGVDIRVCHRVLNKVSOCKVFIFOVBADVT_UFSVT_NFSVT_MFSVT_MSDOSFSVT_LFSVT_LOFSVT_FDESCVT_PORTALVT_NULLVT_UMAPVT_KERNFSVT_PROCFSVT_AFSVT_ISOFSVT_UNIONVT_ADOSFSVT_EXT2FSVT_CODAVT_FILECOREVT_NTFSVT_VFSVT_OVERLAYVT_SMBFSVT_PTYFSVT_TMPFSVT_UDFVT_SYSVBFSVT_PUFFSVT_HFSVT_EFSVT_ZFSVT_RUMPVT_NILFSVT_V7FSVT_CHFSVT_AUTOFSsymlink-target%s: failed to start extattr, error = %d%s: failed to stop extattr, error = %dsyncwaitfdesckernfsafsfstchgfstcntfstlwpvnfullvcachevnode cache hash%s: cannot reclaimdead but not clean%s: bad ref countvcacheplvdrainvrele%s: holdcnt vp %p%s: cannot lock%s: neg numoutput, vp %pxattr-listsystem.user.security.trusted.xattr-namexattr-valvop_setextattrvop_deleteextattrvop_openextattrvop_listextattrvop_getextattrvop_closeextattrvop_aclcheckvop_setaclvop_getaclvop_putpagesvop_getpagesvop_whiteoutvop_advlockvop_pathconfvop_islockedvop_printvop_strategyvop_bmapvop_unlockvop_lockvop_reclaimvop_inactivevop_abortopvop_readlinkvop_readdirvop_symlinkvop_rmdirvop_mkdirvop_renamevop_linkvop_removevop_seekvop_fsyncvop_mmapvop_revokevop_kqfiltervop_pollvop_fcntlvop_ioctlvop_fdiscardvop_fallocatevop_writevop_readvop_setattrvop_getattrvop_accessxvop_accessvop_closevop_openvop_mknodvop_createvop_lookupvop_parsepathvop_bwritedead fs operation useddeadtag VT_NON, dead vnode fifordfifowrtag VT_NON, fifo with %d readers and %d writers/usr/src/sys/miscfs/genfs/genfs_io.cgenput%s: bogus command %dgenfs: bad op%s: ACL_OTHER missing layerfs tag VT_LAYERFS, vp=%p, lowervp=%p spec_fdiscard: not a device dev %llu, %llu spec_close: spurious pgrp refspec_close: not specialspec_write typespec_read typeinvalid specfs vnode type: %dspec_ioctlspeciofictitiousdefault labelWARNING: %s: total unit size in disklabel (%llu) != the size of %s (%llu) %s: %llu trailing sectors not covered by disklabel WARNING: %s: end of partition `%c' exceeds the size of %s (%llu) %s at %s (%s) deleted raidframecgd%s: blkno (%llu) + size / DEV_BSIZE (%zu) > p_size (%llu) %s%u: unable to attach pseudo-device %s at %s: "%s", %llu blocks at %lld, type: %s WARNING: double match for wedge name %s (%s, %s) wedge:%sdkwedge: unable to attach cfdriverdkwedge: unable to attach cfattachdk-method-%s: method "%s" already exists at priority %d %s: unable to compute pdev, error = %d %s: unable to find vnode for pdev, error = %d %s: unable to lock vnode for pdev, error = %d %s: unable to open device, error = %d %s: unable to close device, error = %d WARNING: double match for boot wedge (%s, %s) %s: WARNING: clamping number of blocks to 512 (was %u) APPLE_UNIX_SVR2APPLE_HFS%s: wedge named '%s' already exists, manual intervention required %s: error %d adding partition %s type %s APPLEsysvhfs%s: GPT GUID: %s %s: bogus GPT entry size: %u %s: WARNING: clamping number of GPT entries to 512 (was %u) %s: GPT block numbers out of range %s: unable to read GPT partition array, error = %d %s: bad GPT partition array CRC %s: wedge named '%s' already existed, using '%s' %s: error %d adding entry %u (%s), type %s GPTccdvmkcorevmfsvmwresvntfsext2fszfsmdidle%s: cfattach_attach failed /dev/randombpfmaxbufsizepeers%s: softint_establish() failed%s: no bpf_if found for %sbpf_mcpybpf_change_type%s: bpf_setdlt: ifpromisc failed (%d) bpf_filterbpfops%.*s/%hhu#link#%huif_%s: watchdog triggered ifnetifaiflnkstifwdogsdl%s: could not attach sysctl nodes sndqmaxlendrops%s: could not attach sysctl watchdog nodes watchdogtriggerrcvqif_detach: WARNING: AF %d not purged DOWN%s: lost link state change %s %s-lshktoo many interfaces%s: recursively called too many times(%d) %s: m_tag_get() failed, recursion calls are not prevented. invalid argument to %sinvalid ifnet multicast command: 0x%lxlocal-mac-addressThe multicast bit is set in the MAC address. It's wrong. %s-ether_ifdetachhooks33etherrps_hash%s: invalid ifp (sdl_index %d) llentrypllooutput: no header mbufif_looploifmedia_set: no match for 0x%x/0x%x ifmedia_set failed%s: invalid timer type pfilpktqsyncpktqrenqifqcurcputoeplitztoeplitz-othercpusMask for route not entered rn_addmask: mask impossibly already in tree Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: Orphaned Mask %p at %p rn_delete: couldn't find us radix already initializedrn_initrn_init 2delayed rn_inithead failedraw_usrreqrt_timer_timer: rtq_count reached 0 rtentryrt_freert_updatertentplrttmrplrt_timerrt_timer_queue_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 %s: unable to delete rtentry @ %p, error = %d %s: %s: can't handle af%hhd (%s) mZV%[Ag%=C+ˮ{0w-0 jB;rtfree 2route_purgeifroute_abortroute_accept%s: queue full, dropped message %s: unknown command %drtableroutend_delaynd_bmaxtriesnd_umaxtriesnd_reachablend_retransnd_nudnd_maxnudhintlog_movementslog_permanent_modifylog_wrong_iface%s: source can't be determined: dst=%s %s: %s not ready %s: called with non-tentative address %s(%s) %s: memory allocation failed for %s(%s) %s: called with duplicate address %s(%s) %s: %s: ARP announcement complete for %s %s: arp_setgate failed %s: bad gateway value %s: failed to %s llentry for %s on %s arp from %s: addr len: new %d, i/f %d (ignored) %s: arp: link address is broadcast for IP address %s! duplicate IP address %s sent from link address %s %s: DAD defended address %s from %s %s: DAD ignoring duplicate address %s from %s %s: DAD defence failed for %s from %s %s tried to overwrite permanent arp info for %s %s on %s tried to overwrite arp info for %s on %s arp info overwritten for %s by %s arpintrrevarp%s: mbuf %d too short for IP header %zu%s: offset %d too short for IP header %zuencapelemip_encap cv%s_wqinput%s: could not create a sysctl node for %s inputqgpiobus at %sis-rootmodelsTraditional NetBSD: Superuserorg.netbsd.secmodel.susersuser_modcmd::init: secmodel_register returned %d suser_modcmd::fini: secmodel_deregister returned %d is-securelevel-aboveTraditional NetBSD: Securelevelorg.netbsd.secmodel.securelevelsecurelevel_modcmd::init: secmodel_register returned %d securelevel_modcmd::fini: secmodel_deregister returned %d curtainTraditional NetBSD: Extensionsuser_set_cpu_affinityorg.netbsd.secmodel.extensionsextensions_modcmd::init: secmodel_register returned %d extensions_modcmd::fini: secmodel_deregister returned %d usermounthardlink_check_uidhardlink_check_gidTraditional NetBSD: 4.4BSDorg.netbsd.secmodel.bsd44secmodel_bsd44_modcmd::init: secmodel_register returned %d secmodel_bsd44_modcmd::fini: secmodel_deregister returned %d secmodel_bsd44suser,securelevel,extensionsfssptmdrvctltapveriexecfwucycomutoppybthubamrlockstatputtersrtdrmaltmemtwacpuctlpadtprofisvvideohdaudiouhsorumpblknpfdtviscsitpmmfiseepromdtracespiflashluaspkrhdmicecnvmeqemufwcfgautofsgpioppsnvmmkcovspiipmivhcivio9pwwancacpismbiosefisht3xtempscmdviocongpioirqumcpmioemcfancttyphysconptcqmsofconstunvidcconsoleopmsiplofromscrfcomjoymidisequencervcodawsdisplaywsmouseusbuhidulptscsibusraidugenucomopenfirmbiconsdevsacommlywsfontagppciiopaltqmlxplcomclockctlirframecirradiokttcpixpcomdmoveriosscomksymsepcomtslcdtwewdcpxapcicpxamcisdmmcbuspcmciabuswsemuldisplaydevwskbddevapmdevifdrivechannelgpiobuskbdmuxcontrollerindexdackintrbase%s: %zu bytes @ %p unusedv6v7v71kv8otherhpfsadosfilecorejfs2vinumudfsysvbfsefsnilfsminixfs3stringpropstng%lliintegerpropnmbr%s: invalid base %d?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRtunneldeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"0xaddress:%s: getifaddrs%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLANvlanif vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersaveSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNELSIOCS80211hidessidsocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)IEEE80211_IOC_FRAGTHRESHOLDrtsIEEE80211_IOC_RTSTHRESHOLD RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHAN%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %s%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsWARNING: -G may create file systems which cause kernel panics formatsector size `%s' is not a power of 2.fragment sizeunknown gname %sexpected files per directorybytes per inodefree space %number of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imagebecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%dstatvfs %s%s: mount: %sabnormal termination-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount pointrdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sshutdown~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d ./canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! add%s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / xitverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s cannot create file: %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumes%s%dSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s char%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptysystemwarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s LEAFbad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d writeL%d %d I%d %d ioctlatalkchangeexpirehosthopcountinet6lockrestnetnostaticproto1proto2recvpiperttrttvarsasendpipeshowssthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxyprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinleavemichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorSO_RERRORCannot allocate memoryassuming route to ifold usage of trailing 0%s, %sassuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u/%d%u.%u/%d%u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswdppriority=nfsmntpt=blkempty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponat:usage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s-f%s: execvp%s: unknown mode. TYPE %s %sTYPE %sContinue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciitenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20241129NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsSHELLCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD %sMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxypromptrpromptsslnoverifyaccountbellbyecdupdisconnecteditepsvepsv4epsv6featuresfgetformgateidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspagepassivepdirplspmlsdquoterecvregetremoptsrenameresetrestartrhelprmdirrstatusruniquesendportsitestructsuniquethrottletraceusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]:%u Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'URLInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. %c%c%c421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Can't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. Reading `%s'Writing to networkreceivedCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy cC%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgatehttpFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %s-TBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymous@FTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled - %02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384)%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread commandbranch%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru"%s" ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv disconnecting...unknown ACU typecall failedcan't open phone number fileunrecognizable host namemissing phone number call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! timed out at eol chars transferred in can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedescapephonelinehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filebrdu%s: missing device spec%s: missing phone numberraecbetbdchfesprrcdletdvcmcuiepndiexpausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.zeroone%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecremotescripttabexpandtabverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechoparhardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234RINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgidsetuid-i/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdmbrgptre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. untitledWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitMBRGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)noautoZeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesAllSomeNoneokOnOffunchangedDelete?installreinstall sets forupgradeNetBSD/zaurus 11.99.3 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"headsmount point (or '-')cylsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6StartEndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.3 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.3 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.3 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.3 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.99.3 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.99.3 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCylindersSectorsInstall fromFTPHTTPHTTPSNFSCD-ROM / DVDFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackSendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESNODONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelUUIDGPT TypeBootUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): Kernel (GENERIC)Kernel (C700)KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalogLC_CTYPErelease11.99.3zaurusxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orghttp hostnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/zaurus/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/zaurus/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X.old%s%s%s%s%s%s%s%s%s%s%s/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failed executing: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]tmpfsinvalid%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)-t xx -o /usr/src/usr.sbin/sysinst/arch/zaurus/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 %s /tmp mfs rw,-s=%llu swap /tmp mfs rw,-s=%llu /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s-rprogress -f %s -b 1m dd bs=1m of=%sdkxbdcd*fd*udf%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001%s%c/sbin/mount -rt cd9660 /dev/%s /mnt2/dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/TZ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %scp %s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigdkctl%s/%s%srm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICkern-C700base32gamesgpufwmanhtmlrescueteststextxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %sFATNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /dev/r%saNetBSD11/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdmraidframe/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/zaurus/../../disklabel.c:547: internal error/dev/%s%cr%s%c%s (%u)fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s %*s %s. %sUser answered no to destroy other data, aborting. %s [%s %s]%llu%s (%llu)%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%dK%-20s: %d%dM%s: %u %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %sraid%dvnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2d/%s%*s %spartmanlvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c -n %s --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dmkdir -p %s dd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (%s, %s) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedgesgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%lliStart:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1153: internal errorgpt -rq header %sgpt -r show -a %s 2>/dev/nullPri GPT tableSec GPT tableSec GPT headerv7sysvv71kv8otherhpfsadoshfsfilecorentfsjfs2appleufsefsnilfsminixfs3vmkcorevmfsvmwresvzfswindowsefibioslinux-dataapplevmcorevmreseredbiosbootbootmebootoncebootfailednoblockio%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxApple HFSapple-ufsBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD dataVMware VMkernel core dumpVMware reservedsifive-bblSiFive BBL/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2068: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1774: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2194: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2199: internal errorNetBSDWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDOpenBSDLinux nativeNTFS volume setPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitiontc/etc/group: /etc/master.passwd: (malloc) Error in munmap(): JjPUPuVvXZ ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumalphablankcntrldigitgraphlowerprintpunctupperxdigit%s%s%s 646towlowertowupperASCII/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbinA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number%m[:<:]][:>:]]NULSOHSTXETXEOTENQACKBELalertBSbackspaceHTLFVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d QYm"S$9+g_1058DP::1<==@)AEEHJJĚJʚMԚRښSebef!jcMpErvi{ f}{{b{{{Ɵ)  ' ,!4!ߎ=ůfB9FJYOYUY\mbmhlcmt~S.=e @@  U @@  E q )  5  @@t  @@$ unblock and -DNO_CONV?hD 821100 0Usage: %s [-] [-ESsx] [-p string] [name] usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp--mv/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverwrite %s? override %s%s%s/%s for %s? %s -> %s rename %s to %scan't remove %s%s => %s %llu/%llu bytes %d%% written %s: remove%s: error copying extended attributes%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too longusage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failedfts_read%s: is a directory/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidprimaryCan't read %s partition table%s partition table invalid, no magic in sector %llddecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOF gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1reallocarrOutside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyMalloc failedDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld DIOCWLABELCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionunknownPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s/%s%s: bootcode too large%s: bootcode too small%s: invalid magicInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %scannot open %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tablefatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console-sh/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbin/bin/shcan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedrootsetlogin() failed/dev-MMMAKEDEV exit status %dUnable to run MAKEDEV%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node realpath `%s'getargsrwuniongetmntinfopuffs|%s on %s type %.*s: %s already mountedroupdatemount_puffsrumprump_%smount_%s-oexec:Cannot create pipeCannot open fd to mount programexec %s for %sexec %s for %s: %sstatvfs %s%s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llu, [%s: %s]nfsOnly one -t option may be specified.Aadfo:rwt:uvrqnoautofrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@cannot open `%s'/usr/sbinasynchronousautomountednfs4aclsposix1eaclsdiscardextattrhiddennoatimenocoredumpnodevnodevmtimenoexecnosuidrelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mapping/posix1e ACLSnon-reserved portsWebNFS exportslocalwith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsv7fsmsdoscd9660adosfilecoreext2fsntfsudfsysvbfsefsnilfszfsstrdupmallocusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xmalloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular filegunzipgzcatusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREmoreVISUALEDITORviLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memory<%s>LESS_TERMCAP_%s$<liLESS_LINEScoLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000l LESS_TERMCAP_DEBUGhcxndadbNRpc@8MOUSE_STARTMOUSE_ENDticlcmsovbbc|^crsr[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE/dev/null.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) #[Press 'h' for instructions.]& There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARSLESSMETAESCAPE%c%s%cSHELL-c%s%s%slessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completedownexpandforw-completehomeinsertkill-lineabortliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdebugdigitdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %s*s>rscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columns%d,%dheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifttildequotesmax-forw-scrollno-inittabshilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileTag not found/dev/ttyusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe%3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d: %02d:%02d ETAKiBMiBGiBTiBPiBEiB-%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host sendmsgping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) ...nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu \%03o --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmap??? truncated no address %s(TTL=infty)(TTL=%u)refusedunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> SuccessRefusedUnknownIPv6 addressIPv4 address.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interfaceSTOP%s: waiting for an %s addressexiting due to oneshottimed out%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dkillwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPv4IPv6/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid%s: hardware address randomised to %sgetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltuuidnoneptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typebyteunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatestabletemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentoption requires an argument -- %s%s: embedded config too bigprofilearpingscriptreconfigurereleaseleasetimerebindpersistentinforminform6timeoutvsiovsio6waitipallowinterfacesrebootnoarpnobackgroundnohooklastleasenogatewayxidhwaddrbroadcastnolinknoipv4llrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslog(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %saddingchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)pid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletinglink#%d - %s %s_%s/usr/bin:/usr/sbin:/bin:/sbinfalsePATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuerastatic6reasonifcarrierifmetricifwirelessifflagsinterface_order(none)localhostlocalhost. embed index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string uri rfc3361 rfc3442 request norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zulo0%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)%s: SIOCGIFALIASbridgeepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not found%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseviaNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink    ,E=ZQf# _^F<>?PATH= t$fyds$cml r p&.n:v B4b    EOF reading here (<<) documentmy HNSX[a iheOV>}-+?=..2@8BHNTZak@abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'! 0H 14 1CFO  &, @Z`ipx@@  @ AXQ @618 #$3,#23;2:3@3F#'7hy " > B H P V \ b h n v  ~      w    H wP Z d n v      !         w        * : > B H P V \ b h n v  ~      w    H wP Z d n v      !         w        * : 5֚<Ov   A ] <ڜ'L`u ۝!#$&1234568#9)90:I;c<=@ABC$DKEaFvGvHvJLMNOџPQRS"T+U3VKWe\oacdϠefghipqstu5vw;xOk|šҡ)IeҢ 3OgʣУ )1>"Hk~ͤߤ"/A[k,Ia$?Z6IyШB[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]L\ &\ H wP Z d n v      !         w        * : returning to single-user after filesystem check returning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblockBBBA        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?in_addr_flagsin_statuscommit_address778setifprefixlensetifdstormasksetifbroadaddrclone_commandusagestatus?Rprintallmainzi@yih6@h8(8P6Ȳ[?|88 @E3h>Ա@3h@@@U3h@U3h@@@@A AA&A@2A>AJARA [A0dA@mAvA{AAAA AA A@?Rinit_current_mediaACGLCACWC^CfC?media_statusmedia_constructor C)CA,B02C)CA,B0A)CA)Cܳ8C)C8C C7C)CBA)C`LCfC ACfC`mCuC@mCuCLCfCWC^Cpaddr_matchEMIMqIM;J'NGDMCMCsettunnelDmPhxDprint_link_addressessetvlansetvlanif^E@EE$EEVțsetifssidsetifnwkeysetifbssidJKMKPKSKyKȵxK9_hKKKm_h HP H H`* h <K0KK^hHKH1a* hzK0RFKi|H|HI`GGi`FFXinvalid major numberinvalid minor numbertoo many fields for formatffs@ ®ɮѮܮ@'  V1>Te @̯گ@+0i6=BKRW[cgmbnorripbgensbextattbnojolietbnocasetransbrrcaseinsNN fNNNN NN NNO@ OOO!O+O/O4O;O NN fNNNN NN NN>P GP2@SPZP`P@jPpPn[O@xPtbshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirrorNN fNNNN NN NN2@O@bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacNN fNNNN NN NNjPO@SSXS S@SSSSSSS r@`RfRlRSuRRR R@recvrpcrpc_getportrpc_callsendrecv%s: can't read disk label; disk type must be specified%s partition type is not `%s'9ZgZZZ[j[[[[[\"\B\x\\\\\ ]@]r]]]]^WTWTbSS DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY!4Mz -Mmˏ;eMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATING0123456789abcdefUGHRBD M@dmCLS1@2plbhw.disknamesشț:>BFJN***************************************************************************************************************************************************************************************************************************************NetBSD gzip 20240203  " $#!%Z^\`[_]aŵŵ: SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data;i"\ LLL#LL:#Mț8# Mț|#M!M#2MM[#pNxNZ#NN[#NFY#Nțw#Nțv#N#M#N>M#Nț#NO#OF# Oț#,Oț#collectVQYRQ:YFYNAME=&\f_L\H wP Z d n v      !         w        * : >    "#$%   "#$%    "#$%&'()*+.  }"e1Lcs H wP Z d n v      !         w        * : ghx4q==?-<?97>[8 :Y7-7HA<A;938?DF3GC858777H wP Z d n v      !         w        * : P----------------------------------- - --------------------   "#$%@//tmp/usr/var@# #|#\#VvvvvvvW Details for index GPT part - H wWuuuu &\uu!vv vvk v vwf_8\)v-v 3v;hvLw|nQn- q+Wwcw|nQn- q+rw|w|nQn- q+ww|nQn- q+ww|nQn- q+Rv: =rGy=iG}rvw;Mt?wwmWC 3KOOwwyD<#*=(wxYbBRuoqr xx3Dh&`v(x\ M}-;xLx@Mjy֬]xnx-чH x-чH xZIчH xIчHxIчHwx2IчHwxL6 %?axxS'@ )Ѹvy*1@ )ѸDv 1x )Ѹv yST.qBHo6֯i0y?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~~G~~R~X~^~d~j~p~v~|~~ x@~~cs_path~X bc_base_maxț bc_dim_maxț bc_scale_maxț bc_string_maxț coll_weights_maxț expr_nest_max ț line_maxț  re_dup_maxț  posix2_version ț  posix2_c_bindț  posix2_c_devț  posix2_char_termț posix2_fort_devț posix2_fort_runț posix2_localedefț posix2_sw_devț posix2_upeț stream_maxț tzname_maxț atexit_maxțR~7X~|8^~ 9d~9j~h:p~ ;v~;|~T<~<x=~@>~> B 1 -o %s: option not supported`]ZWTQNKHEB?<96 0-*'$!c3 d38- sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU HeNKmakech    #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef'++9L.DDα;15MS7) x;l%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9,1nn|:pZnF$n31RLHD@;75+)++#+/'++ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>ca'''''''''''''''''''''''''''gm''aj'''''X'X'''dspbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %Ktr`+NbP>r`G 2)9'=tr`+NbP>r`G 2)9'= 0C0,8M(*w\m:j kP`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     @@ !1Aa  0@`M #+3;CScs inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_cstringprop_string_create_nocopyprop_string_create_formatprop_string_append_cstring_prop_number_externalize_prop_number_alloc2;85_prop_xml_intern_find_tag_prop_intern_decode_string_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dict_keysym_put_prop_dict_keysym_allocprop_dictionary_set_prop_dictionary_iterator_reset_locked_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equals_prop_dictionary_internalize_continue_prop_dictionary_remove6_prop_data_externalizeABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_equalsprop_data_data_prop_data_internalizetruefalse_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_removeprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_extern_append_char_prop_extern_append_encoded_cstring_prop_extern_append_start_tag_prop_extern_append_end_tag_prop_extern_append_empty_tag _prop_stack_push_prop_stack_pop_tcsetpgrp_tcgetpgrp_tcflush_tcdrain_cfsetospeed_cfsetispeed_cfmakeraw_cfgetospeed_cfgetispeedstrmode_unsetenv_int_strtouq_l_int__strtoull_l_int__strtou_l ` F g n t__strsuftollxpermute_args_getopt_longgetopt_internalunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s_getoptatolatofmemstream_seeksetbuffersetlinebufsetbufmkdtempfwidefsetposfpurgefgetposfgetc_regerror_inet6_rthdr_init_inet6_rthdr_add_inet6_rthdr_lasthop_inet6_rthdr_segments_inet6_rthdr_getaddr_inet6_rthdr_getflags_inet6_rth_init_inet6_rth_add_inet6_rth_reverse_inet6_rth_segments_inet6_rth_getaddrip6optleninet6_insert_padopt_inet6_option_space_inet6_option_init_inet6_option_append_inet6_option_alloc_inet6_option_next_inet6_option_find_inet6_opt_append__icheckhost__gethostlooprshrcmdrresvport_af_addrrresvportresrcmdorcmd_afrcmd_af__ivaliduser_sairuserok_saruseroklink_addr0123456789abcdef_ether_ntoa_ether_aton_ether_line %x:%x:%x:%x:%x:%x %256s _ether_ntohost_ether_hostton_MD5End0123456789abcdef_MD5File_MD5Data_SHA1End0123456789abcdef_SHA1Data_SHA1Transform_SHA1Init_SHA1Update_SHA1Final_RMD160End0123456789abcdef_RMD160Data_uname_ttyname_r_times   +(&_DB?\\\addcmd_getmodecompress_mode_sethostname_popenpopenve_pclose_initgroupskMGTPEBKMGTPEKMGTPEBkMGTPEhumanize_numbermatchcompareglobextendg_Ctocg_lstatglob3g_opendirglob2g_statglob0globtildeglobexp2globexp1_glob_globfree_getpassfd_getmntinfo##: _getfsspec_getfsfilefnmatchxgettype_getdiskbynamecreatTLS allocation failed, terminating <Q5vf9.z4 }Q5H@5UCmm};Zx0Nm<[y1OnSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec_tcsetattrwcscmp_stresep_setenv_vdprintf_lsetvbuf_regfree_inet_networkCof\$u0LDD????????J^YaTO|wrmhcG unvisAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~fts_pallocfts_sortfts_statfts_allocfts_build_fts_openfts_maxarglen_fts_close_fts_read_fts_set_fts_children_closedir  khwcschr_strcoll_l_int__strtoumax_l_opendir_initdir_alphasortinsertionsort_mergesort_rsetup_seekdir_unlocked_getdomainname @_strncasecmp_initstate_setstate?getenv_getenv_r__freeenvvar__canoverwriteenvvarauthunix_destroyauthunix_marshalmarshal_new_authauthunix_validate_authunix_create_xdr_authunix_parms_xdr_array _xdr_rejected_reply_xdr_opaque_auth_xdr_accepted_reply_xdr_des_block_xdr_replymsg_xdr_callhdr_seterr_replyacceptedrejected_strtok_ry P ip6_parsenumeric_filenoØŘstr2numberget_canonnameres_queryNres_querydomainNget_aigetanswergethostby*.getanswer: asked for "%s", got "%s"res_searchNexplore_numericget_portmatch_freeaddrinfo_getaddrinfoaddrconfigip6_str2scopeid)&_yphostent_gethtent_getservbyname_r_MD5Init_MD5Update_MD5Final @_vasprintf_l_getifaddrs"_freeifaddrsNBCDB atoi**!!**!!SPDGJM d'@Bʚ;__dn_count_labels@sJ}J@7r)E@&?ջ-$charstraddname0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuv__ns_sprintrrf__ns_skiprr__b64_ntopABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/__b64_pton _inet_nsap_addr_inet_nsap_ntoa__ns_format_ttl>ox54ؗҜ<3#I9=D2[%Cod(h4)$ _posix1e_acl_entry_compare_acl_differs_acl_brand_as_sl_add_sl_find  5_strsep_int_strtoul_l_int__strtoll_lfgetsrewindmap_v4v6_addressmap_v4v6_hostentgethostbyname_internal_yp_hostent_yp_gethtbyaddr_yp_gethtbynamegetanswergethostby*.getanswer: asked for "%s", got "%s"_dns_gethtbyname_dns_gethtbyaddrgethostbyname_rgethostbyaddr_rinet_pton40123456789abcdef0123456789ABCDEF_inet_ptoninet_pton6inet_ntop4_inet_ntopinet_ntop6_fseeko_fparseln__fgetstr_xdr_int_xdr_u_int_xdr_long_xdr_u_long_xdr_int32_t_xdr_u_int32_t_xdr_short_xdr_u_short_xdr_int16_t_xdr_u_int16_t_xdr_char_xdr_u_char_xdr_bool_xdr_enum_xdr_opaque_xdr_bytes_xdr_netobj_xdr_union_xdr_string_xdr_wrapstring_xdr_int64_t_xdr_u_int64_t_xdr_hyper_xdr_u_hyper_xdr_longlong_t_xdr_u_longlong_t__dn_skipname0123456789__ns_name_ntop  __ns_name_ntol__ns_name_unpack2dn_find__ns_name_pack_int_strtol_l_vsprintf_l__getdelim_nsdbtaddsrc_nsdbtdump_nsdbtput_nsdispatchbVRZ:{fkkmO=8^%02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04d-00mnEtc/UTC _strcasecmpbsearch__cxa_atexit_internal__cxa_atexit_vsnprintf_lfreadfopenferror__swbuf222222222IhII xXYIiIIIiyYY  &OOOOOOOOOe@Ce7:I\{~#Y0123456789abcdef0123456789ABCDEF__vfprintf_unlocked_l__sbprintfexponentbk]wznQ_strndup_strdup_gethostname" !#&(*-/14}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDؗҜ<3#I9=D2[%Cod( 7yACnF?O8M20HwZm1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHGA$e  a]YUQMIEiea]BJ|xtDD0*m:31HB;\\9############9ZZ99Z#########################o^_getpagesizeqsort_r__sfvwrite__sflush__swsetup,#,#__swhatbuf__smakebuf_tcgetattr_int__strtoi_l__sread__swrite__sseek__sclose_int__strtoimax_lCisalnumisalnum_lisalphaisalpha_lisblankisblank_liscntrliscntrl_lisdigitisdigit_lisgraphisgraph_lislowerislower_lisprintisprint_lispunctispunct_lisspaceisspace_lisupperisupper_lisxdigitisxdigit_ltouppertoupper_ltolowertolower_lc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB _citrus_NONE_stdenc_mbtowc_citrus_NONE_stdenc_mbtocs# dl_iterate_phdr_setup333333333O << 0123456789ABCDEF0123456789abcdef_vsnprintf_ss_fwalk {__res_nmkquery__res_nopt__res_nopt_rdata/&_hf_gethtbyname2_hf_gethtbyname_hf_gethtbyaddrD!*07 _nsaddsrctomap ]:[=             WEEEdg          DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::clearerrF7Z77<7O__rec_dleafNEXTINDEXNEXTINDEXputpair__delpair__get_page__add_ovflpagesqueeze_key__free_ovflpageugly_split__split_page__big_insert__big_delete__big_splitN??S??E?NEXTINDEXiioEoool         $ !t$9!`! !!U8            (( o((((() o`l\X`T_Pe0 H0 $22gnts/ 1 / *A ? rbmnp? h> = $> X> tcid4g hl q \u e e d |e pe j22yekdt l Dd p+4.8.oh+atad Ѓ loob܍ | lilititiyara D T *@1LoP+::::;(;D;P;h;t;;;;;;; << (<4< P<\< t<\ <<<<<<==4=@= oX=8J~ ~r ]b jjcf#h/k>lNm`oloxpppqru <tv\wwx0xJzUzBCJOPSTV"V(X7Z5Z@GV]r ~  l(_Qy15(!_Qy1/dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbin< }-+?=###%%%}  a&EV,eF4I\i>LLlRmZCdnkfrxpbuq0shvVVxL @=( d ˚ ... ...j$p$6'$$$0Q+w7hn7hD@AabCdhlNsuvW:w:z(Q?ĮD Q? HQ 6j@ Q1  Q? HQ0s@HQ;]@(Q?|d(Q?(Q?̯(Q?ı0Q?E,0Q2D9xEX0Q- 7h 8L0Q529h90I\İ0Q?h؆؁ 0Q?؆؁ (Q?0TP\Ph`8İh4@Q90>h>QU/@h686Q/#@h8|8Q2C@h|6|0Q?P؆؁ @Q/@h@QU/@h6Q.6h88Q[?h [?8Qi.88h 888Q1.(8h (88Q-8h 80QC0OԳ@Q5?AhA@Q>8Ch8C@Qe>7ChB8Q?,Bh ,B@Q=BhB0QxD`QQC̴CQNChC0Q^ER QVEhE8Q)VEh E0QVKh(V0QhKR@Q=[yKhyK@QZKhK8QYRFh RF@QMYzKhzK8Q` Hh* H8Q1aHh* H8Qm_Kh K0QKh <UikKM9oM9oMIpMnMp?9oN9oA{;n NnN}oN9oNo"N9o(N9o-No2N9oz  '@@NN fNNNN NN NN2@O@ZP......dA..##"hZDN@6 h   0 ƈ̈+76ֈO܈3R(8688 !"#f$ %&'(")'*+0,4-8/B1L1X2d3m4r5v6LDYR4"&2b<DL>LgeLg{XLglLg}SLLgR`Lgu\DLguRfLgElOLg=nLg_jLgmrLgjLg lLgYnALgQ_@LgaMLgbpLg l|Lg\LgpLgEpLgyptLgElLgyLg [LgSFLg}Lg1^0LgXmLg_4Lg\RLg LgkYLguRLg`\LgQwLgvLgehDPLgb¤LgsɤLgqaXLg-dҤLgYLgh~Lg-dLgbؤLgEzLgRޤLgubLgQwLgyTZLgYLgyTLgiv[LgbLgnLgunLg}LgQw LgoLgbLgbLgbLg5_tLg]<Lg^vLgmvLg}SLghLgEl"LgQjVLgYrLg)x(LgX.LgX4Lgz<LgebCLgmILgrQLgkWLgMi]Lg1veLgpޮLg}SnLg]Lg-ywLgj Lg1uLg)xLg[|LgISLgpLg}sRLgRLgYrLg\fLguQsLg=kLgyLg "LgfLg]Lg)x%Lg @$!L8!{X ¤'0bh z  * . ` d f o 04?4sz _##)#*#######%%&&H&S&&&&&&&&&&&&&&&&&&&&&&&&&&&'' ' '('('L'L'N'N'S'U'W'W'''''''++P+P+U+U+....////000>0A00001/11111112 2G2P2MNƤ`|0RTfhk`oooopՌ"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp| ( ( ) ) oK_pp0J#%')-Y[ : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----*0-000ooprt} %&,,ĨŨ&-GQ).1256CCLL|| /vz      8 : ? ?   $ ' FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB@4@4G4U4jj0k6kOoOooooo-0Fgi{BD6;luu!#$&*06DJ (3:ALU`kr}> &/6=6DP[fkty"3k"}Mq6Pf6>tZ>q&+""    l h b  w  i x X       0  $  k  j [< e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ is a directory is not a regular file (use -f to see it) (1  f   $ %/1="I>TZ`m1|; 7   #28  (# !,59GQ[&ff)r|5e:%6<4 +,-.*%?5E</H/V'bFo WmkRkRkYcWbkCkc kG ky wb YMYrWcaH"]~b@ "Bx"(cpD"S~~dh,"hA8"D`(ʹeX4".BfP"bzFH0"g@d".h8 "`yi0" j(% J !"5kHHK"MrL"m@"n""o)5Oݯ@pHPYKqP"T|r""s!("SkS!"t)Tu<"Vw""8ixx(XpA"yh"z`"3H"XQg~P!"p?HI#@8A"0"(";] "y(ŷ""q<Ok""$"#$"ٸAW"w!"!"!")(uV!"ey""|")PL"qx"5x!"pt"0_hp"`l"$:Xh"K#2ASeq{ B/7<J\eu+;I\hmz " (press RETURN);tags643{}abcdDgGhHilnNpPqrs tw xy !:#=4##eJIK<< !oq!<%/>C0t\-0pw51|q&$)C*+*c".5#5#..s4,?A=#R-R8)#hE6FPocravls{h<)# !"$'(+-.03569:b?bNN N QPPeYiX-dYdNQbQQiQEQYX1QUNRNiNuNNENQN ]Nsb{bb=b!b RQQQ?bMR9R!Rmccc9baRUcccjbk3buRdEd-b&\N 1N bkb'bNcb!bRR=ccccbUS=S%S SRRYYRWUcbMV=V-V]VVVVVVVVqVMN NMsM9WWWVbbMM&W'qW(cW)UWWWmUWW%WXXWWWn[L2Lp\Ly\M\/MdGM\_MdwMK W b% pțPMț01cț  M(M{M  /PțF U^țFU ` p @ țF%P]`țFpV`țFU`țFUMa  `# 0k țF `JPI]țF L P]$ ; `0eț2$zTț2$zț2$ zț ț ț ț  ț TS\@sțFcațF_y_țF`cPa'0 &9A )I|5 2$CVL(^{ios{,8J~<2"v*P#P `oZ?O^p<Qp+(> `     9      \   (Lgv'0EWam}#=YoPnyoRwe|Z&B`z 2BMc|",6<FN[_djn{ -BWfyX (<D_jui6 b ~    QB !!! !!#!,!A!h!!!!!"G"k"|"""""##$#$$$%%%%%%r&&f"&K&j&&&&?'P'w'(ʚ()(((c)))))))))* **@*T*h*@+f \V`+n++++++,,,>,D,L,P,e,v,,,J-t-0!0=0Q0i2z000000;111J 12;2G2b2h2m2v2{2F22222353E3[3f333304R444444'5b5O66H77fC77R77$8M8888e99 :/:?:U:u::::^;r;;;;;;<<$<.<3<=<F<W<k<<<<<|=>>>>'>.>5>>>H>Y>i>>>>>>>>>>??2 ?*???P?b?<v??????????@@@3@?@I@N@S@e@x@@@@@@N@2 ?@@@AA$A.O9.?ki,@ki,Aki,B -C ki,D i,E wi,F ki,G+țR+ț+țPTSTI1sI1c%XsI[ŵZ[Z}.dA   țțțțțțțțțC   y     8  R =  !%),048;?BFIMx P!a"p#|$%&'()̀*ր+,--..//01 2345 6 7&8,95:1;;<J=V>h?v@[\\]ǁ^ҁ^__`{{#|1}=}Q~W  x @@`#####$$$$$%%%d% %&&(&0'<'H'P(\(h(p)|))***+++,,,,----.(.4.</H/T/\6h;x;00011<<==>>?222$303<3D9P7\8l:44455 ! " # $ % &  ' ( $) 0* <. H+ T, `- h/ t0 1 2 3 4 5 6 7 8 9 : ;  < = $> 0? < @H!@T"@`#@l$@x%@&@'@)@*@+@&`'`,@-@.@ /@0@((`81@D2@T3@d)`t4@5@6@7@8@9@:@*`;@<@=@ >@0?@@ `P!``+`p,`"`#`-`$`.`/`%`CC DD E(E4F<FHcPc\d`dleep#x#&&0 (0<HTdpt  @@`   @@@@(@0@<`D`PT\dlt |@@ 33333333 o o999:0:33338HPNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[SžD;P;D;; h 33UU33UU33UUh@81-\0.0<@81-\0.= A81-\0.?|Ah@}&mnnn nmDIPI(n,n0nXχOr_"-gw>/;A>q8.ϳJw"_:[y㵌|kyV^}Tp)k*bL ׽3z;o.\4}iqa~ć| c(Sk\#Z??ۼfsmG"ȯEzډ|Z?ݮF>GiREQ 1 Dso 747d ̼qpvp-M}qy!p[\+HU h8gl{x 6 j;#!r]x:F|f1ɠɇ&ndDJPj,r!, Ur>vU+UB.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf /B0H00&P@@V@@$bddghht  `ypp(HHx&p+Ĉ|MSGTXTS620 4976 5001 5018 5040 5043 5048 5056 5063 5071 5079 5082 5085 5088 5092 5104 5113 5126 5155 5170 5713 5747 6430 6718 7426 7482 7556 7652 7827 7850 7873 7879 7888 7910 7914 7918 7921 7924 8029 8232 8471 8912 9350 9385 9400 9412 9418 9430 9479 9499 9539 9556 9573 9588 9635 9673 9721 9803 9927 10063 10104 10142 10179 10214 10224 10273 10423 10429 10434 10438 10458 10568 10588 10594 10608 10620 10631 10668 10702 10726 10828 10865 10887 10986 11041 11099 11110 11126 11178 11346 11553 11724 11788 11840 12111 12660 13188 13619 13957 14290 14403 14418 14427 14587 14758 14908 15072 15095 15119 15134 15209 15349 15526 15681 15693 15773 15874 15920 15946 16016 16027 16036 16049 16075 16090 16106 16119 16174 16185 16200 16404 16637 16666 16681 16750 16824 16897 16927 16965 17019 17473 17499 17528 17632 17738 17923 18035 18150 18254 18941 19200 19340 19376 19546 19587 19723 19746 19783 19828 20079 20175 20229 20328 20339 20376 20413 20440 20449 20483 20490 20515 20542 20577 20591 20605 20634 20648 20665 20674 20696 20714 20731 20742 20761 20787 20805 20828 20845 20860 20875 20893 20920 20947 20969 21008 21026 21058 21286 21360 21403 21449 21596 21752 21796 22075 22102 22461 22645 22797 22978 23125 23283 23304 23352 23362 23370 23381 23392 23402 23409 23424 23436 23473 23503 23542 23595 23653 23674 23681 23700 23721 23728 23750 23772 23792 23814 23845 23882 23904 23918 23964 23993 24027 24067 24102 24130 24178 24187 24196 24201 24210 24219 24236 24240 24245 24251 24255 24268 24277 24304 24324 24347 24366 24393 24415 24447 24463 24468 24478 24501 24523 24540 24557 24570 24579 24588 24594 24621 24628 24652 24673 24697 24710 24729 24754 24777 24793 24799 24811 24841 24849 24889 24900 24911 24922 24939 24956 24970 24987 25435 25651 25915 26187 26239 26275 26311 26362 26379 26417 26431 26438 26455 26458 26463 26472 26484 26495 26504 26525 26567 26605 26621 26652 26677 26712 26768 26808 26829 26849 26890 26919 26967 27200 27235 27442 27461 27498 27559 27597 27636 27792 27807 27853 27901 27924 27960 27970 27980 27991 27996 28059 28107 28151 28212 28245 28346 28364 28503 28525 28648 28662 28672 28695 28800 28856 28972 29003 29008 29034 29073 29083 29126 29136 29152 29167 29185 29208 29238 29259 29285 29482 29525 29529 29535 29541 29546 29557 29571 29600 29632 29644 29691 29741 29781 29808 29824 29833 29876 29882 29890 29894 29914 29931 29943 29974 30230 30279 30855 30882 30914 30942 30994 31000 31006 31011 31032 31048 31070 31099 31240 31374 31387 31523 31525 31527 31529 31546 31559 31577 31604 31608 31614 31619 31627 31633 31673 31675 31685 31700 31717 31751 31783 31821 31850 31879 31901 31944 31970 32014 32150 32152 32154 32193 32260 32277 32291 32295 32302 32424 32493 32781 32919 33060 33141 33188 33194 33217 33263 33266 33292 33335 33400 33462 33532 33600 33693 33912 33937 33941 33977 33995 34023 34065 34109 34173 34223 34299 34321 34373 34417 34456 34490 34520 34551 34576 34585 34597 34605 34616 34628 34647 34671 34720 34737 34761 34804 35126 35129 35143 35156 35168 35175 35186 35193 35200 35209 35219 35236 35252 35302 35310 35318 35328 35339 35357 35374 35395 35417 35426 35436 35463 35469 35479 35498 35514 35532 35552 35561 35572 35579 35596 35615 35636 35646 35663 35669 35685 35700 35715 35736 35758 35777 35787 35792 35797 35815 35834 35853 35859 35878 35898 35918 35936 35941 35947 35964 35980 36001 36014 36022 36042 36066 36083 36091 36102 36123 36129 36141 36163 36177 36186 36207 36225 36234 36268 36291 36318 36350 36373 36393 36404 36436 36452 36463 36476 36499 36521 37029 37059 37090 37118 37132 37333 37555 37722 37809 37826 37844 37861 37890 37937 37948 37967 37989 38068 38260 38288 38406 38428 38569 38588 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-11.99.3. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? - wd: SATA, ATA oder IDE - sd: SCSI oder USB-Speicher - ld: NVMe (z.B. M.2-Karte), SD/MMC-Karte oder virtueller Speicher Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis (leer lassen, um abzubrechen)?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-11.99.3 ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-11.99.3 ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-11.99.3 ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-11.99.3 ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Die Installation wird abgebrochen. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-11.99.3 InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-11.99.3 ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPHTTPSNFSCD-ROM / DVDDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzSendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd (Secure Shell daemon) aktivierenntpd aktivierenntpdate beim Starten ausfhrenMulticast DNS aktivierenxdm (X Display Manager) aktivierencgd aktivieren (kryptografische Laufwerkskonfiguration)lvm (Logical Volume Manager) aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte Partitionierung (Software-RAID, ...)Partitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen? So knnen Sie 'su' verwenden, um Superuser zu werden.Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden? Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): Kernel (GENERIC)Kernel (C700)TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist.ntropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.ny length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS620 4976 5014 5031 5046 5049 5052 5057 5065 5073 5081 5084 5087 5096 5108 5120 5129 5138 5164 5175 5710 5737 6303 6603 7244 7291 7404 7497 7531 7550 7568 7576 7585 7610 7614 7618 7621 7624 7746 7931 8159 8679 9030 9059 9072 9085 9090 9110 9129 9150 9209 9226 9240 9262 9307 9333 9374 9452 9570 9684 9738 9767 9799 9838 9844 9877 10000 10007 10011 10019 10043 10125 10131 10138 10150 10164 10173 10206 10225 10237 10347 10409 10428 10547 10598 10650 10662 10681 10733 10937 11145 11336 11396 11445 11711 12169 12834 13256 13578 14003 14135 14167 14179 14357 14554 14715 14849 14869 14902 14916 14985 15098 15270 15405 15425 15537 15629 15652 15675 15734 15749 15770 15785 15806 15826 15851 15865 15889 15901 15919 16129 16379 16400 16416 16469 16537 16610 16647 16673 16749 17244 17270 17292 17399 17506 17707 17780 17864 17964 18459 18697 18848 18882 19017 19061 19200 19241 19286 19333 19577 19710 19772 19866 19871 19905 19939 19954 19982 20015 20022 20047 20065 20091 20098 20113 20128 20148 20188 20205 20225 20246 20268 20283 20303 20325 20340 20353 20367 20379 20391 20405 20428 20451 20469 20512 20563 20600 20785 20848 20884 20933 21024 21154 21207 21467 21514 21875 22025 22194 22334 22454 22586 22626 22673 22683 22691 22701 22709 22720 22731 22745 22770 22811 22844 22877 22912 22966 22991 23010 23032 23037 23043 23072 23089 23116 23134 23155 23177 23196 23206 23236 23262 23289 23338 23366 23393 23446 23456 23466 23472 23482 23491 23511 23515 23520 23526 23530 23543 23552 23583 23600 23627 23648 23668 23687 23713 23726 23734 23750 23781 23812 23833 23859 23872 23880 23891 23897 23921 23931 23943 23961 23972 23992 24008 24034 24056 24072 24084 24104 24130 24136 24166 24180 24194 24217 24236 24255 24273 24291 24709 24910 25150 25334 25412 25467 25534 25574 25597 25631 25642 25650 25673 25676 25679 25685 25696 25708 25721 25751 25795 25808 25821 25858 25872 25883 25894 25905 25922 25933 25980 26003 26052 26293 26326 26581 26602 26635 26688 26714 26741 26897 26903 26946 26966 26985 27014 27021 27028 27035 27040 27089 27127 27161 27218 27246 27291 27308 27409 27414 27491 27505 27515 27539 27662 27743 27853 27881 27886 27902 27931 27939 27980 27987 28001 28014 28022 28041 28074 28094 28114 28330 28361 28366 28373 28380 28384 28398 28410 28425 28458 28471 28526 28584 28620 28638 28656 28674 28711 28717 28725 28729 28750 28767 28778 28800 28978 29022 29724 29748 29782 29801 29846 29853 29860 29864 29888 29899 29904 29967 30088 30211 30224 30358 30360 30362 30364 30374 30383 30396 30423 30427 30433 30438 30447 30452 30479 30481 30494 30506 30521 30549 30593 30640 30656 30678 30689 30722 30742 30791 30891 30893 30895 30936 31027 31044 31058 31063 31069 31178 31237 31488 31629 31756 31824 31861 31868 31895 31941 31944 31965 32010 32061 32120 32189 32236 32341 32484 32509 32513 32547 32564 32588 32640 32691 32763 32829 32927 32944 32975 33011 33045 33069 33093 33126 33146 33156 33164 33172 33182 33193 33207 33233 33281 33304 33324 33365 33664 33667 33681 33693 33700 33719 33733 33740 33747 33756 33766 33783 33799 33847 33855 33863 33873 33884 33902 33919 33938 33958 33965 33982 33999 34006 34019 34054 34071 34090 34110 34120 34136 34149 34167 34187 34208 34218 34238 34258 34271 34290 34303 34327 34350 34363 34374 34379 34386 34404 34423 34442 34450 34469 34489 34514 34532 34539 34546 34559 34568 34589 34602 34610 34630 34658 34675 34681 34692 34723 34731 34744 34766 34788 34797 34818 34836 34843 34866 34885 34912 34930 34950 34963 34978 34999 35013 35020 35034 35049 35068 35613 35646 35674 35703 35711 35748 36060 36237 36314 36331 36349 36364 36386 36436 36446 36463 36485 36544 36702 36726 36856 36881 37007 37025 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-11.99.3. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-11.99.3 ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-11.99.3 ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-11.99.3 completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-11.99.3. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. La instalacin ha sido interrumpida. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-11.99.3Salir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-11.99.3Ejecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPHTTPSNFSCD-ROM / DVDDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroSendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): Ncleo (GENERIC)Ncleo (C700)TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD eMSGTXTS620 4976 5012 5029 5044 5048 5052 5057 5068 5074 5080 5083 5086 5089 5093 5105 5117 5127 5157 5169 5598 5625 6201 6561 7246 7307 7385 7480 7520 7542 7560 7566 7575 7601 7605 7609 7612 7615 7737 7922 8150 8679 9097 9126 9139 9152 9159 9179 9198 9221 9264 9284 9303 9326 9370 9399 9440 9506 9618 9732 9786 9815 9847 9886 9892 9925 10003 10009 10013 10018 10059 10196 10206 10214 10233 10247 10256 10288 10329 10342 10467 10525 10544 10663 10719 10771 10782 10798 10837 11087 11259 11431 11486 11521 11770 12173 12471 12738 13099 13279 13598 13618 13631 13820 13964 14160 14294 14314 14347 14366 14467 14622 14810 14997 15017 15096 15194 15232 15255 15345 15366 15389 15408 15432 15462 15506 15539 15562 15574 15592 15860 16179 16210 16245 16309 16384 16454 16485 16515 16607 17098 17128 17145 17285 17426 17623 17742 17889 18056 18614 18910 19091 19136 19299 19353 19488 19524 19584 19634 19925 20034 20091 20188 20193 20228 20263 20278 20302 20335 20340 20365 20381 20404 20411 20428 20443 20462 20494 20498 20518 20536 20548 20561 20579 20603 20621 20640 20667 20694 20706 20727 20757 20787 20812 20845 20880 20918 21171 21240 21295 21356 21474 21633 21687 21948 21999 22375 22530 22674 22814 22922 23107 23137 23180 23190 23198 23208 23220 23241 23250 23256 23288 23328 23364 23402 23439 23487 23511 23523 23537 23545 23553 23580 23597 23626 23647 23670 23679 23698 23710 23754 23792 23819 23863 23891 23918 23971 23982 23993 24000 24010 24019 24053 24057 24062 24068 24072 24085 24095 24125 24148 24177 24199 24221 24243 24270 24282 24294 24313 24347 24380 24401 24425 24438 24450 24463 24469 24495 24505 24516 24540 24550 24570 24590 24607 24633 24657 24670 24690 24724 24731 24760 24783 24806 24822 24837 24852 24867 24881 25312 25503 25738 25926 25968 26018 26072 26120 26142 26183 26194 26202 26226 26230 26234 26243 26254 26265 26280 26311 26357 26370 26383 26413 26427 26439 26451 26463 26481 26504 26549 26572 26632 26884 26911 27173 27191 27218 27267 27297 27328 27460 27467 27516 27539 27563 27592 27600 27610 27618 27623 27676 27725 27765 27831 27864 27908 27931 28032 28037 28114 28128 28138 28162 28285 28366 28476 28504 28509 28525 28554 28562 28603 28611 28625 28638 28646 28665 28698 28718 28738 28954 28985 29005 29011 29018 29022 29037 29056 29082 29091 29103 29157 29215 29250 29269 29286 29298 29333 29339 29347 29351 29372 29389 29400 29425 29603 29657 30348 30367 30402 30432 30478 30484 30491 30495 30519 30535 30541 30616 30766 30885 30898 30966 30968 30970 30972 30982 30995 31012 31039 31043 31049 31054 31063 31068 31095 31097 31110 31122 31137 31165 31209 31256 31272 31294 31305 31338 31358 31407 31507 31509 31511 31559 31649 31666 31680 31685 31691 31794 31846 32092 32253 32408 32479 32532 32539 32566 32616 32619 32640 32686 32741 32800 32869 32916 33021 33164 33189 33193 33227 33244 33282 33335 33375 33451 33516 33610 33631 33669 33709 33745 33769 33792 33831 33861 33868 33877 33885 33893 33907 33923 33951 34003 34020 34041 34085 34427 34431 34446 34457 34465 34484 34496 34503 34510 34519 34529 34546 34562 34616 34624 34632 34642 34653 34671 34688 34704 34722 34729 34747 34764 34771 34781 34812 34831 34850 34870 34880 34899 34912 34932 34952 34973 34983 35002 35021 35031 35048 35062 35085 35109 35122 35132 35137 35141 35159 35178 35197 35202 35221 35241 35266 35281 35285 35292 35302 35311 35332 35346 35354 35374 35400 35417 35425 35436 35467 35472 35485 35507 35522 35531 35552 35570 35579 35623 35647 35674 35689 35706 35720 35751 35775 35806 35813 35827 35842 35861 36406 36439 36467 36496 36504 36541 36853 37030 37107 37124 37142 37157 37179 37229 37239 37256 37278 37337 37495 37519 37649 37674 37800 37818 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-11.99.3. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-11.99.3 est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-11.99.3 est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-11.99.3 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-11.99.3 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-11.99.3 Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-11.99.3Excuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPHTTPSNFSCD-ROM / DVDDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : Kernel (GENERIC)Kernel (C700)TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationditerGroupe umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of aMSGTXTS620 4976 5017 5033 5051 5055 5059 5069 5078 5084 5090 5093 5096 5105 5115 5128 5136 5147 5172 5184 5692 5724 6216 6505 7050 7096 7200 7286 7322 7337 7355 7363 7371 7398 7402 7406 7409 7412 7523 7708 7936 8412 8746 8775 8790 8805 8813 8827 8845 8866 8917 8933 8943 8963 9009 9039 9092 9149 9260 9381 9425 9458 9497 9531 9538 9571 9648 9654 9661 9668 9697 9809 9815 9826 9843 9860 9869 9898 9910 9920 10021 10083 10103 10223 10260 10316 10330 10351 10388 10598 10773 10922 10957 11009 11225 11538 12061 12422 12712 13105 13240 13253 13264 13410 13589 13720 13854 13874 13907 13926 14009 14124 14265 14390 14404 14512 14605 14634 14654 14730 14747 14765 14781 14800 14820 14837 14849 14875 14887 14905 15106 15345 15372 15389 15445 15507 15567 15598 15622 15681 16057 16087 16104 16212 16322 16462 16536 16612 16690 17182 17402 17513 17544 17671 17707 17835 17862 17902 17948 18164 18288 18356 18456 18461 18497 18533 18547 18570 18603 18607 18632 18651 18677 18682 18697 18712 18731 18756 18768 18790 18807 18820 18832 18850 18874 18889 18906 18919 18930 18941 18961 18990 19019 19043 19078 19113 19140 19327 19376 19408 19456 19553 19686 19732 19924 19954 20276 20405 20545 20685 20802 20937 20981 21024 21032 21042 21054 21066 21074 21085 21112 21146 21181 21212 21247 21283 21330 21350 21367 21385 21390 21397 21422 21438 21459 21476 21493 21511 21528 21541 21572 21597 21628 21659 21694 21721 21774 21784 21794 21800 21809 21817 21832 21836 21841 21847 21851 21864 21874 21903 21919 21945 21962 21981 22002 22018 22031 22036 22044 22059 22085 22104 22132 22150 22161 22167 22173 22194 22204 22215 22233 22255 22272 22285 22306 22326 22346 22357 22370 22392 22399 22424 22439 22459 22471 22488 22505 22525 22544 22854 23034 23245 23433 23499 23546 23601 23645 23665 23694 23706 23712 23728 23732 23736 23744 23754 23766 23781 23800 23836 23847 23858 23897 23909 23919 23929 23939 23955 23973 24022 24043 24088 24332 24358 24612 24627 24653 24710 24744 24779 24921 24938 24987 25008 25024 25053 25058 25063 25069 25074 25113 25148 25178 25233 25266 25312 25326 25405 25410 25464 25478 25488 25512 25598 25646 25752 25786 25793 25808 25835 25844 25883 25890 25912 25931 25947 25965 25997 26016 26033 26190 26221 26228 26237 26245 26252 26266 26284 26303 26313 26325 26366 26411 26440 26461 26484 26503 26541 26547 26555 26559 26580 26597 26606 26625 26771 26813 27323 27331 27355 27373 27417 27422 27427 27431 27462 27475 27484 27530 27656 27747 27759 27823 27825 27827 27829 27839 27853 27868 27895 27899 27905 27910 27919 27924 27951 27953 27968 27979 27994 28022 28066 28113 28129 28151 28162 28195 28215 28264 28364 28366 28368 28403 28479 28496 28510 28517 28523 28622 28678 28954 29078 29189 29251 29289 29297 29319 29368 29371 29392 29437 29492 29551 29620 29667 29772 29915 29940 29944 29978 29994 30019 30067 30103 30164 30218 30299 30321 30360 30397 30429 30453 30480 30506 30520 30528 30538 30546 30560 30573 30585 30609 30650 30676 30693 30722 31046 31049 31063 31075 31081 31097 31109 31116 31123 31132 31142 31159 31175 31218 31226 31234 31244 31255 31273 31290 31303 31329 31336 31344 31361 31369 31386 31410 31429 31448 31467 31477 31488 31502 31520 31540 31560 31569 31592 31612 31623 31638 31650 31669 31688 31699 31709 31714 31720 31738 31757 31776 31783 31802 31822 31847 31864 31870 31878 31888 31900 31921 31937 31945 31965 31985 32007 32015 32026 32049 32056 32070 32092 32109 32118 32139 32157 32166 32197 32213 32240 32259 32279 32297 32318 32332 32352 32359 32378 32393 32412 32957 32990 33018 33047 33055 33092 33404 33581 33658 33675 33693 33708 33730 33780 33790 33807 33829 33888 34046 34070 34200 34225 34351 34369 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-11.99.3. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-11.99.3 zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-11.99.3 zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-11.99.3 zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-11.99.3 zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Instalacja zostala przerwana. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-11.99.3Wyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-11.99.3Uruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPHTTPSNFSCD-ROM / DVDDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymSendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Instalowanie bootblokow na %s.... Twoje partycje NetBSD na %s wygladaja nastepujaco (Rozmiar i offset w %s): Kernel (GENERIC)Kernel (C700)RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm sh stty sync# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private  . ..zero wsmuxctl3 wsmuxctl2 wsmuxctl1 wsmuxctl0wsmux3wsmux2wsmux1wsmux0wsmouse3wsmouse2 wsmouse1!wsmouse0"wsmouse#wskbd3$wskbd2%wskbd1&wskbd0'wskbd(wsfont)wd3p*wd3o+wd3n,wd3m-wd3l.wd3k/wd3j0wd3i1wd3h2wd3g3wd3f4wd3e5wd3d6wd3c7wd3b8wd3a9 wd3:wd2p;wd2o<wd2n=wd2m>wd2l?wd2k@wd2jAwd2iBwd2hCwd2gDwd2fEwd2eFwd2dGwd2cHwd2bIwd2aJ wd2Kwd1pLwd1oMwd1nNwd1mOwd1lPwd1kQwd1jRwd1iSwd1hTwd1gUwd1fVwd1eWwd1dXwd1cYwd1bZwd1a[ wd1\wd0p]wd0o^wd0n_wd0m`wd0lawd0kbwd0jcwd0idwd0hewd0gfwd0fgwd0ehwd0diwd0cjwd0bkwd0al wd0murandomnttypfottypepttypdqttypcrttypbsttypatttyp9uttyp8vttyp7wttyp6xttyp5yttyp4zttyp3{ttyp2|ttyp1}ttyp0~ttyHstatttyHcfgttyH7ttyH6ttyH5ttyH4ttyH3ttyH2ttyH1ttyH0ttyGstatttyGcfgttyG7ttyG6ttyG5ttyG4ttyG3ttyG2ttyG1ttyG0ttyFstatttyFcfgttyF7ttyF6ttyF5ttyF4ttyF3ttyF2ttyF1ttyF0ttyEstatttyEcfgttyE7ttyE6ttyE5ttyE4ttyE3ttyE2ttyE1ttyE0tty01tty00 ttystdoutstdinstderr st1 st0sd3psd3osd3nsd3msd3lsd3ksd3jsd3isd3hsd3gsd3fsd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2asd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2k rwd2j rwd2i rwd2h rwd2g rwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1e rwd1d!rwd1c"rwd1b#rwd1a$rwd1%rwd0p&rwd0o'rwd0n(rwd0m)rwd0l*rwd0k+rwd0j,rwd0i-rwd0h.rwd0g/rwd0f0rwd0e1rwd0d2rwd0c3rwd0b4rwd0a5rwd06rst17rst08rsd3p9rsd3o:rsd3n;rsd3m<rsd3l=rsd3k>rsd3j?rsd3i@rsd3hArsd3gBrsd3fCrsd3eDrsd3dErsd3cFrsd3bGrsd3aHrsd3Irsd2pJrsd2oKrsd2nLrsd2mMrsd2lNrsd2kOrsd2jPrsd2iQrsd2hRrsd2gSrsd2fTrsd2eUrsd2dVrsd2cWrsd2bXrsd2aYrsd2Zrsd1p[rsd1o\rsd1n]rsd1m^rsd1l_rsd1k`rsd1jarsd1ibrsd1hcrsd1gdrsd1fersd1efrsd1dgrsd1chrsd1birsd1ajrsd1krsd0plrsd0omrsd0nnrsd0morsd0lprsd0kqrsd0jrrsd0isrsd0htrsd0gursd0fvrsd0ewrsd0dxrsd0cyrsd0bzrsd0a{rsd0|rmd1d}rmd1a~rmd1rmd0drmd0armd0rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rcd1drcd1arcd1rcd0drcd0arcd0randomptypfptypeptypdptypcptypbptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0memmd1dmd1a md1md0dmd0a md0ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullest1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drumconsttyconsolecd1dcd1a cd1cd0dcd0a cd0 bpf0bpf . .. dhcpcd.confgroup master.passwd netconfig protocolsserviceswheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766: root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin # $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  ... . .. dhcpcd-hooksdhcpcd-run-hooks fi done  . ..20-resolv.conf 30-hostnamen $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime if [ -n "$rdnsstime" ]; then ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers if [ -n "$rdnss" ]; then new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi fi fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime if [ -n "$dnssltime" ]; then ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search if [ -n "$dnssl" ]; then new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi fi fi # Break when we don't have either [ -z "$rdnsstime" ] && [ -z "$dnssltime" ] && return 1 j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf retur# Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dmesg fdisk fsck fsck_ffs halt ifconfig init mknod mount  mount_cd9660  mount_ffs  mount_mfs  mount_msdos  mount_nfs newfs ping ping6 reboot restore route rrestore swapctl 0umount ... ... . .. binmdecsbinshare . .. ftp gunzip gzcat gzip less more progress sed tar `tip ... . .. chroot . ..misc ... . .. db log runspool ... ... ... . ..lock ...q6^%KĔ4"#'(),-@7^X@(@<8^@ @+@-@-@X(@,@,@8^|P(@(@<9^8L.@\/@X8@LC@A@B@,8@t9^[l9^(8@:@l:^C@D@[[4O@K@G@G@G@X:^pG@H@O@O@P@\W@X@PQ@TQ@O@:^O@T@:^Z@Z@Ă;^h@|i@j@xj@|j@dk@tk@j@j@k@k@k@}@}@k@(~@@~@~@~@~@@k@k@k@}@k@k@~@~@@0@H@`@x@@@@@@@ @8@L@`@t@;^l@\l@@@x@earmzaurusG@^Y@^c@^o@^@^@^@^t@ @@@8@@@؝@@@@@@@@@@@@@p@p@p@@@p@@p@p@@@@@@X@ @ @^@@@P@ʏ5^x_AhSA`A`^ 0pA܂AuAqApAk^@AC^̻BBdB^BBPB7^"Bttmk%Czټ|Ff梂&Sk@5;D@DPADc^XDDtDD(DD^4^8^<^@^C^J^0^5^:^?^E^̼^ؼ^ʼ^ּ^^^^^^^^N^ ^^ ^,^^ ^^^'^I^T^_^j^j^u^^^^^^^1+_Ƽ^^^X0^X_]a]T8Z $,EEEpEEEEH_]XdX@d@ h h 8"'-T39?? < ddi(,LGIGPG HG0VGSG$XdX@ X@^L@Hg]Xi]T8Z@< H HlHDHHBIg]g `H$H4HHDHHH `$7^_IxjIdITcIbI^4I(III^lI0III^lDIhIII^ldI IIIJ^l8I\IIIn^lI>??  ` ~ ^AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy((((((())((((((())SZZys[zzRTAL9CEINCOUYrUal:ceinDouyAa L= S` Td Z} l> sa te z~ C  E D NG RX c  e d nH rY'S^'s_'C'Tb'c'tcAIOaioAEOUaeouZ{z| OP Up oQ uq(A(a(E(e Un uo7LA7lBhbJbJfJbJplJЫ]8](]]]]Е]]]]]]t^">""""&n@T((T`px|~~|xp`>~~>8|8888|8fffffffff~t0xs; x8|8888|88|8888888888888888|8 003f$ff$<~~<wfllllllll||| 0 `F8ll8vv0 000000 0 0f<ffff<~~~~`0``|```0||~~0  0~ 0`0 ~p~vv8ll8 Pp lllllx0`|||||||^hJJ,JJ@^R4JJ@JJJJܺJ J$JJ@^RH8X$XXX@^RL]-^Xd>X>XRR,?X?X@X\AXAXBX  CX DX DXEXDFXFXRRR WL^RRR V W VP_VV,V ]] @VVlockf2  ^_YXYXYXYXYX@^RYXYXYXYXYX@^RYXYXYXYXYXYXYXYXYX@^R] M_ M_XX(Xd_Ye_4 Yu^YDY>Y`7Yp0Y;Y,;Y=Y[v_@_v_Adv_Biv_Fqv_GGvv_H^I{v_Jv_Mv_Nv_Tv_Uv_Vv_Wv_Xv_Yv_Zv_[l^\\v_]v_^v__v_`v_av_cv_d՗^ev_fx^gv_hv_iv_kw_lw_mp]]$[]]\] ]#]t[T]]]]t]z]8|]0!]0G][][d]\] m]][]!]8]7^7^^l^k^^^^'0^^^'0^^^'0^^^'0^J^J^'0^n^n^'0^^^'0^?^?^'0^^^'0^t^t^'0^K^K^'0^p^p^'0^^^(0^=^7^(T^_Y^(T^v_q^&^v_q^&^v_q^&^v_^ (T^ w_^(T^`^`^(H^Iv_^'x^~^~^'^;^;^_;^&^5^5^(<^k^k^$^n^n^&^m^m^&^ n^ n^&^r^r^'^5s^5s^'^w_8^('^t^t^8'^w_:^H'^5^7^X'^<8^<8^h'^<9^<9^x'^l9^l9^'^:^:^l^X:^X:^'^x^x^^:^:^'^^^'`^@ @p@@ @@AH^x^:^^x^X:^^:^l9^^<9^^<8^5^^w_^t^w_^5s^r^ n^^m^n^^k^^5^_^;^^u^~^Iv_`^^ w_^v_^_^=^^p^K^t^^?^^n^J^^^^^l^7^^c^$S[^3]_H_,@NetBSDJwGA(aeabi5TE  $NetBSD: locore.S,v 1.44 2022/04/02 11:16:07 skrll Exp $$NetBSD: md_root.c,v 1.19 2015/08/30 05:24:03 uebayasi Exp $$NetBSD: autoconf.c,v 1.18 2025/05/19 06:16:24 andvar Exp $$NetBSD: machdep.c,v 1.55 2024/05/13 00:08:06 msaitoh Exp $$NetBSD: subr_disk_mbr.c,v 1.59 2025/02/08 10:49:45 mlelstv Exp $$NetBSD: ziic.c,v 1.7 2025/09/15 13:23:03 thorpej Exp $$NetBSD: scoop.c,v 1.13 2014/09/23 14:49:46 nonaka Exp $$NetBSD: scoop_pcic.c,v 1.4 2011/06/19 16:20:09 nonaka Exp $$NetBSD: zssp.c,v 1.15 2021/08/07 16:19:08 thorpej Exp $$NetBSD: w100lcd.c,v 1.6 2022/05/28 10:36:23 andvar Exp $$NetBSD: w100.c,v 1.4 2021/11/20 00:17:10 rin Exp $$NetBSD: lcdctl.c,v 1.3 2012/01/29 10:12:41 tsutsui Exp $$NetBSD: zkbd.c,v 1.22 2021/08/07 16:19:08 thorpej Exp $$NetBSD: zapm.c,v 1.14 2021/08/07 16:19:08 thorpej Exp $$NetBSD: zmci.c,v 1.5 2012/01/29 10:12:42 tsutsui Exp $$NetBSD: vfp_init.c,v 1.78 2022/08/20 11:34:08 riastradh Exp $$NetBSD: cons.c,v 1.95 2023/09/02 17:44:59 riastradh Exp $$NetBSD: fiq.c,v 1.10 2020/02/24 12:08:08 rin Exp $$NetBSD: mainbus.c,v 1.24 2022/09/27 06:36:42 skrll Exp $$NetBSD: mainbus_io.c,v 1.24 2018/03/16 17:56:32 ryo Exp $$NetBSD: cpu_mainbus.c,v 1.19 2024/05/09 12:41:08 pho Exp $$NetBSD: disassem.c,v 1.42 2020/12/01 02:48:28 rin Exp $$NetBSD: bus_stubs.c,v 1.3 2021/09/18 09:49:57 jmcneill Exp $$NetBSD: arm_cpu_topology.c,v 1.9 2024/12/10 11:27:29 jmcneill Exp $$NetBSD: arm_machdep.c,v 1.68 2023/10/04 20:28:05 ad Exp $$NetBSD: ast.c,v 1.32 2021/02/01 19:31:34 skrll Exp $$NetBSD: bcopyinout_xscale.S,v 1.12 2022/10/20 06:58:38 skrll Exp $$NetBSD: blockio.S,v 1.9 2022/10/20 06:58:38 skrll Exp $$NetBSD: bootconfig.c,v 1.13 2020/10/18 16:28:57 skrll Exp $$NetBSD: copystr.S,v 1.14 2022/10/20 06:58:38 skrll Exp $$NetBSD: core_machdep.c,v 1.10 2020/11/10 21:38:03 rin Exp $$NetBSD: cpufunc.c,v 1.186 2025/10/09 06:15:16 skrll Exp $$NetBSD: cpu_exec.c,v 1.13 2020/12/01 02:43:13 rin Exp $$NetBSD: cpu_in_cksum.S,v 1.13 2022/10/20 06:58:38 skrll Exp $$NetBSD: cpu_subr.c,v 1.6 2025/09/06 02:53:22 riastradh Exp $$NetBSD: idle_machdep.c,v 1.6 2021/02/17 06:54:23 skrll Exp $$NetBSD: process_machdep.c,v 1.35 2021/02/01 19:31:34 skrll Exp $$NetBSD: sig_machdep.c,v 1.53 2024/04/14 07:56:13 skrll Exp $$NetBSD: sigcode.S,v 1.8 2005/12/11 12:16:41 christos Exp $$NetBSD: syscall.c,v 1.69 2023/10/05 19:41:03 ad Exp $$NetBSD: trap.c,v 1.1 2022/04/02 11:16:06 skrll Exp $$NetBSD: undefined.c,v 1.75 2023/10/05 19:41:03 ad Exp $$NetBSD: arm32_machdep.c,v 1.148 2025/09/06 21:02:40 thorpej Exp $$NetBSD: bus_dma.c,v 1.150 2025/09/26 07:48:46 skrll Exp $$NetBSD: cpu.c,v 1.155 2025/10/09 06:15:16 skrll Exp $$NetBSD: cpuswitch.S,v 1.108 2025/10/07 10:35:06 skrll Exp $$NetBSD: exception.S,v 1.26 2020/11/21 19:46:13 skrll Exp $$NetBSD: fault.c,v 1.119 2024/02/02 22:00:32 andvar Exp $$NetBSD: pmap.c,v 1.443 2024/04/13 12:28:01 skrll Exp $$NetBSD: setstack.S,v 1.6 2013/08/18 06:29:29 matt Exp $$NetBSD: stubs.c,v 1.27 2020/07/03 15:31:25 skrll Exp $$NetBSD: sys_machdep.c,v 1.26 2020/06/20 15:45:22 skrll Exp $$NetBSD: vm_machdep.c,v 1.79 2024/01/15 20:35:22 andvar Exp $$NetBSD: pmap_devmap.c,v 1.2 2023/04/27 06:23:31 skrll Exp $$NetBSD: pmap_pvt.c,v 1.15 2022/05/08 22:03:02 rin Exp $$NetBSD: wd.c,v 1.474 2025/04/13 14:00:59 jakllsch Exp $$NetBSD: ata_wdc.c,v 1.120 2021/10/05 08:01:05 rin Exp $$NetBSD: ata.c,v 1.171 2025/02/17 19:01:04 jakllsch Exp $$NetBSD: ata_subr.c,v 1.13 2020/12/23 08:17:01 skrll Exp $$NetBSD: ata_recovery.c,v 1.4 2020/04/13 10:49:34 jdolecek Exp $$NetBSD: sdmmc.c,v 1.44 2025/06/24 03:02:00 gutteridge Exp $$NetBSD: sdmmc_cis.c,v 1.10 2025/01/17 11:54:50 jmcneill Exp $$NetBSD: sdmmc_io.c,v 1.21 2020/10/17 09:36:45 mlelstv Exp $$NetBSD: sdmmc_mem.c,v 1.77 2024/10/24 10:50:31 skrll Exp $$NetBSD: ld_sdmmc.c,v 1.45 2025/04/13 02:34:03 rin Exp $$NetBSD: config_hook.c,v 1.12 2020/11/21 21:08:32 thorpej Exp $$NetBSD: platid.c,v 1.11 2006/05/10 06:24:02 skrll Exp $$NetBSD: pxa2x0.c,v 1.24 2021/08/07 16:18:46 thorpej Exp $$NetBSD: pxa2x0_space.c,v 1.14 2023/04/21 15:00:48 skrll Exp $$NetBSD: pxa2x0_dma.c,v 1.7 2022/09/27 06:36:43 skrll Exp $$NetBSD: pxa2x0_intr.c,v 1.26 2023/07/13 19:42:24 riastradh Exp $$NetBSD: pxa2x0_gpio.c,v 1.21 2021/08/07 16:18:46 thorpej Exp $$NetBSD: pxa2x0_com.c,v 1.14 2018/12/08 17:46:10 thorpej Exp $$NetBSD: pxa2x0_a4x_space.c,v 1.6 2018/03/16 17:56:32 ryo Exp $$NetBSD: bus_space_a4x.S,v 1.4 2013/10/28 22:50:25 matt Exp $$NetBSD: sa11x0_ost.c,v 1.33 2019/11/13 17:52:12 tsutsui Exp $$NetBSD: pxa2x0_pcic.c,v 1.15 2022/09/27 06:36:43 skrll Exp $$NetBSD: pxa2x0_i2c.c,v 1.9 2021/12/12 08:49:57 andvar Exp $$NetBSD: pxa2x0_rtc.c,v 1.9 2025/09/07 21:45:12 thorpej Exp $$NetBSD: pxa2x0_mci.c,v 1.14 2023/03/28 20:01:57 andvar Exp $$NetBSD: apmdev.c,v 1.34 2021/09/26 01:16:08 thorpej Exp $$NetBSD: pcmcia.c,v 1.96 2021/08/07 16:19:15 thorpej Exp $$NetBSD: pcmcia_cis.c,v 1.57 2019/11/10 21:16:36 chs Exp $$NetBSD: pcmcia_cis_quirks.c,v 1.36 2019/11/10 21:16:36 chs Exp $$NetBSD: if_ne_pcmcia.c,v 1.161 2019/12/27 08:01:58 msaitoh Exp $$NetBSD: com_pcmcia.c,v 1.62 2018/12/08 17:46:14 thorpej Exp $$NetBSD: wdc_pcmcia.c,v 1.130 2022/09/25 21:53:54 thorpej Exp $$NetBSD: if_wi_pcmcia.c,v 1.93 2019/01/08 08:47:21 msaitoh Exp $$NetBSD: dev_verbose.c,v 1.4 2021/06/29 21:03:36 pgoyette Exp $$NetBSD: ld.c,v 1.118 2025/10/04 09:38:06 skrll Exp $$NetBSD: wi.c,v 1.258 2023/08/01 07:04:15 mrg Exp $$NetBSD: dp8390.c,v 1.101 2024/06/29 12:11:11 riastradh Exp $$NetBSD: ne2000.c,v 1.79 2024/05/21 08:04:20 andvar Exp $$NetBSD: com.c,v 1.388 2025/02/12 05:15:39 imil Exp $$NetBSD: rtl80x9.c,v 1.19 2023/12/31 03:19:22 isaki Exp $$NetBSD: wdc.c,v 1.310 2022/05/31 08:43:15 andvar Exp $$NetBSD: dl10019.c,v 1.17 2021/07/01 20:39:15 thorpej Exp $$NetBSD: ax88190.c,v 1.18 2021/07/01 20:39:15 thorpej Exp $$NetBSD: compat_exec.c,v 1.18 2019/01/27 02:08:39 pgoyette Exp $$NetBSD: compat_util.c,v 1.47 2019/01/27 02:08:39 pgoyette Exp $$NetBSD: aes_bear.c,v 1.4 2020/07/25 22:28:27 riastradh Exp $$NetBSD: aes_ccm.c,v 1.6 2021/10/17 14:45:45 jmcneill Exp $$NetBSD: aes_ccm_mbuf.c,v 1.1 2020/07/25 22:15:55 riastradh Exp $$NetBSD: aes_ct.c,v 1.3 2020/06/30 20:32:11 riastradh Exp $$NetBSD: aes_ct_dec.c,v 1.2 2020/06/29 23:36:59 riastradh Exp $$NetBSD: aes_ct_enc.c,v 1.1 2020/06/29 23:27:52 riastradh Exp $$NetBSD: aes_impl.c,v 1.10 2022/11/05 17:36:33 jmcneill Exp $$NetBSD: aes_selftest.c,v 1.7 2021/12/05 04:48:35 msaitoh Exp $$NetBSD: nist_hash_drbg.c,v 1.3 2019/09/19 18:29:55 riastradh Exp $$NetBSD: cprng_fast.c,v 1.20 2024/10/15 17:34:06 riastradh Exp $$NetBSD: blake2s.c,v 1.2 2021/10/17 14:45:45 jmcneill Exp $$NetBSD: sysmon.c,v 1.32 2022/03/28 12:33:21 riastradh Exp $$NetBSD: sysmon_wdog.c,v 1.30 2021/12/31 11:05:41 riastradh Exp $$NetBSD: swwdog.c,v 1.24 2024/11/07 09:47:40 rin Exp $$NetBSD: ieee80211.c,v 1.61 2021/08/21 11:55:25 andvar Exp $$NetBSD: ieee80211_amrr.c,v 1.3 2015/08/24 20:58:47 pooka Exp $$NetBSD: ieee80211_crypto.c,v 1.23 2018/05/08 07:02:07 maxv Exp $$NetBSD: ieee80211_crypto_ccmp.c,v 1.20 2023/06/24 05:12:03 msaitoh Exp $$NetBSD: ieee80211_crypto_none.c,v 1.8 2018/01/19 07:53:46 maxv Exp $$NetBSD: ieee80211_crypto_tkip.c,v 1.18 2023/06/24 05:12:03 msaitoh Exp $$NetBSD: ieee80211_crypto_wep.c,v 1.14 2023/06/24 05:12:03 msaitoh Exp $$NetBSD: ieee80211_input.c,v 1.117 2022/11/19 07:57:51 yamt Exp $$NetBSD: ieee80211_ioctl.c,v 1.69 2021/09/21 15:00:34 christos Exp $$NetBSD: ieee80211_netbsd.c,v 1.34 2018/12/22 14:28:56 maxv Exp $$NetBSD: ieee80211_node.c,v 1.84 2024/07/05 04:31:53 rin Exp $$NetBSD: ieee80211_output.c,v 1.68 2024/07/05 04:31:53 rin Exp $$NetBSD: ieee80211_proto.c,v 1.37 2021/07/24 21:31:38 andvar Exp $$NetBSD: ieee80211_rssadapt.c,v 1.21 2016/09/27 20:20:06 christos Exp $$NetBSD: ieee80211_xauth.c,v 1.5 2006/02/27 01:08:28 dyoung Exp $$NetBSD: at_print.c,v 1.2 2021/07/21 06:35:45 skrll Exp $$NetBSD: igmp.c,v 1.70 2020/05/15 06:34:34 maxv Exp $$NetBSD: in.c,v 1.248 2024/08/20 08:22:35 ozaki-r Exp $$NetBSD: in_offload.c,v 1.15 2024/07/05 04:31:54 rin Exp $$NetBSD: in_pcb.c,v 1.202 2022/11/04 09:05:41 ozaki-r Exp $$NetBSD: in_print.c,v 1.1 2014/12/02 19:35:27 christos Exp $$NetBSD: in_proto.c,v 1.131 2022/09/03 02:53:18 thorpej Exp $$NetBSD: ip_icmp.c,v 1.180 2025/06/05 06:29:27 ozaki-r Exp $$NetBSD: ip_input.c,v 1.406 2025/07/17 06:49:43 ozaki-r Exp $$NetBSD: ip_output.c,v 1.330 2025/07/17 06:48:39 ozaki-r Exp $$NetBSD: ip_reass.c,v 1.23 2022/05/31 08:43:16 andvar Exp $$NetBSD: raw_ip.c,v 1.187 2025/06/20 15:15:35 roy Exp $$NetBSD: tcp_input.c,v 1.441 2024/10/08 06:17:14 rin Exp $$NetBSD: tcp_output.c,v 1.222 2024/09/08 09:36:52 rillig Exp $$NetBSD: tcp_sack.c,v 1.36 2018/05/18 18:58:51 maxv Exp $$NetBSD: tcp_subr.c,v 1.298 2025/02/26 04:49:45 andvar Exp $$NetBSD: tcp_syncache.c,v 1.7 2024/06/29 12:59:08 riastradh Exp $$NetBSD: tcp_timer.c,v 1.99 2022/11/04 09:00:58 ozaki-r Exp $$NetBSD: tcp_usrreq.c,v 1.238 2022/11/04 09:01:53 ozaki-r Exp $$NetBSD: tcp_congctl.c,v 1.29 2024/05/14 19:00:44 andvar Exp $$NetBSD: tcp_vtw.c,v 1.25 2024/10/07 23:17:00 jakllsch Exp $$NetBSD: udp_usrreq.c,v 1.266 2024/10/08 02:30:04 riastradh Exp $$NetBSD: portalgo.c,v 1.15 2022/11/04 09:01:53 ozaki-r Exp $$NetBSD: dest6.c,v 1.22 2018/04/13 11:01:14 maxv Exp $$NetBSD: frag6.c,v 1.78 2024/04/19 05:04:06 ozaki-r Exp $$NetBSD: icmp6.c,v 1.258 2024/07/05 04:31:54 rin Exp $$NetBSD: in6.c,v 1.293 2025/06/05 06:30:10 ozaki-r Exp $$NetBSD: in6_cksum.c,v 1.28 2011/04/25 22:05:05 yamt Exp $$NetBSD: in6_ifattach.c,v 1.122 2024/04/11 07:34:37 knakahara Exp $$NetBSD: in6_offload.c,v 1.13 2024/07/05 04:31:54 rin Exp $$NetBSD: in6_pcb.c,v 1.177 2022/11/04 09:04:27 ozaki-r Exp $$NetBSD: in6_print.c,v 1.1 2014/12/02 19:36:58 christos Exp $$NetBSD: in6_proto.c,v 1.131 2024/02/09 22:08:37 andvar Exp $$NetBSD: in6_src.c,v 1.92 2023/08/03 04:24:55 ozaki-r Exp $$NetBSD: ip6_forward.c,v 1.103 2024/06/29 13:00:44 riastradh Exp $$NetBSD: ip6_input.c,v 1.228 2024/06/29 13:00:44 riastradh Exp $$NetBSD: ip6_mroute.c,v 1.133 2025/01/02 16:10:22 andvar Exp $$NetBSD: ip6_output.c,v 1.235 2024/04/19 00:55:35 riastradh Exp $$NetBSD: mld6.c,v 1.102 2025/06/05 06:29:27 ozaki-r Exp $$NetBSD: nd6.c,v 1.284 2025/06/05 06:31:07 ozaki-r Exp $$NetBSD: nd6_nbr.c,v 1.186 2025/04/28 11:39:10 joe Exp $$NetBSD: nd6_rtr.c,v 1.149 2020/06/12 11:04:45 roy Exp $$NetBSD: raw_ip6.c,v 1.185 2024/07/05 04:31:54 rin Exp $$NetBSD: route6.c,v 1.25 2018/02/01 16:23:28 maxv Exp $$NetBSD: scope6.c,v 1.23 2020/06/16 17:12:18 maxv Exp $$NetBSD: udp6_usrreq.c,v 1.156 2024/10/08 02:30:05 riastradh Exp $$NetBSD: i2c.c,v 1.105 2025/09/23 06:28:20 thorpej Exp $$NetBSD: i2c_exec.c,v 1.21 2025/09/23 12:37:43 thorpej Exp $$NetBSD: i2c_subr.c,v 1.7 2025/09/23 12:37:43 thorpej Exp $$NetBSD: i2c_bitbang.c,v 1.14 2016/06/07 01:06:27 pgoyette Exp $$NetBSD: mii.c,v 1.59 2024/02/08 20:11:55 andvar Exp $$NetBSD: mii_bitbang.c,v 1.14 2019/01/22 03:42:27 msaitoh Exp $$NetBSD: mii_physubr.c,v 1.103 2023/05/22 02:12:13 msaitoh Exp $$NetBSD: mii_ethersubr.c,v 1.3 2020/03/15 23:04:50 thorpej Exp $$NetBSD: ukphy_subr.c,v 1.17 2020/03/15 23:04:50 thorpej Exp $$NetBSD: brgphy.c,v 1.91 2023/02/22 08:09:09 msaitoh Exp $$NetBSD: nsphy.c,v 1.66 2020/03/15 23:04:50 thorpej Exp $$NetBSD: nsphyter.c,v 1.46 2020/03/28 18:37:18 thorpej Exp $$NetBSD: qsphy.c,v 1.55 2020/03/15 23:04:50 thorpej Exp $$NetBSD: inphy.c,v 1.60 2020/03/15 23:04:50 thorpej Exp $$NetBSD: iophy.c,v 1.43 2020/03/15 23:04:50 thorpej Exp $$NetBSD: exphy.c,v 1.58 2020/03/15 23:04:50 thorpej Exp $$NetBSD: lxtphy.c,v 1.56 2021/08/20 20:25:28 andvar Exp $$NetBSD: icsphy.c,v 1.56 2020/03/15 23:04:50 thorpej Exp $$NetBSD: sqphy.c,v 1.56 2020/03/15 23:04:50 thorpej Exp $$NetBSD: dmphy.c,v 1.47 2020/03/15 23:04:50 thorpej Exp $$NetBSD: pnaphy.c,v 1.26 2020/03/15 23:04:50 thorpej Exp $$NetBSD: ukphy.c,v 1.55 2021/06/29 21:03:36 pgoyette Exp $$NetBSD: dmover_backend.c,v 1.9 2011/05/14 18:24:47 jakllsch Exp $$NetBSD: dmover_process.c,v 1.6 2025/08/18 20:59:54 andvar Exp $$NetBSD: dmover_request.c,v 1.8 2011/05/14 18:24:47 jakllsch Exp $$NetBSD: dmover_session.c,v 1.6 2011/05/14 18:24:47 jakllsch Exp $$NetBSD: dmover_util.c,v 1.5 2005/12/11 12:21:20 christos Exp $$NetBSD: drm_stub.c,v 1.1 2019/11/16 04:10:33 christos Exp $$NetBSD: wsdisplay.c,v 1.167 2025/09/19 05:22:20 mrg Exp $$NetBSD: wsemulconf.c,v 1.8 2010/02/02 16:18:29 drochner Exp $$NetBSD: wsemul_dumb.c,v 1.18 2018/09/03 16:29:34 riastradh Exp $$NetBSD: wsemul_vt100.c,v 1.52 2023/08/02 22:37:02 uwe Exp $$NetBSD: wsemul_vt100_subr.c,v 1.34 2023/08/03 22:11:41 uwe Exp $$NetBSD: wsemul_vt100_chars.c,v 1.15 2017/11/03 19:20:27 maya Exp $$NetBSD: wsemul_vt100_keys.c,v 1.11 2010/02/10 19:39:39 drochner Exp $$NetBSD: wsevent.c,v 1.47 2021/09/26 01:16:10 thorpej Exp $$NetBSD: wskbd.c,v 1.146 2025/04/07 11:25:42 hans Exp $$NetBSD: wskbdutil.c,v 1.19 2017/11/03 19:20:27 maya Exp $$NetBSD: wsmux.c,v 1.68 2025/04/07 11:18:44 hans Exp $$NetBSD: wsbellmux.c,v 1.1 2017/06/11 03:55:56 nat Exp $$NetBSD: rasops.c,v 1.128 2022/05/15 16:43:39 uwe Exp $$NetBSD: rasops_masks.c,v 1.10 2019/08/10 01:24:17 rin Exp $$NetBSD: rasops4.c,v 1.28 2019/08/14 00:51:10 rin Exp $$NetBSD: rasops8.c,v 1.51 2019/08/14 00:51:10 rin Exp $$NetBSD: rasops15.c,v 1.39 2019/08/14 00:51:10 rin Exp $$NetBSD: wsfont.c,v 1.83 2025/03/25 10:50:12 macallan Exp $$NetBSD: cd9660_bmap.c,v 1.5 2014/06/14 07:39:28 hannken Exp $$NetBSD: cd9660_lookup.c,v 1.33 2024/09/08 09:36:51 rillig Exp $$NetBSD: cd9660_node.c,v 1.38 2017/05/26 14:34:19 riastradh Exp $$NetBSD: cd9660_rrip.c,v 1.18 2015/03/28 19:24:05 maxv Exp $$NetBSD: cd9660_util.c,v 1.16 2024/05/25 06:27:57 tsutsui Exp $$NetBSD: cd9660_vfsops.c,v 1.105 2025/02/16 18:38:58 joe Exp $$NetBSD: cd9660_vnops.c,v 1.63 2024/02/02 20:27:26 christos Exp $$NetBSD: msdosfs_conv.c,v 1.20 2023/06/02 08:51:47 andvar Exp $$NetBSD: msdosfs_denode.c,v 1.60 2021/10/23 16:58:17 thorpej Exp $$NetBSD: msdosfs_fat.c,v 1.37 2024/05/13 00:24:19 msaitoh Exp $$NetBSD: msdosfs_lookup.c,v 1.41 2022/08/06 18:26:42 andvar Exp $$NetBSD: msdosfs_rename.c,v 1.4 2024/05/04 05:49:39 mlelstv Exp $$NetBSD: msdosfs_vfsops.c,v 1.138 2022/04/16 07:58:21 hannken Exp $$NetBSD: msdosfs_vnops.c,v 1.113 2024/09/11 00:27:54 perseant Exp $$NetBSD: krpc_subr.c,v 1.44 2024/10/20 14:01:52 mlelstv Exp $$NetBSD: nfs_bio.c,v 1.202 2024/02/13 21:40:02 andvar Exp $$NetBSD: nfs_boot.c,v 1.90 2024/07/05 04:31:54 rin Exp $$NetBSD: nfs_clntsocket.c,v 1.7 2024/07/05 04:31:54 rin Exp $$NetBSD: nfs_clntsubs.c,v 1.7 2023/03/21 15:47:46 christos Exp $$NetBSD: nfs_iod.c,v 1.9 2023/03/21 15:47:46 christos Exp $$NetBSD: nfs_kq.c,v 1.32 2021/10/20 03:08:18 thorpej Exp $$NetBSD: nfs_node.c,v 1.126 2020/05/01 08:43:00 hannken Exp $$NetBSD: nfs_socket.c,v 1.203 2025/02/22 09:27:05 mlelstv Exp $$NetBSD: nfs_subs.c,v 1.242 2022/02/09 21:50:24 andvar Exp $$NetBSD: nfs_vfsops.c,v 1.246 2024/05/13 00:11:22 msaitoh Exp $$NetBSD: nfs_vnops.c,v 1.325 2023/12/10 18:16:08 schmonz Exp $$NetBSD: ffs_alloc.c,v 1.174 2025/06/27 19:55:38 andvar Exp $$NetBSD: ffs_balloc.c,v 1.66 2022/11/17 06:40:40 chs Exp $$NetBSD: ffs_extattr.c,v 1.10 2022/11/28 04:52:04 chs Exp $$NetBSD: ffs_inode.c,v 1.131 2020/07/31 04:07:30 chs Exp $$NetBSD: ffs_snapshot.c,v 1.155 2023/05/11 23:11:25 chs Exp $$NetBSD: ffs_subr.c,v 1.54 2023/01/07 19:41:30 chs Exp $$NetBSD: ffs_tables.c,v 1.9 2005/12/11 12:25:25 christos Exp $$NetBSD: ffs_vfsops.c,v 1.384 2024/12/30 09:03:07 hannken Exp $$NetBSD: ffs_vnops.c,v 1.138 2021/12/14 11:06:12 chs Exp $$NetBSD: ufs_readwrite.c,v 1.129 2024/10/19 14:13:44 jakllsch Exp $$NetBSD: mfs_vfsops.c,v 1.117 2025/02/16 18:38:59 joe Exp $$NetBSD: mfs_vnops.c,v 1.64 2022/03/19 13:48:42 hannken Exp $$NetBSD: mfs_miniroot.c,v 1.1 2010/03/02 17:20:02 pooka Exp $$NetBSD: ufs_acl.c,v 1.5 2023/02/22 21:49:45 riastradh Exp $$NetBSD: ufs_bmap.c,v 1.54 2022/11/17 06:40:40 chs Exp $$NetBSD: ufs_inode.c,v 1.112 2020/09/05 16:30:13 riastradh Exp $$NetBSD: ufs_lookup.c,v 1.159 2024/09/08 09:36:52 rillig Exp $$NetBSD: ufs_rename.c,v 1.14 2021/10/20 03:08:19 thorpej Exp $$NetBSD: ufs_vfsops.c,v 1.61 2023/02/22 21:49:45 riastradh Exp $$NetBSD: ufs_vnops.c,v 1.262 2022/03/27 16:24:59 christos Exp $$NetBSD: uvm_amap.c,v 1.129 2023/09/10 14:54:34 ad Exp $$NetBSD: uvm_anon.c,v 1.80 2020/10/25 00:05:26 chs Exp $$NetBSD: uvm_aobj.c,v 1.157 2023/02/24 11:03:13 riastradh Exp $$NetBSD: uvm_bio.c,v 1.128 2023/04/09 09:00:56 riastradh Exp $$NetBSD: uvm_coredump.c,v 1.9 2025/08/10 19:49:39 andvar Exp $$NetBSD: uvm_device.c,v 1.80 2022/07/07 13:27:02 riastradh Exp $$NetBSD: uvm_fault.c,v 1.237 2024/03/15 07:09:37 andvar Exp $$NetBSD: uvm_glue.c,v 1.182 2023/10/04 20:34:19 ad Exp $$NetBSD: uvm_init.c,v 1.59 2023/09/23 18:21:12 ad Exp $$NetBSD: uvm_io.c,v 1.30 2024/05/03 07:09:20 skrll Exp $$NetBSD: uvm_km.c,v 1.166 2024/12/07 23:19:07 chs Exp $$NetBSD: uvm_loan.c,v 1.104 2020/06/11 22:21:05 ad Exp $$NetBSD: uvm_map.c,v 1.427 2025/04/27 17:40:55 riastradh Exp $$NetBSD: uvm_meter.c,v 1.80 2020/06/14 21:41:42 ad Exp $$NetBSD: uvm_mmap.c,v 1.186 2025/02/24 21:32:26 andvar Exp $$NetBSD: uvm_mremap.c,v 1.22 2025/02/24 21:32:26 andvar Exp $$NetBSD: uvm_object.c,v 1.25 2020/08/15 07:24:09 chs Exp $$NetBSD: uvm_page.c,v 1.256 2024/03/05 14:33:50 thorpej Exp $$NetBSD: uvm_page_array.c,v 1.9 2020/05/26 21:52:12 ad Exp $$NetBSD: uvm_page_status.c,v 1.6 2020/08/14 09:06:15 chs Exp $$NetBSD: uvm_pager.c,v 1.131 2024/03/15 07:09:37 andvar Exp $$NetBSD: uvm_pdaemon.c,v 1.134 2023/09/10 15:01:11 ad Exp $$NetBSD: uvm_pdpolicy_clock.c,v 1.42 2025/05/20 10:22:27 bouyer Exp $$NetBSD: uvm_pgflcache.c,v 1.6 2020/10/18 18:31:31 chs Exp $$NetBSD: uvm_pglist.c,v 1.92 2024/01/14 10:38:47 tnn Exp $$NetBSD: uvm_readahead.c,v 1.16 2023/09/23 18:21:12 ad Exp $$NetBSD: uvm_stat.c,v 1.46 2020/06/14 21:41:42 ad Exp $$NetBSD: uvm_swap.c,v 1.209 2025/02/22 09:36:29 mlelstv Exp $$NetBSD: uvm_unix.c,v 1.51 2022/01/10 18:04:20 christos Exp $$NetBSD: uvm_user.c,v 1.14 2011/02/02 15:13:34 chuck Exp $$NetBSD: uvm_vnode.c,v 1.121 2024/04/05 13:05:41 riastradh Exp $$NetBSD: debugsyms.c,v 1.4 2015/10/06 22:13:39 christos Exp $$NetBSD: param.c,v 1.70 2022/07/23 19:15:29 mrg Exp $$NetBSD: bufq_disksort.c,v 1.14 2017/05/04 11:03:27 kamil Exp $$NetBSD: bufq_fcfs.c,v 1.13 2017/05/04 11:03:27 kamil Exp $$NetBSD: core_elf32.c,v 1.67 2021/01/02 02:13:42 rin Exp $$NetBSD: core_netbsd.c,v 1.24 2019/11/20 19:37:53 pgoyette Exp $$NetBSD: cnmagic.c,v 1.14 2017/05/04 11:01:16 kamil Exp $$NetBSD: exec_elf32.c,v 1.144 2024/12/06 16:19:41 riastradh Exp $$NetBSD: exec_elf.c,v 1.107 2024/12/06 16:19:41 riastradh Exp $$NetBSD: exec_script.c,v 1.85 2024/12/06 16:19:41 riastradh Exp $$NetBSD: exec_subr.c,v 1.91 2024/12/06 16:48:13 riastradh Exp $$NetBSD: init_main.c,v 1.552 2025/05/08 05:31:16 imil Exp $$NetBSD: init_sysctl.c,v 1.228 2023/09/09 16:01:09 christos Exp $$NetBSD: init_sysctl_base.c,v 1.9 2023/12/20 20:35:37 andvar Exp $$NetBSD: init_sysent.c,v 1.346 2024/10/09 16:29:10 christos Exp $$NetBSD: kern_acct.c,v 1.99 2021/12/05 04:35:38 msaitoh Exp $$NetBSD: kern_auth.c,v 1.84 2023/10/04 22:17:09 ad Exp $$NetBSD: kern_cfglock.c,v 1.1 2010/08/21 13:17:31 pgoyette Exp $$NetBSD: kern_clock.c,v 1.151 2023/09/02 17:44:59 riastradh Exp $$NetBSD: kern_condvar.c,v 1.63 2023/11/02 10:31:55 martin Exp $$NetBSD: kern_core.c,v 1.39 2023/10/04 22:17:09 ad Exp $$NetBSD: kern_cpu.c,v 1.98 2025/01/17 04:11:33 mrg Exp $$NetBSD: kern_descrip.c,v 1.266 2025/07/16 19:14:13 kre Exp $$NetBSD: kern_entropy.c,v 1.73 2025/03/11 14:30:28 riastradh Exp $$NetBSD: kern_event.c,v 1.150 2023/09/21 09:31:50 msaitoh Exp $$NetBSD: kern_exec.c,v 1.531 2025/07/16 19:14:13 kre Exp $$NetBSD: kern_exit.c,v 1.300 2025/03/16 15:52:18 riastradh Exp $$NetBSD: kern_fork.c,v 1.232 2025/07/16 19:14:13 kre Exp $$NetBSD: kern_idle.c,v 1.36 2024/03/01 04:32:38 mrg Exp $$NetBSD: kern_hook.c,v 1.15 2024/01/17 10:18:41 hannken Exp $$NetBSD: kern_kthread.c,v 1.49 2023/09/23 14:40:42 ad Exp $$NetBSD: kern_lock.c,v 1.188 2024/01/14 11:46:05 andvar Exp $$NetBSD: kern_lwp.c,v 1.270 2025/04/11 16:04:43 andvar Exp $$NetBSD: kern_malloc.c,v 1.158 2019/11/14 16:23:52 maxv Exp $$NetBSD: kern_module.c,v 1.173 2025/05/05 00:31:48 pgoyette Exp $$NetBSD: kern_module_hook.c,v 1.4 2019/12/13 08:02:53 skrll Exp $$NetBSD: kern_module_vfs.c,v 1.19 2025/03/20 13:26:54 pgoyette Exp $$NetBSD: kern_mutex.c,v 1.112 2023/10/15 10:28:23 riastradh Exp $$NetBSD: kern_mutex_obj.c,v 1.15 2023/10/02 21:03:55 ad Exp $$NetBSD: kern_ntptime.c,v 1.64 2022/10/26 23:23:52 riastradh Exp $$NetBSD: kern_physio.c,v 1.102 2022/07/10 23:11:55 riastradh Exp $$NetBSD: kern_pmf.c,v 1.51 2022/08/24 11:41:39 riastradh Exp $$NetBSD: kern_proc.c,v 1.280 2025/06/02 16:27:04 andvar Exp $$NetBSD: kern_prot.c,v 1.122 2020/05/23 23:42:43 ad Exp $$NetBSD: kern_ras.c,v 1.42 2022/08/08 22:31:45 riastradh Exp $$NetBSD: kern_rate.c,v 1.2 2012/12/12 11:10:56 pooka Exp $$NetBSD: kern_reboot.c,v 1.5 2024/03/05 14:15:36 thorpej Exp $$NetBSD: kern_resource.c,v 1.195 2023/10/04 20:28:06 ad Exp $$NetBSD: kern_runq.c,v 1.72 2025/10/03 16:40:26 thorpej Exp $$NetBSD: kern_rwlock.c,v 1.76 2023/10/15 10:28:48 riastradh Exp $$NetBSD: kern_rwlock_obj.c,v 1.13 2023/10/02 21:03:55 ad Exp $$NetBSD: kern_scdebug.c,v 1.2 2019/03/14 19:51:49 palle Exp $$NetBSD: sys_syscall.c,v 1.16 2025/06/01 23:30:36 bad Exp $$NetBSD: kern_sig.c,v 1.410 2025/03/13 12:48:21 riastradh Exp $$NetBSD: kern_sleepq.c,v 1.87 2023/11/02 10:31:55 martin Exp $$NetBSD: kern_softint.c,v 1.76 2024/03/01 04:32:38 mrg Exp $$NetBSD: kern_ssp.c,v 1.7 2016/12/06 02:55:42 christos Exp $$NetBSD: kern_stub.c,v 1.50 2020/08/01 02:04:55 riastradh Exp $$NetBSD: kern_subr.c,v 1.231 2023/01/19 07:40:58 mlelstv Exp $$NetBSD: kern_synch.c,v 1.366 2023/11/22 13:18:48 riastradh Exp $$NetBSD: kern_syscall.c,v 1.21 2020/08/31 19:51:30 christos Exp $$NetBSD: kern_sysctl.c,v 1.271 2024/09/08 09:36:51 rillig Exp $$NetBSD: kern_tc.c,v 1.78 2025/07/15 22:15:03 andvar Exp $$NetBSD: kern_threadpool.c,v 1.23 2021/01/23 16:33:49 riastradh Exp $$NetBSD: kern_time.c,v 1.228 2025/03/19 14:27:05 pho Exp $$NetBSD: kern_timeout.c,v 1.79 2023/10/08 13:23:05 ad Exp $$NetBSD: kern_turnstile.c,v 1.56 2025/06/27 21:36:24 andvar Exp $$NetBSD: kern_todr.c,v 1.49 2025/09/08 00:12:21 thorpej Exp $$NetBSD: kern_uidinfo.c,v 1.13 2021/12/28 13:28:24 riastradh Exp $$NetBSD: kern_uuid.c,v 1.20 2014/10/05 10:00:03 riastradh Exp $$NetBSD: sched_4bsd.c,v 1.47 2025/01/17 04:11:33 mrg Exp $$NetBSD: subr_acl_posix1e.c,v 1.1 2020/05/16 18:31:50 christos Exp $$NetBSD: subr_acl_nfs4.c,v 1.2 2024/01/19 19:07:38 christos Exp $$NetBSD: subr_autoconf.c,v 1.315 2025/10/03 16:49:07 thorpej Exp $$NetBSD: subr_blist.c,v 1.16 2024/09/08 17:28:36 rillig Exp $$NetBSD: subr_bufq.c,v 1.27 2019/02/17 23:17:41 bad Exp $$NetBSD: subr_callback.c,v 1.7 2009/11/24 20:11:50 rmind Exp $$NetBSD: subr_cprng.c,v 1.44 2023/08/05 11:21:24 riastradh Exp $$NetBSD: subr_cpu.c,v 1.23 2025/06/23 22:50:23 ad Exp $$NetBSD: subr_cpufreq.c,v 1.10 2023/04/09 09:18:09 riastradh Exp $$NetBSD: subr_copy.c,v 1.19 2023/05/22 14:07:24 riastradh Exp $$NetBSD: subr_device.c,v 1.16 2025/10/04 01:12:15 thorpej Exp $$NetBSD: subr_devsw.c,v 1.53 2024/10/13 22:25:38 chs Exp $$NetBSD: subr_disk.c,v 1.138 2025/04/13 14:00:59 jakllsch Exp $$NetBSD: subr_disklabel.c,v 1.3 2019/04/07 02:58:02 rin Exp $$NetBSD: subr_disk_open.c,v 1.15 2020/02/29 14:44:44 mlelstv Exp $$NetBSD: subr_emul.c,v 1.2 2019/01/27 02:08:43 pgoyette Exp $$NetBSD: subr_evcnt.c,v 1.17 2021/04/17 00:05:31 mrg Exp $$NetBSD: subr_exec_fd.c,v 1.12 2021/06/29 22:40:53 dholland Exp $$NetBSD: subr_extent.c,v 1.89 2019/08/15 09:04:22 skrll Exp $$NetBSD: subr_hash.c,v 1.13 2025/08/06 11:11:34 andvar Exp $$NetBSD: subr_humanize.c,v 1.2 2019/03/12 00:25:44 kre Exp $$NetBSD: subr_interrupt.c,v 1.5 2021/12/10 20:36:04 andvar Exp $$NetBSD: subr_iostat.c,v 1.26 2024/05/04 13:33:18 mlelstv Exp $$NetBSD: subr_ipi.c,v 1.11 2023/02/24 11:02:27 riastradh Exp $$NetBSD: subr_kcpuset.c,v 1.20 2023/09/23 18:21:11 ad Exp $$NetBSD: subr_kmem.c,v 1.89 2023/09/10 14:29:13 ad Exp $$NetBSD: subr_kobj.c,v 1.78 2023/04/28 07:33:57 skrll Exp $$NetBSD: subr_localcount.c,v 1.8 2024/08/16 21:54:17 riastradh Exp $$NetBSD: subr_lockdebug.c,v 1.83 2022/09/02 06:01:38 nakayama Exp $$NetBSD: subr_log.c,v 1.66 2025/04/09 05:38:01 rin Exp $$NetBSD: subr_lwp_specificdata.c,v 1.5 2024/09/01 19:56:18 andvar Exp $$NetBSD: subr_once.c,v 1.7 2019/03/19 08:16:51 ryo Exp $$NetBSD: subr_optstr.c,v 1.8 2023/04/20 09:04:45 skrll Exp $$NetBSD: subr_pcq.c,v 1.20 2023/02/24 11:02:27 riastradh Exp $$NetBSD: subr_pcu.c,v 1.28 2023/04/09 09:18:09 riastradh Exp $$NetBSD: subr_percpu.c,v 1.25 2020/05/11 21:37:31 riastradh Exp $$NetBSD: subr_pool.c,v 1.295 2025/05/26 08:32:11 bouyer Exp $$NetBSD: subr_prf.c,v 1.203 2023/08/29 21:23:14 andvar Exp $$NetBSD: subr_prof.c,v 1.50 2021/08/14 17:51:20 ryo Exp $$NetBSD: subr_pserialize.c,v 1.24 2023/10/04 20:28:06 ad Exp $$NetBSD: subr_psref.c,v 1.18 2022/02/12 16:31:06 macallan Exp $$NetBSD: subr_specificdata.c,v 1.14 2017/06/01 02:45:13 chs Exp $$NetBSD: subr_time.c,v 1.42 2025/10/05 18:51:50 riastradh Exp $$NetBSD: subr_time_arith.c,v 1.5 2025/10/05 18:54:02 riastradh Exp $$NetBSD: subr_thmap.c,v 1.15 2023/10/17 11:57:20 riastradh Exp $$NetBSD: subr_vmem.c,v 1.118 2024/12/06 19:17:59 riastradh Exp $$NetBSD: subr_workqueue.c,v 1.48 2024/03/01 04:32:38 mrg Exp $$NetBSD: subr_xcall.c,v 1.39 2025/04/01 03:16:41 ozaki-r Exp $$NetBSD: sys_aio.c,v 1.52 2025/10/10 17:08:01 kre Exp $$NetBSD: sys_descrip.c,v 1.52 2025/07/16 19:14:13 kre Exp $$NetBSD: sys_epoll.c,v 1.4 2023/07/30 18:31:13 christos Exp $$NetBSD: sys_eventfd.c,v 1.11 2023/11/19 17:16:00 riastradh Exp $$NetBSD: sys_futex.c,v 1.26 2025/03/05 14:01:55 riastradh Exp $$NetBSD: sys_generic.c,v 1.134 2022/07/10 23:12:12 riastradh Exp $$NetBSD: sys_getrandom.c,v 1.2 2021/12/28 13:22:43 riastradh Exp $$NetBSD: sys_memfd.c,v 1.12 2025/08/02 15:46:04 gutteridge Exp $$NetBSD: sys_module.c,v 1.30 2022/05/24 06:20:05 andvar Exp $$NetBSD: sys_mqueue.c,v 1.49 2024/07/01 01:35:53 christos Exp $$NetBSD: sys_lwp.c,v 1.89 2023/10/15 10:29:24 riastradh Exp $$NetBSD: sys_process.c,v 1.180 2020/05/26 00:50:53 kamil Exp $$NetBSD: sys_process_lwpstatus.c,v 1.5 2025/01/11 19:42:04 christos Exp $$NetBSD: sys_pset.c,v 1.24 2020/05/23 23:42:43 ad Exp $$NetBSD: sys_select.c,v 1.68 2024/11/26 23:10:15 khorben Exp $$NetBSD: sys_sig.c,v 1.58 2024/07/14 05:10:40 kre Exp $$NetBSD: sys_sched.c,v 1.50 2023/04/09 09:18:09 riastradh Exp $$NetBSD: sys_socket.c,v 1.84 2024/12/06 18:44:00 riastradh Exp $$NetBSD: sys_timerfd.c,v 1.11 2024/12/19 23:50:22 riastradh Exp $$NetBSD: tty.c,v 1.313 2024/07/14 05:10:40 kre Exp $$NetBSD: tty_conf.c,v 1.57 2021/08/09 20:49:10 andvar Exp $$NetBSD: tty_bsdpty.c,v 1.20 2014/04/04 18:11:58 christos Exp $$NetBSD: tty_pty.c,v 1.149 2021/10/11 01:07:36 thorpej Exp $$NetBSD: tty_ptm.c,v 1.47 2025/08/05 23:56:21 gutteridge Exp $$NetBSD: tty_subr.c,v 1.43 2019/12/27 09:41:51 msaitoh Exp $$NetBSD: tty_tty.c,v 1.41 2020/05/23 23:42:43 ad Exp $$NetBSD: uipc_accf.c,v 1.16 2024/12/06 18:44:00 riastradh Exp $$NetBSD: uipc_domain.c,v 1.112 2024/12/07 02:31:14 riastradh Exp $$NetBSD: uipc_mbuf.c,v 1.255 2024/12/15 11:07:10 skrll Exp $$NetBSD: link_proto.c,v 1.41 2025/06/05 06:29:27 ozaki-r Exp $$NetBSD: uipc_proto.c,v 1.24 2024/12/06 18:36:31 riastradh Exp $$NetBSD: uipc_sem.c,v 1.62 2024/12/06 18:44:00 riastradh Exp $$NetBSD: uipc_socket.c,v 1.314 2025/07/16 19:14:13 kre Exp $$NetBSD: uipc_socket2.c,v 1.148 2025/09/14 14:24:12 andvar Exp $$NetBSD: uipc_syscalls.c,v 1.215 2025/07/16 19:14:13 kre Exp $$NetBSD: uipc_usrreq.c,v 1.209 2025/07/16 19:14:13 kre Exp $$NetBSD: vfs_acl.c,v 1.3 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vfs_bio.c,v 1.306 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vfs_cache.c,v 1.159 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vfs_cwd.c,v 1.12 2024/12/07 02:11:42 riastradh Exp $$NetBSD: vfs_dirhash.c,v 1.16 2024/12/07 02:11:42 riastradh Exp $$NetBSD: vfs_getcwd.c,v 1.63 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vfs_hooks.c,v 1.9 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vfs_init.c,v 1.67 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vfs_lockf.c,v 1.83 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vfs_lookup.c,v 1.239 2025/09/14 14:24:13 andvar Exp $$NetBSD: vfs_mount.c,v 1.110 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vfs_quotactl.c,v 1.40 2014/06/28 22:27:50 dholland Exp $$$NetBSD: vfs_subr.c,v 1.502 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vfs_syscalls.c,v 1.571 2025/07/16 19:14:13 kre Exp $$NetBSD: vfs_trans.c,v 1.73 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vfs_vnode.c,v 1.156 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vfs_vnops.c,v 1.246 2025/07/09 07:39:39 bad Exp $$NetBSD: vfs_xattr.c,v 1.41 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vnode_if.c,v 1.119 2023/06/15 09:15:13 hannken Exp $$NetBSD: dead_vfsops.c,v 1.13 2022/10/26 23:39:43 riastradh Exp $$NetBSD: dead_vnops.c,v 1.67 2022/10/26 23:39:43 riastradh Exp $$NetBSD: fifo_vnops.c,v 1.91 2021/10/11 01:07:36 thorpej Exp $$NetBSD: genfs_io.c,v 1.104 2024/04/05 13:05:40 riastradh Exp $$NetBSD: genfs_rename.c,v 1.7 2021/10/20 13:29:06 thorpej Exp $$NetBSD: genfs_vfsops.c,v 1.11 2022/07/08 07:42:06 hannken Exp $$NetBSD: genfs_vnops.c,v 1.220 2023/03/03 10:02:51 hannken Exp $$NetBSD: layer_subr.c,v 1.39 2022/04/10 09:50:46 andvar Exp $$NetBSD: layer_vfsops.c,v 1.56 2022/12/09 10:33:18 hannken Exp $$NetBSD: layer_vnops.c,v 1.72 2021/10/20 03:08:18 thorpej Exp $$NetBSD: spec_vnops.c,v 1.219 2025/01/06 09:45:49 mlelstv Exp $$NetBSD: clock_subr.c,v 1.27 2016/08/15 15:51:39 jakllsch Exp $$NetBSD: dksubr.c,v 1.118 2025/02/18 17:09:34 mlelstv Exp $$NetBSD: dk.c,v 1.173 2025/04/13 14:01:00 jakllsch Exp $$NetBSD: dkwedge_apple.c,v 1.6 2020/04/11 16:00:34 jdolecek Exp $$NetBSD: dkwedge_gpt.c,v 1.26 2020/04/11 16:00:34 jdolecek Exp $$NetBSD: md.c,v 1.87 2023/01/13 15:46:40 hannken Exp $$NetBSD: mm.c,v 1.25 2024/08/25 11:29:38 uwe Exp $$NetBSD: random.c,v 1.12 2024/08/27 00:56:47 riastradh Exp $$NetBSD: bpf.c,v 1.258 2024/10/20 14:03:51 mlelstv Exp $$NetBSD: bpf_filter.c,v 1.73 2024/09/02 15:34:08 christos Exp $$NetBSD: bpf_stub.c,v 1.8 2018/06/25 03:22:14 msaitoh Exp $$NetBSD: dl_print.c,v 1.8 2021/05/27 13:40:38 christos Exp $$NetBSD: if.c,v 1.535 2025/06/12 10:23:43 ozaki-r Exp $$NetBSD: if_ethersubr.c,v 1.332 2025/10/04 04:44:19 thorpej Exp $$NetBSD: if_loop.c,v 1.119 2025/09/21 15:11:52 christos Exp $$NetBSD: if_media.c,v 1.54 2022/09/03 02:47:59 thorpej Exp $$NetBSD: if_stats.c,v 1.5 2024/06/29 02:18:35 riastradh Exp $$NetBSD: nd.c,v 1.8 2025/08/18 06:46:43 ozaki-r Exp $$NetBSD: pfil.c,v 1.42 2022/08/16 04:35:57 knakahara Exp $$NetBSD: pktqueue.c,v 1.22 2023/05/28 08:09:34 andvar Exp $$NetBSD: net_stats.c,v 1.6 2020/02/07 12:35:33 thorpej Exp $$NetBSD: radix.c,v 1.49 2020/10/18 13:07:31 gson Exp $$NetBSD: raw_cb.c,v 1.24 2017/09/25 01:56:22 ozaki-r Exp $$NetBSD: raw_usrreq.c,v 1.66 2024/07/05 04:31:53 rin Exp $$NetBSD: route.c,v 1.240 2025/09/21 15:11:52 christos Exp $$NetBSD: rss_config.c,v 1.3 2021/09/24 04:11:02 knakahara Exp $$NetBSD: rtbl.c,v 1.7 2017/06/01 02:45:14 chs Exp $$NetBSD: rtsock.c,v 1.256 2022/08/27 08:36:41 skrll Exp $$NetBSD: rtsock_shared.c,v 1.23 2022/10/04 07:06:31 msaitoh Exp $$NetBSD: if_arp.c,v 1.317 2024/11/13 09:25:52 roy Exp $$NetBSD: in4_cksum.c,v 1.20 2014/11/30 18:15:41 christos Exp $$NetBSD: in_cksum.c,v 1.22 2008/01/25 21:12:15 joerg Exp $$NetBSD: ip_encap.c,v 1.78 2025/02/26 04:49:45 andvar Exp $$NetBSD: gpiolib.c,v 1.1 2024/12/17 12:44:33 martin Exp $$NetBSD: secmodel_suser.c,v 1.58 2024/03/01 22:01:03 andvar Exp $$NetBSD: secmodel_securelevel.c,v 1.37 2020/12/05 17:33:53 thorpej Exp $$NetBSD: secmodel_extensions.c,v 1.16 2023/04/22 13:54:19 riastradh Exp $$NetBSD: secmodel_extensions_vfs.c,v 1.1 2023/04/22 13:54:19 riastradh Exp $$NetBSD: secmodel_bsd44.c,v 1.17 2020/03/16 21:20:12 pgoyette Exp $$NetBSD: dkcksum.c,v 1.1 2021/05/17 08:50:36 mrg Exp $$NetBSD: entpool.c,v 1.1 2020/04/30 03:28:19 riastradh Exp $$NetBSD: hexdump.c,v 1.4 2017/12/09 00:51:52 christos Exp $$NetBSD: radixtree.c,v 1.34 2024/05/04 17:58:24 chs Exp $$NetBSD: xlat_mbr_fstype.c,v 1.10 2025/03/02 22:04:07 jakllsch Exp $$NetBSD: strcpy_arm.S,v 1.7 2024/02/08 20:51:24 andvar Exp $$NetBSD: popcount32.c,v 1.5 2015/05/29 19:39:41 matt Exp $$NetBSD: strrchr_arm.S,v 1.6 2013/08/25 06:15:06 matt Exp $$NetBSD: strlcat_arm.S,v 1.6 2014/05/06 16:02:11 joerg Exp $$NetBSD: murmurhash.c,v 1.9 2025/09/15 21:26:19 christos Exp $$NetBSD: sha2.c,v 1.26 2024/01/20 14:55:02 christos Exp $$NetBSD: sha1.c,v 1.7 2021/10/28 15:09:08 christos Exp $$NetBSD: getfstypename.c,v 1.11 2021/07/22 13:54:38 skrll Exp $$NetBSD: proc_compare.c,v 1.3 2020/01/06 13:21:18 skrll Exp $$NetBSD: snprintb.c,v 1.50 2025/10/09 18:51:41 rillig Exp $$NetBSD: strlen_arm.S,v 1.11 2023/01/15 08:43:03 skrll Exp $$NetBSD: keccak.c,v 1.1 2017/11/30 05:47:24 riastradh Exp $$NetBSD: strtoull.c,v 1.6 2013/04/16 21:44:06 joerg Exp $$NetBSD: strtoll.c,v 1.7 2013/04/16 21:44:06 joerg Exp $$NetBSD: strncmp.S,v 1.2 2013/08/19 00:57:25 matt Exp $$NetBSD: rb.c,v 1.16 2021/09/16 21:29:41 andvar Exp $$NetBSD: strtoul.c,v 1.3 2008/08/20 19:58:34 oster Exp $$NetBSD: strchr_arm.S,v 1.8 2013/08/19 17:50:04 matt Exp $$NetBSD: strcmp.S,v 1.2 2013/08/19 00:56:12 matt Exp $$NetBSD: memcmp.S,v 1.5 2015/03/26 13:34:51 justin Exp $$NetBSD: __aeabi_idiv0.c,v 1.3 2014/01/29 22:29:43 joerg Exp $GCC: (NetBSD nb1 20250915) 14.3.01bEx ]U7~75znDd A  JC"ҭ4*JM#bP'n@AIĐĆuϮ;ޫ쵾ZԻgg=vSCQ4},M K4Áo ȥ4s 0}tI#N }|UIӕ;iw~JiZy8w4ԓޫJz/VJSY~K@d}:rSK1UiIZa>3__T7nKSd/Rϯz/ =mm5js**١oPߠ|z~k%;?]y\Uy'>vi/d2ӷw k@ zt@>pnA1M{ߐ)GϾؓ:z4?,żocU㵹 xak{6X̎!}iQ3N.w=#}Jia-]X~V]yPa5;~YMNiNrYi=KҔiS+Jv =N}1Mǥs}gkY x۫l_O{O@ʴ+:kfQh _7 :>*=4p¦5Ϩ(}뱃jvxxg Y} ׭;8>0,=@w?Kgpݙ~)/7mC/R~P1KS_۽̃ـDk)|]UӨ }Gz}Di(K*os~xjkյmi~i d紾e?}iW{D%:T~A~Q~J^~3Ӵ$Mg6t9siiʧ)R*'>7W1H|޻(;%{~KQc1̞QM ;:/M7~+4]87 }I4];Wu.̺LqwҰھuI?6r}ۗeʳ'_6;hs_Ni1_y_?@NI/Rt?6yZ,I}^Vtk{t2ۆ1i "w3PkAYՁn>||Wov^{/d<o Ͳ2Uq W ڬcTmvP*3%s=Գ'4\zaj=;87ɺD5 yNRV~%5*ecr_4N %摙73R_RT|=wMytA':9}(+{X8翔4_'4W,H>>&4d| c>hV:?Rsw72.0,h+ߨc)ϖ:'\'>*q[>BVF}ODp5M̶4}dH94쒖O2{Nij^$mMImz<}'B{g\UdIǟN_fg#ͬ|ޗ"MOpoEK~XW}{~3ۏO5q=7Ln0wpȇϠ~H4Zvs|)0?yL{g%iS\n>ERA3tf/qGQs冦'Jck#(&Y{hilcR3*}t5W_ײO{z yk^i:oiftRJk\l;5EAkܐ~i<2}8hu*[\6͊޷e+<*87>oسeģ feuQ׏@VwҏY~g):sS]Wlc_kHwy&KVߗsY Nr^_!zK$7,sW"wY~+O?,:tJ&~;nI;? d|' i:y =&eoFoJVK:@ N9}}%~|=O^=~ݓZBy\ܗ%]°zk)]2bތluRf;trLyw}fQ,}eOy3o:w7>H9sܝ.(NQ߼>wR{^i_ﹴTySإ2Hd͜o;@ zd#r>q[{?(}Vܻq+ŦLpeX0o?EyĚm^ge{Uk گBW!@T3~}uUe6;|٥] vo9x:kRe6;=tGc qahsQǪ|>'u3~V3er~j^ [Q.^;WGzGD eoM* \)-sOun2d-A'}֜FF72Yn኏eŗ>/|uJny1~fў7N'ׇVMQi-nkҿZ5RheFL*g>62G=72u/IwuLZOVu巧v_~Qٵa߼5n;[7M⡏̛CIϐ-jյ#TkO>to95èJx7s,vc*?^;-med:C[JNwfT6Mu~qާrc׎ڶyȲsg$ʊ6gFq,/W}(:?.n}Ľ XuS9t;ǼIb?+|V'߽(u=?1C83<}3 嚳X'ǘO_e zOq߮MɃ'j\ICꟳƠg\+媛lj~sjeӧ B}vП9bzzdNPi~4/d[4mޞNltŨٶ-<̜iWȦ#SW|0!=OvVߟӧی0{1OյP#}MC<7\رa8?Kt-'7;R0*̇_T;0|l s9Ξ=zm8֨*q=ԹM[Dץtee,u{=ߥ2b$#r7'u6KD3>9q>65O{O4ݪWWX?禆vܜO50"S" J.{?uXYLdONYY=y> _u6M웰sb}ñŻc~ri?6Cañ=`'ٰo{;>?'92|{6s+=Q! k.oVߥ߽+k6?uQ^!{(_kӴr/ru1:)o܊em uX))ı~;\ 7u/"%=Oם;a~,E}fZS?7Qz^A&[t->o8kTW.4o{ca;H\̚QI嵓esk3@7@{E[FBѺ %U :B=.̳}SAN^31y]Ox/]iߑsݖuW0=~5(U {]g&sۍ QGR=7d޸ޅukB@|o#yn5({Ii28T8]uaV^)5FmEiܠF|P*ZG;M5>6nq}t#ZZu}5w~> ʇި_셶itj{W`Z{xrV qαx};lu/{09ݧgU<|d8)EU[^c|`oGzy{N߿ *!lJ9@;󹽻8>Yw*_ƕ{SUcO\Ej/wuW.9kկ<';'TKI9}`鹵?v [AV*e^5k>];L1}*Jxߣk|ߙH[9]Uy">jcV^eJe7W,*<z}j/9A:C3˷V ~z>[L[x[Ӳ\{\~ߔ7kŹF M.wKs^[ gѸ+Գw6CZӎ1$0Ͽ eZ, l- R6&uݼKeY "y/[Bp>yW|DZxN_ˋ%tӚ6ci>$p__/krwU42}oWͦ[sje֪3/{h%ǸϽt׏7w"˚-s%S>-}јv2NXҙNtӹnJ7E[\[NIj:%<s;=xoL{2ޕDSyNtuLo>_:g:3W5ͻӾ^Ȳ~exˍ}^U'Ĕڱm{|Oݓe,oVhC(xHSx3r*' ̞ _A̯DL`<]},y&ܻhd%{8v]fnh4rj@赐q ' \2sI\Ce Yr֟(F mjV~wR &O3u؁Lf^ҲT6Ϭپct~)K+L3xܕه,| VsXɴ̜y1g{va^с?BW҅@<:O>{ kgjh dLݜ /A: Aܕvy?gD_>]yWnL&?<6yu^{X;/;iLwh D1)gJ:؃s춡EX׸o|e({ˏ6aLC֩sL|^%k0:):Ot3+@~.sb|Dy?{y(m*/|Mnvc˸wH<&aH'R~8r+h &p< WF!sn`$/qv˲FApPg_M*&0 cr[hĞFvX6(ac ϼ_?S.? *ψJ.s\AEٸ \淢0xoOUUqawq5~.x*0X ^!քŀ%eKL#YܘSU_<e,bl=;!9fIKEO> <9¿EA7wք{L݃*"`]4wiŦ=Nu c.)M\|Ns'z&<<і->?=(b 9N8r'8|hg:u c.q|TJ~*yxa,##ߍ\]^t<^y)?so& 7*Ք|y>a#ud;77r"xofKЅ ez+ጱ9eMM2u}\.znz3WQ8eҢ#6xsЙn]/8' k kTc`ھXvorHĵ=Z1ǼlLnNg ݶn̥Gn.g߳.r,G5SZ~Wm.g;XSqO_GϿhr{_溉U̶tKC筤̆Wl:োTķg?QZF:g%$}^RNs^t]Iy8_z%{9 \6ϼָ]sρe׭<%6D`:Ҿse\DD~G<.'*Gofp}dKzxh+ޣcʃz12Oje(#^+/uR֝N8F)ŃG:$<[Ǩf?Wḋך/;xnmDc޽h qy9l$_펹|t9_ {KsE:kŶ-{Ox~XٶY "ON@klLdT\Y†tD3%\10̚Д %}?vO@3 cH;M7</{bWCn,ǝK?W(5}>n^tfoVpǧ^0E{f㵡lʸE.}d2D|[z $y>dnlS\4ej66kg >Z )Aհv;|DswKәH $K#OH9%KŮ v`q}es ^ZѦ~;Ǫcu>Sy=~3i9>4ux-'\Ths3M=_;q͕-]3q32 u2<_-dkGovuq=^64Nޭ2>eFmu7ܒq)_.^'=.ͱMtLsCYilg:wa"n e(Tt0C&<8`o_=\D>~)ei<ߣXmۍEʓf}2Rhʘ~P|z%!˳,ᳵDG~y>@y*q(Rg[* {o'Z^?堻!^֥slt@;>=g/A{O-+9g`/48yEOLh>s,O t!h.m\ M ط??¾e'Ko{Ҟe01ԍ~=MS':3W!O,߿¾Zv|Ig 96}u¼/U"8fHr?5]XOG~t':m"cBQD~$,zsΉ#n.l.WWy\"H6{l5^_b - &Ǒ6.RJU&#oﯸMg𽖱ə@jҹ0]8ŗ6]ϔ boOg">nu :^Ji5}S^W^}KMְMKMP/5u;﫾3ƟdKNq܅!];bw8CghkʓYUJrbecgsy_Ӳ ۴ihPv7O&\K<)&|#{5:gi 9D:v,\oL8&;TvQT|IN="0q#~k%˓~cb*Vl;:ei8=4v bss .?s>e.~}{s ;lc}ag';(Z{u') o}߉vE3KL~òo?岉¡{.4mSgm^;2ߟ7Y<Oz7޳,Y} }l# |+X|J$mKt :uj>{ߠi׀\=k8F..~n"-m9b0WXRݑ7yʼnw)CY>ozAl)鋫X]>\ډd&&N9o~[B}}}׺]o!b΅3S퓽P6CPb@Oφ&2}]m!sl7.oMH{;Nv}~'PX;չ[o$e.{{?I?x[]꓋|=cVsycrnX±kߒ=d;r6ݨ z Xli'ʗQ57{?w k+璮U~Qq;؋ҫ77~vܫ󗇟 vńc9vwL@CzP=%w;tuOvːϻ3ػaӇ9hM;Z!}$qVBLDī&vDtPŒ&˯r,6p?y=(hz.W^_LfنT7`fv1s *3eðw$錻[8uqV[ >-N@Nqj]m} /9̓a]}$͕|.ҨGuukUMןʲUմٵun2>HFDf=(>+5Fe(:2|/w1_IJ'ߓ[; ~ᑉj29]gzz{Zz)}]%ZxV_t;YOpx}QZ{2ǐ莛>酧YZ|Prz!]} lG=YVh?%>X<T~s}4I0^Gi M98A_(.v<#iyڗf|>,3Ver7ڔ Gi_ƥVL]gҡe=_3ig}_.Cv}?U6/}rA>lx7 ?QO|{zw/Pc,7m/R!| E3}d/ⱏLM>aU {x,=k"+-89jIUx9i}gUtm({ tO_#8&wU`c>e<(& !'ZZ37p(鵛B8^Ev]'y_A12wL;Gzotgd$ja 2ە;-ڃ.>J?=kBX!߬Ɯ@;0cpqHzw/GNHs ɱU78=щd#JyA,J xYsvLXS˺/aa&}f;=,}] ' h +~>{9렉Njq|c#I1S0_}>s2}6E(;-X@·]3Ƕvj+ޡ'~N#~\,8TC"m3/yÚW.<\euC+ciC\lWb/㩑^<[/w H<-&`?<]GO:gb!2<e0̏}N0i-~y!o8=rH bK\{:Oʚ^>s?874cILFto1#>PK|`8>cXn ̸)t#ʾ)0^ޠ9?+u[~Gs8{Vȴf./ñ}o(lni);"GϿI2WG-#B}CYɏM{L|x~抢{ ߊdVGwJ|ػc#"wg&/*wT} cϵMl516c3 O nߞxl>=P1ۜN lQlNڰ;K.5]0&W?Ww3K :9iq%KD^c~dDo`|X11`ּ7`aOt.K(y߹ϯC_@zB'(gwr^SkZ 0q]@l^GOΙl)8+8F[k+gb Eb_1dtLGq'|<\p $gK #V nk"m{9܃Z6[WӢ˱h}&}MWvOĐ)G8?ϩ2z  H+c"I1ɟDT'Z)[2w}#}csL4`)3X.ٱIo~.ڵo M.GĔ/Aʇh,-<7] r߂1dO]q(z_9>U~|z`'A3?"]Cc@mv.?؇ؖށ]Ҽ̼ hXEUuWw{r||]$t,㛑lK?wEYhS ##˅k i$:l٣o :R9㘠 Hb>e d)qstt/l"d){4<<[zQ^o+:Jʖ aX[y^/?P4z{(Rj/>T C&G<¦sKvBeoޚ^Wa%..1j ۆ@C|"=ޤx[ "-L`\iOWٖ;}X|N`эW޴a7KLFe_:Fҵ걻}F?Γw| :P>y2ErTmH}Ou\meE{c☍&y%XTL<뼘/zXӂGbSTuI fŌFv(ءh-q-cQ*)cxÔ^UqG &؉ny]ȶ[gG Py8A⒜=ڏr /[鞿 |gkf'AmoX$>_׌85g66O)wu-F{ qo1bwKцهM#$$esDK^]|,5c$]w2aؠ.۠Gv}O1Sck0׉QEǶoICso.+B)&nu#FpzOLQwO3Z/ v՞lv_J>4-in߮x]pO噃ܺ=`^Zsfbb1;p.EΠޔu8Ǖ򸺹jyg^s']4BzeG:=k^ාDI۱4پh{2&K[[o1ȋqmX] /8lm l(;|Xc⛥]\I68HSB6VwPˬWVM [4?Ϩ#DڅSmPcuسd͊W~V9=[VXçUmXdl O囫`8}.(_Ľe|m=e47m>\t| ,+$)M9KMG4OBVSQq8h4{7m QY60OLPfG7o֢$盅! kI,9OPɈ{ғ^M~q:w ̴6 pFm$>biCb?|f<!0cB2ڞT |~| !ua 㢘3f S1`SO6 F˅Ez'Ev(BHr:䚬S}d 5~;mzu9%r|ȏ9S^*זKS澋޹8gW%O1v {GcX3ZQ|ES2&pikӬךiFՎJ猽Fxi^`df#\XaBp.esX /JO_Wlq;iAKcyܿfl]e]돚}j ى~PE>Lc+ ڴ2f:U?&"<{rք:Ad!K.Me{u|?Wy|^yl m`^-0 w=KVUZH,/vm]yS)#1-z`~xb:nn6fdgakŢ*ΑʊJyhs 髤8ʌށe~UOC!D m=`_/1hPb4dI`=}hC#[=2Ze%BEՑ~.^-z~wڲq?KeR;JeSֳAH1&^QC$>ƻfNs>e?jZ`H{#5Sye(&YkŊXYh ځBD>Cܔ7{GzOyA|o-|x1E 1o!gqWfЉxfN/  Ɨtyօ4uvs7f<à +*QX7Pn짂X`7J{UyONkGÄK:sľ IX^4q$5qZyxSt{srXK!yGF=H`tp\ܘm\xnM%BQ`} ŲuѿKfsmE7?T30Ͽ(.l^6<)eu8mSq:}rQdWA u}dxg y[17zxs &ahZ=&4 z~>ϷT{ŵowٜ.t"/Xĉ>7 bgS sA._TX?֪㵞kX=1l#c&zux8e,cUSR%3M'Jۊs)cgLŖXk.p2G|7l?SiZ1nGv̓{b9Ťm3|Rn+i뗹s"s]l`H^H7/m!p|Oɴ{@˦8u|0,D @hcTմaE 0vV^OL15^PBp>4^ײTe>dQk ]5:<_tl͙$+g?ncxv5-'}9۹K;e;J+@W$ͫkCD~s(;\=k¾.Y1p<7amN5ք 9FR|=7 qC#TH1$gBӕ2 lhl My?2.ӮٱLu s|5:qaьCFX)&/҃Kڷu(Yg@ہUa/GMfOeް{}Hf=-NoR'`;saDߐy,i|||w˽?D7^[gO<*xrAwCC 'b\<^5c;`+ٝwCvq0Nχpk0_s0_XOvno|Ch˜vvq.։)+'N6 kljoch `>i?2s\!ۦi4E-c.?q\. gLL?/3qWqfL2XB^lۇDp9˯3>;o$lH9FկKG;_X1*Kn~CXsa0-uKu{q\)znU&Q z\#|Wo4\sk}J{e `7DέS!?TxXǵo]" OWr]Wxgnÿd5E0->{>cȼGn>k3uO2s[umT6}6˜.GEZ6yas߼ߔK9"spSʷǚ7b YHl\!qsN_ qoCbApQI&]@*cTu9g3o5k؏ IbŦg v>he`_I}1tLj$զ7 ,Z,[>%2'bw$X%GB;xpH9%B~sqr6?oDW8x.ctu88F6*v|GWPKjlgfa><r,QRrhׂ.?==Zò$thSrm)$cN%`'0_Wgga/mWu nk>GB~1?h! 酚[_xrujg;2zhilL#gb+)|0lz!{ØKff?XkQ~>^M%lb/` |}KW_YcHl# pw ȴ17gئ\}"=)$/)qiۑ8tw'8&5Kd+r`첝A}-$8 T*qY(W}_ș6C q)NbsYX,#~_R=Pw=1 &F^,uc26G' ś~k\rc߻/wgM6>?n~֛TLt@heGc~eێ;yX6a_ scq{#['4M.ģB۠5;&Id3{DtFIeeG+G>g=_rDȀ2n_7:\0Of<A}|C'mUɒ]tv]oEJ'B.yNKNOJ 5@8?> 3ﭦþcE|`m$qFf>Zݤ/*ael~wE!O:_ D73,EcJzGQa}FO&)r6".+qE}ƴ "йM{?咽HH~=lj)#~mnQN_ t+Unԝlq ݣ;R6l_818b5Grz3gciakːr=6|~c+z_1ۅezź#~j7n({CT[e|nMWϲ]u`'FرA%` !G{|]hrE^eK{7I_ 8_<'FQO- =W!l-@FpǫBչ\~uQ,l@+ e4u:`O{DW`}`Ў;?hs9A|w.Z? 1}k+\O(3{b%_׿O:.?2>xK̷٘ms%9>p/Ρ_@[pk;G,kܤsg' e%Ţ=B8r.>9_l`6&vڤA<]JϧO @ꕮi>.U+rG`)C6 ;:✢, {KMccoKdЎ(?ԞS˹ peW&"N˹UɅ{ |I&yqdjk#&UӟH5V1mŗ z` Nx = 5}sZKߝ(TNĭay H 9ڑK_WWP 5FL=a,F^lΛ#fE҂̒1kQZ鳉t`>+O>\zWZ6A%SRGm{6~95rȸQw=}`W_TZvU|_p>J,\#=ߘôa{oU@vhDdٮeT2dUOWFцGbI֕Emi c8bKaY>fh'0߁ςrҚw|MA;%zGŇWt~w BnBB7s*eP1mtm=_bSEG+uu$]6xu7. mp|\S15"Kk"n$.V!p:cd+vmhWM`\uPgg^/b>3ľdۆv,&%PkĚ!%RQWҗ1pn m-OmCs_h801]FOxه06ճ ;g8p_"b6Lx!+;vH+~ƘRrصUG?ژ<M 7椺g2yt$ٓq~ys"yc;|E~F&f.j1.Ts|u!ňؔ:gޝQW$jwr&ncztKlJ#}Q9>fTScZ-ÚDzVnF:-G5ӏxGRYxҮlKE ؓoW6Tk^ Hl#wa? {5 Q~I6\!8|\lW/vrr}|QƯ5}ޣAF}wGbڙz>b-X<2mH~,5b<C~?lҸ+ʦ΄GC#`4gi`/#_8zjs6*џ<\,D{Ŋ`[{'͎8ol9Z+YM:v'X<^1]ԧKl+1) O"TcvA)S-R쯋"/f6l,InJc1+'x,AwN0'$Gh{lyz!c▛6;|\s%"f5KmfX*؉=kL )p#-C2V{_S,`6zL?VJ =ۣl16ee!/qC*Fݡđu!ݏw=5cKB]B wVw۸ 1YՄ>p#Ev MgߪK_N|G4ldGXBD|@Ɏ>q ;GfG}#n}CO"A._F8(c7o$7kނ.~_cV2D&@!xk|nqY΃81koI*dZ=&m@𹋅M_#` 6{FxC"S3+6țχ^ax«c y`G:mqo+'mA/xVޗ3+}=nE}Gbhd.+1~ e[1ޖ Y `;!^#ǞuEfi>Pm PqQGB*dG*{ᡡ,0;q ,h߅xow̔M/R1B { e[5o/y`I;O( )Z^7OVq1:b^g)@ =A%wla\\.s.p.oohI, yYUvgk(̧qN_Bb[3`9doζ.{4~oP>8=f_S׋6Wizyo8 m56<ănuӀEH@p_Ȕ{C8STWu11%\(U"MQ"w6QxA#:|]Ѵ1+u<<#gƌniVOKOlbdƇI<\uɏx^Cq~_/Ce3اatVՍ?7> &-4m}c-EU[~Nwl6 C6mjec4œܟ-lP)яUƴjOⱐ$c5h]%\al?v*DX'\2'(c_@~cXFG]*02OvЭ#o!i1WQƉ:~Z0`)- ?lr`{H>be4![@ݕJD dC;LzfTA$8'(Րg=ua`F)f?Bܥ l,7cQpJK=n[B˦\h7u0'tl7,|Nvs5Gd/bcջguɶkIut60pA6ׇ5'#-GA{i*=ZyH[x* b^^Xe̋3=ISE7.<qXa =eT® kwq5'rc6/̵la #[EWضypv~vz9t~8?ߩ|ce![⸽,9|.=_z@Eӭ"&D=VG߸ lS-[>ėq)٘K}8mW,W>`:;kJC,}F$/a6Z&Veh2\}FSLc˵^?#4}诮uK옩})~qpaӾepb7ҧĐBʢNl].l<j;ڞp]bgcjd1Ϊk垲 o%MPB*esKN#4c ѷ{nL?>ȔČv?ț197!#+bR:5rM%N~BN ŋG!ê^O_i{P=Q>X$5OOy/ #򈒡lR7j N.V|?+ Z.0q Aa==sUxoxbr)z|HJs~3+P{:waVX3G[/*7m[G+oXF?"ӂȽ>hͨcIvMn'їY@e;TuaEJ[^!?@P6bſ)[6WF3q;yGa_U:'}t-[y./&/%mr]1vd521ݡyO'|.6!~ cy`'ïԈ=Hĸ/ckS|ܱ|g[(1!>g冧qed%Pyd, ?M]ꘈ`@8/4u_+7VG=ԇ8.LLoo#cG(Ïa3>!goGyszjƒD^t|wFyi8W&зwPwYC@Nr&ȿpY\H<hmc7X'u5bzy}MIO>IMesqʃĚb? LW)q64woD]5gTuXt>\E~|eKŪ|/: ,' wdj%gW+>~op\/W\?lc%x顎3"te{|E\^r1H]U9F^y"b`LNi20;?B;uD~lDS )QM_m'<^}/4Xt5okЮ矅4\OcL_7vֺx$*K?G%uz Le5TܣϫSle9)qIE"+=[2C%7 σ o?C sc!c y zף?Q6F?_3y\#'RQfx|I#|r0tLu|Z*!'͑ Y\ym>zPeiҏ=Òl =4cCb^tx5 OۅC66_'dWz#>L ]uЋ=?3; =߂xsMa-|4؟!ƐɌQVIx!YL\ɮO!qxa7L;[ER{Zxύ,"ĶFR]w/} 2N2ӤSz,.h >Ɂ>eݛX|ZqOqCNur|ߎ1CC]W=Ke\_8K eDBzX-!zI(K)k -"WA `Y<,;<{|f=A\={D3D1?JV-#{Ҽ&MD<:fDwzy?{XeE`8 y9U+֟ԊugƿoV9%1姎1MAvؾCq',ϭgl근=TUY:mU ^9\H=m:^Q}ˇff:j[敕YP'X_F" f2byn}քax;g,J->ݯ*m㲹;x_&#>OqF8>/Ftt|ί;2VD<<}N[.w7CUb>E6˔xzI+G ']ecKzU/o.7ݧucT=ST%ba[k\[4'+gT/{ĵs~f-)+[9.?bZ?C囊E=TDLgrDuypbm>@ Ÿߝ]ӵɰ}.bOD"G:nA&$[SܹlǻVOݾs\%~ C WlN9V A>>[&|(/V[}%º;ךxŧjgyb̍vȓkʇyCYh_ #g D87q8zi=O>ʊ|KmM?Z+=d/sf3gb&.I^lnXS bFEYڗ'LoD~sn?l9 ||^q߫au"!|my硩TveV UK#4^6NcRx]5?cGOO>Ȗcؘؖ?W O6irq=?͕5|!yܢQbNw_p9׭>or^DؗX% {{2=M臹9a{N=SaߤTW)>.㰠ˆ 5b5*. {nLmQ1QT≾!EGٵq]6r">-ڵ$;{:܏ ŨдZf Ǎl̋itup/51 ?hJʈl8)l~5#چW5|/vvTy5~>M/M"}7ƞYq^Pdxxޖru 2 ag%Yu{VF,ZRWO7N ђ޹My~4.KM7#Q=&uظ D Da]yp0'ug=}ũK8 jmEo\OC0>[>-X)ҹ{'۽Lky}An8n{^8Dr:lN2bQnKDdO}evX^b}X39/5\3dxf*z;|Q{ g@\~dZryQCηsߞV ѕibz$JW8ۃߚ1n]v\.H?֭[bep8}"?%|K i{=.Jem1*_?^*bT׼:"w޷FFG5ָm.3{w%=9|.LDϋq'GZ.:+$uU]+=d`r+cֆ&|ޭ.d ap b1u'y:;ya,=\39?8ׂzFx1EFUK3;O0..sөPx8ꁈl 9/=ۓ|"~$=K?Grl(qq2,owe}t޸?;׽?W6NG>2y̞nIg#aEArI8bqŢ`^I[Zw؞A2?w s4/w߃eW'[ŴU4WJ*aW*–bss&#~;M}t/ou!j<f荥Ӌ}{LgxLO\r,8CHftص~ѥD vrf|A,*:|xof^>y"<8š,=r^/pXz~eG |o.֟a|L /IUCN[~5b:[cLcr9䊞99j:Jxoqbr]uiG\ת} ]eQy Z[?o8L#*k9ayqE3<ŗ؜ysLDU*T:_z^bs|/.@TNekcZ&\qV^eʵ7q|1bb-Z=D_P?N}+9j\S|']\Vn׋j>29'ϽxFxȬ _Xdz>#cZ˓4nCJHw?̋,iYWUce_:LK簪} :(~$RY1F1/"GB+1oKUGfz*d$_2ޟ{'yBuy2ˈc};e(5x8Q?"km$'ڮe3>8ˇjVۼM#|l ވ97s1/0 Iz9)+[TK⪞B~WY-j;~gLQ@Oyqbw\PF agӵoX6Dbň1@sߛ3SUwm.M䕰9Eʈs6Z*" kSgLa%¡cq2zߺ1TO~9Ws8.>h5~liei^j9x9m7MX#[:^|m;18I÷({_? x;O?aqSQb]g|u\ms;?m\Nz;V_g۹C|>m UMʷLYexD}CtE _9l_~| }>$?} ַeF؅~qc':b?ؗP\2hs.<+xuV%K`'~=3kGe:[> \) vJLs]i~]7&e7/q}9oO,lƗk^,:7]l.7+CnW&֦j]"|a = Ew}ƱIxq,\'NVw:c[6fp`?y0Tީwcc}\ R#݇,LXKa^wܽ3L<~5Yp܌d:qXlXz2=X|.ZLWrzc6{MI*Oe+|K ޒT=K>=ɳwt:D)?6iޤ2܇LhCbl.| xA:_\܎71 %(;>"w7g%9]&u?ߪVsTֱXLqĔrF\9mڒұkZ6\Rqw*uZ;Rσ(.lIR#G mWxo.+ǐU6Fl x=x|-z-2 ʞ&e/;R9y{l[}!y8~kn&Ƕ_3y='虙ouV3ymy-5`&-LNc嘎c>ם:YNb|Xc!ה/֒x͸/Y?7mg"~kY^׋8zUѸ3cik'wƟʁLٯ52nc}x`!xGy ^lʸYR]7/$[=tdςN|,#δmڭo5]KxmqR /nZ!X(N.aؕ+'syԹ[|R|^|K+u~*u~'u vl̳kd3>LlͲgf5yvlógf]<{n6%̳f%yG{a6˳g_nQKѭ{b8M>Wp_ӽP\<27Weo"#߸c/.d/V+@ŸQ;?籄<˘P/_ ['sY>O5mbK?^-}%|'z釤~"Aw~Dw~S@w+MOQmo9dR%J_.u*s)oX~kQ6{ LFao<2jKbBya)rF.ff,fy7vnqϝZwn0 9wWLcy]vvyv<{cOxڴQ2x}bn_N'|ӯ m. 1o!{?$u>%<gG; F%e\l'ʠ?p]Oiyi^uTf"yOz< *\H} +}֮Eζ\:gG%^C0%Pre\'1ƃ>>s1 *x7*3F*VYl؄ ~Z0`_^<2a,{xy-oZJU` L0)~;2❾22PP1q߷;Ce?fTQ*Lߠ˽Ux}*B߿Vy!\UMW&nê̏@ E0xAFdΏScϖ碳g/]0xsUց k%mk+~e:*̳E]\ WAeϜ* q"'E` ?=]xP032`̕CU[e:/ FcmQt&{c|J ^ߧK}><:^hu%]Uis YܾEVØ Ƙ1].cʵ' Ƙ#cz`5~fW?syՏuO1G?|Yee|~\bdPxiX2Ǵa1%.+^ж~DLyb^3Ϻró}uўs-B/>✃g v>w#/L}g| ƫpYRg%«ר5f=v6-g] o>?r| >AoogQ\<] d oz{Q:ߠjMVJO^N= Ȼbd攑|Sv r| 3_`~*L,k%5.N R (s6ekvgBo/լNe~53EVWeףش6+phO ":6#N8ۥ"5vT`&Y,YLx>}.+]ALʾTGoez@=UӺ rK___>yY7@/Y|R\OtsNװA\ZO_=vDzb͢A+/(dRx,Ac:hz|4vQ=ٯBʀ#|c' 9ihuy8˻M=QԃR~>K̞Z&'kT_*[gw<۵~u7^[7冰-&x:b_]iO-Us̃0 d8g:4|1^G> d| Y^sgC}ϳ 6# ߂@ Hw^$x/Sé  Kdm07H=ɱp*;==>3_׈1#۟]Rf?]Wܯ_'K4d  y`ѐ>!Q{5L=x^r==sPC޳\Ԑg`W`lX/ {-65W?}Ow\W?}/rrW?|W?rùO] 'v2:}o?hvE*Pyo؉\pHXF F# YH屵\r6bV^[`+nlZ{'[53<܈c4 t#-~Cp1K(xM.I5)k}K[g?X[?64?eM㚲=yD9)U΋wl{?6r{ wHy@vD?֔m gFf *kⓦjI=_Dn YB~R:sl\{0@V a,'>cvhs7=Ⴍ,fr/TfVu>y4&ܒf f<4S}O:zᧅ.l~FΛ?+NL7ӂs"v? ORt?hAC/m">9CG\̆5w9ns #G 58o|C8МmOԂnU[^,Ρ~WfrU<ϡ_um!m#ܧm6TER:դⷂsKIJ =jM i!4@4|{ _NxWɻ@]ЯvIۊ ?тyt神mizק-西m< ?]|K~/Z5M-b-/Ͼ\yـ-e2_- ҂WHxyK>QLx/!ר-9n ~6{ ([·:'@KsOB/ ?[B_K#IKϪb?"ང XS@ti L1BExP[Mx_.Օ_Eט/?pRVo7A=A7WFZq>K=7k2g%ND{_;}omk? .랋q|l3q|.-IE?FOkk M[1s!dzD%¿w,41'l*~GIuC'UfL&^UL:/\{,ViOj$yA܇o }RYʢ\hњ mz`chcu hWx|kaYFfq<)Rs"fӚ⥷~C[|{%±($M:@80ҁJ<^xUӋicd&Bomذh-FP?T\@ʣOZ/ѭQwt53ز;%F{mZרa]4{{c? ۓ0#p<= mtof7ڄǦM}*+eaeE7x0*ﲕp03}b=!]n6om>ͮ|GSFc1~\ -t3eAwg=t]Q[~0 3 =kͷrgр&l߇yYi8"|G%J}@Km&C S;n!i;1 k~]y ?tQsm툵/dMHLZ˚pg;/w#C@}̗G+ss2aB_CxR+N0_HxӤ 1@?)2ʽ,ݖ tmu^[сjӝu%\Ŭ+U7yӷІUVm^6Ѷ_ ߖc{k˾O7}~B[}O$\ϭCw܋gmkCN2-?~A³}mU}=/=BoM̥dmw(tu۲u&۱\:sߪc}N;GK6'ڎtl;"ס׎6O O0ӎ7vzV1^c^T R}!5o/60۫_D:X0lHc m A{Q+>۳{rs;žt1a[{a|. O0lN{glK)sؖ~2ػ@gv'3.&o]9]Mtʸ3:mF9y\)KV_N~'ߞg91tʝM;w#~d,Z:]?|+{Лi/Df/ 9܋5YEf|O0o k7X#$|ȌM:J|K$|Ȍ %2؎ |Ȍ!~|٧`37g}^hI7~U]Z;rǤ# ڎ|k!+:c/Hpl _]GYtTz:Qe;sT^Im;Nj;]v_itG 4^Nlq'mNJ;osiFӞ͝|S}n]u9x>=[k"{e)[&"RM=7$X,qB;.:?7tب${Wg}3 wOg0ovؓ~Yt'YF]:nՅ<`|ۨ ેVj.\K? /хuMgXz)\^oL,Aٿ$|eo.2E/=]B~ 9!EDumU↩r=~;ޕ tЁ]=_71]~C =ў[M{n;=#,*+m¥M]{WuO\U'n :|l]]t%tؼ+xͻ#޾5A<Լӯ!|r\7]/h&EVY$m^-(rȩ<}&QpשQ넟t]'NN{_::ϓY>w%±x>1zv.̸{t'>Bb~{̳vƈ}"9"=]MYörz^}Sպ+]4$Ѭ9y| vW;U!UP2]hs*/K9-ux%}Ps17qR󬫻|q`Ȓ;k΁?#r#u>]u5k zRM0w'Qcu `Xs =E,?_0֢=4ϊTXuϥA=sHWg~ʶB/E̡ K\Gv>߄ǂ<$'dͨГѻ~TƪAO7 ^֚:~Jd~__+Ѯr^RȞ쇁"z? Ꞛk6 ns`㕂VSק{c<o'Tz'mLOկܽ{W l[ƅwz6>泞:od~"cbpN/XN=7U8޷%ỄR{o^ޣ{\KC5f¯'ؖ{f/aݺ!1+e #e=J->KQۋǽe}nK]/ W/7#4d[D([uʄI_;!1Ƅ?L٪!Ꮍ,B;%x vm['O<ʹ|/x1M>|oFcgK{˾uՇ$;_0I_!N"'ds~PYw/17#2_ (W¹}ƷA +<~):fG *_Ѿt4ۏ x]iFv:EEmg1}Do"<>}ϡ.'Mu炦ʋ/#tǔ}D!|^SzʝoWJ<9E>l :c9e ،c=GIOSHe{޳Pe*+T]0hg`'B+m-dYB/ 9F|φJP/w 4:~җ}SnѬG={N {gww ჲgfI_]N YB6EܱdO! ۷mUW&LBW]"unv?&A/*;~ǏM'ܗN%y>|O83w/^Y1<MdJ>E/]necGc/tV2n54[-oG9gs.\!Ϲϣ;NjcB Ptt g3˅56ȐLˋ36L7 |K J`' ~q` ~q`(uB'|`0'#.+u}sP:.ʃbr1~2G:Rb~mŦjKMxtLv4e2(wXݷUA{m8D_uHnD9'|!ޥV,.lglWه(=7>bZ.D~AN||Nxdq dMNxS/n'/aO|TC}Fqrfs&|R'>§$YiI޿Oߟ]ՏGJt9av>R@[g_tՂ;/Éw8 WCw=@j%##^ _Gj _*N^H]+hםiގ^x 6ݲʌuYTV9tn.d''qۙWZe0G(K|JO Ә/sk:Χ7oa$}e5_{Y罵p΃NZoՃؼ CSSw ^ƨf,=px81KϽIhu8'n%m9^_4s[g*}/ 55Mr9)~p~|.$|+n]E#nid}ti5Fշl`? W;W/ko66+#H֗T$|6{U mhYԶ-O=R] "~T0ۈz~Zd# {&l̘i_?"ӿGyV/b"e2z[ .2#5c#5_#5k#^#ۑw,A6@n!M5:Fq{ 75 QڑI"RczذuUX~Q'&~Uk(^f3.zۗs_Ug-bJ|vlEꋶۆ{HV0+ukg[Huگ KEth>yb=:d4w[Fw y*2Ġ_4Zu5wױ VYyhe挡9`xy;k4A`#'wh^k0Ww}F8d>?Zy^I? AG3OWՓ1=14,=R]5\GwCӁ\ vCmNOpq#r3]+;bq<^]RTfO; KmO}mmԊQ?01[koU;WW{}+g(zaƼ:F1cT8F0hw`Uc14N &vޘ`a{&v}Q޹}(xp{pL 1'w(vFC$\-kcXZEnFVJƱ\R6v'\'Ńԟpb [0blz?4{&E\o2,^V_?6Dܾ 1!.J'Xím눹U?r lC75,9BL>4♗HhdnNƄeMA᷻O=c5Kc᝱w{.{JۤWemSQ̷( /)͚321B>"űYAzxx;uB: > wLq;8vY8^ȿwGըۃxS7^Ϟ?9^^w Jix=#"#9^s{yZζ&lz~7mzzZ|a~._e6:O<}.wy>s)W V0έw?('N<>)ΫBۄ?=%k:,2rl~ e9/z69[Em=Q] eq1*L=u>Mx|*Yc tVNJs:](lچ(-e6>Fم_5QH~&dR L?bC.sn46-ũc~u wDI{f|_w~@U_L?M"oI灐GxNb:юLc&OScm&d'ODgM\p8!j&-l$_Bs^=Ie&1Ns7Ҟ' ϑ612v$_Nҹ$)dz'kLڄɽ&+ol;Y>WpNa2Ngłz㾈/WMvn6iM%i3sd}&kG'd Џon$kGu^}+8Xcl#ܠ{F] ;ƕ+O [#ֶ+8{<]yz\yapgr-g3X; ,;ԕ'B^>ɕ'|+OD{+O^WS4))T)O`=cG ;m*Y*rvթt{J6o[.#@S5qTu}` jmS5Mݘ8[Wlyo`=;cu?9-~LU?Oj,  ˗= '㌙YKgz62{^\?ll֖vngo 8Em^~b]VF}VwyD_.m+>Iւ|§ԄiӖ렻{sD,4G0ĥk I {`%.%|qyՄ/ Kd;_!v_ Qoi쏌XMxGt[q gC.M۫cX0`CxaD;:_uk#MN6~ͮb>5˧5mhϬb㲠XXx'| c,Jc,W1+5s`[ )ϸϔx˚.h|z1#qߏڳ5Cb{*_;V\=P|5>m.:VbX9Y7hπcٶ )kcuc5\<\vdVɂ1g^Vy28Do F<;#W嘴wu'o9kj.tPʞ. ڄoJqw8nLӈi1Lx|oMq̅WR!w%L3?9ҟr0s .O?TƒN|4p1ễ9+3]e=Uf~ct3g\gmfk#fSe3Ug93ci +8Six+'幗ޓ I4l3U/=S}ޜ{xؗ3'IJTE֛źeGnv<`ѹ\ ƻ#9z^1s#[cnp>3#]w2 K{s`̥qsշ`\u[?n\Uy|`d[c=6We[`/Uy#W?{qjO`:[ .8=a;,V:Xz`bw+[X}hO'|PK !6o#]xBO-tb#m}9kRsp?oRNyaKH4"b11\2Z04#l92#]O^^0Axԝ}s .6eHLe>KX0^Gd螇i}{Ge~цocaK4%*LY,Q[EHھ[AWg[PQޞ^ csl |w ͮ%ߎK/a#.a=c"/e>A{>d 苯wg b) \*בZp/ec#S3?&<-SӽP0tK9oMq*?? }̈L_r{-J1υoDxi^F:8[o;Z@j܄K5ԥnRGh) Թ(ncۗD#~ga'Yy"V!FKutG Gx /u+KerYG2%HM«34kMFoGԈޑ7Z~.MMe<#h'Qv:hiΉ4LŦ33K$:CF^"miro29u$J s /ې5Eʆ"tN}s2?ż[t{2_ _e߷L=NNXG~ rt_\+,}#͂o]|~'G\.q&#|g3BuTse>_o+eExD2r Kx`L{;* n*z$|`!\ޔC?BmKVh5+dcWf?p : ]"Ϳ"w[>;W3v`Ov<ĄiK0Q}p>F?c,^'|5{WhL+Ԟ !GI=_3*FVIZ)huNogu1L?~9x 3M?1+YatOvQ,s+?".ROމxryFW ?3#w_ZvY׬56HVjVJ97#5>fg&3pTەRuUR:oMV)O8|ưu@FYM>[*nT#WbW۾9zk2o]66)G{W įLy ]o(ݏg}}$;WكXςqp*D^GλVqO\%rgV)o}oƾ"S~JsJc殖$|'ՊSbJp^g<'?=Os^ <`1ߧ~Qt`j'q5fwɽgXָ ׮ֽV+-߻Ziz9/\j~BX}\7kt<*sypYJ cSho~kI55kĵk-&52f ߐ> M_ÿ׮||-c7ְ5l5_/{jV<`}ys /Xz^k4wrk2\~7T}S߯B_ Ox}$<+rezbzŧZv[wPho?^wn7狈qʔAܒ6o<XwQkնO*%3--'Z_@['^xS7%fL1_L!h2U~qZwU/A'ៅ\kukPw\8vSQe{H낶~Cz9fig6/]~:'S^ul_N޶NZyj"k:u +ڀsX {c-ț >I0}# `j+ )ǩmԶyq4G):炡t{KϩPtz3=~M_3t+-MY>3 )sj||z;x\KцUϽ˴Gf^z&PB|~ڸ^YgqYgS?݂_qLWUs!v'9g5دSFdk.i:ۆ ͹ .4b|^c|^cT{+e*P<k r= V>8l?| 6hL ڛ.8A{%~IJvO ,?]Տ=DW?\t>W?/]X7] 'uO`=&~U-c,`a3/:Ix^Qs]W:wu>I ?7K?wv~IYW'NW'\ {\jpf5:zy@ք33jǍ$/!N-z!1'Mx =D³ %Ѹ 0'X 3zIC&|`KWdD չ{r)%9Ap9Uѷkݒtm.\LDrV"m&}xjc˞M(3<3u,ߤrξM}I׻6z߬]fTk3nciQ"٬u|lV{fOڬYզ}7lNoQ[T YPg "l파`żmOhgUOn3= .bjsQcj]w# dcvL瓶n2c&^+n^0>3,+^7u߷wGY-H6zA&`A(4 AEDj衄{ｆ^jWzfޙ3fs.㽿=s̙33Gۀd?&7nm8nm8nz1lCqyaTV<"w@>c̢"w1D>ތs=D:D(ud(9,{18p~aƿ.ĺ߼7fp3o=!3)f)|;OOk4Yql$4Y'q.'p+J\'ǘҘ7)$68wg7¡Dñ=) =f0ĞķWv"\Sde2(Cƛ2\$dȄ$ 7e=Yn2zCE7Cx s&ۡILz'@> {6&P~*u}%U\i˼0;LwJk8yxpE=n/=U/;=K/>:5ԼUo+s[^r6'>%l8bf S7 #+_g/%|76*8{'zܯ=E6Vr[&Ll[4<_z{(S{WoyG?gXt|ɸ!{S$yQkt<Iޛޱo[gbo][d5%tG,t-&F[=-qB7mDBf΢4yPpzE}m;7\i>҆/p^?*Tl=.}Dԇ1?\>!}dM# ɴGxErfw!{UK}$nM*<1/1C6 ս!5wMEbH~|o܌uVy=9#<y}mC[ WęʏňȘYbdsQP]#4;/FH֍1ug a] -x'Ϙ'GGWc^~CN%Ft!}٦iq~iKkG9x=$nRiIL4o!C_Lu;%YW޴ݗ8`f_ p]f ƨ+q:v/N3څl{N_\S_~~dwMOјDg sS1c*=Cwb{JOT:7ўG#꜎q2ƸMc\VJwtܟ~'6Khmc\ -i܏DIߏ|'kz?:#ZZ|?[}6!=^{d 2zK4~L?YS?YSZ2sT<^:JdY߻枿D#\;oߟ#MVc~!kڟle ?|b_ݓaq{ro5?1_Fs:H\(Uhg*m7uG,O8 a!ݎ| R9'7|X#<s=0c*ah1F7ИM0Iqۿ<.⶷@l0siBo;bO&lX;@޵:@% [KN pd~1-w!t 6F 24S(7@i{сBSe -Hmĺ>(@+_ WO&kYe7~f ,5MlwF6Ε:,U'(ol9Pd)K]jN~n GZJi;EϼN:&KUauGԜ_DㅺRnƼ?H y 94$:d$4 4nCA&vG";It<.ttw0=yp-kBmg/iڅ=5Xi. -<7cz~mzyAKX)8&4 ܆XbI23Ռ y8`y%VT$1{ C};C^ڀ_|p!ɻOpF)MC/pS~O+8_3H;6ޅ=H/އ=5CMEs2(v1ʁ{8ʁ AsChz?cOPYaC^ ۬SQ6x*vi8e(٣cCJi!.#LuJLoʻ-gۅvCOF!=Tz Ѡb{njy3vRyLN%m*{m9!.'CI^_@Gv+kjǟp~o>Y41<?ʮd0JGYW >h9\Εިppz֊I]%U]H_.sp9o.zө-p۲[wmE2\ #36#ȼʖNpQ~q<aaT) SƸ8~ p8n,玣&~M\6& .e)p8~  e]a$ C@|] 8`4G`r6(/dohb1goh~6dFsxё1䇅:<<Ok|||O r8t p:Ɠ~1:yh&`%MtGX;xZ9GMD׈k>?5fCӫ+#>$ }q1Y.81Jd LZϣ;%ՉUs(:#`ć9h,Ʃ@؋I1TPˌ#F˙%/BkÛA7X76IAԕ*ʸhw9T,A3KcRRuT;\˂̮7P9ĸQyqW5&RkuCGvѲgz!7n#T.LtGK\݀缇F˽?a3{m=is~06FJ BcD-9Fd޷Lj[iȼ5HگO}=V%7fϋcCey)/fbW N%AAOmUcgŦz.O#:clcFx*DzO0jo,l4mQw#Ƹd{}#ƨ1TtbcǷxLf)TS>F-iЦ ~adGqrQv!i82@sz G=Y r6 Mq:M2ƳیQ7ViՋxO׀ Aj8cw3F_7~.NG[~7Ix <9'pY|뚱ڷ8@C?=@z 0qB7&RH>c xPyLIE`&(9hmdž~'Cq>mYc xcN<,b҉lv86Ld;6zcQ}0]hFobl$pN9I$jpc$?gV$_wf{I݌%õDlo0e$38.M"=Vd:;LwC&ןLcy2ILF1[NBK8ų4r <[8ڒO{-KQ{Fr A0qeW!}߼OO-vN ӂhtK'N+vVXFyMt-#ᷪ|^o*ޙ/<&㡟1;Y۔Sʙ<ݢkkM-Nk quD̠5UtOgКj5͠5g+3hMfҚ?ԇ3iM}=Tw2.goܒUM{Bef&eaI:mf҉{)ڪ hmUZ?ٴ@ ]DUo)0=a#q5;_tA{1>"t#eӗ!9+J;J"}{n+">,ۯf~=,vn"5v,۸YDgΠv۹#,dl80Vi5{]DOqw/,[s>: N+:9G MCÌS -ig'j-XSq(}c?_g'ɯ-lO5gZ d58ϙ0<] OWple8#lUfJ./-ru1j,cyEQOUuNzrBP2V sW;zj#gwSf[ ~OSn 7Qzau>r|Gy_+;~; r8Ժ9ʌ~~Fgesh!)Gav{~c[Bۢsq;lp\8 ~ 'adsnي63c9~ JV*묰gTc9߆oKzp//K*C~D@!~J87]UKg y 嬡-&AP~SNB3^ qHܤzE56z%&;EYTdxl^rrCy7{4ԛ^ي(t<{y2 e,~R y?<9c*d3O/}دܖ\._LcW•mFk^e>'/)M틈'rw\4C|\k>/Ezph8_|Wfs>k@u܅x.*7Ώ9cxJ=:npg#/SLw`|s`V>Un{٧(L?e~e\\e{o[jows8kȆ."b- FւoZ`0~x1đTo>~~)sKree}H_b}:< ]B&3!D[@RW X 7`qF.逛c)cC6p:ukQ_@tS hm|ưc3}=~KsoshK/z}|7^e[7-[8.LrVq0H[՟v~1b;(0a:O'߅K4Ƙ>yiub:ch]v\~-mcV\Ż4r2_-?euǴ+FuΉ[0[(ov~cElv==)-"]tV1v ]t1.:+4YDl{wqZOWCnm0_\7qCE{CEY경{C~4'ʓ+6_}}o]D1ОnAw#sa"_ ; gie;L+{c#|1̧~.s\U\bm.HzwK1|S-Qy=W2bfB0O+弝:2Fyϫ2exo1ĵbǯX| < SIz[cNpayz,4 ~iĹ?9-f )'񀴀D/aD%Nkk hSel1wƨr/g$=hh{1""ηd|m9;ಀXp9#8pCƱ|ߔƻĕԏפ>e=,t%K|i09Xy)Ms\5c0?uY.1{0r2F=B,#<9u9VĹX r ] xm3<߻\.?zcs3+$xqWݭw_)4-={K۟kI{ .WXDVJ,"Sn?OXI\KKކ_)\V\ke%%ECA+V{J5i92?Y x?:<!֟Z)OGo>²ţ4K€pᔶ#SЌOUԯJQڿ$IV:A/t.u ˚3.)un;BGU{IWR{vqcJPz=.<Vq/EghcKuȭ1JU"s.5XZW[wYpUd;4%=ɫD]J7V],*>e~oW3G^EU俄q+pFrrZ|r4[`5.e]<f*|2mhyO-S&joϰ6Ar=m?0yM͌|ixIմ^Fdj6={Iv!-[kwU_Cl t\Csk !{֯;5$O]ZC)גfdZ{Piro. ~^K<\K}ҹٺ]Kh ?zQ+yL#hy`,\])m4|{x<ZLmvt_GCۣ \'uߎ|.#[|`:?I',&6b\'}؟4~T4 "L=ž+64dkzٯJ>d7<5Ʊ9 eX/?'\1y%{]okK=<'aXqH+9=U~ﶨRraο\N>z4YfQ4 Rf Rf *6+Sșq@rc 5h_qn88 ?m@ƨeр_'}[pr 3w$<ӭ.L+7b b_pϽ_ X%G̢<){`>bnJ|OJAyҪʋeu{_AQcb#V]76q]^/OT&at 睍bQ 16(QP׍vݲYPVuUNAԕ#>QuUMA§3}6>t^eq ـ? 'pp=k9sE“Lj}le|P~_ kly]v4+.@yާzImins<Dzߜ6Kp2ge`e6\;2}'c9vfᶳ;{lƤmkhd ޫѭ^5D n!0;t?V ppìcN0#wj3m&$f3AfϦns/? AAxOnu-3nftkohRh/]sPibGn-gb a3m"r":R[}W0:"69$e" 9|7?uJ~S&g[H..<93-ԇ֐Ђ1v{f1meT|m9|r5c:[|q]U]t Stx|EyC[H@^| |[[DbIUKݩ0Kg/3VH{h9t~s 0cԸϡ%8p_Q 8?xkmfP@c+=1=:~ ۄ_/1[=3cc юcV7qq+Gp:wpN2jξ{Rs1 U.FfxJ61qm#8dlϽ&6:;`㌾mF0F6M1@#><+n;KE 1M1Co W>e`7ɷI=|nnbE?b[Zx6KtiYqtY{7ewt->77x^Ю6y(v)֯]|dm>NrOb;A->=I}4Et@8t>14sc{^]}6ns9(g?]l(.v'Er<묲mx:L9twz;?W!/w7;Ͷ;3 $A;>Fo9^IF6+BY_(?l.AcY%=xn:L'ߞgq;c;7"^B;̏Ww߃tyy# % eeoI9, y$)dX}'?f;ugNn ,燝bA.7 v=B.ZCI/tDV̦ݬA-L:wtdc4U\5WExO)TlSz3tWa7Uwڷ^ǿ]u߉Nw~'<!t* {(Ъ=DGPl{2BBRlRl{)ж[^}dZrjb uGʪi(}[>ˊBEWP߲]w Ol[c8h y+l?ˋOӌ y5u2)p@Ey9/; YPovt̞vdh;aC֤3=3IN.{g%t'cmHNjsK> O&1 : ?o~yXpﯦn_Mi/ Rsy p[3t(LH m%Oi;7e|)wPdeYpPUexPJ[ʻ2b/Aщ=(:knؑ壏Xk̒ &H" Czc!Iƌve|vH.| k<ؔ8Δx) M0$yc`q< q%Hۦ|CN?!.h"#h!2F9 c3F92SkS>f|Lwwww5^b֔x)S>c|gLo]yH.>4vѦ1դeq1Ƹyd!H3Fw}uES>j|_q0+>ו>Sϭ-0In?w2{f 8,>ct@^0U*Vo7oMs -@1F;,{XN 0{y+ pҘxi/Kgj$#הHXAY3eʭ|W)(%gVozǷm0Ԇp:":Z_/~ 7,#N_M`_4^Gdb綏>"O:¾v8bw9dg[3Kva6yX%aZ;B2aj$qGH&Oq'Q #_ Nj_/d9J>.n"g1, 8xG)N+ȚG/~{Tb;΃|W &^k<p^7Y -=Jv6%A~(4zO8r2Gy y84O91y>1dCRc$"+sL125W1UE7<&oϴT("{\'ozLlʔctEYf1GYf1Xg΁"jz:|L&}LYWBnX忪'#|<.%S#d[.q |\x|XNE/?csԐ13>+c䝃MPdS>||ܔ6|GM(K6N: 3FcU#kugo)~)VS>æ|LC1f7c 2FyuH0Fy&c1Fy-c{5hi)S>|7LG2Fy0;c_a|(Vb` 1Fy)pwS>ʆ|SL1)>S>|M)QQlyόQTS>ƪ1m|Ҕ:+S>|T2FyU(e+3F>\1ob[x)@S>Ѧ|MW~MwUoȤQq|[o=C_w'QXOnwbyͯ.[(+yrlQ|BڝpIRnq{b-oiV=!_sYr.x~'\6[nZ>rQ}Ccm9y,^]B]&I7t?;!2"aIƸ`lɫQy09e=Iq{rJ')F~.cVP\mG,~Uvm7O'Ѷ BZDgNI9:)瓆'%6Kp%7Mm_Uܴ\Mq]7}3S>*TwIWR-9ui>Z})ySvSU8v=%ೳo~8e-DtJdѧDvJdEDZi2).)En<-rS"7:-rS"7U8-rEnMmNMN+MOܴ4 |Zd=EVJ7NJgDVzFdgDVzJYYwA~0 8wqa]{ׅguo~i~Ƹ6d\y8c(̔γ.s&yg%fX2^ Ϡ~5x,ﻀSc_.#q `Նc] nM2{L=PC3=Z|Rrt־u^7ω=-Z#^9ڃnW{"Ⱦv&u+QNDŽ~f13۹yy[),vt^:OZhx%>ŰmkmD>r?/ Ӏ K`2q/CLa1"Kuӛ/n߼/}˴1GMMQvp302홋 \.1$w7I>dYY&q7/3xÀ2 ekr68Gnc8_jOCQҞz<Ȟ2(G.Ǹ()7_≭wdpO1a?<_5N"e[`|qkwnS\ap+ p.;>5-&j2n%ր;0+XO<"s^S1vT>2| ?BcU}6*4}xtW|o3F笏G͸ow27O' ]=p<<m%a߹^~|^9W-*|oU{cw ƹ\{}Ul$\5џbdRy.-IMt'MT16:d ) x,_xvϖpfnwo]߽Fk"o׿&fR$GAaSTЇ @lotM{OX7AՋEU",kp̀kVO ï/SZ09gMfr35ƫ[ڼ_pmf=}MC^Zk;q MNC.s5GNC)p D];LŎ)ujY, 뢋xb];/gy?'cg0"^OvMT̏a qM6_GkYt*yMzwCrڹY7=[ԭw~Xڵo/ѿF;g^οz*5^b964r~2y;XFxȩnFQ-2fr8~wn :ܫX W4 :W:B'K]VÙ''d Ŗ$u/˾r" p}YӰoxtAuu|ǹ > & ٓP}!{n~隱(ON/>wMWc)+MWn z b2`pC6JUoq&dUn2O׽)nҚCoGƨq/}oPGݤ5yoG~~gW5*#{LvSd7E&137%^/!cE-G[k3ޢs9݅|1s uj_B|4*QN n.Y>w}{ 8o /LʷdZqTڿ@m[,iullP^9z|cD.2^ ^t}@ZmZŶׯ\m4̎:W|uK䄹m1u-eOokqq4nґ[O7,ZmQY{?\Wsq۝~u"}$صnK6>/fsu>WWԙ'T*o@Խ[{R&&G-?w=bgK$pYΜ;ʓ.ݹgU WmyOsߏy)|p9c{X穻2ߕyxzΕ}SpNCwib\oxc;28)-M{0ni!3Y(iٔ8Zתx>~<qYxP+s[_վ'vv]{bg=ˬ77P=dg76/11vqGxH}[Bw_Àoi8#Y}'޵֏&.} ߙ̩b:t_OYr_dݧ#ɋ?GD7P#S?[;7ྼ_}k}νC9(xćOG܃؇LJvjY t/^(㋝!}y+.c~<b O&FB>ލbC9/z(w/k{;fY(~<,^'97Klmtꚫgxc#SȘ`@3߾DE}qr€c:s]*OrP7{,6m]_r z,G=&B߉q~g3]wc\cG3u}1KL<Y"QO1Aq u'_4ܓGRW/.Sg)~v%;\ {Bg3)thou?z"{WzyJ I3[>>u|"Rt 8{ x|?A&3].Lx|?>:Њ'Ÿ?}iyg'r>Dc-~T2ʹ7-<{FJ;zXf(T:L|19;,*ripv:!I.=ЗIi0qLz-2| >c>S 3^~s=׿I2uWA;RJƱQFo51jƸFw1F<i.cŇ\U1U1nhm8}~αQ>ݔ}S>ས||ٔ=2iR8}~}?rm :1oӱ2ƾގ1cX(O ٔvSCs0[dr:8r|:O6 qh=aQa}Jf+^g8"^|_6-/H>bb~\WglЀK2M\i׽!>>Nl6KF{A1o*:{kl޲A[6zQxyxcDcyy6<4?=}F3Ko)9oE)h8ݼogtkuP{Aܷ⾥jƯTY#-7h.+/Ȥz#oz#:fVۼκv~Mv'/}@v yV:nGoric9KݴQn薽w-m-$V!7s0uzTcTD =qbRgЄ֋m5O=4XuXu;{h?⑶,8}y`ßwpNo t,]tny>߹>-O%l|xEWu]ʪҳ4J۾Jzm?Rm6+z)6|UXuLhc^W2zzK=WNw[XlsYy"D39ݺҀ~l#Dp/g%hN1鳫us㸍 quFQ9 E~9K7a62GGFchk#7 zUkǹ͸.ΙpS]Nmo֨z]p61fZ ;97RƧ`Zp HeM|eȶ*#6[7NPi[n3ď;IcU@ 3}.u8xm##mqtGYbC"Ex2RtX%2ƶ=$}ҿ+5oԤ[AS;}K0F?w㺨̸go6<ݔ p{{Bc6sp^w|0շ=XHNHňn ՟WVOSR*mޚZxp&yihjWRjgr->5Jղe(DIM9m(i):!741/cbkWyzwk{ɵsa {*#q MfLyGx6> ~E{0F{70܏y ӀxIF x㼴H5^A=cImaw7ۼqjݎg7gp4N܎1<&pˤ FdFiDiJ#k/4DblOVF4JN#g]iDzl[p x3r09Ue궕T}\797b 6̃Jb=_HZGJީY4~͆rM7ǛtKI"LESrQo:/|%_}CVZEx>}ZO. }/8bݮc =vOO+B˸Oe]xJ7z_Z9{';(oӫ r2sL 4&ֿkԴǜç,^m5/!M/ڕ$-n><a/@xJ#;wydwIGцVvwh]P:n3HnGߨwoTend=ukn?ǵ^2!O ?ȸr: mn YtBo-wֵMtt&&p3۰1B9}6 Nh\:ѕb}fv31F8c*kxWo򣯜3'}`}"G脖.}`r}Zoʓ{E җ̜?? }, ؼR?R>ضO\#*gLu!׌3U{3y]@Wcq}~\f/HA|fS 06(?Kt^Aγ2yvCW?#/Au\j<Ѿ?W-NmD[[D91.࿹'1F|d;!%dH{~hڣ.QcgIhSq"{sjl3"#鎢zty埦PtH<:?nɼ+{Lc9`b c9O}umP-G[q2A'Lt^| Kym~ݛl,ow_LPL9LNG7k.CLta&:4Dޙau.Q=w2]Lb'WW6RqJB.~16"c}h?1rWcf >3DLQyzWzzNYUΕJ? 1=amxǙE*痔1,$!m<ݗ]"弭1کN9ofOymúa2sUX/7,I,2]^,.5%=:KĆ>g<˲t0(sWs= !v<+<$;uO,/D/ߌHTY]8oGx*Ux»Y'|1c/Ubb{>c_VYӫ_Q3^zNq:+ ε3d%2وgF<@6:KfYtTF4P=#tF40m8gW-w7ۋDcNaœ^l4jy' ƳlcnƲ/\J[6o")0+%'_.v i a;Ο]/Osg/xJޱfNuvh8all({dٝ#8p:En[];`Cى&kag'zƸg߭첖9d-G9͓Co/ `KkfWT/jCO:~ҍ1pB4><>|XINv,+P?kgZ`}(~!UrМFl%S;d7'upN%s:}zŜSEN1iS{O%g`I9u`^f.03O]S01ip=.3 ڃzp~\b)L)T21\:V2{m9el3c4v8x{MrM1~'rǾ_%Fv/7pL:>t-앑xf#{w~_f[& &jynv{N١씱yDNJ.Of7fcso奵*Oاa߃sR϶yp{䥉Hs|ܼϚZ5/o}/O7q}|Nǯ<|VyĻ=@߂~ Bd#\3"(o> f|wG\ZGr2mOZ)9cz '&ƧD09KAyifάJ^{_40 /T_G፪/;r_|rOΝw9}0P`|&xȒoS_t;s:K9eͭ,g_Rӱfr=aMsrv(cAjK뚏D(~fs:vzƸwN|p7,1K返!?ǘ9@cb.\NN'\_xo_Mu_h<7yzwbHԽH{3LS֋ 'YT~n'Yi~ .@vΨtYjmVJmP@dnl^fD 8Ϗ}pN/~T>οGV3Z1>k'Ϙ|igxtA|gP9+ c_ ֠3" ڜq*SE:sp~,' >dTO5w<~o&}xsA϶\cY$/,;&_WgzM/ J5h?{4՟_C-H^ oyqc1xm^^ѬG<d:1fQ8G*06}C<,{l'?D|ʄ~RkDø4$|9]-cqWN)+3"kƐos~xd@=t 觅xց$'/ 1f\mZ$hs(Dc\ ! ػ󹋟# <!}:_sBV鼭v?e܅˹JAB# M ZzZ3 ה "Cm\z,B' I~ZȺVqrǢK/cg,2Ak.yky:+,u(UX,,\a:WԳ{=a! cOH~x/.,2),t ۜ =i9Da [}2\P˯4L_b~[-7 <*I6y>1=Q p$#8Ks<\G=yE*">$oKC3q6 }FE+["6goW[(5ʊU5_&}0̽"T]٧.I9K~G!C:w >GtVf ګ[&=[$yA]YbvyاbWc4M~P{2_E/ b~<+r\DxIƸXP;/Ӌ[̪d]T|}V.w~]Tw\&~=+*t }+}MXbvF}Kc/ qb*0lp/*c-4Lr٩{VcGfc͂X~w3XQ̳~̃-#FzF9|eob"4):S\7Ps^1((}bwq=Val/bNSrDdc_\b`<@?K.=do>$SƞZ:+0-2kYipW'}GqgK=)g~꣯?J?xsK;C[ 3%jg}@ O ڬ]"9YÜXsT26x"؆)%X(!zI0I `} 墽Zvj٥uz:M.w(A{dl}^1J&mI􅔴=|IVR1sCJڜ AV2Zl:M:ZZ,|MIٶc޷Gk%gJZeW앒 D2*%vVR6k)Rԛz7XԃiQ*W׳aܯ:←?55PޤR&\1 ߢRK kcQ1?RV}twr@>/lΟ <ӕ9TZ/GiܥE1uEJ1q$YQ35/Y~~si]Ocdi7?XX}pSZz8c*-eqi}x?6rkX+%w|WZQ$GWK{ Q@XsY9|en2rNg9cUFX,#g,WwP empg'zmmm;jm8edMsYYRlNSJ^ʌѷ6c&ص|;gQtU8YK7,ᘎ*kshX}e=%`elٲc/YyR6 8Ztnw>oA}ނ&j4ُqt^g=FbgU9!Ե d61XHS#o\]Nbl)'Ew2,'`x0gIk~mڍ-n1ڮ8J_Ps3{Ƽss671NGYC^nY.-n*~jD(Jh/ƃ,-B781q9ɡBsBE>?T, -.TdMbϝ;CI8GBm/wr:Mc੾۞YgruU^^}͈v --XﶊBVV)id(cpB^ƴSbyEf?Gܔ~ +}[mxnx7 N =ˠ~;IA}0OEOp+xWp:ߝ8vY* cِJQ)NG]T%?ݰq%u% `<߄ x( n䡩>1FMbJ_O|Dsaüӎ]rwW O*#mgl{*rV~Ӿֳ>,e^^EFO9(jBg})_g{\HeH\_ğsWӺ]s\-ƚ[UWF^\F˪U%izc컉U%6NGyd ܱӱ2'8uW7q^k| j}-?]g&Ŀ?4z q~fH1?]Ks:gҟݮ;uH96e.!wvf pΓA7{֔S攁ešהjJ5ggM_7IF֔}nئ|33sWjU5PwV!^WS֢u cv5}-5)W䶪Z5eO/Ք=XO gܬ)5^}5*uN˽r/'/zZt78ŧKtlnwĤʚxJ;<>`.PKvZ6',SK6+\K2nQ բ[6g>ydwyY>ސͯ=[pZ_-W.yi\K9pǥ\N!)߷juS/|+xW-DgJ =]Ue| X$nׯ$fZr+m̽komc>YU6׬RkVeƸfauD{݁f8 V<6iqQ[a\R[a\S0PǵAmR:$uh%uL?'Xy_>H?}H?L~.ԡ{B~n3ƊRŞ͸E4 p9?ՖJ~qVݏtWygu%ƨc8Jhk)ޅ\׮ e6.,:S:~Vz.p.ra|=+lF]/ܐc쏆Yc4h`ܻ^J/%k.un'{,Gy$Jogc#/=_׳+gޞU=V2TEgb:jc幙pY1_}E/ݼ:;pK?ձO2ʏi `o󣹜|N.}V4tOnf}ي Ss!+h{ܔm :]^wcz-ڀuz]1NiVj0c$ $dhZ؀m2F?|[N'ʝ4:Nls l iƘc!Q(˸9B~2JC^<ڛ7Anא4'RzV—p"onH<Ӑxp_Od ߏ ͹eBA~bOd*ٌ~V?dDhk j$s4\R{q=d٨ˎDH֐F0y9:kDvQI|d^l$r%U>ໍD}H?oB2o2G&73iiޔjL4^1ɿHMO`71˘=z5}zTc9;1݇F)sLzԘqNcǥT15lL1rhL1rn5&tw£twƤjBt&rǦD79o(׊~ ̌o iʺ>fҫqՀk2xuw ! \MlG>P/G-}vߧwt= w4i ؆Ӏg0]<׈kMiosaS#Ԕ2l*~")+LL|f@'Ű̕'<ŏh4 p,%dgq;ߥq{aA-PhF%Jf[6v#mi&:Ϩfbb3_11 2/BZ]&~k3Z'o4~ž9c9x b?Mщwa{ -sL?% *k|9Ư uSjt=ue-=_{km¸g>j $h&{{Ltֶq|%in)SzPpTQ*?_F48Ώtl1mc BH盛3=g\ui8Ϣ/>_1~-<œl^QiтpcKOe\~m`!fm6~ ػ%%B3}@q`{oA>VogD~2 8u>V\pʟ9h6C-|?K~;.'N9[ [ޱdk+5.ܷZ~'nsN|ЏdՀ|/p:IG]dũed_*+ZbhJk.ۭEzZ[ֻHgۈn+GGb 2|Z9բ`,G2y@?G}2*Ǹnې.̴Uhq>m#{q.nqλ88JٖJYmY׃^\ 8WBݖd|?|-ڊ-PSۊcòg?Ž{[?,0a?s`8I^J)1e$#}bg٘|Vycm%ƒSF]XV|${޶r1|yݗmIoutxrI'3T Z1n+tE>W| p{5JGO/&K(-6_#_8>j+]v4HOR2T:.>70`;S |װؙ[מvv|co7+,|Ϊ{Z˯t@Lh>`X}ݓs_|]~3ۉjK=-8؟gN=EN+J;oӞ8ތ#kOG3838v8C005lO4׾=\d{I78='LlO3I7x=G^U[m@4X锫w Xb @1N+>u6ؒ.>*[:O>㡲?3=6C}]ygC?+*_Nζ)_r7O;PHߑ;96(NU׸;rlmηH4t֥#'Q\>YE?t9c^t'XsM>+|Mz~Hzh҅yLx6n{~8b6P6[~n-fiVp 9{}>'۽>7 Rg΅ e'p xR:nZWv93ʯm=~v/[P';Nw_>뺜O}iEgQ;oߒfp !=SpMyh8놀3i>1 v8r981FXiQH*U1s5J-dOra;l{߬xاݾоN\DqIܛ_b,d,>:9LW,F/ʂ3*t5ags K;|poJ3}_fgRXm/w]V]= ѝF3l!\諾et~Bvk= r?Qy]'2.` .,vgY2OyWgYi،W|5p44Ax~Nlό6o^Bzъ]8 ߰ ˱иsɯ#)ȗ3We{n]H 8 ԅhp]":n8+ gspn"G]d|pv~J٭>\O“3LsWj/41ih5C 7+hu*VcCk/%9P_ui#^]dJ|$wW5]޽*;e9mɟ ׅ:!<;qZUt{cWߧ0Fڙ *xM ϽD*~]rW}ݕL&=\כW.(ߦF(o62SuQqϯ&O7;T&kCmW6FnMڢGN܌nkr/z7k'-bߞ&k׀+z়޿&};ֿ̪<[sԜٝWƖvw1I3/h.:0ƌ]xI_uٳDwYB8.PtVOյ>Vpy?Xn݅3?߿q٭]û]x3N4ώ.[]McnsuPct_wb)@Ogny4F;{4}/M~N~Fb;j@r.j&#hSJ:_YJ: ,dqC)9.~}"l`MN >럖u.PZE:P?oA:)${, G6 -#MiHK8^};$?@1κKK 3^qŅQ?mcc󰞎ӑ{GOWgދs"!K^2}G;]6cCtgClu[끧xjWHaY60:T!{:=dӸq窻=NC֓Ǚރx^fM.xQcLNlloN B#޽t7{YPsd;@2cZ>S{)M9 i3˜O_5.zGs}ʚ"<'cUO]Sx*&ӷnar݋ۭ6&'][jZ`.{v|WPBxf#uK->?23H's+d_"g9=w!H__2]t^qFN݋}V38K//'!A{zqj5ܘqV x p$0Zp~]u}$>hdgO0dKG>Gb}i0ӒZkmiͅ_N:~ y{qm7(uKgQM}}F[h+[֏'W?K4 ke~6pOIwٗu@>Fi_HoS0?W|X%1c̳MdZ:x͓ }%W}Eg.lgEB~xܗdS]7N\|i&೼w.kvX?@O=kһ 0{U/g;:*$_%Syu\ $%`G1 93;szPQެ;@tκfـw%8?lDߙgX@r2V?Yo1_J.O\\}J۳JU F^@ 7TCR۱]rL9y6S Nk6|=Y/7| x'jY&o@wb'']aRyӳS[u ѐg͸<&CoՁB 뗁鏁"3{}*' 0H4 g_^XNA˩ؔϿP~G|bk~}L$AۆKI\u/X ]m τAbGd_$:;}^$> :_M0s54~lʞ'F6#+p}:7Xh-c_r0ǓD,U9 _-H uۜvVN>|93x <1ʌ38}!ӛھѦ^x'c[̱ ~/.0=-ΏϏ2F'~Ƹx193F]N(c\̛t9^hK{9>gP9tͩC7."Cd"s-(: lki_B|}!r_!Bab;Ttw ':v?1;eޡXḅJC vrP9!QN0=ǻsYE)+0΃EP'ءdc:J}rgP铍CO>92TΔ|,? v9Tb}7Tb=*3Y>f<a2X?LƢ0auѝF>ckÆɽYɽYscgPiܡ 0C0Cߟa俅 !ğb=A=: GC3FppU.nY'5Ys|R5o`58( {BQON8mm/p;PDپí: Rs~Ხ.eÓ_ÓcM}fJ+<הab8[e f1gXyA}`I/<7#x:\t8?lf6E~Ol%xoQC;FBD>ٛeQ{T;kuouJDm0JmN^>&U4Q\nE->h񆦷#UA<9d4 ൾ½#_Ƹ1'iȟF3~%x _Ei=J(Yti m<[moM_2όtU%nqMylbsa)8?K ̛#A6bH[3FUOx]Tr8Q16Dxu|u1c<kc9QkOː y%' =x!Ht:ѵGk9l^hk9FS FslwTpwL%t泉1&׈pmz"W|ߐ컺?tOvD̈}h}hهl-Ժid?xhm<2; @y4?2%vB^v|*^Jt W_yr;H{6J7ʇ?/k6lvƹm~y]l9eV$?u ӆ/.7 Z]Yqr?y'ƨ3N$ x'Q!3qϟ^/12Ѽ.u28=UFs 㱐@7k6|0a?egFNafǓ'p2~~ $c6-pswF ZxuPkǿIɔa5t,(aD'(#6rzu>ļD%(~>1630Ʀb b%m#Cf,>{12F fĈu#CXbGxLV#}7FDɹ>YY$ZˑN|^Me2=y.KwOoֻ( o.}v޷W?pú^7cGk.nyDŽdyu_i/yE/yó/yC| p___y7 Jk4,;I9NJ,q"~5K9K <6Y Y(2Lƈ)r.51?1,U>Ұ*| Q|h ŦD?uOO.Ny;oʆ:~q$ϿmvCo2?Mה;SRXAiɿ#w?d$Rlzir6:_9] H#a;tsc,2? cW.Fd}vrcNlCh ~MSZILN]1M4WDi"<&p^1))O}Kt> r0|ePL{ir>X95\~ztpg[or` SB=}t+lg-xlt1ۜ xZ]OpX]}M~͜ `J̊~WN -Nqs،b\ QA A|Yc|qߗ1# QVAZVt-~ܼVaf-8oҁˉOz?ke6ƨz>a^0.Sg-K,Y'nfnchvB?+gIx!l>D`%97e>4bƣn>eMwh1$|oAMbO+4&_6m>Q#̦otwc~(6bfSe; :cċΖ)7fۜ8xk_A;8؏uR)،<vL;yc+27cXw]49nv㶌cVu-sԢ:hjۖ~ѴHPչOs$y ?91Gd3o/qׅ/cջ0sVwoĖy߿Ugߋcj.aMS '̥yHJD]C ;CF;D^>On_NW-5Ob&f-cyy"5Ϳ\6[?yڸҏjGu*:X_;tYKﬥ RXt}qUv2}$ݤ1*s8~f9JrM6.N9Ә/pO_q|g3FKh<sHuE^ս*i8. EnG.|w?+wLLWr?t< n7y ǤtZܣ X#+C?Ǿb{X<Ü#Q!a>3 ORԙc\O7T|Zg~2^ k<&Ɛ̡,]O.#MW A? +?ބk雼7s9EopXW[{4'pϦQ [ ƌ}4|0crǸ3NgR/N1F=ƕ4F1F}Vž](1-d=xVԊ.md_ai*Dž69ww3=_h33U]HUm?@NZHA '0ph Ó (8|!.S@9w!1% *ʮOg[$q~JO}'R So_''0; =~e!byV)qQ|Ob/nr%?eEwúu~yĮǗȹq]ccbQϊbhsxê jl }?󀪀Ya%#]|aeyT{nL[i]M{g$οq;hM^$18M x&V,{{>ymx/p~xY868s?:vY=&C仲HoHt>|am~h k3 >\,r}Ų)Xy֔dMR;2"Ler~'?~/92韶4_&4>` c OY&4pC{@;ay2z(Fsyۮ< 3%Pg6YF1ͱ g@t 2])x-,z[,29|nLbYn3a\ Sm~r/yۓ8ϪL,b:r5gr-X5rBs`u? W}?zљXN\t(v)cȟt?\\δ;pwy9pϧ%HC_kV1/'[ NL5wQ>+lD;[hޜW|ͷk ;5A?20eJ;׸Bq_}cnBt \>qG^Ҥ>>8@b:t/b\]l߾M+Y!>Wco [幾BB?tVо ))\WRO9ά2}AЯ.Do s^Oc0bt9> cܧf􊫹-k}zCj!7h5`<1ӧrKc |a n/j~7VMNl`ջ7 9 VSH >^T#SRU)YLaaOƛ?tc ;i  |/8X=Nֵq8;Ǒ^688_d~-fkU3/B?ৌijqb'8.wKf W5LW3-c 3Fߪ3s#M׈,~9>0pX#4<p[Y .[CW{vъ|WX=v\,O&ԑ5īNyf ɕ.5t5da 7o5d+N[֒\qi7RkMpZ̰`-ٟ['VZ3vuÈ\k8k9|1R[k!7gV5+c |fG;ģIi>q\^k_2ng}~T;y6ܿWkVp\+\4 :{Aq^'qY'0Fcw]G}Ζى7c\SGr\S'1>&}k_. ۽h״'wcvaO_Y'gUݵ4ɵu#VY'|NV1bKrF1zZzk5p>NG.aַ{J^m, w5 HN}R5Nӣ7I˺u51H30cI>leAlp{c9[3n=8]aoY\|UWwsү;$vr:Darvi\f40H5rQ.ʝGk/  q~^1<}z'{JIr%@o ra{qЮiDp4L u?{<<)9AO ;ɥߟl(wHOͳog h t+/`Qp4(~6RH;x#ߙ`SV{FgM]-gWBLC<[^~  |.G߄C 7_i \|?p{YLs7Y? s~#>2k,˹x{Rnr~kepa-VǾN^kΉ z`Y&wM$DȘMG]qPMVk෭Xϻ$h|d&$|$i7I!pIjeszԶր_n")6nỹoyTF)+?HN`-kn n |#HoYM;f ,{wXM?}Ć-vXֻ8g~>Kk2 {?<'\Zis.Ϝ8>|e6ӚaŷzysNd(pDQe8ӝxN1{|sz8=ș[.!cnFn=Y?6m6fEd5[ y$蘇S}0&2BzK/c?kuChGhZO[D#OM^p|̋k_gy?*:r[%]"9~{`G)ށIWrX|kCP<;(֪1s4vw#23{yΣ?wP +$hQ 㚞*Poiqn+C|*y>|w\?l!ww!%;dnnޕ9smr}NKC/wșT;>~;>A;>yvJ}a āN7t/GÍx&}dE`mx߂IߕW{WyNIlȯ?):S\f@tr',={Y^Cx.3֏E[(к s蜧G?}>":G\(cנJFˏ ?; fr/#_s?ٜSƋ?t#SX9ł3O􎺷\"A Sp@**<|p@a.H@A/qhݬM6Se.ɇD sZŮZ6.6YNK< I=<{,cxN&^#i ~S/vގ'Qx?'<+^ts)vIDKweu%xw]ԮʀKL9*%q`)1{"vIGzj6p|w9^|Mw. ~ 8u{ $66?m3>`\rTR.v2 Z}xP2kuS_k]s}+r~E}KUgi\]y1z+-c[Se#1+[sRZ]`=_~,[-eÿ^ʇSpGE3LH#4Mw~K0EXNt8y@%y1QO;ў @ OA~e*.sv˽Kw˝qŶXpeaٗc; s`N &ȺypY^o$cMȟ^)+m͝s~mCL=Ta clZs #c<*t6k}Q@5[?2;n` =D]Θ=#ԙhmu t9xnbeI^?hϤFZ{>2C gF )ۧVFj&hxl#dahKJ\b 7{;{r^+c8u.Cҹy,g"c#YW]Wv3ʙՅxWx}넾~C }{)WE#<ىidds/Y6R%Ec:PK`Rs>ur{z~Y/g 7kiϪ0͟Fv>%e}m}FgZ2O]u/1;1Q9!xf}ϭj$~܇Οz>2T(gHM7ES.SDo~#o>V $:@NuoA'scNG~\xs9Z߅i}ɰU  ky\2̆!o ƿcO2=|SƗd| hcyg<"C>DZ#~ cC,[@#2=nCKp(<(׷b!r:?1v.q-D%ogy/kLߚv70a湏 94.뫍oQ*?}>oyXaDøl r~ (w;,ҟGUzX[aY]_+~6%ڼ˼x<}wG>"9e=ʜ(QD9;fgI`DO^d D96'E-E.Qt]et㦷|2G&{YۉrVTaiV^y" UhBÅK3U &d7Ћ3s,\vé]|6g}3Qhc_H*?]$c?T~T~Td@h2I;ޛ('$ʼX'~Dp{5g?4wPFc:qo'zUǠދg'zGֽOQ? 9rD<"o:l ;k#N{ys6 N x^ kMk/r6+1gA5Xp]-*!^\z{{߻pUs~{Aۯ!FkZ|nǏ~rDL=#rGū#rGEr2c/uQQU|#=/t<*7uGŶܹ@u9" _@J{kpLh)rf_9F<qG2Zc4z ɼ/̜g1W~1mrL{bd޵ c2.q1z 壾G4lv.g1pscW{$E=+ۂ^+׳%!}y `~o6l1ėr'FxRiAFw*s>p]gQjSL]LMX=$]$TsͼϮ4GZBI>o$mЮZft k|I" M9cg'ΟrN?yIMg}W&͟$'o w1_ڈm'c췽qN$QL[sC&Z_-M-VRm\Ab['o֋$у$ze]3vw,ov\$#5eH* q9o6E6~\R!8ISx=N:hڈaBb9Gc\"#/s(_s3?1>{Qb#16u*'hޡN,/BLOpw(  z/Bۜ{}xfFdf&*UqAEūWTeGQAqE @¾CH @ @zNWOՙ^^>N>}/yqu'-tcąO1Ζaݵb:2pk]srF]z!qF ܁YP8d<~1 c/r¯f?p"'""<_S/? $쏊#[9(3S|a3%imP?dzc_fښ)y*WI?)(jE&vn4YdvZ,2k0ۑ;0-ݸHd;~T_iTw# w/bWx?ܓRjIuC?'y/\%j:ffWoH;[yk Ξ\8""Fj)P_r4HΥ>y#sg˟2ŏt5ko2<1GꞩZ1 ׋5Z,`z嶹W*}`ˣUWcM+4ݳL'(634gߺɄq7xN:2qW3t˔U=_=;>mZ0FRZ{'g el/86+^q@mU9h_R}2Y {N2g ,>22,s9}lTa~/U[WS{F d%Eo)n']e(3Ƙ%l:V2U?_Z<[ra8vw&[N~sͶ½jΰ|F61|$[%\mdK66bٻ(5rCv.&г']S~6z vikrֲ2qcѩN9NuSC·]hÛqrx#?&3F錱N`R9uh1d\9 ϑ:s%/rL1rkVe]=x$=t?u)5I? 8>Fx ro"ۻ1gM1cetl 4O{KDAv%lK:N@g[g7'Y&^\r\b4a;)͔,s짌+r{1>oMuΰn* zs2 vtCq?}}9g2G{]7wݝ#gD~GrD#r962nj9}lcAc59#f c5G̑\+r$ ߕ#s7tXalN X!Vpk8?B|û~gC%z>; фwg sPZܓ߭09İ{6\.<\o Y%Z!Эz!o~XiB6V iDx?x]\gPN^ߊH'Z_ixd{W ?a/> {o|zQ1S+E}qedΗR-F{Q1,U'[ީcWs׶Gm~w>0څ&41† |8+N#|Ab˚gQ=TjDy h"y+48kƐ?آAgy\aZT#NKkՄ',ܜ,h.xfĹݺ(GK$f@U$vT]ne\Fvۘqf{$"=cvs9&\?+x\9?pߌUslKfH7䚽mODo'0Gq+<"'6>%O:~̓<-ćf}ވ穻 7}yb)ˋ΀UBKKAnZjY-6G2{"eoj<+]w6W]WwJrz[%6O8) s>8Vc9G۪:oTE;T;oWt'rJ[bvɑ|t&@>C'_E'__Z[6ZŘwUcEշkO K@eԼ%|=s<VE曾ƳKX{r-\^3?Сբ/$y*ZO@wϦ!-úiȠm 뵉:Sy*dƫVQ oۮګ ws?[m쉨(aGʶ3=\>h;͕s?Oy;L.FT~/O#|?Yfs 4nn[-f?9u$6RBX_=g'vnuj*v HT~}+7\cmY5F{h9K}~9KƜ~ƜZc71טq5f̛56ޫך5vZZZ#MZk]ݲ=į3x3|:u&ou& d}_ uƧP_Pz#ib3u7->\ 'Kjibd0?#/׸y^j?y x~Nksϳ\g*_:L _>k?tc#cgʳo1?[ά\[g<MQ?KL5&/Eq:pu"#<~AO(r:C#;zZ=*mGxCKͳVbnԠo~5w-km]v׋6nU5V~9~9x=#n/ng >E7~~r Z/\#׋/{Ede a}S}M RܓIk֋nz٫K|oqb)Ga1䞸q6Q1:uyٚM1y y{U;a˄*OPq$lO4\''`:ﱮ|cRoӓ˕4yx;d {T}t}Jm ,!ls"fD/ 9ms'6]1a6 ̆~sӐ1OsG b8iC=cĹ~ћ#x&&HKsBxn c8焿˜+$i?d:{F!O}o$l׹]/Zsqޱy]GA>dX1& {wߚpMf Þ[o2;o2sߕ7r9#F!c~x !ܗ'`'<̜om~ް[}?wM&<1bfo7Bx y;l'\@PŌ_@ߕOf?b\pp3 <-f>gps-``ܖpͼ e<f[7~'~#`l#f p71涇1")!|1RID{_D^naB2"g1f-?mo'߿>ؿRﶿ?;E[ϫ-oy݄`i[/r}1~ؗ~hW3mp_*tYj| ۢn5?)bWudL?:e^.g~SJx'{V!;V9"<Ǯ6Z$@mOq63lAuI<՟ߪnPcԹjkVOW/gǝkDҰ-}M~Qۥoۥo} }]lkMcNm>.9*pv?v]2VwB\:xc8m۞6+~CViS{oisۇY~jgq,uvǏzvmvTKz x'S̏p+N&^:%X'@~.|iM'3g{=po^+ev_` hobT^ߧejzQv:);$G,a9vfjUa/S<0f/}[p$|g4Lײ0~r~Üί' ¥wgQf`1[Oy<ڱ ᄢ*r5&'U q۴+kİom%̷ansgaOo"qҎ܆)X'WƋ=i/ak=d;L^iw0)IoN"iگ&or[9PSAa"L]Y6:CWȱ2n o"Sƪ m8 Pȗcv͗#aw0K8{EjN`m?Шp|]勭zDξLi\y{3~E꽗"m2؎~wιһQELװIy^/|o?/wNY+;%'_N;w#-wx'>rN}v—>k#6 ?G}^)>}g|%<$$IƎNI#NI-}wmv !1c;HY;Eųq[ajYhD+n'{uh!/ dOJ!|%?^`|1M G[Տ+~lW(ip/lV Rv,;n)08D+-:G( z_2zoonHhUܿPB[x#<˱>rH{@\RD>cb5oڣ㮂¯$sI9;gt'zãt7NJ'p^5\W<'}S\ ވ@r-/\| 1p1-?r8S|Z.Z31EL\ֿ 'g2'gr >7ފPrm,F>Kлn sQYB s >X %/bBs9r䚳ԑζ &[N^[Nه;YƓΠB㧂=zZѫ,]7~>ᮼ|Z(vcQCp]n]eTǼ_̫mܩ?Vܷˣo o(}CQ7Ա}C۠hG$P߀aWM'{KZpϫz@ưF3oW[So3Z+7РT-'yGf^gY%>pҀf1>w,5DLxI#~ߵ/to9_H/wZʹ_~, De 0nߤ~t|wsMzDLM|.{V~{5V/ -yDh)%B3Kf~Q4hfM%4KL)C&`Pr'ܐa븈1 ưu\ћہqưu? 8Aþ112}cmw6 g>^}C}§m?'g  c-JτdͿ c>h,|ZK%oĂ %|*`?p ʼn+O-5Dp3Y:-Xlg8#/,C,*l鏱O*c%q -#.jƈK选K;*Ej]G^օǧ9+E+J]^#K?X Ck~ rEAWg̺fGɺM>hҮ Ф]C.@v]@N:.@v] 6ˮ Ч]Ͳh?h?h?cqH{d:jςZ@܏XG܏w''#?b\,C.サEIJXpa+b+ʀ_ G7 %8)ݶ; Cstb3|e 's">4BlMa֞'1h-cTƠf#jE(:,ߵ֎#rLTc3NzMk~YW +V2{&ߒB8&hO8.hŜcȾp[F\ԅ`Nx Yu ={$g:]ѕD?Upz~—sPO&|{2'KW!{|ئ~+O0EҎq.; £O&09k1Qg3v8f|ɆotuA13$|u3fƛ~\r۝{`/1qQ_s\lYɋx, ]ro uA9  sA擜Or3M>A˃^9oocOy~%cOw·o6|+l=/ltqNp3 JlHz6Ώ x{S>p#~f!&<7z r9*??hy} A3ϻ 7 }/vGcِۯ`,8 rR\vǏ79&[=vj }FsO}k] o`'d}sB{'Zw `#uVqBۗ^">cOǪO~;«ylg\^%S#7(O?WQy%[K<{M0*#":iFl ˯ ?>bOϑ.;?O{‰Kǹ˖b//dw8-suQYw5|lz y3\%_.K/CK1ҫxa+؊^/rɗtK~\ )~9\Œ#!h&3;N3pB$ǿ)rGxqqK*9ʽto]%FहOA<)uVrmfrnLnzBwGNW{^1Qڿ-h]?ì?|RO6ꤑ7'EɴNp+qߞ4ghp/Is㽋+;:%cGd"|SНwtZU}~]=MQ \~Rb+ ucNl4Ɵ23RWFYc|G)ǜ5` pcM'N,) 1oyuG ჼhd,>=)ᯯ~?Hr%S~M}~L=z*җ?{^x{U7/X>ڹ,OozAOm"BxpJĵ1y ?tL ~yl*62+/ VaGYSB ӥbuD~ VxCr e 4oWq$U7~Q!z~'= ?l+-gBm/t½N o?da>p{`ӆC"<9%{q4;z<mGj,ᗹ|i90pΓ24+zDNtA}&N;JZµ8fƒf?'|K?dqg̷cN8cʡ9ct3Fp9_I\aoyܫgx_co?(أd!jLvܱW+~Ս~yϲ(Ã3B?/ZyarۿKTgd>#Seg'{V| r_;gg]7g彷07 rч:w| "W@hPP'/ynzʭԃtga>beqOQdTn3c [I7s_ 3s}79Su>Κm*:C81vccͶJ ]f:;/pijN13=xpMY1_yefoYs{ia=W(51O'I6@6;觘۞xL<->8wlKYum}Ԓ={%c ,T7kj % hQw)펰;K=..zwg:H}MgY?|>cOsxoUؙ~Sv}bshm߃soQ: (>p2't5ȋg nT{=rVDRݱ*Z*Sd\B`GGB񄳂w6a[/J( 3+Wu<2nw^\C~Y]F zEU;Scbg c,+m G>,>,}sb4Ɛ[0<cYKwưOxE m<-m`ϕG s7hKKދvָ3/k*wQKf1F,AV3FFlEÌa/` c0j2S ! r~/2:kiO8u|1?5Ý^7_'~oݤ_V?!<Ax}X"eg޷1o+־?K2/_ɒO3';;@Mu`#yʶЍk]S;28ap]+ޥyD^n_nX%ONP2ZJB۾wq ՞ŌAtOP_{[>l>÷I[ ~'\1x@[&m}o Ocqg'f~Wnβ `''|֯n>xm÷8= i#|ڶ>l}mUk'<ݼ~"|.rl${ m}z %|'] ` s ce &>ᦶ>V>>v "/~۟ #}µNkR ,ԁ#d'|O[>l}¯KGTX}xުsXr?G)Y7#C}~/6GI<|RMdi!kb [o"…; M#oDxaA}aA6KS>Khq=2vp/7qþc-_[[T^{I»W +4ZI@y\+ՀcιZr5kV6FW?=A3/O. `8hX=6HҚn*`?yz<T:X ocEnҌh-NWJϏ5fuUgin0'/0߅9("6,_ţ45/G] akepa/{)2N]ޑ|ٛB9!$|K4y}C{1W3W ^ucYu_681t/cnnu-"|*UEk/Su>RϪ*'3fnif'9a;{'ku3ܭ~SU|-4Wqs3): bPNX/$j."Qá+ڝ+"|]Xߪ}lpcx^08>;Xµ -}TCwwͪ!gW ٹi>'5֚KᇼmTn91/3qO;ia'Yw"$<;6cSў٠g2+)A8_rɰ8_-Ǝ]س{87'P@3=4~9Dxz$w7c}j IL7[7 _ftq^{>7y{WqfdyџLb#]M]\h8s6Oپx99Bx]uם&\9db|{ ` 8_m }A_T:*\mc\oZƣRɴF\ytʭ{=>/os{qh;TyD_7pXҸHzD{\߫p>O4ʟ~̝J[M:QIZhky mL }p'gl4I 9tӔC5Q^<(3ߌ`=Q(g?$ʙe3QeWs;+/e(Q4N&ʙFL'xL c\jiteR _y=~_c/E).o zg'՜_@sH/yS3$ɜ I<zI"ݶH+JuZ^f@T,Űp(7!)[γЏC_3_Sy@񸩄2k, lf4z:$JbI#c"Wެ<0MA$?9#E8qCjL`' )4`_TH͚GgP}MsFلKX82Rt1lSw2F#.1n< uG~&Luin?_MW5E]SyQųŧkjZ?Ǧjn*]f~*eTRNTՓ;;~G֌o}g>̶Z 0@g|x0n1fluY-Ǻ''yB=%sL P]UgKޢq3Ye|5<}xD䞢yMkl!zܣPzT.ǸDޒ!5M LO='Pwco1>;m})קgsOO%OxOW3slWoasqx'\/|811^v&*~8@e7KɗTߕ=l$˵ĎWtl-N7SpCoae쎐>%`*c/_3ƻ3FYs'/d Yk~cƠ-AW` ;fW|xiφS̹y0Ʋ&uRmOĦZ)n2Aǘg}RxZD9Dzs ?:Sm\q_6e\NG)o~blRDߘ⋈:J߸0|vȑ:pC ;cۆ/ t#fCQs=:pDn|}*Y+YA5jM]x%DS n R3[b^Uۧ Fj-%3ש-g k˙%1cݥwm]$;ڱ2Fb7P[fklzmͭ-:Ͳڢl-~ZE o#~]{_1>T_(Y2ck}ƠצA^oe z4w Jp"{"U` k1Ft#!O5r?ۓ__8TƙhU0wR^ؠU[Mgm0z|~%['oG<}PO}k9^&:oޙwB7n6MD{_(AQg}'ci3 G@Äw ~em)?lxŦrG&/Py =u^4w^h'BB;W|vd@䊱r& _ 郪U8d? 9Oz=dT;>߃hymycc:F2Ygӈoۆg'd a[ìZe>;?h6FǙ6P}< q"ZNӥ~MIR|1j6HQgAƷP{6>'6'\Hxa熵TTS{KA[=;ǧ!}Ġj}5MV:F MmQPd~ۂ"E;bW\ާbfqFc}5jiPpjˮ :TiƇ{x4_w`114`-?k1 F3l2JM>r&A>/t&H7~>sO x?mweW-Bv[8tE>/K7s|>Et#Ã^.> _4s7vlIxqJ32Z1| HYrxȒcӝ1q>= L=k I7{t kr%֕ek=YޓYP 늯Nӆ1ƥC]㷃q1喺G |N[ZB塺<*6}QmjX]C] o^};K{?=]bÛWWluOf#c˧h;gĦ3084a1mz~۩b^3O=3V4Kzfo0'{|\=+3rC3Sꉬc=hM=ѹD=ѹ˻:iR_Isu/:MEQ_t'r}ѹFONm|YmOlDKm+l? l$|.cm~0'|?c0#7hi% Ol W g5:@|i- KO&|E];.gP_uY'7w|A1y#}|a~j.5zSwpf ]PB[y#bxwi($? #INQw=ߵ4V[vP;(w\l}om^:1D#Wۼ>ڢCJ&B}~/v:tqo,_,m}[f\BOm[A̵/K.x=@/OmWԹk3J䡝dqh>ͣƈR\jr5}շ/7׫*v~}uyJ>:~~C[|}<_};\&M&ՋO) u)CW-iRUZ VVDBhv곏hF ߰AxR~:Ck.M]ܺmd+[i -f}n. / ^A2PGZ l-#y& '4n2x@90u̇TXMVJmW?ק⇻wWV\}>~t4սynn/W~.W翟z?<<ΑnBN2YiNj/GK%Gn??.ox8wwϯD߯}]/noE%2au[o'N{:Iju' !у׏OwSž~OrOH‡ek9JK理ۛ9_xC1ۈ7OIxob]ܜ=S?!- uZ7oN׫SQ WoiN^guq~\,vSdIqd}-Sv;r&n !m7Dݦ  dLtKX$Հ.&uee?F}2 q߶2ۼleNEvg"{sIF22q\IF´NL->nyIJ BCd⑑+϶RxydHfH-B&t|䒾|_}O}tG⋠A}|+AP礇}|5A9~\=\?_ѧkOho/s`<\ËVyˢLAfLJ[#Dfo>z~IW]FE%iX=Y9L #½p4i&o}IXuOi\,\5o95䵓aqA)u]Ypm JL Tui񥭻."]EY7P!b &* bkѹ!Qb8X* :[JB'F@Rfl}[*KDSZU|1c*=;%z2<Ɋ(*mYdi.S'>,*>{d ȂE?ӕ:Dw]=饅l 5F1j0ta@VeΏ$#|/#1"> HコQ4E:%֦̓p2|m݃"5z,3+mhJv4nciirohض=& q%/+6uD Xi/ =la ΢̈́Af֝tfD!H߿1e_5Brbyx/n`o^,uBR i7dVf^=TmTSlvinl-!\-ca$|U&r5Ik2 b*B[":f|y?B7>|4*MM <Ķhs^gn2# 5LEӍGGNN"/ @kO_YҿEA_n0 2TphRźWHXu=EM1#(ĝXcIG7JQvtFb7'ҊH )*N&j/Ai@ y߷UM(bjdma1*l^S> ,Păe8qGPf㖨o3aEb'dpKxVs1Z`,MW mtIovg~V^4 lؽ<9D툣OOa_@*%. d+dj7Y{)z RzI6t8D%2s;%#Uou -\\>xSiv%جC8q?O_O\M*X|+i@'B@iqG.y ]W8u,7(P/KOFNR?Z}^Zc8:FR{iB'xNݼ)qBIz[9`v,i f[(wynKd%eÍC9 <JQlYM =$&!؋Eě"1 i ,1 w 1HߧHg1RWs̮/tg,Tcv.![ ‡5xSaetYHlėh76OcE})Q8®q5z+?ӧa}aH:G_6S)9jbڰ4c!y(lHvHH$;I$[$C0E)Cɖ8H8l ,G .$ THv\mZZǩo vmbr6x\FJ oUcH_dTy*//0/XkD^UҍgxRlF2Lf*Y1='P}yNS d!O _Hu`_Mwe,NzRhKRuʩL'A|0Wdu`43R2cw%n*02ǶI] ,1EVs)!p]b lh5 No0~ D_Z-weM'Ktq3WOB#FSDL9qzLEr5QfϵSA&!쑕5)SV tW}:VSJq_0BIV%U7_2ӵ.r⤣: [f lԁԩpN".)cžP<]tP#h)uHQV}!L/$Ra8FNJ{ {+5߂d!Ro/OU鄩TlW3}>_4!)CNJx078COVJP"[u!d˺q˸WN^ 0tO)\v*cNDa)ʏI#&pJ/MzjN˦o..Ф["&W |(Y1~y9# uuy1S2 P֖'Bej]+euL^rp0^mRSFO&s V S̮rlBCQƒAI,}Nsd>پŒU6-d!ĔcL)Bjq=ȘzGaXl"˅F _QBd ' 1T @r VϷ=*PɑN~{jgN\1"XD-;#~ .Qt_ >D)ȆFa>)a,8{EˑtKR!Xw XT38JĭlhoZZb8rrѻd>}r+q̽"&7Pi=VYN=,@ *cD!7֎1ued@=cWk᩹V EMH)M`7r`%BA {S$œxbݓ&#d;5߰rHF$kSNB)6zyfĞ@Fp [˶/ܭS;UȈuuCLxۄٶ3y=w(&*}ltt81b߮% P]\mQ4>A;:%aͫ uzǍcXy:ty%\`49KC`4a*:} c6j5[rT ɻZrZF8pt)v2h|0<*(Le0ZV%`,H+|KgKnfIEM[s90"Vܔl8A+NFx/4[DZ~L?$:0bQGJnSt&̽6__|z\!]4i,7BJ̆Hgc߾?ޥ'v G>9I`XR:"7 >SfYjp yQBiYIi- S qf) NhLu2Ob|Q!z !lPmUop2Au Ƿ"n7+6=5Ovy Xtf`Ҕ3]*I53/$eQ-5-FFpl<9: Nx o'^_ `mpVg|K2~8>3iԧ oiPW8at CPDi,>y"?hؗ7sVNn ݾ55ґC vp#K+@hG8>s#’s=,q=@W]:qˁ2iO ,w =nT\= c(ȏfh0s{9j.r޴rR⾓k9y/AYKTCAtQvU-%)Y0{ lsݭpc* OV2xD{K|D[e3S!Ѓ1i"* g8)L8P!2ӡ2u?>cmf_ *ߕ(x/4 y> AqXfvN9Vzfԡ!-Is q픙|I7rsk"³ĺCjrqD:r `Xw{GhynSX,lvNs4lUVt2~)2:Cptw]BBƹ"ՙwIc!'Ő^eN>eң`O 0՝V=Cj ЦrtKX'CQAU2 `YóͲO*n0`ƹ8䈾#Mun})m<(0E?媈8#zʓbETޥU3go$||^͏c׫c nK{ǔՅWOO}Ǻ2[̞ @ "rZtaKP,f=B *ZȪ< v~_W+']J{_I'h:K!6j16E .kܱ3Y{]~nBXϏqV]mK\ޫ?^}Y=<߭>sty%Ž>aOOp]?>_K\d@kW/†4BeY|f x2Tb*B}KKAUimqD<]ٓ5*;)É%WOFRKT(⍩O`=^I]ᰔ7yA ɄG3&ڑmDؤ5!b1֭KYum?z UܮMp_|m߲K^o/5A޾ZTZ\^S> R@[\;\0 .^7Ro 5 ޥ!NAT4rH 04N7*ܴc˻*2r,q %*)•[ęFC= \2o#l856PnRNw<>#ͭ߳@[`bBs6)H/iUJN^)p pekN0,nʀ p[=T#Nlz{]v[.6Qɜ9뚠]vLfɺ}dEFԮls[tv9ٳnss_aaG48YϷdGrΘ(]qӛ)N:_ G*Q@&(ˊA׃mS\WΙ:/:Z[pm? >hAfi,탥}>XK{{~{~{~{>TCS L%lo<2 $bԛ>/-)/P.urrW%M1s^P7$Zkq uY3@е)¸Bzsū¬Du105Uw =oWv#Gmp2륚)hiXԎ 2>k>3Έ^DRx(=! [Yn]e@}}=@'i0.S "c/A p$}鮉&<)V*]kG}Wa ?kԖ墑qQ`5elj(d<=8=0FGw0 (#Џ*a*g!#w "M{ v' iA,M&'3h1_Qg fSfd7 iVuF pʢS'1G*iTO/LKAxseyxQn*#Kg $iiY*C*Sw;Nљ:NC8n o0ܕTXbFּP2=W"P7wo%B/dz}!jmn9S.E&ˣx+Zxs^ߚ:19]2#RJo_{#!y,?"w#r,"v&B%VTs0<=ǩlƽZOƶC|N8Oˆ@ OScI2_$Z(N5hhPTQ.4;h}z^9hhĜ5l, 6\j 0r}Pa" d@)B J=iUi3, ^yJa;)>Csl`yUeN\ tk%M,Ks p%}P\!|Lj]>`=DYhsBW| aC@PdyӲ"6U813=/!YPn2ZiڎnB"k%;Fh2iY ]mI,cB3* } !uYcIn~I|Brx|9!$$ n#pa=ivQsҍ~8וLᣲ2kpiKOP,!{ Yxx6'rqcXi)mVteLIiGY IGH^gH`q"UeiqtΉX@09ZgSa[JXc+ PA;'t8aי|Y^|쟉N -Kb2IK}6#gbm"w(QJпA$6(x[=WMNrްbOyMP7X:,Np]}/y0AL@AwՇЀ RA@R@Ts@kEEc@:zp!c[ox8 AU-⩁]w3WƱ`*[N0d咠1:"֝b*lM88 xVutu73Q ByU+QWΉm[ ض>pX =ˆUYܳx_"]IvLJ^CAخp2 ;EW@m2*8aO^352 @HIݖ@Cg_ҜY$D# 8\+ݶGz ~~h2-jy@}'eh$]@uIP]K oPӏ+TYTڛm“H:;1TOo&/+ԟV2*d}աQh$֢FYPK=J!DZnV-ŋ npkG*tyPG9 !ia*vѣX' P6 jagSB*';Ec2~!n~CbkԐeoJwr|(+zcGZs}!\#uSO -dm"CfIC|-E{QZbc[Lv&/PQVĐwj]Z:sAh M-הHknPq }\!@!BLrV+1cӷ+̕fSoUFК^fi+c#uUV6p/r%\^Z/iPwMny^ˠlHr=^GV!lk|C@mYw_B'^T:eD/ռr.MT'a+"0m>s,#}iwB=֕IoN3־!^.~>b3|,MAY*OFؠBі =ɕ?ɜ/ɜnYjb%(5>*FQW[]8qLWV i֌Ѳ^~tȊ`H+swg|[=uP=8Ίe en_ Wwy#{0H}>{߶eٯVD_]K8R )<}S9Z7Dοz-oA3NyS/Aڨ-`n=뙼I@Е.*$E'Z zƠmy nB(DHH+,Tp6?q⍃S<6VBm5& YSPWl̈] ɐ1K|->Z݇csyxHxCp#A#..KdI3Tl +P@I20!XĽ%ajސpr#K$f%j5"R|zQӋz>Z uFNmOo}Thk/,{*SY9/pB{p mY2 :?xJG;'@ .]dmϙ9ke鐰a6]: t5֖2jwϴ@9`)ARL>"+LL>y9e@6ȚϔT9 +5kG18@Y7X`1ȖDפ#ȯA ̩c\<Ǟw'3ȏEMt 75|z,AEP+Xu6yUikq{]&kq6zXwNF7*@sq"~S%:z5J@H @ M@Ѫeqi+Z*K .$g7Uu@ vN$3HӶ)4 55=_EɔJ("_wkR<Ɩ!РLQe"`lRzT,)̍!D콈{0ALS8* mFF]3xqMjkDXѐe[AP@bJK:逤ПcCt  8ǾI[ڲsʊ)b^exά\3xuMץm |LS-VRY`֐qqBw3/1+OSYIߥ";zthyELY!}R}ppYX b?mwFٲZԾHf Nc0uFǎ0&.P[v tuDUR&o["ŴLeH}۹'|fNU HEVYrs(o5}*TO߮iK2Qp2J $=62uMz/. m|MOނ2X\?oZtY{n9g6g*ǓA^< :i"څ)/B8_f)O-$Yƾ(I ¢I}اNV]|kR3X6)eΦDN T HKt nqe bW=ƨi$rUo`r҆ ˳os8QJIweJXAek [hTstD`C.vT,DlNwx("鈏o(%^nz"jȶrd(AWݯ8-cáKg5tM/n:ڏUw,_Z80_L[Y9@MU&<"S,BwWL:peN cЂ !M v9rW#GYeq%𗪂WyFu|pٳT2a'p&ACe2Τ9pjtI %2ʌ?4>O3dl]k }^:@f&r@_W)[  ˅ҺJ'%{"CJ;}*xJ=6JxUjiiG0@ʞ&w&}%?։Zci (xS˾UC'zDG OjtsRa*遴(}֣qyCi<25*R66R.φ4'O}[PC]epJi, M)T@4dk3S5ʋrvĿnzQ/PUq]*VOj uOJk`/vh% }N{*li(Ka ڭ( W w|v#IdxM] ty&W!<2bժM3mu*6;XA=l[Tf˭qrRqKcPaBķcW,z}]\.m 㱸nx+_yjԘ\Z ׮S`Zu%*VzłٶaD|;Tslul2oKc %FU.xA"j4ĥz]0\FQAAhTG/os,`cZ dG <%L?LuEV E:H:W#/z;j$1 lq QR\@LbViH邉O5+\B18_htyZb ufBrv.GDe|_^='pYwGnnHjn5yMw>@Z`50Act=W6nA],+y2Z ]Bs:J)28mRE8r iؙ#G(LyR"㝈U _fR %/sjv{(I5Dn(\ZCФ%v {)@vP+xLZ8HzT:d>Rc*SX\Ne.YG }i1_$ŭ1KU%)ЖQ I8 KWDpf :PdIݽEaEp0]B!Ҷ)mb3r11~fAFu?+Ǐz/LՕP/eJ^*U2LՅ"w(F041;8hoA[j;Jm+ p/4``K~5:#.Ȫ\nQX bpͺq>kZKljfG/ǖ_V OGr8jʳqMfocA$u`x?I[UWqK-Z c|uy FXS-T1mEა_mLMіQpg7[N+2sQcz R^=hV%ƼZSaYG:ϻ vEx'0("^u\-H@OǨ%FrثS'(5ãvYyxKn+kHt\8X㝩൙֙9r-bg9܆ IKYy:Vm_vai%tZ f}$I=ns{]0/gPL͋¾l%= Z7MY묒9'!g#L yR8Mқg AQz%x1 nO9{p}NKh<=-h jjꅸtO,Oz[a&Q`g[JW/RCc@0FuPiIe&C#P&ܐ/2W gIfoL )0AoĤ-`{0"i럿(m=nDB%Nge&k4'AHTNn܆&VE#P)mv&D7ؒ-14*m2Htt/ (쪎9V acf"Zu[jFLG%ͫ0I,˩6/WW\%)zPu͂t:z?_?<.}4Q* '̙Dۺ$$/53Mp-ʵ_ϼbN1 h\L~0w$ 3Q'_IwyRb &H:g{"Lv/ LeYY2,^RmuE [eʿW]fgP5BzB;;c^BR|5H5o7 =ʨwK^SlZM NzHя} bԆZ=􉿨Pk3ظ G BZ)M6 Nc0.K%Ó2s6ӹ$)q)d~!c褾m~ Cb~U-`jPMҴm Y{_<ƿ Y}/w?}&>xOW7]ܯOrxm8a~k$GЛǻpxq |(?>mЯ7翯&׫KFvuwqIw|o/wq>T8pSg k ןaRo?Nݼg7Oy{a.~RW7gXxR3iURJȽ85mt?ɉl!6Àzw_<~J x{|uisq]MOx?Xwh n~|n|?ajm=;; |{O+{:I~g8qm>WragUU8C,^̈ "\aEk$j,yje,J>a񘤗kgȮ'$ѐ.֦n]8 Z5l,vP,aC V}꫓fe~" jPtCoHEr{ O{XtPL1hbXx8jR!n͘q\" PH[<HA*GK&5;ih mB?R UR#tP0݆kTD f<1ᴼ2U$5:УM(j9^[ A|%Y~x^JoVvӰBr C;n.=_E~9~~p.1N}erD#.^ nM&6jE0\b!" &@G}lL`{51(g.˄017-LBB+¬0dN3aڶ<0&dfa0IMY3{z*-((ms&Q2hkJ9ixtHej:,S"E%i82z1uT9ֵJ|ӼATb]e*u1vxrpp=dT;G4@P3\N O>MtxU&;D33Y/V;7TsU 3WZNn6Y<׵ FmMC a=5JjqK/4GBaxᨶD*lQt'3uЦ gj-dJzV[ÔsKR5YSGEgYsly&qKǃ%B'Xjy!*Ԍ2;Ah(<͑/9Yd4 3D[ qJ}D~qdnn#Y""EكzAT9 Ԉ Or6(Dm£a)B@^ kHUR8d!S4+s]Y ~L{,`cBkh%USFw_?].7~V7'1|Dt/=ݽēl҄n* Y\ZVqMLU-M!n"Z;vT0HUS;%73RFutpF^5`{m%/WBS/8P/ 7UN7Cv%|;OwgJ\^}VGJMd NJ~6ug K /V+ {Po#y$Q$t  9 K"9stӴPnNNʣȱڦy hݬDډqpKwaF{~ȡ ϞtH EM$dLSm='Xv/4qyaAkDg]iQ@ã[m1O Bqh#4u PZq]KU7uM$8`2Iڂ N ઢWq/CEw5Kikl-۟^4Z6B4.I q)qo>rS&KSqo&&"=mqh5]SݸBD!lKGpDy_  QLl= kSZAlm#CD`[G9?Q5bXx>oWꇒU8GvcJk86~`Ҿ[Vqݶn` Qď-H2|aG^0аq/"/Do/zB=\=<>!_B^WbI$%$'־ q~ clő3)c#zGH%c-|Gg K@! @m~,t9B&dhfAehҍ=?5 &(Y@opVTzVMFVNpZ壠 RNaw9mbx*3U󴀵XvKeZ7b,Idxg0+%d`Ҙ7Miˠ0{u xfYᵶez[~VՆY?jϟݬ_?;>|,pui^ŧtysn>_}}7/d{awWy|7 Cw~:Bod%?CX yI4n>?N gգn8zXR$Jf~y{~bNDuR9WHXO7Ź1r{ǗiNnQ"V?{=^_.}xx_?_WoZFy#xws*+7? OA5혫Ψ]ۆ Pvzsž E)Kz'!,NmCP{Ɗ`6C&Ae&x '%CZ0F كi5|6]-;p,k1M2S3{tMM.hf_6L`:x-T\6,-KQyWxcݠڠ!uՁ yb|sm`K,r9gQ{ql{!|ʠqQVC=,60X 84K'PCEznƦGK@ULϡ/Ņ0='l%֐!dz u aE7'ɂ=<OE `u١I#P_QXLj7n3Mq/,k[=7lʸq$.22p 585H긃dXoKAVms rZ /PQQOQqrS/* @8AU\)5`~HdTU`5dnz =Ԯn~w(쩠O$~uq}~բO5eb 'ܗ'q8V zCf  & yz }iP7^ă:ПX[fmRU {SeO/`d/t˲/+ݙ}dw\5k&H=N*r9./StFlq.<`4Vh)QP&Vx)r,˼kɒƶ{@g[=e&D֨ZN]6 韚I2"%-Uh]s/CSy?-XzqZy6 KZ0~evwU$ [^$/JJ1y2C 珡~4c.i0pv۳,K2GA8_-; bF,)?ϸ(2ϥwUɂ& -]_x.|2b2 ~LoZ#lwL8P7$(^8nuz&J'XhқN{ isO`!tImyx!\гH;tU8n0#<.ۙ[hmbӋ2PJ~W 1.!/B#QcFv<0@5z: r!Re0#Ń_9 i/Xoѣ8$\3T̔_p @(m BIEi7Ϟz[Hc댠,$"eA`Ӕ WLf9b/,^c@`7sπrvlNgf95o8㹗?. =. =. =b>iUҌIHa&8p,2h.nQjv6>& `dj{^xHjm+#-m>#M\*sCː?3~8DEI!p$%c/p Ώo lDoh=M' v1-CmvȫJ!TeQZVflcc<(_s\`@jbtwb|&ъ!Vb\?"<\{yLxx8?,^m_[1ˇ#/Gϗ_OnI+LW_.W_oH_ rwDz+p{~ߎ'ofuJx|qJ|P"ٜ${{u+9x UHz6P vMvTDo ubZhijKkWqvs%etV~ݘTBƌbau-} 48xTPFBvwD4 'ػ~F,fA:5cGg }2A1 YyҵUg3*{Q&H ٗe 5v7̷$3"P1<aQMF dK(A/Yy<7,nc> d^y' tOQ{sɃy`BVR -W"L(W:; >[H\Y4Tln9aNi-(g>:X8Y2s%x4N.h:Pa_C\RFh4|.'"f\ShpQv2R[m*z`Q@zJD(z^)ydsDXcg~z1Ccd5){hl90ӳi K! x@_7TeT9 "ݪBhV¬ʋbpb7ǫx-u3ϸXnոɜ{D63{(g=sE 9l0<c~?[ԮyԆя4I,_ag-w*'Up6vfuSߗ7Q֩ԬD HD΁*n֯8dJ)T|ڃ?1' X -8gFV"kD7Xr+s܀r٪QԲU7Qf% y87z ))83-誃LAvX"5}Rا(kᘷ]=4+A-T'EC"q\׳h1>:oT߯jΩkyO8/.5:*U/X.q+GL7xˎ|I9ŁZ'YIϐP)W# <#͸l<8AT!׃)ZiTh4H ߋ"55czH#a>};xJ+'p%9pn=T|ri&(yAW uFb"FW&l, +eBczm6cI=WH'ICgfi#O+;_z{n{kS=ٖ6vž![H1u6Af\vb j>&p@fX.qu#C˔?2nl_:R)N,9C\fCY!ͳTo7[+eNnGB~#'XtU Tn&wܵ5bEIMC .Kئ歌Q\n1/ `}`E>B\r"V"u:=xV/qgUTiU)ԕxu<ʩɚZJy_L=1a3Ŏx샹g ӟ2Av&qaLjߜmxf9HąG@(NWqOjkj":g$ Ȼke)8=\U|a!B2Ä{ o>'gEcatlfMVhx mCW*0Rmr"#BV,Tz(\+q-wTtm0tHEyQp\Jja}] dxh6xxLm|R}&{Xxb1.s 95M,C67ϕYMr_P\E9x& DE,Ӥo|=iV46?.*2C:ei'v0C-2vJk%>hCP=t ֶrPyHIQRoׯn˖@rm noZV;uàD9SvEn|uWXl +?>BLfm],`D)%-$CJ-t$Q)"5 (MKC${8:D#I3*quoqm1qBr$ 9ͫTiSODž }z gN &=dHqWKvtKV7tFs6rq lCX4'rC:dW!觧,x.+RB}4?AG2]H?; J5 ]M ɈĔDq6FYo[~?N ? $1ڋ6h31/!zm`0jϘ<2 ==hUMy*FSS~嗰 8614}>i:mxp㌀%LH@_ȣ(KZ ЌkQ)o$|ˈQ%dᅋֽ$ug瑱UwA/\d>l-G %c 0Yv uA 2YHT1 mŻ.a-U֯3 gV񓊟U}s/?fꍰу#cz=|@թ"gB}G5n=3%~DloOiH38bŶv[ 0`uf T4\%} Pΰ A{i[8L\@6tE5 ^k'Eԡ'RFRS8v^7;frSy!J/߯"t;aay}QJB),ri||ES¸CiX<BOb8Uz62fڎ:J-D/pVmEEdlT{vB ES<"nGxH`QdJ r+vyL(ha 6LYJVrLZͲgbm#JIޑ#6? i7wÁ.J9׮XRa$dr+bI m|hx0,4ǮlZ3NOOg׊($3Nh ̮hSNN[Ww\Ug>s~^/'+t}BN^f)Y.ߩ;*$/0^TePQ#n}Ex;l'xdb!%|TQf{$\QD˺?.QYF~8QإTىg [tKDP3@wb(q&[ت~qOgoCclCmSEn",yۼRaȬyNNc(>j,Wb'}\ȦO9C|)Qo5au9<`ػ;jߠ֐2ϷB>&F'0on90Bl^<s:{I azǍ?aPVtLnp`)E?9Kfl=1T@|J(R1|ۄ: s&OULX2 :OۼQ #h?C#7fDIMNER93QnApH-spJ"37SAb$&qK .|ɛ~'6sA2 ![+ğA&5?ngL~T,~N4+K廝)Mj{2۞ԍ -i0eiH %U3TXFs%%#O[KwRj+=&s׿X]ZoHh["zeO Q_D\ƌnkފ?XJ.+O2F5jv:KlFT^Pr%8 LQ"wة+в:ܦO2ڏwﻓM\e;%«#i%SOOt/S - V7%k ;{T>Y7>MӨJ.a;TtdY>kPd3/K PT\123=̃P2^JMD [M|QxeЄ}aWlR /}grţzS0&7R3hx/2=9c¦DdJ1N2 `WFȎK{^hYNJ(w,q\oێruNtn Q' cΰC=ȄQXI«u9NlBD:X32x :=PC£3)1CAWpba'oҺ^Oʯt:bR}U.I<1O @c31MI} T據A,N2o`?_O<ިvY./AtqxZi+FPF+d$=(Ll÷0Sɫ8Z0T0Gz9%ԃ[e2K脘? @VVT2y3f׮Åhg{?BLG(ApE(B @} v;XSl.,CkNeUͺ BO2* fީ]xȷkIӯq:*: Vm1}!d6A~~cM ;k@} AjL]S&U|Zb"!8B3r^Lnif!D~lOZTNənЕۇNds7.<H;r)*4jDDEoJ["TxGl.p wu34߻e{Rf$s H_qjتw%ۧ~Rm{8KgX{SXmg7щ! hF 45~ϛꤿ!VkYi IFP{ Dd b˥$Pep XE> :*"1hSk} ńQa$FCUQ2~X]sv03~?׼l@|O(SGӨ*-eUݛ*D SjyqJBpy/~!ztu7s}tu[|Kvi݀) Ȼls舕Jt%G +\yQb\c=F (^VT M=eMsFj+7yVm VvbuZ'L"e4ئPCR-*A/` rqvO7ߌJ+Àɡ#5><cT"b[bXVvuȈ`PH̵HN/)H l51pN!lW@O|#7n)K`DXU1w)\f_|4 ‡1nX21QDΜ 9ucK 5sLƶc=xhm}Zg D5*/_a}ŦOy"}rNC:V=yi}# ;uPl;`#) g񚆜*!ck ^]6Stolzx6*xsP&rsiG`=_$['O>C Kag˹{$4XG'@4]IiW5n&lt'K$p( o ٪ij\D.3뵑# l8&_F `]ݶL$Yҋb4"ewP 9(|:]F7a^ OHP >v )FLͭ*魨$qy{42]_\Nf^^x@ ^Ş<[[ }&;=(R 4$EЌ@/H"Zxrdھ_lʗ7^޶U*:PkiDŽr%u ӏ{˻ÃtF z08E?O__M~?m?'5gfo*<\%؟ק'gZ4>mgRqO_ҕ&%^ud*dl3۠=m ʿξ]~Lj~C_%DEv _j pPq Α (`a+%+hnr5E D:󭷲,{q.^1&. .mjo3 w9cM!Cyr?~meu(s ;yqsqgVU_lQIo?K+a"NYfNu h,MڣTӹ f6kx;UQ\e[,:q_RaʧcUBڛrOۧZ$^h\">SΡt13PӨJz; (ja㞥U|EgNܧe=x!ۮ4Fz |dhby,(!"JGnjǙshPƉVuk @9q|0H|`?xC[Ҿm*nfi͏pi_Vs 797`A_2@5< c”p(Y1QHT?Xm1۱W\ˉ*^^G@TǛXUfۅ} ұ4itf,"ҶoEm`6 {fX'?'\:x83qmY[ԌKOҾ#74N| ٞ5HՃ\&.fSfvfIikkuۺIş?t7u>zj9 ,g6~=LŹh(='9ږ ϒiWOIi^R=F`qG &Sv!fW7_Y[ +zs11˅<ÈYaD \2:^YUkl];&hF|Y?J$PmXܱ-jZK\{REbEM5xؽ˂iQ*(:z0E뺪}{$k}a׶-^$P"q4 bLzUŁTk&׭gY uѪ(b:tv .j^[h.,|-鼀B}, M-HB%됋Fuz@vT5bR.|q$@2 p~IIq]C$$q[&$j\~uzk2j?R)a 0S] w|.;9\=T>N`ZKvFXmvwX+IgdhDzYCSj?+-1HcV+Ҟ@iaZ`Y}zQp@jZ Խl9m<{DEq1Y-ԓ4[4C@܆t3CuqeB *{S8 7ڋXxf%<;T7ɽ19gkO~h@lG:GKaᴊ&ƾ_~31s_<8>eK-'ͧ i`BYSQEp5T.@P汏aJ.v Xk/(1v/v7tQk=74" POQm~B~65iAf# RM(B?4I[T6<4 D-ɉQnBWDf9e9M0I6SMњD89JhኞoҷIk.)l(Ԍ@`. (PאҔjH{^:BuR b1PH9 x-6{yM+BkGi ZwwA[!CnD^B "苽Ј0i-{sgo$$/g8k& M@a0p PG|&aǷn#+Pu djnj)B6Mf?:wy1.vCc =>Bd6EMpg>H55Q\1^R#Ç i[fmIStD2M:` v ZrK^̣_-^WQs>|..Oe.{ I^]| ~j$L )xĀV B=*](Z]0ӧ4X[hBPǵLH-0 6ծppMvUOm= 8\c0)9JS,dֲfnI--7ި4^`6"0b&ԫ{Ъ޸nH !baJ n[Yk z.˚ꥫ_.+JѾo~t+5֋ _qktPyGE<vb'v?:mi,3tMEQK Ab,F 0)Ѿ9c@K,#yj~@~5#":2wFxCMyNAwq3 [ѵ%e4l1D$1!e0u㫐ˉCLM [UԀKqDYe^"ld>hqG:Lj+ iLz Nx(1E ^1:A*f6@&0(?їB6,=.x<\zC=~& 0P Xux'Wm`Y߾J&ڲ0ځ3Rf |fnJNfsL&D]k$N k'\3{2߽TkPqeW`D=F:ffSii$tx -QdY4q9vlTG{{)azl{}''C Kb*\“qew*PH1@?Y/ϼˊwd`jK43fKvwDaW>B /^k@@VI۴ bkmtBL _{. (;JpX58Hmà{EbKA9} ۘK<#;cpt.}%  (hg8Jh3E9C5FbWMMْ1XeUd"7͎Q*6!0@^ZŜFW{nwk?[/ |y4 {i#dQK/)KZxnXY 3!4?b73Nwu~I1gEQzLD$ fI;[mk6W[0v# 9(Z/htMh]A>aRɀ4ixςx=o80*s6ݚ0Gzl<ٱt#c<`C@W*K j\m/Ad(~1^'!_Fs'O <Ų[bT l!N%lKaXgؾDmb&"/Ȕv( ^J/3߯:wc[J`YVDEzFL*I" $JL");gG 9#7TaHB7u6_!]uecvq6*hp"*#(Ӂh`vy]ݯN&&\l7(6 R.@*B哜]s6; # 4nxFkjz ؿlx\6ahEXEq=Vi >u?=:#U Z/gMÈxMT>.WKđE/&F`aCI,0b؇!-V/"QaJ"~N5\H)^B, ʤgV!.ܯz:0Qdwmou[sXJe1+@IM&<bC)U,V% .V"zHHQ㪎29_ؕ{9\xi>vgHͰ=[-j#we@^"!; {lph>L"tʲ ⻞qAZ.}%=?n@6Ꮛ;Y~c~<|^u[f=0;U\=2:Z>~UoW׳ٟ窼yTyq]^Ϸs^zCM~[Ůw*߯ng-~'/k_ Gᇬ(} $l#Sup<E[Z^zSѶl)9#NIlOZ%ǼĐQeBsA-P#2r_Й)$l5z1.9a BGAq>1Aeҹ[sY3&c7څ&EζGi(y+EMĚ7+`0Γ^2{pARޡfs%y7_g!} @(r 4 ^S;E[! t(=;-}[vU.h!6nH i0>}Hɺq=.Fnlve]~hՅG.}vro UCۅg/0t1?/T~!Kp~y_u4~(NjkںBJ !W%[ p_4 u$ƘcT1nq@4]q 0k"tW3G`ݘt1m 7r,0"6HSdǣ*` F TdavVc_ʱ 1`:1^% @[4MIP9S2'g?_*aJ%>bznc9x,Q=@@{ƿ(a^0~QPjlā$cÊf / ?d@|PtgrNu3_/ ĵ.b骾_ +>WD/!S<}e~Ϝ[n6$ߣ2,AOظo맰*Jnʯo8nTٴ׫_~B18gpԆ'} mCDIiW# u18Ů:=꫑K!`Iii']YYC;R@45 YCmc}cf w2~0`BI—D gFZ<˱e?  󳳗`␸jE=Qliud-j0Q^|"H*OhI%G"4r]%d=qH&"(::]~ l;Onz=Jw*-օA#^b _3څj(Zhs(Y-[wJ^.w#duwBL6O)6OA{hmLUV;ƧX'늏]KÂBl \^9j[I4{\U:xc';=k'h;Hrz4|Xio;͕ J]n"bav}qNÏnyƧyvpCcA6xE!_RR6WJdC{>s Zdȥqs`"D6t XfHq8v_M; Uk@pCTO~hI1 D8Y\haK,Mt*Q U'A h+LjGw X*-Yg/긶֩iT]EP #h Nn`sT4Ϸ X}{xf,^xؿW3XI\f3_|}/]{_޽/LJ_n.7Wy{B%ylDEtTlΨžA(g1(>w^}&(~lʱg2=::E/KpBdGx\HۡtByU),xKݻnB*M_vkiv/N+ꚍc@Nt]7DikEyP@U >!yZfp>WO`盥A`oE_g%ހOyZ(pE3w+_\0Wu).aPV-KSX #j21"ʃ0 ax5kg\C$ eR0 ={KKo Dr1DM;~b?c="}'젴/[O+  Qjx~ ӠDVuDV[v{<N  6>6>6>BRŚ*a{=n%֥Lj Aw徎]0avkMЋ`o EuA?l,/qlꀀ{Q SXC᝟As_T]#0zL 2=vi^ kaVq'&Z:9Y i>r܊ǒwJ)b'C!qf%\@N~ٞF#y3iq9Cj0ZC"^x[B^eQ)Ҟ'0`\iǍ\b<(y P|Lg ʗ!H] 6$@!\G̰RR>MC`w AWA˷ȏ`i'ɪ-a X4F6tRWRO{E,J<*" xΝx !y/vy ȤZg}kx#<ǼUݳNt`8 Yϼ7sHЮu&95)[i[(3 'o%>Xc[7:CRy %2BXpT^` Z+!TCu7@Qyie[s{p,YmFY:Zk(Kq.9p-Í0b0C ܽԼn 3mNxofWJadTwpOp˜d Fbmj#ע|`%6cH8fTόQE;X[j :شּ΃P vqU()Rμ@Z 28=&[; TH,ZNtKE 1£ n@𛭠jG{KUTXO\&|AP~"H䔰>v Yx3l}C(Hcyr'B;" j݈ r6Q nQF81eVH8 "T:.omk'X?/B yDL+DR &Ck9pD b y.~< ׄ,x:]V|}qr=xVȤxZۯ'Uдٗ7FW_A17uWO{wi 2{>pDʧGiϾ_g=~uwyr1qk.{./oyrٟ#wZpsq9mjTׯ^6 !] .{Y]ʷ"s1R|er>#4&hѽ:VO1 6-V sq{r@>+o/v]e1u8h_>qɼlY^ep)<&:5Y{-u/}`W΍%ZI|\`R8.#jL+< 2 ddUk8%/P[ dxm|7qx؇o+aoT1mYHB!$ xG/; BFA2A*z4y˩nXS׺g`qV3Zb?+ǮBOwF7A Hxa x-]#ZIU( $QYAߕb XP;VǷF`FD_a)q) b/ُy3p݂sgG0*pH"Kr0`?T3 }XlN MAk E`<Ė}N\IЃ;a"<( Fm`F*Ԏ|#f@ԓ5J;0i.~ߞs`=Zܢ򙜡@/xa3/Q^0%!X>D޵[x*&U!8MuvRa".B&r嚫jrYؾPB:&Y;~8)16)J~%asPASFIށ^^^r>o(1XO.iGII$`L Dj[D^LX?^pdȧX<UʽBp#5!a@uy1>Y^}xH涘(6ޞB9Rw3_Wr+/(r# ˿! gbX֍m.Zx2Y6Bo1qV y BxJ0l0/f-SDX7x^Z.PP2^0T^_sIGZ|gDS ,]ylMɜ's95Q }.,{w674RtcE7xVDLjj8fsɝ_B-W"h;2mɠzgIMtNғZ*  A8떃seށ/%zB1<ƃeÕEHB&]A-7$?y%%z8g|;|./w_w sn2;^}gHJjk7j7Ƽ_c:[g!~=,/H*]|<ZMŎ%%Ah%8eK>G(Ҥ͘KN8=7NZj`Ȩ^>-:1OnJ8;1-B W吻* y @! :+852-{[7uQK]90P~ 5)*_=s:xAc5;K' ܠcЄuy!+_l=wUJҿK i`f hkb⋵H4Ő4 W6%f"F:# txj&|\"}}ߌ)R?>P !Dr#Lj]z[필 (H03$L˃.Hw ]ٓ 7nv0[Ӭ/* *tƾpF}3 5@ۮ4ҔCG}nLRne~P@$Κ! A4" e`g"|:mB\WzJ0P;FJƇ>YzX=t"|.VLȃ1RU+o`=5ejbT6?cB!s ::CLiFat)l SuU{ װP/#X=5sCZqyOe(IZgv)(`~|)ņaLt] FJo݀n`SğLT A·kkFĽb: ZK6pb.s}·˧ȒjCi%$.&k`5rEr ewI*;|W~QF (2AP%-°#+xkQ6r 1k7Bgp.:C4!g(J9g7rm&} -+Ü* <.JU6hG ybL0BE>b]̧w?@ X?ȐI vA|p}̶thl:ʻڃzᷣM&'Vc_v` (g5.o=YӪi/>0z {;]B# V^J*PEt-/Ĕ@Rpl`A-& >.U.K%\R & 09@iEU [_W{ rڴE1,]o%$-:Q qY8DFx#ڪ`Oa&9AE_7w8F#WRFLL p#夝޽dv{k9,׈Pl(EW^rF|j՛Q -ٸii5BPQVŧ\0ikGj3(ɸQԗ/FQpxRb\uKZDLAZӃ(7) m'X5t!-@8;1i>NzqҫW5WR¹:Єs=KČv7tp߃hZЩW=~E2G5[-+u.ۈQJrDU~5>d"En5:qIE}ar&3p;H"sgw y'1s yYkHAIE U3-5AHKGĥYU$0Nu$NnvTM/̘MYZM_鈁,n6螺5c)#d+\ʳDAVTA'-9ʶN9ol7Cr$A/1-Ey0Bu!Ń!SA `,kf٠^g"sFwgZ tIeAM9~WDxA% -ˇH^BtܦȽԬ9:zԻeUpjVJRua (oPC't#;<@y⹱UBZXJB&Y0sv8`L80kG ܁8F`6bqK>YsM*H7"=a* h<(@u W^z|𒁝rզmW ܳ{ϱ?NM[Xgk1b1܏IWWn23|{<>'WoJ˜%Hh!}0F18]Ro;\p[mf/NLA}>B:|T$1b_!\f\ҧѺmڬm5g7ZFu;wBoW`%}.h("7m0<0)5j%] 3:^ UDD-U/ nx4bv8l,Oޱl 3{z}dH7$ !=KG^ ɡaŴ @"bPM@f\2F9)2r~lli=8Kq2w:4ٞim ERl h[ MH1289h,KT-ڂ 2/ 9-*%mFH7RFSXQ1VVphCjs!XoB@dE&&np?rƨr77Zi[(Pk㻽g;՘AS7b(Nwi @ro<6טWHZCr_`]}ˢ]7drf%aOт|!mFXY6ҽMjm; SVD3 կ 1%8"ix1$.j鴔Nq͋|Nla,$Wl֋R)ǎ );@ 0%Zmw].;׿Z_a]-2swE=EF&6w#1Oy$6$|t0'J#spۘǩE=t ^u.[.;?:yX?BD{c}fo?yC]?EJ"mxJeOGj񴘯[׳ӯf/yb&>jҀl贊LS>lClhCGKubHVXn&Tpu_E \PXm6 (-5ZZK+DLξ.m%}f/tP1]s['-JhxV9'O{s &+d IL򦑛TT$[Ln1MbqiNtP/%@Q+.l) fQHXFw1G2D) O@tF,bN]0V2m ~b収8v`0DP4*@<RU͠Q0[,R==Zz|CzuB1_-?#=.o&NIOqQ#m CY%.:T6 M4* OJCEn6v @mXJ.bnX9OtN|2h>EF6qxVœ&O"| ע֘OC[Yqh7| 2 yD\ڄ#%-$<)x6mvlL @"mAϔOFLv'RdmmB7Q!T*@N " |E)쒙^ k/#NcREq,C8} ~$mD!-W.trT].䎅UggQkE@IqQzr ]P7dVU([[DmqJ-Tcq <(㩦ࣕwf94!Z[TO+o{^=Jެnetbsd-INSTALL_C700.debugAd@h@#`@*݀ 5̀ <l@ Kx@tn`[|   4@ @0@@@4@l@82@D@U@j@{@@@@@(@\@8@d @T  @D - ?t߀ LP(@]X(@`s(@|)@ +@t,@,@$<,@d,@t -@-@2܀ GL.@Rd.@]l.@Ti.@s\/@1@ 0@dP1@t<[ F[T[ a[s[x߀ 8@$,8@,X8@:@ ;@;@$([< Nl( a<@s >@8>@ D>@\>@t>@>@>@>@>@lC@ C@PD@D@ +E@@E@WF@4iE@0[|[T߀ G@G@G@G@G@L8H@`H@8K@DK@K@ O@O@()K@64O@hB$[ XD[0ot[[ [0H[[ [[ [|  *  7   F߀ NO@ YO@iO@uO@P@0@P@ Q@DPQ@TQ@XQ@dQ@,T@W@0 W@V@!HW@-Y@7\W@$X@tHX@xWD  f [w0[Z@Z@Z@`]@ l\@T\@<\@<]@ _@ `@  b@@U [+  6 ߀ > x_b f@Lu h@ h@ |i@\ i@ l@T \l@  hl@ pl@ l@ m@H. [8 0[ @ P[@V [@m [@ [ [  @[ H[ P[  ̂@d X@ @       Č  @# @@ l@] @u @ ܌ ly_ @H D@ @pk[[ H@) [@1 [@C [@S `[@d [@u [@ [@ `[@ [@ `[@ [@ [@ [@ [@ @| `@  l@`* @: `[[[ F @@V @@i H@Lz @ @@ @@ @4 @| @d @ @ P@@&@lC@Z@pp@(@@(@,@`@@4 A AA7LA<L0 ^  r$ ($         0 ( @ ` +d Ah X( d@  p[@H[@. py_  @/  =A<>A@?AD ?A`AAAA+CA,5CA >EAKFADVGADcLGAdkGAr|HAd|HApIA$LALAXOApPAQARARAhSAbAXlbAT 0ZAhZAl[A@$D[A<+[A3_A:_APB`AT`A]` pd }|[[[[ [ [ [ <[,h[ cA cA(cA\cA8dAhdAp+eA=mA<NoA8_[p0pA,}\pApAqArAd,sA|sAd tAtuAĀA\܂AH\AD ЄAA. < I [ i t [ [ [2( N2, ]24( q2\ 2` 2d 2x_2DD2 DD2(DDL2tDD 3FD`38GD,)30FD|63PED3`ED?3FD,y3G]lh M3l R3p ]3t b3x_3y_3DHD3LHD0|HDdHDt3TID@4 4  G]"4G].4G]H]64H]>4H]LC&0I]J40^DPY4^Di4^Dv4^D4^D(xI]4I]I]C&I]4I]I] J]#J]5J]4 4(iD40iDD4tjDP4kDp44lD 5@lD,I5llD 5xlD5lDLJ]^J] *5z_W5\nDc5`nDo5dnD{5lnD5nD5nDP5nDP5;Y]J;Y]V;Y]Z]Z]6Z]b;OZ]jZ]Z]n;Z]z;KE;LE@;LE;|ME ;NE;Z] ;Z]2;Z]:[];[]<O[]<s[] C&|[][][][][]<htE%<tE82<TwEE<  S< b<\]p<\]44\]~<H\]<d\]`<\]8\]"<]]<&]]8<^]]8<]]8<]]8<^]8<>^]8=v^]8^]$=EH=E^] h= y= = =E$=^]=z_=PET=E@>/ >0 >0 &>0 6>E B>E O>̞E n>E > E> EH>hE0>E@>؟E >E0?E8?LE *?lE(A?EU?@Eg?E}?E?ȥED? E?E<?Eh?ET?E4 @ @ ,@ 9@  H@ U@ e@ r@  WTE @tE@EhpEdEt@@'F B>`'F >'F@3C'Ft>4(F BC@(FlOC(F_C)FpqC*Fab] CKFCHLFCě CP CT CX C\ CP CP CT DX D\ &D` 5DWFJDWF[DWFlDXFDXF D(XFDXFDXFDYFDYFD YFhE\[Fd[FdE[F`(\Ft%E\F\9E\F0NE(]F0cEX]F(xE]F<E]FDE^FEcFWeFEeFDEeFDl*,fF$EPfF`EfFFfF FfF@ gFdgFtFgF %FhF$?FhF<IF̛ bF wF F F WF0FdFtFF b] F F\F|FF WxFFFFF,Fd0FtGF8GFGF@4G, I8  @Gt YG hG sG WtFGFG FPG\FXGFpGF,PFdFtG(Fb]G  G H H HFt#H( 3HpGHHGYHGjHtG~HGTHG`HpGH0 GH4 GH8 GH GIG+IG,=IG'Gdl'GtdI'GxI)GI*GI\+GdI+GI+GI+GdI,,GI,-G J-G@J.G2J.GCJT/GLTJ/GgJ6G<~J6G0J7GTJh9GXJ9GdJ$:GJ:GJ;G`K`;Gl3KO$mG0SOTmG0hOmG(}OmGTO\{GO O O$ O{GxO}GOp8  Op  PGPG(PȀG:PGCPTGSPԂGYPG0iPЄGsPG Pd]0P0 P4 P` P` PċGHP GPpX PtX QxXL QX( QX )Q1 WG4QG FQG4RQHG\iQGxQGQ,GXFGQG\QGxQpGRhG*R4G8RGTER8 ^R< qR@ RD RL RT RX RY Je]_e]me] ze] R1 6>0G B>PG O>pG n>G RGSG SG<(S G?SG(WS H NT+Ht_TL@HlT`@HTd@HTh@H@@HT@HT@HT@HT@HU@HUg]Uz_AU@HWUlPH`gU0XHTUXHU0lHci] mi]}i] UlHTUH,UHlXHdHtU0HU(HU U UpZ V_( V` `( #Vi]B>(H )VHHt8VHhPH EV\H(TVHbV0H6k] B>H mV HV4HVHDVHVHVH`VHVH\VPr Vr V@2 WHHWH-W$HBW4HUWDHgWTHqWhH0~WHHWHWHWHWHWdH0Wr Wr Wr( Xs( Tk] ]k] ik] uk]XI@4QI XI4.X4I CXTIQX$IcXIk] k]k]k]C&k] k]qX8s vX@s k]X(IX(IHX(IX(IX(IX)ITYT)I Yt)I+Yh*IAY|*IWY*IjY*IHvY*IY*IY*IY*ILYD+IY`+IYt,I|,IdZ,IZ;I+Z>I?ZDs OZps@ [ZDl]Il]Zl] eZhl]8B>DI oZEIZEIZ EIZ(EIZ0EITZEI ZEI[EI[EIFEI,[EI88[ FID[ GIX[GILm[`GIhGIdGIt[@HI[HI<[II[II$[II0[II([ JIh\$_IPl] %\ 4\ C\_I_IR\_I\\aI0f\aIlo\XbI\bI|\TcIT\PgIp\cI4\cI\`dIP\dIH]dI$]DeIx]eIL/]fIT>]\fIO]iIxjIg]PmI]l]]x_] nI8]DnI(]lnI]Hm]]y_]tI"^\m] ^y_3^$uIF^uIhn^pm]W^y_^yI +dyID^I\^m]^܀Ip^LI^I$^I@^I< _m]<_4I$'_XI@>_I@M_ؖIc_ȗI|x_DI_(I<_dIL_I` _It_I _IX_I`I!`I\0`m]8`o] B`p]HL`dp] _`pp] s`|p] `p] `p]``p]` q]8`Dq]`\q](`I$`@I`0I`I`ضIl aq]aq] aDI$*ahI9aHIHaIPXa`Iiaq]<saq] adI$aIa IaI4a4Iaq]ar] a8I$a\I ahIpaI"$r]Hblr] bI$bI<)bcr]HFcDs] ScI$^cI4kcI wcIcIcTs]0cs] cs] cI$cIcIc Ics]`ct] dI$ d4Id I(dI7dt]?d(t] LdIWdIcdIqd8t] FIDOGd :~s hIdIt:~s :~t }dI4dIdI dlI8dI\dIxdxIdIHeTIT$eI>eIdMe`IL_eIqeI8eIeIeIIdXIte0IPeIhelIfIDfI.fITFfp0 Uft oft ft ft ft fu fu gu g  g ,0u %g(J(7gPJQgJsg JgJ`gtJg4JgJ g0J$hTJ3hJKhJah(JHuhpJ,hJ(h|J\hJDhJ h<"Ji$#Jdi4u u]hhu]08i#JMil$J0civ] liw]0vix]iy],Hv i$z]Pitz]iz](i8J`Bj49Ji:J8i8:J:Jd<;Jti;J,z]iz]j  &jy_Wj?J4cj?Jhojd@J ~j@J j@JjHBJj`BJPjVJjDJjdIJ(jXKJPjKJ$LJd k8MJ8kpMJ,ktUJTVJt>k|WJDKk( ckD ikLv$ |kpv ktv kxv k[JDk<\Jkt kx: k8{]k(bJ@lhbJ$lbJD"lbJ2lbJtHlfJWlplJPol ylЩ W\mJltmJhlmJ<lnJLldnJ`lnJloJmmDqJxNmqJ_mLsJomsJmuJmvJ`mvJmwJm@xJmxJn|yJzJdn||]+n|]:n|]|]] InĈJt[n8Jl lnJ~nHJnJDn\JnJDnJnHJ8nJףؐ]nؑ]0n o8 o o]1oP]>o]MoH][o(]ioP]ovo8]o]o]o]o]o]o]o]ao]p])p]%p-]24pЕ]Dp_]Sp]cp`]rpة0 pЫ( p 4|v pv a&v pJ(p Jp8J8ppJ9*xJ pJDpJt qPJ`qJP.qJ Dq JXWqdJ0kqJ,qJqJqJqTJqx]pq]qh]Pr]@r]@rJ9*J $rJ,2rJDrJ Pr8]wr\]`r y_ry_rJhr JrJHr@J0s] s]s]sdJ "sJ05sJFs]Ts]esx mspy wsy sy sKslK0sK,9*K sK ] sKs.K@s.Ks.Kt.Kx!t`/K04t/K@Wt/KxztH0Kt`0K<t0Ktt2KDt](tp6KXcu6Kps@7K 9*`7K  uP:K,ut;K9uT]"uy_Guy_s SKxut]@WhhKuhKlu uKWKuKu̔K@ KdpKtW\KWTKulKu0K8uhK uK|uKvKp]]v̼ vz 'v z 4vz =vz OvK,\vKjvKlK`]zv]v| WKvKLv Kv|( v0|  vP| vX|  vx|  v| w| w ] WK"wK;wK|Nw@]0Tw]Xcw]qw] wv]wb]wV] wD]w0]w]w]w޵]xµ]x]!x]1xp]@xH](Px&]"^x]ox]x] x] xܴ] xд] x]bx x x䙁 WpLxLiypL,yLyHL,AyL]*yy_Myy_W+Lyy/Lt y?LyLNLPuOL8y!M0y"My$M y*MDy+Mxy|+M z\,M%z@.M`?z3MPNz4M]z5MkzL6MHz8M8&]] ];]C&1] >] 4J]X]i] v]zMzMlzMzMz(M0zXM,zM$zM$z̪Mz|MzPM{DM4] ]] ] {M{M%{\M8 |M5{MD{M\{Mhn{8M|{M{M<{<]P] ]] {h]{]] {]{D {y_|y_1|MdF| M|0 Np\| N,|8]g|Ƚ q|d }|y_|y_|< |N<] |T4N]] |\8N@ }]("} DN0R}]-}H ;} y_^}PDN,l}(]{}deND}eN|}$fN(}LfN@}pN`} } }@3 }zN} ~\N,~ȅN~̇N\]&~H <~ [~  m~3 ~4 ~4 ~؍NX~0N~4Nt~N~0 : N~N,~@N~ N ~@NHN@ %5 .@N\>ԣN0~N<R@NtqNx,NN4Nt]$|NN$P$ D ]$x 5P OhP h y̦ .N\NNN`~NH]䩁 π5 8N,dN, NN0N(ND ORdNj\N0N|NXNpNɁNׁN| ] ] y_ O<)OLh.O] $Oo+Oy_.O1OtǂFOقHO`IO JOJOL4KOdKOt,dLOD; I ^ g   $ ( 7( ȃ0 Ѓ4 ރ= kOlO  !@ 5L L@8 W8wOvwOLxOPxOP˄xOp\yOdyOtՄPX 8 4z_8z_I2SPX(3Sn3SH3SdT4StDS9SX?S$ϮDSIS]C&]]    .$ >( M, [< n= x@ H P X ɯȁ گȁ ȁ( Ɂ Ɂ   Ɂ -Ɂ JɁ bɁ JɁ  w bS@cS`cSxdSXðeSҰPgSHgSxjSHlS`lS` -Ɂ b9Ɂ sS<8sSGtSH' uSLXuS4VuSjhyS~xS hzS\zSdɁ ˱ˁ ֱļ ż DS4xS@%S85 B MTp@TD@TӹDTXFTFT<QT)X]l]C&~] ] ]] ]]3  F Ú d́ ń ́ hՁp Ձ ց Gׁ ؁ ƺف κ ޺ y_tXTXgT$ lT0AnTpWoTopTtqT sT  ̻ف ػف ف ف ]€ -@€  pz_@xT<'|xTLxT49xT`L\yT$Z{Tq|T,XT\\T@TװT8T(Th|T˼TټTHЍT8TPTxTHȎT|T3]EdT0MTWT`LThl wTTTP TDPT(xTͽ@TֽԞTT4TġT ܨT@#T<5dTN|T]_  xL P T @ہ Dہ Hہ ž8܁ Ծ<܁ @܁ H܁ L܁ P܁( ,x܁ E߁ [tz_xz_TD̿TPDTT8T0hT/T6T@ķT̸Td0TtJTp U€0 `€0 lÀ  |@À  À pTDTx,TTT,UT@Td T|T8$T6DTHTLSxT\@TDn`T{T(,THTTDT ]H]- ]  p ` d V28?V?@?VLH?VXP?VfX?Vt`?Vh?Vp?V@V]L$z_(z_DVlDV EVx0EV>dFVPLFVPXHV,e0HVoHVh|(IVdIVHIV4JVLVpNVP]X]@_<] ŀ ŀ ƀ @ƀ "ƀ (ƀ 2ƀ HDy_lxUV<tUV8{UV4 VVvVVVV8TWV XVXVdYVv@ZVLZV`ZVXD[VD[V@"[V@1\V>\VP]Vd]VtJ|jV\ h y      `]t]]]V8t V8F VElV ]]  +VvVv VL4XVh@V4R0V^8Vh@VqVvVvĿVLzV@PVdVxVPV\$V8\V |V$V8V VV@VH XV\V$!V,dVH>V`G V@^LVXFVvVhpVPVVDV      ,VV8( V03V|?V,NV`V(sVtxV$VV0Vd4VtV0lVVPhVt VVW$    . :  D U a@ǀH kW|WW@0 W WH W h W WLDWT W  ,WhW,&]4]E( X0 hȀ w@Ȁ Ȁ GȀ 8 W8  8 @ 0  $  (1WT,  6W7W<+T9W`79W@:WDL:W,T ;W$h pȀ {BWX$CW4DW@tDWxEWJW,]]]]dWeWD#gW<rWM0  W8  q<  |@  H  ɀ ɀ pW`W]]  P  T  "X  3\  :`  Ad  IlW[WTcܚW0q W@LW`WpМW,WD@W\W(W 4WWxW,DW\CWXZW8p0W0`WW$t  x  TW<WXW@(WW4W\HWH)W;WRWXgpWv|         ɀ ʀ %WX.W6Wp`W$DWPW\W,oWT$WWlTWXWhWL W,XXXlXlXXx,XDD X`]]] ]]O  Y 0 c  n 0 y        @ʀ ʀ ˀ X,<XLXX8XX$DXD1X|<XD X$L#X<X,$XHat&X(j'X,r8,X`3XX4X4X85X8T6Xx6XPGX|uGX8HX8YX]]*t[X@5[XA[XO[XXY(\XXv\XLv\Xg\Xul]X<]X,^X<h^X_X<`Xt`XaXdX$dX eXTY>Yh?Y<?YXAYX h          ] ]@]?,]Lˀ (Py_Ky_|LYl*LY4LY0]Ty_UYUYWYWY       $XYZY<6>ZY B>ZY O>[Y n>4[Y 2T[Y4A[Y$R[Yl[Y[Y  \Yht]YT]Y@^Y,@$H^Y<^Y\_Y `Y( 4`Y$;X`Y:``YD'`YL`Y4O,aY(hTaYybYlpbYcYlldYpeYY pY $\xY ]      '  1  B  Lˀ [ˀ oˀ @$(Y<dY`Y`YYXY]  ]@^]d]@      3Y\FY<VDYf`Ylx̿YDYXDY]   (Y Y\tYY(] 1] Xy_AY8]]0{YdY  1] B>Y YLDY\Y`YỲ ̀ ̀ "Y5 YJ0YXLY flY yYY<YX4YLYYH`Y@Y@YdDYtYL(@Y;@] M ̀ [̀ ǹ LYT\YYD(YY8d]    |  % 7 FLZ@Z,RZ|`ZqZL|hZ|ZtZZZZd8ZtZZ@Z4ZLm]u]   & 2 ?( K S ` s@̀ ̀ ;̀ ̀ H8Z ]  B>H:Z h:Z|:Z;Z;Z;Z ;Z&(;Z90;ZO8;ZeH;ZyX;Zh;Z ;Z8Z(>Z(>ZT,@ZAZX$8BZd1CZGCZCZd\DZHpXEZ NZt}NZ`TZUZHUZ\TVZ(|VZ4WZp ZZTaZ\$0],2 ] ;]]] F]LT,z_waZ<  dZeZeZ,eZQItdOXpMn-[>LF@L$V,\h m(ByS$(BdG,d.IS0$O\VN$T8MnMn 1(X8BMnWDhjؑ[hpUX Ў[I,zNl, [(LXHVl ، J >R4 lV+- 3nYDF, Q\mWkSxDO!EC (:Ax Z@X(~@YlaI ,X+E,N(,8, ,Mn,L^R,A[h-<*  -Y-WT@:-+  D-LoT0U-Mnm-L]-vE-PGDB0R-yQ-@]-}@-]-eK-O8 .PQ\!_Wd). R ; ^R6.[YC.pWN.( W. m.BNx.Mn.P .8P<.8VO.4ST@.pP[.W,.T/<]-xxV/U4!/W2/DlC/[`R/)R(`/5C@p/[<~/y@(/[ /O/0NU/W8/`XL/Mn/B0TE40ܧJlB0hUVT0pZp^09N<m0B0 04K0dZt0f]0Mn0MD0VP1Mn$1VTY$W091[C1XO8Q1Qf1F[0w1Jl1LS41pS1dfJ|1ZD1lS1B1\J>VD>,T)>DS89>TO>B_>xIm>SLx>Mn>8 >e]>TD>SP >eT8>@A>F>[>ܑS`? KD?THH-?S ;?4ZG?'BR?/A]?N,m?u v?N8?Mnu(([,?ȼ ?4AJ|?l)[?PPP?H ?X]?A  @R@ @E02@U4:Q8=@0D E@zVlM@$uEDd@W0o@@I @f]@&J@ 0V@@@L@ @G$@&Q@@TiN@ąOJl)[@](x A< AlQD%AR3A\WdDAiS(RA&VPZA\{ToA(XAUTAtTUAD AOxA AS ALSXB\@ Bā8 %BtAl8B0_@W@@BWhHB _OXBQoB(FBȁ B(E|B0EBMnBXB(  B}V4BMnB BgYCpHHC\M!CtU8C!],BCrT0SCYMdC8QH}C@ Cd!Q,CWdCNTC[C[TC CMnE @R4 DeThD8{CDiW*DrP1D$WOP>DR4TD ^D4SfDS4qD]SD P D HLDMnD|dQ8DY,DxTR0D]E(T4E #EMnBESNElH$ ZE bE]zEف E,|T0ELN E~@EN E<)  E$@dEH  FMF|fT,FPE6F0YDF1CSF~Y<hFOlrF9PFTJdFDOFx F CXFpFl|A`F5ZLF̻SdFNFO  G+FGDƁ 0G\O4?GT \GWiGMnGLCHGEG]G|CGPZ[0GMnGTHH @H, Z"H,9A3HSL?HĆPKHZCVHt{S4cHYrHT H YHTXHH2W89RG, / HP<HMX4HHRPHDxQLHHV$HTHDTI]IxU@I@S IF*I0d[02IXD[,:U[(UUJDhUȬZdULSU APUKlUxSUoFU UK,U8|]< VdS %VT,V0UVHWSUWлN(WBITlJQ6WJTFW b[_WzT`jWMnWpS|WkKWh]Wt(BW WFW@F WEZUZ(S8ZjJ0Z Z [Mn"[S[@](2[ﾭM[@ ^[([k[,{QL{[0J,[d(B[nQ[`OH[`@\[COp[HzA[[Mn\]UN]Na],H`r]`V4]HS<]J]0]Mn]dqT0] ]`-S]S8 ^D ^@(^[,A^Mn`^Z<o^Mn^PB\HW^tA^@^xPT^ 9ZD^,0A^ _ @(_hBt0_y A_<'QW_P a_/Rm_ROP{_pK[T_Mn_b] _h _DW_8 _TSH_\#V|_pZ@`Mn&`Y%_SF`E(Y`5C,f`St]{`LY` `("Hl`SD`H, `P̀ `HS$`s `+Q\ aHU<a[4(a1A2aGa($V8QaX8V`aMnpaXyN$}aZ4a}Vla]t]a a,]a aODa=UdalObH bMn6bQHb JVb RpgbS[wbTUpVuRXb@bL b@[ha'dVbW8I L$bX[b;RHbO@tS\b0TcSX([c(V$,cF;cY Gc+  McMngc0S$NxKF@^p|[hK[TtJ[Pف @R\,V<[lʀQ,ՀN߀vTPV0kSP doW|L]/d@X5FPJ|FX8 ``@|q|\C|[MnčV$S`uA4с} ؁gI]G[0 h'Wx[-LYD;s F@PKXXULhqMnTgWDH,<N‚L ڂ]XP8MnTP ,SH:oS|ES[HSoI(}dXH3TlU]W\F[ у`{G@݃V _EX&WL^R+MnK,LH[tT@mxXzL#@`XT  @4OƄPTׄC( @TDS` @0 иS< JVT^,Ilp)[4|)  :C$"V\l@(@^RMnLQXdF( *,J9UDMnW([hتTTqB$Z4bQ8,t[\φ8MPzQpQtKH @L V bLW0nHB~rWXhAtMU([8At˓0n[HxVԍKMn#@4ؠ >xQJLBYMns]!Q,YH Tp @> ǔNL֔vK,yT4(pU N8 0IW$8E@8 GtVTOMndMn`GUK~T$֕MJ P 0pOW)d!MDHxQ35W> VMYLI(UPWx\Sj܂B8U(Q oMT8}H@؞  h#T̘XzV0|X @I( R(C#@ 3 ;$GI US,jFX{ T_L`J( S[ ΙEњSX\/`J,<X$DtRPAc` HlQl|([$uXR`[,][JMnٴ,Z4;HR ,D C\^R,e {  yI#B(IǵLX`ٵA[`QtW0@Xd4GLZϿX[THxW(hMX4HWK<(XcN20 <(jSPGMn\VTlW x$GLPCH`XHHHt @0A$l:QOl}B `@4D\DO= &Q0DOL0TAOpR]dˀ tL@ܔ[3W OYZĚ d8DL8@ L XT8Z4W,F@I\(T:@MLx@% WgxQ(N @T@Mn$S[,O ZS 4VPPE6]FMn^` oJd<@dW0V4[@ET!SSlC}OT#VP\YYhYLIaO^tYDrMnoRlKPDB   o[KSXDTU,]@2/UE\P`SA bl r  L0QDP DU( U`UYD8pX-F4Mn@SPJJ@Vx,MnJZv[^UgsI8{T9T] ( GXJTNā, T]XxPHqR%[n`]|QWSl`L ԔA8tQP(MVZ@A`E`!J =\7GV@NhV|H,XT8Z<Mndk@D _ E8E`;A|0Fl#T0p,F::A0G*o`sF\oV| CSh,AP9ZDMnMnD,LXRD 2@rP3  EO .8 >ZTI|JYN$h0E(WcK|t]<L] cGhwWXA.CJ|Mn:C$L< J` Xh[dYWl@DRP K8xZhYOMnb@P"PW , 0@>VGB_lTSzqT,xOmIdRtL  -<)[ h8XX@pW,`O|WH=Xx lQ[E4*ț[4E(B(́ R[JdWDr@ z ;QJ0UH  ,BPXO,t] SH@K;C ]$?X Mn w[0$t[52ZEȁ VMnl"5^sMnP 8` gNpGH]\(Al9DPIX{@(XT"ЋB`;rYLKW(Th,E$r6QPQȗWAJPPYQX CMPQXT00U,  4 [#Ot> (KDRMnwtPTA\@0KDx lV$9PYX8kT\B$\K &EE NEP4j-  sPMSLTWWl,ATY8NPX KU8XC<2̿JT<PUYYhuVho  {tRdXpZ,HS:B v](DZ. Pb ? JL @0Wph OHW, PZ H U%WxpYYx2]>wYLJ[0b߀ ph]{@? ZdScO{T XXW@Mnȗ[;DP TO&H/hWXT:E J Ab@Bxd]L`UKtPXl`UعOlBNZH TB44X$QhK! Wt,y ApD ;AH|CcDPx|W0SFL<[0ĤSdY X\}VT  :P F O[H*M9$dN@EMn_Ug IET@{MnEPp)[4@xE ](CDX,9S\wIT[\!]R0.T07K@xWLL8>JT]W\iKz|]pA0 !H @XMn(S`NXpK02 _S\,4](8 A WBxZ,WeoWxL^P E J}@iUMnZDPb@\nI3P #T$)  9I8HMn[<|@$kSX, d@X MnT$@<rIH ,L[Xt UX0{SX- S=|f]ZW[8wA@7K@ 3XLhXT8VTs 8 LJW@U]j x)  4V@G J ^CfKt`@T}WT` E,,WlV8V4KN,Mn"ЂQD:Z  Kh'(9NtFNSZL`Y<nzZlx@TC@W\)  XC$KNEHpQB|0^[@ ;P3R= GTLS XRhS (QPLd Udm P[JT{ B ̉T 0Ch  Y R H^R" S aS C &  ]< [Y +  c kElu tO( ] L}C R  t%D@ Mn  XX gH Mn( LC ; D1 QT@I ,P ] ( k p!D@{ lI ހ Mn G BD  S ಁ 7R N/ LMI= T,SYF =Xx^ 6CTj DEv  LB ܼ (X X C$ {S  NV 0D L8GxX'BdMn{  T%HrSHj4^1WMD `VP̟ T@hMnAdT@,R\<ȄE4WU jH _[([yR  n@@ fY8;D  , TO](|TQD \S}@ DI\!&V'Z5` W<}YAR JnIWؼp bEotI,J"Xd/ЁT/H^R"/Mn/8`Z0l|T0x[30ZR0]h0(zT\v0[0@LDT0PYX40N0(N00 0G0*K$0 1 1PS0+1>1 :OJ1Td1|R@r1H@1Xd1 1NP1 1WO1X1H^R"1HgY2ԠYT 2BO,2]R002G2ETW2"L`2z@4{2@2B2]2 Z@2] 2؛ 2p5A2 X 3A"3TO73M(A3@@N3L^RV3zPc3XTm38!Eh3BX3 S0 3Q3X3[X3B03kN\32E`4A #4 FȀ@44>P,?4V`N4T b49Z4|4LD4D [4W4Q@48pqBW8\8E$j88Zy8\R88M88*[L 8 X08F W] )[(80GPD8]8`W88(U,9D~Wx9[(%9A$99,sRA9dDPY9$ l9 {9Th9!V9`L,90!]<9UP9JX9  9PV9 Ɓ 9Mn:Mn:W(:H^R"@:$ Q:Qj:Yx:Mn: :C:tt]::WR:TW,:`gTP:Mn;F!;GpŅ, 6; AC;HQW;l{N(c;ZT$q;\W,;Wd;K ;YS>H0)>B>ZXL>_>Sl>]>Mn>\|T>T[M>\߀ >|(  >(:Z>@ ?l ?fC?P)?|z_@?ܹZ}B_?C(q?D? EX8fR )E,U3ETVKBED[SOE\f@(WEUaEG@pEH^R"ETW,E`@E 7@EYE OE`KRPEG E7OE0 EY\ FS FT\E(*FX7F],>FSLKFMn_Fd]tF FtB<FWPF܆PFd( F\XZF=OF, FMnFgD8G:DtGZX&G*Q89GMnNGI[G &WDUoG[(nI`G ~AGL[GGQV<G G`]QdGU GQ|HlHHU$HND1Ht](AH \HtA<hHF[H$T8HR\H]jHVhHT HNpHUxH$OH\BpIgHIX\!IJ 9IHBIIMniIąB$~IdSPI̯S4ITVIL$IZLIMnI@ I|SPIQ0CO|WHMO0]_ 8 _OMnOHPPO(]OXd@XTMn'T| 5TMnTTG0fTP̀ rT TQTBUTt[T#ZTMnT$F$R4TS T]TMnU 'UMnQ<Y_ g_@@~_Ğ _Sp_P#([_p4A_Al_G]_L[\_\+  `8A`- 3`ˀ =`L^R"J`ԟ W`yQb` W o`xE`lJ(`*E`*[4`D [L`p[L` \O`I aXGaSh(a$T@7a%FDa4E8NaR,]aTA4iaغRdsahrZ}a'Qpa\NHw=HaLXaKUaгB4a}AaMnblE*b0U\SW4bTLbh ZbPlkbAb,Odbt T|b$B@bdA8bASlb4NbMncQ4cF!cPP)c,FH5cQGc9KVcC,cS[TcZcO dxTdЖY;dZMdZHXdXVedLdx@dMndlXNhdԌ d\wT[(dxU|d8VIdx@( e82Tde /e,[LeTm@ SeH5@0eeT ne| weD9OdeFP\eL^R"efCP$Mf hfMn$%Vf]f\Zf /V(fB f Zf J@fHVXgJDgW +gH^R"@gx6@<Sg|U dgHdJDrglTgм ghF@LgMngMngDI(gMngE@ hd h S$)htY6hqQPHhbS[h"Q8ehRDthVp}h  hH@h(XLhMnhN h8%Rh hp hv iPPLi` B4iD=[$EiN`NiMnriBDiE ip iSiS(i iMni]R0j@X":T8 j|m[ jMnEjejI8|j,] jT@NDj]jSjOVj*RDjIWLjT kVT !kMn2kpM Ak@ \kخXik Tsk̗A k,\S8k\cJLk8Ɓ kH@k8~Qk|9XkMnlX lT8l(Rˁ !l8O,l =lZJl QLSl@dl\ rl|R`lS lVxlN lTOlPR l\S@lSlA@l貁 lRP(mdsWm`R\.m\dQ Bm@"SmN<amErmd/V|m`3Qm$aFmL^Rmd]mLMmMnmHoWmW4nIn?V#nMn L,,Qd,NTr"@xJ[`W ÂVTЂ J[8YUCBO4H LV4 jT0X@HSOT`gC sCO<G@ Ń`@҃P L0H0\SQ[(|]00EH>&TDSDVe\Sr,Ox [(„PIX܄EO Xh\D s /Kh:\WSSMnkz_@D d#BTMnȅMn{XH Z4uIP(@,.MnCW TFN\^8`Lg[xHvV4R,]R0s [ֆMnT}[4MnDV$#WO 4TTTMd[` k`PwMnXxTDXB Ƈ0N`Ӈ|qYMnP d9Z4 #I5vQ(JMnb opC,zMn$F[(X UpΈeUەV؈SpB`@^R"|-  U@D(B-м +XaN5\T4BRMlVPU@S4cU  pND][,P0o+WESӉY8z@(/Wl԰Z!T-dFpCV\V< ]tQ2H0ZTzf@@m| yWz OF0|9QP|#T I̞ ΊN|يKx@^R" A,x:P!hJ- 4JXEwWXSh f\ Jh{L`O$ NXd@`CTh@@O֋, MnyQH^R"2;[LTS_IXmBNTvMn | 8ITX=AX|OȞ\DG4[W$W, 'SU@4<"@4DPL$EDa,AmC ulKHrKPULԛ 8qQhʍ S$ԍ,  F4d'Q$BLRp$fT,1] ;C EdPU @4`Em0W v?HtMndWI]َAHdQ@xzGl]LԿRh$ހ 5[,EXP(SASeC }  @D ](|SDŏTlՏZ Ol@ ܵB( R*TS04SFuI] Rhi xlZLlR4OrQV$@T0J4אIXNpMn+nW,` +w ;YNK_MpoEdy(YPIJ[\[N8KɑMng@XBI  C MnCrB`Nx_g[<DȖY]0E<wYX#B((}Y@\Wlˢ$#V8Ӣ[,\AL$@L Q)['4 6 VA߀ I@^GMPo0T |L1Ax@܍[YR C0ȣRLP]bl@dգ KP<VZ<ijQ)[X[0XSp, :I`Js ^ Yv$SPF@QR|GtlTOŤADݤUUZ X\T[`CpVS&{S5pT$DJX,RF|܀@PFt`Mn}, TYTSlǥ RhڥtS8D܁ @IHP0RL'I;IOZTW$(Bb`Yrh JVB8APlSæлVҦMnHUDpM dR!\Ql0Dt]EMnZSo@SL}@TM|DE4d, xYħH@PӧTXxܧ]0ZS8 tB@28USW$T`_ZpATh xQtMDeJd](KPDШR$ިKUTDUX\ $LVH ,O<@LSFC@^ EtvD  NTdYLA8}R[ڷMn@XhR@l *,O`B =d$VK^FDT[x;D,T@\]Mn?C`ϸTTڸJ4V8$ LY,Y`!8Y<!Bt/nBTAP[QOh^UfsT,tLf]~NN ShMyKVVlCGd}MnL`WpRX8$D$(([,S2 'Qp4MCṕ Lkp]$v@ $TX8UVS@QJW0sjT tBXS4StS2VX@* 3EF\,  PhuExlxKxW\W (  x~R(@LVl4SB oKV@HO$ P!Mn;X\UKJ^t]s0S,cWyNXd]HQ<\S@ExUO8Z0Nt]YhuLTfT(4O %Mn@RN̾A|dDWp$ X||MnUR (^RMnT  VQ)TY`4OdF rYD%ZH+haP:Y<NJ,`lNoMnE2tp)[4,  , 8CTHRl"Z gW@BEMn̜C%l|S;e]GVOADa@Dp АSzT ]( K[P]S@MnhuV̻T|@4A<NT-aE A@`RT ` tMn$O dT )[(LDtMt aP@ dZ\5Z<(J#=Q /8GEL@XD6QbLNxHWXPR,(  xLRMnT, ?D, QS  . 6nKF A@][dv[,B BSp vBIXGB |Q$f@0MnF#BaQkK}DvYlI$@Rpd L<؈TMn  @ 6`FFMnZL d0Gu0UlUX,XCHN$Xdz]<OOhlƁ T@kN%Mn?J8K]aUHjCT @؇GD@H|Q|BԦZ\|J$C 6|hF0FX4RDU<a`|@0|V <[0X]R0@^R"4]dbGԼ V,J]%SH6 L"A$Y|@$ixZWPq( 0[X,KX [l0 5S:N$nOx hAO-PXx8zTJa@\RC{WdH[h]$]PTK[A@ Mn$SK\XO&dJ2ȂTAWJ[oA}PTXR>S<H_] dOU>Dxǁ Mn(EX]0NLL=\M|OlvI\ `w[eSy`Y TTX({SLXT0A$H^R"l)[P N[,̩E( ԨA82lE8GxQ]]wxES&EOtPPOT[@08 @"T]1{`R`/ADܠ Q$S]ȁ iXJHvU8Hc]c]MnP8x$ ԄY  Z VX&4fWx8fT0GLxTElX^M~O@H}݀ \$DML8LpH^R"dCRpt[ MnZ#TT1Y4K<[0`'DTMnJRPX{@($JeDZ!S 2hJETZpAH`jly_1|@_ @F pU ȥ@x^L J0SMnWL":X7L^RAuEdEATSV$ VT@]@D mp)[4h(ZpRPC0 RXLpI(B@3HEpNWXUWY d] x` [LVL虁L ,LY$tXC]p  _N409G8Mn$HWH2J[J=[xaMn|FNH|.El(YTEL  S8!BN\NVXSH"lS.,R`7MnVtJg^R,WԼ SS( ؼ TlE\,O8| G<"`{B.$N>8N,XBd uYv