'Vh10vlNetBSD/earmv6hf ramdisk 081h<  1hP¼at t1h@@<@T 081h<  1hP¼at t1h@@<@TU 1ht`A1h1h1h$h 1h1h1hA1h1h1hfA.1h1h1hHPXA1h1h1hgA1h1h1h_A1h1h1hgA1h1h1hA1h1h1hA1h1h1hmD!1h1h1h (08@HPX`hpx$w1h1h1h (08@HPX`N$01h1h1hhpxK$/1h1h1hM$J1h1h1h (08@FA1h1h1hC1h1h1hA1h1h1hA1h1h1h!1h1h1h a1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1h a1h1h1h a1h1h1h a1h1h1h a1h1h1h a1h1h1ha1h1h1ha1h1h1ha1h1h1h a1h1h1h a1h1h1h a1h1h1h a1h1h1h a1h1h1ha1h1h1h a1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1h!1h1h1h4!1h1h1h!1h1h1h!1h1h1h !1h1h1h !1h1h1h !1h1h1h !1h1h1h !1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h B!1h1h1h B!1h1h1h!1h1h1h"!1h1h1h"!1h1h1h"a1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1h a1h1h1h a1h1h1h a1h1h1h a1h1h1h a1h1h1ha1h1h1ha1h1h1ha1h1h1h a1h1h1h a1h1h1h a1h1h1h a1h1h1h a1h1h1ha1h1h1h a1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h !1h1h1h !1h1h1h !1h1h1h !1h1h1h !1h1h1h!1h1h1h!1h1h1h!1h1h1h !1h1h1h !1h1h1h !1h1h1h !1h1h1h !1h1h1h!1h1h1h !1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h !1h1h1h !1h1h1h !1h1h1h !1h1h1h !1h1h1h!1h1h1h!1h1h1h!1h1h1h !1h1h1h !1h1h1h !1h1h1h !1h1h1h !1h1h1h!1h1h1h !1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h !1h1h1h!1h1h1h !1h1h1h!1h1h1h!1h1h1h!1h1h1h?\!1h1h1h>\!1h1h1h=\!1h1h1h<\!1h1h1h;\!1h1h1h:\!1h1h1h9\!1h1h1h8\!1h1h1h?\!1h1h1h>\!1h1h1h=\!1h1h1h<\!1h1h1h;\!1h1h1h:\!1h1h1h9\!1h1h1h8\!1h1h1h:\!1h1h1h7\!1h1h1h6\!1h1h1h5\!1h1h1h4\!1h1h1h3\!1h1h1h2\!1h1h1h1\!1h1h1h0\!1h1h1h7\!1h1h1h6\!1h1h1h5\!1h1h1h4\!1h1h1h3\!1h1h1h2\!1h1h1h1\!1h1h1h0\!1h1h1h2\!1h1h1h/\!1h1h1h.\!1h1h1h-\!1h1h1h,\!1h1h1h+\!1h1h1h*\!1h1h1h)\!1h1h1h(\!1h1h1h/\!1h1h1h.\!1h1h1h-\!1h1h1h,\!1h1h1h+\!1h1h1h*\!1h1h1h)\!1h1h1h(\!1h1h1h*\!1h1h1h'\!1h1h1h&\!1h1h1h%\!1h1h1h$\!1h1h1h#\!1h1h1h"\!1h1h1h!\!1h1h1h \!1h1h1h'\!1h1h1h&\!1h1h1h%\!1h1h1h$\!1h1h1h#\!1h1h1h"\!1h1h1h!\!1h1h1h \!1h1h1h"\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h \!1h1h1h \!1h1h1h \!1h1h1h \!1h1h1h \!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h \!1h1h1h \!1h1h1h \!1h1h1h \!1h1h1h \!1h1h1h\!1h1h1h \!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h\!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h !1h1h1h !1h1h1h !1h1h1h !1h1h1h !1h1h1h!1h1h1h!1h1h1h!1h1h1h !1h1h1h !1h1h1h !1h1h1h !1h1h1h !1h1h1h!1h1h1h !1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h !1h1h1h!1h1h1h !1h1h1h!1h1h1h!1h1h1h$!1h1h1h4!1h1h1h!1h1h1h!1h1h1h !1h1h1h !1h1h1h !1h1h1h !1h1h1h !1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1h!1h1h1ha1h1h1ha1h1h1h!1h1h1h!1h1h1h!1h1h1ha1h1h1h a1h1h1ha1h1h1h a1h1h1ha1h1h1ha1h1h1ha1h1h1h?\a1h1h1h>\a1h1h1h=\a1h1h1h<\a1h1h1h;\a1h1h1h:\a1h1h1h9\a1h1h1h8\a1h1h1h?\a1h1h1h>\a1h1h1h=\a1h1h1h<\a1h1h1h;\a1h1h1h:\a1h1h1h9\a1h1h1h8\a1h1h1h:\a1h1h1h7\a1h1h1h6\a1h1h1h5\a1h1h1h4\a1h1h1h3\a1h1h1h2\a1h1h1h1\a1h1h1h0\a1h1h1h7\a1h1h1h6\a1h1h1h5\a1h1h1h4\a1h1h1h3\a1h1h1h2\a1h1h1h1\a1h1h1h0\a1h1h1h2\a1h1h1h/\a1h1h1h.\a1h1h1h-\a1h1h1h,\a1h1h1h+\a1h1h1h*\a1h1h1h)\a1h1h1h(\a1h1h1h/\a1h1h1h.\a1h1h1h-\a1h1h1h,\a1h1h1h+\a1h1h1h*\a1h1h1h)\a1h1h1h(\a1h1h1h*\a1h1h1h'\a1h1h1h&\a1h1h1h%\a1h1h1h$\a1h1h1h#\a1h1h1h"\a1h1h1h!\a1h1h1h \a1h1h1h'\a1h1h1h&\a1h1h1h%\a1h1h1h$\a1h1h1h#\a1h1h1h"\a1h1h1h!\a1h1h1h \a1h1h1h"\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h \a1h1h1h \a1h1h1h \a1h1h1h \a1h1h1h \a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h \a1h1h1h \a1h1h1h \a1h1h1h \a1h1h1h \a1h1h1h\a1h1h1h \a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\a1h1h1h\ !1h1h1hi!1h1h1h!1h1h1h!1h1h1h a1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1h a1h1h1h a1h1h1h a1h1h1h a1h1h1h a1h1h1ha1h1h1ha1h1h1ha1h1h1h a1h1h1h a1h1h1h a1h1h1h a1h1h1h a1h1h1ha1h1h1h a1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1h!1h1h1h!1h1h1ha1h1h1ha1h1h1h!1h1h1h!1h1h1h!1h1h1h B!1h1h1h B!1h1h1h!1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1ha1h1h1h!1h1h1h!1h1h1ha1h1h1h a1h1h1ha1h1h1h a1h1h1ha1h1h1ha1h1h1h1h1h1hbpf!1h1h1h $1h1h1h`$1h1h1hF$>1h1h1hc$1h1h1hh$s1h1h1hj$1h1h1hpA1h1h1hrm 1h1h1hxo$1h1h1hs $1h1h1hA1h1h1hA1h1h1hA1h1h1hA1h1h1hA1h1h1hA1h1h1hA1h1h1hA1h1h1hA1h1h1hA1h1h1hvv s@\kkt+ 8o7/oC!B7T7bh B#"Ȍ=h؇=F0uobs[~ruw#[$C}2]Jo~__dY|ϞXGsיY엟D9glIrN3Xc>un!?F N F[D(^Y'F9=M$"F fA) + _XOy(ۧ7•z!?l|)pk]PC0 O<&-A/B/Jq (>uց+_ZL3m4<>k1镽Dsu`t~ Q*jSV%R"@ 9TBXz%]Oa*4uf`3zdN$V%qv٫ؖQ~L¡{2d>v "d*sit . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(40!4 ( !1%1%LL!1%1%NetBSDJwGPaX NetBSDearmv6hf4p@-D0D 0@`Qp(@P`F`F&a03/T@p0O$0$A-`0`` 0PpU(pGpG@Pq`P03/T@0US 8N$\@-lPQMK \!\1 P`0 0R0819  0S  /S 0S@10S8 0p ZpG2 pG0@3'q1*03/T@Y ZpV0pWH2H0@3(1*03/T@ >d 0 P0 0\N$d0/$D.$h$@-l llPd@P L@/\`POU $6P @&111% nP@-@O-`00R@,2tMt@0pWo  ~]P@tt@(: R @P Pp0: S U`0SЍ@P0`0x; 0xS0S  &P0S S0p WP ' 0S;00 0 pP 0s s0T TDP   TPpW`%&>X d2{2&9H0`  BR` pRp RX Xp/`%%@-a0 2% 000/&pC-؀-`P p0M@ { A ( A{{z`P$0  ЍpY@&R%5%@-@ M00@  fP Y Ѝ5A-` l1V0zP 0 L@P@TV FPC 9 W@@7%>a0S@ )@0;0P W 0Xp&aV pa0-S Xd H p 4@0SV  W R%55&5O-5MpY xp `P` Ѝ  p` 0`$5XP0S 5%0 0 5X0S40S* D$尠D00CS0 @ Pp  @YT e`0 @00CS0X0 X0 pE00p &p@300 n/80: Sxd h+p@ p Qt  X0 0, 03($0000x 00 Q00S> 0 0 `Fp2  p 0Z 1(#00 H  0P \\P 4 `+X"J 0R 0p0ZZ3r0S P Y' sp00 R0S ``0S  0 >(dw P <`V k`0 ?oR20S 0  0 0R0P `hP hh`0S H,` P0Rt00!P &R% &&&&&%6`%&& &61&$&(&0@-MM@P  p  ;0U$C d]P TTYۍЍ08 *P ,(0P X=6R%J6U6 &Q@-@ T:P DD6,P $ 0P@R%J6a6 &Q@-@ XP HH0"yP $ 0P@R%J6l6 &@-^0 4 v6%0$/'0$/H'@-6@-7@-)7@-?7Z@-1   0z 0 ЍT7'@-1   0k 0 Ѝd7H'@-1   0\ 0 Ѝp7'@-0   0M 0 Ѝ|78'@-0   0>00 Ѝ]H''<00/@-0   0(0 Ѝ'7H'<00/@-0   00 Ѝ'7'@-1  ,0  0_e Ѝ7@' 0@- 00 $0P@JPЍ7V%,0A-`M!A!qX0 p! R0B=0B  PR0H 8 R8B 4!010,!0ЍPP =M0P   0S  0 pPN0P      0 3/R ! 7000<040LD0H'''#=W8q8X|H'77 8 '880p@-|@PtP00 R 0p800 p0  B0Sqs L''H'0 0 0 /'H'@- ~ @-@- u @-@-80M@0(@3/P $ jH08 : S( 0h 3/P   00 0Ѝ00 0 1/qp^]0S 00 m8@@-@APЍ@^ PЍp@-(`Vp80@  03/PP$8003/(Pp8@-@P`P 80 (0(3/@] P ]PЍp8'O-3 PMP`(P,`B  0S9P06 0J S +X0\ 0 X0\ ! R(P0,`R!*0 AB 000+ xpt| 4A  ЍOI0 P % pHp 81/qp4  ?P p 4 \0S4 tp0 0 0 0 "@0 0 0p0 t 0 p0t 0 %0 0 VU0 "SR x0| 0 x0| ~p0t 0 p0t wx0| 0 [Xx0| n 00 0S04L0}004 8pX  FЍ8'8H'9 *9N9R/ R 0 0 /\\CC  B0R0012/P/  AA  AA  A A  A A  AA  AA  AA P AAC-lBM0 0  Ps0 0  0k  $0 !(0Ÿ}?LB?@PN3c` D0S%H0}??@3c`_`RP0!!!! d 4 !`P4rU4 8" BXX P!d44_U4 %" B   !d44LU4 # B  d449U4 /0U8p<@0! ?` d @44U4 Ѝ']Mb'9G:!:4:K:U@-@RJuC- A `00P4 2#&P8P (01/qp$ '㬀pU Ѝ0S0C080 $0(3/P 0 `V`PE@0  Y $  ' 'V%:@-PAM P04!2#!8 P0(5/qp$ P9 0080 0( 3/PЍ80 $0(3/PP`#U0:0p080l0( p 3/p #U0* ,0P/`RP `H' m@-@L M 0Q   0  t ЍP'!%O-M0@S M. 8S+ #='0|0S( 000| " ! t!x0h0# #|0 H& <%ݍ Ѝ'|,E 0 Y0 S 0E0VS06  S  S $0S0 600000S60 060 00 6R|S R0r0C0C00Q0 0S- ,B<  6#0P`p U$  ( ( ,0S 0`"000(0040 0S $Z# 5%W(0S%0 %00   0 d5dO,0S T5T%0 0LEDqY05%,X; ? X07* UT 0 6SP KT0 -Sp BT0  #S004 0 0000 0@"<@ 0@ p|<& TXW% p ? X :$0吣(0s' 0吓(00S0 ,0S#$PU 0 !40S \ /\ * S0  R 0D S 0#6# q |0r$0[P,01  !{0$ ( !s0   !l004 0t 0000@0 <"X1,0S 0`QP T0( XUp, ?U0(*S 0  mRS0 dRyS0  ZR00,000 0, lCcS됹U㐚) ?U :WS$0U㐣(0吃( ?U :IS 03!  0 @<  0p ;P': ::&;^;;V%;;::;;d'<<> A<{<e<@<K<z<d<j<<<B6 <}"<<: <<@-pPP`@@R  SP Ѝ`3MU@=p@-XP8@T`@D p eSP<opQ<PpP'A-AP 0P$ 0 0 SQ ( $0#P !Xh dF`P, R2DaDqU`0``000PX )00CS000 P   0,`0CS0000 (00x/U R W`8 4D 0$00 0$ 'p%>'Il' ?T0 S 0SP/P/S/@- ' p@-XAXT0040S+@! PPP P`04 0PV R@40P 0PU4 ^*00" `0PEP P0P4  P U 4 P0CSR40PP 0 p''V%(''p@-.?0 p@-0 ?0P]JP@@sP0P  00S/S`m8Ppr&p@ \P(UD8叾<p '0'E?W?K?''d?~? ?p@-@(P P8P V  0TTPup`U(` a88` 0"p'%?@-8@P(P a8P I8080W' @-<<"yP $000<0 P'`%'@@-<`%O-p`㴢B崲0S@ >pPG0`F [stlV000PXMT4 0r,B00C0Cf 00CS010:uPU 0P1` 00CS0s 0 P U Rt0V00PT  -00C0S"10 T00CS000 U0P 0@ Sk | V 0 00 0 @00S 0S YI'''p%Il'0'?O-$RM` 0000100010S u@0Աq`0#0P 00)<0J?oT20ST SRP {0S  RZ  @T  Z     0010S@@  0 1P000CS000 Ѝ S 0P  BR l  @0S Z0 0$'0'('',''% @'@A-0P!S` P@S 06FLpP0!S P R 0HHH <00S ,$0@舮%1@H@'`@,'A-P@dp`T0S PRP$  z'p%e@O-`@ ؀P0S p0 T T R R u0p[P Ѝ PP P   P Pp@'('0''A-p0`!SP]P@eR 0Y @ PP0!S iP FR 0HHjHA <00S ,^UpGPP%w@@'`@O-@P b 00CS0n p0@g R 9 0`001 pTpP@0 pW2tQtTP0PP00qPQt8 , 00CS010 5 t0P0CS000x0 S0 0 @ X 000 0 T0 `0U0$0T p 0 `%''@%@''pIl'0' 'O-PpP0 SPEUP ЍE P 0C0 X2 Ub000PjQ _ 00C0S 20  0 0CS0L200 CP Z0 P CPE P 000S S ) `V% V000壽P Qx t?p 00C00 0CS0@100 0OX 0PFGP0 0Z CPF V'P尀VP0PP00aP Pdt pl 00C0m0 P0CS0<00jl00`6'''p%Il''?G-P@`p  P`T  0PSxP 0@^S00\P0S @\Z \i@P X0 @P*0P00@V%@%@@-T @000 <pP 0S( 0C00S 0C0 Ѝ'ht@V%L0 R QQP0R/@- 2 ' G-P`P@ X 0S@ @0S @T@@DT rpP 0S 0 0 TPЍ'@G-@P tp0SL`IPUP 0 @,P @P 'X0000@-@ 40aA R    0/&@'40000 01h@- &'@G-dRdr@`0 0S0 "3( 80?Y+Y# Y{00 R  % O 囸1@s{O0"Ss @`` IQV ^Y0^Y-Yj @ 0@^Y-Y00@R(QO0 0f1@s@FO0"SR 0.Y@0 @R /Io@P0 R00R  h@PR 00;Y0 00 V@ T0S'&F '@ 0@-@00 00UP0 000 ,R;R 0S  S   0;SPp' p@-P@0QS@@R0p`V P0C'p@-Pҹ@P NI, ($ p 00p%IlQ 0Q\S@-A /`@-0S*  0@000S! P"BpP :HPP ┹@P 0 S</R/    D 0  'PA_( Q 0@30/@-'00@- R 0C30'A-ppQ1SPS a00S S P4!`0`00`0S0P S@P0.S0 S 0@00`P 00CS0#0 m W  bT0100CS00 2pP'`%G-AP pRpGWR0`0`052` 001S 0100CS0H89  P00CS0' 0S   P 0Sp`0 0`0R00 00C0p00  %`p'G-p0A0 SRXPBp0GB`pPPU,000P 00CS0'0  W  pP 0圑0CS00`PU*P`'G-A 0`0P0] P 00CS0-0 p& 0FSdp a1S  0PEP0Cp00100CS0'O-HB`0pS74P UB!0SR0XPPP00IPE 0Q0CS00LN!1  PP\00`F`0uP0   P*  0!0CS0P(P*VP; 0堑0 S- S   P{L p00CS00  0堑0CS00  XK0PzP']p%IlA-ApaV&ʐ0l00PP8Lû ]-00CS00  0a0CSQ0 QF Ee0S 0`0F0 0\S0pS0 p'p%Il0G-D0!10]PpЍ0S0  $SPPPP^PKaX TP00CS00 # b0Q0CS00! P1ȃԓ 0 S)"Rʠc0U```00!P 0b0CS00 J 1Q !@o!S/ %S !`V U 00 0P 0帡0CS000!000\Q00`PR# !RU``0``00÷Pd 0a0CS00km0` 1 1S 0S21a0S S`l   喷P7 0a0CS00>@10`! S:`Fp00  1S pDa0S `10 BRpE` S`l   VP 0a0CS00   'Ap%Il?/A'( Q 0@30/@-K'`01S @-0@!S @EP /:P /'A7@-A0 R!RUUʐ0\00P@vJ |xk00CS00+ 0 @ R,W R P Ѝ00!S KP a0 Sڰ 0R0CS0000 0 Q  vP   '&p%IlCATA?A-O 0 P0,p W !GpY\ϟYP PP0  nQ pQ lQ 0 S , PP1S P PPP0 nR pR lR 00 S1S P P0PP_PP0 nR pR lR 00 S1S jP!S00P0PP1S 2S 0Sڜ 000@ `PP 0 nR* pR# lR$ 00 S5Pn PPPೃ0S!S , #40S 1Sm cP0PPPeI 010,0,0]0S000@ PQ 0!SP@ =P00 nR pR lR 00 S-0S  3 N`3PP1S PP%G@o%G`GooPbVWP 101?PP00 nR pR lR 00 S PP RPL nQ pQ lQ 0 S*0S  P0 PP RP, nQ pQ lQ 0 S20cS2 P0 PP RP P0  nQ pQ lQ 0 S1S @PP"PP0 nR pR lR 00 S{1SkP pP0PP PP` 0 nR pR lR 00 SX_aP0PP PV0nQ pQ lQ 00 S 9PPD B 0  P6p PP10S `Vp0VmVpppVpW 0 nR pR lR 00 S1SP0PP P0nQ pQ lQ 00 S   0  l P0nQ pQ lQ 00 S   0   RP nQ pQ lQ 0 S2S060S$602P0 PP R l Br R0" 0 S1S 2SqW P0000@ 0S0 0`PP 0 nR- pR& lR' 00 Sc1SS1S0!S  20S1S d  PXX 0S0T 1RP0PPP` gRF  R 0 B RG `<&@p>G0"S:b-pR0 rR0 U0 SP0 R"R  " R0U0b0  `P00CS00 /P00PP2P02 aP P [ 0b200CS00U. !2R00 2#20# 02 0nS- pS" lS& HPP0 nR' pR lR! 00 S1S" P20 2 2020P0PPP pPPP0SR `V0V pʈ0 nR pR lR 00 S]1SMcP0PP RPӰ nQ pQ lQ 0 S?:P0 PP&'f fA}AA/AV%V%AA'p% AA-?B''PB'@V%|.BQP000P0P@v ^`P 00 00 P 0 nR+ pR$ lR% 00 S1S0!S 00S1S{ aWW  EP0S0P0PP1S 2SqXP R# l Br R0"0 S0?PP0010CSE P單b@p uE0"S0mPP00 nR pR lR 00 S~x2 00S <PPPP0  nQ pQ lQ 0 S`0S iPP0S5PP]0 nR pR lR 00 SAP f\2SFP0PP P5 "-@- 00 ЍЍ/''-0^S0]S0]S S]S[S .0Ls0S>30  Q  ]Q RG-鐁`P@0 SS&tPD(!RGdadqU`0``0,04P,D7( $ 00CS010 [S \S @@P`0 S @ "0(a0CS,0p00,a rC L0 0@S G 0&'''p%Il',B0'p@-!0 P= P@01SE0p0 SS t`P@0P 00SP0P00 P0 h0T h0儱0Q.P0D夳0 ,>('?'B'''p%IlO-bB0  %R R 0R0H 00CS00r00 Q0&Qn0C0 RʴaqU`0``00GP? 0A0CS0l10G 0P \QH 0 SP 010S uP/ 000S S)00 S [ U 000P C  t00CS0L00 0`00Pp8 P'P'B''''`%p%Il0A-P0 0p@ W 0 `@P 0 R00R00 1BQ5C@ @PJ@p*C0"S,"@gR000'P'@O-@SMpcȳ00 0GS TcsT`0``00倯PB僲` \X00C0+0&SK BR D R: Y J@p RTPBV 00C0S @Ѝh20  R  BR   0 \SH 1B\C00 BR?ˆr L\ DQ-WppB@ \ p P qBD @<f00C0 AQ 0 T0 Tpppp  ɮPu p BR   @W0 `0CS0(00oq 0 bP'''p%IlO-M 0@P0P0s 840S 0 0 000 (0MpP ߍ0P0`#2C 00 S pSN(0Y01 Y  $ \P$A^P LH  B R+030 # ^  BR 200S 0 0k @ 0 0(PP.00Y0 Y H $ P$  BR 200S 0 5 p@ P0 (0 P'0 p1pG Y;ttZ ԭP<1JAհ, (o$?00C0SuX   R    P> 00CS000^`W 004 00S xxL00S 0   @8 0 X  0'P''p%Il'B]O-pᬡA0M0CQ` 01 00C S00`NlЍ0  0P5 P!` 00000`P00CS000  M[  0S00CS0x00` P  P ',''$'@P''O-RB0M00bsp 0siЍؑ؁0S 1 0000 P@  0#⩟ɐ Y Fp10S Z0p0000000CS0C01;  \" \   " L\ B  @      0C LN ('V%,'Bd'''''A- `P 0 0Cs 0x 0 p0 l   AC^  00@pT *@ 0d','V%('G-@p0 PR` 0 P (S%0  d -P '0 ,(d'p%Il@-f?0 B%O-eGM0PS@pM$Q403/P Z0: Sa?00W +.* P8:T??0OP0: S 0S7P0: S 0S 0S 0/S&%P7*0p0oO:P- DP 0#v' PvO+)S0P ]D#P]P /<P/<P :0P+I [(H Z% U8.0. 0PT9.0. 0P @DP ^ PT1RP o R00S$ 0SS 0: SOPN 6  0=G=00 04K =G=00J0SP. Tq0XG DX00CS0 p Pp  pYW fX0 X p00CS00 F0S P0SGݍЍ0c ?o25000 8p'ġ CCjC%C%C`%D\\O90\\K9X X0p@-@P@@DDT ` U H H0Rp@\\59ppX 0Xp@-@P@@DDT ` U HH Qp@\\9ppX X0p@-0P0@44T ` U 8 80Rp@\\9ppX 0Xp@-0P0@44T ` U 88 Qp@\\8ppX X0p@-PPP@TTT ` U X X0Rp@\\8ppX 0Xp@-PPP@TTT ` U XX Qp@\\8ppX0X @-ppt t0\@ ^0@\\8X 0X@-pptt \@ ^ @\\85S %R R S R SSh -^L^S R 0/0/0000'O-QMTg @ `u @ 0 @0L0@@@ @@D@H@,@0@<@@@4@8@5 SS$听\ &0 !00`V0S9 0 0刐0L0St 40D0800$0S00( ,00B?]6$pp6,0S d4 @?C000@$0D0p0H0D0pm60$ppe6$0S00<00@0#0ppU6,0S 3 @?CZ㸰张 0x#pp?6 0\#pp760 \ 0C0CQ0B003/040 0S ЩYT R}S0~ 00 R0! 0L0S XP, x0|R0 D ,0 0\HD5H 5 <P !p \t @@  < * R(" $\  " &p P 4 04080080 0Sb Q> 0 !X/X0$0Q: 0 t!d%d0(0$5[(5 0R  P 4P0@50S00P00P00PP\0.S0S 0!{0P$0 0P(0 $M (H R P0?"P000Ѝ'VUUU;$XG-@a!80S !PP a$spW Gy"<0SB|"@P ;@m";@;0Sp5!0CS0 \✅$   唅00L0S \0.S0S #@0S40S t$$<0Y?o20S X (040'l3V {4DDG-`I+/P0DL0 8P0S$00D0H04P0pP〔0t$pZh4T H0 `F0P 0 H.P X$4X0 s0X00 00dt |  P PRPS W( ?R004(0'R S S S3 L0St3 T0Sh3 0S\3PT#QP30V < 00Ѝ10@GS  0$ 00H00P0L0 0T0X0s0X0 00P0L0T0H00 00P0L0T0H00X0v0P00L00T00P0L0 0fb0d0_PP\0<0Y080 PT0 D0h l0N0D0h0000000Bp=0p$0,p80$00,03000@0-0 0*0p0'0t0$0D00h00x00|000000000D0@P 9 @00D`0S0\0S00S S S0 30`0St0\0Sh0h0'ht@V%] `D%5'4в0ܰ$V%#D%T(D80p@-@PT @@\p'80p@-@PT @@\p'-L0MSM\0 + <p9-0 ލЍ 00 >04@pl0l 0 0  L00S    D%jD'''$0\ 0S 'j 0L0S/0 0 0/@-00 SM 4 $;pp*hЍ\0\@ X0R@P0 B ? 0Ѝ@'''DD'DD'P `00CS`0p S00 P0S X0X /X`%: S@-  S  S/ I* S  S%|@=A-x1`@pTXPM !XQ@P10S D10S- 010'p  6@0 0 0) 0@0S00S 0: S@Ѝ0p 0R0| x0B?2 0T00S 'D''D3''' ''D''s@- P@@P `QU00S @HT DЍp0t  Q \0 \@.U )P@%UD' 'p@-P@Tp0 0C0  $B @C-@4M$3 30S`sV4Ѝ0 0C0{ 0XPS !${0S 20Sm  4 "; $pxp _Ѥ0( TVH20S 04N $J 20S   B0 : SK0( r" 08"$4/10S10S61!0 0H 10S|10S : S0: S v`x81萟 01R(1 B?1 0 'Q Fp| , l߿L\,ֿ00S ''''D'D3D'D'9ZE''''' ''D''1O-0S$0@010S 10S,0001!0 q0P0S ЍOPa0HQ ᐣ0P 0 `0SpQPPU% Ѝ  B 10`    0S[  L0  $R,   V '''' 'V%V% '410G-S$0@010S 10S,0000 0 0PB0`VGa`\pP儠UG o0 0C0 W fp0S$,  `YpP V`'''' 'V%0G-@0T$@0@SP 00S,000@p0`0夀S㤐@VG /0 0C0 W ,&p0 00 S p0S$,  Hp` ''''V%@- M @ p ЍT P 0@  QQ  00&T tP S  %0p@-0PS``/@P 0P PA@P4 PQ:p'S4E C-CM@/ `4 }4PȐ`T *F 0➣pPPCߍw ? P@^4w0S ?@UP?oP@h%@-k5 峾㋻E% 000/,'@-[50 墾zDE%-$M0P!00Q00! 00M} pC$Ѝ "$ ҹ0P 00t0 p0|t p\   HHT"$  ,0M,'EE1Ed EEEEEO--Le@PQM Pn 50Sr  pP 0S ޹P  t00CS019p0pЍ0S ᾹP PǹPᵹpPX ⷡ) ,4 Rl pz0! 0 X 00CS0p YX 0 P 0S  p P⑹P X0: S ڸP4P₹ P mX0: SPX pP[b0S 㜛  P< ePA ·[ (30P ,0 ˯S ,!0 0 } Az! A ({{ z0 |H.pǷ00@0 P @p lP 30S X0;X0XP ܛP 30-S  ϛᐷPXǸpPt0S  HCSp Y@,'WE6%`%F$F 4F56?FMFaFnFs@-@ `P/P0P UIGЍpU  \@;90 P4@FV%F (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpxFFFG-A~M0MSP 0p`E 0E}qPV3d! 0`~܍Ѝ~,P D3 !0 0E~PP63 ~,ʶ`P-3 ~,P0pE 0E~2PYp  Q \p/0 00EP3>$ /V%mGF,GVGGG00CS0 㸼0 /G-\D`HMp 0008T8$8t0000 00 $0S0 V"4`0p Q 30Sa3PZʷPZ20#f/a000 0K|#CP20`#R/V 00D30p Q   #&P0 020"3/V0020"Pk20"/2000HЍp(0: S P. S+@ aP00S`0:0 03V-V)V q 1X  ?+ 3 0~\P F ;0L S0 00 0'qp20S0 0V00 V V  1!00!0S ~<0~0VXHPQVS U [+ XPV P 0V%P' !'4[% V%'p'1HGV%GHW%CHm8@J'I'W%}D00S/@-4@~M0S~, CP~܍P'V%0@-p@$0l00S Ѝ00 0V'0Q 1, A.PV%P'tHL0@- R8-P 0 0 -P'Hl'J'HA-pP@` P@DTP`VA-pP@` ŴP@DTP`Vp@-P@T0` Q˴@P 0 Q @;;S p軴@P00T@ 1(0( -( q-V%P'J'I%Is@-R@T` V0a@$00 ?00S 0CS3P300 S9I-00@ЍpPڀ;;S" 00 0&0Q P?;P00@00" 00S @@00ES TT 0$000S00S 00S 00S $0STڄ00Q Q`,T( H,0(00 ;-$V%P'FIpI'I%III`1 RS@-PQM R @!  BR0,ЍQ   RR  RQ     ^P000S, @ 00pT0pS 0L%Qo 0)p T0%Q/P'V%4[%0Jm_JJG-P`0 P ,p@P"ڰAQ"%Q 0P P 0%Q/@ ,ЍP PV%P'J@-|A`MPh1P0S2 S VPLD%,00ЍV0App0 z%0Q/ f, P0S(0S 0d%Q#/ ) Pڐ0V 0?) l0 ` 0ᙴP/ 0< 2,00V%P'J"KOKtKJ'GmKO-rM,M R(`RX0E@FP[0 0S 0 |00 SJ'0S X  H"YD2p00 (0$"L0"FTm! ?S܍,ЍT ؑ0S =! !.!0`(( ㈲0Sx1pp1 00( 00!00@@z=0 C.z᪢ @+Jލ Ѝ  ⋢r p G@$<pm ?4S(4R0(4 \ QX00]0S0(4 00P 00 l'b''WW''H[%L@XD[%WX/O-p@M 0W0DN 00S08 0<0 WPP0C080pG0S 0`S * 0R 08 0 x x.  P8 C@0 X2@ @?Q*4@0 0嘠P ੊P` hЍXX &  ` `@vXXX' 'hX''Rs@-Ѝp@ 0@`PQ08  bP0 X@'vX0@-@MPPኡ00800S =J"Ѝ0@'G-`QM MJP㠔@ Y #p KP 0p 0PP=! SR J(ݍ Ѝ⨢PJ8 C= $HL0Q\ J(L0 00=QJt8 PTX1HXXA-QP F000p@T+`00CS0pT0 0S0T@ 0S@ 0 d0P 0S@ @T@ S P D'Z%`% P'0 0 S00@-@R00000S0@000S `P L^p 40P''D'' X@'p@-PP 0S|@p `@P` @P0/S000000f PR @@@p$Y?YD'h0 RX R  H R/< R/ $R/Q/ 6D''''`0@-0S L0@0T R S$ 尥0@@'D'fYp%G--b@ 0(MS 0SzB((Ѝ0 0p5"0C S60 |20S 0X0 00!P 0 ! " ~PPp  0!$$! 0!㓭 X #(4 : S=  S7  S$  S03 0`!  0J 4!010,P7 S  S/  S04=! 0400S -ЁЂ ;Ѓ"040+04 kP0h 00  0 0 Y D' @'YYYY l'LYp@-8M@  |D 0`P`⢃U`$ $ @ 0\P8ЍpZ!ZA-t1hM0@S T嵤hЍA% `Z(n="(<p@21WpP0 0000p084 ⑤40CSH$0r"60"$僤0( ~4 CR+x u hЍB>'PlS+<  e<'p-Z?ZQZJZ@-@XM="p:( 0 SXЍYZ7@-@PppP Q Ѝ0 0 8C Ѝ0@2C0S :R Q/ 0B\/0@ P 0 0B \0@ AB\7@aB\/W@Q/Qq*-0C\^* 0 \ 00W0!00N0 00N ^*N^*/ P@-*0S@L0 ? SR@C:@  ^:R \000Cs R00 S00 Cr@ T \A Cr@T2  0a0Cs R"  -0C\0S* ^ 02W"!0C0 0C S*CS*80P @-  t//'bZA-@((PQ U?-QQpW  :WP`0 ?`S AA诎0:S@0 R  0 `-h'%Z%Z/s@- `0P PQ10*@PЍp@P mR bR kR%$+ *R xR R wR!$/QP@P$+*$&!PP@P0PA- 0S/`Pp b0P  T @R p00T0p0S , @P0=0 PPፆZp'Z [s@-@`P0l C300PЍp@00S S@@PP 0 @D 00p'@-  1A%![0 Rr @-/4[%@-00A$(A A A%[U\,]&^G-p p&/@d- \P(p`0, wZ/00 `^O-lM/_PoW]@P$ `P0`p/刏0/ P0@  p?p/@p`?\?A0sQ S  R8?8/00 CRJy?zP< N>P ,c>@>0 -R.Q0 00 0|> t>t. l>h>d> >0SPp2 <>  = 0S > 0.0 .0-0==P====-000X=00j=@ T }PPlV| -1 ! ` S=<-<@0=,=<PE < -<-<,<,<,<,x<,<{T< d<{_ Y P:4Co S Q  S  FP  ! C 0C0 0A0 B!"00@& A-Q@pW :0&"*4*0p000 02S($0 *4($040)($84  R KS 0 0 40r;;00 04KS<  4i, $ '' n0o'nonO-j4@SM- S 0cS:l& SR0d0C0 PR/R0R  E?o2R0S%  0CS@ ; 00$0$0<0 0 0ݍЍp$  'p@-@ PP hp@@pp@-0P-S0S' 7@P#~s 0N0p S0 `CPE`P40T Ѝ@pѼꈮpp`%-@-0@P   iZЍ@Ѝ/('p@-@ATp@0 R PMP ` `P`p('-P@- 00|0 x0x 0 0 h@0S XHN00L0L <嬌 ,)$ :N Ѝ@ Ѝ/\''<'8'%l'4p@-x @PlohPP XhP p^ 000S  ppP(''p -P7@- 000@ 0 0 0 P0S xM00l0l hU XҡTrD 8I0 M Ѝ0@Ѝ/\''<'8'%l'4%s@- 3 p%0@-MM@P@Mߍ00/SGPtGP ߇p Tڇp  0RP 0RP spf 000/0'@- Ȉp%A-q`@ MT pphAPDQ00CS0>@ Pp< @Y@DOoB0S@ Ѝ0P: S xP 0S vo X L 0 R@@p 20App T嚋0 @00CS04嵻0 0'q%)q`q`%O-PQAMS 00@<S =S 00@|S0 0@&S0 0@=S0   +R'0  -R(0 )%#$0 &' '0r''ur ? 0@- 'r0s@-0P`0oW0`0@S P 0R@P@  P@0S00S 0ST P000 R  Ѝp','$\%r r@-|AL ^ XP sr^( \1#P?  B 0b0?  b0 0RQQQP0R0R0P0QPQP !E rssO-p`p됰P0@%Ss00&S T6g! c0 00 @ P@P@'$s@-0@!4Mp JT` 0 P@4Ѝ0@P S7WP@V P @0 FAP@$ P@ޅ IU'p@-@P0)Sp'O-@p`,MTP TS T( T) #T! @$TO "T 0@#SP  ! ,Ѝ'0DSYA `@V@@P'0ISV'Y00`0` H t T! z! 0  @@P! 0  @PVb'T@@`@P, @ @  '[s2s@sO-p`M8P젟찟n!@ j0 X@ 0DS'00S^^* PU @ 0 e 0DS00SY Ѝ` pUU 'U C-锐p`  0BS0p0@SP ! 0 00P@@@P@ Ѝ'G-`dP0@S! p0 00PP@'@-@MP91`PLq0P  IR NRpp bPpEp@@0PS@ $F1Ѝ'msPG-P-PP* `0@䀟00 0R0Cp0W S `S0p 00 P11Sp0@0PH0@P 0,zP@}1\% \%','@P/- 0/SSS00 '0@-@PMMMߍ00/S \p p  0RP 0RPp@-`\<0@P +0D0p@h0g00"SP VpOkz 'sp@-T` RpH0@Q 8 GPP 0pp@ '[%sG-pWR 0S)P hB000000000CS020S @T  |R pR\T/g424b0000@/Sp=FpPJ0S0/p0CS0pppW000000pA0P00 h00/ lR `R00CS0<10S 00CS00W00 pR0S/S0@D00r0@:P  R*0000t/S0S (P 0/0CS0 pG0S 00CS000F0@C0@@0@ '@'<'ss\%' \%A-`p0@00PP 00CS000S W0P0CS0d00S H%@ HW 406 R0S 0N@'<'s$\% 'pG-2My6r0@T@S@P 0.S00.S000/SS?X20PpTePZ( ,`V ?PP  ` .` EQ0Efg@0-S0Sp1@T@dRP.Pw $0S ~.pP  `P i 0: S W f.pPX%P pW 0S I.pPЍ$\%s4'_s 'ss tt@-$0Q @ PQ @ 's)tp@-L@50P000S LTPP 0Ses@@iM 101M00CS00 oM 0 QM0pi<4'Tt 'ht4]%tG-@P@\R` V101 <P (P  `I\TQp @p0T \0DsQjSh0 @0 p0BP!0 BS@p@00CS00  M 0@0 @T0S 00CS00 L 0 0SZ00CS00 L 0 L 1 0h1@ @ @ @ @ @pp\@@4]%e tA-@ ` PR 0R 0S SLp0S0 R  M0S  MU  LTL6h xL Td@00CS00 pL 0 AQL]%,''48]% 0]% 0@-P( 0 ,'@-@(0Q M,'@-x0@T   @@@@ @{@00S 4060S "Ѝ,''$\%-$0@- R    '-@-   0p@-'-@-0@0$ H@-P@` =@-@-   3@-@--@-00 " ЍЍ/p@-P@ p@-@-   ЍЍ/ 0H P @-4 49L,P /  tD'0/P'p@-@F|PPPP b{p` f{`P V{p` Z{`p7@-P30@T p06 N 0d0@T PIMP0 0@ 0pN@B Ѝ04'$\%P''B @-p`P@U'o<0P%{Fkk&Zg{[`[x q06S 00S T( Ѝ @0t0S0T.S N@P'vs 0    /P's@-@ P`TЍp0P0CS0  000 P 0 4@ 00 p 0@-PM @T @@ 0ep ?+P   P@@ 0ep 80 @ 0 0Ѝ0@ ?d @P'[%[%@-@P 0S0S 4P 00 0 Ѝ'G-`0S q0P00#@dT0SP_&@D1$@00CS0$10S 0Ѝ00S p U;zf;  R L)P00CS00S UA0SzAUzP z@"@'<'P'vG-0@P`^PM U*릐 s)2Q0 U2$PP20S H0S 2$PPPU I ^0S|2 0S@*T ^0S<"$0 0 *^0S2 R$0S0S &F@ P0S F0S F^0Sd1 R$ R @T$@0S E 0S E 0S E 0S E  0$ V $0?o2$0Mx0$ R  0S E 8I4NI Ѝ$\%'y P''0v]%O-@MPp*0 ;`㠀堠堰?P@ RC*Vx0$`W T ^0S W GP  0`S*Ѝ,']%$\%P'P8PG-P* `0@00 0R0Cp0W S `S0p 00 Px*v*S p0@r)PD0(00$e* 0$ 0$/\% \%'P'A-Pp`@000^0S 0S S00CS0 0 0S 00CS00 00$`0C00CS$` $0 R Ss 0$`S SP'$\%G-P䑟 M^`AV $`[)pWT0尡p0p00WZ 0S- |1|a3HlH H00CS00 cH 0= I00CS00 QH 0 3H  K^ $`R 0S S00CS0 p  0S pS00CS0 0$`0C0 !) Ѝ$\%P','X'0]%C-@$M p䀟( 0 0`@T+ 0S0 PU@ 000xP 0t 0 SP0 0U$0 @ R^PU $0($ЍP0,'P'$\%G-P,Eo@p0媢S' 0S$ 1a1Z2HHY.HU H00CS00 G 0 G|aU000 &PD U 0S @T H1守 WB@MG8KG1F0S  1$ Iߍ0A 0 000 0z@P00CS0 0@ 0 00x0 =00CS0 0S GlGD0FX00S i@00S c4'$\%X'0]%,'@vxv8'vP'@'v<'0 @-`o$M 0 00^0SP4P @W'000p\ pl%P 00S )Ev=9=v0 p000CS0(00S  ['$Ѝ$\%@'v<'C-@?mM000@H0?_00?0,@0P@ '@P0o0`p00dp@Td0hP@0po 0lP@T 00/P0l $00`0S$&`0 S 0D0>60S >0S$0S 00D0$ 01C 0>0S$0S h@T @ xPP H0B7S 'x0R8 P>0S900SD 4.000\0,0(00 0p(0&p  =&0S(7S%00S 0 0S= 8  x=, [vp@ P 0 t= xK8 `= <=, R , ,( $P000==0S @U0 0P%@I.P  @J$ 0 $ R 0T@ =lqvp@-Px@x`M$P)00S d"0`(00``00-!`"$ЍpP'4'@-h@P$0;&0 RP   BQ   P'//C-LMe)8c8 p@<(P@0` D, ` 0ALЍ4]%vA-@P`qPpWU  L! 00%';p<''O-pWA R``%` P0S:S SE@ @0S(W@  @0T/S/00Y0p0 R00P R:R:RPPP@DOV!!\% \%'@-@MP/p P㨐K  0 @ T9qp0 @~0!0P 0pWZ0S 0 bT0S 0S 0 Sqp @?! h`P T T T0@@T >0DS'A- 1@PM`Rk0 1000  ;p !XZU p@@ Q X@T@Q@@ 08AS 00CS00 )@ 0* 00CS00 @ 0 ЍQ g@@U P000$K 00CS0T00S DM@K@80 'w0w9w 4]%Bw@'<'LwRwVwp@-P@@Pp 0S%SpP @" p@-P8@Pp 0RPp@! - @0@ R0S P P\ 0[%'G-`P@唀0吐00|Up00CS0h00SGD0S0 S 0S00YPPp@''[%<'A-p`P0@00 Q' Q:R @":QR!@P 0`EJ0@S`@?%R00S @#P`0W:SP0R@''[%uwA-`P倀000|Vp00CS0T00SA0Sp00'KX@T`@''<'0A-pPS R+`a@T"W p000]0 @0 0 W00CS0H00S `"P `@'@'<'p@-P$@Pp0P0@! @-L@000@00 8X00CS000S@a@''<'O-PM/`@ 0P @@@k (oP00š0 0S 0S 000V#   P@ L/P @cPM R RA R 0S   0  003 0 03 Z0 R"00Ȳ0  *pP7Z { 2 @v 0|>00Ѝ H" R," R8pP B0000S R  pbQ  0X/R0XZp "P pP t"P R  R (nP0 * R; R 60@@DK P R  TP@0000S R    BR 9D R5 Q3 P'tw[%'0]%@'uw}w \%w<'O-`Pp$M `x%@Pp2, 0S*[ 0 00P@0  p0Rp`#0`2|P& ZQ>=01 =@$Ѝb@DT@ P  p R   U 01W VYXU' [1 00al 0aS v00@0S v P S>W 00SY0 0 S0 P 0< S0 Xw 4'' 4]%w'[% p@-`P0000S S@H000 00 00000CS0p00Spp@j@'<'0@-x@M0 0000\0P>00qH 00CS0$00S Ѝ0@IЍ0@'$\%<'@-yP 0SHO-`pP@Md$P0cS @@ <GpP vPP VP@ : R8cS" .U<rP3VpPA U=< IP4 <@<T 00S pB00CS00 "< 0 0@ T  Ѝ 0R]PU D_<\<@X pP`1000p  `F`l1VD0 /PX81 0 000SZU0W?<lPU3<U~aW)<UU Ut Ud;}wwx4'w)x@ Sxaxp4]%>xqx' wwx!~xxxxO- M$B$RpJ0@0`V% VV:V  V /V   BR <` F R  Y Ѝx! R  \a[  0000S(@@PvkKP@ @5T ~p [ /R0/S0KW 0 BR r R  BR    BR   { \% ' '$\%_ A-(A0S 0PS0 0aqP0S00 P000VT00CS00S P 0SRh`hp0P RP0002T000CS00S [ '@'<''s@-0!S1Ѝp*S@SP``00 R Q0C R R00C S@ `O@0S00S=STL00 <0 R0AD1U0 S 0S\%'<'A-dp`0PS@  R R00PH @ 'O-s@0MR02$` 00 042嘀0C v40`SX00 @ 000CS0E0S00CS0 20S HiP*0X00*PiP dS P 10S10 DC}0@0CS0d10S |Ѝ0SHH Z- Z`* V + 0S9@0  NP B?`F@ 0S 0 0 0CS0s0 S00C0~0000C0 0`F0CS0V0S@@ '@' \%<'P'' 1O-0Sp0 Ѝ@1匱 100 Z :[X0S @ PxqQ@P P `X% V800V `@`@% T* R" RPP "P P@PP P DoPQ` @P@ '''`]%tA-XPX@X`P0p00fR0p0CS00S '@'<'p@-PS@kQN0@ p '@-QpP0` 0S*00E@P`PP `R@ Ѝ `0P@@0`SP0S0O-0R0@ 0[1 GR00#S00 B00S0p0 G0 B0$T,Ѝp U   p  R00SPhTs ' ' \%$\%x''   ,'x y,yO-0M P0 4帔0@0~Q 0 `p0 @Q Q#:Q =Q Q  Q@   4  BR  fP AA  `3A P W 0S@ЍQ Q@Q =Rp `p(`` L  BR  wp w     BR u   u   BR   x ( R 0BQRQ B  W `   BR  vR v 0ASq Q AQ~@P /  Q @S&~  ;@@ Y  7@P  #  ~R =Q0S 00    @'`]% ' \%,'' G-Pp`d1dAf0`S 0X00P0H1 0081 (pppV0 S000`0`0CS0!0 p0开@p   0    0  R 000p 0p $\% ' \%'\%,'(' @-0n@l \%O-TAT`0$M`FA8q00CS0@0 PP 0@I0O P0 0C0S0AP 20P0 R"Y 0CN0PEPE0000C0$Ѝ0000 ' \%','O-R`p@P[ 0 0000PPX P X  3 0 E0CP00S H D/1(04  @D,0,0D '  '' \%8]%p NyWyO-Pr0BS,` @( ؂  R [ 0 0002``TP `? Tj T Y@0T: 0P[Z  R@0@Y0@FT: 0iPD BU# 2Q0 TQPR D2@Y@FT: IP7 DU0#0 2S 0TS0Q00R D2@ 0PY 0S@@T:@PF0D0 0 C00PE0C0`FT00 0 D0C0CS@0 000000C00000000 '' \%C-PpM@`᠐B 0嘀00000p000CS00 p0@ @XЍ00p ' \%'\%A-Pp@.A00CS00 5. 0 ` V.00CS00 . 0 ` V`e.00CS00 . 0`4]%@-qy@-qy00S/ R[%T0QH0 0Scq o/P0//8'[%0    B /8'A-P夀0@000p `R$ #0 `0T @ `  0 0C  S000SAS@'[%8'<'0A-P` @0p0W0 \P 0X S S0 000 00 0h0 $P   00T F00CS0 00SA[%@']%8'<'A-bB0 pWcr 0S 4-2-0S@0PP0/\P2b000r0S\00CS00  H0S 0X@0#S \ P  \Pg- 0 0p0P0 R R A   BR 0E0CS0000`0\00S =-H0,`8 Q[%8']%8]%y$\%0]%y@-L@00CS00  bp00CS0@Y8'@-T T@08      00000 0$008'[%A-P`@000a$ [\V |`0Pb$p0PS  D0  0000CS0 00SA$@'t%[%8'<'@-4aM0p0P0\@P ]P(0: S$ 02  \P  P\0 00 \d#T[L00CS0,00S Ѝ@'yyyyz<'A-h@Q0P0`0 PHpP<0`00CS000SA@'8'[%<'p@-`P@00P0#P dE 0S00]E0X 0000CS0p$00Spp@|+[%@'8'<'0/[%p@-@(`(P0SSSp[%D',zp@-P@0Sp[%D'p@-@Pp P0Ppr#0@p[% 0 R/[% @-@0@1^ `   VpPW  Q Q 00 r B"Q q A,PU 0  0 '5rO[%A-R0S20SP`AT p #Zpp "#}BP + 1N GPpW>[p '[ 0P 㽐'''[ qP b[p F  )Bp,F Z P G[pF  BpF "00\'Y'V'`''[%p.Cz$\%'qzz0S/p@-@PP1PL1DP0a 0(00R 0S"00Dp05#0s  0C?o2^0SP/pP +FVP p0S *00CS0p\00Spp@! Ao PQP'z5rO@'zz<'p@-@\P0P00 C@00CS0p00Spp@@'<'O-@pTM R0 TЍO*ؠZ* P`PZ   0SPs  0 S S S P R00S0S@TЍ0S{22 G!0R+  p  !R-    x"b*   0P"W* 0sT ,fB  ) 00CS0)0 X )؀` 0S 00CS0)0 00CS0)0 | 00CS0)0` 0Z 0Ze)000v ) #40  ) )P S#4sE 0 * l@ h  X)Ѐ 00Cs 00`Fj&|'[%5rO{({-{d5{>{C{R{@- 0 S  .^\Q   p@ S0C $00P0R0S pO-PP10 0%SW P 0@S!!Q@ C$0S 0S  R-S %S +S @@1@YZT X@1 r9 002#00S 0S 0p?Sp  P T"@` [ P P ^ \0@00SJ R Q !" R @[%X{w{'g{{G- a 0S Qq0m0@SF @ (А0Sʬ00CS00 L( 0 )0 R  0 S0!('4'5rO{{{4]%R{A-pP`0P00Stp10P 0S TjPp pPP gP`W@ P1 1@t(`V Q U` 00S`AJ 0 X(P00CS0 '0S 0 0 00S0 S 0 0{{4'{'5rO||4]%800S /@-P `'8 P  /Q 0SZ//'`060S/P00S/D0Q<0  40 A!0 S00'$\%'0]%'5rO|G-Q`0SS@00SjZqP000M:@ 0@C  @ R0000CS0L10S 4q000$100S010000<>00V00CS000S 0S @pWZ00萠~@ 20 Z@Ꙃ! P00 R @'@'<'$\%A-`!@S1p@!P JO%Tp1@WV2 `1N0SN U 0S0PXP2WV 1=puB O#L#060S$ E#B#?#VB%?%U 0S iPPtV\\VP LLrWT 0 V'4' ''$\%[%zy08 N R S  0S  P ߯$\%O-`R0pMxB0 pP P Ѝz0S0S "0@0000 0#P:TR 0S0L 1 0S1060?o22T97 S 500070S а 0 Р 嚲"S :^ 0R Q0  r; R-z!   B/oZ" R" \    P 0 00CS000S \  @Vz   B/oZ"  "0'@'''$\%0]%<' G-pPK@P EP1N0St `<@VT @V<pJA t`㜠@0S0S 0S0S/`@Y 0 X 000 9$\%[%jz'A-@s PPT0P 0S ilP@ pP@ ZP@it06 R0S@@PX` p9 0 P m)|4' $\%4]%O-`s$M. PPY30oV &P *P xnU pUV \`H3 R ZP$Ѝ3P\ ZpP&0?oQ20S P VP  Q6ZP@@=Y pW  pP 02 QY QvVP  K(160SI\  \@ /o"/ S [ &(\@ Q 0p0_#Pv@T R *  W R #0PS  R 0 S0C 0 ~X 0 R00YXcX `Z^ R[00VD'J|4'N|d|-|'$\%p@-P1T@\a000 R 0S 81F;p 1?!0S 0 00E1  S j00P0  Dt@ RQ Dt@@@Q00R00S 0S~00CS0000S p@'[%z'5rO<'<1p@-Q00@S($P`0SP00CS00 # 0 $0:p =?.g!#PlP000V0@0CS0800S )p'{{ 4]%[%zR{@'<'@-m @ 004'@-@ b @p@-`@0 0 p 0Qp\ PU#00p'p|O- 0HRHr@@@0T$ T 0"  @D@ Ѝ0CS0 )0!@T0 R 0S\S 0S`0S S S=S8 " CK 'SI 0 ` D V@!  `0`F V`0#`V "0! V 0  }00 S$0!"0^ 0  :0 1 }S`V0 0 \0$0< "04  ' |J||||[%||A-@`s嬃MTL 0SIPU0  xS0S d#"?= 0 BRS8@$#":P(&@`@P@PUV0S 0S pPdTЍP@8P 0S P wPlPxcPT tid`0DPU@ B0 =0 SPF Cy P9 P6 P3 P0 P- P*{xv' 8X|||dv|J|||||||| ||}||#|||}ZAp@-@PTpU0;U 0S 1@p@-Px`x0PP6 R@N0S@2@@0S. @D0    p 0 p'$\%A-0P@`Tp R@ 0N@T P 0S@@QW\0HU 000000V0@ '$\%[%A-P`p#p P@ 0 A<0 }G-PP- 0M00S _ou1q R100 0000 S @PЍ~0SE  0 Q S/R CQ P" Q 000S*  RA ``0S:SV@!00S!@~9 @00CS00 ~ 0 ( p0SP0 @00'''' '&}\%'4}0]% \%C-@M$Tpp``P A0S 60SP 0}P# 0^0v P1U00S^0SP60S .0S } P P PЍP ^Y8 0 P0C?o20'$\%0]%8]%]%C}'0S/p@-P000O@PU00CS000S TpP@T` `@V0`0T0@0v0S V00T00p@@'<'$\%p@-l@0P00{OP 00CS0 Sp@00S ]@'y<'p@-P@IPUY$p@-6Pi}@-08Pb}p@-PU@8pA-@P0PS`~Up~0000 p 000CS0h00S 0p000000C000CS000S \%@'<'P @-(N 00C00/}\%00  0 00   /\%'p@-@tPt`0000S0 000D0 00CS0p,00Spp@008@'\%'<'@-D@ 00040 00CS000S@@''<'G-q0A000@0V 0Y0SPkPP) 00?0 000E000PS V 00CS0l00SGh E  P0)` 0`00@''\%<'T 000@0A00CS0/00S/9@'\%<'p@-$@P0 0C0C0p\%'p@-(P(`@0@D00C0p\%'( A00C 00 0C0/\%'-A-@P(MHp@`DpPVP u T(01 0P @ @`@DPpU(ЍAЍ/T (01 p@60 P p} O-D4o@@k1000S P 10 A0 SFp!倁V@0  R0 0C08000+0 000CS010S)0@0 0 0 0 02 P B1 0R }z0u`@0PEPUZJߍ2 00CS0`eR _{00]%4' \%@'[%<'\%'0O-ԏԯM0ϟ  Q"/_@/0 0202280 `00t/20S@0S5@@" 2 pW `R00S  .00CS0.0R00S 0@0C0D0000Pm210SxPTP"PF 2P%p}<k8.U0@#S00 p6 p00@ S0p@ A0@S7p@a0@SaWp@ [\ P0000P-'P 0@Y^00@S Uyp[U'P8Nppp= 0 0CS00C0~000p@A00@S0p@7wp W00C0t00j/`0@?o? @2;R0Sp |\P!\Ppp ?PpYW6;G S4 5:0 Sc@0 W0C *0?0'3?pp00s0 S0 0C0~00@00C0p%W!*00'60'3?00q Q~  B  ?pAp00s0 S0@0C0~0@0•3W5*00'90'6?00q Q~  B  A0'3?00q Q~A• ?p Bp 00s0 S0@0C0~0@000C0w300'<0'9?00q Q~  B  A0'6?00q Q~A•  B 0'3?00 r R~   B  W?p00'?0'0!Qp R00C0@R 1 00C0v001`@G0"0 !0`0C0w001 0`0C0v0(PA(P0@0C0y00 0"!0C"  0 0H$2  `!!J00pS 21 냐`00C0@50y0C0  00S 00C002  B )Pp' "1@0Cs0S10`0C0x0000C0p0 f00S210"QQ 21Sy0pW 0 l0 n00CS0<2pP0@D21S;0 0#<R00S2 0S+0@SP P1P0U1 UP>Y/UP3>P0 |P!000P$@D 0Ѝ@PF0 ,  w0P, 0&P00 0<P_ >P &P 00p0pv0((0 @ -P 0(0  p 00@ 0F]%[% \%'\%  8'<'y, /F^ ''& H' \%  0{P B@ 80 } pL0 {Y0D 00 B #PD}P@ 0 0005 }P' @ 0 y BR '  =0 BR@ =0@[0%Yy :Y4 #Y5pt0@ 0 p0I Q y BR K[ 0 @ Rp 0 B p74Pr 6Pp@< [ B + R:p%pp02!R1S 0GS2@0 Ww 00W2 ` !k !z@Ryr@pYp K/o}Y" R 0#p0CS0p pT@'P023Qw0  00"0 `!2$0  0G-`Ȁ0@T@@0PU @ 0S 0 0  B/o"Y`0p 0S 0 x 0 0 0]% @-.P0@-2aM0$ 0 10< 010@0<1|0000 NPI@1| 1Q @@00:} dt 0S $Q. 4QG Q ,4  8000<  ,000 0 0 d0 0 0 S00aߍ0  p0 `0 KH0 D0 H00SMS,0㑿 04'$\%,']% \%8'Ƀ G-Up0 00 P0    x5P $00pO@*%rP 0 R 03`      0@0S 0 00< P0, RP 000@ 00 00 R, R崲P3 00300 0000    BR   0` P0  0  CR S 0 P P`  ``t 0 0008 @0C 0 ^00^`0 Sl^P X0 R   L000`0S0 R Ӻ0/0P 0 R000< 0  P 0@S P 000z F`@`!0P00`e P0.    00PU# T 0S #0@P0@00S0P0S0S 000@Ѝ$00pp]%t ` ]%$\%A-Q@`pQ` @ 0p P0 0W@ 0q R$@@`FR ( X% R"p0 `4 P /A`P 0 08 00C0@04`Ѝ Q  0Sppp0 00 00 @p 0]%[% A-P@0 P. 000 `P tpn@`i`@@P 0`0 U000 VPPe``0SU QP]%$\%(p@-@|PP 0 @gP P 000 00Sp }pp]%; !P/0S/80 P/0S Q/0'A-@Pp`00p` P@-` :PF0@ pT@5 PP " /9 Ѝ E@P$9   ~:v]% 0P/'RQA-pP`%9VU``P``V@ 8`0 R@9P P0$ 080 ]%)A-`P@xpT@Q00C0U U n"@P0 P8'p@-X@X`0P0000P"00CS0p00Spp@y@''<'p@-`H0@TpV@PU P8P'|0p@- PR QP@ o80 bP `d8:$ dp]%Ep@-@pP0 S00C T  DC8P 0SF8,03O@dA T @0@p@]%gfff'p@-`P0 Sڜ S  8@P t0 R@U 8pf0S 0 S 8@X0S '']%p@-P @0Pp @  0p'@0@-@ P  R !@70' 0 P/ R/'C-(P0 U0M0000p#0C@S0 ` 7@P @2@#  幻V 7 72 R@Ud2T /o"Rm 7h`0"0|7@P2V0S' `q7p@! 8pdzPy7óP 1 徳ܻ 0: Sf7밳00``!l`P!` `V'oPP %# 0N V U0S00! 0 "1P @倳 # 0-700CS000S Ѝ@rT  0P^" 8X@' 'p]%$\%  ^<'Rp@-@`PP Vp " x6pPV *6pV " 0P0 ppG-` PppW@p  P0̐P0S TX  >G:  |40@ l.V  T(T 0S @V@ P4]%P  ]WZp@-P  @j6p R  a6p d0 Rp  V6p O6p I6pT']%p@-@PpD0 0RPPp03/76Pp'O-@$M0@000`p@A p2@ 尲娒V 0S"2 0S2" $Ѝ@0Sp2 R@00CS 0SP P ! 5Ps6PP jT 50SX gPS5P0000 Sj\1 0R  5pP0C S !  N 5PP 0S( 5PP0 RPU 50 300CS0p00S bT0 00`Y0S''L]%4]%0]%'T@'W]%<'O-P0@ph#hcMdP P00L#&p-0U40@D[T$Sg 0Tq00 0`V_ '@`00S0S,P0SU0SRp0sS vS #UP0+S -S P `  8Q (` R:  eP     "PT 0 @0SA0MЍUF ` p0      "TR 00  常r   %5S 4px  04p0X0 N J 0D x-%-Y''-^ 4]%ՆA-PQT 00CSPDq10SK R@ 0r`0CS00 `01L00<S R 0qL0S 0CS>S RSxh R 00CS0N0 -  p@-@^0TP R R R& 1S# 0 IPpR!Q QT " "D0600S0T0S 00S0'@'<'$\%@-@P @PaGP@-@P GP0  8 'KQp@-@ 00CS00 P `d 5?U UH?Up!P0P0CS00 ` ]A-@|P|p0`00 T 0000CS0H00SAM0S 00S @@''<'L P0  /Q Q0 S//'@-b@0pSM10S 0SPP10SR WUOT T TP160SPPP0SP;x1N0l16 R6`! R20SPP0Q: 7p3 0S$ UEoخp' W`RUG0@D>T000 0 100 2TPx0N R T  DR 60SЍQ Q2 1 @$ ''$\%0'<PO-@`P&P p P P0@DpSppTPA TP@DP:P5@<P, (4  @P@sSa0S 000T $00CS030S C@@T00PpӪTW00 T\W! @P@s 0E0`P 10STw@ T@@VPT @Pb1 R 00STV@ Tx@P@UT X@Q0S 00S 467@@TppYW `СȱPEPe ?P@1 z10S VP`0-S0S`TPhOCW W0S8 _90S4 0@ V0 S R0V00 @`1 R BT` F00CS0400S ed <QxK4]%X'@'<'Pn]Ze0]%npG-PPE o@0p` TUG0S 00S 0@0@000CS0 00S %@''@'<'p@-H@P02`S@20CSp V02p'40T0P?o20S 0S//'C-p@`1010r!Q0@S10C1 ЍqXPU X2P·P 0S 't'?0!!R/P/'p@-8P\2Sp@\Bp'0-MM01`"R !R X"R   1 1d"1!d2S ,BPl1, ,zBP L!0,00qB@P$1, h@T0d1`0P, U @T 0S PF00CS0 ! 0F00 0$0(00D>S 00 (01F0"!031't'4'@' 0@-`"dy'p@-L@'Pm0PPp0C/U00pd p@-T@TP0 0P0 0 0000CS0p00Spp@@']%<'A-@R`P`p /0PPEUp WD>0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP000U0 000CS0h00S sDP`000B0 0C0'@'<'p@-@P@0SH00Spp@00CS00  ]%0]%0]%@-@PsЍ-@-   Ѝ Ѝ/-@- 0  ЍЍ/]% -0@-l0M, @P(0 00SZ0c10 @0DЍ0@Ѝ/G-@'`_P$ 0S! l˜0S00CS0?0 "  v00CS000 " 0S pW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU UPP 00CS00 ' ?d ]%0Q]%@-@0]%@-0rSwDd0G-p0 P0R(0帐@0=00咚=`᎚`F@VPpPER000 S=S B`` R`ĥ`PGI@ \%'\%0@- 4@ 00C00 0 02Ѝ'0P P PR00/0@-LP@^ ^  R0L00 A-鸀(  R (p`@pW p0S 0QPU  0S 0S   3/P@P004'0Sfp@-@hPṣUh 0Sp'SPTP@'PP(p@H EDb A-P0`Sp@    3/@PP@X %W  p0@=S0U0 0 00CS00  0 00CS00 z 0 T ;4]%O-@00Sp 00P㼀✠`V  X 0埗@PU* ЍY   [ QʁaP`0p'4'@0 S =SR/=S/A-`P0S=SPERPU@'a\0\p!0qV@pT 0S |PVpp@'4'@-1`0@S @  PPT 0 `` X `岰  `P Ѝ@RP  80  00 Gߍ0  0 i4','A-`p= P@ 'VPp PP0D @S= O 0V  @`ЍA90Cƈ-GMP00 0=P00$0 0  Gߍ4'p@-J-X@P0`@0U<N 0U`00 0p@'ވ-|!0-P$M00S 0-S00 0 R0   Rc  | Rf  l 6QiFQlLQp Rs    \$Ѝ'0''$\%'p@-@`TP000T 00CS0p,00Spp@R@@'<'s@-P@T@ dPP0 P00Ѝp@n` RP 0 @eN00000 00PЍp 'A-PpU`A0  0@TP@ 0@00`4' @-@P 0S   3/P 00A-P`0@T PP 0    R   2/P @@@ pP =@@T'G-pP`0rS@P W 100S V@㐑'<nT pTW`V 00S $p`V410PU0 DЍ 0`=S3 P& `W000X0  Ϯ@V 0P U V000 V 00S  *W P$V`P`e4'@-` pF@P6 0 Q0 PQ 0 0   R 0000    0 00CS0 00S Ѝ@' <'A-`p@TP0U0  A M0S R   0 02/0 00 0000']%$\%A-Pp@P `0`&`PPEPvT eTP fTpxTPW C@V Y@54'PP@- 嚭 a:C-p000P0`-S㸁@TQ Ƥ@ 0@00`0CS0Vl10SR ЍCG g@P=ᑕP 0 @0 0  0 0000000  0 0 00=S g0T 10=S010C0\QP 0P00 Ѝ@'']%$\%<' ' p@-@PTpt@p@-P@ XNP@ xP@ IP@4%P(P0 P pVZl4'00@/ 0S0@/s@-@0 0$P`0S 0"S U1r0!d%*0SX L巬0 @ R T RЍp&0@-MMP )P Mߍ0)P@D 0RQH0PP00@-MMP )P Mߍ0)P@D0 SPH0PP00@-MMP )P Mߍ0)P 0RP 0RPA-@`)PI0 0SC P9)UA 8)PPPp/)PJ! 0RA@- 0-RS# 0S0 00t* Ѝ0SX0 0P0S00 040,cP$ $( p x 0@-0P!S@M0SPЍ0Pi 0SfPUo U U U )P7 Po(PL1PEU@P  b  P  P  P  P  P  P P   p0St00@(T @p(0(S0)S0 0L p@-@`P9Pn 0Sk0 "0CSe0 ᴞo p᭞P᧞ᢞPQ`@MTVF@`BVT;`@7V@0`@,P%`@!P`@V@Hee0S p0!Sp(S0)S0Sopa p@-@P2PPE,P*0U%P 0opMpp0 \0!S@p  p(S0)S0S 匪p9 r @-ت0㎪I0]%@-$0$0 00 〪'0]%k@- @ḙ R1P\ * 刪ЍO-`@<MHVPpF0-S0lSA 3S -Sw `9@Pw2 000F @PlpGW 喝Ph TTH`0%SbPPXhpW 3sS0S`3pV`/W0SpFPPW1 000 @P@@Ta9p 9P  vx1d@@P ]9@PPU0Su@9pWpGi0 0  0PV 0S  P1r0*Q0S 0Q\ xy%puX PǩZr k%n&d@p4]%]]O0@-DMĶ0   0@@DPU#%@0 )  #  &0P x, pp Ld DЍ0=kP D''Ȱ-ϋ`]%k-|ԋL|p@-.00S 0| 0x 0p0p p@0   PU P@P0P H0H P p PpJ8'8'@'T']%'L]%4]%]%0]%8]%p@-@40@۵g 0 0@0PU@:E000fA d0 R 00CS0H00S p@@C0PCt'\%'$\%@''<'P/p@-@PTp000@A-@P`pT0   S*0 @A 冚0000   u0000@ \# $# 00C \ /p@-@P P0`@  0!S0 0 0 000@0pO0 0  0 000 00 3  0 000 \# @# 0@-@PM  0  U  0P 000 0@Ѝ0@-@`PT@ Ѝ0000px@PP000/0P/  R /u P/r  000/' 0P00/'A-@pP 0` V  V t@00CS00  0@ 000CS00  0`'4]%A-`@pxT [TP'T TG "T Ŗ x1 p\0DS0 @@7T/T@ 0`00CsQPRA`ET@@0P0  aCQBW0CACQ70C00CP@V `R|凧 ``0 \@RT| 80 @ @ @ @ @ @K'# & @-P`p@P \P 6/*0 cS 0<0 Ѝ0S0P@00 #100#7Q0S0AU@MS0-S@6/P^S   C@^S@0?S0'&0 0L'i0]%p@-0S @0AA00p0@S tPP0 0CC``00pڞ"Pp0`0PPE_EQ0 ަ00p'ь@-P0`V) 00廞  s0 0@00p 0 AdAṦ0@0T0 A$Aᨦ00 Ѝ'&L@- P@pz5 `z0P h@ 0\AAp00 ЍV@@T @ 0AAs'vь@-`0@T/ 0'R"R0PP Ѝ@I PR p+0BP d0000 0 A@AC00 Ѝ,pP'&G-Η`@V@TP L&0@`0pF ,0p@P0''0O-hh,M0X0\8P P1@01%׍Pp PE@ LP Xp(p70PEAU,Ѝ0  000P@`V7 0S 0S\V $`7P00CS00 07 0$ %V0%S@600CS00 q6 0P`ݳ0p*S`p0.S0@*S@pZ\入P³`p8弳p@0xZ0WZ%Zo A0Js R %X0J S00 %S00 ;눅\P  KP \Q \0l\ s00vG t 0 |D\ \LQ  b '\ \\ "\  \M \^0? \^0@-000fnrtvaet 6P0030  C 1 01៤똓`P & d` P  db  Pd  xes0 v0 t 0 0ճp B`0 0@ 0 ót0  庳#l cZv t0 O <"0P 00t W 1|j  1v t  j 0et 0^h0P $0'S"S {YX0S$ L v t   0# p80$0$ Y t 0[#v t   0Lt 0NVBT0 Hޣ '4]%y%č<# # $ &t '  0C- 0`qMP` Pp "@P 0 0p"@PC 0p W ) PuY <YΖP0P( 0ES P  00S00H l^YPH0?S0 -S00H0,Ѝ$ $ &,4`7@-0@0 0 X#TPQ HP3 , Ѝ0@#00 # Pَ$ A-p:&P008P@P3 0S0 =PP  P00 b]`cVtDP 00 `8iVP9P 00 82P( D] 0$00SЍlV P 0 0oVP 00 P !] 0(0 Q 0SP00CSD ]0 0 0S ,% 5PT$ 8Za8g0K00M00P0D0 0C0D080;800,0/(#Q00,,#0,0/@0D 9K<@0(080$00= 0D00<00,0/+$@宕0@-0$ 0d8 Ѝ@-@4#000@-@4000@-@(0(S00 0s0,0Ѝ`t p@-@PPJҍ8Ѝ<΍@̍GPD[`ȍUč\`, 8`V0,0p'@-@4ٷ80,0@-@4Ϸ80,0&"ѽ@-8@" ( R o8 ", 8 <  < D ,-D  , /(0S ]@-@8@0<<@00,0@-$ P N Ѝtn@-PNnt w@-PNot p@-0MP`0@-S00(00P0 0  P P 0( RT  0 0 S40(03/Ѝp#0% A-@`PpQP-U@Q᫔P00  P᜔P0 -U  `0p@- P@@0P ,pT 80$P< D0TP$ <0<Pp8& ,' ' ( p@-$@P0S l!00Pp'Q+  0 BR@- ;! M| 0- BSs^0@Q ^ 40 ? 0 C  / /'',p@-hP@`V Pk!p袒`HV4c!,`![!0' nO-M`pAPU \ B!TP D ;!XP 0 5!PW  /!PU  P pT,0p zR S [ Z YXW0S@0S 0S<ST00?{[ZYXWP4T <@†{ RS [ZY XW :S 0S0S 0SlPT`7pPP X WUP$6TU P  ^R@ 0&T 0~S Tv[TqZ TlY TgX TbWp lT]0SX TTX@0S@ <TS 0S( $TN<S JTO[ TJZ TEY T@X T;W 7R@ 0T 0?S pddT7[T PT2Z@ <T-Y,(T(X T#W}T:SuT0S mT0SeT0S ]T  VT| xOxLT X\XETWH D>TU P,U$3TUPT;S < S@ SU@S@ S 3  T:v`XS&[& Z+Y0X5W:U?P(s0SSUA ,t*<S@T[ TZ TY TX TW TUp lT`jBPUdЍ0k0d$" @T   Q ! 0R녡t0 ! P U ῭P p꺑ڑ F[dˑZbYahgpouv|}ȐɐАѐܐݐ  ('/067>?NMTU\ck1-sr9y$ 5%,5@- 3 :%@-,0, Q 0 0 # '^]Ӓ%s@-@`000 #S@P0S  0J00S 0 JЍp A0S/#Sp@-@,P$p0P 00p '^]@-PRP@ p`ip 0R" Ѝ衕0"S0SO 00SS  00@O&@-TPL0 <p@{0"SeJЍ蓓0'@-TPL0 !p@`0"SJJЍ“0'ғp@-d@P0S 0S 0SS 88U40  S $cPp0'?ոp@-Px@Q dJRP L0   P    pp@ @) 0'0@-@PPM 0SL'D00Ѝ000 0?P0 0 &L'>O-Pp`PPM 0S<;$ , P 0S ߍP/0 S 0S @s?0P P@ P@0ST WpU: 0S  H 09/PV/` 0 0'UTj@-兔0S S S8 4 ЍiS$ Ѝh Δ0/7@-lP$ R\GI;@ H$0S p (?I 3I Ѝ00'ו('(p@-@P 0Sp@嗅0PS 0P0Ⴊ00Sp\@-P<@< <`0S"00A , _f%C-P`PM 0S)00(p/p0 BP" /Q0`@ p0@2P T0p (PH$0@@ 00Ѝ &L'0'tA-@0P L @R<2<1H#4( ,, 0 8 4 #4R! !4S !4S |!4S `!4S Dh!P0S l(L!T0S T pHP8W ,ЍA0S. a`v`啻 0 0 0US !S|  !3 \t0US83  0U#,  f 0tapPꑖ%) 2Öʖіؖߖ BB&.=(G-Qt ,@Q`5P0QH 4QP4(PQ "80S,00 80<0S#<0P:PP: P1 QB"7`8X0apSwp R l <0RTP)0< S4P0S9`(Q (܍Q @P0S0 BS `a 0ph0S  0 S* 0Q*da 8ZGVgz0'-՘e,O-;$M p*bP 0$S F ߍS qP@0T[D@lP 00뉔 40ਛR YS< "$0f0Qjf/ %,2S,!R !PP0,21S 1P P, @oP  0 pp!dT1P8 P, @P0 0008?s0 R* 0S 0p P 0S 0 p1Sv   @:1S  f/ Ḑ01P P%D ('0'RyVEW}}IWEVۙ 5'%A-P@`+Pp %R 0R000005S P vL $0f0Q ,XF(| 0'('UX'p@-0@sP  P$p@xH0@-0S ,0'@-P & X'O-@:PMzM 00@ l`P5 ` |P0P0 v0SP :P`( :@00_0S``(`0P+V0` {(`嬩 Y 9 0 ,07P,0S d ,02P P HHἂ$P,1 PFV 0SZ 0 0,0P2 @r`(l(wP,00 xpP ,00,0`V 0S,00b8_P,00  @8, 1\ , RP0 ,0S  S;ǑB0;\V0`(P (h/匋P (tl僋 P0(`0,0P,0S ++RP0 0 f*g P 0(`0,0|P,0T0 V P 0(`0,0kP,0`0 E P 0(`0,0ZP,0X0 D4 P 0(`0,0IP,0\0 #P P 0 (`0,02P,0d0  P  (`850,0 P,07 l P (`40,0P,07 {, P (`40,0P,07| j؊ P (`l40,0P,07k YNJ P 0(`0,0P,0x0Z Hl嶊 P 0(`0,0P,0|0I 7 `aFy0S0S  [0Y: Y0  0J 0L뼃(0bSTB  C(`H 2[9 坥0S(I # \3  0 R M 0( 03000"0,0 0 0 ,0rP LJ@, 2![{0ȰÕN 0=; 0, 0  (0 bS P  (0,S 嘉D@pݍЍ R $0噈  QP$0 zKn4- .ȚҚتX'M`'Ap'#7EV~ftƛL'x- &"Q&h) s@-`0PU V  P3@P hzЍp`PD!M 00k|0@≥Vx- 6$00S I@-000]%p@-@5S4 0PSP p@-Pp0S 5S 1S B|Pp5S T \Pp< HPp(( PpB0'X'HedArdAȜ7@-1AP(000(;_5 S* 5S( Pʍ0S ƍ0S005S | PlRh0hPJL5S Ѝ0< <mP0WEV0'fdٜmd]%WX'gd@-@P f/㑌@X' 0 L]%$'md0S/!  -3@-P+T P 0S S@@ NP@Ѝ0@ Ѝ/`%@-0@Q-@`  @]%yr@-t@t0MQh  `P0cS CS SS 4usS00ۍ0((l~0@-MM@` PP 00YSP ,SۍЍ0oPѣ 0 ;'%@-@M0 wP ۍ@-@ 0@ '%'@-YMM@p p\YލЍ<0< S <fEP10YS<0<0)rdA.Z@-*0gj zgzz'z'&z'z{zgzzz { Ѝ5q7@-P0@ 0$S0S/ *0S' TQBQC0AQ QE00S 8@0  000! S0 c0As Rxt Ѝ0zg{{' Q { zg{{{ { { @((T/ @-X@X0MQL  DP 0nS00 yS lۍ((|ؤP `00CS`0p S00 P0S X0X /X`%C-` 0pP01@P @kpG埅T@ U @ 0@ zHPPFup 0l Q V |PU PP pX ЍDlZ%G-PMM`p$0@S0#!)p- P ņP YP%0 x p P  `D(8p P  MP  XP08`D( p P  MP 0(0`D, tp P  @xMP D0,0`D0 (p P  cMP 000`D8 p P  NMP }080`D4 p P  D9MP @h040`D< @qpu P  $MP S0<0`D$\p` P  MP >04`D$GpK P  HLP t)04@`D$T1p5 P  LP $04`DP p P  LP 0P0`DT P  PLP 0T0ۍЍ'%h/ +<gzQԥ1Vu"BbçO-M@ M叡p PS `V90S0`S*P`P8aEX```0E8ġ0 0St 00A"S0#1` Xp P& A<6P,s"  ᱃ P0S  3/ PAP+ ࠰Rx%4.A dp P" 4S@4`S=s*4`P82a0C" 20< S :A6"[A.x5|%.A 0p^ P0 x5< A B0qpA A 0Q<0PA@xZ0x5< 0RA| eP 0 000S P0`㬀(V R s S 0 0p)0`PXލ Ѝ<O]%h/ Z/ q@O'%((g - BR0 R p@-P@B R1!: 050 07X0 1X0 l+X0 X% ( D, 80 , 8 4 < $$$$P T 0p 2Q0S*X`?\PQ |Vl۰p@Bzꦪd0 êЪת*@Obk{wXO-pᔀ 2MSR R@`aJ 8QG ,[D 0妃0 ᠃  0@d" y 8 呃,  ዃ `@0 " c  0r !R11` i 0S 0Cs R`!S]0   1 0 020M8QK 幂` D<0P+8DQ* 8 0A0ࡂ @,2<0P+8*Q *ЍO"0 0 020 020t h< X ЍOЍd0 T0 "s5FYkA-@Pp(D<`8SAJy 0`ꆬ0/p/p@-0  R( R((,,004488<<DDPPT@TXPl XRl@PUl @ 0T0p  Q CQCQ}CH'@-@t40Pt08f/ WEV0H @-P \PY Q@pWEVH'80@-0@S K08f/' 0\ P0//@-鮆D0 <440@ R  0Ь%^%˰P7@-@ PTځP0 08P8 0 p0 ; Ѝ00(vd0@?o2P0S@- p`P峁@P 宁P 婁P 夁P@V@l囁PH@T@T } p0 4O;@@ Ѝ}`P>0(ud0@-PM zdP@` ] p D0; 0 400+ +Ѝ00(zd@"3As@-@ = p ;0  0 0`P   0   y0  hr0  Pk0  8dЍp0(td@ivdí6e( p@-@PM`P㍄  p  ( V V d7PЍp (pH( p ,: 0"0(}d(@~d(0@-PM @ opP 8{:4P 0 p0 v:Ѝ0Ů0({dЀA-`0@Pp!倁(M00l!Rp0SP@LAH { p  ,N:eP qP p` $0Q 00S*@P ,:QV W = V 0Ys R|0|0  0S(Ѝ00* *D  `@x-%0(|d7Dr>Qb@-P$M 4@P  p p90P i Y70P 0PQ0P  p@觙p@ 0x @d p@>U@@吙Pptcidyararbmngnts 0D S/ 3C5C$1 4! 8<0/8(0@-0A„QU0%Q ? /@.0@1 ^ L043c 0P0Q ? /@.3P0@1@ 2@D4P5H@8( 213/P/`(A-PT0p(,`|@|,0T@@DA?@?@@8(?0@-0@0 (20,20${0P!P308(> 0R//G-`0(,Bp  P{ E|@PP W ,20CS(20CS G 08(p@-@`42SM%^  E 82<"@  0(2," Ѝp@  単<"82E@d `倘,"(20@ X"\4Ѝp@ 8(^%&Ov-s@-P`  .0SЍp00S@0"S1Ds@-$Mڀ@z00  0 0 %A-`P 0p @Tʬ5 /, s0d  ? vqp  RЍA]L`Z0S`@D@, Ѝ^%Pf8(A-0ppP@`ph!14P S H d" R S R 0 esU8(p@-4@P0S( /0B1p8(O-PTM0$ (00#,0x0@00030匠s4<000S8 (2,3`E(0,8 0y80$08 ?y$0 0y$0  00 y$4܂d"WP  5$040 "f ` RL` $R0 S l200#1-R0" 0L L`P@,Tq00P00S qP  qP  qP$ -0L00 S> y0g2< pDnE%KUL1D?C$\"000)S Z0)S 0#R00S  00 0[0X   0SE1!^P|8/8(E`1 n4N]^%zҽ"8$ (HUjݾ лA-l4RUP@P@mЍp(0PPPB1P@$a$aTS  ЍA~ 1y1 0pq 1l1!1<0 c 1^1 ?0X1!1<0d O 1PJ 1@?0ЍAB8(47*:IZnƿؿO--<A0 *IP o8800  :0 R00S% <10\A400C0L!LC )t0S0St0S0S C 0S C }CxCs $QPj4#pj h PSe  P吾.((WB|EnU[ _%jE0//(0//(0//(-@-   A%G-P`p6t@0S  0S X| U TY0S G0Ss@  /(4s-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  @-@M Mq` @PxPݍ Ѝ\!rWp@P=0D@rOP0: S0RP00 0APP P81: S P% S  R  rRPPl"PPPU rPP$0@P/( /((B` @-30P  0 00l$Ѝ  c}3(0@-4S 3/ d/(@-=s0 @( 0$r1s@8 /(@-+s@Urr!s@@-p PL`@@0 7/P0 S Ѝ {U00<4(O- MM0p6@  @  @ 0p$000 (0"P;  @ ܍Ѝ 03/0P0.   ZP @$0PS C(0S W0SU S U hh000,0;p` $0 pU Pl40@0Y0C @4 `V*` 0  0 0!0`4  ` `  Y!  00 0 ,0ymP,0 0S `zmPp pW t`Vxp@P ZD Wp` Y0K0S5 #z @ 0 %00Q00R00S  000 x' 0 S   Z0% 000 0@@0 00R0C0q V B G SE SB `V` 0S 0S^-+)!@U 000 awD[#G-0@  0P Q< 0 PP  ^ 0`P t pЍ Q*P !URQ 0 l _n0 pH00W0p tP  0Q0  1!0 1!$0 0 0( 1 0, X0`PT  P8 0SD00D0Dpp $0"X0(0R+* 0H0p,0#804 3 00 0pe00 QP    0P KP tyKpP1S1S1US1S 3S3S3US3S, n pP0p* p2 02 121300p0d00 QP \ ][8  n 0Pp00S1<01@040  0d40  QP  n 0PA0O A0  *KP 4 0R  eYX`V P0EFi 06#++R`DX4 $0S,0,  RT0C)iD0"P#10P 0 # 0QL \0  0P 0PdPd@hX+Ea#RRaArrAaU7[~@-p@k`P P00 P0c 00QP  Ѝ 0P< !@ !0 P0c 00QP 4 0PfhX@-@L0 \:0\l00l0Ѝ |p00p0l0 \ \ P0 S |H |<00L 8  % $P00P~&*JG-X` p@P Ѝ0PZ%V0 0lcVU D X0 3X0 PO-@,M0p@l@$0`P PpP$P @,Ѝ *l 0 RLŸV^S PP8 PU @4p2 P ^ ^^^@ \ \\\P   @P@CL0p!S sP0S} yp0p P p _ X L2Q0 2 q "" @ "  @*"*  P0@ S 2"!"0  0@R?(0P s s// /Z^&*O-`@PpMP0S Ѝ X  H r0A D00 s/ r qh \DP0p@P x q0 ` .P 0 00 %P 0 00 ` P s0 `P pP0 0 P`8P e#9VjR0/0@- PBU02S0P^0A-p`|P@P  PP P0S"R0R04O- p`0P\PPX $P  qQ 0 @T 0Q\(2 R@0 PS C 0BXT" R t0D s   0 TX  R 0 0 p p8P YP  L BPTR2 Q PEO4O-X`0pM@ePPX Ѝ j0Yl0L (2 R0 r00 PܑP" 0 STR rH 0/UPx j p 0L˜ Z,$ z ,(\  l  ,΂l0\ll 0\ll P 00Ql"! CClX0 哊("0 ` QP 0# 8P<G-@`PpP0S00S <q.p@q8WO$0S  0S 0S,0( 0  P0S<P  SPpl Q *P l0p<0P0Q*l0S 2Sp  lXP0P  RQ@0 P 0P#{@-?`XPP@@\@#T@TpW @@T`Lh5(O-`@@M18 00TP0S<0T D0S Ѝ1@ 00 `P0DS%0 ᕈ0 0_QP P0 Y:0 0 0_QP PL= 0 QP<0T 0Bh4(O-M@L0Sp<`@DH S  mP PJ_o VR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T:s?h4( A-@/pp0%B?[`0S )c0ES PC shp@@0T?  C0h4(0 PKn %/h4(O-` 1cMV, 01 SP0 S@0P`00D@H0(0$0@@4D0' R$ X0p1#r3<0#400< 0,40^<04 QP cߍ0P@@`00D`H0(0$00 Cp`02#  ,PW002800qL0pGL08 SD00S   80< 2800,040^<04 QP (100  RR R0(10@H0L0 p0L0B =T LzP1  (10(11  K  , @ 0B0 H0P 0H S1@0S  [I@(1 0A@  0I0@;+ [f DP(10(1 0SY 0@ B /oD000"s R"0P `, (0%g0000$0D0SD0! 0CD0 0D 㓢#X0X 0 PP :X R: U$0`(00`P1Sq h U8 `k0D\Q U`V$  (   P`( P\0K/f0 x!Q0pq P b QQ0S*0hQh  0 U `$P(Ps000 ,P#`@P  Q .b A0 b @ @ bρ LG?@@0Cs PQ*V L 1r|1 8 <|10V1 , uR000000U\`0& V0 0$  \T P0000T 0(00P0 00 ,@pV 0$ S1S IxQ1PP|!xR \XP1P PPL0sPP|! B0I|1@|QUP0U* 0" 00 0x 1S \P@ 0I 0000@1hjbPP 1|!R XDPP 1b |10|1#40L0s_?00010I@P30 s0Qs 00RI U$0`(00`PA1 S}Rh-bP0S 0S \pdIR P0S 02S 0S0S} 0\2SV\Q|!)xQP PP00@ s > |1P 4<qP PPPPPPL0Is0PP@1>@<haP0PU+ `|1VS HP@ |a``L0Is``@ !RP P/PP0 1A@`PPTG K/\iePP05nP 9 5P0h00h04U U0@IP0U* 0RPd01S\0!8P %4QP0%8%\0 P0PEd0U03:\8s0P P|!d1 [b" :0 0|12P0P0(00`P.P$18 ,q80PI!2S0P0 S0 ( U$00 `$0W00$000 ,@ D00S< 0,40[<04 QP80,R$0 2PI h4(-9 h5(@]R/u\ 1G- p@r W pP\aPP Pp $ PK/dD08QP0Q:" 0PS00  Q pxPh`P 80"8 R 00 05 !$uh4(Ko h;p@-@5%SQ%5 %SPQ %UUmkQQp  0 0Q0 Q 0h4(A-lP`5p@ @ 0% Ņ~@ŕ\h4(O-POMpP) b5S5@ ET# |T 5d 50 ! S!$5"R$%P0S88 _P @TEOߍdP  RR @`0d B2" 0CZ JQP d d0P Eh0K/0h0 !c0 @!y,q(r0d  01Zc  j c  c,10,1#40L0sK?000/1001001#40>000310 00 000L0 CY(%,5QP Hd d0Plh4(9(v@-@ P o0 5h4(0/9(0/9(0/9(-@-   岮%G-P`pc@0S X 0S X|O U \TDY0S 0Sc@ 49(4s-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  @-@M Mq` @uPxPݍ Ѝ\!r p@P=0D@rO]P0: S0RP00 0 PP AP81: S P% S  R  r PPlPPPU rPP$0@P9( 9((B` @-P#0P  0 00 $Ѝ  }=(0@-4S 3/ 9(@-b0 @(h 0$zbb@?9 9(@-b@LEmbjbb@O-`M$MpP`P"NX1 b: S/`0P  rR b00pPP W UP 0C P"VR V  V]PN P P W\1` 0s`PIX1: S<V2"92rPpU}PV9 PW002`` 0!$l $PPt dP5Jb0S3]`P S R SpP`-pP ``!\1 S R U|6Pk`x%|!0#PaY $Pp"pU`( FPP bXND% ܍$ЍJF F F@0/p/p@-P@B $( $(0XRX0X00\00`0ddhhllppttpp@-@ P BBBDDB@@{BHHuBLLPPTTXX\~`\`0p Qp` d`P0@ S p@-0@"!Rc0p@-@PCB@B=B:BpA-0@PJ04S->C+B->C?XB9>:>CB?n:>CFB 0? AC>B}C>GBmFAEnFAE~GAX J.X V  $$((,S>,A}S>GAmFAHHLLPPTTXX\\O-@  $$((,0,0 P0PQȡ\5 S L5sT 0K TT`XX\\``ddh~hplzlpwptttxqxVA1[ h`ebp0 p$Q*\5 S `0S&P%@ PSزK 0CA0Q R,E2.0) TU 0/0+P0sC@p/p@-0@R M4 @8 P(p@-@PD @ y;P ,00S 60 0pp@( 00S/?>(00S/p/>(O-M 봰 (2 2@0p00 2P0  ` `X00#03W0SH100 00 0CW<:0SX%|10SI p10SET@Z000@S0@0   b@ ``0@S.T0  0'W (,0P000R0S 00SЍT /T 00C0CV@Td00S X00S0S@ FP$0  @(>(>(@(0?(@(|>(|2O-0@4p 0 X0P;Q8"R000U00S.  @`P'0SP Ѝ5 p $X001P``` 0 00,000(00S/(0, ( ,R00Z P000 `0` R0( ,0 0Q  0R000V00S  P0P`(0`F0S, (00/PS0P, Xb5 P PpX00 0>(@(<>(G-@PDbW@ppT@@@@   0@S(t@p  lx` X i5pD aCT 0 0 0$ 0p @(@(>(A-P` p@H5p0S B50S !SRp75p0S 150S!SRP@P@A-P`p@ `$P`P00@AO-HMQ M %80< @0|2 0B_ `P?V VP( ,P8r 04P`P (0, 0S/(0, ۍ Ѝ10S%  qV 03?00?s0S0?0P 0 0" R?"R0`00m88Q"  P`k B0 00@?003/*  0 0 00 ?0k00@ 0sB 0|` *kBh050S G&0 0"P@(>(@(@(>(@(>(>(@-P@p`AMM(h% 0 P@ W4U0:t0 R0*d F%@f1P F40  P,, 4%AލЍ;>(i)*7@-0 Ѝ0@-\M`Pp~X @ Z0H0T0 `'!D0DP RpRLtP \Ѝ8@(O-P"M0 M:x6 PP#P3XP3X0P#Up` "ݍ ЍA(@X Z0p06,08"9<Q08u@5ppL0p 0SXsL 1Z0 0S &Z r000 Sr:0 02P0 @S$00; ` 9: \08%@5  L0 0S^ \@P#H20SN <0r0 0 0 0(@00$? 'n60 P 0 (?U 01S0 A 00(!( (h h(| S  z@ 0 }/P000 R0T 1A| PyvPs8 1 t0 1( @( d Pah;@9h>(@(@(>(_%rx>(>(O-M`@ ) P0G: 0 0@40P$? 0 52ܒ2Q{ p q Br -s)Q0< ,42匢# 0JR hLpQ 04  0R  @PЍ( 0?1 r0 4 Y: |10S<000D0`1 `0 0?1 010S 10S 0H` `$1100}10S pt1pp1000 ppQ>(>(_%@(@(H_%@(O-P`FM M X *X@j: 0 \5 RXXTa"0pSg 450S00  000S Fލ Ѝp00 1000D0w븤 H0T00X0404QpQ\t`  3H"0S* L0 00 0 HP! #0000S Bp0  0 0.P 3 (.P0!0K 0 . @pp  0 0S   P0 !-P Рᰒ L000X0 H w p 0`0X0x2  0Gt0  m000Bf00S$ 2jp0 0G 0Gh [ Y0# 00C 4 S 0040_pPY!ox1p 0p< 0<0  k.000C0 0 S (@(0>(_%$GA(>(0Đ;>(\]C-@PF`pXpaY x10S l10S 00 0Y P4 ЍC"`@DT< 1 RP0H 0  P P= H'0S"00S T  0S n0S Gpp ЍC_X,P H0 ЍT>(x>(>(0>(_%)*>(0/p@-LP@08100@ 00 .0@0 Vp>(00S/p/>( 00S/>( 00S/G8>(P000R0SO-p42@ RPMhD R0R0aď080S  C/ S ! R 0C00 0@ἰ? 0P\5p!`S 0 000 ?@U (  R8 R  0^\0 P3 `0/0/0 0 HЍ  [ T R  P060 0<00//>(>(|>( T5MmP0O-@`:1 R0* 0H됑吱0 pSxP P* 0 T C:\500 :P/<# P 1R 0 0/."<0 P 0:`0 C c00P0S   0 -0xP 0: T0  0:400,00S Ѝ>(8>(>(T$A(@(O-0#M PQ P* HPX 0k:0 `\5 00  h:@/<#| @2R 0 0/."<0p @x 0J:`0 C c00d0@Lr CC cA30B$ 0Q,040(0PßP0 8+10S 1 PBU809 ̱P XEʼ0 83,80<01t!0<S0<0<0Ѝ U: p P\E6EE6`f6U  ~6 R T` R< ܰ(/? 0XTFV p P Q RF 0Y:P`0 FR Q8>(>(T@(@(@(@(?(@(G-1P 0p` 9   00@ 0S 0 0 80PS `P` 8UH0ZP000PS　O`4=PQ$,$ (,`(PP8>(8>(@(@-@8P Q0808>(G-Pܡ0S1p00 B?YN PAP` 0@`8޿@Pp1 ?$9X10A0I00 00 0 V0 (pp1 p#",`(p ( W Vp`0PQ&d0SAP 1@0  XPP00Ϡ^P0d000 A@(>( A(A(A(A(A(:P0p@- P?@8800P 0 !SRp A(A(Yp@-X`0SpL0LP0@1CA0S000pA(A(A( 00 /$A(O-H0MSP` M 003/ ލ Ѝ40 pPࣟ00 ]+0H00@0 t0 ¿ S 0V  0U80X0t3!0S$ d30S0S l0 +"0  1!4!Z0 02* 2R20t0S=W=000 Qo ! ZP"$0$3+P,"0 " Rz{! {  0! t R1*01 Q5 1000S1H  B/oQ" RK d!B0\  ]+BHS@(P:!P R, P j 10S0Q 10S 03/     0P  0p`V X >(@(@(@(`ap>(>(0O-S0RMM 00@#4PU( , : SRލЍtt \`(5R<R DP  RSU 0 0 ,Qv0 PB? 7̓ @`@ 00S 03 00 X[8ő @5D0LT 0 a31 Q>P(?(>(>(@@-@f80\P< S0 80<  D Pp@-@@PU DL P BP$0 Q0: pp>(@0@-P@80\U< S0 80< 00p@-P@ 0U0p81 R0p8@0P0S 0Sp͵P0Sp00S t0S 0T0S(p@,>(,?(@(;x>(4@-p@`MkWP 1  P  p`V' Ih 00S0H0S 0 0 $,00Stt, O(00Ѝ@L&P0S 00`Ѝ)*x>(>(@(8?(8@(>(0@-@PM \" (Q Q0 $Z0ASЍ000"1O-T5,Mp0@P @Ps(0S @P,Ѝ` T0): SR 䔟0Ḱ0 4$刡  !  Q01:` V `3 V `! 呼P d^7(0`S @P0!+60 0S:R 0姽30  `(`\Ő 0\"  ? 嘣 ? K'0| #O h3R0Z SZ T3 R #R 8,3 R ' 3  R0\ 0㵯 Y40 20 00C 04$0S4L3 2$ 唂 B *52(`20S 0 0 0: S S-  S5000000sS 1 00108r'1 1p Z7 *P 0080X0 ␷?0T @ 0`; 0 + 000A00S 0C600)P( d ^ 0ˏT0 C c;  뫴 hA(>(>(?(HTXA(@(>(U r>(>(@(>(@(O-2@ 0lMp`30P#\P  ? 嘒 ? @&0 Np"p2 0R S X0 S 3 S <@X M$20p`M2 RpR\tR`Xd   X 1 R, M&00X0S  0 0 %Z*L!00ST06 0 S0\ 0㵯 30 20 00 04$04L3 2$ @  *r40'h00S MP8 PH& PlЍSr  m>(A(TXA(@(>(U Đ@(8?(8@(>(>(>(O-`x2p2PU@ 00U000  ZPp0 Ѝ0c ?˿R0 0g4GC WV@Q TVg0U A0 %00100 @ H @T`T0p0T S @`A 0S@   T 0`9 0 U2 0 Q%P 0 {G0 qG`0@S 0 000T000 /%[P000xt>(@(O-P(4Mp DWkW0 ca P0 c0 C003 X 4(-P  4ЍhD+a p00p0S ?A 400 0? 043@030000,T  &C @ @XT00T S @v0S @ & T 0 l 0p0`00WCb 1 Pe (pP 20020SU 뉑  400 0? 0̱ 0 F0 FY@"H  10J(Pk 00 400 0? 0 10S4 A0 0000 p0 @0S$0Ye0000o W ($p y0 sq00000 $pchA@(>(@-L /%s@-@P `⾵0S 0S 0 ЍpO-tEM` MP/0S 0S D*p P 0Sލ Ѝj000S  kP fd40S 0S P0S KT0SN/ 0StHA 0S`B0SL<0S 0S,3H 0 d sS80!"70  0 " " 0D@?!? 00? 0E 0Ed!! 0E0 dpPu0SQ "04 0 R0  0"=  0,0S)(04,0AŸ80/R%78 <0PP0R [0" t:0S d5PUs @0S @+@PUn $#0SP@PPDPTH0S  `嚳Cn* ls1xl$|0S lPl0p00S0P0$ 0,0UA:000S 0S Hs @1 H0S 0S$h0S c P  P   000(P 0SI P PP Px>(,Jm/QF(BWb O-H0PSp`M W0R0: P p`$"< "0 S 10SQ 6bЍ@ 0ȱȡ 0 000CSY?00 1> R. Pt!P!0  S D  oP   . 80< 0 @80< `㴵P0P 0 #0 S00@ ` R Q\Q\DA(Tx>(n@(>(G>(>(z>(00S/p/>(00S/0/>( 00S/P+>(O-M,M@("[:[$0: S`@[ ` pp&P" \&P 0 00 0؍,Ѝ0 ({&P  Xu&P h0S !  JP \0S, I : : z  [ 054%00! ?0S S :00/0S 0 S :V00#03*  R00S :0S6  0 B19* 0S R P0@4`PƟ Z9U)Q900w0 B?.pQP @90S  0@ !8 0 0P080S, HM[  Z8Ppx U0 00(p UtxPP0X Z~P h(0000pPbP7@Pq"H$0 S7Q770S3  V0;R0.*h0S+ 7('d0 ( #0 =P |870S !`` g @ (.60S 0h0!60(%R/V+:<V3#\Q RqP   kPpQ^q U  #p# PE"`:U Pp[h RXPp%Q_'qP tPE! p 10S0A` 0 - Z? 0S 1000S X50S 0S 0:  pt ?B$ 0S 1000S 40S 0S   10S0ꊡ  0000 04 $0 S0 0  00 0!jp$000$0 #600S40S 04 PP @ p td3 0R00 0pRLtRPXd00H00XSS/ 0S D30S= \P !2P p2 @0 \00&&`2 0@S0:000S08P40d/<0Q5#fP8`

hd=\ `P 0H0Z0`0AQBPp`1PU 0\I85 @5D0LT 0 b32 RPlh@(?(@(`@(@(8?(8@(>(A(>(|>(x>(>(b>(z@(@(@(?(iC>(@(@(?("UO-@5pş|M,0S%40A `HDLT T0AX  E5 $00Pxd p 0@, R< T5@|Ѝ0/1b&\% R  P  0`P_Q0`  0oS /  !.0`?00 1> (@ P00~4ğ %1#\ Q  0  D ?0 E#3 0R< S< `3ē0S0x0@S 1d0,  A 0 ll`d30S9 X30S5 L0 S 3 S?X ਁႎ0 % s\@T`S  H0 S\000 T @T`VT0? @`1 0p20兑A0Y 1XS  0< 80P0 $ D000Y 0;* 0 0VT0Q@`@ T ^@@`R0@3T5P`1:@P`$ 0@0A 00  P ~00VT 1PS GP   0R`* A jDA(>(T@(`a>(>(@(XA(@(>(@(@({%x>(>(U ?(A(O-` @ 0Mp̰̐ 0 0  BRЍ 4PPU  RQ l @ p R RP Q @pA(>(G0/O-dMX D0PpP0D1D 0@1@ <1 0,0SdЍ0S @d0,`?0 `U00@԰ 0D RpT0!:o`P 0A 0RpS RTtS X0S @Pdw>(>(@(A(#%>(@( 0000@/00S/p/>(00S/0/>( 00S/%>(O-0:M`PV`@@ M:0S 0P )S *`0080< 0/[ y ?P X P )i| Pt9`0S 0S @)V0 P00 9 #R0踟p00S0100,0C/(0 00< ?00000800$q 0P @pgz b 0#d 0 @0C0T B000S0z \?P0tJ0 S$ 0S '0|0\Pp7~`| 300S0100,(0.('0 00'?0p0pp00ppP*0S  'Pa 0 0)`YPU @p ` yp) )80< 0 80< 0@0C0Ɵ =0 00 0Q.*0S  P  0" RWލ Ѝ0S 80< 080d5 0< S PZ0 00$000 U)_ P 0S 80< 0804 0< S Z`0 00$`S  Br p 1)y ᴠ+)P@180< 0 80< 00C080P<.\SP$ .P #PPfP3P`080<9X3 Q0 *300NP. 0 0rZ P0SHp0AS0 S3 00v20S40000P t2 B#R0؀2 00 #R0tQ& p20Sd20SX 0 @P    P000 /0 0 #R0 R  0x{R>h!hz D10 S& PY#R0 š!ȡ0S  0R ؀P 1 000p0P``0P00C0ZCP<f @(@(>(@( >(>( LZ%k2z|>(Yhx9 %x>(>(O-WM M'0ASz0 t pKP `7 0L H>P 07 00@  6)P 60S 60vV6 /X @0`06`00夦1࠶00V0:6 R0S2@`aVnPVt=Wލ Ѝ4 P P   eC 0S 7 @ F  LS0 00@(0S Sxp%?<DH(P* 4 2  B. !  ]Y5( 0S W 00]/E 0S X(0Ax<0HS(G 4(^Y,p?p$h4 R@ )xX( I1H 0,  R1 #( Q! R000000X!"!"'Xdx"hp40]/ , R1 #(Q R {{ x@ 0D00Y *( R ,~?2"X(,` Q@D aV!X"XdxhQ@D a`V { {@0 (0S $ Q P00r|0SU! $`|\ ld10![00C0DP0 200000C0!" p"0S@0 0 0C0 00@z9 2>(L01z@(A(A(ztz@(x>(@(c |%@(>(e @(>(|>(00S/0/>(O-̢̒0`1CMa@Tߍ0S Pdp@FDAG@D0 ddp00@00C0 00 R2PU 20S 200S0R0S P0:000RP p 1Q R>P@h1 R 00"P <1q00C$ P X P<>0P00 0`0L00 pRpfRTtaX`[`00!Pa l0 0N 0000A(A(@()%x>(>(>(@(0>(KF@(rGO-쳟p3张P M`@?8 \P  ? 儣 ? A0 >\#\3 0RT ST D0 S 3 S (@ 00000CSFTYr P 80R000303L32   ?b8` a2! Q,S Q0lB*$\2<20S P  P 1 PЍS   dPh?00 1>!  R1Z 10SI0T!  0 S<1`0 ? 800 20!谟00S0H0S 0 04040c/0 $ 80QT $0 0$0404 L3 2   ^[0{ {<0 姫PpA>(A(TXA(@(>(U >(>(@(>(>(00S/0/>(O-plMX <x2xx00,0SlЍ0S @d0,P80 $$P5000P㸀@1 0 0D RpT04:I`1 ARpR\tR`Xd00X0\0@SH0 `V r%P $10S  09@P5P 00S  0 0S  Q\ {{00 }0R  000 T  L 0<4Đ>(@(%?(@(9 |>(>(7CKO-MԏM@PI0!n0 <0t0?0SX0S $5St0SVhPWX0S $Yk S Y R,d$?pW\ 0P%T਀X僀 H\;00!` 1B`01$dQd0ڠP0C00h01`l0R!B1d0d.0CW P0=SLq QT00H ($0S 0 |$5> *"d>X>0S  0 0ꬭS0 $5B111`R B- 100 S L $~0S% , 0帐- 00$%BR0ө`S<B11@%L0 !PP  F PP 0S  <PԌ *堐b"<<0S =0 02d0pA?P0;3A?`0 =<0T0.L0; ;0WHQ RX0>F@ @0 ;8 84<ϠQ bh{ S X(,0 Sa?^ @PC l;0S @ A>+@B@  C P;"  @0尠 \ 0 000 :J*!::0S 20 0؍ߍ0<00

! "$5S8;5(0W8,(2W42,2<0002SV0@ x S0!!~ 4x0990 $ST0< T09$2!S\0P &9V=SL5s35 `!~ ?X00S-["!>R\ /  X B  R\ ?0  020C02`H0T SD0\ 0 3!΍0h0H0DlE ,#0AS0 000 0"0C 00S\0X00!!!`V0: 0phppPp P`lXX ুX姁0 8PPK,2!~00<0S. dr40! ST0T00! !0P SX00ԀYd4p40 0 4K4000$5S `0|63! 03080H ` H D /D VQ 42!.0$00` S`0?00S00\04 b>(A( ?(x>(o@(?(U i@(@(@(%T@(F?(?(@(A(f A(8 @(9 |>( >(>(>(>(@(0>(>(XA(Hh$5S|2! `0h ppWS $%S0! !42 D0D ,x  x |0  ("|H Hp L3t !n r! T0iP3 L!T0 R H  2 00000 D0lFP1  q1*110S 0 020S QL (P 0< ST0T STTP hFLPt2 L 0< ST0T STT~c0" 020S}0 S\0P S\P BFP 0P S\0 S\0VT;0`# 02 ppS $S00S0`" S\0?0 0 S 0\00001D0p` 0Rp/d0W S`0?00 S`0?0001D0pR8 0 S 0\000S8D0;!H H Xp㵟Y8 0 S0\000S8D0 ;!H H XG-P`@T(,npi W @"A-A0 5 P0#R%(r`! 10" q0SR 1G0a0  a*t1h10S z0 00SP03Q0S4 N@ 5*< 5z000S U0 0{@xTPUAt0Up Pd0 0S L P<0 0S >(x>(h_%&>(>(>(>>(\0/A(0/A(0/A(-@-   J%G-P`p?7@0S 孿 0S X|夿 U ᱦT噿Y0S P0S6@ 剿A(4s-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  @-@M Mq` @ʻPxPݍ Ѝ\!r`p@P=0D@rOⲻP0: S0RP00 0JPP ▻P81: S P% S  R  r[PPlPPPU rPP$0@PA( A((B` @-0P  0 00u$Ѝ  l}E(0@-4S 3/ mA(@-F60 @(㽹 0$5:6@9 A(@-46@55*6@0/P/00@-0@S 咾@ x>(41Q0@?o2P  R7 P0 P0S 0 0SS00 0000/ PP  P R ` -X XQ PPP0  000  /TTT8  ?(>(@(@(@(T 8t0t 0 0 \5` S\0 X SP0\5L00S/\5, S 0 $ S/0\5/@(?(T8 T 8?(p@-@P0000 0 0022=p 000=000X0X0<0<0@0@0\0\0TH3H3L3u/L3P3P3T3T3H Dh p@p@-@P0000 0 0022=p 000=000X0X0<0<000@0@0\0\0H3H3L3u/L3P3P3T3T3  EEP  4K44K44h 4 5- 5d0Bd00000P5P5H5H5=CS>S>h p@`0 \\L5SXPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//@(O-t4MP U `D``t``@qvH:4D40ŏ 0 P\dp LЍ ?-0 P~ P\IP0S 30S|30S p4h3h#0S` \#ST P H0S <80bS s*0S @"\5S 2 2\5" 0C?o"20Rh [ŚT24 ᕁ(Ud $2 ?-:010S?, A!(Ÿ0#\ P  0B ? 0Sg0S 0Qh 0S |!\5St1\5P l10S(` XA( L!0 0@! 0 * 0S _0 0 00 QJ0Ph PE @X* 0R A?(9 @(>(@(@(x>($?( ?(>(M>(8 @(T@(dA( A(|>(~>(?(?(@(. O-8MM 0|*08Pp<PE3Т 巻80S ׶:P23形 h0: S PLcPލЍ08H0(hSO 0)00S 儻00 7 7 8   ` 8 8 [V``Z`P`H7V@ .P 6Q mP 庚dL8P0 0186 R>0 0p 0<&0&0P\7p0p 60pw>0 P0p$2S# *-P *-P *.nVXZ hY 4[ 0SW?관X V. 0\1  , <0\:P$ V( Q3C ?+xPPe 2S|3%8 S20#"20$#20PA 2S@4$040404劺`02P$V20A\2@02 ,2C`'- `Fb, 0| j+H  ?`0PTT#0`P\`Q=S/0P 5` ( 2RV0 S4S c 5*< 53 30S d0 0`20S 0 P3 0 S` V 10S0d"S`` 0Hz2= C ,0"00 00t 2oAp'06# @r00S10S10S0=S0S pCq000? ` 0L%000P%X30,/a *& l10S W0 0@(?(?(mz$?(A(+;>(0>( A(TyM@(@(yW)PwT7Ur$T|>(x6W =?(x>(Gp  ?(@(|a.]@(@(@(?(>(>(>(A(>(D@(>(@(?(A(>( A(A(A(A(A(>(@(@(=S$0S)  0`<<00P%X30*t0 00S O0 00S5 0 >0S sP@a 5*N> 0:#: 5Kd1o p10S &0 000S$OP0a0*+1O 10S 0 00<cQ/dxP 0Tb<0* d2/ p20S `0 0r0S0L%r0L%r0H00q" P 000cH00STDPc*,3830S .0T# 0 00L40q"  400cL00SPc*330S 0# 0 0t4 R.0E q\ `PVR d0SPl4d*~440S Y0$ 0 0$d0Q,%R0%45 S R! p0040SPHu*NX5rd50S )0% 0 00u(0S xQ$ W0S< x 0(%0Sv4Pu*! 6E60S v04& 0 08%<5HSR$ ) H00850<SN^Pv*660S H0& 0 0v@%D5LSR$  L00@50DS%/Ppw*770S 0' 0 0 7 70Sx(w0S0Sp0L5sl0Sd `d(000 80L50P5?T5V> X5-0$0B0^ Ӏ1`@R$@@B!!@H0 000L 00*l880S G0) 0 0d PWt P1RQڨ0QUڜ l 0 0S Pi*99]90S 0) 0 00S0 3 E0S0QQ'` :0 0S| rPdj*t:+:0S \0* 0 0 `E0S ZE0S  TE0S-(Q\KQK H R0P;0T  E~0 ppV aF!` . R  ` ,E0S72 &E0Sb]<Q| E0S E0S E0SH  8%L < @%DL<0,5S0SO p t,l000h<0,5<0(5H000/85L0<%0/@5D%4*q<<0S L0, 0 0=0S (=0S(4M*SD=wP=0S .0dmh B,= P: P5= 0S= @_PL Z p +@TW.  @?00@1>0A@O@@=P.P\7  +,@K|>P* ^ P;0.00 0 S 1 >5> > *>`$VP?``X ? 00@DT@8 H4L0d Lc B b"30x@`P Y( 0S  i8 H4L0d @ B b"30760S  Nt6p00_`\PP6圲@ ᥜ46P( O0& 500060S 1S 'P 5 5 @bQ 7U @ 0}pP @@  04 8 +\5P @50S D@@P 0 0  pp*0  0 0 4 8 P  &0S_aP`0 4?s0 S x0ScpPPd0 4?s0S 4D0Sf?Pg 04?s0W:PP/PQ ȓ0Sd$Pe000 4000 Py ds|0ScT Pd0 0 0iD C0S 00 0 0 00  B0S 0 0 000  0B0S 0  0 000 w0  0@B0S ppw0p#40  a0  0pqB0S 0@00N0  0 \1 T1Q1Q,+ 0S xpA 5<00.X!00P!0L!0#00#p RV !0Bs00P 垳P0SM0@GPT0 `SV0>(>(lz>(A(>(?(?(@(0A(@(LBAL x>(<qU|>(@(%@(A(>(@(Fr00S q: S *C   S D00S @-4E * R  S//>(|>(x1p@-0`S d`%@ T D10S810S( 1p10ST00S  p@*00CS0pP U 00CS0 PPYU NU 㧲YU0 P0  0 0 Sx>(z$?(@(>(%?(`%%p@-PD0@0`S  09PpCx>(zO-01 (1$100 AP 1 3P 0P  PPPpp(  @ PT`00 XT bV ^p WP @@ 00p(A($A(>(XA(0A(A(O-@1$M`Hp /2#$`D  呓P 0 <w  ((=P U  0 PP$Ѝ? 00  ?  i P 0l 0 0?QR0 0#Ϡ?#0  80P @(@(AO-M0P8 0`ĐpP/2#V ![ 0 Ѝ 0|xϱ@[ ЍO膱 ?  P  ? 帱0@p@(>(ԴOC-P`U@ (1 U P0 PP0 0T2`p܀*0 L@D0T@S   8 H4Lđ0Ϭd @ B t b"31 ~0S   0P00`0@T Ѝ@({>(>(>(@( 0S/A-@p dQ A0\ a2Pa00 SR P00@00 0` PЍ>(H(@(@(@-0P@T@TNd pL `l0p `̠V W @ 0 0 0P0@0@00 ЍA(>(p@-`P@XMX  )' `P @+XЍp 0@-Q0 H0@S $\00S P?008M0P00: x>( p@-<`(A(>( 0 /@(\@-^* 0<80@400 0o 1Q>(?(>(p_%O-\M@pSR D00 00S` P [00CS P\ЍO`T `&0XYH`o0`0D0002 000D0@ p  00@pDP  `!0F  / `@0V @:@ p?0`F00@D@0+ B\ЍOk H($GF\%2R/C-=@SM{QPF PV㈒P V.K 10S >10S/ L5as0倀Sp X&0S     X0?00S  ?&0S  ?># $ $0 \# 0$$ 48$( <@$ DL H$C0 5L5s0P500ߍT|>(=@(>(0 \P/Q/ 0   Lq,PŒPŃ , TPD40S/8$0G-0DP(4 40S1 40S- T0SC 3`3 30SA=S> qS*{ 3`30S U0P 0T`dSTSPsPUU00Q A P 0S ??@“P`"hR0"00S8 lr003Pb0S* xG0S* 0R0E>0*X4  2p610S g0 00Sh=\P10S \= 1TQ `1* X1` H10S :0 0H10S <:= (1P 0* 0`00S 0t 000S d0P` 0=L 0vGs@(>(@(@(>(@(?(x>(w>(@(@(>(>(0A(XA(A((A($A(D?(@(?(|>(H( O-PPMLp8 R8B@0S 0(3 ?P00@TaVa` 0 SQɑY\ 22 \P 0 `2 0T ? w0 P$,",2 0Ri Si r0S 3S /0'? 00S  00S`0 S  0`Up!Ϡ0008 L3R 25  B # R#  B ` 0Q" P* 0`00S `$ ` `Ѝ 0_S  $  B$ $ R$  B  >(>(@(TA(XA(@(>(U >(>(>(A-Pph0``ATR 㼏@P<U0S @ X#1p0A@(@<0 0 1S01/ 0S00/@(`0 5 /H0P 3S P 3S P///>(^FPO-0(P,p0@4`8 P P0P \ 0 S   0 0 0  0P  0S L0 w0 0 00 0 0 >(H(A(Q/0/O-@8`夠 砰P8Q ЍP@p8Q Q0pሀቐp\: < < 0` R P/! 0p P  C1p  1p @-: $: \0` xR o/ 10#/C!000P/@-: 0: \0` |R  /  /C! C!/! !/@-: @: \0` |R  /  /C! C!/! !/@-g : M: \G-@$Q uql#`h RPSq p$ Z!Y  @  T*B\ !B a ! L @DQ%`L  R V@T@ ^@  `R A G-`RM@Xr PP dP`T `)bP P9  ,էp "0S  姊ߍ<0H(00,0 00004008004004 04$0D0(0P نW[  嫧pU l奧p* `x\|` 8 9! 8lb ,b  b b b 0,0b0 b `! Mp 0`?`a8SHPb 0  0**0P0   0* xd@edAzd@cA-@Mp`;@@ p@ݍ P@00@T 0 2 "0 O-`M$MpP`P"NX1 b: S/0P  rR !00pPP @W ʦUP 0C P"V3R V  VPN 尦P P W\1` 0塦`PIX1: S<V2"巩grPpU⫦PV9 FPW002`` 0!$⚩ $ PPt ⒦P5x!0S(3]`P S R SpP`-pP ``!\1 S R UPk`x%|!0#PaY $PpPpU`( FJPP XND% ܍$ЍؤJF F F@00S/p/>(00S/0/>(G-pP1P0@0ʟ 0 ] X 3#15`05 à121 R0` LPpp0a0!R00S #8% 0%# 0! RXh000R T00!ǁ8P,0>(@(H(Vx>(@(l >( 00S/>(O-,Mp0`P@အ0V000,Ѝ00 ?U0$p$0 0000 P$0S v?00 0 P(O-X( >(A-)@A`7qP0S<00 00 0fP000P 0S Ѝ0@000 5 0  r@ A @`P@*D00S e0 0>(>(@(>(>(G-`pM0/10SPP@t1@71001000/0 0  0    0P@, P@00 ?U0p15:0 0000 Pp0S DЍ?pp%&` 9 Xd00 0a'%y 0S    @(>(>(>( 4 @(O-FpP 6c64MVg00` 襟rP01共0Q 0ş@ Q ` 50S +6V 1 10 L`<Ѥ Q 1  (0 0 0G 00P(0Q- an 1 0  d40SE l50Q(00 0p00`P(0 R3 t\0P QPxNQ 1 b( 000tPv 3 4ЍtP`3P0QS?  P`$3 3 ,`Q0 C,0(@,0h PX,*?00IJ ,0R.( 000V0K+9 \2 Q,`` (@,0!RP,`S@|!嘑 0  B!!#  V8 !!R!' 0S& 5, R*0( $ {000{,0 0( 0Q `@`P0,00~\000$00?-8000P$ 0S >(Y^]x}@(< L x>(o     >(^FF^ >(@(H( 4  L G-QP A3aS0Aa M` 1P11r00`00 0000P0PU <6Dpy@p@YU 0001 0P@  Ѝ0ATP  0S X4  mP@LAP@0>(Yx^]}@(>(A(  x>(g   >(p@-P0 % .  @Q 0S p# #3 0# #:>0 T0SpP8P㾢p>(^Fx>(   zR/G-P `$ 0p@V` 0@`` V`@&!D( `G-@P 4`S4 Y00000pquP0Y T0T! ##P @?Ѝ_uP :^FF^: p@-@P`    pp@-`P@ ((UX0 3?X0pA- P 0U$PP(4@b*^ :^0 *^*X@40P/ Q\/O-@Pp02#U 1! `R ` J U c9# S!V Q V3  P! I` P0 c9# S V!Q V3  P 0  P$ ` U 0 Ѝ < J 7 0A-1àQ`P x0x xxi0Sp@@ P$` pFQL @ @PQ0࠱@ < } 7 p@-@P40S:a80Sd0d dd:0C800S   0ň00PP80Sp0 U < , 7 k 2 ,0S/`0@-0@  L2,奈0,0080S 0  0@蕈H( k = 7 ,0@-S ,0, ,,@TP @~ =  7 O--\MPpU`@8 U0!@3 @#81S41@D2s2@Ds1@DS@D50  0 00Ph U0#03?Z[[UV@D `0P$005Q (LO0$0 3D 0XR @"!L0<p(08p$0 0H(0 0 `,0`4  0 4$yHP $0 $PH40  (00 0@P ,05S00SUSP3S` 4$`UQᒅ 06 00`F<0408p@004`<`3 00HpL`<0@ RS80 0 ,H0PpT`f@P ,Pd3Qk 0Q 0CQ @ȢO@ $@$\Ѝp0,03(0?D00T P %HpL`VW v1`0, S24040S@p( D0 0 P  X Z ,2,",Z (H [`400 0Q 80080p0?(00T` 0RZ@p (0T 0 P 80S010!00C800S   0` 0SP THpPL`P@ T@Pn P0ᵄT`@V !P` T@!00P0V0$0DH( LBAW  *= 7  X ;= NBAW~  l N= U `=  G-0,0S0 ;P@x`40S*ÆЍ00qW!  0W@P   k@Pp r= F 7 A-`0@c,0Sh0h hPpQ H0< D 0P@DT@ = 7  a C-`0(Pc,0S0 p@Q |0l x@PEU  0P !  0 P P Ѝ = q 7  s X0sC-Ђ0@ P@` 0 00 0EP 0OЍpH(@( X0sC-Ђ0@ P@` 0 00 0*P 0ЍpH(@( p@-0PQ @`0P Rp   T0`! @P 8|4P㆞/$?(H(6 H( k z@-,@P,0S ?00H(@-,P ,\  E ЍH(p@-P@h0h 0 SX0d0R 3?p@006.4 Q#3SRpp@(>(>(27@-0S S+,Ô2 R0 ELh `Q tp^PCaQ* Q( H<QP 4 ,B 5*< 50d30a3210S Ḷ20 00@ @7.Bp#x3 Ŝ & 0P xXPA 5*< 50d301$10S ჶ0 0@ d3S+ CQ+aQ# 0AS"P 0@a3d3*{|0p00S V0 0@S Ѝ04|>(H(>( z  >(>(>(H( ,D @- o M O-0p M"##0@` 0$0L4@ 0S $5pP t0S@P8# 00" qp$4$坄BtUhUaU bU P5#i0E S0 0,p$C @* P80 ( 0 @0S ,00(# `!B P P0V yЍVp FpqP` he pbP `P0V:P0V$ SP XpE0[0b$$0 :!/ P  @P 0 S 0 00$ 0S Z(0,  $ 8}p C @0 S 0 00$ 0S Z(0,  $ 8Yps  @0   p 0 Pc 0 ! P4 M ]%= = j9G-p@P` 0P V  00 000G 00`000O-0 mM$0P@@`004080 0bW, AW- LW% 8j4hcW iW0p X$׊ppH40S ,mߍ8 40H4: S@ @0(008`,0000400P  P 0 0! ATp Κp 0Q= 0! $∡匱@P 0V$0 0/S k<<Y``0"<,P0<0$叀`P P< ly #w <͂V@Hxp n/B  n?< n/ 0Pp < !$Jᧂ$0 @#0P!S! 0`pSpV|p 0S `0S  R  R 0S( m0$H 8HCP`pF0$pM 0$ pF dp>  T 0S ,( PQ S RPQ= %zd@j.r!ZO-P-@p`,M$P "塉p($0S0$020S'$p P V 00 0P0Ne 0 fP AP PP `JpP$_p,Ѝ`P 0`P ,& ?o  00 00 ` p 0P"qp p Up` %"8= MU_G-@pPT!p`:D10S:  p o09 6X $$ fp+ P%W00S $$ Vp YPPU `fV rV GTP$$  :p$Vk%=  @- %o M A-@P`pP 4\ XߜT  @@ٜ 0VU  AΜ A_^4% L@- R0Ѝp`P@ ]P0 0S 0SS0S $$1# BS0S P - (P/00#s01"$#> O-P@U \  p耟蠟 U@00P`6 [ `` `7 V `V*!ƌʠ?,͇Q`V*  Q*`V*?!Ì?G- 0 @,a,q@P^ \ ^0᳀ 0S@ 0S@ 0S0@@0\# ?\CTムა :^ *$5@0C6;007;00@R0@U^(PG-(`$p@}PP 0㘤I$0 0rQ P  PЍ :PC-p$4P 啓R%p@ 0`RQ P Ѝ P404-@-0  Ѝ Ѝ/-@-00@k 0 Ѝ@ Ѝ/-@-P 4(Ϛ  ㇚Ѝ Ѝ/4O-MP`@PЍ Pp P 4S  0HT0Pp$Q Q$VP 0S 4S $X 4P S $ _SpH0!!`000 0 0  @ 0P 000 00 0 0 P p1 T`喘&P$(0,p 0p$S4pS 0 Q p" | L0 `0p"SPb 00P0S".Rv O-$M@pPTPP ? 2R 4S  0~$Ѝ0 mQ Q0   RSRQ"  "S 0000 00 P 0P~4S 0S(  00 000 P0 0P0 <00SS P   0 0`S4S 0$R V P0 RS 0  000P` H0H 0000 0   H>pJ"U1;MG-P`8Mp|@Px@@ C>dtC$$0840; tp+m!p D}⛕pp H4$t: S! W B.L ⏕p< $4S0 (d,T0.B. p (d,T0"W|(d,T04$t0dT 0  (d,T  C00$0  P0p 044S   0  06p 0P Pp|  0Ppu P P 0" RpP5:Ѝ Y0p["}xd@d@3O@-@P 4B BRP p 8Z4  dЍ@vЍd@@-@Pp P P.4PS 4 <A- @P0TP p` X`p0 pVl$$ QEAS 0Ŷ r0"(Ѹ0 / 0T 02 /$4 0T1 / $4 0T1 /G-`P@Pp 0P^ P㬐`0`00 00NPU:Ѝ 1 00X0L@0`=P1 00, 4PU%YZC$$0A@-zP@- x`R@dxЍpP P 4k R 0 -O-Pp_o!R0`@tMR(0S00S "R0 U tЍP PU 0SGQD (0QS@!RS R7"R S R.A 40[ P#  7/p ' 7/p 40 P m0 $8  P P  P A-@pP`P 5/p 4 5/p 4 C-(00pS4P Ѝ$d@ 0   0d` 00  0 `WP #\O- 0 0pPz@ᄐT  P Z @Z` 0 z@-B p@-P@`0 5@TpB O-Pp؀ $M`@0吰     Q E At0 p ` X0 T p`⢕04S0 + '$ЍB O-PQ@04p 00` ЍP P0S* E `P0       04 p p#p p04pp   0s@-SX`@ PU0 ?o2R0S  Ѝp-@- iR sR aR p` V~+p@-P@P (`Pp _p-Tp@-@T 40`PᥳPWpp-oiR@-- 0 aR bR LR( CsR% tR@P 0P0S`-00p`(j0 -p@-@ M\P`RP0 0͵0,0S  㟔ЍpsG-Q@PM Q  ЍA~␀ p${x`P phB~0 00 ` 0PP yesO-$M@`HP 0`$ЍPP 0 0 0 $0Y!<#P0*.Q P0 0?Y S0SXP pY0 P pE04 PU 0pop $ wP 000 00 ppP y4   \ $  0V,S( 0 `$4 80+p{ $Ĕ{%!#,[PP { T P R*L0Sg 0p^ L004 0 000 0PL 4$$  i  $ 0$$? p6  9Tr00S 0@-@C^M E$尓E$$0 0w" Pp"Ѝ0 @tq !ᖓ"`#XT 80 @刓P8兓%B &;Rp0$ 8O-`DMPp4  1币<0!p 0S& ! R"! DЍLRR a0BSS0 H10S  4P $@P  I wx@ uP䰟 8 x T 0 <0@ % T @0  @vP@pB %a-X.B `%oA-p`(P@vP0 p!`P @00 0$0@-@P$0S w@wO-20SK@0SD00m@ DP 0SD0SA \^<40$ 400#?qpp, 804<0P$ 0I,0   P bU@UqU PH04 89pPTЍ0$$ `Vh0Y`0X0 0000 WX0 0 0S " [ P$0 0(000qpp 0 QP Р 0Zup , op p  $ sr!% M I |!!!O-C~LM` G@$P0 0H%xp<50S ,sLЍqP sP @0p0$  0mqp PP`0$0G$$ pP0P 00 0XpY0P$0  0 ($0 040IP BP 4 0 ( $ "5 1 $00PR00( ,VU 0Sd% 0哒#80 08 Y :0 U P  0 <0}P<0 0(, P00 0 W P (0( S,0,0U000U,  ( 00W  00SWX0W 4ST 4SQ 0S 4 X4 `4\ P 4 "$`0 0S 004 _) $ 0$ R40H LFp 401SD<0S0`01pw0'x4 $r/040s?pp^' 0S/U0P` 0"p  U  0  (Ph 4$$  p*"%J ."E"""""" M $#Q###m##C-P0 @p`$M!!t Ph!(wp*0S00' P 0SF0SC \^> 0T 00S!Q` $NP$ a@ P P TpT  T  0/$ЍP`J #%(J p@-P M(@,`6#"X0ⱟP0 0͵0,H0S B Ѝp7$s@-WM M`p@T 09Wލ Ѝ0S@ P" 0$$ 0$$0 x50 0xP xb x 0tm0 $8XT#D^@$X$o$ n4u$%&C&$@-1MP@a qPg0 Ѝ@Ɖ0 ‰` 000 010 0!p|p⮉Ѝl媉 80XTP0 0 嚉4嘉P 0  @TR- Q冉 $m0 8 00  ppm1S1SxЍ@`2\Q\ TЍ@U%7%E% n4K%$I(v%%%%"&$cA-0p @P`M!L @@"tp420SP+ lP`P a@ P uP xP pЍ@@ p@@@0S00} P 0S0S \^ 0 Q   Y0p`pV ݇ ه Q pЇ   `4EJ P&%Z&TJ =%%%>%7%&ep@-HM@P`4  01 0S 1D0!tp T  vP 00S  0 <iR TR LR a0BST 3plRs0BLbHЍpT p M &&%ThJ 0 Q /0@-$M` 0 0@P!!0 0=00<00;0 0:00(0;pp0 0,0|P,0 0H '# p DЍpW0`VpJ G'C-`PP o_P0Sa UpP xv<P[``V` H =P  4=P  =P  =P  =P  =P  <P  <P  <P  <P  <P  l<P YF^P  BP ZPY >P @] >P pU P<PU _"80x9x M=P P R2".Q<P  p^Pk TP  p $ 02#W: ,=P TPP _ [1! |;P 0!xlx =P !0xpx <P "x<P "d<P #P<P m0$ 80S ^P p <P@Q#0T xh00ЍX-*%8M *LM **P.0M ('Q+***zK*+ ++'+6+C+4a+k+t+y+SM ++++]M =LJF%O--@`pZM*op t:0S dЍO0FS iS@:PC>`C$P X 5ЍPP X00 9P9V0P 0 TP0$$IPh ^X TPP HTP (0IP$^0 l:P $0  Q4 ;P 4PP0P 4 Pg 0`P00V0000\0S 00 0(0QTP 8MT0P,0 ]PP _pP _$OfPP04 ;P 4`P `mP @ 9Pv H 9Pp @0 SD00H0 RL0( 0Lsp 0qp(  R$4 "#qp 0p` J}$4P p$$?}$4PpW SpP( xSP$ GWh&XSP \0P$0 $_pP$_$&? p 0]qps p 9Pt :p o  9P   9P  9P  t 9P   ~9P  @ w9P q( p9P   i9P q/  g9P r `9P 01S [r/s?`&(Ѳ Ѱ  K9P s/t D9P{$$|$4P, \P ^pP  ^$$p0 qpS/ p0l< :Pl <pP < ,s< :P\ <P 9PQ  9PK < 9PE (< p:P $ <8 8P5 8 Z* 0>l$ Bp $ )|P$4 "p#gqph$ |Y$ J00"\R8008(0 000(0 40P0 `$,p 0$00 P00 T0Xp0$$*qp|$${$4P0H00`L0p$4&pk# qpm$${$4Pp X+%hM -+H ++*Q+,+k+<,t+W,++,zK M =Lz,,,,4a+U,('****+ ++'+6+C+2-JF-N-l--0@-@M P   0 0SLp< <Ϭ 4|p$Ǭ0Ѝ0M -'i-@-SM@P, z0 % %$ &&4 '@p H0P0x00p0`0h00`0 0X0D0P0L`0|`pV RD Sߍi@-i-!i-@-@  @ 0Ѝ10S/p@-!MPM@P% PA. (01P A!;AxP 0`0?oS c` 06P ``(0 0A. 00P0ZP A Av0 0A. 00Pl0;P AX XA\0P 000_4ލЍpI(N(-. ..(.U.s@-6PP P ܫ '`@TЍp P  00SUV  @M _.=0 R !O-M@ Pxp!p"㤫`P"    |PP- 3TPP:PpP 'TpxPP T \6P 0"h 0R00  p!  6Pr 0SohQl @ z{pal S! R R RZ  0PW l Z X+X (s<"W 0j0S, @ hD{P@ `>{pd HQ L 40R !01Sp0S 3/p\ U 8 X{p \ [ 5@ `{p ЍM -_.^m.u.. ....A-pO@P@OPPOD[`P $QP P GPPZ@5[T @- `7P ЍAA-MP p5@P00p`ЍpP W ⤖0 zp !0  7.i@-@p @A-P`OpPy00RP@p?0S l FA-P`zOpP[00RP@:R?0R N F@-( 05P<00 ЍZp@-8M@ P5P 1 ! AOP R0 Q0s0S00@RPP  O@CYDp ^  (R< PkO`,YV8Ѝp.1M .1/i@-@BMM  6p 0S 7  /  0((@0S700$0/ 0d ((@0S BލЍ<(}`@ }X@i;/q//0@-MPN@P RP Vl0l l_"R 0 0S ,pjЍ01//M .i/@-@M  $ pЍi@-M @L4PC0 $x p  1Q0r R0s04 1p`Ѝ/1N /iis@-`Pp@ @@4P0 C@PhGQ P@ L@NP 4 haЍp201N /<0N0m.h07@- P@:pT TިLN P@00 <<0400XN@ Ѝ0N .00/m.7@- P@p\ \巨0H媨@M P40 00/N@ Ѝ0N ..u.0/p@-M`MP0P0Ѝp$QP@Ux^@Pd〨0 D(p<o8 P@ PP `8000i0@-$MpMPl00$ЍP`t^@Pp 0 XpL?P@ P`@ p$9` 600i1@-B{ Ѝ>!1@-000 0  P12@-R@JPP [mRpPL``KP00 00zt0@`Vm`;` PT0d0X @ @@@@ozUEw03/`O 20`%2 2,2%2////0 L0L0/0`%0 T0T0/0`%0 \0\0/0`%0 D0D0/0`%0 d00d0/0`%p@-@pP 00p00D S 0A0CS0$P>P 0@p0`%@-p0hI( 0`P/ R/0`%0 O-4M@@!2T0(  Dupď㢥 P(0$`!pSp D@T PoS@ڐAP`@ 5 ptpP`[T000 [  v R  P Q R. 0S $P\(P  1/P s@0S  %up "SR(0 SL1\ 2/P W0hI(L4ɚ;6e=Z4O-MMPp  U p`%  IpP$ 0Y00$0 `-x  upW p up Q Tex @ x K p$(Q Tx$_X@T ڐX00@0 0tP;xK @0I 0 ,0@4@tp 0Z0Pd0o 0P 40,@tp<e 44x\(H0S !P31xH0S;I0S8Z`@T 0 3/@: " ⡒M0S:00!  l"啒M0S Tw@8w@03/@t JQI0J/XtpNI0!S'a`"%J` 1 0 d1 T|p 1 d\!1 Hw`@#%Jo!1 @ t1 x!|1  &wP@Th 03/@ 03/ݍЍ"O -p4~44i 5~i'5/550`%i5i56(6hI(N t66=555i:d4 F6O6Y6d6|66O-@PpP  p 圣T H@HPT!刣6H8`P \兣PPU D1O0S vRR tW P.Z  P' #0P! K0S 0 L0S 0M0S 0 N0SO0`S PPV {v w18O 6=hI(A%@-,MP@rpP KHP`(  p"0S h  H-P00< <0 $,Ѝc.9N(8i(9X 99@-P@m0 Pޢ9G-@ HPP0 `@ Y㔀rKpdKეPP  pp H H@@@)[@ :X 2:N(d!s@-@{G@P00Ѝp>KP0KO@P <` PZu W:N(.s@-@QG@P|0| |QKPK&@P T` 帋PZu( iЍpm;X :N(.A-@"vGPP0 "`@JJPPp mp< >FJN@~xX :N(b:@-@ \-PP0P PPL 0 S@@00 >00Ѝj:1X :N(:%t:0@-M@GPGP GPp GP d0P P P P 4P=p ȡЍ0~xm;W: :N(7i:7@-@Xd@u ~P H8uDP⌊ P! (.u Ѝ0)u@ ::WA-M`@PK \ppP"㇡(  L  ᙍ qp% (>( pl"x <@T h8Pt`2PPt RU TЍ0 P6X@PE $@gqp 彉tu 0R tl)pt nt` TpthQp R%PPt \tmIP;ЍAYQ\ 0Q    1 0PtP0 RSnqtot$ (t0` R P U 0pD` Pc.Y -8i(i::X :;%9;Y n4W$Y !;7;@;Pp@-P`@,EP V  8F`P O`O 00pETpOA-@T 00`PpJ0 p `@@-MPP00Ѝ`0 00p0@ 0 P H0Pn 0 p 0 `P0G-@(PZ00`( _ P1r0Pp*0X!U0"R0 ="0:0"SЍ70P. 0 , [p 0 @0@-@P YO@ O-`@pP,(0V0S 8VP$P$P 40S 04S 0S(0p(`8P0S$0(P?XO-M00q W$000Ѝ`QB QE 00 *PP0P XrU =0ሑP x,,2,h4@[T /@P00 DT0800X5T (xS( R R[S"00WP 000 ≬Ps0"CQn BQj Qf?5^ Xpp=UPPZ Ჰ  )$P "PGp}WWH 0  FpA 0STt 1PPX0!8!100#R0S 0o8^@  0YPpG@T 0CS0 0r xC0X0^ :T 0CS00wRxC 0 aD\W@DAD\ 7@Dt@S 0q@0@Dt@ T030ZF@ WTh l㓞 DPMU8 @ 0 0 0`0Z;8[ ;N0h0A-X Pp@`/Pz0010Pq 0 p 0 `P0O-P`$M@ HpX) P W0  |Pp` 0p0  0p- 9pDP08pN/Snp `|0 h P,00P0P,00U0,`(0DN/&o%ݍЍN(KiZAt< @-p 匛Ii<p@-d`dP0S s@ Pp>j nkp@@pP@@f%(O(O-(pPW` 00S`1 000xSP p<14! @T Z  CP 1! P `IR  B`W    c0P Y:WWP P0@DBt@UWAq0@D@W@Dt@@t@@&&<<<Qp@-@P&00S#0 000xSvn`Vpppn`   ,?QQ0S p@$$[n 00&/yO<pr&p@-P M@ U U( 0P0 Ѝp 0TPTT@ !m!0P!!`PPP  @ 0A-p`Pp@ @P(~ ᕆ Aj-c.p@-@P`M  4 `ЍpG-SMMPPx!xYpX!\ `Fp>10] >i_>@-@(M!  0P p< < 4 p(Ѝ?] o>i>@- M t@#Pq`0` `\ tpL 0@ 0kp, Ѝ>1I] >i>i_>A-M< Pp!ח0@P "` # 0(0tp0@`@$`<0QPP100 0(000800 0p&店 !P@0 @ p  :R@00C00 1P00ݍ@ T0S l儗@0 @P0  S 0C]] >>i8>>&>0@-0Mx @pd d[g0PP  041p O0ЍCh] >?i? %*?@-@CM`(  TpP 0 P P PP  8 ! ll pz l R jlm U#0P 6sp 6S30S xj0\P 6ap 6SL<30S 8mj 0P 6Op 3Q?_jI0P 6Ap 2Q8Qj8  1p 0S0 j8 &pt p l p 0@ PPo@2Q 8#jCߍ10S j10S jj0  `0000piPU0``0` Rڬt1000 0:S R DcP4i`pPQ iV pW ,Pi@iH0S Li {iiei`0Q i gi8i(i?@i @I(@@'@) 2@@@i8iiis] x@:@I@P@&>X@\@h@h@@0@-@P@-@M    Kp֕Ѝi?@-MT @ P@0@ @@8 0p$廕ЍC1y] N>i@p@-`@\P2ij``V``<h`0FS$$iPU>p@h-h Op@-P M@` RQP0 aPp@@}H Ѝpi@@-< @ P$0$ $I Ѝ@1] >@-< @ P$0$ $3 Ѝ@1] >0@-MP "M;e@PۍЍ0@=H P P+cP@.HۍЍ0@c0S0S1iS@@@-T @ P@0@ @@I xp ЍK@1] A>@@-T @PM<0< <  ZpЍ1] >AO-PMM@ 40L00t4 T4>PX”4'S$0P0@ 0 0 @PE( 0RtP~ 0S0'U 08 0808 08P080808&h(@!!0 P d0 /C BRY      -Bd8$ B2"!0``F ^w E0($800IcCP S@BA`p7 0P0a g!0儷@"0(0(0SF g0$ P0B'S$0؍Ѝ 0 00'S   BS>C'0C'S Q:Ɵ"!! CR   ##9C0C<"!% &S&2"!2.B&>C2"" h&2"!/B Q 0*Sy S D&S   2S% Sq 0S R )SI&0C'Sg00 0S 0 t7 t0Wg0( 0 B( @ R `%SpEg||pW>f `R0 0L4g`D0S4 +g0S `p0 g4H3਀XP0  @gp` g0S Z40$S.Lf0S pf{`f`pLX#v0,01ap`J zX4!,003c1s0SqfZ&0So  j ,J, f3Hp#P# P# ß P# `fXH<#S0S Lf0S?  0f:Sf0S2 fs刢 `0V V"    0sfV/ mf0S Dgf4bf` p X1p 0J,0Y820, `&#Sqv ,, ?f1H!P! P! P! p+fhI  ]S !Sxtplhd`\XTPLH <iA$B)BA-BA$?^BDO(2BI( $\ \ ]BcB"AA =#lBsBBBBBBPBBB*AFAPB"CW/AS00!031 0@-Mt 0|J@P \ㄐ FLPP @ (@@ 0iJP 020Ѝ0h%dO(%@-X@ ((d    dpa$F%`FGP@-d0 !X|!T@0 6p0\ (0000/a a a Ph0h@-` |!TD0 6p0\ ,00 00/a a a P-4s00#q^0<\ 0000/a a a P 4qs00#\,s0Q00/00a a a P-H 0:# ^4 0Q$0000/a a a P-H 09# ^4 0Q$0000/a a a P 4 <# \,4Q00/00a a a P@- 0:# ^ 0Q0P@d|0:0# TDD#^<s0\ ,00$00a a "H6Ha @- 0 00`P Ѝ$ i%A-P⻆p`@WЍ qP k3MP@ p7@-P@U0  ({G Ѝ0a{HA-0@nS0oSp@ pS{P`\FPtG0nS0oSHPPHPP'@-0 c_H%O-M MII O(IJ+JIJJJW]p@-PQ@@pQ(0op^P0pP(PA- 0nS0oS 0 }@P0Dt ?P,WpWBPP`8>jDp@,@P@P(L%@- `\L%O-@PM p0`<"P04"4 P0("Kp/ 2 00CS20%|000& 0|0`P0 +0000 0p00*0 &0Z [pH `唋rPdPMP UP4 GP 01e@ P 00 0 00 0< 0~x`|P 00  0uuP\fu 00 0< 0ft[,0t0Z00x0V 0;;0|0Ѝx-%-LTd dd L-BMMI^@0 P@M00 \ 0Zp0 @ 0 0/ 0 x{l&\1Lf 7@-@P 3?0Lo SϜ 0  Ѝ0TM@-@80P@^]@-@D:0P@Y@-@ ?0S 00S0?  NJЍfMp@-@PP (0/Spp@|MMM@- ^[M%O-p0000@P`ᜐ (,唰00 Jp0@DTq oP0 PtP<傊t9 O4%x--*Hf L@-M@A>0 0D@00 l0Ypo0S SH hD 00,00 C][$MM N9Np@-@P]P (90/Spjp@f|MMM@- a^9[M%O-p0000@P`ᜐ (,唰00 Ip0@DTq oP0 PtP<t9 O4%x--*g L@-M@A>0 0D@00 l0AYp0S SH kD 00,00 廉ZWMM N9Np@-@P՞P (屉0/Spp@|MMM@-  Z%UNG-`0@P $p堐0 Ip00@DT oP0 dsPP{s  ZA+VG-*%i L@-MM0An H 0P0 $@Xp ObZ1Np@-@PeP (A0/Sprp@n|MMM@-! i]AZN%O-P@M P0`TrP"Ip)@20 R. +x   &  x `!p0 *00)0 &0_ XpM uPfPMP- 9P GP p1g@P UP|0 0|00|0|00|00|00pt`x0 rP妈rbPZ,0p0Y00t0V 0;;0x0U;SW$00|00|000Ѝ-N%j j L-MMJNP0 @PG00 |0Wp0 `d0 0N/0 4 x000 0@([bY1Ll O7@-@P n<0Lo SϜ 0 . Ѝ0TM@-@60P@^]@-@70P@Y@-@ @<0S 00S0?  ЍfMp@-@P P (0/Sp-p@)|MMM@-JO@-40 0,0,0(0(0$00 0\XOOOO%PfO7@-P @;P00S\ 0 巇 Ѝ0KPp@-@ PX0 z0(pyPP(姇PXp@@P(LO-@H p0YH ($$e %wGp50pGWQ. 42@FP 40S  4 40S 4 0<007a08:l$0000000Dv0@90;glP|04P 0Ic0(80@008 0;qPP"0       +  @   ' B 0# R #  # R" , @ ( "  )            p20  |p0$000 Xp0 000 4p0$800 vp0<:00 lp08:00 bp0@900 Xp0,000 Np000000p0909R41r0$000 0 0t0,0w0 0x00007000+ 24  Ѝi%i%-P%l Q(Q(Q(m LQ(mPsP|PPPPPi%C-RMMIN@XPpD`p`00EL Hㄑp$xL0~Up$0KS 04  R< pL04I0 p? 04n/`  0UvHP ,PEP.0D P! D4eY 4$04 0404040 40$4 0(40,4`044<$@MYRݍЍ$VQ(^Lo PQPp@-@P͚P (婅0/Spp@|MMM R R @-包/Q0@-@MP`p 0JT000 wUPPЍ0P0 0 0HU0 *T0P {ws@-`/P0@00 TP0 5JЍp0/s@-`P@S00!  P0d RPPP @6@4 0X0ЍpQ(vp R(002P0/@-@BMP' 41010 0000000 0P ?< 8vXH00BߍBߍ@o꠆~p G-0@`p8Pp3 pϿ| D0Dv4<40 8p0m,j<0(000pE040p<0< Dp PH00ЍpPPL PG XQ(@K`Lp 'RO-$M@0 7`Pp0 @T .V0<00$Ѝ 03/ Z0p m7P P @0 ` uv0P":@ 0 `  p00P LH0@3/pOPH7 0P 0T@Pp 0 0  W꠆p 7R0/A-PMM`p/ P@1L# 4N!D0@@ 0@00 0@p ߍPڀ@T ߍA8Hꥆ Q(C-P[ 4M@徹@ξ0P` :0P`PT  00T 0 P  40( 0``00S0 V0S`0000 pp  jPP0QqqD0D00V 0 000OPP4Ѝ 000<0PQ(TR^R Q(--0M 00H0 @HP (R* zg ۇЍRR@-4 |WTTR%O-P@M$  00p 0@"b0"@0@ "Cpx20a0CSy `2g@P 0p00@0ⴅp ! 0 mPl P ⏷0S Q ς  hȂKz h!! <P m0S Q   -z ' [p x+倸Rp x 0[4S08pS @p @Ѝ?Bx--%-Tp 3Sp LNSSS~SSSST:T0@-M MC^P80@0 0DP&(00 0Qp W 0 U U U(10P( lU,;00P , TU0LUލ Ѝ04U(U 2KTWTdTtTTTTTT7@-@P I60Lo SϜ 0   Ѝ0TM@-@/0P@^]@-@Z10P@Y@-@ 60S 00S0?  ݁ЍfMp@-@PP (ׁ0/Spp@|MMM0/p/p@-P@῭ $( $(0XRX0X00\00`0ddhhllppttpp@-@ P {xuDDo@@iHHcLLPPTTXX\~`\`0p Qp` RP0@ S p@-0@"!Rc0p@-@P1.+(pA-0@PJ04S->C->C?X9>:>C?n:>CF 0? AC>}C>GmFEnFE~GX J.X V  $$((,S>,Ĭ}S>GῬmFỬHHLLPPTTXX\\O-@  $$((,0,0 P0PQȡ\5 S L5sT 0K TT`XX\\``ddh~hplzlpwptttxqxD1[ h`ebp0 p$Q*\5 S `0S&P%@ PSزK 0CA0Q R,2.0) TU 0/0+P0sC@p/p@-0@R M4 @8 P63 $!4" (2 !8!"2* Ѝp0S/!  O-,Mp0`PTXP  $  $0Q$ @T 0 ~bQ BQGAU Q  @ @ @ @gAq \0 dU@T0 0D dS2Q "P  T8 DR0UQUDTP 0 @@@0 X R   0P[0 |00S P  \,Ѝ0 000Pr~0 Tq TUQ(2UbU@-[@ PU ppRhh0`@SPP0SlO@0@,R  (R@Q(U%Vdr UUo00S/@-QOQ(0/s@-@00S 00S Ѝp@0001!Ѝp@p0P`?.ăPP02V !8 0$Q"OЍpQ(U(U(V($V(E_R/s@-P00S"0@00S |000 Ѝp@ծ ?,P0`2V w8 0$]Q$NЍpU(U(Q(V($V(k_A-Pot10MSP8MRTaO0@OS@ 0 402#0  pᇍ!?P09 ??. U00S.UN@@Dm 0ݍ8ЍAc0*Jt0 R `\ = V 001K0*nݍ8ЍU($V(U(V(s O-C ` dϠ 0@ `ÌpS0 10S  0#‚ 0Px 0Q`0 C cà00d0 PS CQ c ( $V(U(U __i%`%4`s p@-Pl`0@S     @00Sp0?00Sp0?0pi%U(t0p@-0`S[\@ L00S000000B0E0pV(i%O-MMO⾟D`, h%5_Q0uPSi`50J\Jp%?D0Sdd/nD? 0?D4'Pp؍ߍ 2@ŒD 0L 04;20d04 0]0 00@4T@:T @:T @9T @ 9T @8T @8T@@04s00cJ0`p 0 40S7{ 3 0 000p0  `  'Z X  Z0 ``ao,F Ϡ ß\ ^/F222902?"""0Pb 2@őD L 00 /4;2II 0d0"0 0 o 0S,2 0r 0` 0W9 |Ip`xSi`10IoI/0`22220&OD0? 0 0430hl 0@DE0 L04;d00 0@ `4 0<22229$,4( 0 02?  0 0@Dő L0 0/4;$0 lI I 0ldh 0@ `Ì0 1mi%Q($V(A0k%@m%oV(U(TO--)MM,0=0?0(8$0ID0D`0S> 80pW:,0 0  0 JQ(U(U(V(V(?P@P`P @4֩ P@  4̩pH 3E⿩p@ d3T@  3SP@ * 3P (d0S0,5 Sx0<0(5002 0,%S0022Q04$LW 0QLOxrx" 0 04 0A XLA 040A 8L8 0 4QK/ 00 Q*K& 00Q(K 004 QK1 @00T(0D%\3SB1\Cp WXp\1X0SHK X0SS0$50 40bH00aL00BϠ850A<ŀϠ@5Dŀ0\P00\T0R380^S`R001K @4p 0R`0 a 2!$ V(V(i%i%^``U(U(`` a;afaaU(U(aaV(CbTwbU(b$V(i%%bTU(i%U(U(V( Q S,QdS18$Q<4R:xOK  @0\5?>C0P4p3x00084%$0<0D0t@凇0|00匐XL5P5G   ?,8`F  ?%  ?h pi pG8#PE0 0" 0 p p4%p8$``05<4Rp`J$11 84<00x 0 08PSPK @`@0 ? @`0嶦PP* ?ϻ@P`(6#R0:߼`@0$- 00[00 1p&"0 ?001>0[`0 c2# S,Z Q Z3?001> !00   BBpQ0^Pp0/2#$ 0  ?KWp1Wp#T0p10G 0`E  ?ZPPB@TP` 0P+됈  00B1  B[1 ` U"B !!0 R0CQE0E ?P/0 p됈 0 1 B[0`0US  B 110S J:e @P`x1! G084<ĔCPp0S84<Ą-0$5BPS,pQɑRB@L0 0 0000\60S|0p ?HL404P@0 @6p9'(/FS@00 Qv(7\5?>C0P奁%4tx0eL70(1#T a2!, A3 31 0  @`0 04 p ᵿ 0H$4  E$ ( B, @%LV.  R*h (r < ( X ( \ $( ?.@Xt@+@B@A.@B,-8 Hu p  @40K p0 ,p B8d A YZQ !t0 XZ R ų{A/  <pW $?.t{ 4Ąß Rï80\@$D04 0H4( 0Āp@2 R 5#< 5$23dr0S+y됺 z'z'xz {' 000d0 CSQ c6Rc(+S`PH @ z犸 z'(Ȋ0 (08 +S,hH 00 SP0\h!P !0@ 1@p0 Q0_& ʾ0Sb@ RH QP0 뀠@t9 j0JF 0fK0`0S>V(^Fbb5cV(Pcs V(`%ht@%cV(chc;$TU(U TdU(Q( d$V(i%"dU(U(8 U( h00S: 0 #$C z$0+V. 嫾|00S  t 0=S,P0S/0$0(1H@ pp<DPP04SP0 0R0 S00C0> S< 0,00P0hA 0,0S7 p开8嘥ȿ+" < Q \%`R 0  ᐡ! #0@(0 0 @DU@4A 420 @R40 `0```0T0y(lb 0 p2 I `0 P$5"S`0 9pR8<00 t x00Sx0x 0\0  1`0  B1$%R`# R0C00h0$l`0 R#00B1d0 R*2%눃U` p 0 0 0 (0 0C 0(0(0 S 3`R` G $%R0 l ! `(4 p  R2dN 4RT T  4P%QXԐ R0 d0 0ȹ Ź  ࿹0 #  8 @ le`Q A+H0(H (|P+H" 1H00S , 0 B2\,^   00/d A! a,3 1 T&0SF$01=S,00CU e010T0010X0 00&S\0?0  0  B  R\ ?0  ` 00C 0 80 C  0C1448000C ST00C@ pd`h48 QT* B!44 T: $5Sl0 @0h pp^:S $%S0! !H`$p$p(0W,x0S ,4 k d,04  0,4 $[ 00`  Vj0S   0帀0 X#` x04y 0X\%Ϡ H R     dp 0G g!<Y 9\%R i0SP Q``ƌ` $$T :`R`  $%R0l ! ` p   R2dǷ :RT T  :P%QXԐ R( d0 0A >  8(   8 @  l;R` /  `@$  $ ppS $S00S0@Rl倐HG P00@8p`0x1Y4pYU0IX!@@l00@0T: @5A$\Q 0@08(0 0 (0d0O@ 0NN nC 01tp0S<=0S0 000S.D08CpM = R0/5,\%R    0 d0/ @ `.3,00 $ D0000P0S 0,00C0S0 P>0S dD0S cD|>0S 0 VD00@P|:x*,EZP>0S`EN C>`>0S303040404 0#pCVW*<pV.PToV.GV⥺0S  |?0 PS?\5=S,⑺??^ E?T0 0S 04  dLĒH 0@ `Ì014 ,$0S0S 04 h d ,04 0@ 04@)ݍЍSmfG-`RM@Xr pPP dopP`T `P P9  ,@p s0S  _#ߍ<0H(00,0 00004008004004 04$0D0(0P W[  c@pU l]@p* `0p\Y` 8  8$ ,V  R N J 0,0D0 @ `͹ @p 0`?`a8SbPb 0  0**0P0B] ˥ 0* xd@edAzd@cA-@Mp`;@@ `p@ݍ P@00@y>T 0 2 "0 p@-@PÄP (o0/Spp@|MMMR/G-P `$ 0p@V` 0@`` V`@&!D( `G-@P 4`S( Y00000pquP0Y T0T! ##P @?Ѝ_uP :^FF^: p@-@P`    pp@-`P@ ((UX0 3?X0pA- P 0U$PP(4@b*^ :^0 *^*X@O-4MX0p0\00``P0 0,, 0S P 0 nmS2aSMS ASB0C0`b0CX S0 SSU0@0 0DT dS$ 09R 帹"P T 0U8$UQUDT P 0 sS@ @ @U00 @@@ X 00 p Psn0S00 0 004 00P4ЍTTt U2UbU@-N( $Bh?:d%Vdt 0@- @   Y G-@0Pv t``PE0 00000BoH0UB?E ᴀZ(`(P0  /PPP\!1cQ\\/p@-TPL`(FV@ d0 P 6V0@ \0<@pZ(0P  C @- m co`/w ds@-PL@` 008"V @ mЍp`Z(Z("w ds@-PX00S@H0`ă5#040<t"V @ mЍp\Z(`Z(Z('w e\10 PS/C-HQ@@MPM`6`@fa ,1p P06 0 T:@6S-O@ ᯳ DD6ۍЍC+ 0 Q 0ˍ14 ^ 3?\ P;0T 0+ۍЍ\Z(Z(`Z(xZ(dZ(,w G-hB` pS#PPD"D%m 0F040( 㓜06# R 0 !m0 :0 0 !l0006&0B06 0  B 00C0( 6V0:`8!D`Vp 0R$&0? J0(0 6 C c0 0 &$&?30`L0V&S %ζ0: S((0` 0d  &ЍG% R0Z(w *eNeweePo%A-Xa00S FT:p"PP  0 0A1S0S$ P @D A01 S  Xl0S @2106&0$0& 00C00&101 00C 00Z(w eO-@PCM0H%<뜿? R`$<k g2 WSQ( 0t0C@0fb= 0(b S 03S0! ,0Upᐩ Q U0B 40P40  0AS (00 07  ,3pF,0L-000 6 0 6< 0g,(2200U( ,0 00 (p|Pc`$H% $0$d0@d0<`LPx;; 0T0<0<X5<0Sc X`<PU PW  0L VR0400& \p#  @ \ 110B0}f0F൰0&aPeeC0CP!Pp\p : !P0 ` 㵴0Z0C `$00SE 0j 00S0 :#*&(:C14:0 0L:Ѐ70S>* 0 (X "*I> 6 !0H 0 0 :坛PpD ZH&t0S\9 R0H0jL  X&' d  yP &X p \ ,p0&s0&$0#0  0vSsw0Cp0 0 V0( " Br  0& 0 `v] BRH(0 x0Sv 0Su00t8t@ ppf:PPXP 0R SHq SoٯP@p0S Ԧh7L R d0 P# 0`Dd&oobe+E!&0#H6 C 0 ᓔ)6 6姯0 <묖 ṳ6g0CT 00C0CS : Bळ07! S9)0S0  C02#&0<yP0 0Y 0:YG:xe3006\  0(01 0_ 0 JYT2  060 5&Iĥ(6YB:(0TSL0S d0 TP U740S pW,@61 210!!!0 SD$ ᓢ""ᛈ $0d0$&S: 060& 00.z<xG 0W4#0004 <pX0SMVPEPUI 30SA <W V<3PUCL0S \08`0 x PP1 P# j⾲T36!96l0H0p0t0x0808630IPp`$_<hxP <ph j⑲268H0p0t0x08f&! 02/!"6 QP*dT"< P 0 l0kPPP"w 0v`P!m P  6!d!PU:< &U":0U:  0  0 h℀+L0S]_U(!% %F*p0SK:Wc: 0 6PZ(dZ(ehZ(e`Z($fQf{ffTo%Po%fxZ(gpZ(Xo%QSNJgZ(Z(bg[(zgXZ(gg5c\Z(hw `%ht@%'h;$dAi dVhhhi:iw xii\o%Atr%w ilq%`(Z(`Z(d  0P0  Wp %p%* 吣  p001p1Pn 0 !IP `U&`06!0U/0 h h⌱L0S `0  `1#'$/%l167|pH0lp0t0x0{7080&2l0 P _C 1`p2& 0hD0Df?o2U+Puሱ&0#6` c2H H0 HDd7CߍWEG-`RM@Xr gPP dAgP`T `P P9  ,_7p E0S  1ߍ<0H(00,0 00004008004004 04$0D0(0P cW[  57pU l/7p* `g\+ ` 8 ð 8 ,(  $    0,00  `⟰ 6p 0`?`a8SXPb 0  0**0P0T ❜ 0* xd@edAzd@cA-@Mp`;@@ }Wp@ݍ P@00@K5T 0 2 "0 @-`pᇱ  @P00S0?0\ 0S 0 WfS\F\GL0 \ gL|0 SDKT ЍE%KUJ%FZO%A_0 #jw .j@-!H Di:<<pP4@0 ,P^:U@37Gj%rj0x jA-p`P@"P V0 e#jG-`RM@Xr IfPP deP`T `]P P9  , 6p 0S  ߍ<0H(00,0 00004008004004 04$0D0(0P W[  5pU l5p* `e\ ` 8 m 8 ,     0,00  `I 5p 0`?`a8S|WPb 0  0**0P0R G 0* xd@edAzd@cA-@Mp`;@@ 'Vp@ݍ P@00@3T 0 2 "0 0-<\   RS  0 S& 0 /`)Q@-$ Q:9llO--@MMh V0d00h00X00|00p000 0\0$0l0(0t02000040<080H030<00404p 040F00G00H0040P0050<00S00|0000000S00?00H R00S t0S cPth|0p 0l0- SHd0h 04?i/0:3pD @|0@ Sp00S D3P xo 0D@E/a[@P#3pD 4P |\Sl0S 1 : S  R 5 @ 8vPPP0j VPrPE_oRb pbPU p  fP aP@D U3m`Tbd0h 0 0D0&d0h QP  < h0<@ Fȭ0S@040x0 0P0T0@0`0,000$0 T0R0 T0R@00@00S@0S100t S0P00RS00 R0 R0S0P0y /¬0P00Q,QP `R  V 000\OV 0`S`SU [ T @0S T0S2|0p 0/>0 D0p{ 耝p`ST(+qpv @@0S ?W01?0#*@0cph T0S*Zp_ T`[ 0ZK Y  Y* >05ZR[:\0Sd P!0SV@ <PXP UU \0 0P U PDIpgP0 @$  0  , ` $ ( @ , T 0 P < x @ D04 0`aD-3pT g 2"_[[P0T`?p[sp0_[|0[Pp0 አPUPQPU\FY" Y Y < Y0S *0S 0S0 000pD0(0 L!0S <0S ( T*,0 Y00S,00,0<0S$ < 0C<0S* v<0#Sp<9 $0R0$00S S d^H0S H 0CDH000 ,0R0,00 0S0`0 0R0 0R400 40R000X0S /GX0PL0& k5 )T0PL0 L0pL]Y20P!* R0b4R Ủ 00V 0S(dR0L|800S0Y00Q$`80V`5Z0A೧00R`(,0ES<੧tZ ⠧ X,0S800⏧PP eZ  ?ⅧP Uu40S|58 R 0 S%X0L000080 Y $0S8Py80$04 8 R Q R8P 40P0S4U(8040 4 R Q R  R U R PPP$0S F 1P3P0!01 $0,0A%Z-Y  P)1 0$008s8`A0Z Y Y0c 00 Y0 2" Y" [ * Y 0S:$0U  Y ,0S<,0ꊠ $00` 0S !0 3 [45x:0)qb&   K0  !} YQ YQRU10A0 ୦ 0S0 0@c&0 0 0   0!] p@K 0W1!XHE Y0 !Y10Qj*H Z00R 0H  Y0 Y00 l+m>mbmy vmX mXm&7jnmmnntnn&nLnno)oUooooop?/(p@pZppppp+q[q>qqqqqr rr)r2rCr.Jr<Qr(Yr%`)}rgfffFn{ UrRRaArrAaQ!A0Q R0 3`0SP0S00`0 Yx00x0P0 0S !3# Y Y00 X00 0 00 0d300 0$0|3,0S 3[ 3`3 0S 3P0T @3X 3 0Sx 33a4RQ33Q~3 :3l0S ݍЍ0/^ &>l02.`PP _l/&>C. 0 S0|0| 0$02#l0g Y0000 0l 0H0 20R08 0R000\0\0S0 Y0@0$0pQ p#   t  003Q0tp0H0( S 30S d(0H3H0 0(030#0X0S% Y 0( R030"S 0R<00&=+80< S .p! P < L6(0<0 (0S Y0( R00S~ $4 0$0 Y000 @0,0 0#40+40`00 0 1@01T01P00 0$00(0x0,040303)00000 0$2?@1c4 04v 08#$0 #(#< 0 0& 2 =Q p0QX0S000t0o0 00 R  PT p&?  DW-pk P^ ( 64 R ( 4R  R 0( S6071011l0( $R030#R03S 0$ |CQ`000S  0! YQ0R0( lR00S \U(0 00 25 010 0P B24 01(00(0S    k B*{@- S-b A 8 / eA@00@- 44@4P\P 0B"" `)-@=B'm)0/p/@- Y21/r%G-`@ P pا!>0оP U0 0  _P@ Gޓn0P\00" 0L] R 0] U   `)-xsss@-pP@ 0  /X 0TT0LЍp %P `/0 0`) `)s@-03S   .1 Ѝs @-@p$M0 0S ` P1 00P 0! 0 1))11 h0/X0/H0Q@UVPE:$Ѝ0sst t2t;O0@-4M@ 0P0S 4Q 0   R 0  9   0 "0!4Ѝ0@0R  )   0 "0!R 0S 0S 0  ( 4Ѝ0@04Ѝ0`)9tZt{tt @-+p\b)tH@- 0 R* 0s# p@0l)P `00CS`0p S00 P0S X0X /X1`%p@-`ʧ@P8!R#<10 <10 .810CS81V <1S 0 <1l0 hIdG`0裧Pp <10C <1$0 810S81`)u%%%b)0@--@4MT /A`/d/hQ /`"R d2RK/ /d2SA |= hk0:{PPS['ΞkHk>[E{781 < = * + (+S  PPP/ 0 @@@ zj{ k{[+S[/4Ѝ00B:k{{'*k{d+S/?@@-C6?Y@8b)t`)ttuuu%Nu`c)c)u;up@-㎦j0d2S,`)@0@-0S0@d2Sx`2"R2u%`)@-@ 081  0&,t1 t t*   <(8(J*@0C *K+ C x 0#-S88<8xS`S?S DSf .< Y0 ( 0BK+ Ⓧ00CS00I)a0CS00  Z  ÝPK 0@P: 0@0 x9 t90Sh9 00K )K ) 4 ( ❝PK 0  PK. + K    ”PK P 0K. 80   ` f@Puvp @80S 7    NP]7'<07807407007,07(07$07 0707070707 070707072+ ⵛ  `P-K PP 70Sd'0 0C!0R3 D70S0S K  @PPOh `∛pᅛt0@Pp } p{t@@hP0X#T0 0T\  xpW phS  0QSL0QA0P@jf0X\0D`X0D S@0S3 @DU1 PP  PPK 0P@0 K. *K>l%l 0 )@ट8@}pP @ XHl 0S$0 0C!0R3 0S0S 0`0jP `0dP c=0,C0 0 S;.0l0 Q*+ Nj0  d0d0@  47IS p 1 01 Q 1 \R \A?p@1cG0D H`R(p3 R  *  Z   tY   \0T0S 0D00D0. L0 SH00H0H P0S  h  ћP0S* | 6 V d ⿛PcݍЍ I8  C  ⬛PPA0S, P  /  ☛P "  ⋛P  | PP@d0S\X000+ #s(.Xh.Ps*q*(m** m*%0^jh 9M} m*u%\n3bl*F Ԅ2Nnʅ#GgOˆ$$m*l*gfffD+L//5p(8b8J[dio@-<00iS03S !55P%l*q*@-l@hb 0\ 0 L  @4  0   ڇx*߇x*@-`0@Px0 B0PU1 S2P T0p0S 0@ S<< 0,$p( Ѝu%$m*l*X%C-PD1`0B8! Y!R!tM@p  10S ( tЍ000iS00S 00S d `P ~'W @ 0 b P ლP000 p 0p, W@000u%$m*l*%l*l*u%%`0@-@X0 B0@T1 S2@ 0P   0S  u%$m*G-lQ0S ``L @P 0S 48A4a4qP0 0@0C!R! 1S1 "R TP`pȀА U0(@P 0E!0R30S n | X(0S+ @TP`00 @$ l*%+H m*$m*m*l*Zx*O-0B$p 0Q0US`PP PP" @P0 D  0S= 0S: 0P5"  UE  (; V S 0S000C?oV20SP@Ya P`P30S  'x#0ES0 000D30S ЍY8 0 X@00020S >P0 J'qX0000  000S 0@@*' 0 0@0010S P0 YQ: 00 0X@H0000S X0000000S~ @0 0 n RT 0@s0S @ 0 @$ 0 k@WH00S 0 T,} D(&4$m*fcl*~%6} %Ոx*&@`1A-0S PP@`DqD T0 :41,a PU @T)$PPP@`0S 0D !0R3 P U 0S 0S  |W&&P0S0S \0S < ?&l@l*%~m*l*x*$m*0A-0S 2|P `p @T V @TL$@ 0S$p$00>`@l*%Ήx*O-!1 RR0夑S @P|q| 0P0: ЍS DP`P 0 &< %000a PP@:SR  0%o Q Vr`P0p\0 p000a000l*l*(m*%0q*m*+@P%g2O-0S 0b0 8Y 1P!pġP@0pP00Y: P0 *@@ 2 W0: R0':&0 R S U :SR00W 030"S P{ 0000 S 0 SPhd z\ X %000P@ Ѝl*%0q*m*(m*fP%C-MM@P Q0S @p T0:ۍЍ0S 0 ;B000@T`PP@p0 % Y   000PU l*%ފm*ϊ0A-0S P`tp U0(h@TP` 0Q0F00S 4@l*%m*A-p`P@P j$p>pDorP 0L0 0C?oR20S  P %F2p@-/0@Pt 0Pp SRpx*@-80S$0$ 0 0%$ [l*%A-`0p0O0000 SPڤ/0>+b P0 P<P@O 0 ી0O0?x**u%0@-@0 0儐0@0Ѝs@-@P`P @TZ TT#?0 00?i+"+R  + 5Ѝp%$0L<S/ @-飊P뼘*y%@-<%p @,P10@0u% O-1@`pVCMv Pap@0DWCߍ貀TX B/0S x VV@0PS 0 ?2/ 00S 0S 0S0000崐(h X:0000Y&*Đ0S Q0 0S H0 000R*Q l\1#0S D`W0S  `l**l*%(B0*O-X3p0]MS DD@c@C 800#0!00RS #0!ip"& QRPP "N"W 0"!00RS[ 0"!xjiph"lLQPP"L  PpDDB@@r0PSY : SVH`P؀/0 }10L<aS$ {@ 8( D <`  8P  H\  T  X  `Ђ{gP ,D "8!88hR/0>+b  P<OP P \0?0H @P 1RPPD % J"L P RPBP|]ߍl*%jm*l*l*u%P*ˌy% 0q* x*,8Ch##l*K%}%\@-$@0 00: S0q*G-@ q `0S+ tP 00S P0 S00P R HRڄ00S t!  Y`ܓP 0 Y00:$00S $!m*l*%{G-AM`P@spP00 040AލG/0 008/P1 00C 0  R+h X c!0 ڂ 0 D p+*ڍ%+A-MMp00 0/R @`㜀GPP 0S P@ۍЍ D @᪑`D @P 0S  P`꼘*p@-0@ @P SP @p@-@@2O-3tM0 S llh00RSX3 L3L#0HDC4#S8-44tЍO(  PL  /  + p0@`00ԢԲL<` ( L\0@ v嶿WI< h`VV#W@Pp iL<0@'ph0PxSiSbP 0'0@$ 000 L<0@ 9yv\-\mPxjL 8PtЍ0 0C0X10S 0`S$0` S\"X"h0SS   ,8,0dS X00%U0P!rd0 8 l*%Hl*m*l*y%u%o%*l*l*Ԏ!2Om*bA-MpM`@PP 0pp;d!d[@P TTLR벖=< 0ۍЍ aD D< pPUNL U`k (p0P 넖 x0S p T0TP 8 k8 [E걏4%*l*0q*ۏ0@-:P@-L@4#S 0  70#S 0 @-u%0A-@P` 0 P0: 0lhp ?z0@$a@00S$`V SRm*|*l** 0S 0 0/ R  /0S90 `0p@- P0@P*D` ?Kz0Pp UTp$/pm*|*0p@-P@ 0 P0: 0|Jx` ?'z01S 0p@D: $ P\@P@ p$0m*Z|*w@-MPM@T 0``p/VVP   忐P @T@ۍЍVP @p@-/Po@P@p00/00@P 0S ꑐA-P/p\0@oC 0T@@D4{ZU pDP@Dꀐ*G-pP`04PSpM@P`0PP0C0 T`4 $D@꿐|*l*ɐG-頡FPTp A$`Pt&0@(0C0V$Q@$0( 6帓00v`PPEPP jᛎ @$@@(`/ɒ刎 0`0 @ `P`D0P p0@0 P $4 |*l*:@-@]00$D |*0@-S@ 0S 0S v 0S p0 Pgd T` R 8dD0&F$ ЀP 0S00K^{|*p@-@`PP|50S ? 0P0 @/5Poe0P 0 00p跑O-2p0SlM ||\x20SGhaPP P LBD0`000@(Q /*` R 0?*@a0Sf@01 $10 %1 08`008<0@ q p YLlЍ 0`0V@ 0 0/ك 0` @T`$ y000 0 0($00S0,00S0(0 0S000$0S0400ᬃ@0 1S0 00᠃@l*%ȑl*P%m*|*m*m*l*C-20MS 妻Yr 0wP0 00;000Ѝ PP Od `t X8WP @4 $e $@0@D_`P P ' L 1RQ rQS $0!SP P0h> 0 P X1 D1H1D10S0"(P 0 AD@(C@D\ ((00( CT( (0 P < "< 8 R"8 4 R"4 0 R"0 , R", t< R" l*%Jm*|*d%͒l*m*10q*m*l*L/ '!X6ꮧꐧ0@-P 0q*q%0@-Q 0@T0 R ||岺0AS@ ЍH0 DPi( u%(m**%}%m“p/0/@-x 0 RS T0R H0P88iЍ S ꈒ*I0q*ӓ%A-D@p 0 0SP( ` `w `舒*L0@-  Q0 0P ,06 Ѝꈒ*0q*%@-0xP 00S@%*S` VP@` 40P , $  0 Ѝp舒*0q*U%>0@-0@S 0$P B5/x00SP`P 凇qpH0P@`ốF 0((@ Ѝl**l*0q*%p@-hPh@4S 0SP LLH0H P0000$R0p4<'눒*0q*m**0s@-0@SP  40B3/p00S\0 pH0P`@g 0((`aЍpl**l*0q*%p@-P,@P@pP @T} p@-X0XP0SpH`@P FP  d2@pl*}%*%;A-P 1 a051q0S :p@P 00PIP'2PBP 0!lt4PzT 0H000@A(]l** m*l*`%Xpb*C-paM! Q\ X 0 00@! P 0A0 08 !Q 讟 0"Q/X. , P  0 00`  P 8#`Rp000F"t Fd峸00@ LgEЍp*%v0m*%l*&hp*ؕ̕O-d@0EMSP8a  <<0 @000T*0 ?o2Q03S 20S 2 T" d0S Eߍ0S{ 00p0"<0S 0"p! 0tPEV- V V: Q  B B B 0 0m"p0H0S  0%P 0- PO 0S;  7  B B B 0 0>!  B B B 0 00@! V     V !p 00S 0@^  0S  V     V p p \ L l*%ul*pr}%Җ+<MXh 0P/00S M}%*P O-5M M)$ `R P  50S@ލ Ѝ90dUY00@T GL500RSM <50SI,9S' 5 05%05U \EXB N00 (4 S B¬@P$ʠB>B@9S4 B.|0T %Bht@ T, V@30T 949m  ijrB 0弰 BPq(4 S B9k R ~ X3p H 2\AR(@3B0 050Ȑ30s33P03Ȑs0 20S )\屶00-40 S 0|#R Q`SÝ\U J $ N4 N  ~ 1 )a#0)90S 0)k(PU <10S1$10S 0 X `y 0W0) B?W00pBS @!W<1<0Ѽ ?pWJBIBE`FVU /'4S 04#0 YB,Iꈒ*(m*l*0q*q\:% m*ڗ.Do2}%l*l*%ɘm*m*5A>f0m**O-dCd5)SW0pW_`R00yu0SW  0PS9 S00P0S 0S ˵09 R ?oV20SJUMU5D R4 pGW`pVp``宵\2 RD R: R; 4<壵820S>,P:i %+ :s909909 Ѝ0 +"+R ! R  xmEUY0+5p`PlP d<\X (W`e ދ0S O P A00 ?ӂqp V00S |70S 906;#;S T%kE+Xrꈒ*l*}%l*%%0q*l*чl*+9Rk(m*0*0O-t'BM @R MT'T7PP jP P Bލ Ѝ$W0S70S  00UP 60Sf KHE B ?<960h]mh~m0(04%48"8<<HHLLimfmcm xx||Km9^EGmEDm:^E@mE@%0A(US0 (12222( , 0 4 8 @ D P T | Z40(01@ 0D0(02,020028 0T0Pp00|`P$ 0PD \4$ R> P<(4 R $ R %3  {x u upro`lP i +u0/ဳ䀣 0/00#00 20 0 0/0?,00#H0?\0?d0 0,0刓吃(pX``P☊20R000%60"`20=S" " \" R0x30=00 2R 00# |# #X0/80\ /`0d 0 %0L0<040h0 aRS! |m#3 h\f P!0!! 0AQ  ZI9-0CS A  R0 R R 0N\ \0\|0=0- 9!sl*lT*l*%@} kl*}%} %F} (r=_C-2BMMP0000 00 Qa0S q=܁0=P  RP!0AS[0 =0p㄁0W\1hqPP  RP 4!=0=0S p20000000H00%"4080&"<0<0%#L0@0h0D0"$000 0@-Rڐ0=ۍЍx0 l0P0d0`0S L0D刲0q*0m*T*p*m*K} m* %m*֛O-MEMM 0$P0@B@@<hSD 4 4R 4S{ #404P |DQyD$` B D 吃夠PEN␓{D0S[h 04;`#4 "SQ A 0P3/04$!0P+s00@ @"͡3( 0A E6/0@0 GR00 G0Q0'G2P004SQ 0P3/04@EP0 C 6/0@0 4S; 4$`0?0;DC0 4P%x ?P~ ׍EލЍ `4SQ 0P3/G+p0 G#͡0 0A6/04G+p0+ G4 $  BRPEN0SP @0S1P@0S( 0$00S  B0SP D$R00S5 00S \0l 9P tlfx3  PPmP0SY0m*TE*m*}%00q*l*a%| 0 0q*8C@-@0SS0m*0O-gM< 00 0 80 4 @؂  P  0 @0 0H0@0LP0D pPP:P S  S  S;  S 0 ``p SK  S"  S<60S  ,,(60S  6f0S -Y P@ 050S  Ѝ50S P 0 L50S  << 0, 000%`,,;0S40S  40S \  P 0 0 8VS : : Z0 0 0`40S 0 H& 30S  ]30S30S   ?| P 0>   Z 0 0 8P30S` P [L 0  0#`0 0 020S   20S620S   P҇] 0   Z 0 0 820S 0 $m "`f0 0 0= 10S 403/    !PDZ00 0X10S00S 0 0 8_ \ 00S 0  4\  03/Z 4   00s@ 0q*Ȝ%l*%l*l**u%`CE\E!*l*7Jc8Cl**\FGW՝@-1M( 0  S != 1 1R 4S5 !4pq04@0TaP/ P0S  R+* SR-P- !0 010000 QP 0PT 0$M gP ЍPB0P;C0P|80S050 0040 @ 0@0 00m*0q*TE*m*0@-|cM0S llȮhChS0S YWP0#0,,  R0  2r 0500K Pr5"0C590C990C9000|Ph|n x0S \2d"`2Q090 9<@D@ \0@0X <@ DD@꠮*P/_*ܥ>|­@-뼳*0@-6S 렮*@-wytyqyxnym/l`v@P" XMT : G <C4ws, =@s*wX*@-y %0@-h@  0@ 0\Q0CS @C&p@-@Pp00Sp8PU``p840#U :PX0Pp4P8P P XPp`P -7@- 0@P0h 0P0S0! B Ѝ0@Ѝ/G-P`M`P x@䠟 T0D 0 S ⊐`Ѝp | J ]  ^pG!0 l =0`# $C0  .0`  W0B^P w&d_O@-@`Pp@"!0# U 0 x1ph h- \'PP@TP,P  Ѝq x}-,Mx 808"40!00!,0 (0 $0$Ӱ%-7@-x`P @XT@ R 0@  Q000 Ѝ0@Ѝ/%4l*%p@-PP@ x0S 0CS 23 0 0pxp@ TT 0 0 zx, ,Up0Sprl**.A- `(p 0@pЍ P A-`@P  PP 0)pЍAp01Sd0 \ 0T2Pp 0` 0S `` F(P `Sl*%WqC-q@1MS0`o1SP1SeV1 |묁XV 3ЍCVS 1S  D1ЍChV0`p0S) S S  vX t@ KV(ЍCE  A vX   v X t`& TT! ЍCVЍl*%W%4~D.Ŧ;$4 0Q 000/ l*%G-AJM1MSp{=\g`0 P$v c4F0 0 Fapp 0 S JލЍ;X P0vA7J.H0 0G1$HL  $`000P Pp4w Lr0S8k1!0 l*ڱA-XQp1`S1S@1SFV1 {1SV 2AV1S A 0gVaS D@d0S VAT0  pM1S XFQ 1S<> AVl*%W%4DprOA-a0 MSP@Ѝp R  (|P10 01SL0 D61S*]GP !)βl*%WO-DMhYp2 0S 0 000 (y^P (P(0U%`(` P@PDЍ`(P$PPv (  PP$0 \pDЍO(` 0v ( 0C$ S  M(v%Pp㠱吡v00Y0S Y 0I00h!,b,p1!0< 0(  (`(Pv ( q (V((0$ 00 0 00 0 000  00 0$P 0 0$ 1SD|"!!!! ql*β%lB4 C-M⬀p`` (qW0P0 0000 ]PPQ ЍP@P2 PP  PP 0p$ЍC 0R  '0W400(00 P( 0SQP x0 Pp0!00(pP0Slp1SX`D0S U 0 $Pβl*lB%4J0@-P@0,M08PP0 ;p,Ѝ0 R  4'0 0 1SL zZ{e[jKZfke[KK{K+Sβl*4TO-lrMM 00`S@ kTPL P"&J@ p Y:0@@  0Ep,oTٍЍq  ᣺p Y d&q"QPX !4%*1 210T 1S1!T0 0*T 1!0 0*PVk0 D  @Fk 0 D rl*` duO-锋JM M`P@p*k03<0$k0`400c?c8000S0P0S@TK&1X0+;4 0@X䚟4S ̪U08 *0<: 00U0*:4 0@p:@#TRT 1S d  GRT:T1L W00  , @$ 03p0 ,[,[੟ , [, [방倀  , [, [뀩  ,l [,l\ [P  ,< [,@, |[   , t[,p[  ,h[,d[  ,\[,X[됨  ,|P[,lL[`  ,LD[,d<@[0 ,8[,8 4[X 0 (, '[,#[ 'HQ ( W\7$R [? 0WS; XQ;X PD0o4EH0 1HL00 1`00D0 ,pML0X 10@sX&4 0#Q0X00Cs 1SLhX0@spWG4 0BWPE X.- TS/D44}pS ,Z,갠Z 0 R(0 R P n 0 0 0P3A8/%00D0 Jލ ЍW@ 섟 RH 1 H0p&H0S# 0 0 @3S+H  V8p$W"RY 0 00@0P0@3A4/4pGWpp 0 0 @3SL1R 0) 403001P  0Rp 0040 [*Y \o0 S P40Sr0 00   $ $  0`p`08哫*0S P   B ( P R0X0,( )0P$0 ,( n$0H0 p0@  !H0 p0/;㨀H0 H0ppn0 Sp HpP  H0p6W 00 0H0pH0pp Hp0pH@P0P p ppH0p 0H zꀵ*%W%l*4 ZAǴ4*ڴÑ ˔-7@Qд*hX %O-`qM俟=P`P^@P U#*0T?SD00YP.0p0/809p R  `1`SPFP`  l00 14Pl 0,@Py-  +0S qߍU !m 8ᓶ80U  0Sm0Sp\hPYPDhP,U ,hP hP040 hP040 hP hP040 hPy   h PU  m 8 7804U T 0Snm0S ,h P"U  am 8 k80pU  k0SOm0S!1R00:q{khP"UZ 0| 80 Rn aBQ @IKKLGJ 5p  -MKIp m 8 8 W   Rl R0!P  : <0<00140KS0J  X01S 4PU 0H?oU20S0H?oU20S0H?oU20X0S  l 8 ɶ8 W  Rl R0S*  %00140KS% 0400qHf4PU4KU* 9fl 8 8 W  Rsl R `0 01 40KS0 }DS01wXu40S x  Kv 0H0l7X' aXg zXpp0W0P.' @900D@8A@QjP 8BV08 4@V80 R@00Y@0-1 `0400<0,0@pl  @c40$0 6@ @XV6p8 80 @W1!0 \6\1"W04 @1@S4 pco0 jdDp@6pH (VpHP*0 SX Zpj-0E1 nd! `0 D000``pk- P1!0`1p00CS%$%1" = r[@P qߍOtor4S 044 (04c0(00p`000 4, Up:X~,s RT=0`0D Duf@P0=S x#8 R`  gfP 0=Se @#8 R @a  YfP 0=S #8 R  qߍOn( T W0@400, 0@WD@00S a1S, rY, pP PU-  > 0 0(0 0,003A05/00P9T"Yd(p@,PW\`0,S(P T'&j XqpF j0"S jE 0 SX0T R 00S* S S+ F$0Cs"& d0P T0Lp0 pT0npUXN0 &p000&00' T00.T0hp0l*f%жd r9 ص zKG97m.3Qo.n :|ݷ3N i|ZA%6 ϸظ*9'*7j0SN@@T T TF0P 00T 0@L l8@' 0@0& 000.000h 00PC \0p XW qߍOQi0S \0TP0 0 0t000( 0, 0Nz@-i@  | xl l\ `L T< H, < 0 뒽%Ͻ8Klt0p@-@PT`d P  p@0vp@^i @*}`@-M @ P  Y Phۍ p@-IMM @`PDIލЍp ?P0 j0 ldhP 0S 0S0 50S  TP @*@-M @ PDۍ00 R   4P @*H- p3MM@PPYW`8dP $dP `P 04dP00 S 6P ~P00 S * tP2  }t j`P` \2P TcP ,XPP0 0{U,00P` 0S徲X J1!P J SP 媲J1!@ Pp10S d 0c 0pcPPPUX$ P?hU 0 $V, )EPnP`ZZE_oR 0nPPhU  4S J P |Rp- 0dTNP*+ -@*7z hXARbs%ؿ O-@MM`;@.p p P @ p @0T @0Z:: J0S ލЍ0 0T\PL @P@(0HT*20Sa001!pZ0V90 ZVP gZ.(@bP0 @ZV㟹 0Z ;P xglZ. @ZoP lgZ.DZfP cgZ. |dedA@*^2Wؿ@-0`0 0ORPP y0@PL BRP Ѝp@(AP I Ѝp̅ O--lM8 4@00nPP~lЍBG0P$0  $[pPU  JT T T;H0l4lT 0`L6H0P4PT 01H0@4@T 00SZHL 4TP 000 0S0R0S,0 00 $0@` 00@TF*3#03 0303P0L0U@֋P$0@`(@pW6*00S 0dS0ktDᅄ h 0Xpt  ;Ppk P X&$m0H02R 0T`0BnS01080S 04 S? ?<0?@0,0S+ 竸0相S/H ?` L0, JH 0_?H 0D_ {{'0{D 0(0 0(0<0P00@0@ Bn} 001 00P!p\ `?4 $;Xp J? !4 ;$`p P0 0L0 {{'0{0` XHʟ 0_P 0_  0l}UY@%n:|;u;G{<e<O D.8ax0SQ0勤d400kS& Lp0p$Pp p$;Xp~ 0@U 04p$;`pq `0X PHɏ 0._ p0(_ 0@U00`  0_ 000 T (0S0gd0kSㅤ8 q 0pPUp3 4X`p$;Jp( 0U 04`$; p<p   A A{ {'{P0@0 L0  A A{ {'0PUHp Ǐ 0{^ 0^ 0 ^L0 Y@@-d C%A-@p4S`  rPT0DPEE$UX  !`PV00`P V0-04 `P $3MDPE@Dh*X p@-P@Q0  0 p_P@ R 0S L}#Pp 8O00 0, 0p$o#H%*m +܍+؍+ԍ+@-2400S (0 0 pp  **]x*G-XM0MS0 DpW,Q`@`$$Q0  V+0A<P 0 0 ۍЍ0 000nS ?S aS ppS qS x0  m0 d0f0L0j0 8Z***`% +&jA-X`0S L00S 08P8@p0Pp00 +***@-@L0@X2@00Sy&,0, 0S00q&***8+|*C-RP`tM  4ş4@ !Q RP ğE R`S u]0t`FQ ğ;   T-P ׇ Ä CR ` 0S $ LVb 84\ P0@04ßQk [Q \Q< $Q  DR?` R @T$P \P" P!0 0^\0 1Np$@@$@ l  P\p\H 0P 0 P p00$0 R  "DQ"00" t 0Q "F0S 0QX ]Q \QQ0 00DS000S+M`tЍp1A$^? l0HQ pppDW\Q> $Q" 傀ಀ 0R㜁F p1 B!$Q, ltH R' DY  DR R DRڵQ 1 00,Q ]Q 0 $R p0 Q,Q ]Q B + 0R0F p1 B!$Qd lXH R_ pppDW{  DRw RQ =&&+ +++*Pp@-@@P@T /-|@| |P|`0Sh娊 `0 pX@ P ,0< 8$0@pp@H%*|? +W܍+A-@P@p0S0P0`x0 R `( R0T @ 0S 4 P@` ԍ+*(*H%H+P@-, 0 F +P@-, 0 : +zP@-, 0 . +"P@- , 0 0  +*l+(P@- , 0 0   +*+IP@- , 0 0  +*+lp@-PAM C0@ 000 0S0! 7:P7 0S40s=PP0 0T00aS` 0` 0R`T0 0 0@0S0@T@ @0 Q000S0&AލpP-, L0 P @4  9P4+(+$+ +O-1M MP , 84 1ݍ ЍP $9P @4@/ PZ30S cs؃ 4PPQ / 3P㜃堓0S0S `V~`30S5 0@P/ T30 083 0% (3($3Q0Q3@OoB0B&Q20S  2` 0gP0002`P0 0R R00 R K@P 42H"000 H 2 2QU2@OoB0% Qy10Su 1@#P0001@h, Y_ 0hPA0S0X緪,`V pQ 0S 0S0 0@P+ 0! 0 00 00QQ0@OoB0{%Q|00S  d0@ 0P000<0@` + +Lx***(+*$+4+**,+G-JMMPp 70@ 000 0S! 8P+ 0S(0;PP# T0  1 1 R0 0S0QW`5 p1 0Sd1d/P* H1 @JލЍP @ ! f8PJW#P0ʡ _0S @$00 R000S00 !'l0P0i4qp P0ST00@ ,+$+(+$+* +H+ 0 0 0 0YH+ 0 0 0 0NH+PG-KMMP/* t2 KލЍP\"7P @<2@82000(ZP 2 0S@2升- P0 )qaЁ0S 0S 00 2@P -`1@0S p4PH1 \R0PP 818!00,1 0-0S P+ 0 0 000 T P _oR ]&l0Q00S 0@0aP0 00`0@ \ + +H+%$+*Lx***+,$+,+(+P**@-PAMM r) 0 !@PP0 ` pF I p0 0pppp0+6PAލЍ0S 0 `T +*Q(H+P0P  /<hP@-+)0$ 00 0 +*luPp@-o@P P `h'P T"P )pU ( P$0 0 op<h*0@- 0* +P@-( $0 00S/0Y +(**0@- 0* +Pp@-0o0@PP  00S 0 (/0S P (0 0pP@`P<P l4P000 0<+h*<H*J,* +0@- Z 02(* +0@- P 0?* +@-(@(0 E 00S 0 ,*U +<+0@- 5 0b* +P00P0SA- A(0 !0ЍPAaq0S000+0S 0S1嫅000PP7P00/P ,2HB7`0H L0<\04s +0*x**z<h* *s0@- 0* +0@- 0$* +P00P0Sp@- '0 0pP`P@P# 0P 30P x-l00?o2`SP@8 8 <00S000 +*<h**P00P0@-S ' 0 ЍP  K5P 0Pd00}S`00S T0T0H{P 40 0, 0( 0 +-i(**>h@+++0p@-PP0000W8@Ppp d}p@P p@5'1@0@ 0S 000媄 +*p*+P00P0@-S ' L0 ЍP 4 4P 0 P 0 +@+@- P& @1 ЍpP,! 4P @1@*P0 P` /@P*0@0 S0 0S P xP l0 Q0S  L0@ 0nP000$0@ + +Lx**@+*@-P& 0 ЍP 0S t R4P 0S0TP0@P ,0 $ :4P +@+C-`@ppPH_oR`VP=10S|1| ЍC΃TPda8E& X1 ЍHw5U@ 0 00 1"T:pXR(PPQ 0RP#Up;5|0@0 =FT V0P``TT TU@T 7@P XP $0  ЍC$+* +XP&J2 G ,@-$MP% 2 $ЍPN0S!3P 0 1C@PC@@2T(  NPA@/_XP+AE00S `嗂00CS0 %U0000 ,? l0 M0 ,)P(t@$" +Sv***FFY00@-MP 0$ \1 Ѝ0P D!200CS0(P@.0S0PDPP P@S XT0S0 @ʴ/@P @PS XU |0|T0S 0L @~S X ,0 R, +**0p@-p@P0 p@b$\0\`0XPS 0S%/0S0p@Ձ $00p +++*0p@-`@P0 p@<$L`LP0S.0Sp@(峁 00p ++*P00P0@-S $ 0 ЍP | 1P 0hPL00}SH00S <0<}00 P 0 +P(**%O@+P00P0@-S # 0 ЍP | 1P 0hPL00}SH00S <0<B00P 0 +(**W@+@-MMP`+ C@pET \P+ CW+ $C@ 0 ۍЍ @+@-P}# <0 ЍP $ A1P  +@-Pb# <0 ЍP $ &1P  +@-PG# p0 ЍP 0S L 1P 0S0,G  0P +d!Pp@- # <0 p00@PP0 +Pp& +(*0@Sp@-# <0 p00@PP0 Pp  +(*Pp@-" <0 p00@PP0 Pp +(*oQP@- " $0 00S@&+ +* oQP@- " D0 <@0S z0S  +*@-0@-P000P0S " L0 ЍP@ 4@P@$Q V +p@- M Po" 1 ЍpP! 30P 0"p`1`0S@1D0 0S 1($P%P 0 0S 0@T 0%`H@P $Q d@ H=0@ =B0 @ 0@3/H0T 00S00% +*/B|**[E+\8+0@- 0k,+ +0@- 0x* +PA-PPPPU㈀ !00P@lph0hPQ00`0 @00AT,0P AA +(+* ++7@-PA 0P00)00 Ѝ0P!0P%0S0P 00F0@0S 0 S  @F@00+TA0 S +<A 0 ?/P +$+***++P@-0oP X!0 0@kP |fP paPX0H P@<00Q  @4,0* +<h6 **000 0@-S$00 00 (*\* +d*000 0@-S$00 00 (*`* +h*p@-@Pp@0@- 04+ +0@- 00+ +PG-uR@Pp]P\T- ,`PgTP( ,@PP_$}$U; W P10S- D1D!0 << S4! ,'P`KU1`1@W 00S 0 0  S   A$ >$l0`h0@P`pP \P LP k Ѝ(*T*X*h*<]L*P*!)(U @-r0 +P@-P x0 paP \00}ST00S H0H}@QP 00 0( 0$ 0 +(**@+++P00P0Ss@-  0 Ѝp0` 0S P@P g0Q R   Lx 0Ѝp@y}$Ѝp@k +$+*H+Pp@- $0 p0@P0Pp +(*7A-P0 "0Ѝr0S2G}P70S10S 19}@a0 ` ?0封S Cb"c! !    c#A P0U0C00CS0<\5 P?00CS0@8, P7 (!S-PS0p00 p P 0c" R  c&0P UR PE 00P0 0 Sp(0L0 0 S +**<*v++*`%kP00P00@-SM  ,0 0Ѝ0Pl  ,P 0(qpP@ 0 $0$U@00 +*P00P00@-SM 0 0Ѝ0P | ,P 0(qp L0@0Pm) 0,R0S 0000 +* P@- 0 P +@- (0@P0 @'P*P00P0A-S쀟 00ЍP  c,P 0/`P PPP 0RPM@M@@-p > Di> e>00 +&J2P00P0O-SM  U 0 ЍP  ,P m @P@ 0R@>M`X-|0P 0Z>0hph`h@Р0000 0<0 8 +&J2<+H+(*Pp@- 0 0p`@PP P P@)p0 ` S Pc@@ @000 (V0 +M9T*\**xA-p`P@Pd0 A\>P r00,4 0 RU A)*(*@- PP   R Ѝ@P  HR  @0S00 Ѝ@`p +%*0A-p`P0 AyP@PLp @AP 00 00 +*Pp@-Y H0 p@00Sp@000z0$@$P0]Pp +$+*(*0@Sp@-9 `0 pX00Sp@H0Hz0<@PP0,;Pp6 +$+*(*IN @Rp@- h0 p` Rp@P0Pz D@P0P ,Pp   +$+*V(*O-MMPPQ  3 ٍЍPʴ#EE*P c@3pY 3 A 1MP`@)L<0p㓄( @0S (30@ @c0S0$00p`J2z2`0S@$S \S0@0# 0!|"  0  @#"00B   BR 0 F )b<0 gK`0S@iR0@S 0 F)b{<0SK`P1y d1 0S x10SL1h`10S ,0y00CS0. D E K<0 03/00S 0S 000CS0 S0  )t*<00000h0 Y 0pS7 +k+**E+&*/*[(***@-@P 00P 00P}00 -d0lM jT00S PD 0d P,00ppy****-lMKP00S P@ 0d P(00ppZ n***A-@P p0 0Cs0S13wJ `BP@ 0 B RQ@  0 0Cs0S13p@-`@P:@P , 0S!PR xz,p@lv,s*`(P %k@P00 0f,۽S!0R2;p@-@P ɽ00PU J OPp00p@-`Pp@0P< 0-0Sp h0 S] Ѝ00S 0C @pP2*FP/0S/0@-@Q0%Q#0S P   R   07W0C20s07W  Br&G-pP(P SR@ APP0   APN0 0010S / ?Pe )`@?P 0PS $2` P):`?P P)P :?PP000S`UK N0S 00S1 @RđR0 d姙 TvAP0 0 U ])Z)W) 0 011 则0Ѝ @P%) `): 0S0006) 0S S St0 0S 0`S@$)H0PU ),P_*** - BR0 R  P R O-@M M pPE$@@P0DHLP0(,$00D (0p0,0DHL` 0 0S 0S X 0S@DDHL`0$(0 0,0`ލ ЍP0V0 0S ;L@P `函P P傽P @}P4Ԙ $Ϙ000S V PU@ /LV@0S  e9P @0U0C?o20S b4pWp 00C00p0Tp pW D9pPpUP 0S 90P00$ 0R 00001NE+ #9Z0<03 0 048j)3 t30S6Zl# d(@>0P0 $3@@ (:>0P@ 0 @(0`0 @i0 `0PPy P00@tPS 'P Y0@ 0'T00STeU 0S} W +X8+X8+X8XP+ 80!0 4Pp80L YA+ P08E>00004P1@@DcT@@/=0P  00+P 0x8 08 04@ 0R 0S10}Su0S @0S 0S@0P/eKP0Y8<00 @ *@***G@+(<**%B +%n8*O-jMMp@lTtQx|Vύ<84PLH0 !0PX0A6M0 0)p7 4A&H8&0Sl0sp0st0sx0s0S|0s |z&T>0S0 /JP&&>0S 00SU  0o 0 .=0S |P' Ui=- (0S L(P$.0?0O0 0 (00 /BQ /p>0S-@>P R* @,0 R_{GP<0X 00|ST p30Sp<0Fd 'ZN PZ> =  Nl,6<`0S00  U ;+ 0S 00S 0Pz 0Sw %pEړ`P` 0S :IPSEX :H=`PW >`0SU 0S[ ,0 0 P$P %;P  0h![/0d1`1\10A?W/p h10\1S 0S dAT! 0S 8FP ( Wj0 0JM0S 00S P `k%dMPMύW0004!0 8!e4 @!0R PP000JT9e/01010{V`P VXK04 0 xP|P|0S4 0om T  $P<哑jG0 0  2 @Rp ]G0"0C?o2? VG"0 "0AAt0 S ;S0 oBP 0 R RT 0SB0S(0?&"( ,0 R /$ $ T @/͡"͡hP 0o"@RD á0 #PPh#PP0S0S60SY#@P &X000/R0HL0$/0 pww0TppT0 T`Lp` dFdP #P U pW70S 70S7wP $I80S @DTH80S TX~~0 0S( PZ0S= S E#d8 8`00S0T0SB uPtH  #P  AP( Ue g890Sg09 Q bX) Q0h9 .W|9#)7 9R.sr . 0A3/@Vp:@i O: R0 0:QH:G`*`0 0 S .lm,p i+te*xa)"0S,: 0R.MRzAx0S C000S <000S 5000S .00jލЍ0S 03/0S 00s@- P@7P  7P0P VЍpP`P  7P 0 FyUpdP Ѝp@| 0S S0S  t70PP0@-Mh 00P P10S 0S00 0 Ѝ/ qQa @T0 S 00S 0s 0 :5P 0 S000Bp@ T dL@P 0|S |00 0S00 0000** H **8*XA-` M@p /000@00P>0P/S:S X>@HP / </p$ (//@B@P/:BpP @&P " Ѝ@/000p0 @@PW@p00l0@@DcT@@010@0CcS1S@TU +PP00/@-}D (0@  000rD@**@-lD p0@ `00S T0 0Lpp<0000S OD@***]*@-FD@\00S P0 0Hpp8 10 10S ,D@**]* d0@- zT00S H0 0@pp00 101000***]* + -X0lM@ Vd @.80 00sskN }***@-0lM@90 0 00 0rS sS ld d.d Xo.P0 00ss;,Od $* +*@++M**%@-PP`@ @0@ss00V 0ss0000@? bFP UV 0A0T0Ѝp00CS0 Sp0 S 0 /?O-TMxp|W00ʿ? p00p 0C_C0P`0V0W B@40 @040SD H 8PZ0S= S DO0 S00 @P(1C0S -C0#S )C|0pS `1 R R 0Ha# 4Ctp uTЍ ? 000 $@0 uPPB0S B0#S@DT|0S ld@"\{4$0V 0 `{#N"00 "@B@**O-@BMMU@ A'#? 0a>0@@0`P5 p`5刵P<00CS00 S(P50S5U <% 00e +40We S00G00S+ V-0S 0 S  Z  S800CS0PP00CS00h `30 @P00CS0 00 0 s`83 ap0SS 00  00BލЍ@d3@x<30S VW@@ c030!333 0jgV S$ " R 5U Q Q$Q V VR"d 00H"0M0V T"  0 C " T! RBd@Q@T [ ! @ S)S   @  @R04 5T dT(S@ V-S R !   A.U PW040 00S10S 3/1U 0   0ZR\@\0 RY P 9/ 10 XS P 8/0E,*| | +**(*****B* |8+ +&l*-A-` @T U 0 ЍAЍ/0p0$ P xLi2 h0h ;<oB0@S ~P 5/h* +*| * O-@FMs M` ( @? ? ?0$0`30(0$ 0H,@K0P S@\0  3 Fލ ЍK0 @,Q(+2@@Ȳ@aGT  ӊ 2 K 0 PD0P|2d @P `"`dl+ Lh+0S 00S , 0(d  iPP dl@0S00?o2 -P i?0@6bK6 D01@,p  dD 01 D0(66S0d00 0d0 CA>0`PS UP /P +00S t0 |0FOP@0H @00,`@0?*p* + +(*c*/**P* 0O-FJMMsn0pܖVXv600S00p  9P忧X l6  d60 9P<孧JލЍ(60 0 00x97S 50SZ5g5य़0S# Ե0S5 Q U 5R "P 0S 500CSL5lg00\=0S P97S( 544(%(0SX0$000(00000 PI 40000Z40܀C XSX @4`0(  $   TD CmP 3<!>\ 0h0$<` ((0d $r 0( 3?$r / &<7R |3a0 R0S R3(0s0?008'P30SC97S00000 0S   0p徦008'PL2 0 00 00I 0 g= ~p\ 087LP<否 97R] Sȁ 0S [Q0sN0010S ;70:70?70>7='<CL0S ,0< t1, >P!1 R  < 0 !0ZP 0S 0097S|0 o0S [[X  S\00000IR**4***1* **\**d**(*Y +^*p]*h=*v $@-2Bp`WLM LЍ@ pP=  p7 00011 0S<0 ?!tq((00 Q 00SZ=9Q ='/?@#b!"/}p =0S =0#S 履Pm00+0(60 8epp =0S =0#S S pEp 90S0 00 0 0VLЍ*4**Mb4U*x0A-H`D0 82Vp  R`RBR RB`2b  Q  ,0(00EoE?AA?1 R$!$! 1 (!(! t1 ,!,! d1 0!0! T1 4!4! D1 8!8! 41 ;0SV 0004 8 + R<00S0 @0PKNx,14S$`|3P $00|S $-P/$16@@80SR <80 SN $ (): (1RS ,1S $00-S0S : K:$ E<0S $ EߍD0S X: 40sl80sm*0P @- Pp@T Wp`W VL\ P  R/%G-@p`xM/T oTP ЍGFT8,j,a,1 (!Q@ 岽QPv ЍG{ 8S 0S `SP pP  0 吽@DTЍP 0 pX0   ) 03/ 0  q*_`h%8 $R!R(R3 R 8( 0 Q Q QG (-R ( R 8( "^'  ^ ,QQ(88S08 S08 ( ( !R0/\^^00^ "^0 00Q8/8S08 S08/*%p@-H0H@8D0 (8080$8P  Up$80E+*+@-A(8S [0 S μ@%0) P p p $8S 80pP\ UP 0S ,8S0[ (8S 00CS0 7{0 0` 085 8$ 0`3/48S 0S 00CS0 S0  P0R H@ Ѝp*;E+`%/[ H P/@-@P$ P  $K@-<@0s(00pp50Co萇%*O--p4p$0 KM00) T շ0 P 0 0SZP=9 =:k{/ A8`X0 P@ A{ Q5P@0H03 3#(p  `|#0Ϻ{l`X|T0,S(#  f$#帺`i0S f"娺`<Y<{0f"嚺0` U  S  RS0|"1f 0;#;Z0S;#;0d ƒ>#/+"+ 0"%+?;#;0@#5;DE !i0@SX `U0TQ1QM!0 P EP A Ak{H{7{ZP!`d9XP e0 !1P<<@e 0 !0 @0S  P0S S d @ d0 St00ppb .A(*,*`+@*>@+|Q P+H+]*KߍP@%U[0DE?@-1T0@ R0 @00S 40 0,pp*1@@***]-$M?0 0 ݵ$Ѝ0-4M 00 000q1P4ЍO--pMM$EU] " pT4 0 P0 PU0( RPU4d" R 0*Pğ^ $0S  0sT0S )P 00⹝(40S` $1H`$S 06  { A0(q A{{zdWdp00#f*3` 3R - BP  * BRڗ\3\s"B P#0 f<#2 ` 0$ß R#3SPS0r 1"000f0`  $P(0 0SZP=9 =:k{@2 AP09ڝ A { Q 5 P;!%#3[QO  d 0@ f0 !屸1`P0Fx1p Rf P 1*!3^4?^03^00h!P0⏸\1 000ss$0S "%+0!iU; e`0Sf ]`0 0ppMߍ Y@.A`+@**,*p+H D+ P+X+Q  "/D**Q]H+@~^!P Pa0  A[ A k{I{7{Z`0Uy0P  pP<<`g0  `  @-/@S/@p@-Bd00` pd00CS00p ,P P00 @R0S"P7d`Qd00CS0*p "P \Pd00CS0p000S8A PA p0 0 `Vyp0 c`Pd00CS0p 0@S P,P \Pd00CS0p `V0 0 *Pp@ꈖ+%+A-pp@`P@ .)PP @P PE /!P@OoB@ꈖ+O- U0mMS p_DPd /0S mߍ80P.0͵14PPd(0P/S SUpE P\4PPP P,$0CS0 p, P P P0 PsdJ)P P )P d0pp˳P 0? hxdxdp P 0Sd0ppP0? xp P 0Sp0S di0 P P d00CS0p`2`V P Q82<0 0 dAQ 0p0 1@S P0S!   Cb"c!   c# 0`S<1Td00CS0lp0 dL\0\p 0 p P`, ^0#S^0C0 h xP\\ q*++ + *9<X&*+**@-0 @0S劜P  P  0 00@ x0 lrP T0 LiP 00 ,`P 0 &I$+ - BR0 R  P R <1A-0aS0P0/P3U P 00.S Pl`1h} \HIT1P@  D(AP00T,!,!,0 $1$ U 0!\0@p000 00000P0 0p0S000P0T h0h0 @U t0'(P$0`6U*(*7****lH++؍+܍+$+l* p@-@P 0x 00p @0h hP0d Q0 P0P H0@D0@ -80@0S, 0p**+++*4*d*h*** H0@- 800S ,0 0$pp"6***]*A-@,Qp0S `0S ppX00`PN400000S p`0S pp:p000080xT  E[,p**4*8+`O-`"AM |2 MR0pB h" R S4 P B04 SP 4SPP004Aލ Ѝ$Rg1+;004P/S ++PpVp們0| 00g000000000S H1ot410N 1 R100CcSppW000S 0oW 000000⻰$RV00u@uPPT{ P00 +*+*t*z(*<+,**P +*A-Q0qS0`00@S Q`Ѝ0SHP eP u0 R 0000@ Pl00}S0s00T 0S$@,S *(*$+**& +O-쁟a0AS04M00qSP Q 1iS4ЍPF P0.0l P00X$P" H@5&P$,!0920$A$000 00@, )$P 0 "@ P 0$0娯qp00P0}S0s00U 0S(@<S D*(*$+ +*'*/3*o02@- wP+A-`P^`pZ LC@P  8=@P $7@F_ #@-@tP+ 0A- 0p0@S0`P0:P㬀" VP 0S 0"S x0S R00`P"S0"S0 00+*(* +s+*0@-M M P  @`%Pۍ Ѝ08Ph4/S# @ 8%P;0@TP/P9O-@pP`V1@@P`3:$`E$0P԰0Y/  0#T@1PSZ 0 10S 0R0 R Cz#0S*00 060 ЍX+*@-)L0@0 <ppŮpP0 0SP0 0)@Ѝ*ht@X+P  R @- Rx000 0R/`0000/0S < S0C00S/ S/0CT*L*_P*X*@-0 000 ‒0S R 0Sd0000S b0Cs R@ S0 Ѝ && @-(A`0S0 0 0 0!0p 0S:S50P0S0 0 000 p0S:S5000h `0PЭpT00, 0 ĭp(Ѝp**C-@\ᄐpA`\P ^T1:00"\ \ L|9̠^@2\\WO-`p@A R %R Z0  0 @PcUF 0/U-UA%U  GR%0R0PMU30S2 2"0S0mPE_o C0RGQ .Q\P0mU nU|2G0Sx2l" 0 BQ P082 R 8cU.U00  0" R10S /S0S  0R 01B^ 0 BA R : ^^/XR \/ B/o" RQ00S 0GSE.U GT]*0SPY*0SPU*@P0LG RS QK 0TE*/0S@*<0 QS8*90S2*+0S-*> @ S'*000GS0P#0!*X ++++/A-p`P @qP0  T  `00T  [!0@ R   `FVp`00CS0 X PpTD000`000 T00`%#C-pP`*!@0尐TO 啰 00@)ax0@P`0 \儰L00D P 0 ЍE+?*:V`%\f**O-M M@ P 0<`0  83P`\ I'P #\ 30S) P Q PUP ګp'0@00002F. 'P x"xF&F@hލ Ѝ ᝪpp04\ 0ێ ᐪp \Ў020(PS @ ᵫ(0, 0/(0, ypQ&0$S,F␡0I00S 嘫0h$Q000SZ=9Q =*/?@#b!"/E <p4&0S &0#S [&0AS  \0 0 PE0 P0Lp 0S x&0u& 0 ps0L\ |Pe&<00*w>*Mbc!2p@-@Pp@p@-@PP`q!P 8l!Pp0Sp(p@-@>P @-lP7@-@lp `P@-P0@-PlMQ@00 00 T  40S P O00 P F0 0 0 PrCcpWX 30S }@z@@`  Hc _P p`wP@ 0S @P@ R U$ a P@G J$T0S @P@q5 8$0SHLo0 S8 0圮0P 0 0P0 2 厮 1 PP 00 @T   $ P 0 0@T  #P lЍ`c]DP@ #T1 1@T 0P 0`V> PP)>000x0 0 0P@T|Q PP***0*J`%f ++**+*]E+**++7@-P} 1 Ѝ0Q0S 1 1P !60 CRtA R Sd10R L1P 0S0S(1 0P 0S 10S 0 0屭@ @W0 @0@O0 @I0 @C0 @= 0 00S 0S +* +*40* *x*$*(*Az܍+؍+ԍ+h++rl+h+W++H+D+*00S!@-@0M, " 0P0S8InF@0Ѝ0@<*-A-Z <6 0 @++=Ȧ+ئ+@+++4+` %+Ц+0@-EM,P &P@P5Eߍ0 ,PU @ > ,9 x0 <  fTP#f 5k` % O-``3MP@ pHHϡD`4#(3 $ߡUPE =Pb00CS0%p00 R0SdP1s0S6 P#hP2x2l1s0S  ⮡ꄉ0 PpP1 Ps0S  P pC PXS,1s0S 7 P 0 S 1s0S <1s0S Vl1s0S 0x0`1 j P1- R @5 U 11s0S WpG'㴅P`D<1s0S0 " ЍS R   RVP0 Uq 0QDDȦ++= +ئ+@+%+++Ц++/p@-BM,\@P3L1 D$!1 OPP4`0<1s0S E P00 廠 Bߍp -@`UPp0奡J<⏥Ȧ+=+ئ+@+%XЦ+++Fp@-BM5,h?@P3X1 Pv0!6(1 $兠PP/4`1<1s0S ۄ P0B0 Q b_Bߍp Ä@`ⱲUP|@;8FC<"᭢Ȧ+=+ئ+@+%XЦ+++F0@-@hP4MTP 0P,,<<0   4Ѝ0+<+0@-@DP4M0 0P88 04Ѝ0+<@-M, ,PF A S 0 001 ʟ1 010000 001s0S 1 011s0S1 011l s001 012 02 2s0S܍b%Ȧ+=<h+@-(@ $s @+{t zt @-@1T㘟@$p@-@PPpwP p0@-AM MPAލ Ѝ0@D[Pƒ0|!VPPl1LAd1T@us弟om0!P0OԠu垃_]Y+:@R ⊱U 0S S 000 CT|   T l嫤t  10D0 S B/o" R  0Ci1t%vFҮ5+%|4+@-MP Ppop pl@PL\܍@, HP 1܍,0 < A++%0@-MP MgP(@f?o2P0S ۍЍ0@`2P55-d d寞PPTۍЍ0@@ 5 , ۍЍ0A+4+p@- P dd*@PpPP'Pp@4<X8P L|l1s0Sp0p@Fꑧ+%+p@-P MP+P/o"P R0 ۍp@1Sp`@P\ۍp@ P l! r R< < 5崢 ,:ۍpA+$4++%CKh@-  B㍠%O-P4M$`4~`=@PȔtȴ`0 `4$$双p0Z$ dQ Y  Q|x$0l P0\$\40X4L@4( 0$R!PS pP 6U Ut @DOo0B#10<13 B0lS010S P   Rpp+)+@-@ 2  .% @-0S  뀢+tT@-00CS0=p0 00S00`%+P@-@gP. ~뀢+ ꌣ+ 긣+0@-M0Q00@ 0HD # CP 0 @P00CS0p 0 ' $h00S0@oЍ00 p0 P 0S*000ꀢ+\2 `%0Aq P/P//0@-^@\P0 R NQ | 0\ P0\R@ @ 0$R ^ ?+PP 80 dÅe"Å^ P?d" @pef"/ဢ++p@-t哞p@pP 0TSp 0T X0h2Sl@傞 T 0T * 0x @%%+0@-P@4Ml ⊁⚁ 0<, p"lR < 0 2  s0-   S 0"!8 0r 0R><r> 0 4Ѝ0耢+%@-`0S@ 7P0S 0000q20\ @}ꀢ+ s@-0Pl00@0p`h R R  l R  T803/@ЍpQ P% %+ A-$q`AQT 0SP ̂=@P00000P |P0 uP0 tnP  ddg\0H@H  "  \ %+}`s %%+,0@-1s0S 0P %+(0@- 凘@0 埘ئ+@+Ц+p@-`BM P┘@0 S0`01s0ST01y0 (0Pn00x0 XBߍpB/ BR 0k00P y0001Ц+%+ئ+ 0?o2 0/%H-AM MGD,r,@=00000P0000@0 5Pڶ0 đ (P0SS WS BS 0 +P  Vdqp0S 10 S0Y` ՗1s0S ؠ0S Q  ]   |P Y 0@^S00CS00 S00 P0SȦ+@9 +@++%+p@-PH@P@p=P P 6P @% 0/@-o/A-@PP p 00CS0 `V  PP=ᮺP0 P00XA+ 0S P0000 !0S0R 00 ԇ A-A`P0E!S qp_ 0!0P0CPSJ0 `00CS`0p S X0 X 0P"SP, X0SP`0P0CS`0p SX0 X ! X!=0 0P0 P 000P lPқ0"S0T0A*8Ǜ0 0P0 p+`%܇ % r@-0S S S \S ^S R@ Br0 000 Cr@T0 0 Br@T1 0 Br\1s0 P P0 A-x@,P0 =`P`PP2 00pPF 0P 0V @P  @0S@0Sؼ*00@ PP?P PPP P 0!SP)+%p@-@MPP\1 ᧚ ϛ@P`u00u0ۍp0 P 0@ 0000S T  _P00 f (\Ph%*+4p@-`@;PP 0 0Up$u P`@p7@-@P 崕 I R B >@T|囚 Ѝ0(R( d嵕0PP O<P K(P +f@xt yt +0@-@M@0(@,0 0 卧@P Ѝ00,+x0 }$PPP P0S hp00@SPF +%+@-< (,p@+@-@ Ζ% Ȗ|mP | 0P3P xth 媖 X | 坖9Ѝ+xt yt ]cf}f@p@-0M`5PPS 1<1s0S |xAx 0 9 0| <Ԕ4S,Q( ̔,0F R   彔<P 81P` |0(0S r=R墙 00FS0 x噙h嗙P0Ѝp\XTP D凙%+%+= k@-0 s@7+-@-[{0 R   ЍЍ/,+-@-K{-@-z[0 R   ЍЍ/,+A-ARp`P@1T 8pP@`@DO-dM@P{0P 0X{0P0 0 X880 0(P400Pp`,@@0,@ T R3 U&T  (Z0 (d(0p ` Z0 000_o 0,@ @,@0RT ZPPU  w 4 JR  (0 R 0S0c} } 0S dЍU 3 ` 0@D(0,@-D00(0 RR 0;0@D(0,@(0 R0@D(0,@x(0@Dp(0,@pWm( pG  (0@Dp(0,@`(0@D t(0,@XWT Q ( Q @D( ,@I F ( Q  p >W :80!((PP (+) R  8 %Q  R P`(/cplh`8@Ht  C  $P $0`000S(/( 08 40TU (0 Q@D0T,@(0UT(0 Qt0(00@DS,@T!/D _|,+  !9ZrO-lM($Fz`CzPVPPG8@ 0 0Ÿ   0<0d2d@0`2 @0P 00@@P 8/@P  CpP@0S($,P @ S|Q| [lЍH<`@40S( (w Px  , Bp, 0P¯4 0;P00;P<  B,$( p( ,0RQ @(S<`@ 0Q@P%<0%8s00%4s00u0 0'<0'8s00'4s0\ 0w0梖 $P$@! %C-锑p0MS@0P t%`0` 00(qp@  ?sp a@`0 PƖ009 pppppW0@ @ [@Op`6t0` }>?@d 800 S @. @ C< A0ЍC艖0%%Xr%0@-MP 0: S0 0 S@ P 000vЍ0 ゑp P @TPT0dHS 8$   S,+O-0]M-SP M0S 4P ]ލ ЍOv/v]ލ Ѝ@p㰄❒P* 00S0W0S 0SLd` xpPH   @pW ]ލ ЍOz0: S  SQ  PPru `rP xc0v: S+p$(3 P@`nP2y  KҐP p  0 0M0 00 0S0S`-巐P``ŐvH 0S 0` G᭐P V ᥐP z{ RՑ\RZ{pPQ Pw!1Z[ d 0y᳑=ᰑY\p`2 0S!Pv000  P: b  0S -;pPP-P@ 0S;p<,+%%D "7McW`%0 R R /0@-0S0R @ PaPLU APLU @P AC\ 0T00 0@-@P@@  uP HFP00S D00S  40 -F!bNX(@++Ķ+%@-H@-CxPp@-P@xp 000/ᘩ+p@-@P0-S@@p GP0Tpp0p@-0@S`@MP0@  P@ЍpPU Py Xu0P0%+@-@P @a)00S@ 蘩+p@-@PPp00Spp@8 ꘩+A- `pP@P000 PP0 0@-@P P0P00S@J ꘩+p@-``MPU= 0S:  PP1 @@?T.  T  `00@ C @ F00 *S ?0`?1XP10EE>P `Ѝp"Ly 0@-08EP40P00P00FGP00P 84P 40P|4 t ldP00\<P00D< 4P,40$wX+lI 1~ۏŰro`+60  ꘩+0  ꘩+@-@(=St00S h00S\00S L00S  p400S  i0(=蘩+<+x++++0P/0( P/T++0 Q꘩+0 $ L꘩+0 G꘩+0 B꘩+p@-B0@0S 00S 00S  /<0S <0S 8S0,=t00S  \00S PH0(]0Sp@ TBP 0Sp<++x++++P+/@-0  t@꘩+$00S/0 R/ X++00S)B\+0  ꘩+0꘩+@-@P/ P, +P@@0P-0Cs0LS pp`P0-0Cs0LS0| |w pp |w00VpU Ѝ0  0.S= @-@P !P  P P ЍQQl0l0ӑQQH0H0ӑ Ѝ@Q$Q y= /p@-P63@P 0+SSLTp0+Sp@p@@-@@@    0 0蘩+ y 00@`/ဏ%p@-@lP     <00S   2x @p  ꘩++D0@-0S 00 @T@ZV@++@-@0 0 0@꘩+@- Bo 00S QA0 %+G-o`p`Cqp A@P VGBp PPVYpGWVpphp7/pXUt @X@TZV G '&} @$0 0) 0 00S/ȶ+pp@-@ P 0s  LB@p$%TG-`0S@p )0   ?990 VY†T00SZ L#B RP @%ȶ+iP 0S  R 9  (0///ȶ+Љ O-4M@T YR(,0 Q P0Q 05r:p$ ("` "RgpT  rq$ $$Q  Q Q 0nq#P 0 {   {  P  0000 ``0 PPI,(p0劦᧩vp}qpW [! SR@ 0?  0qp/ pAЍQ P"0 0PR*x2@0S 0 0 P P 0 2  PP900 S`05:`l109p1 رqC   0@! R!T / R   0# 0 )ϬTS? 0A0SzE0IA0026?00S3 10S/P,  0 09@@ 0 00*b>p098p QP@@qp00P00S 0&)ņ(\^# ;#;0bQT |` 0X R p 009 00R0II( ,0@ȶ++@-P X00S S 9(,0 @ T ȶ+p0@-@TI0 qp0@ @}01pȶ++p0@-^ 9 @ 0@&)60 P@ ^@Tȶ+0 R& 0@-00S0C(0,S0@ 0S!‚"\0PQU00000@/ȶ+P0001S0 0/$%7@-P R I0 0#0 Ѝ00R 0@!"0@@qp Ѝ0@J?ȶ+0@- 00qp Ѝ80098<@ q|/ 00\ /ȶ+A-p`z PP"@9  @0@  P09   U 09 r`Aꌩ+ȶ+@@A-p`VY@  @ @ 0 oP0 0y0 T 0 0o0@A ȶ++0P /ȶ+\ -P0S0@  / P2:1S0BS /C-@,QM@`@|0S1U?:ЍbS7 .S6 00C S 0  ?OP w>cS@U:l>0@0CS000000C/  0?NP @@@Զ+Է+p@-@P 0S`PpPQ P@dPQVL.>lP0S  p P,%%A-PP`p@ 01S E*0S  R@ *Sn#0S 0Sn0*S0S sS0 dS0 k0C?o210@@ 0C^S0SPP@u0C?o2Զ+@-XMpL@DM@M<M8MTr,3,!4!!!8!!@-@0@ +@-|0DM@T 0S P p0`P VDЍ`F0PS h+@-@0$ 00@S 0+@-@@P@-@G-0-e`C@M03s0؃0?000S0S  >30S |[0S 0S43.P ;P b3Pa0S HP R3PQܢ0S'80S- 08D0SeVYP0SeVi0SM /Sr *S1 S S(P%UJU!$"0ES00 -6;P p0Z 0S :10 i!A07S iS U U[00E.U S``dP eP PP0S`<0S P0 FP xP <P 00`P iV\0iS 0 $( 0SXP0@T_U0 ,0S U U =U Y\ P++++D+<+|+Nʈ |+lP++% %>  +++ + H+|+%X\+!0FAT+`p+|}L+%++++8++U@  U !UQ0-UQ00  \@0#0P2 PR 0 a0CS00 0-P  00P= 0Sa0@S @P000S. ,Y~P& 0e`0,0\0@0S 0! [,P 0Sj-P *a0ES000 *P *0 /D: 0*U @U !U<30S 97R0 <430S07S ;07S 00#p#|.10@S0 @007S9  P 0S S30S PP d0S7 40Sb 1#0CSPwd ;P $0FcS00 0 e`!0 S $0!R0)?040S  #/0 S 4%0!R0)?0 c!R00 !ı50S!R0 !R0 0!ıy v 5p 6!R00 !ıd(60S!R0!R0 0!ıR !R0})?0F60S 60S <`@0 S 0-70S y0 S 0  6!(gR00 !00J 0R eSd0C0<0S d 0!0<0<pP0miP0b!`Q 0!(8 S\Pq3IcG\80S0SO=F @ \8 D 8 H 8 qP- ;,9000!R0 0!ıX900d90 00!R0 0!ı 0< `0000!R0 0!ıp ` `<0P 0P0 0!ıP *P r P !R0p;p; 0>P }0P0 0!ıPs !R0;; 0i0P0 0!ı=`P \ QPXQ=qpT 4< ]P0P0 0!ı=`Pl A0P0 0!ıP 5 3=1<`P3)P #!0`0,`LPM(P 00,00  <=0=0S:P V<H- 1 0 p)PP U U ?Vc!P0> ]PP U U u!@0 MPP U U E!8>0S %L9PP U U.P*!0P.% (P0 0S .00S>0գ?00 ϠR0  B  ? 0 S /00S0?0գ?0/0 H 00 `? p?x?0S080k>00S/Է+@-@0 S!0O-S`PpM`V`@ pP Z:T008 "1 0T S@D0X0@D@Ѝ0  0B80  @/o0"S R 0CS0 Q  S P R 0T@180 0P R* 0P0 r  80 ^P ^ [0J0CԷ+O-pZX& RP P`P|` P [ ``F 0R@ 0R U *0@S0S  Ppp@-`R P@ )\0P @@@ 0ppM-@p M@p00PCu RT0Ѝ` `?<P ?0 `P?~<P@7@-@PPe Ѝ00;SP0;S@@O@U AU \00SCBD00SBC0mS$00P# 0 +++p@-P\dpHPV@^8^LP gP @P%C @@A@@T AT T ep00SCBp00SBCp0!@00CQ#h 0 DPp@{T ^gP 0S0^  PA0dP fP pip+++@- @ @+ @-p@++ @-p@r++2G-pWrPP{ P0`rpЍ [@P 0pqp6\ hrr?SZ (\0F0P 0S0MS0+S0GS 0US 0US0UES0UnS0UdS@0vS cS eS0@UxS 0@Ur0 #@U00Yrp*pL+ +p@-p@`PP;O,;0XV@` ` ;D Op *p+ 0 + 0 +7@-dP@ PP 0S  P Ѝ0+Po/@- * Ѝ A-`QpP P P@P%U0P 0 P l @N[T @P 6/P=[8 _H @-~|0p p0h hhP 0X X@0L L8P0@4 4 ̟%ġ%P  b r       C-P1M0SL @10SH 410SF Pp` Fi0@?oPU20S@ [PWe@UTЍPЍC 0@Sd@ 0DSd@ Td@ 0DSd@dT`P fPE!U@@ĩ++ȩ+G-@`M0PSS00/ @ R S"\R" :R R DZ Pp =P 0H3/0S@00Ѝ踉 P/@-&p P' w)_ZЍ00S @  df)\0PT T L' 8Hqp   +   O-@|`\PvPPPpᔠ唰0SWpV  S P0Fp@ U0 PPUP@ RpP SpP갟%%p@-@QP B0S R SppQ0 R*A QR 0S:/@ PRS:/p@-`= PPp@pWp@0 0@-M * srp@  - PP  000Ѝ0茩+X+400S/@-$@P P@++@-@P  茩+P/ @-p@&&0@-M@%oPo00S@(aP DP OP AP dP oPi~|0t00SЍ0 ~o0LP 00qpo00@E(ꀩ+8 v % O-0M0S 0S j0@S T { P 4X ЍR @p Pp 00t pPPP`\P# LP  pPPP 0S P``40SWPTnPQ ((@'#PP3`00P0`0 t~P0`0 -P X ' X0 cnP% 20SP `EP   @' YP nY |2 pd T2 KD2p@20WF0b,2P 0S P (oP11P %0S (. 1X P DP Pd1 XL10S X 010 (0 qp 000Sp 0 J/P D% 0 R  [ R 0 0P: l X .ꌩ++ X+ X+  h++l++T+|+++%++%8 P@- 0@ꌩ+00@-SP &@X+= XA-P`XpVZPU@JT[jP0+ 0 ꌩ+@-}P@ @0 ꌩ+ 0 ꌩ+ 0 ꌩ+p@-P@"@P Pp@5pp@-@`P(PpVU p@ Pp PpA-@Q`Pp _.W*WU|G-@@` PР @PUЍppPV7FP V8p0SkЍGꌩ+@-W0@0S @yꌩ+0 R/%R %R0 sR0/@- @PP l+  G-`d4d@p00CS0ᖢPu U   0DIS  UVp@P0 P00@- 0P @A-@0 0pR`@0S00 R0R@@0`P0S U   P@00갟%%O-MpG`@ P!Q[ Z@|P[@P) 00p00 0pЍPP P K PT VPAP UP00pWp갟%% @-@LpgPPP Ѝ@s/@,@@\`H0H 0P0pU \@U ЍSFA-PPЍ0S `p@@@vTPP D00< 0`VpW kPUk@-@@ _A-p@`P@0S P@0S0# CV* UR@ R %S0P @# CV* WR   R %S8 P0cT@ꈩ++C-EMP PEߍ@ 0@qp `,bkPڬ嬐P ` P:T0S EP @  f0pS`P  CP@Է++A-kT1@0SFn <1RpP> (Fa1P1`.`+``PZ0p000 0`00}oTP@pW PpTW Pn0STЍ 4PT@L+X  %% { 0A-0S@`@P0L :o@pI`P|T@yTwTL+ @-@@8P ,3P .oX @-M@P Pۍ@ ۍ1O-0S# 10SPpP 0 `|R@0 -R` `P PP <7#@ ЍgP dPP  0 n T P TU @T ` vv`0jP ᲃ@T@P@T 000d0r@P<`)@ᙃ0SS+L+ X  0A-`V8@P"pP0 PЍA"sPp`@@@@+0 `TnSS@ST ЍAOЍL++ 5 -M kP  @oЍ0@-@P0MSP @RR jPN @Ѝ0@T@0: S *@jR+%%@-M@jP͡0 00Ѝ0@-M0P@ jPh0 R\P0 R\ tu p0St00Ѝ0ꌩ+`+X+/F@-@XP P0@/R@-@ (0@0T[#@+@-40 R\00S@,@p+\+h00S /pp@-qp 3#qpP@ QPpp̶+@-P#P3#0 R/  p+O-q$M0S@P`0S\0SO@sP`@@100CS tDP`@ 0S"P`vu00 @0 00R  0嘠嘐00 000` 0 0000000P0 000`0HP$Ѝ++++,++O-M<`p@P8@V |30Sp30`So`V L3``F`V`utV-,0S 300CS QP ""]l"QP ""0S6 O`+20"`Px0X 0SJY/Y @ Pb"VD"0 <0 ut (20S2"0 000 [0 0 10S*P10S k*qp@PZ |"Pw"P<1Ap"P  !qp 410S E"P ЍO0G0 0 ЍO"V utS 00St00!20 0Q*)@P7ut`b긩+(+P++%P+p++h+ %h +̶+p+4+H00S <0P/000S $0@///p+,+P++'G-(pP@,`oP"V 410S(1`V``ut 10S100T T0 00'*`*00oᨂY Jq)qp00S@P W ЍGo!Vi V %긩++p+4++O-M`aP P @+P! ЍO!qp@PV00SЍO0Aq!P0 00@WЍw!pP@PT p 0Z qp0 @P̶+++A-p` qpP@VЍAu   0@2Ѝp@-@4P0SPpPqp @긩+0P  P/%0P  P/%@-P@p@-@PptP0S 0 0HS @ 00C0PPp@ P  B 0ꌩ+%+0/+G-`@ qPU  P9@ <Y* OpOU&8c@e{0 "0XPP00040000 (@0@000S < 0P00EP   0%+P/P // / /00//000////0/0/p@-@4PPP O4Pp4/O-M cDT {rPX  0  (AP  0'XQXQ> 00  0 'P*Ѝ=ЍO <O-P@4M(0X0 ,0ut@6 P4Ѝ40ST400 ?QE('@PPp,d00 0lp P6s[  ` ܳV0+5 cp` P P@Pᜣv V{" `?V@P,0S0 \3Z0 A'D30pW06 0$~ `P" R $0 S S`" P P  `VʏZ: P `@T_A[ x20S  P0 P (0 S  $PQ20S 0 @ 1 R00 SA@ P Pd p 4ЍO V  P0 0PA R TA0  Pp``@P41`!Z 0 0@P_ V V@P P P P P@Put 0 0@P_}l00S V V0 0 0S m@Pz`0 p+4+̶++++++4+<+7@-P@P ,0 R  000 Ѝ0+O-`P P pP@000S  p@+@-P @,zP00P  B@ +A-p`Yqp\rQqp@PA4X0 {P0T0A  - +0 R R /@-h@M0 M0P`p0@ e P*`0 e000ۍ Ѝ+G 0k*p@-P@@Ppp@-@P \R ^R3 R   0 tS jSbS4 0CP@S 0 S" 0 Q ŸkC P eS  00C00C\T PQ  p2 p@@p 1@@ @@p@@p@@pQ 0xS QSDSK #1SJ BS0 C^Rp!X8edR C&R  0 !@@ 0000 0000 0LS 0 00 060S@@@p0 000 0000 0 00000 R      R Z+ (%+Ű]U  \ O-PPAM@MPp㨕ep!PH)(pD)0,p<00?)pQp L5@P8u 0epP!0 0 0P0  P  P ,00 &PtAލЍ Pg `{P\0=Z* !Z' <Z 0J^S0͕ 0͕ 0$Ydv>Z =R+ =R-b [ =R<Z +Z -Z0Q =Z0 QP0QQ0QCo0S) 0 S(#S 0BS 0R\S 000S@  RG = Z* P+R( PE0P-!$,P3% R R R000#=R00S 0=S P,0E0P0 S0PS   Y PdP P P 0Su p0P  0%+%X`%{     U    &$0 RP  /+0 14/+0 Q/P/%@-04 ,    00P+H+X+D+G-P㌐剀'G@#GPT`ppP PHT LH  !  ?H =H @`匀+A-8p@0PS` 0P0aP +@-@$ 0 @z+P 0 R   /+p00S/p@-`@m~PPPpP 0S8@pPp  ++@-8@RP000KPl0 0O  K;D0&<&8&4&0&00+lD*;D+P+\+h+t+P/0/+0p@-@00P0 0R 0.PPPPPPPPPQQPQ&H&D&@&<&Pp P0 Q00+D+P+\+h+t+C-餁P0@SpM`"p`xx!0 0 0S[0@ 0 1 @P(a00CS9 `PU: 0 Ѝ 0P  Uqr   Q   R l@S `P 0R } yP,tP +++++%%+,0P$0 00S000/++ ++p@-H@P0S0000p01S 09&P+D+Pp@-`0 p@X10S P@@p(1@0PSP5pP/`P0@@S  1CP0 1C"@P 0S000|  0p  0d  0@@P 1CP Է++T+L+\+@+O-`CM00dwvP1S0& 1S8  0A# RfY) Q 000 00P20S P wv  1PS  ps000ap1U 0S k 0 S1C10510S)X4 1R.sr0nS`/ S`0F[/ 1R0Ѝ  ` 0rP  00KY1 0[/0 `0S% Uz% 0R 0Q0tP 0C001萄 S vI  0+++++D++A-p00PS` HP ` P 80@0@D@ 0@0TЍ+++p@-P@ 0p@2A-`p@@PGE$1S 0P $@@+7@-8PPU p Ѝ0@@ @ Ѝ0+0 (! ,!/+0(! ,! /+P 0@-P/+P @-@P$0P/+P @-0000/0@-S@ Q) 0S \Q@AOoB@0Sh Q S Q000S0000P p@-`@P 0Sp(P pG-lp0dES`P01SP001000PW PP- U p P Ѝ010vS00# pP0vDv0q# 0dc F$ F#} 1R P@#1 PR0(d0 d0 0  0U*P0C0#0BD001VX3 R 3PR 0 ЍG0SS QQ C0  0ЍGRP*pRS 0 0[P 0S0C 0Q` 100P0C000jPPUF` 0Q 000 PQ_VP P0SPPA0SV_0Sh bPd  0 ЍG*_V` P V10S t! RS 0  m_PP P P0 HPPP0  B01S0R4AB }@D pP@DT0CR0S*A8A@DvP  0 )0S pA++P+\+D+H++|+H+Է+x+%+BCA-A`pP V P = CP  V10S ! 00|QS 00 0S$ 8QQ 0XP< R0$1a 0S0S Y00S$1R0$aʈbPt` F F)00z$<0u0$10P0 0S $+t+H++Է++@-(@0S =\00+G-APpP 0P0U0S = CW`dq, `0S( 0 0S0@000Պ0 0C0S [10S0 0S N G7 GjY 0 0R  7x00S U d00SX00S D00SX    +++++,+0++<-0 R!  ^ !0+04/+0 R 00S P@0~0/0P 0/\!4 0 / B  0/++ 0 /+qp/G-p`@PSpP 儐u U 0 6 0W 00V@00CScP %P 0P0@P++PG-P0P`gPpЀ@ 0@D P V 000U00C0C0y Tʌ'P 0 BJ 0 Q@ @D 0@DSB++G-p`P@0@@0W  S #R0C00C0Ѝ RP   NA 0 rpGA-0PP@q1`EP q 0P 10+G-1@l`Pp0XXqp00 R00STDP0pT@+++p@-@ppPL P0S0 @p LP%@-p 0%80P/ R/0 0S 0 /+00 0S/$0$ R + +T+A-X@ 0S0dS 0p(0,`P` p U` 0+lX0QH0H 0.4 00/ 0 00++0+A-P@T  ^#0pP4 044 R@0pW T 4` 0P ^@Q 0࠱`@ 0+qpO-PP10SPU @PP0⼡p`@` V  RXWA  0 V 0 0PW @SU)PA `Y0 0 w W`@TP0 00  0` qp )@PPAp ` W0 0K0  0`qp @TP +++P0G-`p|PU0  SXW@ U W0S P)VP @P P`@V0 0 0 0@00qp0SP`,Ph`@W 00 0@00qp0SP`V@++G-`P@Tpတtu00V00S 0SP@`P@tu TUP踩+G-@Po0p`Ptt80@ p 00 0`Pqp080 ++800S/,00/PP//++00CS0 Sp0 SE[0 p/O-0P-SP   ~ ?p! bZUp UPRU@P0S,5@ 0S 0S%,@T ?>T5UT7WX C A  { 0 $ ЍO6`P @@ @^ 0A $ Yf>괟]S1+G-@P $`P( lpP_ `w   g@yz  0Z Pp@ ;p Tt p@m H 40 w pPvI]+C-`Gqp p]qp@@PPU.Y T0 0 Ѝqp 0 p 0a0@S@-TA0@S<0'@ Ѝ'P( #P   0+++.Pp@-9 $P" 'P= P !srp p^P 0 &- &P =06 pPtd0`@P\0 L0Af&P,@md006p+0+ ++G-@p`dP4T#0 5T Ta0'0s000Pp0 Q=@6T` P'00+@-o0@-MPh@P  ' srЍ08!P )=0 00&ꌩ+0+@-HP!sr@e 0! 0&0+@-\ sr @@@60P&6 <0606Ѝ0++G-6@PP`j>T6k.sq 00P6 <06PU p<P0PPЁ  G P 0+++@-P ,0 0R  茩+l0@-0`  ^ @^TSa04S '0s05S #茩+0+0@- @P0 QA6R 000+G-pP@P P0`Pb<`_<p6W @0+00S/A- M`pX@qpp6W @ Ѝ 0 PUP4P P0 W+p0+X@-  0mS Ѝ 0 Q0 @@P 0 S# B PPP0`0 S  Q0 R pV`PPp ;px00긩+17@-PU0P( P@ P\0 Ѝ000S@PP ;P>;A Ѝ0@~H00S< Ѝ0@ 0 0$0 L+|+"%6Q] 0 ꀩ+<07@- R P(0(@?@0 Ѝ0耳%+@B+@-P M# @0.S 00S Ѝ 0S 00 00S000b @ ` UP0@ 0R 00@0@$k%m+<07@- R P(0(@?@10 Ѝ0|%+@B+@-P M# @0.S }00S Ѝ 0S 00 00S000 @ ` U+P0@ 0R 00@0@$||%+0@-@PcP  @ ЍT@-@PP  @ Ѝq0Sp@- Sp00S p@t l0p`qP p@+qpP@ 0p@ L+++P07@- S Sl0 Ѝ0XP@T0PP `:c@ Ѝ0@W:0 00g 긳%%P/L0@-0@S 00 $0$ @l++h+P7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@P: Ѝ04@P,0  0 10 ꨳ%%+%L+ 0/0+P/QP @P/G@-@S|A pl$@0TxSPLHD~@|<z8x@%Bf A@--0@dS!@S1 CR&0C  R  0Q0 . Ѝ@A C#R  k Cr Q 0Ѝ        @^P @ + pO--PN<M`00P@*0 S  ?  0p00C/  0?pT*000C SY E0!R1PT*0@ S 0,S UH0@ P0EPE1!0C, 0UЍ +%%@-PMP M 0@Fݍ Ѝ@` @80Sp50 5 x@ݍ ЍU XA8" H5P0S(7%+% P@-  0S 0 0ЍP  R lЍX 0L H 0<0408000000000걟%%@-PM 0  0 x0 u @l?d P 0S>000D ;0Ѝ,0P thBX++"P @P/f 0 /:`+P/00S+0/@-@0S=+0/@-,@0S0 0@00Ѝ+K0/@-,@0S0 0.00Ѝ+x0/400S/(00S/@- qp@++P@- 00@ ^S00S00 Ѝ0# x%p@-P0M % @!`P@@0,S  i0S 0 ,R 0p 0Y0SX 0Ѝp40@0000$ cR @++u0@-PMO  AQA0S1Ѝ0RS'DSSS 0e C R  E C R    C R  S -S 1 CR 0CrSdSWS ^S wS     0  E000 0 FK N R WR Q S-00 0   ++800S ,00S 0P//+++$0P/0 0 0C/ +++A-PU  @Ѝ`p@@rP|`V 00S0\V0S 0S`@W ^P `@$V00>+@-0S0*00 0tQ( Ѝ *  jQY+^@-Q00P 0R  Ѝi@- 2ZB+P/0S/P 0  //ህoP@-/" 0LP/+ 0@-L   Ѝ+>A-`@Pᕼ0-S0p00Cp S  P T00W`O-P$M cLP 00S S03/0L0$ЍeL0 @Pp88 0 R @@-PJ &$PP 0@s093@!+P0P0h0 P @0+S9P 5‼59P/P0z@ pZ)EaD[@T>0S.nP0S -P00 0 +P0P0PmY   0 p0 @ =RP    B  Xp00aK[0(!00CpS0 0U?o 200@S 3/T_U 0 [ 0S00S000 RL@<0 0 R 0eP.00S +l++' @-@PM @PU`p0@ tRЍU  i  B U Rz  0H"00CS0 U0S U3/U@`x 0 AV00SXS^U 0  1 U# U U 0?o20 0 ?o2P0U U U W0 0S00P0S00 P W 0  0S00S000ESU U U J 0S0nPS000 00SD000V T0?[/ +vp@-P`@ᵺ000C S0 ` 0 Br ^ ST00p pS 00 000S/P/@+l+@-XP H0H@ 0S0S  0  03/$@l+ % 80S/S/ 0CS/$ %O-@pM0Q 0S [; 0S0 0 Ѝ`V$P  <0P  AAQ-P $YQY0 ;0@@Oop B0 0S `0 0S Wp0p %@-'PP0+%/@-0M @20S4P 2     I2 0S@ 10@@0Ѝ0! R0< "$01 S 10S 10S|1 \11S(  I2 P!2 R@ r$10P@ 000 0 R  RI0 @000S T0 0S T \0!PL 1 10S 1㊹0Ss 0#So @`+d+++(++%̶+x%+@-fd+@- - Ѝ@-P95`[@X@@ሹp0 `M Ѝ色@-@,5P  &/"+p+G- @$pP` 0 )!0 ֩@@ό@0p\p3#@- d 0 Ѝ(7@-P@2"@? Ѝ0@B@-<03?B3c/ $ 0 0 HЍMb@B40@-0@@T HP  0 舳%++@-@0@舳%0$R/ $峾+p@-<] 0$+@- R0 0S20 P00S@To p@- 4@0P 4嶻P}p@ X00S#żhd0`l`P}빼H0@뭻80@0@S p@ 0 ++@+%D+++@-0 0 Ѝ=+7@-@PP Ѝ0@(0 0  ~ Ѝ0x%\+V+p@-@P^P $@UP g800S ,0 QTȶp ++@-@1P0pSQ 7޶000@ @U'Qζ0 0 R0 ?o2 `;P :0W Ѝ<HP l+0`'0$++P+t+@-@P [000o/O-|MpP @`< W1 Y0 \0ACX 0s0^YP P0@ 0   W" !Q0S|Ѝ@00S0/0 0 0J P00CQS 0 XH R 1 @^AA0 $+/+p p p D00/40@$0@0@++800@-00 0^ʎ1C0@ @긩++@0@ 0 C\1/0@-ACL\@c0踩++0@- @P 0000CQ0@ 긩++`0 0 P0H0@-0^@P C0/++<001P/ R02:/+ 0A긩+0Q@-@ q1!0sr T0L1!0sr $0A Q ++A-pP 0RX@` P.X00yvt 02C!A`Ѝ踩++ 0P0PP@/ḩ+0 :Q Q .Q 0?Q  \QQR/ R//A-Hp`0P; R@10C @C" ,-0000+ꈅp@-@XPqp00T00S 00CSp@u@qpp긩+@- 0 B Ѝ@- ; Ѝp@-0@PS b0Cs0Spt 23p0PjS BS bSp0mS tSpp0000kD+p@-h岴d0d 0`P;@BS⥴N ⡴,PV❴⚴p\ l+ +%C-U0`S$M@p`d$Ѝ:S/ %S .S 0 pU@0S0S ?S \S0S 00@ 0X 00~xX@KXBX] DX. @4LH,X؀ PP6qp@40S(4 qP40S K30S qpm P j Pc P3 qp P$ |P0/~tG P3"Xq 003BH@6Xg Q0R 0 Yqp 0 O|2MP0t2t"0 \ P B B?M8/qp20 PP01P 1011]1Y1Tf- P \1L0  0R0:P0P P[xy 0RQ u0 ˹ 0R0:|0P 꾹lSA Pb ] PPP$0dP++8 ++X ++f ++X+=W0ꤳ%H0@-@@00SOoBټ(0(01x 0 L+l++%+0lꤳ% p@-PPp P$R@ @Tp `$@R@p\ @R @T @R \ p @$R \^ 0R0 P00\ 0/ R0 P00\ 0/@-@P ,00@p@-@PT `0S`0 # p`{0@w0000 S`@@0@A-@QP` @$ @,p0W0 S 0 R 0 0 ]PЍ 1,P 0`0T X0 @P +0T0 +*`$++A-`pV@  ` R P ( ^QPR(;P" ^ U!R ( ^ P0 0 Q P$^U $CP 0S` 0 00`Q!PQP "Q P \U!0S `0P 0S0Q  R \  P  RQP 0  0 U A U0QPA00  @-oP/+A-`PM8@0C0ppG4 Ϧ AXЍ H/o0"^ R  ? 0Q 0( XϦ@+O-pP@$M0P`@0L00SF RC L R Q R*H)  H0 0@000000 YH  )-   0S0S @ 00L0`00 0C=P$Ѝ@+ 0   /+0A-0@S uPT(`V0(0l00S@`p f(`qp +Z}@00CSrx++++1O-`wv@ 0 0РS ЍO;00S 6P@Đ00CSL$ ЍOڴVqp O 0ZqpV Q  P,d@ Ѝ%+%x++p@-P@T 40@@@ @p `))@++p@-PH@U p@^Qp@(0?o2(0+++p@-P@ݹ p0 0P !U@p+O-M"X70@40pw@780<047 @%70S 70/S 0Ï0@{t (0, Prs007S(00(00 0,00 `$0000x60(0, rs  T0000S (0S0 00000S0S$Ѝ00C000 L0H " 00 000zy+  0Sqpqp0S`100 00S0 @ y40S PIUPe U 0B 3Pm40S 4L HF0x4Pt4U 'VPR \400PL40S 8400S0R0S P4L0SPr`rP L0Hw3PPU7  T  qp R#T0'`L0 `    h  D0RPD0 T 0P@TX\PX( V( P ` @ PUeP  0 `hPp`PL0 )P  000 0`0 L0$00CS$0P20S t000 0`0 L0u408 CPPI h0S8 Z5 ` p J!` 0C Q00_0p 0S0' 0P a 00o0 0S0YPPYP(1Up1' '0S0$0`P0S 0S < @B X0C  BSp aoZ0Yp0pP0++++++ +++|+H+t+++p+++p@-P@ܷ  04P !U0p P$@+p@-P@ķ  0LP 0 Up PS @P@+p@-`@V000P0S0 r| 00^0tu00 U 0S! 0P tu !R0(PpVp00@00S 0Sp(0(0Sp p+%%+p++p@-P`wU 0S0P@T 0P@|0 pP&@x0 00000@pp@&0P00++@-,0PP+O-P3@أ0 404M`p 0P 0 X0`Sp$$P4Ѝ0  $$X0X8< rq ut00T00S04\0^ut 200@_ut$0  sy00 $0Y0 @$Put00V 0S 0$0(00X0 0$000 P#srG RB R 0A0P 00<PP7 0 Dqp@PK a%ut \0@P100@_V `p000/V0V`p ` p @ P0X08< Z000rq0S Z0 _P 0  0qp`p000 040.+4+0@-MP @tu :0 Ѝ0@- 0( 00S@+p+h0p@-@xP HP0 pp000S(0Spp謟%+p+@-$@$0S000{ @++$+O-0 ,M"0Qp 0SGPy pC 00#  \PH Q ,Ѝ,S0S 30S 0S(0S 0(0v0(09P2 X`@PEOqp@P[iH@PutTXPJ1\R0 0#Ip HBHb0 0 0(0s0S 0S >20SX` 1``FxZ@P 0 @PX SiX12`[@Put0`V@P004S S S ၩ0PS  0 QP04 n0S  HH P? 0 ^R0 P\ S$R 0C 0M0`0000 \P0C R 0 C갳%+O-pQpPpMW M ۍ Ѝ@`S`ETpL3LC  DsD4c PU Y< 3T R+FP2@DPpp@   @@9 0 pW "x 9Q@ "T<"0S000P ;04P S@ - Pp 0S 1T T0 0S0 0, P+P,H,,,,,1p@-P @ 000P @p$%@-@ 0  @0$%0p@-PPUphs5@P 00CS0}ep )ep0  e ,A-p`dB R3 RQ R P$0SV0(  R R ::5$0P ,`P0 P0!3PQ`$00P0PT0, PP (00S(0 #R nR0V ,0 0200#0$0,0$0d( T0R #R nR   RpG QT000(0V0(00P R R0   $QT0P $w (0V0(0 00  T0(0V0(0 , 6T,2@-|@X0  0S 0S00CS0dp X/0   ,O-DMX0`SpM00S 0S &`3#X0X0\030 `00d0崓XSXP 00CS0 zdp XX W"pP0 V0 X PލЍP2 dp0S /0.P 0.P p4S /00p0p4S \PP cP 00\0.Ptp0`0d0S00d0000S 00Sh /P0  _0 2 01_00S +冕+R P0 _+0x+0Jta/Jb 0d!2 P*|/\PP c43P\c ( p$pq.\0pp!l. 0`PS(0u03PX50U00.p0\`0P l000S SP@  0  l7(00(05 ,2`%>9 ,,,33 G3'3=3S4_3P@-@BP _k3P@-@@P  _w3p@-@PDPp0 _3@-T`@PP j 0G#p0 ?# Ѝ,@-`MQqM0S000@03 0@0S k 0^ 0 0S S ` 0ݙl3@P *0 [2 Pb 0ə00ڍЍ,|,,@-@P  Pt^ `p\0 P `P 10P S x m^ Ѝ,3,G-pA唁!0`PU , R:(,?0(0 &U# \U   0 R`Z &R\RP` , R:(,0(0P    "pr P qu PE ,  R:(,0(0    0 ,&A-@P p0R`*W00 Վ 0P P 0O-h/MdO0 0XPЍ08000C S0 0S4 0  P0 R `>0R*SD>0@o+P0 00H0P 0S40P 0 R =0R=0 0S= 0RR0S0S4 0 S0=0@oP 0-=0C>S00 L0 R: L  0` p``c0Sx<`l<8 00 T\04 04<0S ",H0SP80S4PU 0`  E˙P0800A E4 ׍0T P "0 t 004 0p 0 \\ 0@; 40({0 ,;0R$ <0p c0P 0S vP 0 ,P2S 0 @l`0S0`V: $e b00@ X:@囧0S ! 0,x\  @0oP y0 @09 [0`V: $2 /`0 0C0 $P 0`V:P  `  0i[ Gp  5P 0`V:w`8K8 e00 aV :f ` 0 0T00 ST88 00  0#<000p00007< <0 0B15s?0 0@c,0-01S ^00oS^ P0\ S0S Q0S Rr P0S0S0 s00Q qR   -,0@-  `Ğ\ @ T\    %R    , -p@-TA0 5S <0S -00$!<QPa0U&!0! R8  (P  >0  ,P  50  4PP bp@000\P ȦP @ 00, P$$Sp -X x,t,%bp@-@0` V(T  +t+d lP`PT p hP000ST @`%%4,-4@-@P P<9@P @0?SP@ p Ѝ/9P@KP 0S SDa440S000Wn4=4Z4@- L+$(v4%@-0@<TQ T00 8+0001S R0Slp@2TX` T@0$ @H4+T(8  @,+,44% -44444@-麡 +'5%7@-@Pϡ  ᠌0S 0@T 00 Ѝ0軡0"S sr@-@pP  p VЍ5<0A-@X``# ^p "RG ^<0d#N R 2@% 0p02#L @ "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L "L / 0p02#L "L /0S00//00//H0H 0p@-P@!@R0 U0 ,㯛0P01p$x,Xk,01//00/00/00/00/00/ 0  /\,1 0  /\,W00/v00/\600/e600/800/n600/}6@-@b,00/@-@s, 0  /q,v 0  /q,\6 0  /q,e6/00/00/00/600/600/600/600/600/600/600/600/600/600/600/600/}`00/͇00/00/00/W00/6sO/gb@-0  0Ѝ@-@ +@-  py,r0@-%R  +@-  py,k @- 0v,s, @-i,(0@-% R s,  @-7 @- 0e,b, M@-a, @-  d, (0@-% R yb, < @-  pq,< @-  g_, < C@-^`,< @-  V],  @-  M],  q@-Dq, e@-<`k, e@-4.k, e@-,k, @-  $\,  @-  r,  @-  ^, @- 0}n,k, @-  q, @-  _,  C@-`, @-  ~m, 0$S00 @-k, @-@D P d 0  2 0@-0 |1忇$x, p@-P( dP& <PV 400C`F V$P SuP4P 0CP  @@PLp4P P0S 400C`Zyk1SR !0C B/!?1@]!NRAPN P  ^Aжq0r0xP00S11A)zP`PxP@a@1S020-(PJ @$3@P, #0@S00 2P0CP?P <P>P P2P 0PTvP tpP1a;@ P qsx1S'ʰ1 ,@ P bs xP 00P1 RE40S 3/Pc PP c P,ЍPR0y 2Z 0SpW 0m 3/pg P 0`? P  s vc `wqc00x00AM%0 b02P 00P000]wQc ,7%8K8X-& T-8S&R   001/,P0 R0//,O-p`*@PP [ ! 0P @ Ѝ0Œ00 1\$<0,P0 00U040080 0<0<1@0q00D0`80H0, 40L0$0 0P(P1  @,8P/D0 R/0@-A1 P b@< {,O-dBp0 W`@4ye0p 000 Ѝ0P@P 0S 00@ [& 0 lP 8U0S 2U000 00 `[0S kP U000 [0S kP U  U0 00U P0IS0SPPk0 00k0S kt0#?C S TPU  ,h0Y!0Cs0S( 23PP PET,&VUUU @O-$MH0[S0P 0L`#Dp < G0Y0 0S 0g }dᨌPgkhk uk@` 0l@0@0000. 0ESET0D0T00Ө?0S0 CR C 0DS0  0eMkX 2 d 0  Bࣉ$R P0{ P>  PN P P!VUA`E Dwx@DP`0]d ZdWd@`"PD P AP;  KR !   ` D0Ox0@0!P`1 V0p00@  \`Wv`F`FV0p00@  DPE$x@DU`E¨` Y @ }@T`— R   BS0S 000 0 0|$ЍOw0Y S ,9&%A-lP`Pp `j@}j@0T `P@ P NP,@-P@p 00T0* sp@Ѝp0 00㍇ 0l` 0@ wo@t 0P ] %,9h0p@-P@XP0Ps H` R :FP 0S@@Q@pu%,@-@<,0g,0h,-@-@00|  Ѝ@ Ѝ/-@-00 m Ѝ Ѝ/-@-  ЍЍ/@-@@ @-@ @-pP@`M,0 0(< 0 00`Ѝ@- ЍO-M P`@pi@iUiT0 0aP 0D0PSX 0SU L00SQD姊PPL00PT]y@DO@W <p ˀPRWpV`KЦo`0 S`K0 n@PD@0 8PT0 0P00L00$T "<Z  Xo _t__Ѝ00D R00S 0S HL0X3#PptnP 0 (o똰CBaa ;|0 EG4ncP`CB`za}a,9X-@-,, ($ +Ѝ@-P@`$0 0 L 0 00`Ѝp@- Ѝ@-pP@`M,0 0z(/ 0 00`Ѝ@- Ѝ-@-00c  CЍ Ѝ/p@-Pnh@shp,@-7@- @傃nA1$UPU +% zH00h@PU %T jH00000S$$ Ѝ0\,_Lk,^,%uO-LCM@PP`@ j&@ Pp  PHCߍp@T 7 k0P0X Y Xƥ @=R@8徥@4ŀ0 08zꈮp%\, 1@-p0C-MM 0p@z`P0 PP* P kP 0S0 0   JPPSP 0 Q000P7xۍЍ00P 0 50 05ꑫ,00S/ 0P H@- k,p,@-T儂P nP <j@("Pq@_C-@M @再0S0|$P,  y.0S#a{P  o0Sl Y0] C)PeA@PaCo'D[*A^&'ЍP@R9={P'P'20S @`P'.@p 0$!P9{ X $P 0)AT PtP @P psPP 0\+Q !Sp 07'SpT+pAW3Npp0W3:X# @PQ  R@4Q p0Q  R@@P``Vp003/P,00  h0S  R l 10!p\k,$x,h, @-MM+@(x+(txB+(xB+jx(?PލЍB?P 0 T @@@@@ @@@@0&B(>ү-MM+ kx+L 7x+ cx+0/x u?P  i>ۍЍү0@-@M .1@@$#P @  qP A0$*!PRU)QX&Ѝ0RL00S 3/P 0$003/0$E*cH@P3P/[P+W@P':@P# 0Py 8y  0S 0_ Z'P @P4o0m%(!*00\k,$x,bٯX-T-@-@M ⬋0@@> #P* ?@4  qSP 00*!R00$Q )@P  0S 0` ]'P%|()Ѝ\k,$x,O-`M!  0X#*0S ` 0 SS 0Pp0 S00C `@A0 S:ᨇPP@ B pQ %S0S iSc %S, dS *0T PsS(200P 0 倠ಠ@ZR  @P %Q0@ 0S0 aRT @R$R0PPR@  T 00S  0! SD 0 @S$SS0P @U: R R 00 R @ 0QR\P 0S  S t00@Qb0cR^ 0 3/PW Ѝ 0 v&7@-@ PU ! O b}D00 Ѝ0llP X= L 7 J}ꩋ4( 0$[*k,^P #Wp@-@Q`T8080P00S0S   0p@2k,\,7@-@ xPU  }sD00 Ѝ0PP | |d00S TL 0H[K0 ,pH\,L/@j,TWT%s@-8Q`@6gTw ]qa|\ax ]faV2a\3wc 0 Ah@Pxx7 2o}P =G=\\ ܁]wЍpT- wX%yO--}Mp@` ~ 0p 6V 0S  P R- 0S  똵P >|눅P 9|npPT PfHF L- 'P<0B? 0J'P sCPP jC00包P凅P: @  t: :0S :MP : <5e0#0v 4$"0}ߍ4\ 3 34ވ0"!03140`040&2Ћы ` 0T40   T(0 P400  @>"!!0#   PV  XT 2t 0S h2P tt>̉0S$@0 B U0 <"QS m k 1P P{ 1 Q0V$2j@T ) @>0XC 0@0S@ @  0R0SQ ᢱ {0S  +P 0 #[ul0  PS $2  k,%ptbtİf@\,k,ǰpְ^,ٰp,0@-0,MP0 00 0\PPP@P DDD@0Q ,> ,Ѝ0@)\_ %%4\, -O-iMs?!0Z P 00iߍOЍ/Px `P<1P 0!00$`P z[p P@& [PupT00Z%AU0P 00GSW 010#S 00PpP@ P%ꈮ\, SjR-O-p0MT@X   p$p嘟 `V  @P'U` WxPPP@P L=H E0ጟPU m0'SP0U*S / 3P0 0sX/0 0P 0@ 0 0H0 yPX1Z Fqwp`PUQQ HPDDM %`ێ,Pz0尪S  W:-8 4e0 w=C$ C/Yw G00Pw=0夽pQ>e0 pP4000 P40  U/ -Ur0YR? ;/ 0pp @*<: R0 :P'P P 0X60,09Pt<FI0.\̟   0/P `0< B 0 0u`````VP00ۮtl= *D00lq0,ݍ<Ѝ>0a X4p typP  `sP pP;{ 1sS1lS+2 0P%QP YP;fpP`~,p*0x*0woNP\8 0\8WV*0yU l*0z\*0}\8@*0|w(:( R0U:$ R *  Q9ɟP \ɟW弩^ D9   +X9 @H- A|) 0p 0HAop p=SrL9)10@@ CP 0H0 H0Aop  A]YpP( 0W` 8vPSUppkvC D! J@pH p.0~p<((0~CP (P P P P P Pe0:4JP '0\6S '0(||~ pP 4l \TLD'8[7S/ ' =P&P86&A A~0\8{P )P 5&oP pz:4S 5h_P 0T&APڴ  =[L\80&8\8~Pp n ( sP0%08P n  sP0040%S\880\8P tn 0S 8%8P Xen  DssP000S\80\8*P0S\80\8p?#4S3P  0@?S @P l34n 0{HR##hRp#xß$`RX#W%R<# 2  *0S1 t P 2@T ^t HHht#0p0S l"T0S `"<t <3S3 UZ #s?00N?C0C lo0  0pF0pfPxP8A?\ێ80EpE,0x ,P"H p_U0S z|VW5S 5!1u,oobXfNtX60Sp0 <E$V4!S< "0 0 U~ x,ѱ\,%&%*<p,L u,ñ^,,,,Fx,=DZ,,[ W-m>iw}`r,,^Ҳݲ/" ,(3P[löζ,,ݶd%JP 01/ C-鿏`@(MPK}P3S0 p 0p :00 0p@0p00~/00 P 0P/S/00 0 /S 0/0 P0%R  @ 0  p@ ߍ2Ʒ@-p`CM|@|PlP#`0R\PP @ W<0080 `0(*PCߍ2ӷ`,q,׷ s,@-@ @k,@-0  0Q P @0@ 18 0/P $  Ѝq,$ ^,j,j0@-0@XMPA0  0@) P x x0 t0Ep@1P0/Q   LL m 1 0/R@, ,@c Ѝ0,4 q,k,^,p,jg,@-M@DUPc|P  l l0 D00Sލ\0\ \P L0 (0< ' 0, " `,^p,_,g,\,r,q,!@-bCMX6S $P \8lP9XT20S H1\6S 81020"(1PPr 010 ZW:4S / OL\@aU 10 A:4!SO *00 0 B6x3||1@P) 0l )\&T#D 0S 4!4,!,0S     9TP\6S U l9rCߍ 0 B,*Fx,[^,7P,Hh,Z,,;p¸,ϸr@-@T^ S C @TR \00S0 @B_TQ "#0  @ ! 0  @  0  @ S00\RQ @  Q  G-P`phM 0S%phЍ0L0 3/@P 0 @P  Q 1/P @ @t@0ᄠ80:/P 0 083/P@@ 0\ P0//!01000/ 00#0//O-`$MPA@T :y pzP00  0S 0S0S$ЍP P00 S zS, R ,0S R : 8 80R:P3#///A-@M`Mp" *0P p Xd5\\ SS=S 8 d3R 0 ,0 ڍЍTTչA-`QM p@ DP PP fPЍ(zPTP0 phP@$U@@LT @ @z80 @iPWG-Pp0@0Mw'PP @`0 R  PЍ 0L03/P 0 *x놁0 $xD @5$0S P @=i @9i`Xk,p@-P`o0@0S 0p@%ꉲA-0Mq!P0`L0 3/P< 0t@T 4/@0@P0 w 0w 0g$0S h$0 hT \h hw0S0C, ~%ЍXk,& 0S/p@-P@K 0000p@:O-p@P|M Y80P,0+`h,fP|Ѝ` 0S0 !X V 0S0L0H 3/P X0p``P 1,0000U/0 0L1<00 00pP ,0<<0@Dr@0S 0P 0@  !D00 0S0 !Z Q 0S0 L0H 43/P4 X0 0 0ؓ ( @-Z P 0P 0Pp PQ` QTPQH "P <080P/,/(// { 2kVp@-8@Q0@P@DPp q/Pp%p@-P@P  g g00pp@-  p,%@- { p8%G-@PMP N/{ g0 0 s0S1 0S XP a,P ލ|0S |0S1S P wP @l0 1h0$1d0(1`0,1>1S nP >(%0`>@FppԐ* `$_ [  $0;X 4` ]0S 3Si Xt *{ &{0`0?  `p䀍0P 0S0)#0C?o27 #3RR  0"R6p7 'Sn`F0'Sn`pF0'S``Vn`F0(Pn 0C QW > 0 0B,0!4!ßp0#0"`p`(P"P 壽P ,0!4!xŸ~0#`u\2P  @000@A0("p0N?P0S Jp zKR xz0p0K?(0811n$10 100 h<@qx1fP0p( {1S%4` ␠0!c 0A^ 0Y ,0!!0#P [0@  ,0!!P0#G0h `~W7ӳ#2AM}Dl,QNEFXZyBzK&L'Q`fs@-PM`p PP 0%p O@P  hPP 0pP 4P 7/PЍX @-0 0P Ѝ @-0 0PЍ䐙 O-aM,MQ0`aݍ,Ѝ@|`ᦿPh vPP - TvpP, U@"8T^+"e bV+bze`tP@``VnaV+"je+bee~,P 0 R@3 PUFh0$P 00S 3/p0$QCbbn`Eo`YG_FPEuP 0000!z8PP 00S 3/p003/pNo\RP 00 QUi $P 00S 3/p $QUZ ` p0 `` pxb.;8/ 0 ``px`;".6/0S.   d e0 x0Mx`PU  b +`P"  <OP+"db+K "`P .uP# )uP $uP uP uP uP VxT d  d` (wP4` u$x,p,u ?s*+y00A-p$0p@` P AP0 @ p> C 01/@P00pЍpP@00003/003/$Am~O-`UM MM.x0Pe9x.5x Qe@,Bf0Q@[@,0p%SppW 0,0,Uݍ ЍU  n? h4F>D 7 \4040@P#`ύ֯Np 54, Q~W <S <7h4F>D0C27\41 [ V?h4F>D0C26A\40 40 000000000 00p@ 0 p0}<55ps 1yt0 00 00000 0p@ 0< 5 5s qଔT1 @t00, nE "cx5@0\qW 42XL1຀`0pNόjppr຀qh p\  t00$? 000/0,0S00Ӥ?'N?,$#@`hT00,0S E 0S N?,$$L4pW@4 0}10  A 6c "1c -c,1p0!,1 101$14141(8H!L1 1$!0L1H!,/6$1(1\),0q, 1401$141(!>8!@ $$!pR  } C^yWw  ŸHp#0Ÿ$1P00$4;p2P p>ؠCT $10>0$108P00: 0 f0G5  5Sp Pj $003/$`rPK `qI!> ,! 5$F0@?S  GPkPC K;AS? $10С>C418!<10S4 @_ 0bVQ!!10b/7v0,1014181>C0(1}1S0}1$1S ` E@\k,T-`%L Z @%$x,p,`,`k,\,ƺ_PP$030/0@o//BO-@P MMAD0*!Rp0)Q`U0 $0 F  P ] Pp ,-*l'0`$0 ,L$P7(pP 44\,4 ܍Ѝp 4&e0Spp0 @0 4p0SW00l , Ri  000x;8,9/PV 0  x8;,;/ 0 x8;,9/T08SS "0CS0 S "S S/ Pp  R <pWP00P0)l2YP0 U @' 'pP 0s P&P }d0S !88 ⨍Qd0S !8}\0 PS !u8+`0S !k8!X0Sl! hSd! 80\ E}L0@ DQ\0S ` R  !8K8 h Q bQ{\PuVPoX0 SLPecpQWpph  c$x,oWfy~1 \k,+'o:ջۻGaM1U _ f$O-eM0M*Q8U"lUY&dd&@'&Xu TQ X &0 40T mQ ލЍ4 )qWd nP7 FP' P  @oP' @ pH0X h40pP40 Z P U Z@D`@ 4 p PU   S0SC   0S # 0P000P F)`P14s10D#5:d#d \%X%T%0S D%@%< /.fupp80P0 0 ,0ST0 S00 P0p800SS 04  0x;8.:/P>0400ST0LL S>@ S?0 0$ <0 pP<0PL!@  PP ,0$  40( P9 S-  S `0${ PL oP00(5S0+4^f_14  z0 S r0 o%Ȱ0$x,nP\,sü #.k,ؽ $F|S% 1.3;BKR^fZAaW*A[ O-@BMTMh Pp ` T@PpT0$(PpppPPP@BލЍ䓟C3ܣ0@ 3# $04@(8 3P@@00<DT@0\ P `430$3 04 {2 $02(408@00S0 fP ^댲夒  Qp208@`2@DDAT L2L"LLtq#P 82 4%PI(2  *20)ATp !0 kP&!$0 U@0S   %#P 0Sp C0@ 4 000@0x; 89/P1  6%P !F %@P 0  j @$$0 z@``W@h   fWƾؾ޾ m۶| >\,n$x, ~b0p@-`M2 R !,^RЍ0P @40 PP@xp0 ;87/P   PB,, $0@-@"!P(@,@-$@2S 02,O- @P@B`P@   PP@ Zl@p0Ec#రPU* ЍI NP  NP @BI    R0S p&@-@00 KP Q P 0`Ѝ O-p`JMMԢPppp HqP)NU\b`H4PfmPX` EpGGYK `mP 0 000! 00P T"XT1P T2X"TPZNT"R0 0XpPX 0H,081A 0101P0000PPP lP,PV0S9 0S)XNJݍЍQUP 0Xp$1Q QP SU T"P 0 003/PT2X"S0 S(0S 0SX(0S003/PT2X"SPp, ( % 0S/p@-@P`!a(0S  R 0Q003/@Qp@@-@`pP4M0S4Ѝ0 0L03/P 00@ 0pP180/C-PpMM`0 PPpx@; 9/PލЍ0 PPxP;A.5/P A> or 0@o/b0 !!/ ,10/Blp@-@4P0 `[1111p ,O-P@p`ԐԠ԰0/ C !  !0  Po00S  0 0S 0P1SR0B 0 0`p@P X 00,0` 00000 Ѝ ,(  0@-P@M/.so1, 00 0d0@00 0T0@@@@1 0 000@vP,Xߍ0 ,O-Pp@`4M 0SpP `Ppp 0S00V0#S 4Ѝ0 L03/`P0 L03/P)   0Q R  ,[0 0P  P  H   4@R,  8pT  TX $ `\ ( ` , d pA- 0R 0  DQHa@1QRpB   !LAPAPs0 \Ae0Q     TTAU @@ ,n4O-PBpXQMU<2!PX\1S2\U \QUЍ0C`1B`1Sb[`i001PS \1 X#X1! 0`1Vle.0X`0 T1]X " kn\4P6 \ ! an000: S.X1 2 \1`0n0X1`c`P 0 S 0.S [Zhup ` XXPX SX1, 2 $ eZ ,% \ x h p@-MM`bP;oۍЍp%P@P+Z P*+hY P*+Y P*P Ptp@-&M@(KG`Pq3 e<0 0h P (Lp3(L e^[ <@P _ލpwXabj, O-p@MP! c0  b 0^`嬢Y \p` 0 0P0SbߍP X%]P0iP0 a0CS0S  PDU`08Sڠ0SP` R SY0  0 a00  p 0T1勅00 0s [+,p Y 0 @00t00 00S 0 JP0h!R@O 5O0㏐ 0S* ?0!CUa0 ,~ d@edA!,Fs ,@- D@01SP@ 0S 0    , @- @-G- T1  D1D1@F@od!H1P0  0M(Y' j 0S 0S| q0Sx 0Su QN@P  0)0 @P_F? Q. QFNnoqpy,`k,q,$jR,%mwX2ӷ r,\,8'b-MM P  7P  ۍЍl-MM P  "P  ۍЍy7@-hP% PdP %P0| S0 P @LP I0@TT Ѝ0 x0|+R/ @-d|+\0XT0PL0HD0@<0840 ,Hy,t},Ly,(p},hy,1x},P@-@ A@08Sj,p@-@PM H(@ue000H ,0@@04P,P4hPp0: S HaP uQ qQ܍p,Le 8HeQ @P"@Pڤa <PT8|1|!||Fdx8%<DQi! P1 0880"8PP  Q P00S nz < R t00 00000 00l0 p@ m(Nt(0S!`,1p,_,g,+,  'o` .k,q,+,L O- 0CMSP0q `@h0!`00`SPW!000> @ A?@3/@P CߍW! 000_Z 0S<X 0 5@>T W  00 0 5 0S l00S \  P0W0 ! !  000q,^,Py, *p,N ,7@-PQ@0 SS 80 000] Ѝ02S  T^O- UMP!Y4Q 厍 d#ß0/S^P3s0ȃC0`/V`3P QGU@tc A@ `PKQP 84(@1 U `PP$ 0RP P l^ 0 10S 0S6 0 1S20S QPpG $21AQ.6Q챟 !0 aB0 0r 0R R` 10 1000p_R `01S RB  0 P a0S  /SPR Uߍ` 1 06UY U@P@T Tp'k,cPy,% ,'C\aX-T-q,w~p@-Ph`@TUdpUP`P  p% G-pMMPp p@ < DL{P P0P o  1PڍЍ D1{Px D){P3P )`P 3PAdPP 0 ,Y0z{] ^P 0=Sp  D PW  P |P wP\pP B PP 3P\20p@-4 P@0b0 Pp@@-G-P@p4 b0pS R p2"4p0QSP pzP`p 0S!40Sp  =b`/0 R/@-`p0LMS@`aP 0S0L0 3/P (0! "!P 3/P 0S00LЍ 0  1/p@-@ PaP  p@W@-@ K(I@FA-P@p`p0S 0pp R6A305#h00P200#X0S%0Q #"h0Php P#"4`V000S 3/0Q #"40P4 A-08pЍP@`p p   0`!V僼빮 t@T  \{]PLqP <mP 7@ӳ#2AM}Dly p@-PMM`; p  @Hp .bP*bPۍЍpp@-@P `` DP  0QpPip|d zd@@-PM Mp;P `p  @0PQPUaPۍ Ѝ edA! 0 02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/@-@p HP`00/00/4\80S0 S001/\80S  00@-\\@"SR0(SS QU S!0$0S\  0 1Sp@- l@$\ 0P"QS:pQQ   P \ Q0\! 0 ,04S8 000803/P,000403/, H0, 4 T 8 X  40S80S0 S001/S S 8 S S S0/00000, @-R!R@ b4 BRp01 408 00803/P,000403/, H0, 4 T 8 X  000/O-0@p 4MPPp`204ЍOm$0 L03/P$ Ѐ0 \ p!D@ Z["H* 0*P T P , [p _8``pp 0S0P 004Ѝ0p,O-P@4` Q 1SQ " 01 r " 0SQVLLSS<SQ R?!S,0S 0S00 0S p  0!"0 0  SPH P00P00 0 K`03/P L Q Q  Q R S D x     xK O-0c(0M<00PSp@Qp`00 # 80s 3 0kYh0@l0 S@3`7 0D@( "(0P000ЍW0W*8q @ 0L03/P 2PR  "00 0 00@0D00p2 p0 0$YHL0  Y00(, 00 0YP23T 40p0P<0SNP0 K T00SG0Sj00p0q  x0 0 000000  P0 0 00000PX 00808/X0 PpQXQ Q(00,0p 0#_p a X0S h^ 0$0p0 0(00,0  0#0p_>02,Xk,2,$<C-`F`0pSPlM^DPX0S HX0 S@X0S9X0Sk2X0SG+X0SH$|X0SIuX0SJnX0SLgX0Sa`X0SYX0S000$ R$000 "0& W40SU4 QQ00Q00Q00S 4 |lЍC( &X0SWA<4W>0 P Q Q  0 \3003 0W0 lЍ3003 0W0300 0$h3 0W0 0LS(0p`@ w0 iSH0pP0`@SH0pP0`@SH0\000 SH0`000S"H0d0S hP`@=0 <"00 P0 / R>0 H0L0  H0L0 H0L0 H0L0 H0L0 lH0L0  TH0L0@ <H0L0E $lЍC!SH0000%0PpG0  d 9/ 000(00 2, x D xK ^ di,Xk,m   1 {1 P   C- pQ0@PE0EM (000S 0CSEߍh0 3/``d0 9/0 00(0 0``0 0pp07/0@-EM0@P 03/P 08 00 @@003/Eߍ0@-`,MHP G@0 0 0PP@~00 RS THP pW WP00H P00P0,Ѝ @T@0/W  /0 0HyGH P00&Xp@- MP@D0 L ` 0  040PP`2HH0Dd ЍpG-%(M@PU T L@P`4 ,VV !R "2 Vr PpP`"pVp$UpWb$U  0  Z0 00 00 0% 0MppppPP J(Ѝ   @ C-40PS,MJ S S S ,!S SB +@P? `q``X 0A>; e8000 00 000 0 00 0 0M`P %80S=,Ѝ  $ O-P@0p(AMP U   b  p1#`o0 !(0#@ dU`P $P XF00 P P F00P0Z@! 0 A@BA0  0t!lC @0  L!b- P0  $!XD`pTP@!@3@T`0 -PY @D@0 - U! @ P 1.P嬠o 00@p `PD!XAߍ #"0P0RPV i,s2,3, FwXO--P5M0<p@$P cP `P%Q4  0@0D  U 0$ p0pC 0@D @0 0[D 0S , S00 00@ Q\42PP00$4 04PA00 00PPPgI0S8@P 0P40 0H03/0S,0P p p0C @P0D P000`ċ@0SOP pv0,01v0(1PP ! B BP2"Q%00@  R B @"X X 0 R80pPn 0 R#,500y60004Ѝ<0X ∑0L0 3/ 00X0 ,b0  * 0 P  1@0 B )R RQ1PQ0R r Q0CFS0TR000US0a0Ѝ@0  ll31PT00U00Ha@0 \%41R7 (R3 !R/ R-R H ` ` 0R 0R`[XoFT00U00V KN @0P0 /S`Sp`` [XtT00U0,`0 4,s_4,4,T8 T4, 8T8,\,O-0MS@pأЍ`  `W0@ 0 P0S% cS2 %MS) CS, GS R 0MP PSS! +0C?oW20S 000 00SmS sS gSR 0R RO-OM M P#0 P0P<0@0@0.0P(0` 0H03/00040 00!6 0R 0  0(3/ 0Ps`` r S08 P&a0D&XU\a`v0$0800s0,00$0&p`0(`HpD0WX0h05R0lp0h o `pV Sh f`U Th ^PUh XVU 00 00PTj0P`000@ S40dP0O>0=C0H0<0000D0 0L$xzUT0 R  xPj0 000H0P0 F0PT0S xrNP 0S80Q00`Q0S 0L0 aA3/P 0Ȁ`0` 0&003/`Pdp0E0 7#`@0o?LX` X 0 [0R0 `<0S@00D00S8Xx& a`v0"$0$0,0+i0,0$0$$0| Dy 0_L 0xhp0  0RL 04c 0ILȐ 0 Yx0h00l010h Ht0pw+DW=+ S=L L0` S*pV 0 TiU 00 0`Ti0 8TiP0,,0$ Q00Q03S (0A( 2`L%pp 0 `&E00`P3/0A` ``Q5VP04`T帿(嶿Oލ Ѝ X 0C[0@ X 09Xk,i,;$cF7@-@! 0$   0 P 0"ġ0S 0$ O-Mp@( P,`|1/0@T0P5PZ0YP0 0uK @p0oK@Tp UYp 0 cK X00 $P $ T<000$08900p@3/ 0pXl0%WQ@Xc'pF0Z0 0唳+Dtp ;JpW000 0Cpÿ D00JpWP 0W000 000W 000$0>Xk,;$i,c0@-@M0@L0 3/P" ! !XQ 0 0 SS@Ѝp@-`MMMP;` 3@P O ); eMލЍp{dЀ@-@P DoKP 4jKP $eKoǮp@-0@ 8M! 0`P@@ 0 P8ЍpCKPUJ0 00  0 P@oC-T1M MPM C  01/@P  0Q$AHL Q>0 R 0S wP P 0$003/$q$x,#0pQ@-s;A #"T R0//s@-(@T@ЍpHŻ0P0 w003/@P/@-tMr`P @P0 p@3@(P  90@Tp@tЍT0 @T|0t dl0l p1 `P L @Ļʵq,,X, \,(/@- @O///@-0@Q s㙻@!o?0 \ 0P000@-@4M0  KP0PU^G0 00U00 0  04Ѝ0,X,//A-pP@`VT0S0S XGPH0P$1U0G0U00 0X0`p@,X,0SR00/p@-@PE<0P4`" 6D0# A@$!ƺpXk,i,A-<`P@GPp( 47 A0X,@-(7@-0@-AM  J0 h0S Yg@L0LP0T 44 0 Aߍ0ce6q,Y1G-1MP`@1P!t1t1t0pplM`PBL@L吻D0 [ㆺ'ߍ &@P BbE G@P 0=SE?A@0  @T@  aP 0 lc=P P Z=@ 9:ۀ|W\\, 1A-1@P$`p1P!P0P0P`P`P0  @/= 00|g\,9:/p@-0M02000`00P0@P @T 1X 1TO/11 0PO/11 ЍpʄB;R 0@- P D,@-CM` P@IP 3p0 0`0SO/11 Cߍ5Sx xl lPX \\T0S  <~4/1, 1b,`a,{~,M;妹Jp@-P@tB1 1  ply,1p@-P`6@P20 p@$ p@-P@ႹP ?PN/1 1 pVp@-P@1r1(1 'P1 1 p&V@-W@C-@aM.pOITV PS2P@PG aߍP ~P @"{080E0$"rmP ",j2X , D 0, D ḷXN?1L0 0!,JP Px1x10 pAPphaU U UL10$0PU@4!44`A,ppP0S S  @H 0` 0P@JP0@}6 @ru6 0 0 0F& 000 p ȵ@,⪲d\k,5B8\,=9:4%XX,ly,a,b,{~,X-T-0b Ka A-P$pQ@P a-@T F @孱P( 0 3P  0F; P D@oЍW\\q P< 0 P\,ۀ2dh//O-c@T Ѝ@T@T( ^& L U[Z [Сԑ YZ PUPE P P$P@ P$@0"/|,O->p,0S ! 0S E ,vk.<0P1 0$ 0 0 0 S 0  0S 0$ TЍUQU0E"1,{p@-XP@0S!R+)r00 S @ 0N Dp,O--BM MXt\0y@P 0P(` ; PpᜰBލ Ѝ@0 HPᐰ Q 0  0 d!pPt0 00!$0`4X00 0Fv0`F;S P xwPV +RQ 0P \Q SC0Rpʩ0S R2 S - S/ S0S0000000`0 0 P 0S  - 0 R$ ?! 0$ S0S 0$ P0kedA#O-DMhPl`PDЍ㼮@P >$6#Sp 0 ;P` ;#S0;p0 d00\ `0h0x00X9 P$`P`t0 (04HW000 00 00p; U@-`X0Sg0 @\0@Sh0 `0Si0t d0Sjl0X h0SkT0< pP S 0&é Ѝ K ;O-MpD001PUЍ` ؠذPE0S Y0@  0 0 p1/Q S@@@  Q  Q r@ 0 @0R0 0p1/P @, A-Pp@`0S P8p0 S7/P 0403/P 0D03/P0403/A-㚬@P`p1S 3/`V@Td0@@ᅬT0P0S@000S4000S(0000A® ,, H p@-@4`4P0Sp@貮10S 3/@,,0 0#0/0@0/p@-@8Pq, 00080sp `^/ 4R R0 0`40$ Rp `083/<0 0"0P000`0X0S 3/ P0001S01 0S0P000 괟 00//00/00/00/10/Q@-@@@ 0A0003/P@  @ C-B`0SPEM;0 a:0pSY:0 St Q:0S J:0S@C:0S(<:0Skݮ5:0S00$ R!000uF 00% % d 00q˥p`Q@B0,>0;p8` ㈤80|$4@`!0 `40 000 f0,0pLz0$100\$10 `\0@ pd0`800S< p0 PÁt ,l3 000000 000 0 080pTp` D3d,00ᙥl0S> S@; SN`p%P H3/P 0p0072 |000L0p 3/P x0| 0 00S 00CS`p 0SV 0lP2Q daЍYPR00SZ 3/@@OoBS V@0&0010@!Rx!@!x@|@pPpt@彡t0S|0X*@4P PQ 0!@x 0T:x0S@ 6t@OoB0@|0xT:*@$x,7 \k,Y,ԍ R 08wX( 8 ,H u-  \,>O-S[?UM8 ,0044@`D ƤpP P Uߍᶤ0P00 P P30 40S 0RB 80S8(1SI1<00H ,H!0L\." ? 4,#H@; $.嫦㨦 0@PP@T "2B 00!P0S 3/Pt20 SU@0%0cD0`t T2Rw1@Y,N nk ,H!!LPH@0#`P`T@WP ` 1@ 1,1,00 0040 @g 1   , \ 1, S6140P1:1!5 @0 000000 0000 00㎣p` DnD0S#0 5Q7[T Y 0v ΰ,,CX noNH G-/0@JMM`0PP+L"P& 0S" 0`"`{!p/P5P T` H 0@T* /R  ԻPM7@m+" P:B7?0 `H<P+0: S pW37>00ꨠ t!ºPJ>0@0/S|0@!1+ ! SᕻP`+! P*P 0/S`0oo`bS 0p00&000 SV+t! P*+! P*ᐻP6@Ꮊ6@`ቺJލЍjW@-ʼ*@-M @᳻PЍ(0  T@P I P `^P:00p R G-`!"PPp X`pd'@PЍ0S @ p1P0 \ MpLi P Xp0 @ ʣjhXaA-tM `PXP HP4+ !F@P@0 ᴭ@ .$@P+J J.0㗭+J xzJ.0L㈭LrP ねPP|<i, xPPs~+J Z0J.hPPcn+J J JB`B QPPLW+J l3pd0\!0J>۽P 0.4P UT ލ⢺P@[ +J{ J⡺PPp0J.@+g  P h lJ>PT pyqo<%j+/00/00/00/00/0@-0@4M#|0$P 0.P\ ZP0T0670 P唣 @P  ᕢ4Ѝ0Xk,;$i,[,O-AMAd2 ,000PB,0 0000/ 80s0`0P, p $  ?(0 $0K 0s$00 0$h5 S` @@`嶝@0S 80< 03/P0p80<P Ѝpv'80s @0D 0 0Q:8`0S0L0` $3/P$ & [P T0T2y@&L"@(}@@,0S:(帡(0"PqP@0@00 +0@080s=0 0@( Y 奠W|Ѝ#㒡!@&(I00T1 0,X!00 ᱵ*80`0000Y9(0S` ` 0 RH03/p`0Y80s Hȟ0Q 0 0 0  BR0S0pS 0Yp08 r  *   * PU0"0U  YP R 0S  Y)p0    P P 0$ PU$0Y0 0 Ypp0 PUYj0Y) Z!P%:p0 0 0 00$0 0$0 0pS 0pW  )pWZ 0 p 0P Z$0 0 S&,0 0S (0  !2 P2S 0U PpСZ050@ D Z0)  Z$ R Rp 0S  S0 0Q0000 00000000 \Ѝ,PT P 0Sp0 0 ,4P80 TQ 0X 803/P0  0, 0( 0R T RR0  0 ,0S 9P 0 0 , 0R 0R  `R  )P` )P 0 Q ``T R T  R X `( 0Sf0L0( 3/P <00S D0SS000(( N L0( 3/P 80<00S (0, S004 Q 0 `( ],0Q G0Q0Yg80sd 0*0 PZ 0WYpq  !QQ 80s 0  00UPpp~0  R 0S  'p 0 0 0 # p, $x,Pk,H ^O--`M,p#@PVY p$pPT Pp0Z:`PU`J6ERUA x6x&xx+00#h R 0  80s0`F`pHU p ,h0S 00  80spHY pPp ,h0l0 0L03/, 00Y:pPpp0ʙ0P80\5ЍO>p0H03/,0$ 08RPP0$P(<00WP:< R2*p,0, 0$` 0S `0S< $`Sp $ PR( P`"&PU` P0 Sa@D S Z0S 0 `p8P0VS:00S40000040,0(pWq닟8`0[:pp8`$p0< p 00<<) `8q ,0,( 0L03/0 0000 0V `V0$0( 0S `" z&`V`P p0o  008,0,p(p<0yS 0| 1/0 0P SR 0 ሰ 08;/`0P0H03/s0@08P0D00Z}*p0 0 `<080s_00\ <0 0RV04 @ RD0 0 H3/PB $ <0 %P 0 0X 80T,3/00T00X0 0\0$0`0(0d0,0003/p 0 L03/00 00008@`0[ `0  % V00 400P m۶ W ];p,! 0 0Q4 0p0 P80s00  h0S~ l Yz* 0L03/Pm !0 儐X09/Pc ʛ00040$0$00(0 00 0S(0  0 H3/P+ X$ 0 03/p6  0L03/ pPpP$0( 0S pP"O% W00 40 00040(0$00(0 0$00c<#$‚0  0  0H3/P0`s 0R04$( $ R( 0  0H3/P+ $ %P 0 0X 0T80,3/00T00X0 0\0$0`0(0d0,0T0S ,0S~ P0 P  R0P0v 00040(0$00(0 0$00c<#$‚0  0  0H3/PP80s0 00- Q ( 0 S% 0 Rj80X T,3/00T00X0 0\0 $0`0(0d0,00Sz 3/p^p0`0W:0p Sn:Pp`,0 0Um:8YP  0$ 0S0p0$ p  Sp`P 80 p0R:pYP Y:PpW00 U0#S 'p`Ѝ L0 3/P@D0 RP RP 0 L03/040T0S ,0S P0 P  R0P0ꌀ 8/ #"08,00,L0 3/P 00p开8S  8y\ X W08P@DH0Pd00   8 rp0hp` o!8p 40U 00 0S 0P*p ` >)_80s0 L0 3/P 08400H0, 00,0+$0T00X0pPF 00 80sh p )P=p@-@P(Msv(0S*(`,`0 00P0F0 P P`0(P⽕P,(C(P(Ѝp000啒,(70,`(PT-X R[,O-X`M)1$qS W W(!0 "@PЍ0 p0> C 0 1/pP0$q Q 0 > 1/@P@p 0X:@1X!S<1\@17H!L0X!\Sp(0 ,1P"#0L@0$'8D0 ' =0 W %&, 峗0寗80000, 0 0塗0块80000  0'X0南0H剗LH0P (P0'W0 000p8500 %  % %P,  (P 0 %<  5 000000 000 000Ɣpp <5P,0ᢑ XpW* 0GS0.(>P C$ 00S H @3/4pGWp @ 0L0 3/P 00S 0Sp003/60pH03/ 0! P7/P%$%$)@0 QIYb @J@DpH L0 YZ03/ 0 0]Q  01/ 0S 2""&$Є  0<PX 0 Hp0  @D@0 ᄀX60X< Plؖ,0S$G#pP p@H0 0H008L0P 3/P p0`0 0`0080P 8/00@D@H,pP 0,QQTQ@Dp pT Q  Q0p p@08L0P 3/P `00`00p80P 7/00P  P 0000000 0P 000$x,\k,p408wX 4 D ,T $ u- ` vh ; 0@-@P`4M#}p@0S $ 0dL03/P `80< 0 80 < 8PUV`4Ѝ R00S 0 //O-@0SpP 0< #80 s#   ` 002%  Ԡ`0SQ,  R) 0 0#Q! Q0 2%<{# 8 0 r  1# 000 S   t, 1 SR0r01/`\,!0 /`\,p@-@$P x1SP 003/p@Fx1CP$ 0SO-@0`PKMM~p⻞G0DI;0S K2 @,0z% ,0崋 0 < o=(05#ਫ KP@T80U 00 0 00000@00萍 @@@@0IrpK܍ЍIN᷒+R*<o=(02#8 ;c&@@L u-O-`0@PMM,0h1h0p 0S (0 S> 9 H % 00 0 <0.%#@~40kP`0V,p0U 0000000 0 00000000p 0p`ލЍG],0S*< #0+,0B#X0S000C0C0000S0 0,0B$P`\,L u@-@-$0  !<$10(10,1P001.@-@$0 0! 0O-4M\T`Xhp(0P  咕"\ @,@;/,P R7P PpK $p WpF2 {$ 0" ( 00 0兑`gБ (04ЍO/Pɾ4Ѝ[;0p@-@Q* P 0 Pޓ40 Ppؓ <0dp@PTϓ80 P@ɓ,0 PÓ00 p| ')*+p@-PBM `@᱓ ,2 V` P夓 0P囓 Bߍp`吓P00S0`兓40Pp`80PS<80  4X0S0!,@$k 0 Pc\0 `0S  @`Rd0Ph0S @l0S @p0SH @T`.t0P^ 9:;=>?ABCEp@-`M<P@   1U%P 0DPK0 @0S  K  G8PU@ 0 #P 0܍p(0S p 嚬@h,0S H 听@D00S , 冬@$^ /1230p@-M01P@Q# 㭒  ( 0`N 0S (0S l   ,`V D܍p4劒   0`N 0S (0S    ,`VPk $0^Pb 0 P\0 PtV0 P`P0 PLJ0 PD 0     C-`RGMP@8 C"\0S0 `F` tČ0p⇞ 0S   H `,p WV o$ ᬌ`h Ϲ0`0"  %eߍ@U 0  0S  ↌ `PV 1 `S0N  `8 0  0S @0S @& ߍC<0040!00ժ@0Fo$ 0DL03/00 O0S !0⻪{D` 0S B  (> 8`Y0,p x Q0X 8 < RFO    ጪ 0@ /6@Đ 0  m R0_| 0s   XJ& w.@-x @ +0 @0p0d# @ŋ&@-D @ 000(0,0000d @尋ꐯ/@-hQ`0@sKMP!   0׍1!S=0 届Kߍ0 00@ @@0向P(@UTpp (`0 0  0`0`pw{?Pw?P]>P\@P`@d0?o2d0_h@`Pl@p00 S0p0t0?o2t0 0 F$x,GIJKM@-14"@EM S50 0 00 P0 "PP 0/S  = !0w@ 0/S0 0Eߍ1?o211St!Nl,!@< @P1?o211S 1?o2 1 1S 1SQIOUTpp `0 70  0`0`p=P= 1S 1StPJO 1S 1S_KO 1S 1S0PN 00 &$x,!"#%O-,MbPp@]X  |0XZX2Y 0 DPp0 @Pe@  ,ЍPp1`SPe 1S !N ,!ủ@p@d 0PPp1`SPe 01S  1Sލ0@!ᗧ@p0@d 1S 1S$1!凧@p@d 1S 1S(1 w@p@d 1S 1S,1 g@p|@d 1S 1S01D W@p@@d`\,X WXk,;$ 0O-P`QWM0Tv1 L&0@ 0T&4勥060S $$000S'6L@TP| }1AS 0S@  1P11$P |X003/$}1S}A0p 0x 0 01"+Q9  Q 4  0%X0S/X& 0΃}!΃L )!6X<1,!   X" 0S0b㄁0嵉b/Y 0x0S 0XX0P 0}!11VUi <@T0d"@T30S D00D0 C000 D30S \3L000@P00000T0D0 30S D00D0 p@ 2"b"`"0  }/T2 0"S0C 1šWߍ 0 p2 0@00 0)1S080.0$X80p$P! 0 S L0X 3/P h W pW 00$%1/pt0S _PWC0A00N  000 0" $!  8 0L0X 3/P ht0S 0_Sʚ  0X 0" 0 0p@080 0Sp,`\,6p},,`, 8jt,Ly, ( ,Hy,P 0( L60S/O-@pMU䅟 MPi 00x Rp#R0`ZadD80  @Q D0 \P” L པPC 8%8 % `V800(0S$A$B00,0S$4$B0000S$'t$B0+ 0 `0B/{P `ὠx 00 0; Q <0Sn0y0!##B00 0=,0#Sn0y0#B}0 00;8 R3#0ߤT#Bl00 0=<0X#Sn0y0Ϥ#B\( K 0 R #"BM 0 R "Ⲥ"B?x 06#0= 0S"⢤`"B/x 00 0=$0Sd"⑤"B0 00=(0S,"₤!Bx 06#0=00S!r!Bx 00 0=40S!a\!B0 00=80Sx!R !Bx 06#0;! Yt|  0C-pP@㰐,M0T 0^ ^ 0S 0L @̣`P aV@,Ѝ@p,C-@4MT2P`p!PP 0 L0T3/P  Q000T0SX0`pS@, XT $0Sb S L L0S004Ѝ0CS@Df7#(`,0܏,(30S/O-@SMP 000`#^X↤`P DD i<3P $ b ⻯  00 ᳯ尯,0 P0S* XZ'0 ┇PP Tq 0 x0.0I1P/S L(⡆0(0 00~^0SvU (u r0S `P *00!15:%  P r Q 0, ($!d $ P` 00 8a4Q101Vt},,p,jX60S@0@-S@00 0S/, O-P2EM 2@T P0 x2P l|1S$ $P| 003/P ,2P $ f Eߍ$0 R P 01/0P 003/P A10SW PaPD  <0 040000,00800 傐pP@2@0S- $P* 0 x0D 0$1L 00T0@0@00 0000(00 0P$@w\Ѝ0$:,` ;'@-08 S $0 0 0`Ѝ,;$:'` 10@-2cA80!0CSM PU 1S {pP 01T1PP1P D X8 8 B0R  ހЍ0 0  00 0 0  0  00 0 0 0  00 00 000x 00p000d00`0`\,$x,\,+ ܏, 04 ,` D$,| h , @  @-M@P `y00T20S'  DP!4 00 B\ \"00P0<  4 0 !崟 AЍHPH010S/  PP)a 00 BQ Q"041$0 000xpP0` 87/0P0 00!`0z] U=00S0  vP* 00APU PU000 !̓P^ X^, Rh P$0H ".R>Ly,,?t},\,\Hy,(,CLA-$0M^@ QP`p@0 L03/P 0 @p$ 0S0Ѝ 0Q@#*11P0\  R'l1@h1@T@0SP-D1@1^0P@@T  @T6 @pW3dpW0V82# @  R @ RD RV @  @H0 pW P^ TXV ,0"0P0 0R,0Ό R8<0Ly,,Hy,,p},,\0p@-T00P DPPp0AS@  1SA{`,$x,p,0@-P$4M0@L0 3/P T  0P  0S4Ѝ00^@ ^T 0SR2",l0\ Q0/\P ^U Q0000@-,0O-`GMMzl7\2@(T H2V 00 0 0000000P@@@@ 0@Eāp@a< ((G܍Ѝ$1SpA0L08 3/P `7Z Z ZT7S p$ 0ST7S8 P P C  01/P ,00 H$L Q>$x,80S @-0 /჋d m G-`@Pጐ匠X0r2 S80S00 00 S80S0|1 P%S$1S00 0VUp@-8M`@8  T P $QC$00S U 0 |1 08ЍpP ៮P P Q K ᖻ P ዮ Ӯ OP `\,A-M|P8 hU`ЍFP $A003/0 R   01/`P 003/@P$a0H03/0 `p;XEH2 08 8/PD? 0!! `b7#`00  3/P"#"#00 03/p p0` L03/᧼˭ X` 0SWp`?`B414!440<0S P L3/0L00 3/P @0D t0Rxp`0L00 3/P @0D t0R 4 d00`RP  v00`p 0Sv N 0 |1 0? r  `\,G-`RM@Xr PP dP`T `1PP P9  ,ݕp 0S  xߍ<0H(00,0 00004008004004 04$0D0(0P tW[  峕pU l孕p* `\j` 8 A 8tP ,P  P P P 0,0P0 P ` Up 0`?`a8SPPb 0  0**0P0咲  0* xd@edAzd@cA-@Mp`;@@ p@ݍ P@00@ɓT 0 2 "0  /O-4MFpT(t$ ,`&X\p@T  0p YY 0 0<R- R 0Xppͱ @P R$ P#2Q4ЍS0< 0 Y+Q X( Q   0T pTp 0 pWW 0 0Y084p<  ,(W \^ Z9 RR  Z$ 0 Y000 00TpTp 0pWW  00 R R\p\ ؀0@-4MP!! 0  P PP@4Ѝ0 00P/S0D0SD/0- 0S^0$^ (H P@  @ \@0P00@0/A-` R0 >h!ᵔ000㓛#000X  J   d,⠑( [: yT  P ؀!\R 00 2 0Sx 0 10<0< H0S< < 0 yd|d&:{dЀ\ 8~ku0$\ (00t S S  S00/Q 0P/0S 0S P//!R@-404 44 R )r0@/p 8 80R*@-0M@"P0 0! 0! P0Ѝ/00S/p\,Up@-,P@0S0S< 04 pp\,@-@0Sp\,A-pP@0ST 0S` @ P<0@P`V@p\,s@-S@P ' `P zЍp8P z`P (ePP )aP` P P(  P` D0tPh6SPP 0SP` P qP @0`0@0 @-  1P ڈx |EP xЍXS0S 0 t wPnx] \O-@M M@P;B/$@аpPz(` F pt p㣎00@@Q$D0S8 R( ut 0PPY0D04@T,4@0@T30@T0 00 F z P P    0wP  p 00#؀w@0V  00# d#000G ; `#HP܍ Ѝ04 040RP8< 8<0RPv0( S 00#ԁPD DP #pƁP@h Y #YD幁P@m  P #P0&$ D0S(0 D s؃0 S 0 0 0 `刁@0x0#Y@#000@40 <`qd@ '8Qs׀0@-M 0r 0@S|( =wPX,xx0L @88  P 0  ЍXssv7 8@-es0SЍ@-@M  sT0  CR$00S ЍwA-pP@0ST 0S` @P  v0U0Q0SpPX u`X u0P00`0S `] `YP,00W80@00<0|P0$000(000S DP rPP Hs$0S(00,sVލЍ` DR00pp<00008``#404S``V P0pp`00S00PP 0P0 0@5 0* 0!$00(0080. 0<0`$0500D0;0p PUP PPTPJP 0X`=qPPT`,s؉0S 4 R 000 0#0P 0S ְ뼀 08$ <0S P 0$ 080S0`P P`\0S 040 Q\8<0 Q\ P   P` 8hy,p\,]\$$$ |d@-齞0P0Phy,x},O-`ᴀ 嶐 DMⴃᶓ890 ( @: 0P30sS' 0lS`q 0P05 6# ap&?0$0>0 0=00<00;0 0:00(0勍pp0 0,0P,0 0H '# :p DЍpW0`Vp G'G-pP8M@(P2 0S 0( " " 010 020 0008Ѝ70 0600500400300100000.00  ,0c P #00R R R d `9P 0h#(00202000Xx' p@-`PhM" P@0@$00| 0 0(0 0P0 0@00T00T 00T01T01T00 (6/UhЍp G'O-PM@8 SHo*@PT `PVr``PT\0(Ѝp!SQ0P ؁1/T 00괡 O-DM 000 0 0 0 {p 00@4p@T0@4p800,00  (0$ gp ,08<\`?! (0_%"T0$ P_5#$<0_.8̅P R0^W  PSuT h"?L1 0@LH0 R p ? 0 /G$7@ T S@``000 00  0 p  R02# !"8 0/RSYL0 V`0 0P0pZnYXDЍ$x,/C-`@40M` }p\ X \^ PRPR VS  RQ \R  0    ;pЍO- g@-P Q@0p@-tP@0S0S 0DHSTPSD  p# @0p\,0,08S^5/0,(, p@-@ 0(  P0R0PS 00Sk ppM-Pp`NM@< Рp`0| p ` $000 ;ݢPP <pNލ讀 ydG-xM` @pᜐ堠_P! |!0@P 0S PU 0 R<D1D!DD00S 00" !P@&P0 0S0L0H 3/P HL 0RPPT $0RP0 0   x@ 04/@xЍY Y ZL   cYZ( ( ᙄ0 g~kuO-p@PBM M`/0&;P( >0P@0P0iP) Y  $;$  f P!14"S5 0Sto@ U01U01Bލ Ѝ Ag0P0  e?XY$0 0I0,zi?X Y 0oS 1 SR 1S  RS1S1S p2?R0_Q  @0 0@QD 0H 0L0@!1F41Q 04 8 <" 0P塦뙢@ጦ@Q Q' Q0PUTi 0"0S0S0@0gP P `@@=02s 2 02@F @DURX A- 0MHd h1h!hhNPg@P( T00K 0R`0 !?020!2002p!04 ph0Ѝ 0S" $0Q00 L03/P Q 0L Q 0 SD S003/D g>0,P/@-\ @  0 2BS02D0C@AuOvO0w.#8\0 A- P\\0@@ \ 8\ @T Ei@ `Č `Ȍ `̌b` ` p SČpȌ` 2aaa0q1P )hp`T8BvP08} ^\ 0Sp`82S04@11111111108 q2aqR 2@S22B040TP 2SX4T0S  O-cMM00 QP ,00#.;60P 0`cލЍ0 Jjp \6X&`RS000o?00@ , AY 2S 1S(2("((0@0 Ḁἰ  &      0S@p!?⩻D  0 eD U <  cPWbV } R $0X&0 &p"$1Wp!p'q ?p? @p0Wp!p'q??p$0d@P   pc?WU E ,   ppcg?W U `d@W gUs@-RU0 i@2`d0T `Š"; P0H0`04 oЍp a g@-@ ^ @ TD@@@ Pp` TPPVPU Sp    L"4 0"8 0.4 0@.800 0",<< . 00,p,O-@|MHp4 $P   RD }$$P YY P^ 8RP QW# 40 RQ }_PbV VZY RP``P`V W0p|ЍRE  0 _ZZ 00` ^ V ^Z Y  `VRU` P  ( U S"!RQ8"H  @08    0 4  D "< ! ", , "S01@ 5 @ D pE W2zP Q PY Ƒ Y ( [Q"R$PQ  R1!" "#(SW^ fZ D0@ S(0, 02o(0HHLPTpPC 80 Ă2 R020S PP e00S0 0!40S`1 0U0 <0 1R o 0($  RQ   0ST0h h2 Q HW400,%ls Tg| lO-@MP0Y00000 RL8H8H(HHR4  XD00P}/ $00800 0 U"oQP RP"4!8$ 0S40$ 00SR 0XSY t70XY`7$004 0Z00/$ 00(0800,0(0, Z00"0 <0 0@0<0 000@00400 (0S,04 08B4Y6u?v/0808 S 0 S4 1YX6BT@q?r/`0sh2`0 (  R   T R00S4000D0:cpPD0GY50\6o_P 0"P0S PP Vdǝ0$ 8 @ U 0 o?0 R S RQ ' 0^Ѝwτ (0(00,0/ o_S㴂!P# 0 500S4000@ P0X\0" 0"P+0S PP cmB `H ` 0  0 0 V0R0 2@ 0C0 0(<0"0 ^,0,0^ X0\ 0PPT0S PP c6 0T2S2 R800}bP@0"2? 01@22rMUY $00l2l2 2 S 0  p 0 H 4L H0LpUp L0S000 XRH` 0@@H@ $  $@T$ 0T @ 0 p`  V`V X`\ T040o 04"PP@t0S A<PP Dc嵜<PR3C H0P002S 02#38T 0Ro_PPUPo/ @T \ `TV R \ Q0, gp,U|C-dM‐@Y`p 0P 04##0 PPPY dЍ003/00S 00 * 0!!2 P02V 0P ( ^P 00D0"#"# 0 cP8

S@P0 | P0ddG0@SP0 0HL R   ?  ?/Z[d0P `@10d ἐ 09/0P@\Ѝ$x,G-p0@P8HL041` \ S ^ ?Y R  0\ X0?Pࠡ࠱000^ 0 G/$x,>0@-@0M 410810!b0 P0u0L b0 K0PU ! 5/ٹЍ0$x,@- Gy@ w@-@ 0  }y%@-<@0sw(00pp_0Co%L,-$M?0 0 x$Ѝ0-4M 00 000P4ЍO--pMMxExUx " `}x@5 Ѐ0 p0 pW00( 0R0pW00"R 0*pğpT0S 0s 0SMߍ0S P 0 l_h40SP T$1l{PH$HS 04 /{ A0( A{{jodVd`#0eO{3P 3R - BP   BRږ3c"B # e#21{P 0lß R#3SPgS04c 100#0e{0P  $P(0 0SZP=9 =:k{=2 AP09ë A { Q 5 P;!%#3ZQ/ a d 0@ e0  "z1PP0&!`S eP *!5"%+0! W ! zP0Se\!zPT1 0ppu0P ̫0 A ǫ A k{I{7{z0W60P9  {zRP<(<`Jhp0  gzP Y@.A`,X,@,p,H,8, 0,P,Q "/DQ]L,@~^  Az@-(@v$@SRG-@  700pP ąP:`X:00X0 zPQ@-P@`pP0S -S :S S  000`  0 0P0 ЍU0S T  ZP&p@-@Pdup  `Xu@puU700@pp@-P 4`Mup@  #uPYu@p@-M@ vp$ ЍG-`p@T2 P  NP0IPE EPP& PE0P @ R R0 RR00#R0;R0S Q \Q  "Q0# #QS0 @-3M M p 3ݍ Ѝp@-P R`@0 @ v0 00S < UP3PE ЍpA-@Pp p`" j 0W0 |0WxX Uh0X`0 P U <0H  0h08 yЍ P 05!@-`0tM0F?oP2p @pu uptu@tp h2Sup L0V#4 - tЍuh"tpp@-P@@upPppp@-@0 } Dt0 S " 0PUPUp@]0S   0 0S ]]0S   0 0S ]]A-p@PMU `0S@PE7  0PM00ۍXC700S @ Q@BPE@C0 00 pL'0S #0#S @UX >Pb@-M@ H sp8lۍP   p@-d1`0SM LLЍp@@>  <P  0 !   Nsp0 S 09S g.Ѝp0 S   000 00P0 PS @ d0 J pDLG  Ѝp@pn  p@-@$`PZPp0 @ `P0 002 0pp@-SP@`xM  j0 0#sp@) sp$   sp sp  rp  P  H0  p(0xЍpt r* n0 0 s@->@P`<p @ p0 p`` P0)p @ 40 pЍp: p@-@PqP  r01CpP`qpI r0#1/pp@-pM0 p @z vrpur@pЍO-QMMڶ700ۍЍ _  Z  @`V r@pP` @-`R00 ЍPp@0STZ@PT  Q*R@00 S   0 0S0 S *ZP `[[ [ 00000`0 @@P0   @-@ @` ` L1p@-S@T1S"d1S,RU6lRUppbV7l[lbp1C[L10CL1SPz[0P11Ct[T10CT1SXm[0X11Cg[d10Cd1Sh`[0h1:2,P0C2bVR[b-p2,P0Cp27@-@0 PP$ H1 0D1<1-@80@ CB Ѝ0@ Ѝ0Q@-@  W  bCqP p 00`? Ѝ@ Q @ 00/ pЍ@* Ѝnw Q@-@  '  qP p t00 Ѝ@ 1Sg70|ZrXP| 01@ 40pЍ@ Ѝn @-t0M0@Q0$)p Ѝ  081/@-@d3&P0S  P 0800L0S S@ &@-p@\M Q t0 | p\Ѝ0@-800@@3?c P@-@4}p t10cSt14 Ѝ@ @d 0 Ѝ$Q7@-@  ,,l _ BVpp W Pp Ѝ0@ P 11P,|1@ R  |%;AQP |`00CS`0 XXv@ T0$p 0< Ѝ0@ X0 X Ѝ0n %`%p@-PD pp44p@ @pp p@pyp@-P@ ` 08 l, <U\N% 0: 0 008 , 81pp@X p@-`<1P:<1x1S0p0@Tp 0S   ʌ0@-@T 0S @G-`Pa,H0$:0@   1000  qH$R $2/ 080P040>0S0&0 Pp P W  gx03?0 0S %/0p@-8@` Z40 :0FP PpP  Pp%pp@-8a? $0080S  p, A p p@[ @-@@O--M`@0pRPD@T0Ѝ DP R+W& 080 C "0   Z0800 >X  R @@ d Q/@-@  0S@C-q`@ xQ @P00@ 0S  L0 Sx   0@ Ѝ 0 pPti' @P 0@0PEU  x PP 0S  $0$0> R>  **X  0S .@0 S   000x1  @  0SP P 0F0 S   0y 0A-M P0 0E0@!0E+lp00`+j`p|QwA07S =0 S X `0E 0\!`1  `Px1  ލ ' R PpzP0 S   x0 mpP 0PPUcTxx }x x1p  P  0S 0| 0P Q@-@  ll|)p07S@\0 S 0VS0S@Wn A-`R@p@M PP U 700 @ЍA>P"R 0S 0 r>XU$  *P 0S <0 *] p \ <0S <V>P  *@ЍAm@Ѝ )YvO-P@$MpP  }P 00A $ЍOnPw iP000 P`PP`V=Q`P    0PEPE 00[PPIcmSPPP P003##Xp`r 8118100x1pW* hiPx1pF 81181kP NP00 6PP4PPUPpP xP 0: 0 nP P ` 0S 0 0p  P YY _p 000 0S 0 0pW81181$Ѝ  P YY  ;p 00W0 0 0 :0C WUx1  0@  R @ [ P W @(0Ƞ0 0 0  UB U  0HȠ0UB 5 0S W xx0P 0S -``W`ʁ5`0 xx% p@-@>Pp0?R02P?00L,003?00> *> 0Cp耼p@-p1PSM"`! #@P T 0p1!V 7R 0S X\kOP Dd@tAtЍpp>0S M0x1@T l1S C  @>0S@ 6`l1S   0 @ qDP 0  @  B.(0o#p ,l1S p 8  0 R/ 1/,/A-@P 1 !  (SXpR0 qP 0`0SG000S \ \ 0 S   00S000@00P10 paU0-OP*A G8f0P@-p0p ppq 00P R0 U  *Q 8p@-@`TP\@@^0S\*\@\0 0SZ0 5Pk9 <R0p@-`M@Ph p(0l``FSЍ R*p 0  B\ L *R B  ʚ;G-PP $L1L!LLaY@10!<`41Vp(@ 1!0 S0 R S,   @T0@T 0 S4  0(p `Q ,00@,@fN@P0S 0S0 @@*d 8ʚ;@-@^300 Ѝ ^   ʚ;@-0 Ѝ@-@P`pG, 0B0 0p"#l ЍMb@Bp@-P(0 PUPUR PU PTP,PP@PP4PP4\pQ@ *x 8P)@-0 0PT0/* 8P@-0 0T0/* 8//P@-$0$ $$~#08D0* 8@-,MP` V1U0@0$00 a0p@000 0<0S  fp,Ѝ8010C>Sy00@( ( 03(00@000 0<0S80 Ep @* Y8@-X~N@P gpO@0  0  (0,  0004 P0-s@-@T0P0Ѝp@Ѝ/ r P @/op" R 0Q000p e00C0sOPU 0`0HiO0HPLPU0 P(P0P0V00 S   0QO0 S ,  0HO0 S 4  0?O@-@@7OC-@PM pb圂T0SY 00C01@0S D3/X2X"XX(PU0S Pf0S R=0 S ,  003/00400P4P+!0 P0V0U0S/ L0 S* H#P% HLH0 R |Q    00   CCU 0 HK0SP'pN0S} J`ЍT0u0S 0S   ,r Q 03/PEU\ YX,* 8@-8 0(@ +p@ t@Ѝ%A-`M4PspM f0 ip@ pd@ۍЍ4F P P  ӣ#P@@#C 0 ,$@4   zP%%-@-   Ѝ Ѝ/@-MMP`@p0  hDP 0pۍЍ色-@-   Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  l ЍЍ/-@-  ЍЍ/-@-  V ЍЍ/-@-  ЍЍ/-@-  @ ЍЍ/0/% 0p/O%@-M M t cp P@;00 dSV .00@ۍ Ѝ$P0p 4Nd% 0/%@-$@@O4 @O%p@-dP@c; PZ4  PP   OT V00pp%%O@-@P8T>/@?M@-@= p !dp !dp`@-q@ pc01p jc01@f dp@-PM@` ^  x0 Tdp 1@ R! 0 p`Ѝpii$0 /L0s P/P  //@->P\MUmV0P0\ЍUd700@ p`R0 PU B0>000 <0&  ,>  PP> *?@-@T<@Q/I@-@Tt=@0P/- R 0 R00^ PG-`P M0(0S @ P P P:`P 0!00 0   08S0 00 Ѝ080 00S # `pP `Ps0P 0iS.S  `Pc04S 040:S&0@-@PDM QP@T 00p@DЍ0U  P @0S@-`Pp@MTЍ 0S P 0S0pQ   )<@P @-P000Q/Px1P/$0/@-@M    0 BcpЍ~iO-YM `F/@H9X0*IpPpYߍ0piK 0S 0S PP@ Y P @T0SL0P 0@S0@S@@T1S X1 PAT1S@\1S`1 P5\1 S S R@L1SP1 P&L1PC_oSRPU@P04S 0s0P?AB@@$P00SLQU IPPdh1 ⯏P Pd1UjP H@ ` 4 0[$0D  H+ `0 S Q9X001H \0[bp X0 RB000S0 15S4 S  CR.T X L@@RS! y r R02 > 0*81 000S ip S 0 S `@@W0?H0!p 0P0H0}>H0 @000L0PPP =i0@VA-p X`0P M0 @R  RT T 1 # 0@ @ QPUx!@T00 Ѝ R @a`-Ȁ 5S @0s0 50A % 1@ A  + A+": A !9 R50,@-`pB@P@ Ѝ 0PXIIp Q,4$P !PP @-`RpP$M 0S0U00$Ѝ/@P 0 00 0  0S dU i6PP, T/00DU t6bsO-`@0p"S0W"SpG` Y PP u700 ЍTUYP T000졟0W YT X0#0%*T X3#: 0\S^0PxSmS0S< bS ST Tn C R  T0 `T 00T 0T 0000 0    00 PP 0S& T  D0 `P0A\0SP0S  tDT PT0P &P /0 S S /S/P0/S S S/0/O-M PPЍO= `P ||ЍO|H@Y@S   pWnH߁PP  ⣜P 0QA00Ѝ=0@S. P( 0S ὁ@PCH@`@XG0P 0 @ 0 0 @ @ p@-@P H` 0SPH$` PP(0S $ H0(0$0p,e P,e PO-@/4M10C`pXPSg00 pHU- 9`Pp $<P@ P7 7  '$ !/P`0@T\0S @U0 @3 0H050U) H0pl>0P G0 E@PA t014ЍJEP 0 1pA 0S UPG01@U  CUH070 0  pP P! .R8  0R77@0U   0pP  H RU H0@1S᳀@H000zU P0H0p ,0 00 0 SJ,0S4 _ czU ,0!00 0 c,0 S J Uu <1D80w40b儒000 0 PPP00 0 P  p@0  @P , UG <180w40b儒0p00 0 PP00 0 xP  0@H0:0H P0<0UH# 0S /"`P /`P00 V /0P0 Q00<0000H060U ,0 00 0 I,0HSL  Ah 0A  ap  P 4p@AK0  U uU ,P 0SU0 pH0 50f h050,0 % 00 0 e,00,pY2$ UWPPeUʛ700 5$'0 5'@pp 0 ,  0 ~p P H0@40U 0S 4S 04S0:006S 06S090PU, ,0 00 0 H,0HS >U H0P SPH0;00H090U `  n`,pP /C`P 0%.` CtEH0Q7;0UlQ /P0l1 x(P0l1 `!P0l1 P poD0PDp1tH000U10H 2zP0H 2r P 0H 2j P PH \ H000VH020QU D 0pP(a H0 S;70>H0209H0604H0;0/H080*UV <1%8b0w4儒00 0 P000 0 P0P0P@U2 <18∂04gr000 0 oP00 0 ePP00 0 ZPp@0  @U =PH <p @PWH0p000 SP0<00 %P WH p P  PWHp   \P  HP  4P   PWH BnzPP  ($wpo 00x % c )EXu  ]g}`"'/ FOjv <e+CL('em={R]7m@2i'.4<CKzK^s . &*0RLZ_ ip ,p 00pP $ ( H,8  pP B EP*WHN B $p pP (( ( H$8  ?P  B \P  pPW ,0 00 0D qF,0HS|  P /o"Bl ($P/P0H (0UPs 7$ ! (0'0N ($aPe/P0H  (07PU 7$ ! (0 '00U\ H0*X UX$H020H0 000P3H000H000 H0 00H0 00(07600R 2  *450S00T01=5 =50H0U <10(@0P@470'OP +0SxjU H$B{P$U 81 800 ,0 00 0 E,0S0H0800 PP0 0 P 0 0p+H010H010H000|H050wH050rH000mH,';,gUeH090_AK3O0\ U0` 0 ZLAKοOAK OAKҿO+Up \0@T$(@" G`P  ,00E,0 S;PP  (pP0:0YP  ,00 D,X$CPPpP`=3PCP`PpPh CPPpP0 j <BPPpP` f lBPPpP l BP`, BPi& BPl   9 l?o2=  W + BPb 4BP`Y P i`BPc tBP BP` BP` BP` BP ` yBP@` sBPh mBPd gBPe $aBPe l <ZBPe PTBPl dNBPg xHBPg BBPlw >$>0g47S90>8g<7S:8>@gD7S;@>HgL7S<H>(>A>> 1`P>>1`P>X  WP T0 ST47,`0C47<7,`0C<7D7,`0CD7L7,`0CL7O-MDM`H 0\=P4cxP E3&7 E0 + 0+0 0P70P7= H0E00 0:00 30000% _p T +8 0 E 0D0 E+ ཻ0 P#Z 1@@\0Y,=P0047p(夻P3 @5:o ؍DЍDP yPA0 D  D 0 0 DDP078247024,0<'哸 R28=@,0D'哸 R,@=0H'87l"L'<7@7D7p"H7L708 gp0  l$@0S R R P\R @0@ R #P0 00 D?op200p0S0p@0p DDP 0 0# 400dDP P0( % 4L P9P4 Z#d hⴑpP"($$0@0S 0 S S0P\S 00@ :0p  .PphqdvPd p < P 0S P  P 0S P Ppp0 0# Pu Xs0D00D00 0  0g0 S E:$ E000X ,@  \y}0Q//Q *///G-p000@0P ` P Y 0 0 `R:S@C@3@D"X HGU( IGYA-TpW0 T`@V0 L0LS @sP a^X X| |00 S HH0P 0RS  p@-P @Pp$h<@-T 0@0T0S@-0 t  T0A-p `R0080810@2 PP71W U p@{0S Xpp0S 0 p; @U0 }K*P P @ T T0Rt0t 0SmPt0 t0 88bPx x0R Tj@RP)0S @A-`P Pc_ @T T0pS"@p@-Q M0 T0S0 PU|0h xPc_`@P 0 @ T   Ѝp  #G-Pp0M $    P S@81A0 81'P  0Ѝ |B @T|   T0 R0 0800, P T8rp 0SS90SSPT0c | `P 7 R|0   P @T T0R88xPY0Sx x0R d2 _T <00#XXWPR ZP T T0R88FP} p0VS tc_ @TG 0`SS-90SS)&PT00S8 00 H*: S R  b p 0S 0S s@PT 00,b @P , 2@Nb Q00@-@1LS? @q@dR@l̠ BR00 1BS@P@-;000 0U0S /00k vP@-Q000 0@0S m/00k vP@-}H0H H+0S SoR/00k vP@-D0D D0S Sp6/00k vP@-H0H H0S S,0@o/00k v ^p@-@Q0 RP_0 0`S0 SQ 0` Sp@p0 p@W0 p@o! {v0P@-x0x xxQih0X  P R !P BR #@@# vp@-PP M0 x0S0S 3?@c@Ood@T $S 0@0 Ѝp/0@d`Q >0000P 0 k* v,'A-0S00@Pd` pW Z/0000Pp 0 ,6 nvP@-808 88 Qv(0 !>000kD v@-@QRP C-`TM@ P `Wep) 0 e ````e1pWp0`V& ze @ 0 N@ :eT  @TЍ00C>S00`"P!@03@000C>S00p"P!@03@04  , 0 -3@- P khp@Ѝ0@ Ѝ/@spp@-@RP`@p0Sp  ppA-0Pp`@S:0SS 0  RS* R0 P`V1S* P a 0@DpR: Q ] .O-ATP` M zy?@PA(@+081 Z  xp 00dPȀ ^P YP TP OP JP xEP h@pPpZ P Ep @61@ R ,;p 0;1#3G0800 00%%)p L0S% S% p H p P p $  p | pw P0S t0$0Q0 p 4 pe x0Sz08!LӾ0x1[sQp M ╿Pw Rp@ LP 00Dd hp0  Tp* %P %P0 x1`Q@ p X00SXppW0h 1SP᥋p@$P# |p ]Mp upp$Lx lp~ 0S P uQ [ T  @Qp  r"7Qp2P| -Pw (Pr #Pm P P X00S 0Sa!Za!Wpb%P `V%R_ pZw0Sc   5pl 0!lpTdpQ0SS   < pW 08!pCNpPH 1 R=Z  P; ЍZ p pr P n4[`7 /@Irtq$ Td} p@-P@pp p@RRA-P`@@pL0s  S  U@ p@@@dW0S R H R U pQ p@-P0U@S 00p @(P@M@T:囸p/%@-P`1pSMAT  p@lЍ TPЍ@!R 0$ 0 0 2p@ _@aV 0 !p@N`P p0S lt=00#40  LL0S *P PU@FP PUP`|/0P@-000 00AQ$0  @m} A-` (M\00>0@SP  0'0x B0dpp 0t0 0 01 0 0S0S|0@0|0 0  X00Qx0 xPT (Ѝ0 8 0=0S 0x]PTɹA-`|VPPFPP2X@p`Exk,P x倂|"x20 ߾V0  |20|2@-`@MpP! { (w (⑪X( 8pDPU@ T700@Ѝ ⧾i///0@-$!M@ 0  *PPЍ0 3"Qp 000)00EDp0000@ 07Dplp 00 " 0+Dp< p  p@-QUp@p B,0x1p@,@->`GMV 30P0Gߍ@PF/ 9  0l0 p 1`0 DF?(DP> *0 F?D ii@-@MP4@ $ P P@Ѝ Q@-<0< <<屼0SSP`/// $0 /Lp/@-Q @ ?t0@0Q00@-P@,M(  n  ሩ PCp 0 00S p,Ѝ08i(p@-@MP J ` E _  (PCPЍp:iO-PQMM,3,#,,BT0S3#pW3"@H`"0J01801\0t0 P00K`T0`V0P `0P0T00T0 P T0X00T00T0PT0 0T0VP0| 0P0P0Y<0 x P0;P0R h0x 0h00|0P00`T0 0FT0T(@)@@FƼ@  弱  T0R  B  @ Y? P1F0FᶰF @T0  YI @T0 0F0FᶰF @T0  XP ѼUPPEPP@ D$r =Ap`ݍЍ  <  ⶼYI @   C-`p"0M` 0$`  0p,pP @T*Ѝ`*PPA   0X,pr0 S *@ ``T*x0V*b00*T00V:0 (P|%P@ (H dzY *0@P @-`@DM pP@    !> U 134  R2$ $@0 fDЍUi@i@-|@QM  ⽻00p |2 0"x2AЍ@-]MM`@FP#@p PP VR ޼000S0S S SS wR0S H_pVPS CQRS 0  VxpU@P V$0 Bp 0S$H` P j hAp 5 $ L z80Su S S00,0S  R000@0S  R00@ H @ 0 H9!>50H \0qAp\W0S S01S hhQc0 0 000 0 0pURZ1S SN F F3]ލЍRIx@P= @4 3P0 0- H)@+ATY$0S! H M PPN0 G0~Qii@ @-40 000 0*Ѝ 2S/2S00/@-@@ѻV002@-S0@0 @@ûV0002S / A-PM`p (PbP'@P. 0LL`0=?p0 ,!C2?pP0Sp @p PU0S $p +?(@! (E( @p | Pz@p 7/PP o@p d&P Ѝ@CLqB@WlBpBfB@O-@p`0$M00PU  >0S;P  0P0S P弱 00SU 1 !  N0P00 0 P0 PPP0PU:000y $Ѝ@-  @ ЍgBp@-0M2S`P@x (۹VP@0 \(?º00ލp@  B-$M^ * !  >$Ѝ@-@B> '@'@-@pp ?p`~B p@-A^ Ti00p``0@D^Y"000œ\p@Tp0,p/0/Rp@-00@ ^  0s# R0ppP0QRO-M@@00`1Q V00ЍP0p Q :8Q@SH 딂\= \ plP p,lP U  Z4\[Wpp\X @ Q*S0C S&P 0 B0 Ǹ 0 S2X00cSc@-@ 000P 0S00 Ѝ@-@ 000oP 0S00Ѝ@-@ 000\P 0S8Ѝ@-@\0S Z\0\0@-@`q0M`=0`0@-@08$l@0p@-800@P >0S0&0T0T0x1 RpR 0S TT0Q  0800 >0S  p@p@-`PK@I%Pp00,000S00 /0KpcScO-@GMpḀȐp Gߍ0RS*R?  0 000K C%PP d0S  GRW ( Q  R p(Qh 0 00> 0200BS *⿷0 370 RS00 Tg K4 $ `BP0`  D\W Wd\ h00 P h7 ?$000FP@Dp$P DPW0S <0S @FT60000<0 @0W0FS 800006 S0@0 0Gq2!31 0 b %R  FR0+  %A C? %0 @W~ 8    FRp2   0@08 R  FRb3   0FSW 700 0 02@,0 " R 07 ,04'R SH< FP%*p9SW (1S 0 F0S=00(  ٶ(100@0S W0 2S 0 FS<0 0 "  20@W081 0 Z00 FR P0@  2S P I0 FSQ0Y0 0 2 0000Y00 @  1@W 00  ^00FSt0p0p@x 6S 0`FS^00 &A a 60@wW0=(, "r  P W: ART ,00,S P R:(, "r   PW: ART\  ,0  00D0C0W0 0FSL900000@ CpD 4S Y 0 FS8M00 $A  40@B?S7? B?S7s 00PD0 KS:KUKe 0 S0P0"1P 0F R 0   ŵ @@ 08 c$S [cSc257@-P\ R&@P\0S x0xB08  Ѝ0PP +@ 40!p ꠣ% L@-PR1!=`0@ 0p\ 0C R1 00 R0  06 30 0 0P0 0:0 00P00;0 00P0060 00P00 ЍP 0000000 00up0 00ip0 00 +C-@PTM ""P@, 000`0001iH00 P00 븀x0`  (9#0(10: P  P( # 8c@  ' 0ta P( ``(1 (1  0(t!p⭴0 +"70 (P 0x >``v` P( `"(1* (> >Qߍ 0*X   Xn0@-p M$M0i0PS` 1!pp8p@Z0S i p ۍ$Ѝi@ 0 /Pp 81Q50 00}pP= P( '`%$ @- 0080@P PU@ 0S@  `P@Ѝp 00O-IM Pp!PHLL `PR @P0}IߍO="0,0&7"600 0-400` 0 p00,0 PS2 V30a2@0 0 ,0T;`0 P ;t[@PIߍO7@;0 Px VT` 0X`0T;0 4`;P @yG-@pPQP,b,`2S#PU`,@ ,x<P`<, Q 0S ,9$< P,`0 RC-100`p@PT:p T  X ⢑00U *"0 p Ѝ0R0   @;0 4&=p  ; =pnnp@-RMM000PS`B S@ س00 0pۍЍpd p p `F0D:, <p Vo @- 81SsQ S0 00 0pPЍ 0SFDPD3pO-04MS@ h@@ `_0P o0 00 0 GP |3 00 y0 <PX3 0 0S0@0eY00T0u @P0n 00 0 !`Pe 0 $ ( _X]pPv 0$,0(,8 P@ Z0!   Q*"00pP 0$00S  $0 j0(0p,00t0$(,8 GP@0Sh0` 0h0 l L0304Ѝ 00 !0 pP @ |Z{0p$00S,0 P@,0$S  S S0t0l0P !R "R[p( $T(Q,8N P@ O-P0M040@`0 `2''`pp'`W9 pW6l0S,0S`,0r0v 2S`,080w0v 847S`,0lr0v p"Rr0,p802 Sp0匳0g47S K9 0` jpߍ0(000 `2(p(`  `(09 0 Op (`Z 0 Ep 00 `2,cp 9 0 2p,9 0` &p'0z0,804l00 40pl'0k@0!04,0 40p]`]`d`k,0 !P !404ǜ R10 `"`P' 00$100,0G0 ` 0 X00, }R0SKYP 0H ` `  00,p6S  ,0 !P !0 `"AP 00@ 0  0ep,`4EWi~@p@-PUp@0L0pp@- P# Mp 0` 0 ` 0@5p4@ Ѝp ` 05p )X` 05p  ѯ00; U1005p@-p@`P81.(080000&0S  0R  dp`H Ѝ@1@ ,0up Ѝ@p Ѝ O-`@p 0帀SP$H` "000 0 0 `00`0! Р80 `  $7 00003H081v H ЍO<0 $7 000x3@0Sl3H000s$80407 DS ,0008 R":kg{{'{z40S& zkg{{'{ z0S+d0S( $0P$h0!_7 00R::kg{{'{*zd8 S zkg{{'{* z0$<7 00H0S0ST h Q 0R<0S 0S11H000s8040 P14 P18 Pp10 #\W00@0S0i ,J0.0 0p u0h` # P0 F20S00H\ = P 0dh0 ЍO Ѝ?? $D, d# 9 ?A-@PT R0A }`h0`  | R 0i0iP 0S <0S ${6    .p0 O p pp0 00 0ppH0  00 0$0 F#5 FAd0h08L O-R@`pP\M$P X0 #3P 0 RT0|x00 p` hPP. cL0S0 0@S@0#/L0} ೃ?I00hP X0 "2P 0 Rzgjzzz{T0=d0S  $R P $[ <Y y& H" @"p  $P(P Qo,  0  <  @ , D  0H  <48`LPPPTP,2pZ ;pS 0 0PPI  ⑭0v` 0h10 p; :E0007@0`0v* *P00 0\ 0`v [04S 1S0810 Cp  X @0 \Ѝ7S zDf l CDC  @-`@pP`0 h0X $7S R @`00 , ` 5 0y Ѝ@4   P f   p@-P@ $y F0 00L0p@:  Tp@-PUp00CSp@0@ $4  (*00j0L0p@dZ  p@-P `@p?800  B\ 000D 0<0L00p@8 % s  T [A-P`@ 0h 0R0P3 081HAsp` P081( AP    * Pd0d dd 0d 0 P $A    p + h00h0 C-p@ PR0  R $ RP508Ȁ ` 4  i@0S ~PP t P0  lH81 0S; 0 S<$g2  0 <`?0  @ R 0P ЍG 0PS 0 PD0A 0 00 0SЍGЍ|  cSc   0p@-800@P  Dh00h00L0p@ ^i  \/0S/0> d0S  0R/C. /O-0M0000PS@~T0`Sp 0 ЍOs> R*P 0S 07S ǚ ǚY  S1  P!  Q 0 S:500 0p00 0  ЍO Y 0 0Cs0'0S0 S0L0 p p    0"P 0 0  BF0SY0A060@ 600 0p0 0 " `P  x0 S 081Txi@<6P P0S0 0<S<0P0Ѝ 0    0P 0Y6S700S00 l00 0GP Rd532Y@0KSK?38%0510 Y0S0   P   8 [  i0 p4 @h0S Y0 % 2)  Br  Br0 0 $ 0P 0   0 dY 6 0 P t3@S R@00Y$00D0<0<081(?00; P0  P4 000Р 00 0 &0P00S* -P *   p @ 0ЍO9600 0<aP0 ,0S * VP  p`81 @000H 0 000 `0`0\0S   0\!YP 0 8 R @1ЍOQY 0 `Y 0 00Sh00 00 P0gPY0 $/ x ЍO $ N e       0    l   9 K \ y p@-@l PTq/ 0 Lp@`D N\P d  p@u`$ O-`Pp 0x1@TT 0S R T0S> R *₄P  0 F@ O-4M@P,P Q0 4ЍOPE ڍUPp @RL RIUD:paV@ U=:$ P3U0:" R-   P% 1S 0Q00R0<2  vo  pP .  4U4Ѝ0 C 0 B<  6 p@-` MQP\@M  ;0000x Ap 0S TH ) ۍЍp 0^`V \@Tn $A- p`@PpAPUo. 0 HA0S 0A\0S 0A S G-0 ;M0MNp`p Dd`80 P480EL80H8$0ED80@X@8<8  XXW0` 0E 0*p ݍ0Ѝ` n  p@-@PT [Y W(US@x1S0pSq *02p *02;022p R Rp07@-PX0B @P 0S.0>8 Q0'Q'+ " B r R "'    00 Ѝ0@@}S{ zgjzzP+S, @ 0f Ѝ0zDv lp@-@P0( oUph0Spp@lO-P`@T Q Pd0S  0 t0`d0P0BQ 0S 0P T-  0800 |#  帀81- 8 0 $ 0R0hd`h08 R0 , 00C0 A0800<0  P`00 \0 00S $0 pWp1s00 2   0P C @Rԥ 00pwpWL0H0Ht0p  0/@-0P s0 @Rp@-00p0`PQPE@ `P @d@$,b p0P @-P 1S P/P/P/Q 0\R/ 0\/0S 0< S8/@-P 0Sx1@-@T P@x10S/ R0 " /Px10S/ R0 " /PP/h0SdP//0 SRQ oRQ /Q P/Ph0h   RQ P/@0 RP/R/@o//cScC-`x1TM@T. 0S pW$ P  ᴛPP@0Sh0S d0S4$vxΚd0 0S wPPTЍ|0d 0|0 00Jd0 00D090 yP] q PU9$0 00 CPP 00d8dX IPP g|0d 0|0XxĚU" '8PP 2|x Pp|G0S P 8 P  JU` 'P < 0$Q S "  Q  Pp h  5< 0  hppP; t0<0t00 00 80dxQY Xy ᵚP ӚU ⤚pP šȐY $0% h  5< 0|  $0<0| 2 *>  k p@-PP1!G 8p`l01S h0S d0S `0S  0 @T 0Q0 PSP 0U d0S0h0d0p@ >  p@-@T P9P@0p G-Pp`P@Ѝ0E @P00 4@P 0P000000 000*50  *$00 pPP)0 @pҢ0S pk0 *CP  0@R 0 0000@@ nAu.  @-@T PQ0 8 00*:SR h0S dP H` Ѝ$`  Pdp (0Q,0Q   `P 800000( ,0?PZ0S  0h dW $0Q 0h0d`w0SHEڶ $ 0S/0S/   O-MPH0<`R8 0@xP00ЍxpP P0 U@ UP R R R0 P 0S8Y0000000Cs u@UЍO=4 @PЍOq p    @@0 0(0 ) S n0S/G-P@M T 0p `x&00 0@0 0 @e@ЍP/@-@TP@0 S   0p@-@PPP 000pz Pe 00p0000 S0 @00:S 0S @\S000@:S @,&0@-P:P@A0 P\:R \:\P@\\ @R0/% 0@-@AP:\|\00\0S^ 0N:PP |P P O-CM M 0d4!Sp  SO0E`VK `0P0E@ PPנ 00pCލ Ѝ@@J ;04pW p40(0= P 0 `R0 :R `d4@0  0(880P4 PF0 {0S P$ p PP ;000P p 0S#0 0 0Bp8`@Z + 8 $0P R 0$0SF e@ a@ #0P 0O008`0 SWC p@DW:SY @\Sp S Spp00T:C P@D  0SQ #Np0P0@ 0 Y@S 0#SS `P@@0x[ P:0p0e= p0 R0 :R0 0KI 00S B:S:0 00IS! PBP[0e P0@DJ`F ; 0S #4 П 002  @ ` P D,0圅  ᘅ,0@PE P0S e#$ D0A00T*, PP 0P:SVr,%p@-0  0 Ѝ@-(@ P X0 0,0C-BMM00pS 0S`! \0S)  R&    RA^0C R[ z0Pv Ps @ WX Q0(P ލЍ z0P P 0@P004@ppG0SkX$0`S D 4ß0 R 40<L>T @C 0 B3^00@  C310X  2` 3 d ! \C 2h00C0'0hS8 0 p0 00r\\؎K`D| <ώ,`;PPDpAލЍ,pP P 00PpWA C9RQ  0000&000%0}0L 0 R0Cu0s0Sp00$0k00S0Ce0cL 0 BR^0 0S0CX 0VL 0 BRQ00'0L00(0G00)0B00*0=000 0d0d :/1, !ߖlP 0H0L,@ %Y $% ,,j Ͷy 0H0S/L,0P /L,@-DAP|0`SDM)0S&0S S f0P 0P@ DЍ pW*P 0 000W0ppȗ@ 倉`0p堗X0 T7/0S 0SP 0 P0DЍ@2L,,%]] G-\qPL @0P12C001b5R 0 0&0S  Jh0S*0s0PE`1``d0 R1 *! q ` `  !`` 0Rᄎ000S0PS u&0S,P O,@GIL,-!\  0L0#0L,@-p0M  L0@31 ^AP 0C! 0ЍlJL, @-L 0 0@11D ^Q       L,A-@b@0Mu L0 @2# p PW%cP_  Bc p\  Z᎕$0 HD@,X#10000 2R01   000 S" V00 S ̍ ЍA X 1(4/00~X0威0 3SV Q`ЍQ0S  ЍA`\c  Z1 l⡌@l⊍%0S Z c0@0L,| A-Q`0MS 00S` @P9 0s$@Ѝ <pW   @4S0p0|0S0S d@Ppp00FV@@P 00T l@Wp`W 0S:S* 0 0p0ppL,,O-`HqL1P0SU#,@T,P@P5 &0B1 `P 1Vh L0C R P!050%Pd @T: ، =0 p[L0CY1T*Q@@L,G-qT0So:\0`S& 2 c@Oo @d(0d$0P0@U1 0S. 0 P B N %Q * RG  (0B408@S 1:X 0@D8C 003 c0?o< @@D@  IPP  gPOPP 0 @ S :    b01"!00000P00-0PL,%A-p0@@ `P PP0`0P P@l⍋%Q *0S  ᵓL,$00S:@-@@RL,@-PP` U(0SP@P )@T \0@巔T0T 4/Ҕ 00'0S 0 (( @ЍpL,% %O-$MPpPdE00U0SPc )Z@ <3@兔434 4/W(0Sp0eWD@XU0XX5 0PPW00 # 30+*[@C@dQR: @L{P5 KL ` $ J2 10X0D30 2%Q a*0S ^Z^1)Z @\ 1@(1 ꆁ`K K:1X0<0< J 0 @D@ T1 L0 43   @[ [@K@@d PP P0P0 K D K0@D   %Q   ᫒0@P0'0S 0 P0p$Ѝ*0S  L,%  ,%@-M@pP,aD(0SWTP )@T: 0@嚓0 4/0#880 JP0Us@P  Z'0S 0 |( @XЍr@P %Q|0S0S Pꂓ 00L,%J %O-@QpL$M(0S@ P yP'0S A p$$ЍW $0`TM\0T*P* 0`0  `?oo 0c `S PP T 1b*=C4 T!P030#P0S X $200301S%T#2QZ FD*0T00S<PP 00PPP0 0#  0|0S0S @ Pp"< `0<0 0 pP ePP% 0   D  S%T#2QZ J*0T00S  DtULP )PU @0@厒<0< 4/PPꥒ 005L,%%,w @-L0@'0S 0 00 0OT Ѝ@ЍL,%K////%/%0p00/&0p00/&0p00 /&0p00/&0p00/&0p00/&0p00/&0p00 /&0p00 /&0p00@/&0p00/&0p00 /&Q P00Q////////0P/ R//A-`Pp@0 P @U*0Q R* /0/h% p0 0CSp0 S P0 /p@-P@,`Pp@ Tp 0A S010// 0P/!R/P/P/Qa/P/0p000 /&P/ 0S S//0R/00p00/&0p00/&7@-@PD@P 40R0PPW0 z Ѝ0 %PQ 0S///$%03P  /0 ACP 0ABs0P r CoSPS//O-MX@ @ЍO!SQ`pu rTp 04S`\kP0@`S@T~WlЍ_U` 㚔!`PE`0r>T 04SJ:`\H㌱  ፏT  QX ( Q   { t Z P   ỏT0`[?oT20S@ @ @0R @T`0-@0S S @0V @ X 1@@V X* 00`00P 08!!00S00/!&8 00S00/(!%M ///@-@H/@P N( s @%kDs-@-   Ѝ Ѝ/ -@-  ЍЍ/ -@-  ЍЍ/ ///@-  Ѝ@-  Ѝ0-@-   ЍЍ/ //////P/ @-P 0A 00ЍQ@P ׏@p@-0P `| @P  \*. Q  Rp R  (  p 0 B &,qA-P @`p>3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p0@- 00y Ѝ0S/1>3 !/0S 000/,0S*p@- @PP P p Pp/0S/p@-0P @R`*0 PQp0Pp0S/@-@0 0C0 0  (  ( 0 S/! ^R/@-@0 0 0  $  $ A-P0S@`$0aH U ( U ( S 01 BpC B!t0`A-PRp `@{P 0!Ὅ000A-@P`p쁟0 SV1 V00W W0Sc0 P 0 B 0  BV  B* "M A! AC`0 F  B8  B "/ A & `PpG  B0Z  Bv`FPpGo`FPA!A-a@0PS0<R&*1 21<0S 0R ,0PP0S*!!! 0R ,00S(!!!,p (O0PA , (0 ,Ph%&&A-`P P0PS\ ]\ xp@BX T 0| PrPpD%0@-S@* Q 0S0000 [Q.Q000 S:0S008000R .R ]R00, 8 0 s000/`Q'Q!//&0sA-0p0@P`M⤂ p00p00pS 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0SN u P0( S,* R)\\&|\#00 |R 0S |0 3/000Q R R0SS*|\0 Q QQ S: 0S   B 0  BЍ 0S 0 c 0000  B 0B B0n0 "0 00 0W,p@-P@,`߇P@tp Tp8!Q 010//8!,1p@-0@S0<QP: 1,0R04S"`$0V):8p1P8 S50#p(00<^ 00^ 0S8opU 0! R R0 0P`h%&&O-P 0R@pM @c P&  $\ P 000Ѝ 0@  MPP ЍO 0 PS@ Ԋ 0 00<00S*^Q0R08 ]R00-R ((g Q* ]R -RS\T0]Sh-R0 S^:0S006000S80S 00000`d0xS ,ZGV ,0Sl40Si$0Sf<0Sc(0pw_  0(`c0 @`F p@ ZUj 00C0e-R [RS :R =R| 0S: R 2S0S0`0`0-S]S0S0`0`40\ 0 IY0 S:0`S0`00S00``G0 B0I~P   0y S0<R$ LP    wP  $0  0$ 峠S0hS0`0`0-S]S0`S0`0= 0 S:0`S0`00S0 -R[ QX]QU -Z00  YJ 0S- Y0`S 0`00S0<Y00 Z0S  Z4 0VLP / {y400!0ⱐᲠ40  =P0S 00100  0P  +P{ U [ 0]SS0<Z*0 P80 P <0 S P p`v`00勰P00 0  EB#ЍORZ =RW ]RTR :R ]R007c j h%,&&&p@- 0@0 (M! 00 x l0R 0`0]00000P0 `P(Ѝp(Ѝp@&&&A-0@``Pp\U [U_0V:0dS0`000 4\U=*Ux .U; 0Sf0 `S xIPu 844U\ 0CUUt0SU 0`B t  | 0D OU &83U N 0  , 0000h30>@0S* *Q2  0  B  BI   B0  B=Ѝ 8 0S 0S 00t200}PT\QR {RO00r0PS;* ,R8 Q 6 2000/ ]U0 R  !   p0 S*R\Q}Q00 S*0R S\Q }Q 0<00S 00$Eo/JU @0` V1@`(p 0 S *R \R0)S ) \h V 1L  0 S *R \R )R003 0S00000+,)>{^ ]&@-0@``P?Q $0As R % S 0 ^Q [Q \Q 0S Ѝ{Q |Q?20V:0S00500 @0` V1@`(P G0 S*0)S  ) V 1L  40 Sf:0S00p4000 S**@?PQ{PR ,$  "!,Q 0S 00300\0 0S 00300?P  *P 0 B5  B   B0)  B0Sw* *B?RP {Rp Qm 3000f b 0)Sa  0  $  $  0  (  (   0   000p0@20z`o ksi0V:0aS0`000<Q >Q q`x+P {N &   B 0  B  Ba  B5 "X A, k0 `S0* ,R-  0000< V0 R   0 S*}Q00@ R 0}Q 5000S 00,!,&^ ]0S G- `M pQpG ۀpL7@P 6W: ЍPCPP P $PPxP @必P 0uPP6    $ ( , 0P4 8 < @ D 0 t000L R:0S005000 S8:   0A0gHP0S 00,50000Y`  p0 P>3S! 1Ss Sp S <0RpQ00< 0 f  SV S<0RpQp< 000p000Q S S SS7 S S3 *S >SQP>3S S& "S 00 0\ S:0_0PS, 0E10S*P8O@00CU00C0 RB  \ U B!U  1 EU, X 0C^ဗ!1LX0RU!U! R0>P P PS 00 00H0@0 @000 0 R00d000+I 80S@ 0Q10CRZ/TUUeQjhQ,Ee,1p@-0@S0<QP: 1,0R04S"`$0V):8p1P8 S50#p(00<^ 00^ 0S8opU 0! R R0 0{P`h%&&0p@-0PSQ@ʡ@80P p<0S P pH0@0@P(00Ppp@h%&&O--P@pMLP 0H #W # 2RS T| z>#R  Ry R R Rg 0pR0R T` 0PfY Rl & R *R` &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Ra R 0R  _ R Q R) TQo_RQ_ B00/o00"P _Q0R TЍ0pP T @00S00 0S000S00u 0S*0S0T S00S 00S4 000_\0S 0S00M 0S *0T _0S 0R0S \0 o_\P0S00S* T00000_R0X0 S  _0S 0R0S0p>3p1># R{ 0G a >#RJ RT RV R _R Ra R 0>c0D2H0 00 P0 0 B>c pr9 pRd[3 A T0-  _P&0a !0R@pH0 00 P>cp0A0!RH|H A>3   0GhP 0G>#`0 @ \P01!># R 0 p`>c`1>3"S`F 0 D>c2 H0 00 7P0 0 ( \(& O-Pp`0,@Q V >\# (\ \W \E \O `P \V \[ P <\[ \ \G \02\ \ \6 "\Y \F \ 0H \ &\{.\$ *\ \0s0S \ {~ ^0s 0@0s0s0S{0[00>@4N5>5. P`F`FV00@>N>0> \0C>!0>#0 R@x @O-4M0\0, 0(0 000@$002   0 X @ Q  0 R  R  PZ$P  (    R    ``S  R  Ug h V pt p r _U RQ v   _V R up  r   _U R w v  _V RQ ppX u0] v  r    _U_V QO  X 0FP|u  p $ V    upv  w( ppu  v X pX wX0wq uc v _VX 3"  Q$,ZS (  `X S 0P&v u _PU PRPU00000S 0R0 4Ѝw`Vw_SwPu4&O-pP`M80U:Ѝ0!>3S S8 S6>S1 0800@ 0 YS  D>31># R 0800@ 0 Y_  DS S- S* S( @` PS 0e800@ 0 \Y  DSU S S 0>#0FϠ2@P0  @P0  0P P 0/VP 0P   W` 0 PE >#P   0T 0  0Q>SP!>#"RPEP0>#2  F O--P@pMLP 0H #W # 2RS T| z>#R  Ry R R Rg 0pR0R T` 0PfY Rl & R *R` &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Ra R 0R  _ R Q R) TQo_RQ_ B00/o00"P _Q0R TЍ0pP T @00S00 0S000S00u 0S*0S0T S00S 00S4 000_\0S 0S00M 0S *0T _0S 0R0S \0 o_\P0S00S* T00000_R0X0 S  _0S 0R0S0p>3p1># R{ 0G a >#RJ RT RV R _R Ra R 0>c0D2H0 00 P0 0 B>c pr9 pRd[3 A T0-  b[P&0a !0R@pH0 00 P>cp0A0!RH|H A>3   0GhP 0G>#`0 @ \P01!># R 0 p`>c`1>3"S`F 0 D>c2 H0 00 7P0 0 ( \(& O-pP,@ W`> ^* +^` ^g ^N ^_ pP ^k ^Y  OP ?^t ^ ^\ ^05^ ^0) ^D "^{ ^h ^ R i ^0 &^y".^00 *^ ^ r R0 ^ y | \0 00 r0     0s0s0Sy0 r RY 0>00 E0  ?oR20SpG pGP x0 00> 0 0 0m 000>301> \00 0>000 1>3 SPO-3S S8 S6>S1 0800@ 0 YS  D>31># R 0n800@ 0 eY_  DS S- S* S( @` PS 0I800@ 0 @Y  DSU S S 0>#0FϠ2@P0  $P0  0P P 0VP 0P   W` 0 PE >#P   0T 0  0Q>SP!>#"RPEP0>#2  F O-3S S8 S6>S1 0800@ 0 YS  D>31># R 0n800@ 0 eY_  DS S- S* S( @` PS 0I800@ 0 @Y  DSU S S 0>#0FϠ2@P0  $P0  0P P 0VP 0P   W` 0 PE >#P   0T 0  0Q>SP!>#"RPEP0>#2  F O--P@pMLP 0H #W # 2RS T| z>#R  Ry R R Rg 0pR0R T` 0/PfY Rl & R *R` &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Ra R 0R  _ R Q R) TQo_RQ_ B00/o00"P _Q0R TЍ0pP T @00S00 0S000S00u 0S*0S0T S00S 00S4 000_\0S 0S00M 0S *0T _0S 0R0S \0 o_\P0S00S* T00000_R0X0 S  _0S 0R0S0p>3p1># R{ 0G a >#RJ RT RV R _R Ra R 0>c0D2H0 00 P0 0 B>c pr9 pRd[3 A T0-  yTP&0a !0R@pH0 00 P>cp0A0!RH|H A>3   0GhP 0G>#`0 @ \P01!># R 0 p`>c`1>3"S`F 0 D>c2 H0 00 7P0 0 ( \(& O--lM%PQ0u @%Qp ppm        Q 0"RS. 0 YP,Q 4^ 8[ <``F0 0`Z01S` 0s vQBo \R 0C1!S` `0 q0 0Q[0 000,@4H80<@ U PP 0 TX\ L0`u Vd 00 S`FY1`0 0 0`,UP XD0S 0 0D0,E`PD00D0 0R < 0JS : _SP Z Z `p4`XD0SZ 4P ,0@P4 pj,0@ 0S%00D ;0$0 0D0,PP5DQ/*0 F00,`PD% 0 00,P0HP 0000 0D0,H0SPHDhX 8 D0`F0C0X?4@` 0 ,0@`\ 2ŁŁ XP4P HP PR [S. 0 Y*,Q 4^f 8[c <``F0 0`Z#01S` 0s vQBo \R 0C1!S` `0o0 eEh% 0Q/0 000V,@40H08 <@P0T0X0\0 00S`FY1`0 0 0`,P XD0S7 0 0D0,`PD00D0 [ ` 0R< 0JS: ?RP Z`XD0Se 4P,0@P4  p4P &HP "lЍ,0@ 0S%00D ;0$0 0D0,fP5DQ/*0 F00,%`PD% 0 00,"P0HP 0000 0D0,H0SPHD_X 8 D0`F0C0X?4@` 0 ,0@`\ 2ŁŁ XPpS0 0 Y,Q 4^s 80S 0o <``F0$0`Z"01S`$0s vQBo \R 0C1!S` `0n0$0Q0 000,@4H80<@PP 0T X \ L0`sV 00S`FY1*`0 0 0`,7P XD0Sc 0 0D0,'`PD00D0 0 S` 0P< JP:$0 QP $0Z`XD0SX 4P,0@P4 ,0@ 0S%00D ;0$0 0D0,4P5DV/0 F00,`PD% 0 00,P0HP 0000 0D0,H0SlPHtDjX 8 D0`F0C0X?4@` 0 ,0@` V 2 1(1( XPppp pnpl-Ѝ///@-' // //0p@-8P00@S Pp?eP p,7@-4P@0S TP Ѝ0P ,@-@P 0S m@P/cP0 0 0/ /0 0 0 0 0/////0P P@-  / , P P/ /O-Md`pPR0@H ~* 0000N 0Y00 R0030#$όZQ^A2  # T P@P2*0 0 0T 0C2@TPT  # 3S R 0 RS# X#0 H0X 0Y00S0Y Ѝ 0R #3SQ 0X 0 0Ѝ 0S! 00HS X00X0 0{W @8   P)X0H0n 0 Q0p@-MP @$0 /"(0$O Ro0?,0P@,.A=T-00ŵЍp0G-M@0p`W PV P%Y P.X PmZ PNx P4 i]W Pf  a] \]V+  U] P]Y  I]t D]X5Z! L 9]< 4]_ЍYXZ-  #] ]  ] ]=Ѝ ] ]ZVY  PЍG@ (  0 @  O-PQ0 M0R0p`TT00 0  @P @0S nSc a0CS0 ?mPL 9mPF  Ѝ0mPzZ V000U000mPLZ V070U070@mPZ| V000U000lPZ V000U000ZW V080U0800oS lPU000V000~0@DlP 0lP lPiZL V080U080]lP~ lP lPSZ8 V000U000@U080V0807U000V000.U070V070%U000V000 ЍU080V080U000V000YlPZw ZpPlP XIlP t xJ H (   8 0 0 0A-`M 0 P!!0@H@>SHPPP PPP8`"`!P03 pP0  kp, 0 pp@ pp@  Xp@@@dp0 PppPp0 PDpP`Ѝp00@O-1MM @PDL 8 "( Ap C. `pXK@D;@8 (g0Sl pp  ` ᰑ 00㨱$ !`%0p@ t0!0 sPqP 0S R]p001ݍЍVp0S 0K0S R Pp 08D<4! @ P0 00Z  0o00h,R <91ݍЍ<p FtHh gt0@-P@M 0  POp Sp@ P P Ѝ00 0Ѝ0@A-@@0s/ PP0P 0G(p` ``0`0opp|X`p o``p0`0o 00Pp@-@PCM0 /_P2 $CpPA ` 6@o000Jt1 @ 2{@P0F0 {@F=d0S VS00 SCލp|@@0SSo@d0d 0P@0  P@1:fo?00@`o00@` p@-QMP4@SMZ TE /2_PB QP0s+ hjP VQaP 0`'pO @ 0@dqpF @ p? ۍЍp+0si/0p0! +Yn@0 P@0  P@1:n?00@p 04n0#S4p@ n00n@n@xD) %@$ , @-rP`O-$(X,p.S`P@+Wu00Sb [0 0 SP:[$" 2Q%> !4"0x"3S20*rW00Sa [0 0R P :;! "#.0P@AQ#Ou0 {0Qp w{_ R P :;$" #0P #[0 0RP:t' 00{S' w{P c 0RP: :) #0P@AQ#O[0 0{R P :[y'@w{ 0kRPy: )Z@0S20o2" U%> "Xw{U OR P ]:4# JP0S20S2">" R01Q"Oj0S20YD"""""""""""p@-@M@ P, ` F 304PIP S F"x&  RQ9F#0 S0F P\'0s F`0d   0 Q0*0^*{ r0s{P T80<0 @0D 0 0h$% 0S 000000(00(0,00,0(00(0$Q0PS $R" :"  R#Ό01"?!x"0$00$0 00 00000S <\ H NR LX \ @0Dh 0R{{AP{$hv` &s0P 0v> 0`0?d000P0?T0080?<00@0?D00H0?L00/X00\ 0 00#MP0L dS0 {{ {{{{{{`0{0{d 002(0S  R $ R' Ÿ\ :6Ÿ$4&60!$ 0Ϡ! !>0T"!!!0C 82 P02@.3H0/#0Ϡ R  " RD#L .@0L  ?8 H D<00 0#!/":N6@ 4$&60.$ 0x.>Â!!!0C@ \0RDL,"΃0,ώ #1 HL  LH @00SP0D 0 0T 0 0Ab00$0S"x$0S"x0$00t00q\/ /p..P-ML,""""l'.%Q(\)\²0 4080DP @:($^0<P0} 0=RH wH %0h00c @D0D0@aD0@#:6D 0 0@ . 0Ϡ.>! 0!!!0C" R 0L  Ό D"L!Q@X?#"  ?00 #1?B! H " H D0 L@0S 0\ 004 0 20DP :P0 0<R $0h00c 0D0@uaD0@#:6D 0 0@". 0Ϡ.>! 0!!!0C" R 0L  Ό D""Q@?#"  ?00 #1?B! H " H D0 L@S0 \0#0  0C0  BQ $0 h00$% 0dR  P@D \DDDQ&@0TP08<b  \0y Q00000SmPT8< LF !G 0 F!A 0 !;0S(0SQ <5@0P G: c 0D@`0D0.:@6 D0% 00@. 0Ϡ.>! 0!!!^0C 1H02 >0.D0LS@/2"́ ?0 0 #1?B!  D0 @0SHL 0Q 004 0F000$02p rp t t   0 RR  0 & F% F RQ#!F RQF# &(0S@0$0D000<\=QH NRL0X\r@0h@0D0D0x0 000$0q0$0n P#R R|  \Qp% 8&<N0dP(003( :60 0!$Ϡ0! !>)0!!!0C P?00.!?@ /" R  " R D D0 @ 0#1A0H h0 0%L 00@0D C00 00S ^0  $0h0 C0000S ^  0@D h0 BQ0 $0h0  vps; 0 *R" O-Mp@$e0Hl0e0W`0 T) 0 2c1 00 <0PP/ 0v> 0`0?d000P0?T0 0#?<0 00$$%"\˟$@ 0000  000T ;0h0PK 0TP dP< P= $`Pm0Sj Rgʰ R cʸ R _ 0 0c 0S0`@dp?O$@T'pET0}Np0`@dp00Be00@D 00000 0H0X PQ h 8 v^D Pt PE PQPHJ004 嘐lpx|PVtRSY Y  h[@p| Ux Zt 0Sp0Xl0[h0 Rwt XX8P0>C 0Cĸ0p00@t0p`VPu x0S d0pt0 0800@4p0 h00 0P  ' 8 PZv> 00! 0#/!! !./᪐ B 0S.?)0S 00#0S<0 !hv.A BϠN ^Q| Sx000t Pt0|d 0 qp  A 0qp `pV@P0 ?oR20SZd00ߍ 0Qd0h0qp@p0 Y Q#! !pY@1NRp. h0 P0,Pd000 `0  ZR 0`S 00@ d0h@ $d0S  0V0ZS0 dh` 0hP0? T00h80? <00h@0? D00hH0? L0X$`\SZP L`cT00c0S@Tpc0S: *ß䓟"bY02#:"b"R0 \TP(e<ePP 0 lß0dT0BP30@p=c000h0 `0@4pIP8P ? /( Rß&0Q 0Z/0 #10">/ 0C!a 0C0 0"#0R"P#. X#0,nX10( #ΌQà3\!=30S C! B^ D 0 EIqp> @p(p Jc#00 c0S @㼀p h S@pb00@pߍ輀X) XXʏ 0b0Q  s!P bT00b0S10(` #ΌQ0"c01 2c1@T`bT00Yl5)\P(\ ףvɻ %I$@-@ LpTEat X00 R 0 R 0Q/  /  ܣ ̣  DQ 0@-0P S@@H  ^0 S  Q 0#0S0 0/@ 0 H  Q j.0 0#  Q/00Ɠ\ 0@-pPo> 0@" \ 0 /tA-@P `p@P0% P @PPA-\@`@P pjNP0& P @PPtA-\@`@DP pH@P0& P @PPO-P M pP9 谟P n`P P @ % gP @P0S  Ѝz T W 4[  YG0p0Sx A-pPQ `@Q 0P 0@DDB(000S  :@- M`pPPp) Fa 0 [0@0S :a0"S" 0p000S0 7/ Ѝ&a0"S1Ds\0pT000S @ Ѝ1Ds$ GT8  @-@c a@^O-PMU@p  PP2SPR PV  P` A T @ P) 0nS: P= PP0 p0Q Q P P 0 IB"Sq0 000P Ѝt0 00 S Ѝ0oSP  m뜘 O-BMM@pz`,0  0nRP:XPPP  bRPm00ZpP PC @@`Kr'0 PP1p [0P0 0 PP#p H#@P! 4 0dSPkPU0 Pp` ;py  0I[P @PP0 PpO ໤P Pc a_ 00BލЍP/U ` P p=_0SM  JP J0H0PP0 p<  pJ_00  0JP`! 0 0 0_080  0J^_ !0 QJ]00,_00  0]JP_00  0 PQJuw_0\0  0FJPj| x ( zd@L   ܢ Ԣ -{M 0 { 1PЍ -{M 0 { PЍ >-{M 0 { PЍ ?0-,M 0 IPЍ| -- 0$ S   0/ 00p@-PIU@p^? $0$`0 6/p<ܠ p@-PIU@p^? $0$`0 6/p @-@P 0003/ @-^@P 0003/Pd p@-P?oU20S@p00 03/ p@-P`UV00P00S@p  P05/ȟ p@-P?oU20S@p00 03/, p@-P`@PpT^$0$ @0p@/\ p@-P@P p 0 0 03/p< -@- M  Jup@(0(003/ Ѝ@ Ѝ/8 @-7up@0003/ G-- M` P @R0Sp Ѝ]00,0 P@:/P G-- M` P @d0Sp Ѝ]00,0 P@:/ĝ 10!Ph /////x/p/h/`/X/P/H/@/8/0/(/ ///////////////////  ̝ 0 \ L 8 T   ؝ ĝ t \ L 8 $  ؜ Ĝ | l  X @-@$ MP#055050%A0!0%%P$00$0Ѝ R/,0p@-S@pP($ARp$0S*> $0( 0C\ 0 CR$ *#0$00S3 5$07$050$0(0,0!PpO-@Y PDM@p, fx[@ [a P @O [ [8$0P$ 0@Y Q< `@@ QQ3 Q0 S0A1@ 8 ,0R h S,3 5407,050,00 00 Q, P0Ç0,  0, 0 Qa@Q8,0P p S>3 57,05  50Q,0g 0 CQ * 0CQ,*# 0 ,0 0,0S3 57,05 50S 5,07,05 50S,0YR#00C RL00C F5$0qS<3 57,058`0,0= A/of[" R  :AoF[P  f[ AA0@ \Q[,0 S#3 57,05 50,0 QS 57,05 50S,0 R#00C R00CP,@DЍQj p`0t FQ)Q* AR  bQY fQ ?R0@SP p b7rp@S B:p: C cs3<2080 S ,0 S,3 5407,05 50,0FQ0 00,S Q 507,50 , 0 5SQ= 305 7,5 0 ,Mb@0f`N2$0?Qa R^  2! a, A0! @ `3 8 Q,Q<3 57,5 5,8Q,  P,  , Q0@ `0 _P$ P! QP3 ``` VRQI[  R `S` 0P0`\ P\=Q,0 S 57,05 50,000 R,0 Q ,0 0,0 R0`S<3 57,05 50,00804Q,3 547,5 5,y ?R0@S@`0%#jo%#jx"%ju-M{0{0Ѝp@-`PM0@ 0 4/ЍpG-PRM\  `UpP*/a@nJP D1000< pp Ѝ80S  1 000< pp`Z0S Ѝ贠 VZ0S 0 < @x0000< @ pp;Z0S6Z002Z00ԕ d X ` 4 @-$$@M Ѝ+O-EM MaX@P+p `ED (X0P@)T 0 X0P@T 0 0EAP D DUEލ ЍY00Eލ ЍY00l~ @-@` pMPTP* /W 0R rR  P   P @0CЍP  rR 0rST 0 @0 Ѝ@wY 0 T  $ A-`@ p 0P/S /eWP @0 Sp 0 S D? hXp@-IMM@`PP Ep 0: S X0 0tp IލЍp>YO00@IލЍp6Y00h p@-IMM@`PP p 0: S X0 0Ip IލЍpYO00@IލЍp Y00 -{M 0 { PЍ P 80Q 0 08080//p@-@P PP`  PP u pJP  p@'+<PPp--00 M (0  ЍЍ/x%0P --M  Ѝ Ѝ// -@-McO<@P@ 00  0Ѝ@Ѝ/$00-@- M@sOP  Ѝ@Ѝ/O-q`Pp,M;  PR $ Ppp @P$# PY P@ 0 @LYP 3O8!,Ѝ000:Q!0P00,Ѝ\$<0p@-@P(M & (Ѝp0 00 #0p@-`@POpp p@p@-P000 0 (M` & (Ѝp"0p@-@@ @  `  @PNpp p@kX"0p@-(M@PNp & 8 [(Ѝp@-@PP P  ,M` @Np & A,Ѝ!0C-PP,M/  @` p`FV`R V @`0 @T }N ,Ѝ00 0:2 0,ЍT!<0p@-@P(M I& (Ѝp0 00 , 0p@-`@PKNpp p@p@-P000 0 (M` "& (Ѝp0p@-@@ @  `  @P#Npp p@w0p@-(M@PNp % 8 g(Ѝp@-@PP P  ,M` @Mp % M,Ѝ0 P $ Q80 @-8M80@08 Ѝ880/LL0000 0<BR 80880Ѝ/lP/0@-@0@0 M0S 0000 X0P x0PP d00!CH0P00 Ѝ0@M0 V0 W8 \2ATT 0`Fs 0Ry %M 0  0 B0SH M0Ѝ0 V  0  M ` 0 0pHX;0S2 0 Lv 0 B@ 0 B  BL`FtY  0 Bz  BL 0 pz L 0 c0S 0 BZ00Ѝ 0 P] 00 ,0p@-@PLppp@ 0RS00 /p@-@<0<00P  @nLppp@ 0808 00 Q0R00 /\0p@-@`PNLpT T   p@pp@-@P\ \  ` @1LpTT  p@p0O-!PP Mn 10, 0D`S1H0?a0P^1!p !q1 W0C@(t  ,0@@KDAA|` eBp2  W R ? P QQ Wt ,0 000IC1100Q0 0, Ѝ000D0 00w@0@-@0@ 000 @T AP80@080@-@P }AP80@0800-M  uЍ0-M  ЍO-ϟiM PȡЁqal QP@ P? `K͌U P`? K͌T P? F͌(Z P> F͌(1S P1> C͌ X sP@> JB͌8W aP= ̌V OP= ^B͌`=@ 0S078d H0P< `P P  P P P P p PL Pp(, qP P`P (aP Px PP'( Q780D0x100C40S000C,0h0Hp0L`P$$0PQw ,0 p0`@ , V @  f`W/0!1AQ 0 0 @T @vT, V   @@dqXhP 0Z  Piߍ P 1 S  ,00 0! 1S 0D 0| 0L@p00AP,,0`L0!!\V, @  B  (8<`@ [$ 00A00@S9 00a1 P Ua PU, [000 P,0匠0Zp(0p1P0@`@P㐽P`  V 0@0@S P8<`@P$04 0R$0'HpL`P1L00P@@X1(@P00P0$001T00PPP1 PX00P00000P0, 0pBPBHPP@ 0T8`<@OH Us,` p@PW 0g1pV@10P00 00Z00 mZ,0W0 P ܰa[@@PP  Z @pV @@ PT 0P@ UfT0@0p8`<T4 ! , <B B P $@0p8`0[/To0, q 0q00` p @@HP\V 0f1`W10 @ 0 0 P00U00 PU,0 V0 @ PqY0P@ 㑼PP  U `W @@HP\@4P,00 0 ,0H0 V 1封0D|A>p`FR 0`0 0 0[0ꈰ  0PU 0P  0@TP0 @  0Z 0^ύ @  0`V 0 Jύ @  0X 0Q̍ @  0PU 0P΍ @  0PU 0,0$ 1@,  BU00p@8`< ,   , 0 H T0封.1D|Q>p@T[ 0p8`< T P H00 0R_ (0Sk ,0P0 P 8< XC h!(0ST L0!11 @ T p @巽T,00 0 @,0 PCT0p8`<,04 10 ,0 H0T0 就!D|=p@.!(0R1P@PB+0P@ T  0PP0,0ST,0 00C, P P0 X" 0 0 B00 S: 0T 0 q!1 @Tq` @AT,000 @,0,0Q@ 0@1>PpP`Ժ Pp W  `P P$0SC ,04 1@X h!$0S5 P0!11 ` V  `V,0 0@ 0 `Tq$0W1`V W  0 ㉺0P`}0p08`< 0,0 SV,0 00C @,p0 [# 0 0 B0!0@SA 0X 0a!D 1 P U a P壼U,000 P,0|!0RP0P1`@90P`. V  0 @ P50 0R80000S  0p8`pP` 4ԅ`S A-Z`pPp YB2S @TwU000 R A A X@-lQ+ P@E0`XM_  S- <1^p0!!!!v : !' !_ !| !o !* <#>4{!*prQ>{ R 81 R 0SЍQ L0 0 0JEl0T0Ѝ!fԁ@0l 0̃ S/4O-C@p`ᜣM[ + (p( $W0CS0SL෸3ø8ȸP $3$0/# {% 08:x{rH̲ pŸ夒堂8ırxrhÃqpr(rhrq`r`PrXr弁qPrxrHrÃq@rr8rq0rr,rqps rqrqrqrqrq rrrqrsrq}@s: R 0S 18p10S pWЍQ 1 0 0cDh' Jl`p \p  00(@T(0Ѝ `aH TP l!X+!,!-%!.%0%#fq&i%`"j#%ok{ %|l%m<%ns%t$%u4%v,%w%x~#p#rd"ye"zH@}T~>pp<^v8#ݶ:ڶ0'׶#Զ0z# 0϶H#̶p-ɶ-ƶ`_ö|o㽶p㺶r㷶y㴶z㱶{㮶@|㫶h}㨶5A-\`'^`@ p 0\@(`V(P8}O-8g887M`  `P `0ǟJҭp 7 000 S00 U0S}Yp  @00  4` S 0 `0 40 s 00bR$ 4S4 0((&00 Ѝ$0 s 00bRS4 0㋰ ?<21 R R3 $ ` r  aR$ $ Q ph0  T5 U0pS p ! @00 4 ` $R{  40 0 ;0ϵ $Q B q/ 0 ;0 p4 S S040ST 004 0r0  cR$GU  p p P p0np P 440 s 00bR4 44300fS t30l3 `` pS 83003 `Q p 30 B  `40q0cR 4S02$00$0C?o r  aR$2#V p SQ p  0 s 00bR40 ; 0p P `R pa 40 s 00bR4 4$R40 s 00bR40  ;0 p E  `Q q 4 00 0q0cR  0 ` Ѝ 100#?c p; 000#?c pv/` 0 `00! 06 4 00 40 s 00bR 44 `0܎A\QtC 0(  0 + 004 00/DO-T4P@P0DM 8 `$Qq  :Q#R3Z 300S 8065P0@P@P@x@-@j@P `d@P >P10S. ,P:  0@S0S0[S0mS S@ 0S 1 CR'0@S ;S 00C S00 0@S0@S mS 0C;S P   0@S;Co = t= O-0\fS`@pMDvpZP S0 prʍr 0H"Rp (0$00 03SN8PK ̭TD8P í 0XSڄ%$ x%T 0l5"00\4S03`00S5 p0S2 4S, 4S 0㨄25X】匡Tp2 3Pm 4p2[& LAT# `P P @ñoH5S4S 4S0?o2᭱04Ztx2 PsY  g?P3[x2  ^?Px2?;~0x2X  T?Px278x23Y|2 PU t3|2gЍ0 D p$h l $ <%$(LYh .?P Z '?P ["  ?Pp2?;~0p2|20P?0 rr 0H"Rpp2[P 2|2[  >P|2?;~0|2X  >P|278|21S0! 4SOL%REZ[(h1M80<4 |2v[X"[UX,  >P'x278x21|2]1Zp2z[(0M#< |2+PQY+X  >Px2 78x2|"B0 |2P 9[[(T0M#< |2P-40|2+; ; h;  8 0 00O\@-0 0`$pPpP `@`@TPxPX@l@ l` X 0 0ptx|" @Q8 z8 80 00\ X 0//tO-\ M`p0P@T \2 !0S S0SXT Ѝ 0 O-鄁\ Q |Plp@0`P Q0V0` 㶭PC 0!  0S0200pP00  P 㒭0P  Iⰰ帰 就帱 00Q0Pn@0@0 0u2d _x2 D2 x2 A-@P<Pp p@Pp `E`PE0 ~2 U@0 q 2@ p@-`\@PT 0S1 RT0S@t0@Snp@kG-lp@`S0 ST0S"Q0S 0STA-@0M0`@P- 0 @  0S 0@0@j†K~"  2 0QU o; P*L , ]@Wۍ G,vup/ -P PM 0 R  *’0  ЍX0 Q0L 00S P@-: #k/p@-0 0P0S$ :#`Ra# #p @ۭ0P:##C B&'0:#!Ba##p8 -L0LM0 0\ 0ʌ   > Ѝh8 80 00\ T 0//p@-PĹ|`p`@0@ A0SP0P0:3S 8 80 0 L0:#p O-ll3 0dS0`` M*pB`P 'WW p p PS p   r  `R  00/"1 R" @0S S8 SW0B S h20`2 `kpw  @U ` Ѝ R j  P  Ѝhp P ` Ѝ0 r  `RR  1  S7K @y ` 0  S q`R Q  1  Ѝ:p  B/oq`R"n000#?c Ѝ 0X0X0 0$08   rrrqQpop) nG-0S03P`@PY 80$ RF U ʌ3S23pSlW " Rpy *86odcτ00 0#d#lm0 p _F?2? 0p2ͭY?w 0`w b2P`0  0 0hdp@-D@D0@Ppp (0l0m 00 pdp@-@0@P:#Rt t# R- # 0pppP`p8:p蠷(hp@-@0@P :Qld^p- pp#DP`p  :(hp@-@0@P:#Rt Ó \ "R-- , pp#P`p:pH(p@-0@DPSP @p (0008 <@%8 pp蘵0@-H0H 0@0:#R#R"#0:@@-`0` 0@ :Q Q- :@-0 0@ :QQ σ #ppPo :p@-0 0@ :QQ σ #ppPG :гp@-0 0P@ :QQ tà Ãpp#QPp :hp0@-0 0@ :QQ σ #pp)P` :Qxp@-@0@P:#R  #Rp @8 %8 "R--  pp#P`p:pp8 :Ա(0@-<@<0@00:3S 00  @-8@80@00:3S00꘰ @-0 0@ :Q&Q)   0,0̌,͂ $  $ "p"p#P`S :QHp@-@0@P0ʃ#R(#R+ P-0 , 0  -0,$0 0$0X0 R0pp#NP`p0ʃ#Rp\hp@-PPP. 0@` :QQ! “Tƒld l pp#P`p :Qppdh0 0 ꄭ00 0 `0@-@ MZG,qQp* c0 0 `000050 00508003 Ѝ 0< 503 ЍL L0 0`0` Vj#c|P` @  0 000:P/@-0 000啲ЫT0T 00:3S 0@-pp T.P`/ᤫX0X 00 :3S 0-pp@- cP`/@$0$ 000:#Rs/ت$0$ 000:#Ru/ᤪ000 000:#R s30/p(0( 000:#Ru30/00 000:/p@-P0P`M0@0 0ssؾp 0S|000 SC q R 0:#Ѝp R 40,00 3/Ѝpĩht@U A-RBP0@SMq QP 0S `[ 1 P00pp1p0 Q41 1`p0V0S  d100V0S  034ppq- 03, pp/%ЍP  QÁP 0:|   000 0090 ` 0@800HUب,Uht@ 0`@-,@@0S800S@-$@@0S800R@-X@M@ 0S Ѝ< 000 0080 0ЍR<@-h@M@ 0SЍ 8 0R  (00 Ѝ 8 0RQ@-@B@2@P$MQ :cVT0r3ppp,0Saqp 0SO1p0S@ 0  B0*1`00|PM 1@ 300 R 8 C 300 X30*0  :3,pp4 P`$Ѝ0`00|P @ '8 0R` 00 `700T @8 300  8LlQTQlO0pC- M P  ᐻV L`冻㤻<0`00:3S \ v Ѝp  0 000:3S/I4T0T 00:3S 03@-pp+P`/@-<0< 00 03, ppP`蜡@-808 00034pp+P`L0@-PPP M* 0Q0@00xP 00 02000*C") Ѝ0|P H00 020000*) Ѝ0l/0@- 0 @P0:R M# P P&tP 000 20( Ѝ0`P D000,PP Ѝ0l0 000: !-Q0 S0 0 Qp@-@Pp80pPU,LQ (0 P0C0S0 U@TpV#80pP 0S,01///A-PPM Q@`Q00?`FV`V` ,p(L 0@VЍA-PPM Q@`Q00?`FV`V` ,p(L 0@oVЍP/\ 0,  B0/\//A-`MVP@,p(L 0@CTЍA-`MVP@,p(L 0@)TЍ@-PP M+ Q@7`pV00Ӣ?0`FV`V` W ,1( @Q Q( Q Q V Ѝ,@ 0(@T0 p@-PU,NQ Q@(`@0@@`` \0C 0 S0Up(,  0 R S0/0@-P0PU,LQ (@0 P0C0S0 U^00@-P0\0P#, 0 BP 0 PU0,LQ (@0 P0C0S0 U0\0O-#4R lMVCT_ ,PA^@8 =$^8R@ 0000@0pP 0-Pp4S-``@PP3@ 0 00p) ,ण4, [ 0 + . 0 ^ lЍB0  9lЍOG0O-:$M$pdZ0  r$ .PUv P0p 0 p Z Vp(:0PSH7 0  @P$Ѝ0SH S4 SpV  3p0004S$ЍOAp @0S S SpU  3p`Fp@0SF0Vᨀ *HVp P @FXp  G3p`FVᦀ* P@Xp P @0S SVp @Vᦀ:Xp PQO-PM 4 3`S,[*Y= @00! 0@ @00@ -TP/ { @p ` PPE @0S 0  `PЍ` D  P 4A " 2Ѝ @0 ,H P0  0 /4404 000S :P /ᐒ<0<0 0 0S :P /L404 000S :P /<0<0 0 0S :P /ἑ404 000S :P /p-DD 0\ ʌP 0 (@-|0| 00@T 0J#4R B0pQ 7@.P f @А808 000S :P h/DD0D 000SP:P4@//000 000S :P /ᨏL0L 000S :P @-p @_/hA-0 00pW* Z3$SP! #R`@4Sp`3@Tv AlB0tQ 6A(.-0    p 000 000S :P [/O-00 0 MX% p `P 0 Ѡp @ÝP  0 PŠp@ 0 5@  Ѝ@갍P  P /p@-JP 3S P`4`30PVޟ  0s3 S 0嚞P 2 $R 0X0S 0D3 20X #$04p03pp.Hp@-jP F3S @P4P砟30@Sp@號A-`Pf JSU?sW< @P3$S3 SW*0N, SsH0S0 WP3PSSpP4S{pp3PUp,0\4000?a000401C0010L10|1spp@-@P PX0:"C0T0XppG- ؀\/P@p  `"P LTL VW PT VW  P000S<080  0 0 P|O-($Z Ap`PɟP@8P ( 0T2͟P* T ßP 0 0 @00 /0WXT P  RX8 @(  !60@0\| @-? p0   0 `T1@A pP`U@  0000<A- Q@PP% pW# 0 0S0P,N000 R   R   R  P 9743`T `TX *P Q Sp  QW02|p@-`P X0@:R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S ZP00SpX@ '(@ 8Q0@0ppp@-Xa@P`Q X0P:20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  \00S P000080S@078@0p `pH0H 000S P@ ?# Q@ 080//ᰁ0(0( 00Q0/T0(0( 00Q0t/0p@-P0P0 0@R` ' p@O-p0 S;,0 0D | 0 00P0q~pI PX 00C 0HSP 1TX[00CS``[TY0IS`YPY0 0CPY(e|0 00a0p@-@PpP`0P0C(, ,1C B00R00@UpP 0S 0@//P 0S 0@//P/P/P/P /P/P/(!O-PP , 10, 0DS 1H`?c``  AAp0@!qW#갑@W0 8 0| 0p@ P@ 0@0 0CML`0 00_0\000S  Q R P (!00// P ( \/Q,0,  R/1S \/\/1S \@/O-A1@ 0QM5 P`p, @p 0S# Ï#SÏH000C  ```P 00(00(00S0000C00T0 03/p 0PS@  Ѝ ^X   (0A-S$'p`P4@(0PS@Q Qa ppQ p 0P(0@Spp(0S/p@-`@0P (0@SpP0@-0^ @ 0 Q@R0`O-`@ MP VT``D0S  00C(00@00 T0@ 0 S `&, 0 S@p @ RᴀD`Dp `| up Ѝ@0 S RQ Ѝ,nP d,0g0P 00X p  ``F , B,(`aaA0  T p0D`4=P  Fp`,004@ 0T` p0Du@U   PB  0SQ 0 0PC 0$ 0\R =@U 0 BQ 0C R G-l@P 0Sp: P PR E PPQPEPUP ` `R F `0`S W0` XP0`F`V` pW 1 $p00SC 807`PL! R@! P( 4! R# $! R  R 000S1Q0/P00` 0S0  0V(W ѳ`F`V`XP0U0P`W`V``0 @p 0 $p0PEPUP (X0 PQ8 0 /$ $\/ P/UPQA-a@`؜1Pp0$ TY 10 0 QT$ D 0R U ETpL @10 0 QT$ D 0R U EBp: x0 0D  Q SC$ 0R U E,p$ 0$@ P0*@0B0TP @T 80@Tp` 0Q@U0 PQp@-P0P`0*Â$ @P uT00PU pp 0Q\SP- 0S* 0@- \&@T!\8x ƌ8 t @,0A0@PU 0P0U00 S0/0?o2?=XA-$@0S00â?P4 0\/@0 T`A pB 0S%0^! 0S0X K"@0 0 0 9@U/P 80Q@0@08080//A-P  0 BS0@( p`0,,0A0C1!0 0T0`S@( 8XE?*00@-B  80 P R00 8 $ P R  R0 00S00!R0$R0 R d1S0800800080$RQO- M4zڌ`3@Ps |{툰 {,Pp,p APP0_ Y4% 80!S0` ``pX08 0 T``0a$$ <@0H0|08 @!\08 `0d0h0l0p0 ЍP4- P' 0*Q- Q80 SpG V P  PʫR Ѝ @ Ѝ  A-0QM@PP(C p`QAR   B P1 \.X) P$,P?PP H0 DH00R00D p0$`P!b@0SЍPЍL@-M @ 0Ѝ@-M @ 0Ѝ- M ЍO-M@ā` HP`JU@p_WNVPED  0  PI L1D00S*Y p$`(D0p0S0`@0,0U00 D0U@pC@`C0Y Ѝ00H00H0t  P PEP` V IIP ЍP @K|$ 0@-0@P0M t  l 0 B/o 0"00  lPP :Ѝ0PЍ0, 0(0\,0!0 s0  S^LPIL00"A @ t@T,0Q0@t@T80(00S&L00S= ( R , LP S800,0 1-$00Q$0 0\( 0qQ 0 , S(0 0 00,1$00 04 S 80p0L|@0H00D00cp 0SL01H@804 0,0000[,04 0Y0Y 00S0`S0F0Q804 0,00 1 1 01IY0Cڸ@LHPQP YpH @ R T0 00P P 00 SPR P)!R00S 00P ɟ`V0 0CSp SqVp4 0 AS0 S P0P ` P R  0R  `9,00SM@ Q0C0E 0 S00( 0S(00000 0 S(00 R0 000:3s P  RP   L000Sj9, 0@000h0S(00S8000S3 80 ;8, 0`V 00Pm0 0CS<0 HDD<0NN Œ Č Ȍ N LL\mɟ`VWY8 T0T T@00D R 0 R PP! YR  rY $Rg  0E0 p0_   0E  @000$R , 7@  c@000!R :x8 8000Vv00C000C0)X6, 00SA0X *1h"0 @, H60H 0  8 0P4, e `p$t00S000 @0p 1P11qW`5`%``0 @00 00S  05# X0:h280V @ 50S 0S4, 0pQ0A0 0C0 ꈄ 10&0 SPP 1 11RY@ڒ RRQu 0    m,Q Q !PB#`F p0p`P@ !?3 pGWaFP `/p @ 0  L H P 0P0P00 XX0 P0P0S^L L00S3(080 y 800  L,,20 p`dЍXL008 0080@080) R d1SdЍ( 0 0=x \X1, `p0, Q0A0Պ8! ,\PY @@YP 4P0@, QeJ   8@,@ APX@T `P `p1  | T r`llPT` P @ p0 `, APYD PDI  P! Y   @@T`Q00 BCP`P P8p0 CQN @0p  0@4$<0S P 0,0[1,01`w @@[`o P  XPn0$00S00 $X00@ p4<PLPA\L0(0 0R( , p0 `, Jz @Z0,  \F `0{8 0,00@ 0C}(@ 0 0800  { 0XPx    0Q0000 CP4`0X0H080 0DP# @P 80@0PL Z J D| p~Pc d1S` , 4@  TP:X X@ P S@DT H　HH E@E0 0: 80R0,`0C 0B0X00@P `0 40 0E009 PU U R0 R  X R RR)0SC 0 R /7,  @000 @ ` `(0,0 000 0S 0 PC@08 0 0U0P$b pQ_ R$R $Ry X  QAH5S>  9, @` 0  `f@0 0p0 `Y00P c 0@` 00 B0W P0 P<00 p 0 P0+ 40U( R X R$R`V] 0` 0 0 |:, @p@0 0`rUH%RPP p RM $R $R X  ôQ R9 L5S<  (;, @` K0  `@0 0p>0 `00P  .0@` 00 B0 "P0v  Q0@00` 0  @000P  T P$ , x<@ 000 @000P" , <0 0 0 C R! U p=, @@0 0p1S U `=, @`@0 0PL5S 0 0RU p=, @@0 0Lp0 0 0 1@000<, ,>@ 0`C000` @000tW # v 0 U@`= 0 0LfP4Pj @00 pWU zʕH%Rn0 @@TI 0$ppP@<@U; <PP$p`@0 0H`*UpH50S0X0S* 0 0 0 0, @p@0 0H`U~0 0 0 @000jP$pPdClp@-P@PPM/ 0`0 R    80x t00 0 000P 0 Ѝp80 @000! B/ 0C?0Ѝp0 000C-鬐M@P 048! \` d0hlp`PpPg80  D000 0 B0C 0/? 0ЍЍ@-@P @T(!G-PP 7 1D00SHp0?sppS/, ` !a@aT:#80|0`p @V0 S00? Q R!R0 S  0 00 0 0R" 0R0 0#0  -QR ^ Q QR 0P //op@-PP0 @ @T $U0` VP `Vp`}0P 0@PUpT` @T @pp  ! !@-@P@T R/A-p0,SP` @T @T0`SP R0Q/ C0A "" Q/p@-`Q'P@0N "" ^ "" T \ 0L "" Q\PV@pp@-@@@0S P$00C$0IDO-:z0Mx*p$P( ,pP H*00\c S@@s  nRXal HR @@i`40IS0c0@T ^OoB@TP AA  RR0|)\ 0  |  bR\ H)` R&8) R! CP'I@, 4R S[80S y0P0$ 0B$0X @C, 4R CPf S ^\ X( 00Q 880, 0,4(0RJ0H 0@0' $P)0S700S00l0S# 0 S , 40R#0l P, 0S 0P0$@P$@70 RЍ $70( U$(00 SBFf@`< & (00 S4$&P0C (00xP0S  P$00C$0'@`&  T60,@(@0 R 5060, 40RpfF`@ 0 0, $P,04 CS (@Re 0 KRaڠ5%0 p p @d% 0(`Z Sq`nR `F%` V ,00P0S d0P0$ 0B$0X@@aV  @ Q[Q $ 0(@0C,00 K[Z p<40,04$!,1010y d 4`000P ^$ $@$#@ P(@h0 Ru ,,Zq  P+ p# J d# (@$@ ?#R W( , #\ $6 (@  P 10(@$ R  P $@@ lP "  20,  , o40 S _ ) @20$ ܀(B@0S 0P0$ 0B$0$܀ 00P0 ! 뼱 00(`V7ڨA@ 10(`0 V0|!0`Fx P(`0S  l0P0$ 0B$0@,0(A@0S X0P0$ 0B$0 @,0 TԿdh`H|lH@ԽlL`(  X$4ظH(pT@O-lsl3phC@00 S M ߵ400040,c`(,P Zm34@3`0T&#0C S402PK袟  ?0@DS(00S00lP 0S 20 0 204@,P0T0hP \RP0 @P 0( 0CS SP 20 0 P1040 ,( Ѝ00S00h0S00~1 0T0 >@P,P  ^@1(`0 R*T$ !P0 0 @T 0 R 0 P$ 0 0 00 lP @T00,P 00( p0  04@SSCPE@D4@P,L 00SL004Px H hlT0@- ,(4 00̱@-  ,(4 00蘱O-x1x!0 p *⨒YX!X P!0P[& Z( 0S!`,ppGP@0   R     P0 P00P0`SYPU0,@a@DSQa@U S@00 0 Q  ST 0P0 00 08QD0S0l%R h%R /!R!RtP/P// 0 000 0P/ G-MuPp0 5` 80s3  S̠`D Pr LR!1S85@450 50 `\Pᴖ 40 00P 40 040 0:p@00@00l%R h%R 0ʀl2 0h"T0s# 20T0$,,h"h"+h"h"+h"h"*h" h"*h"@h")h"h")h" h28h20SK\Q*g^SrA Q _S~VZ]9 Q gSf2 Q PSSVi^* Q j^S! Q k^S Q gSf Q[-S 0Y[=20  0SP R!=-pRt000 0S@"R 42U8,Ÿ= @0A00+ 2bA`PU" 0S 100S H0 0YH0 ,N 0Q  YBPUЍY 0   0 0 00R0  00!R 0ʀl2 00 !R 0ʀl2%R t5S 0ʀl2Sp Sn Sl Sj Sh Sf SUcĮlxh\1P0PP PKPK 8 QD\B@- 00ʃlœ\ 1:t“ '@T tƒ'> 'tƒ A\ B\ ^tƒ    // 1P0= 00` P7ʀ :l“3\0 /@ P 0000CS0 00000000000000000/@-@P@M&\\ Y #3t P P 00 &000 0vЍll`P -P\P Y͌# /@-00  |00S d d0 8=0!D00 R 0(@@@-$!$1 00ʃlœ\   R  ,Ǡ 0:'.t00 R@\ A\ h0txxLgI0 000:h/ p@-@0@`P0M*l"R R &Ѝp`   P H00 040@ 00 @ &ЍplX02C-00$bS`@ M "2p @  "0S 1QX0&R  l"R R, !p@ '( V@ Ѝ1=00QM0SJ\1p20l P10 0O0剑Q:20h1=00Q!0S0p20 00 0/0剑Q:20t 00 00`0pU0!Q 00pI0!Q ꌢ,l0 000/p@-x0x 000@00CS0 S p0 S P00p=Pp00p@-0CS@0 S p0 S P00pPp0p@-,0, 000Ptw@pp@-Pjw@p0 000S  @-@J Q P\,Q    @/d00P JP\@-\,AP /P/0S/p@-    A BJR@Q`,PTa@@@AR  Rp0O-3$MC0P`Pp@ W %wP 0p#0C S-0 00$Ѝ)T0 S80  )2 0@~ @D BT p`$ЍJʯ,0  1@Q!R 1Q0 CPg(^01A@D D P[Y :0 0 0I U0@D0?Y 0封@0p@`P`p CsPP+  U  P `X(0 SCJXC0 0(0C\00C(^$ЍX TP P  D0|0ap H0@D002 T `V `AuV `` P|(|0 000p@-@Pppp@p@-@80800P  @ppp@l0O-`6lM0@P,0 j Q 0p v`Pa Pr0P0[ W   0<0P 0R 080ЅP 0@SF0 0800`P0S 0P 0 0PEPUV 080 00PS0P<0? 0005 000p`P0 @R  <0T R8 2 0<00800C?80uP0`FuPY00` u, t480pP pK 080 `0p`8ppP P08 E<,QpQpP Qձ4pp( X< R!p! Bp G" RX :     HU pG< S8 8 (P4`< @p$0,0 1400H0@0 @0 0D-PU<$0 (Q00C 0 Ss 0( 0C04 Q00SP{ 80 0? u2, 8 P zI000 0P8p0i08 k800C?80tP0pGS00C0`FQtP00C00p000P0 0PS08 B! Wf 0 0H000尡pG WD0|0pslЍ80< p` 0<0T pR0`<0 yPo 08}slЍ`{qs T0 00 W0p@-`@Ppp p@I G00 ?@0p@-@Pppp@ 2p@-@@ @  `  @Ppp p@0p@-@<0<00P  @ppp@ 0p@-00P 0`@0000 0PP`U1000C1.V P*U /UpR00ppP00 0PEP``0O-ԑMS D@HP 0S p `@ 0Z  @ 4/ 0[ 7 $[0<S<0.S00#10>P0 0@0 0}00 P00 Gr R0S0 0?P4/ZXЍ G\00r R0S@0p0pP4/pW$pQ# @-@ RM !R "R pPĜ\  00@bЍ/0Q # @-  MS S PpP$R ,@8Ѝ/@-0@,M @ Ѝ4@-@044M0 @ Ѝ0@- RP\\0N ^\1   %@@ _ ,\'\ { X"LN!!N0 ("!! L}0 0% !  <{  \@@ RA 0BP8dP P @@  T0 B! { c\ "0  '  0  o %X  +p {o\\:\   8QO-M  n EPP@ 0 p % p 0 5S p/ Ą`@Ḵp,S 0 0  C@00 S  Qr%S+0@ GS0  %@0iP@0@ `fv` 00#1.Q0*Q 0S @0 SE^0 @00% d dP00 @0@00 S*L0 0 r 0   0 0  < @ 0D@0 @00 S^ip 00PЍ0 S0^ ` 00 @@D"0 C0 0 S^ 00000 h0!@ @0 @0g0 S!00sp pp00p 00p 0@p p0, T \0@410 0rp 0  0@ 0ppTp0 S\R W' I00 S0   n  00w0`f Sv` 0S0\S 0 Sa0 00 8\%p,%c%+%c$</>p@-P0P`@0MS SP!  00 0Pl 0 Q00Q H  8 x0 ЍpF0ԂpA-@0MS0D0@!0@P0S?  0 !~|!!`"bNL LL 0 0210B qP `0 pW$P@WP 0fSPЍЍ 0ЍNLgA-@0MS0D0@!0@p0SE ^ 0 ~!^\RN  L !0 120B QP `0 pW$P@TP 0nSPЍ"0ЍЍ`kL>G-`0MS00! 0p0S[  0 `1` I $L0!b!bIO4ቐ გ1c1cL0 0#3cl 10B ALP P)0< X" pW $@r0sS7P @WXV @T {mPPPЍЍ-?LT*S0 O-TMlk`PM ,$  0 : 0` @P 5U000P 0:P @P 0S  R 0X F #X =X =P 0000pP, p WJZp  D00Y*S  m`P V30  Z l0S m0q,0@  0;pß $ 112cA112c B LL0,#0#pr!qpC 0r0P0q0p6@B P@=rH`@X 0Sp  l 0` l@X0`0TЍp  0 "$ L䡟‚  H !1 2ਁሂBP㈁K 00@>p  0 \1\ $L $$H0!b4!b Lƒ1c$1c 0L 0 00 壀((!h!b!CP㈁ 0tS0cS0Spp0@00 p< p0S `y lꔝ, NgkLP>-?L|*S A-P`p0\ %\0@pS sS lS P0\UUW Y000@1CP0PCV` 1E!H00O-̟qM PQ P` 00S040 p$  l@H Z 1  RS GZ P P 4 Z %Z%Z400 R,:@{kP 400@,%,`+P p` H˟,@ 0:ZAZ JQ  0JPPp0-00 >Z A0Js =R* =S00 C?QRp  Wp1PW -.R0 XZD cJqQ   Rp~ PA0JlRpY PA0Ja0Js Rq11OSts00qߍ|I@[/xiP 00040oiP, 000#pRp  Pp1l X   QU PEQQQ W! 3400`P, T*R 0 Hp 40P040 P PPp1  \1SE 0C111SB Z0! Jr 2( R'Z OP0S'Sl 0S'S'SPPAT 0DS11a d7@D!&J0AqVZ ຠ `OT` a 1l!01ATe @DAAAa0Js RA0JS3J Aؕ 0000 0 B10 OQ4 }RRT0  R}R}RP!RU 1h BY!r ;#P`!`1`Q,*P  0Ꮕp^ 40040i10Js Rd1lp1OS!!0l1PUAT @D`1AP OT0a11@A?0Sl00l0 0St00t030S%   ?R ;R P0S %S0 01S2 0C11AT/ #Q,,*P  4 @ , 40,0PPp1BA0JS30J1OS!l!011@00@`oiPv 400`,Vp p2ci Pj 400p, 000S   ?R ;RH eRQ` P0S %S0 0AT @D1A !OT> `V ᛣ```&``VP``P``ý`@oobP``V T``@Q AOQ AAT @D1!ZAo!᪢Vp p2hP 400p,PZb00!J]o0 0媢V0`0R001&J0GZ @poD0`0>00:00-50 0|@V``pT@`V`pO@`fpK@opG`@pCoo@bp>ꔿ' s V8n-- M0 0 ЍЍ/--M0 0Ѝ Ѝ/-- M0 0 ЍЍ/00/@TA-PQp@M 0S XA gP  `V 0v0) V Tz 00 LPP0T0d 00ЍT Y 0 0 R Tx ~T`xP0S T`( h 咀p 0S R s0r (0 000ST00P vd p0 (0P jd p0 0T/T@)4%(   h  ht@lR@    p 0R @-MI0@S  ЍA-pPDP U) @`TV 0PS |@P0DV  VP NoA-PR pQ 00@ `P % P P |#0 ES  DgP  0 000Q  0 R0 R   Q PAuPP0 QV \`Q  0S  0 S o W0C  s0_S0S  0 S Q V0Cs0S PUD 0$XPFPF " X< $0 Ž20nP; sPG fPY P?oR20S 0 0qQ :%RfP NC!KfPJ<DfPL5$ PP qg$Pmg 3fP$$ W PP?o2?    0S V P(C-p|Q@x!P`M0  P 000S8 @ЍPP vp  01p R 0S 0P@ P@ @pЍ 0 P LPP+g P *PP004a0 L``O-M Mp:S$0S:S@ 0PS:S``E[ P!* a `0  oP 0P:S ۍ Ѝ@ۍ ЍC-pP,Ÿ,MM @`tP9 0/SI P R0fX PJ P 0 ۍЍCt0P d!  P"0 @ۍЍCy,0P 0S/S şpP LfX0 ۍЍC0  PۍЍ p 0*fYW L0L 0 $ۍЍ404 0 $^ ` @ ,   \ \ G-p`@P  X0@eT  NP @\PPP P @T  @0G`-@-@ Mm00 Ѝ@ Ѝ/C Ѝ@ Ѝ/@-@eee@ee e0e@e 0p@-PS@:pS dP!pHc @-Q @TnR  sR) fR Q \' sR R\  Q  0 ^Q  R Q A- @X p`fS@X P0P@0@nS sS@X@@ 0 0S00@PA-P% Ppp R,R    0S,S@Beb`P   `00pp@p V G-pT@`PP 4<pWW*nU< sUZ fUH0D Y+R. @cP" H0D@pH0@0 H0lH0nUp@0 H PL sU: fU& L00L0 @]P @P Yb 0S0000W 00 H0@ H00 ,00H0@, H0@0H0(H0, 0H0 0@ SH0 $H00H0($PH00H0 L 4 O-M PY p pX` `0( 80H00 a0P@^  P pY  X`   R , R < R! L R* JЍP   , R P   < R P   0L R `P0 0 @w0@-1!000 @S0 0S0:PA_oRQ@ \T  0S0Q@000@T0\SET00 0S00S00<A-`p PPU@R bP !0峀0 V00pp   0  0 0P aO-`0@ $M 0'P pNcPpUP5  P ^b0P  03c pP|@P Pv@@DbPc $Ѝ cc0,P pU 0$0(0,0# @ 0S00sPa PU Y  @RPU  @RPU R@b0LP@U@0D0H0L07 pfS&p @P" PU!  @0nS sSpY@@pp 0pE 0 b $Ѝ &]"]@r p A-Pp ``V@R aP A0峀0 00P00 0  0 P`0A-P pW@`R taP 0` 00P 00 0P_0O-LM<  <*, , 0ZpP |@P0|0`P 00lZPsT ePa\:PrP`PP p pP V 0T 0,"P`4 ` 0100#$090400S% $ .S  ROS> =`pP 00p`v= <00P5 P 00 R,P `aLЍ#<@P= pp`v ,0 S Q0S Q0TS 0 10000000 P0(-Z801_80 R({aPLЍ@0@SF p@t`00 0 0f0 `PYj (@[ 0 [P p;  )\[  R-Y %\^[\= @[0P0&0GS-v  0P (Y0 KrQ40E K/RS  [@ [D&,0  @ 00@&,0  M p00 D\D0 0S#P Pk 0 g 0SP v0 h 000  00 n0PB p (_801` Q  Q 0S00  p    00 ?[#v 0 S00P0@ P  0BP,  p0 80u Y80! [0@B PT@@p* 0 000 0s01P (d@p@tnp@t: ,0 Sc Q0S \ QIZ@RPaT` RP40 %00 (-bP00kPp@t0s <00QG Q 0B R 0 d a0 0]P<(0 P00 0S00 P' &0pl0  < +00 00P"p P7ĕ4  @ D | P/$P00//0@-MP0 0^\!1l!1"b2cNL 0@@0#@B!A@C0PЍ0赁Ng P0`0K?//0p@-MPn0 0nPel b N00PEK 28@0#AB@C1dPЍpkLȘ>$0P00?//Dp@-M`20 RP0el`E $`L0b!b4!b E|@R1c1c@L?MD@D 0P0@$C!d!b8A@C1|PЍp-?L*Shp@-0P0M`2[@P 0Ѝp], 0 0S Q20ЍpPG- 1 !0 qP P@3 04 S0`0`2,0PP00|Q``  VPeȄ`EQ  V|0`0ȇ`H00BpPB@-@P <^:^8^ 6^$4^,2^0^,00!R  !0A 001/@001P//@; @--@X@X0@0@0s H vPJI HH @,Pp@--(M D@4`0 @@PR  k{UF{{v!00 (ЍpP P # 0U 0k {kUkf^!00 P ~P P# 0U 0 0"uP  0cP0O30{kUk 0 cP  0cP0L20U 0:"2Ť2"NPh  0cP0x20U 0t 0"<P7  0cP0t4 0U"  *P5  0cP0x10kU ! 0]"1"OJP(  p0cP0ʘ 0U"  P b0cP0d10U 0"81"P  P0cP0 10U 0"0"P  >0cP0<00U 0-"0"P8  ,0cP0Eʘ00U 0 0"P  ??P\ 4 G D X  4 0cP0(00 0<0<0U" P  0cP0xp00{kUk 0 wP\  0cP0ʐ30{kUk 0- eP  0cP0qL30U 0b"83"SP@  0cP0O 30U 0@"2"APG  0cP020U 0"2"/P  0cP0Hʈ20U 09"h2"P-  z0cP0D20{U{ 0  P  i0cP020u{U{ 0 P<  X0cP0!10U 0"1"P  F0cP0ʀ10uU 0 P4  50cP0n@10U 0_" 1"PW  #0cP0)00U 0"0"P  0cP0ʸ00U 0"|0"P  0cP0Et00U 06"40"P   Ǽ Gl , D @ p  $ | 0cP0$00 00U", iPt  0cP0h00 00U" WPr  0cP0ʬ00*{kRF{U{ 0 BPk  0cP0\30U 0y"|3"0PS  0cP030U 0"43"P  {0cP020U 0"2" P  i0cP0_ʐ20U 0P"|2"P-  W0cP0PP20 00U" P  E0cP0 20 00U" P  30cP010ek{U{ 0x P}  !0cP0ʄ10U 0"\1"PK  0cP 0810?U 0$ P`  0cP0b00U 0S"0"P  0cP0fʴ 0U" 4 {P  0cP0Np00 00U" iP  p x G( h D L  t X  P  0cP04L00U 0%"`0"9P   0cP0ʌ00 00U" 'P  !P  ~00 00U""00 o1010s 10 1U""00 \P10X10 d1U""00 L10 1U""00 ?10{kUk!00 23030 |3U"!"00 "\30T30[ H3U"!00 (30u 3U"}"00 2020 2U"m!00 2020 2U"h]!00 20Z20x20 H2U"DJ!00 H206@20h 1U":!00 20 1U"-"00 1010 1U":!00 10,10_ T1U" "00 p10 1U"w!00 @10i810010Q( 10q 0U"!00 o00{kUk !00 _00 H0U""00 R00 t L P P P 4 x {kUk!00 #30z 3"ZI _I  3"U"00 t30{kUku!00 D30{kUkh!00 30\`"00 ["00 " " A " PI : S@ F"00 A"00 <!00 7!00 kk0!00 +"00 &"00 !!00 "00 "00 "00 !00 kk!00 "00 0Sg !00 0S0 !00 y0S !00 q0S !00 iP  c0S !00 [0S !00 S0S "00 K0S !00 C0S] "00 ;0S= !00 3 -DT! @ d  0S "00 0S !00 0S !00 0S }!00 0S u!00 0S m!00 0S) e!00 0S  ]!00 0S U!00 0S M!00 0S E!00 0S =!00 0S 5!00 0S~ -"00 0S %"00 0S !00 0S !00 0S !00 0S "00 0S !00 2H "P !H H  3"0SO!00 k0S !00 cx# ip# |"00 X"00 S"00 N"00 I"00 D"00 ?"00 :"00 5"00 0"00 +"00 &I mI "x2"2l0 02L0 0 2,0 0@2 0 0\20 0z820 0q20 0h10 0_1l0 0V"1L0 0MM1,0 0D/!00 P10 07U,10 0.\10 0%;0 @@?0 >0l0 0? h < @ h `  X H 8 @ ` ( L 0 @ 0P0 040p0 02X00 0|00 0`0 @@0 s0 @@0 100 0u,1P0 0,P1 @@0 ou!00 10 0}!10 0t10 0kG2 @@(0 ^82 @@xX0 Ql2t0 0H20 0?+00D?0$ R'4000  0p@0>0U 0PEt@T$0Sp0  0@p=0U 0PEt@T$0Sw  '$   0   0s  0h @$ pRup@=0Up 0PEt@T7p0pp@=00SK <0000CST0S2 < 007s@ Q<0E(0 S0(0@l< 03pT<0U/ 0PEt@Tw0Sp <00<0LQ`D0*;;0\0T  0T :C0PEt 0@S9U 0P0,P0` 0U@@ ?N?P?5? J?|WM? H?A?L?@  ( 4z :?;?0p0P0?0X00 p0tP 50040 :@q 850050 7?R5@0p 0V 00p!500x505l 02^[PEt@TU*U0 C00ST 0 000 6Q0 0S @0p 07s0D@CqV$0(\$ PEt 0@\7U ؂>6L070 0s0P7s@Db 0@D'qM0@ph0dl70n0` 00P00X⽿p0P0tp0 (0$P$(01 80080J80080 0sAӆSR: @3 0@|0089@0I(@ p \ p T d \ h P 90090 0S90?Gp@-@)PP80S ($03/$0(3/00pPA-@`PP@p0 QR 408 B4 08@V000PA-@`PpP 0R| S  P00S  X U0S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /C-T#T3 0 M000P@P`^-@\3 R < 00 2#  00S "$< @0 P0cA Q # 2RN  S=P0Sd2 R @< 00 \2#p0@< l0^ppW} H Q0c& R#2Q3 S"Q0S Q*0 P  Q*0P  Q:0pSp R0*Q  R*0Q  R:0l00p0C0l0pSp)x0 00 0P,04T0p0 p0 0 0 30 Ѝl0Spp l0@@@ Cp@S???=P 0S $0S 0S P?,A4 BR/ Q /@o/A?A-`Vz@ 0!(3/PPw 8pWG  ( 0(3/pP00 f  @T 0  d!RP S>0R`*p  BS>00p0 (08#@8pPoRS B P T W B T p 0Bpp00  @T 0  d P S>0R`:oRpS. 0A pp $0(3/P 0S $0S 0S P ?,B4 BR/ :+/P 0S $0S  R 0P0?0@@/O-M@ @Pᬰ!X 0C00$P $p`0 sRpW-0p  p0 Ѝ0` Q`V00p;J\S10b60s0P0X 0 C∀0S 0X\!\ ! 10T2 0# T 0SЍ0W0T0S Ѝ0D?o 240%R00S0000020(0@0,000@(,04@080 00 0 00C$0 B T@[ q W3> BI  p Wۄ2  B37RL q`36 B Jq`36 BA@g @PKU 2@EAa P%A0@  2 `"<0@ 4ЍP [P1:  XT@p`0 pW`6@^ B37[`pNV*jkV`HV$+ `\``\pWLNW\NW`Np\ \2Wۅ  >`V7*pG(p\ p`$p`p`(p$p$p@ V(`$` PI:`@`````^Lp\`@\k \c$`\``$(@$$, V,(`@  %$(@$$, VpLF$(0$00W\(0`@]mР Q??? LD, 0qR0C0s0\0@0qR0C0s0\0/O-,Pl0AOE@DS8@$M@AO<00x00@@D@^00S| Pt0`"!!^!@p4 0TT* RR 0 P^ ^ ^YY  0PU<PU=PU>PU?PU@PUAP0UAPR@oPP 0C  0001&=  &6`Rt0l 0C `t0l u\0S8 B0 l0\0V00S8#  #800#"0 B 0 0 0 0 0 S0 S00ӈ R01q 00  R000 00%*W6: &R \ R80l0 C 0 B 0<L0DC0C t0S*l0\06x\0l S 8 B0 l0\000S10e\ R80l0 C  A-`pPTq@PB Q00V0SI0S: (0sT Q 1@0@!A00000 |0 `bp( 0S*t l00\ R$6S S L D0 BC '060@D0 0!1 0Rppp@-@2PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0($03/0qVP0pPO- M8\04< `08^1S00PP 0 0pS{ $0Ss wpVjV`F0HSs0FSRo WmZkFoY㫲[dV @!( `4/@Pi * @ !2) X  P "L  BT  A0`, `4 ( P6/ `,8(6/ `L@(6/jD 0(3/68 R! ( @ R% D PR! 00C60p删$0 ЍO{v `fp00$0`(0 } Ѝ8 80  000& -M 0 BЍA-PCUo 0`0@ 0S@  00 0h!(3/@PR P!@C 0 ,(P3/ 0 ,8(3/ 0 L@(3/z 0D (3/080P. @ R+ D SR% , 8 , @@ L DD &! 0 0C006& 0&;> 0$0;/(O-Q$M R0 t 0S!q"$!@P`p,ß  0+0* @$)z0(!y0qx0aq0t0@AP1:SuPQ "9SuPQp'8SuPQP`&P5S>3s0uP1+@$ 0(@0S 0P0Ÿ " rP"$!!! q !P!"  " " rP"$! ++{ !Q+" @$ $ rQ"$ S4@H QPQ paQ"$&P%uPQ@D"T% r  Q% "r Q Q T% "r  Q% "r a Q d& "r QQ&T% p!T%$"C0S |0!qS"$!$ЍL!Q1C1@`pvp(, '&&&\&(&T% A-PR` p㴀@Pp  !1   0" C  .P p18   0" C !&$ A-PR` p㴀@Pp  !1   0" C  .P p18   0" C !&# p@-@P Pt`t`@P  !1Ē   0" C  @pPp" p@-@P Pt`t`@P  !1Ē   0" C  @pPp`" 0@-1@4P 0,C @$!0 RG- pph Q ROSRCW-o`V @0@0\\\0 p\ \  0p0\0p\ 0\p0\0p\ 0\p0\0\ p\ 0 0p0\\0p00 R7Ǡ7 lŒcVV-2P0 pGN0 P"R 0pQ1W1|G.7&c2pG0N 1pW|GpG|1^NNPV=F10C=@  L 0R`RPR0`P0 `R0` PR0P `R0` PR0P `R0`PR0P`R0`PR0P`R0`PR0P`R0`PRpRP00p 0Q0@  0C 00 pQ80'7b"c2pGNq(R&-7c20Bp c!qÂ'b "0C0,Q  HA P A@8R,C(0 BR,B B /qR&-7c20Bp c!qÂ'b "0C0,Q  HA P A@8R,C(0 BR,B B /q/Y U/0S0`0//̟ 4?76@-S k>@@0 #400k.06S0k. ς 1O- p:PTU$0!`Q U @0ς!\KU` ẠZ 1 @1:  V:0Q=0^  pQ Q Z @ O-pp5 DMP[Q @!M080I j\PĖ PĆ0\@ CSP$ R(㨆 pPp 0Q= q[P$尐6H0C6RƆp 0€00@ jX0@PQ- 0ඟ0 pJ`{P09 `;ST`+0HAX{T4T+ pQ}Qp0Wq 20|~6{`0,Z`;p HT$@P;0>0 0 0p0S01Y0嵏  0100W0Y0[ B   װ 0Z.061#60S\+ ೎LY LQ LG⋰@ 0p@Q0C Y> 00A@N0 \0000C01 LQ @00^ 0 P 00Q0 0S@\ R @02^02N00 R0@\DЍW@  xP 01LY 1R 6 G2#6pP^p N0j 0=C-@TppR!ಐ0N+m^\dT( Y!. Q =^0p R. \HANpR 5 ^0@ Tp5  \ ʰ Q ^0 Q ^0 Rp^0@Q^0p ^0@ Tp@@  @O-M\PPRf!   `0  +M @Nk@^ᶰZ἖p S 1>@0ny SwpFP0N`ppP`p%TPVPeTEtp漖0@P0dy Swp @0`pp0`p#406@D@0cUSupNT~F0PDt@`@`@@0P#4``0F0d^~p@D[pF5 [0@Q p[ ` Q^kp徠἖0pj9Ys0pJ 0 00#4 0编0iQq0 `V0἖pW 0@S p`W0@T P`㶰[ Y0ʀ p ^C @0@Pc UYuP@ 0PpP0CPpP%TPV0PeTEt@ S6`F3@Ps0kp0p0@0P#4pp06[@cVd 0C`6A0@Qe pW `r 0@P9pd Ws0 @p0@D0p0#406@0cUSu0 TFP `FPDt@k>p@p@@P.pp[@nVd N` 0@Q# p[20@S P`㶰gtwp@ p@ 0T0 `W2 @p0@SЍ༖N~C[0k@6 N~4[@k0F| P`㶰00@S P`㶰%0@S P`㶰0T 0 i p@` 0 `aO-ʀ6MS 3003`003k^0 0300300! A@b9 Ts0@p000@p#406 B 0c^&6S0@ 编0$` pḀn9 Zs0 0N 00#4 060cXx0qX tq@DphWt@>s0挥pH000p#4060cTCt0 BR@@@CAԕBԅqಀAph>Ys0H000#4060cWsw0 p0@sW `D Br @g>Ts0=@000@#406pGp0cR#6 SvekN&0Pn2Rs0 P`0`00 @#4PP0&N0bQq0 k0&Ѝ 0&;p0v7     00@-(  ;0,8+J &̀+k. $ˀ0G. 0S0 0xS0 0LSZ=I( , &&A-@ k΀`P s0! Qr p p "$  aS2s Ak> u 0  u0#Ġ  <##4U0 0 h000*60@-S S00k@@6 0C60k>@PP@@!PPƂ0*0@-k6 Sq00@PP0#4@@06c\| 0Ck΂ S600@PP0@@@#406 0CS6 S00k@@6 0C60k>@PP@@!PPƂ0O-0 QR@ MJ, R 0Kp&]EP+(+;0N  q/ ! R7@P j   Q& R \3 "[k. Z0-q:s00 00 "$ 缦0jQ3s0 J+ ZB(弦| qk>0#40缦0j\3s0 J Z㼦yzk>0#40缦0j J\3 Zs0漦@|qk>0#40缦0j\3s JXM⼦k> / ! Zq ! 缦jR!r J^ἦ b _ J  \ P+R +R ,RE R  Q ,Q3 "[Q6k S op3 s0000 #406 cPp 0Ck N.V6 0G. 0S0 0xS0   0LSZ=00IX  && Ѝ R3 "&][Pj 0 ЍO y: Zs0漦)@q:s::s0 r :s0q#r 0{`(T:Ɠ0@-PV Ɠ!DPV @Ɠ@QF !6@o0ƓAƃDQ  !I.Ì!ܕ"܅&  40S A-P p@0 C`0@GTUT @&P ;&/@- MP`pX*@P @堻   Fp P F/ @P  Ѝ 0@0 Ѝ0@00@,/T  Ѝp@-P'*@P @o@p 00p@-@*0P 0^000 00p@-MP`*@P @ @I0 0Fp .@Ѝp0@.T @Ѝp0p@-S P@0 C`[0@cFTi 0 pW&0P@p%yara0p@-S P@0 C`60@>FTD 0 p2&0P@pt%tcid0S p@-`@0 CP0@FT @pp/0S p@-P@0 C`0@ET %,0P@p9%p/yara0S p@-P@0 C`0@ET %,0P@p%p/tcid0@- M@ Ep  P Ѝ0 Ѝ00 0 Ѝ00@- M@ Ep  < P Ѝ0 Ѝ00 0 Ѝ0yara0@- M@ Ep  < uP Ѝ0 Ѝ00 0 Ѝ0tcid- M Ѝ- M} Ѝtcidp@-@Pc%0PPptcidp@-@PW%$0P px00ploobp@-P`=@P  0@$p@-@^@ @-@X@ @-@R@ @-@L@ @-@F@6 @-@@@E @-@:@b @-@4@{ @-@.@ @-@(@ @-@"@ @-@@ @-@@ @-@@@-@ @ @-@@3@-@@L@-@@c@-@@z@-@@p@-P` @P  <0@#pp@-P` @P  *0@#pp@-P`t @P  0@#pp@-P`b @P  0@#pp@-P0`PN @P  0@#pp@-P`< @P  0@#pp@-P`* @P  0@#pp@-P` @P  0@|#pp@-P` @P  0@j#pp@-P0`P @P  0@V#pp@-P` @P  0@D#pp@-P` @P  r0@2#pp@-P` @P  `0@ #pp@-P` @P  N0@#pp@-P0`P @P  :0@"pp@-P` @P  (0@"pp@-P` @P  0@"pp@-P`x @P  0@"pp@-P`f @P  0@"pp@-P0`PR @P  0@"pp@-Pv@M#(0P p:0P 0pgntsp@-P`@P  0@{"pp@-P`@P  0@j"pp@-`PA@#<P pP U patadp@-P`>@P  0@@"pp@-P`M@P  n0@."pA-P@"X0P p(`P  P `5+gntsp@-P@"(0P p0P 0pgntsp@-P`7@P  -0@!pp@-P`+@P  0@!p@-@R 0@!p@-@ P"$0P p00ploobp@-P`g@P   0@!pp@-PW@P  0@!p@-@s @ @-@m @ @-@g @ @-@a @4 @-@[ @Q @-@U @` @-@O @} @-@I @ @-@C @ @-@= @ @-@7 @ @-@1 @ @-@+ @ @-@% @" @-@ @; @-@ @N @-@ @g @-@ @~ @-@ @ @-@ @ p@-P`@P   0@!pp@-P@P W 0@!pp@-P`@P  0@ pp@-P@P 5 0@ pp@-P`o@P  0@ pp@-P^@P  0@ pp@-P`M@P  0@ pp@-P<@P 0@ pp@-P0`P)@P  0@ pp@-P0P@P 0@{ pp@-P`@P  n0@i pp@-P@P 0@Y pp@-P`@P  L0@G pp@-P@P 0@7 pp@-P`@P  *0@% pp@-P@P e0@ pp@-P`@P  0@ pp@-P@P C0@pp@-P0`P{@P  0@pp@-P0Ph@P 0@pp@-P`o@P  0@p p@-P]@P 0@pp@-P`L@P  0@p p@-P:@P 0@pp@-P`)@P  z0@up p@-P@P 0@dpp@-P`@P  W0@Rp p@-P@P 0@App@-P0`P@P  20@-pp@-P0P@P k0@pp@-P`@P  0@ p p@-P@P H0@pp@-P`@P  0@p p@-P@P %0@pp@-P`w@P  0@p p@-Pe@P 0@pp@-P`T@P  0@p p@-PB@P 0@pp@-P0`P/@P  0@{pp@-P0P@P 0@ipp@-P;@(0P p0P 0pgntsp@-P`@P  K0@Fpp@-P@P 0@7pp@-P`u@P  +0@&pp@-Pe@P g0@pp@-`P@<P p]P U Kpatadp@-P`@P  0@pp@-P`@P  0@pp@-P@P 0@pp@-P@P  0@pA-P@jX0P Lp|$`P  cP `&gntsp@-Po@L(0P p90P 0pgntsp@-P`@P  0@zpp@-P@P 0@kpp@-P`@P  _0@Zpp@-P@P 0@Kp@-@Q 0@A@-@R <0@7p@-@0 P N&L&p@PP"0S "p"0b@-$@@"HbP 0R @-P Q o//Z Z P г0 t@-0 j8 $ X @-P Q @軳@ @0@ f0 U( (0( g0 L 8  <  0S p@-\@`@@ PoPpP p@ ȑA-P`p# ^#@P  r`P pp"P` e"U @% "%%F|`p@-P @`Pp_P p@Y@- #@P $ -0 0 0 hA-pP #@P"  0 0 0 ᚱP"`P  ` P0 000 ,0< ⡵@  8 /@-@P w@ g 0 0X ↵ L  }-A-M `V $P0 P?@P"pP  0P? =ЍAЍ/ЍAЍ/ 0 0t S   U @-@P )@  0 0X 8h   }p@-@P x0 0 0R0 Pg"0P Q # p@xppԍLU p@-@P `0 0 0R PE"0P Q # p@p@T P/0 0 0R /ȌP/<0 0 0R0/P///ᜌXT 0P @-od  QP  QQ f#/<S P/ 0 0 0R/@-@P \0 0 0R  !0P Q =#00ꈋS P/00 0 0RP///R A-PPM /o00 0"P R Ѝ R0 p 0 p!`P 0 S  R H  > pP` #  00( Q Q A-@PM 0 0 0R ЍQP 0  0pZ!`P 0S d P T> pP` #000( (0( $0 ȉ' Q l @ ; P -/o<0"0 0^ R  Ry/ĈP/D0 0 0R /@-P )ot P P/D0 0 0R /@-P oO P /ol00 0"\ R RP Q  Q /ḇPO DO fP 40 0 0RP ڰװ/,N fA-(0`SM.P@U Ѝ P0P  pP 00  0P* S'P0S0"Q00 @P X 0 0 0 @Ѝ( P "<P 00#0 0 P 0S S R/P/ R0/@-@ h9SSp@-0(MS- @{ S  P{ $=` ` P BP L(ЍpX  (ЍpD P { =(0( (0 ൲ Ą  T  $@-@9"R@-(@@pR 00 S 0 P :\03#/S 0 P \0///A-Pa`Wt@P lh(pP  [᧪@P S!W@G, ,0, (0 *D7Q  p M 00 S 0 P :\03#/S 0 P \0///0@- @PM @ Ѝ00@- @PM @ xЍ00@- @PM  @ jЍ00@- @PM  @ \Ѝ0@-@P ,0 0 0Rh /P/0 0 0R / 00 !S R!* R0*/-  ^0 : 0P0*  R*/@@/ / P $0 0 0R //4P $0 0 0R //~P $0 0 0R //~P $0 0 0R //~P/h0 0 0R / 00 !R0* /  P 5*/T~P/h0 0 0R / 00 ! R0* /  P 1*/}P/x0 0 0R / 00 !R0* /-  ^ :\}P/x0 0 0R / 00 !R0* /-  ^ :|P/@0 0 0R / 0 0 S /D|P/x0 0 0R / 00 !R0* /-  ^ :{P/h0 0 0R / 00 !R0* /  P 5*/d{P/h0 0 0R / 00 ! R0* /  P 1*/zP/x0 0 0R / 00 !R0* /-  ^ :lzP/@0 0 0R / 0 0 S /yP/`0 0 0R / 00 ! R0* /  \ 5*/yP/`0 0 0R / 00 !R0* / \ 1*/yP/h0 0 0R / 00 0S00/ P %:/xP/h0 0 0R / 00 0S00/ P %:/(xP/P0 0 0R / 00 R/! /wP/h0 0 0R / 00 0S00/ P %:/HwP/`0 0 0R / 00 ! R0* /  \ 5*/vP/`0 0 0R / 00 !R0* / \ 1*/XvP/h0 0 0R / 00 0S00/ P %:/uP/P0 0 0R / 00 R/! /hu P -/o<0"0 0^ R  Rv/tP/L \ /  JQ\/tP/L \ /  JQ\/HtP/P \ / Q/S/Q\/sP/P \ / Q/S/Q\/s0C-M`000 00Sp pP Ѝ(@YP+ A( 0Q xRJ  P p&*0 00 0S  P Ѝa kP p:T0"SO0"SK I qp  0 00 S 8 30"SO-MM(@PD1 p000$0`0$ 0 0[ Q` $ 0`;/0 `P Mߍ XP 03/P 00  $ 0:/P 000 PMߍ0p@-P2s0AL7@LP@a`Lt0 0LWLV p@|0 T0s0^0ppO-3KM `0 0@R @@@$@@@(@0 0Cs0S50fSQ ="SE [Sl2 0 @3/P 0p0  0̠<P p0S !S$0-S-P00S00PP -P 0-P P 0>P 000/SR `,`0 S S0p p S :S 0 S S0GU0 RŠP0/S7 0(00>S: SA 0S p03  0Bs0SR 0 S S6 S4 /S 0 S S,/S >S S`FVx0Su `Vp0(00>Spj 0  $ 00 0 ܫ S =SB0"SP0SM   0"R "R R@C$ >R;0 G-MX@`pI P dV W$ P[ <PT &P@ aR lR gR' qR uR oR  tR ;R"@ tRT Ѝ mR8 pR oR sR ;R'@ tR ;R>@P P"Po \P@ V   WP UP PS00S@Ѝ pR ;R@ uR [R<\ BR   ;R<@{  @!1 0 "R /R 0jP 0 +r  R:Y  Yy*     SP00 Rf \Rc  uR_ <P Y +r PU6I0 r    0 # <  P,!*-"-  ƠP  * --  (  " "0   O-`Ÿ M @ 0Ds0S<_SS @S  0>S 0 T  @P (0SP  R @ ЍT T$ @PV` kP @P ` `Pf0S  0Sh DG--PM `@PL ,/pC 1pF 0F fppSp>0@ ‘P P/u&  0  `p 02Ѝ00 `0p``0`Ѝ h/` Ao/A-PP P`p @@P@@@P p40,p0P4080<0_\P-@-5@ Q $-@-(@@8 ⌡-h^ᇦΩ@-@@O-4@T p`, qP @@D¤@`T P礀Qㅑ@0@ @@0 PZ PZ P  @-R 0P< P 4Q ,  D D0D )0 ͨ, ,0, (0 Ĩ<] p< p@-@M4 00R1SP,0SFR 1`V. P` 0 0?P 40, 0C40P& `ЍpS( R!ЍpЍp 0 Z0D zp p0p l0D q\ \0\ c0D hD D0D @0D _렿 | yX 4 HiA-P`,p@P W 0 !w,@0`,@0`C-`0@SPpMD  P00Ѝ!0 rP ,0ST |!0 hP ,0S(0S00  0FP 0S>0S0"S:0:S 10}S "S000"S 8P  2P @` 0 @`P P, ,0, (0\ ⲧ@   ,0p@-S `  Q P@/0@)p 0  0 ⌧(X l80S 40 00$ $0$ @-0 vW L 4 @-R 0, B4 P @ @ @0@ <0 [, ,0, (0 R$ t PO-80M@ Ѝ@p` PP @ ` @ЍĒ  2~PP0 z *004QY r 4 ,R\ 牱Q1v  a P 0YIV  B B!,0 P 04 `<0 04 <0 ɢP,UM<U7U+Y& 唡 @0 P  *PP( & 0,S<SS= OeP# @ <0P0`<04 y< !⮎,0P RYP |,x x0x t0F/∦d d0d W0,L L0L 0 vX $Tp#ط (2  xp@-@PP0S L  Q <0 0 p@ 0  0K/ISܶ `,p@-@P 0`0VPP l l0 0  0@S0<  pPp( (0( $0K/R$,$ tO-0@SP MR z`40SM x `4P@ ЍP pP 00S 0q 2 00PX 0S. @0R* P# [` P 0P 0S P'\ X GD` ЍOiP 0  03/P  40R 1#PP 0 0U/⇥& 00C 0P `@zh h0h d0U/nT T0T 0]/eQ 0QdPԳ $Op L d@-@⛞0,S<SS 0  0 9d PG-V Pp0`WSW@6 404 S @  S3 F000,0 100,0$ 100,0, P  ?o @ 2\0S0S P@P : } {404 SS@ o @D D0D @0c/Ϥ0 000 ,0c/ƤM `D!а d 7G-PS @- Y`' T 1p 0R ?   004 00R% OP  0S 0 GVd d0d `0i/⁤0,S0 000 ,0F/pXL h 1x l G-PP' 0 0R"4P 40S @,0aᄑ1p  ,0`p40@T:8 408  K0P 0  Q@-P80080/\Jp@-@P80080p@p@-@P 80 0R@ pP4@pIp@-@P \0 0R@ pP`00S@#:p@Ip@-@Pt@opA-PP 0 0R4p`_40S @40S ,0} P@N* `GHA-@P 0`0VpP80S ~P @T @ @0@ 0]/④@@LH HLA-PP /o0`0"Q@@T @0R p K@P @T @ 0  0]/WG `d0P \@- ^ 400\@/ 0  0F/8F  0P o@-x@ T\ @\400\@/ 0  0F/LF D @-PP M @1 0R Ѝ`@80  Ѝ@ P 4 0R S!*,\&0 B!p@400C40<00<0B @ h h0h d0s/ƢT T0T P0s/⽢@ @0@ <0s/ⴢEШ  u pv `w P/?o0 2 R0S/0@ S/ D0P -?o82 ^0S 0 S /CP/0 0@0R/CP/0 0@0R/XC P -/o<0"0@0^ R  R / Cd A-`P @PpP (0Sp0P  pA``B `EDBO-0S@9 0@S7  `N P. X8qPp@; P 5 P / P HXPU0UU !B< #1 0@?,B PO 0 s0 ڡX% XP0@#r 1bP7 0 03/P0  40R 1#eP' `P 00C 0EP  @ꀐ pG \ \0\ 0 8 808 0 0,<++  40S 0C40/ 0  @-0 L 0 0p@-S `  Q P@t0@np 0  0 ћ*ď Tip@-@P 0`0VPQ0S R <0 0 p@DD D0D @0 ⩛0 000 ,0 ⠛)$  ذwG-S )X@ `V 0P 0R 00p W` V 0S  Gs@ @0@ <0F/`0,S( دA-PP 0 0R4pP 40S @,0a, 40a@T:8 408 p'@-P80080p@-@P 80 0R@ pP0@p&p@-@P 80 0R@ pP4@p&p@-@P \0 0R@ pP`|00S@#:vp@H&p@-@Pi&@dpp@-@P]80080p@Vp@-@PQ8@@@Lpp@-@P 0 0RP`>40S ,0AT 5p@p@ 0  0O/ⓚD%̊ aA-@P 0P 0R@ p`8040S ,0X <0, 0Q<0@@?@D D0D @0S/U0 000 ,0S/L$ԉ  Ԭp@-@P H0 0R@ pP`@pp#A-PP1 0R@`4P%80,0!qW% P P ,0P < 0@ 40< AiAD D0D 0W/, ,0, (0W/#4 D  ̦0P -?o82 ^0S 0 Sd/!p@-`P pP@fP (0S p@  0! & !0 //@-~UP0 p0 , O-IMP # @T p `0 R 2/0iU\ P Y  9/0  pDPV @T!1 0 ]003/Y@ 9/T +UT T @T@" 000Q 1/0)U' P70S+ 03/P. Y 9/U@T 0 0(  0 0 Iߍ 0 0(  0 0( Y 9/Z 0 03/X X0X 0( d h8\ `08 @    pP0/O-@MM(p fT 000 0\0+`P$  T%0 `P4 0@ 4/@P`P@003/0 `nPMߍT00 0%P 0 $ \00 Mߍ0 000 ,0H m R00꤃ ̥x# 0/0/@-@@A-pP`PM1 @T. 00@0W   WT 0 /R C 0CW /RW  W0 0 B/Q d!0C@T@! Y0@ 0.0 0  R0* 0 0jp@  U 30P@+Pۍ&?00@ۍ S0p AP?H p p 0P@| p@-R 0@S PR :   Ppp0P  , 0`0` `90 ગL0L L:0 ࢗ808 8;0 p  ܀ Ģp@-@Q PPpQpA-0MSz@`PA7 Q <Q& >Q &Q a`Q PЍP QЍ|a&`Q ~PPa&`Q rPPU q/UpU"0E'S0 rP\\P WP PU /U\U fPnPtPbPUx 0  T! QQ 3P0 000 0 눢 ( \~ \< 0S p@-P@ P@p 0Sp/p@-@QP Q PpQp@ 0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Qp@> 0 0@ №| p#0p@-S+@PPU Q PpQp<Pp/P PQ P Qp@> 0 Q0` G{ |0p@-SG@`PU Q Q aP<\Pp PU Q PP QPU Q CP QpPQ 6P Q/.P p@>( 0 0|  5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@F P//-ptx` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@Pތ80 0 @  0""048# /UUUU3333  6p@-PQ@t : Sj E Sd0 a Sp0  S?0c0 r-w-!- R00K <Rx  -   r-w-T  Q5 $Qx-$1r-@w- T" T T-x 00p Ss0  Sw0 S?0l0Q s! R0s  tTSS   S?0b0A0a0-0$0$ $90 e O-8AP@:  نpPA PA  0pP% 00ۆ` 0@T' ᅍP0=S AP` AT BX ! ݇᷆D0D D>0 A >00 Дd C-@``"`2`M 0P$@P@Lg p`XP \@`@d@h@l@Xpk p p` o{{o{ P  {p[ p0 0S04@R08@<@@00000/-0k-m-0T-ZL1L0 00@000h-X  #ԑ0S op@ 㭑 㩑 C ЍoЍ @갑0 0 ㏑ ㉑ ㅑ ̇̇̇0 O-PMp 0GW"S00`0v@IP-TPg +T@`0@ ǿ 0  u 0 u P p  ! @00Ds \a0DSW0DA0DS"70DUr X : QP   S  R 8 "000T7 W. 0 p0R00S 0pS 0F0 Ѝ0S R 0@0` 00 R0  Ѝ p p᠀堐 XR A B0A PR @ 0`X0X X?0 ݎSW p pqW ꙙ _ 00 0M0Ѝ2/O-PMp 0GW"S00`0v@yP-TPg +T@`0@ ǿ 0  t 0 t P p  ! @00Ds \a0DSW0DA0DS"70DUr X : QP   S  R h "000T7 W. 0 p0R00S 0pS 0F0 Ѝ0S R 0@0`:00 R0  Ѝ p p᠀堐 XR A B0A PR @ 0`X0X X?0 SW p pqW ꙙx[ 00 0M0Ѝ2t/O-M8@<ЍP@0P@ 0fY( @P@ PU 凁P 0 0  2 e  @Pt@P@h0h h0 <P0 05,Hl|7 ]]]hel]\6 @]H]- M  ЍA-xx1 0!M@P0<80P`I p4 81p4!PP ! 1 0 <8 30:!ݍ0 ᫄  0 PpPP@T Cn` 0P8TPP @T@ΐː404 440 གྷ\,cT^l4 \^A-!1 0!M@P0<80`b QPP 14巅P?p4 d1p嫅 P30P0 $ ( ,  0 0 pp囐PP!@T Cn` 0P8T劅PᕀP @T@0S  [ p0 0 <8 30!ݍ`00JPH H0H D0 :+PPLb\ܗl2 H\P\O-ğFM MPQdč@`ᐴt嘤 T V [ ZX ( 0H0;d 08P0S  0H1 PW 0 ( P(00hP $l Pxg Ps$Wj ,^ Pj(,hP $W , b T#L3 0 d4 30Fލ Ѝ( 0P3PPs / ᒂP @@W  E0Sv ST2" @0 8tt r X0T h P(( \ "2  0]TC!1  0RV:!1  0G[1!1 _ 0<'!0  80$0Sd / P!P  0  8(1(! @0 }8 1A  *  4Z[ZZZZx/ ZP/ Z/ Y. 4YXy. YXz. XX{t. XXXHYOOXX- X|- X`- X@- X@-XX1 0M`P000@P8  nT p T0U0P @@P@ 0 0 0 30)Ѝ蔃/000U00000P0?s00P P0P 0( uu0@&p@ *X+ pVyAyXAy`AA-@P`p0M5 V> W' 0 :|   0ᗈP @T@T 0 pPP h0Ѝ @bPx x0x t 0S{` `0`  0I{V@ @0@ < 0>{@B 4?<^ ?<| >`<]- $M!Π00  0 (0 0 0 30$Ѝ#L-|| $M!Π00  0 (0 0 0 30$Ѝ#봶`G-p PP`  B{0000 C Ra CRE@0@Y)00 C Ra CRA CRS:Y 00Cx QaCQWCP00Cq PUaCQWCQACQ7CMS00 D0C?o2R0SX ? R0T*@D T T-@A CRSb @ A BR0G?oD2Z0S\  Z?0X*Y 00As Pa0ASW0AA0AS70AQ P,1,!,0 Xz00Cq P 0 T:aCQW0CACQ70CS 0  }07z   DACQ7Cz|0| | C0&z D@`S| P[@0@ @`0 z<` ,<; ;X; d;H;P ; G-t1@0P?  @RP>T !6*8p@-`P@P0M$ T- U6 ,0 0 (00$00 00P0 $S=P.0 $48<(, 0 0Ѝp 0 0 xTt t0t 0 xUT T0T 0 xz 0 h 7,7 R7 <76O-0"02 0TMP0L00`w Vk 0  00 0 0 !8 PPP @p1000 p@P< 0+S+0S((sP,00$00 0(P 0$U,$,0Sz3 0 0 L0 30*TЍ0 :P VP^3Xz00h h0h Y0@ IxL L0L X0@ ?x} 븭6=6t6TL tP4$ 4\4O-!1 0pIM010sWW _PPN @`p y0 `@P; 0+S+0S(P  0 P  U0SP2 0 0 1 30Iߍ P uP2y00< <0< 0P w_ H;X4X4,( PN`20/o0@- 0 0MPP000@' T  0MP ""  0S0 0p d0 0 0 30Ѝ0!@P000 040 uw L Ĩ1P 1@-!1 FM0 M@P0d40p/ `V PPd@"h+ P Ky0@Fy @Rh \0 0 d4 30Fލ Ѝ4 404 N0 &w8  00@-0 0dM@P0\00p` P  TX P0 0 \0 30 dЍ0 000 h0( vP 0/99@-<@<M@ c0 jЍl/0P1Spp//0@- 0 0M@P000P' U  0 @  "" 0S0(0p d0 0 0 30Ѝ0)PP000 0F0 v-밥x (T. .G- M砐 p@ U$ePH0S W0Ep +@P2  PUo0 ;u0 UB @P  U0PUo0Dx0@?x@  n 0 0 4 30܍/x0P*xTP  0mQ,p xP|`똤p 0- M Ѝ@-0 0dM@P0\00p`    #X P0 0 \0 30 dЍ0 000 0 uy똢D$ ++O-/? 0M@Q000Y 0SM X@@P 0\@?P `@ %   " P l%X!;d \p`D@lA @87lA$d @b 9 HnM aLP,hPpb!5_T`l`:b.͌6o+(d! P% PPbQ tP5_l & d!, p' )``d!" x` 6o* d|@n,4O-p'`pp%nQ $pPp pnQ%Pp !7( b n ]>a,$bA!(@bA$͌e!@M l 8+,`&'pbq p)7 +0).)&,o.e)8`` `e.d)` !6o) *"( 4*" *(((e8P*/+ $ ("*, " 8 0/" *p'*''`$pdq p dq' p, o& o&o&$ `n da(@} (a (,nA!@o͌`nA$g!@ oMnal ga,`ga&4`_?`/%/"(`!) `0!,`/"!! g1pd,)_%0 !_%:_%`PodQ `P%P ` n o],daa@n!o`,o po&po&   $M` oe!na  `4.+0`+(͌..`dA. pea$ `& `l$me.`_l P!_O%f _%)_% O$_%,$P_lQ_% ,,_%O$_%%Pnf._P*ᝉaQ.魊i P%쟃4f Poa ` )`o.o&.o& `(p..4p0p]j oaa.o&$p!!, o&o&坉o&eQ0`ja% `&pi%`mj n篃i.!_p /%,/"_%$p"0 _%p/% _8 f!.iQ " _p%4((p_%(_%p`%fQ 珃P%-a P] b./f!`a!( "/ "''?a1,p8!++4/"/"p/"< 0 !!!m@e(!&f1e1fqp?0 nfpn10}e$Pa1n1a?f1?8@`O#?#?#]?#O$(`0g1$a1gA@?n1@0 .0<`,,0 ,`.e.g ea` Mςa ``e `ςmg 4pd.` dςe Ϡ p_, p,_%p%

pmvmzNS3hˌe;# 0͠T0+>C3C7Cg; )0隠c{n 0  k{Pct0fˌa" a(f `hHekb,b(e P]@a[l&al( h4bf%bf! L+I pᕓI嫗Ik <ll`` +LLd e+(Ldˌ p'e+" p g|nˇ\pb)f+ *h! ph,f{`8 +LLLnˌ ꩠkˊ i p`Kfileka" a,eP @0e]h[ $bK&@hˌbK$ @dIDaKf%aˌf. n`be$bge( p苠8fd.  f+d,dlʠeˌn{( pe+n{'pXP`"{d{g ,k+T`h+, dh+" h+APfjAkkAkP%P4]+AAA`[`b*Ln+lK'@n )lK$@iMXhKg"hg.h 0ll;Xd.dˌ@nˌb$ b,l̠gˌ,04p (llphbb+Dpl0h{,p+>Cn{,p'3Ckp7Ca;}d{0lK(0@$@dJL0nKd;f0h;'0#0;l;ae <$ k+* g$.ꩠk n8hnˌ P+LLLkˌ ` f "( P`+(  ,`+ j+gd#, ͠gˌ\p +~GsGwGf{`k芠c{.e p' phhgyd{g H "+@@@e b,a+P``&dnK,`@$mjk @Hj )dMcKl 'c; ` <0n P`g;$0#09ll˃T00l[d; 0#a\0gda{`;,0# 0=d;$@cKhK@(@clK!@$ @H`K d b a+# " )l+c;$0#0:a;dK"b+  @$@0䊈i= 0tЍG-Pp 堑? 10@@i00T0Y?W@` @@@`VVT(@T(pG   Gi ` i`i=V0@-P@  M  1?0 @ cR c B T 0 E,̠P,ĠD 80 0 0 30` Ѝ0@-iX ?P L0P00 1 R/@P/!R/c(0 @>R0 00//0c@-Mp @g`P`W P0D>S 0!3100 0gЍ>SD 0!3100g00g00b/-p@-MgP@U@0 ` ` Px0x 08 R;0Ѝp@Ѝ/0 a0( ( b,, ,A-@PP`p; =U( X0ES  S0 +0E0VpP00Vp&2!0` 0`00+XPp -X =X00-0V0`0+00+0`0p@00000 0]0 `e00 0 4p@-PP@F 8a `0RuSpWS6X0CS0 p à 0R Q PSPQPQ  0    X0 0+S -Sp0( (0( b0 e I@< O-0 xSpTM 0@@ 0`004080<0r j0(0f @(m f@T%|7(P0p00000TG @ @D 0 a0GS00 f00f0@f@PTЍ+W = W0 -S0000 0` X B R  = G/oS"!"   ( P:0,Pf , }f R, ("@P0 @(偑  ( 0S# (p W:,Pbfp , Zf0S,0"@(p剑pGPp(pW [0 0X I0 0p(ppW ,Wp`uS(`! Y0,P2f` , *f Rm, "@(`0`FP`(`   i`(=W +0G?o 2R0S$ Y,Pf ` , e0SB,0(`""`FP` @(`傑V [0 0X I000 `(` 0 V:,Pe ` ,l e0S,0(`""`FP` @(`傑0X0 00($ KR; I?I00 KR<I e0 @$$0`0Se0"SF  V*(@ T:,Pe @,& e0S(0,@0CP@(@T} L2-+ 00 ` 0TЍ'pC  001!]0 ec1!]0 \ck긱1FsVe00(0UpL 0Xp+`-@ +B XR R  +B0 -R +R XR 0 -R  X@P`Qpt0t t]0 cx\ \0\ o0 bx^  D H  $ (  0@-@PPM 0{ P@{p`Ѝ0(0( (:0 b  h P 0 @-vc/o`/000/000/000/0 00// /0/0/0  /0 // /A-@pe`]TP+YTU PU  0  Po@P PPrBbP \000p@400Bd0P;dPp@-0P@`T @T0rS Ppp@P0+Spp@&0@-$2$M000P0p 0Sv 0P 0P 1 00S$cY~p@4 P! xY0rSD 0 P01 0  d1 P @00S7$Ѝ0@$1$!$$0 @X6c@CY0 00S  a_c@P0 P0Ow 0P$Ѝ0h0h h0 aP0P P0 ~aRt$(  t (,P 0@-Ÿ$M 00P0  d 0Sk 0P0@ 1 00S<p@& P 0rS: Q0 P0`10  D1 P @00S-$Ѝ0N)c0 @00S c@P0 P0|0P$Ѝ0` `0`  0`D D0D  0`0 3`3C0P Rs@< $O-P4M@P\pt WhX0S, `00 S 5/000 00!S5+0 0 00!W`W0\ YZ X00U`5S\500 0 0 0@0` P(0`0o5`0$0X[ 0S20`gW ,A 0`F[VW@P ,(05#K 0P` X $ 2@0 4$*&  # #. B@T#0#"A $1?Ϡ "!,:#  `V4Ѝ3+00 00!p3/0 00!ih30$0H\.d0La#0L0|2pST0, P `@!ZP 0`V ^ @P,y ^}[`"$:600%$0D"%>!!!0C,"0T$P%"1 #1O"QX00 0" 0$0 0?S%D P@ `1T101! T$?01>! R01"_0`A(0 x10X00`d(00@t`dP(0 WZ  R11@$Q5J 0A`X0 0A$0PE `0P 0  `4`4 0 9@ 0^ 0 8@ 0^`ꬨ GzGdQ(\)\¬L , SQ̔( H O-PP@` Mo Tw V p0 8T:R P- Ÿ P2 1L PPq@pQ @T*RP P 1L P R 0Q_ SQ Ѝl P @@0 L0\? 0 \ @ p R@p\ p W R:\#Yp 0 0 ^T0 0 ]V0 0 ]vp,@ \?[*!]- Р  p@-@PP U p@IX X0X 0 ]U8 808 40 ]p@vI @ğ EG-P@U T^ Pp ppq W00"1gP: Pc 0Sb 0 R 0C ` PP0 XA V  0s0S0 0 Q 0  ! 00S3*_oRe`ViP( U  ! ^ 0 0 D]Tt t0t p0 9]\ \0\ G 0/]/_00P ܝ  \A-1 M0M@P040`P$ QE U9  0s0S0 0@ $03/H!@1 0 4 30GۍЍQq1p$p 0\V U$ 0 G0 \ 0 0$ \ 0 0$ \0 x0\p p0p H0$ \K>|>x XC<  8E ,D |O-xxƟMM lMPč pTDe0d XA 0SJ VS 㰰v^Uc0U@@ R R0 0C?o2 000RU$00 S0E0@u0S0000SfV H0+0I 0@ 03/[o 0@ 0000,00G(0 03/P    0S00* z 0.S  Z0S0 Wy:0S 0S  ,P80: S $ xP (0JQ/03 10J10 00@P~000$0 000S  0P*80: S&V 00S 0  00s0S0 P@T  0s0S0]04/P/ 0,0" $2 MލЍ  0.S0Sm 0.S|i0S  0@ 0L  2/0S0?  000.SP _ P 0 @JP? @ m  2/0H(100+$0 00 `P0!1 |4 0E[p0D] R 0]F0@!@1@ 0, 1[0S!1 , 0%[V!1 , 0[ 0 , 0[0~$ &QI]0/ 0 0 @  03/0tFF0o<<*@9  ,/  `` 48  O-ßKM MPčp`Pؔܤ; WD UM YV \] /\@ @ 0\/\0 V'"2 0 4 30KލЍRb/\;/00P/\V\- pd"d2d @ 0ZWD"D2D @@ 0xZU("(2( $@ 0mZY " 2  @ 0bZ@Pp P<P 0   R  R 0T/S 0: S+ S 0 0 0 0 PX! +0s0S0 0@ (03/0S0: STi*/00 R0P夰0P H 0Z0G 0 Y[/0 0G5<5 Lؒ 0m n To 0SO-şM5$M 0`P000P 3 QE @0~S<   pH 0S/S;RR 0B0 4ZS 0H*0; ׿P4S 0 0CPR3 IR*0S0;R) 0X @H p S    န値倴*S1 s00@0S ?S! [S!^H QM00 S@000XS 0H , R @ 0< 0@Ⲑ 0R  R QR Რ@  P+Z@PU P#<3 0 0 30ۍ$Ѝ@\0 D SP 0]S2!^0m 0]S  s000-S]Q q0]S  0@< 0T20u  0BW 0R S0BW 0R S@d 0 Q{  001A0 HY0 [0!^0  @E  p4xMN0P H *; P =0$10QqAp@P0 XU 0X X 0 0P |X 0 0X sX0 0lX0\X gX@1@/1?**T/[-]!8  Ċ ĸO-`QM@pM R W T   D:YI^ @P}\ @\ [\ {\PU PE0]\\ \8(/PPލЍ ]RRRF 0@Q`0,^* [^ ]RR6R` T: `{^0 }^S0CV  B0S00 8(N 0SV 0F0C  0X0 0 @ ]RR ]RR x| |0| xd 0WX WdX X0X Fd 0WX< <0< 8d 0WLꀇ TL ĵ $ Dp@-@P`PM( V1 0  0 S 30{S 0\ {\ P 0 Ѝp0}S0S Ѝp@rd d0d 0p GWVD D0D 0p A0$00 0^p P2U<000S[ iTU] \'P7 0 0 30Ѝ `s?0l0` Ⰸpp  PWpJ 0BqQ #S P BqQ #S Q BqQ #S V BqQ #S S BqQ #S R BqQ #S! I BqQ #S# H BqQ #S" G BqQ #S: L BqQ #SR M BqQ #SH N BqQ #S> O BqQ #S7 D BqQ #S  E BqQ #S F BqQ #R 0S:U 0p0S8 Rh BD{P `0000  00  T$   440000   $   30000S0 @  # 00   0pW p[ pT000Z@T@W 0\ T000S T0 0TY 0  [ T0003@|T@00fp00,(@ ((@(@00,0sX [  lPk~0Sz[u+ S1!_0 CRHCT00T  ppe pw0`00X0`0 0SCQ Tqp Y*0p0^0  T0SY00Q pp0S03  wpE`00C0'  kp9pQpNpK[> 4pDkp.pkA8$@8r @4ĠH0ˠ- M0 Ѝp@-`@`MQ P0ˠ 0P ЍpF4pP P ЍpXA-P`? A@0S' A@Q0+pPpPP 3M@@勾P   p0 @BAQA p0 p0 ,0, ,<0 HQn p@-p`pP`P@T T0T0 R@@pP00ꔲhhA-P@P`@p0S |@@L R"@`R@^P00R0@ּ@-0 00 @p@-`MPxF@P 0SL0! V ! U@Ѝp 0P  R 0QPG B&R  4՜(ќ͜RS% S @  S& J S E S జ A0 ড় A6 A|p 0 dX A; 8l \dpК tН0O-00% BMM $ %u  %p 000 0000+ 0LP 40 4=P P@\ P 0S p400#S \ P 0S 848d0``\ P 0S 4d0``\ P 0S 30   \ 0P 0S o30\ 0P 0S od30\3PE0 +<D3D0 0P`\ @P 0S jKPP[[ LP200xS| "l2 0 4 30BލЍR@P\ `Px 0S \200#SL \ QP 0S $2$R0P\ CP_ 0S 100xS0xS0S) 10 0sS?0wS<0!S 71Q0P \ 0P 0S nd10\ 0P 0S n410(10P" 0 $N0xS0S {00  00 00004LP $j 0j i x<ЬP\` 4h g p@l$g 8h lp@-d@@0S P Hp@P@P 4 P මp0H\pip@-@P$ 0PP 4P PPKP SPph`h`PLp4 404 0 Nh,d hp@-@P$ 0PP 4P ZPPKP Pph`h`PLPp4 404 0 PNgDc 0p@-\PP 4P "p<`<`yP@"p  g@-@@P( 00`O-<$M@P  0S Zp 9P0 p` 0 0V;  8000s?Q WQN *Q0@0 t8000*S' .Q S /S#! /?PP$Ѝ[S5 \S" 0S@0?Sc S *S0@V0*SV0 ' *S0  0*S [P$Ѝ[QLX /X| 0!S^SV J  Ɵ  P 000@ p0]S2^ -Px 0]S00S /SD .SDB 0S} = 0U/S:w\Qu 0@q/P P]S /S \S$ S] -P7 0QV]P 0ZJ q  0@PR ?=@P PV@S 00P, 0-S PVP]P0p l P]P \P^ S0S00@00  $ P   R   U/R S /S P 0-S P0Q^S@0@00oQ@ 0]SM-P ]Ho0⪢XV@T S0TG 0Z q S[XQ 0Z q  0@PW828"80{ PL0S;2"|0 EL2Qm0 @xPb 0-S P0;0/d Q@KS pP@J0V0  ! @T0 0 P`/T @0 ! @@T S0T0d /=40]Sc /Sg \S$X[ ,[ @0P@-@ P M 0 Q 4Q?o2cd@p@-@lPHP XHP T00pT 00pM 0 p O-0Ÿ M pc P   ˺ ɺ10 230Zߍ hPT 0 p H  ZP 7 R @; 0`  0P ἹP& PP 0 pP 0 P0@T*p@ L 0 pP M - R  O-0Ÿ M Ypc P   C A10 230Zߍ PT 0 6p H  ҷP 7 R @; 0`  0P 4P& PP 0 pP 0 P0@T*p@ K 0 pP L - R   `O-0Ÿ M pc P   廹 ṹ10 230Zߍ XPT 0 p H  JP 7 R @; 0`  0P ᬸP& PP 0 pP 0 xP0@T*p@  K 0 vpP K - R  @p@-X@0`P@ \P0S SP 0pQ p@-X@0`P@ P0S SP 0p 0S0 \B0@0T9  T04 0R/Q T:\% 0 \/RT0C"0C/QT :0 BPU0P!T0l0p`@@PX vG0<@@0/S (@@ @@tFP`FHF7A-M`PB,A0P@; !0C p0 00    0 b0C S'0 p8H0 0A0@S` 0S 0S&H0"S D6!@Ѝ T1r0:H00$7C @-@P1 0S* A@T. 0T)  /Q0C T !@# *0P@/S |0 B@T@!l0 0F  T @@4@0@/SCCH50{-DM  {000p 800S DЍp@-`P+p P@p V U p@p`UP #p` V)h4qQ?o?o 0C-@c^?c^' ^./ "(0C0;: `pCc&Pc2680E270G2&1H010 /0 @- / ,00-+C@ P@ 7KE0 0/0E0E0C 400-+C@{$PG{6KE0{7 Q/ 0E0E0C /0P!Qoo G-@`^?`^) ^? 1?1>(@04!50;:@p@`&``4 3V4X4G1Y01000 /0 @- /k{  0 +C 0/A0C0C [k{ 0{+C{7 Q/A0C0C J|@ @-yp A Jq@ @-np J;@ @-8p J0@ @--pPP `@-nF00p@-@PP  p@$ 0 10 WD[; 4m?0/R//R/?0S/R/P/R/p@-PMP`V \@T 00+EЍp{ : { +p@`($ 1 h4: 00 R dꤻ,@-4F00 0S@@$h0 /"b0!s!!@ 00lRR0c0A1R 0< 0 B``C/  "bQ0"Q$I)\P ףA-P0E \`dp0LPSa0@E: T@@ X@TS^!:O-p(PB`F?@ 7P PXY  P A-1 0M0201 0@`0pS 00S \P#P3.000R`0@ t d0 0 2 30ߍPP @@ @0(@$0`O-ϟ 0 0XP(<Ѝ 0 P(000U00S SD 0$`Ph08P p`C Ps> P6P p W R0 0$`0P 0p`C PW> P6P pW R0 (000@ 000@(X(P(PzW0  GS( y +St -S 00 00$P P䅐ಐ P:U X$P( 2c2c2,S \0c$00P 0(0w 50 ,P(^U0W0,0i0pP=0  P26P1 p=P  (6PP% 0(P 0  R9,0X0!0 B 1X/0 00|; 0  0P(10 ,0 c0,@ 0PS,0(111v>C 0C,0   !/"b!!A0,0 X0 0000 0 : ,0 :,,0 v>C 0CXP0( 000 50 ,P(0PX%S(P 0 ,, ,0 0CP0(000Xp 0  0P S(B 0 00X0 009 0  0\P(X}XD9\0   0KP( =0 P( X 0P( 8 ,, ,0 0CXP0(o000{ 0 P(a000m 0, ~,0P#/A!b!b0C P0( I 0 Br0 SW0(0S0X0;7 0 0P(B c0 ,S 0PS(, 6 0t0?2c11!, 0 0 0000 X780   0P(X ;0 mP 0 0 S0 (0X(P3 0  P(((P000 c0 ,P(00000  R 0s @`0PPv0 P@ ` @a0Ka1c B  B0   0000 P!/#b!!"A @@şK/"8bP 3:,bQ # 3 P b4$  Q000000%0 2?3c112B x$xK?##p$cR3:d$cR#300T$0010 !00C0 00@ZP8 R0PR00J0PX$`p(P*0000PX$`p(P000,P 4!/#b!!0"A ((K/" bQ:3bS0#03   1 01 B00DRd , 40 00N(0~0 S!0r @WPO"  IPH 0 40N~ Q @(P0vPv 0(P00(PP @ ACLC|q \^JS S 0 0#3P0 z G/o"(PzW (PUSX ZSP  @ 0!P ( 0$0A010PE0,P ( $P( PT#/"b!C;R, a2ba12D6 QHdQl'\b,bn$I_P)\(\ ף, , + * `ktTQ(tP ⎀Ḁ@CP(fMP P(P @j @0C2c2c2P$00( (0  @c 0 @]XP( 000 SlXP( 0000@>0S; 00@70S 0@0 㸁,0  0P P(00, 0C$0(~,B2000c^\0M0c$P   0P  P(00 , 0C$00(0W    0P ,  "P ( (0 b$ @00 0M0Ѝ!A-1@0QPHP P MK Q$`10 P1#L@p P@@ (. R! v P`;U Ѝ0 P0  P La@` U@T 0 Ѝd   0!?00$ |$ *UTTTgfffTT @-0M@ 0P 00Ѝ@-0M@0P s00Ѝ@-wP@gꔢp@-LL1 00Mp0,00`@P= U2    P00Q Q Q  0 0 ,0 30#0Ѝp  |{? 0 \0\ \;0 l=D0D D:0 c=dt,t,t,xE! R:p! xRp@-@PP U 0DPp P @pD0D D70 ==U(0( (80 3=R RR QG-pP`' X/ Y 8V @P0PES  R  D$0PEV R  RS0@0D@ D0D DH0 <X(0( (I0 <4Q 00808 8C0 h<3O |OlE 4ORQ@-M @PЍTT O>@ЍΪЍF> 00O--M⨁ Mpō@P`pG x1PR pJ @\CKX0 ^00pt0 O&00 T>5 q@Ѝ0,  (@P / P 0 0 5 30ݍ Ѝd0d dD0 ;=00@=00slX4 0S$ RT 10 R RO 2/!1 00U00' 1/0P p $@t#0081003/0P !p0 $@ 0V0 00 R (㎣P000P3/0P! U  R  SV  0ST冤P000U p/>3HH\Hd?0GG=A- R@P 0`Sm !#b!b DQqU> 0S$ RT 10 R RO 2/!1 0 0U00' 1/0P p $@"00810 03/0P !p0 $@ 0V0 00 R (P00 0P3/0P! U   R  SV  0SP00 0U $̄FpFF=EtEA-@P| P_1`Px rpPh  00^c<!"#b!0CaqV8 X p2PXU $001p00S Q"\1003/P00> 000$0(100S100S 3/! 000``0S 000S 3/000(ZP` p  0000StdP0000H0003/P 0̂/>3,CЁCPC,=BA-@P{ P0`Pw rp Pg  00^c<!#b!b0CaqV8 X p2PXU $001p00S !\1003/P00> 000$0(100S100S 3/! 000``0S 000S 3/000(P` p  000$0SˢP0 $000D0003/P 0d|Al4A<$@~H@SR: G-P0`00Sp 3/0Y @IOP ˣ T 00 00 Y @IOP T P00 D0D 0 p`P/?}}}h}T},?SR; G-P0`00Sp 3/00 Y @IP T 00 00  Y @IP p T P00 D0D 0 p` P$/>|||H|4| >O-PPM M Q \ /\E |P/P:p/\ p P/ `K`\n @ /RR.\)  B R}/0  D04  I ⴺp c 0: S#  S/ L/o" R/\  @ DQ6 .PQ X0  [K/R_0W0[0娐 !uP-U  )/   RW  q40/\0#p0 @/R0 X0/ ލ Ѝ @ ᭢ލ Ѝ.00B5 X 0/ ?    EPH.500 (5>00#5005005?00500A-@P Q P`\Pᅡp@P ᗹP`V 40"S T400@p@-La P`M=  .00QP0P ; 00\% 0@0 :\0@S \S 0@ S @ 0:S:\ \000ЍpL0P  800  4 0 @ wvvp@-@P`P3 V( 0Pp:P @R0R P:U P0@Sp P P@Rp:UR:Rp@0@ @0 S2(0( (0 J2. .p  p.00/07p@-@PP" U+ 0PER R:Q|Q00Q0S"P0@|R  :RRpT T0T P0 2U8 808 0 2p - T-O-ȟ M MDčpĝP$ 0v 0S 0S 0S t4!S Sdh`P @P5  pP 00S RD@ 0 @)D@ ` @PT"0 S* Z :S `\S S S 0U:HPPE TpP+ (P`0@ SZj0[P0#QQ 8P6@00PS0 006 p0040(0,@= P :S~ 0pS t40@0 0(<QP<4` GC pP> :00`00 [00S  `U@P  D 0 `- PöPu0S00`YPE*0 S :S `b[ ` Pf `b :S& 0@S  0D`F00S:S:00` F0H[0 E0   F0 PCy `#00p@ H PEIpGSP P p ,@ pT u E0AX0$0p#3 0 D4 30ݍ Ѝ@ @*Pp2 00&P ⪝pP `3P00PS0,@`TB `@0T<S= {20@ڟv2@00"2 0 g00S"2 0B [00Sv"2 0 O00Smt"t2t p 0C0c  0@ᜟ0S> 0K0C 04 8 0S:SZD H R0 0  Q!000AM04@@0, W0:S - 00UiP e0 E0 +I0 :SS008$ 0:SS00@ {1 z ` x <@-0 00 4x-H-M0 S0 00 0 0 0@  00^100M0 R@0    R L00 @ 00 0 0 30KH Ѝ/wwPw4@-&I0 @ @0XO-@`$MllPὗX20PY 00 0@`QbIP p W  B P G  pGpPH0 S#: +% U10 r 1$4S1$ !t@00H ʹH0S "<100S (!0 0 0 306 $Ѝ U r pP Р P 5SX0(, VT00#    'PH JH0SRNv|$PXWD@W(u4hp ˠ@-(@M@@0BPЍU  {{ { kG[F { // =A z z kk'k [FKE{{ //=A  {{ { kG[F { //=A A{ kk'k [FKE{{ // =A@-Q@0M 0    ",  0$0(0T +P0 0# 00Ѝ +0Ѝ0-$M  00 0IP$Ѝ0-$M  00 09P$Ѝ0 -M 00 0 (Ѝ M T0L/C-DD sMPPp`/ V7 @X0^00pAtAU0O⑕4{ PP0P >TA{'%0 0$00 @8 |0 0 1 30sߍ`0` `G0 T)VD0D DH0 J)pH(p  t 0   M ЍtoO-ϟ MPÍp0_ Wg 000!R !X P  #P4%X 00S)00 R .> 0 3 30 ߍ`. 0zS  000P0C0 pXcP o@0 0 #P 0C PSNP =- 0 (W=- 0 (a`0`F p0p0S8@0 k#P, 0P0CS0 0000偼0S0p0@0 0 O#P0 0C P0 SP 00 pg0p0SP 0Sb0 0_00S 0p000Sp000b  0 P\PY+PS  PO00SVp!p3`0 S` 0伲P P` 00 000020p0S 00hʠ@0^T@pp,(0(TIP 0', 0$ 0 0$`-Q[ ]QP0 ` Q: @$00!0SVp!p3@`0 0d:P000 P& 0  B00  `(0 ⩗p PTPpG@0SW `ϗP 0@0080偼0S !P -00SG0p00p0S00 P 08pG0Wdp 8pFWp!>᠈ m@(0H0p0 +0BMS00 [m0H0 00CS0c000pWH%\0XS 00 0 (G  0        0H0 0(0L0 P00-0F SJ*N0 `p(@凖0V '  0 '(0 4 8@` p>(00S <P V ,$00SOV`@ T@0  R  R=  0 BV0 5 RP/0pH  Ry @0H  R'  `V B   H 00 0SP HX A 0p0 0000P00nLH HHQD@$@on  |   T 4  T$ I B \ `pG00P0W0S`J 0000P T0$@p@00Lp00 0P00( & P5 0  B0 0  % 0ٔp P p/ הp Ҕ0S $0 PS0pS`F V P0 0@00XGP ($@X T 0@0 0\0S6P [($@  0(pI00 ?Lk00 :V+$  ]R Rt@Pp00@0 0mP00s$  ($ n4X y@WP0 0NP 00p,004@cP P P P P^ P 3#0 /$000C ,0P[ 0$@(j ` @vV @ ](0\0LH0\ -P-@0 `V`p ,X@0Vp@H0 PH0 B   H `V  0SjP H0 p H00CPVX0p0|5Lp0@P0 00 ?oV20SX 00 0 0p B0V 0\ R1PV0 nP O Ó P 0  B0?0C  $. 0(  sp0 P s ṓPX P`Fp0S P [[ (0 {1(0 SA-@P`p0 0@@-@`P MDp @0p0 000@ ЍWA-@R@QP`w v (200S8 0P1S010s G000Pv`$ pW@0PE ᄑPP_ 0 #00P0 0 C `C0000  Q  Q*RQ2 <00@8 0 B`0.P%00P0s0 ˏP ˠ0/B0T0T T`0 "~ B0 uq`,WD p@-@P[ 0@\p@-0P$L`T M 0S pW  07/@P Ѝj$@ Ѝ$0$ $08 \"0p0 0 00M 0ЍSA-0P$L`TpM 0S $X 0 8/@P Ѝ1$@ Ѝ( (0( 0p ""0$T 00 0M0ЍRA-0P$L`TpM 0S (X 0 8/@P Ѝ#@ Ѝ( (0( 0y, !0(p l00 0M0ЍRA-0P$L`TpM 0S 4X 0 8/@P Ѝ#@ Ѝ( (0( 0D !04ꌺ 00 0M0Ѝ4QO-MD`PpZ@@` T6 0US``$ZG 0SD [A 0 `;/0S+ @$lV 0S H[ 0 ;/@PЍb#@Ѝ0$lV 0 0 N!0H 0 0[ B!0h h0h 0Jh 7!0D D0D }\ 0+! Ը @ H8x @-$$@M sЍN@-0P$L`T M 0S 8pW  07/@P Ѝ"@ Ѝ( (0( 0 08pt 0 00M 0ЍN@-@`pP"tt0l尀 T  q@0 J$ ỨM,#0.O-ğ$M `H0 O 0P 0u pP3ʿ00000! B b09<Bp  UQPE @ 04BL3@0S0 MTT  MT   ^DQ #2!Q   "  R  R  \00t0!#300@ 00@00 @0`PU*$Ѝ@0 0M  0֏P-0 S^^?0@0 0`0  ӏP 0J ZS0 { 0J ZSw R @ \1 0000 $Ѝ0\  v  `0\  f  `0\  r  `0\  s  `\00 00 00Cs0S ``0\  a  `0\  b  `0\  t  `y0\  n  `r0eP0U 0 Dr RQ0\  @`bY4$0 4 p T$ `p@T 0p 9/P# 00၍}{$3 0 D1 30 Sߍ@@d0`S$O 0S,0  VR U 0004p@p`00 0 (  @ `ɠ8ʌ `pPQ^_A (, ^]*  P2 0*A5)q @. 00 (0<p ax ~$0~s$@ 20 ,0`T 0 0S0"700 0P{00, 0R 00$00S$0000P04p0S 0SV W1!0 ?4pn00Id1 @`,@(R(0 [PY4*( Y $0`0S$0 DQ  7P T`I< 000p0GtG ` PT l , D LḼ (D B,x P@-@ M(0|0x000000@  @ 80P @0 0 30 Ѝ>`>@-@ M,0 0(00x0 00000 @@ 80P @0 0 30 ЍZ==p@-@QM`P0 `0 `aЍp0@-@RMP0 M0( PKЍ0@-@M 0 00 :Ѝ-M $+Ѝ-M $(Ѝ@-@ M00000h0 @ D 80P @0 0 30 Ѝ;;@-@ M(0  0 0   @D <0P @0 0 30 Ѝ(;:0@-@QMP0 0 Ѝ0 0@-@RMP0 0$ PЍ00p@-@QMP0`0 0  `~Ѝpd-M00  mЍ-M( \Ѝ-M $$LЍ 0-$M  0)$Ѝ tt> sp@-PP@ T aPp >p@bH H0H X0 }, ,0, W0 s> sls= rDsp@-PP@" T+ Pp OaP 0S S[_P p@U_p0p@/L L0L w0( <T, ,0, x0( 1 = qhr< L J=00h00x x#K 0 ?s0Ԉ nJ- 0S VU0  SU S RMJ=000:02嚏0 0000H0 ,0eSP @,VU  W3 0S\0S  0S0s S0S RJ= 0 J=00XWH O<  VP\ 0SG 1jh03?Q #< <0K8 0J=00t0 Pt J- 0SJ=  0rvS S{J͍0 *]&$ 00ScLP P P J=00W0  VPJ͍YP ꊦ84 i03 JfO- ğ M@pQ `@#0 0CPS0 #3 0 0 30Ѝ#3 0 0 300 HD@pЍOWX] 0 H#? s0涇pPT0S0SG ? /r "s0 DࡇPT7VT00QWX00 R0SX 0Sd S2YP00SL"0 vT@@O 00QWX00VT;! 0 [ X: pYp 1嘡嘱 P0 pY 0@D    7T00? 4!0 +piT 1i #Y>p0萟蠟PP0 p   P030#?pW 0@D D P^T[pF\  xw / |dddcuTc@~bDtb}baG-p 0 FM& P@`p P  RW  P Wr`ov` J0@Sp0 0 0 1 302Fߍ000 00?1} 00  0P Z /r RX 0S P 0 $똽ȼA-@P`p 0 | 0P ;p@-MP`P@@P@T 0S  R0S P5@PЍpP-PЍpp@-@P pPpPp0 @0 :( x^0S/. AA0Cq.S .R Q P-S Q P_S /@-0 S@RO 0RM 0^G @PTO 0S`V DDp Wf U` \# DPD`VR S`/ @@@0T*R^00^00S 0 0 0R0C?o20SJR 0R 0^ 006 S0S0^ U. \2 D0D@T 0U& \ D`DPVS` D@D0T\U \ D`DPVS 0R`V\0S0p@-d M."@0' P  0R0 0S  R la  haR 0Sd .P 00 Ѝp  0S S0S,  R R R  R/@-/ 0 S /0S S/ 00S S/0S/ //0@-@P M 0S PP0 PqE@0S0S 0S  Ѝ0$0$ $n0 q# @Y@-pQM @Q`P Q Ѝ0SSp P*pV0S" S  0`S Ѝ Ѝ00S S<0 P 00 ꠸W:p@-PP`@ V T! 0pPpx x0x t0 +V\ \0\ X0 T@ @0@ <0 ! W|W! WPW|! 1$WO-ŸM2`C @80 0m[P00  03/P 0@&<00&,SS00 40R0ST X@`$`w R? p:00(,P Tp*0 C 05[PPf00  03/P] P[@[[[` M40S?&<00S !T? [ [[h5`z_0D0 [@P200  / P@) d`P% %I0 D0R4  4 Sʆ[ 4S 000`0 T &<00Sc 0D'TS@pW0(pY,PD Zu H0P0P08p`h@ 0 fZ3 { 0{{ % %  0E {000000YP qP0qP R R 0   pR kfZWy 80LE0S5 2[00.[0030 0&<00S3@~P@V 0 8(5$%0 5s (0SP #0S 0f[00@ $0R vTA TThT @~P@V_(0S <0`PC80D\K Y<0 C ,0PB 0P,0(00(070@ZOt00S000e@0 1z_0 0 Y@P"00  03/P Y 00`S 5@@80RC.P@VT&<0P0@` $0%@P h  ܫd HHx G GH pGF FF < <0< 0DD $0S\ \0\ 0dD 0S| |0| D 080PRCPP.@%@0.gPU0@ 5YPa0000S 0R $ R[ $R 0`whO-@ğ SMDP0b`P bpP $0  0f8X0`00pS0  PO 000 FPK @@PX 0  5Pdd@#|3 0 D1 30SߍY 00lY00 Q0 0 .Q0Q RS% d! St*+ 0 Pdd @S Rd! Sf*.[ 0 P< D |Pdq 0 DDQ0000 0000 Px0=S EY0S# S S Q 0 Pc0s70SS0S +Y000000  Q000S0000 P=Y00 0 P3Y0.[0 0 0sx X00t 0 *.0G0 kPX000 DDQX00UAdX00Rꠡx &AO-`@VpPM 3 0 S_ `PL 0(H0L0P0T0X0\0`0(000 00000HSC S$ S0 0% 0#(,pLp0  0Phh0000 0000 d1S zЍ 0,p#ᄀ넀kXgoX00lXP P P 0,p#bp;P h08 H0  < 0 S6 10T0  0BP  0 p5 P/{0(,0(0  {$0PMcZ 0 Sd1SdXO  00S!X ?O-Ÿ @00@$0` pY i;92 I520Y0 0 S   S  R  R Q\  ^ \/oQ" S R0S   0PQ ,-0 0S Q0S %0P 0 PA  0 B   (DP(IY! 0( P p0`4P8p`P,@<Y  0S@TM 0Sb 0S S 00SO P(0 0< RIP RF RC0S0S ;0S,\%`;3<! P 0 0PU `V  ;00\ Q  P U V  R R  ' p' Y ` P 0S   0?S C" 0c6#PY  ^i \S㔐Q^ @ pTp0S 0`@ p$p T d;42 D52H 0SE0 S > S PR  PO 0@P0 0`P`&0e/0 8(0 @YP`(0@ S0 `P@T $PP@P ]`[`T$PY@T@ pTu W 0/0P` 0 PU`VX _PS 臟PpH0!L0 0PPHP$paPPPB "`0S: 0S ` 0`@\'\7\ Xy/0QRSP㔐  P   P \?oR20S b R㔐I GP\BR PLV `$p(,PP00 00SqP@T0 ,6$p0(,PpP S 00 0 P@T 0S00S`;`9  0 qP pY 0wP-u 0P R 00S R00W  P5 0mPY 00S"S㔐R0S |$|4| 0t}/ 00n,@ p0`4P B_RSQ \`@ T P@P +_)_TS㔐b ` `_@ 0&P 0  0P ` @P __Y@4#434 0,0 ` `S_] P^`00\P 0 PPW`PP HpW0!@%`!!:Px\@P  H HFeH`L WP @L@*`@ ^0 "(` h`$ P,W 0@VP` @?HI댠 p0W|0E0B l0 0 0  Tp`h{ !uP tPU0E D $0DuP00EJ$H|$0U St S 8^ $P"/@T84@4, T @h1L~ t/p.cp 4.-u`Ii Q D 0P03 P Q$P0Q W : fth,pt0(` 0 0q"0S0 0]H@P P0U 0P]P0U ]0`$p(,Pz$PEb.,> f xuP1x00x0 ]`@`@HP0U00L0P]P`O-PLM` Zi  @㰱q p  PP0 0 0PF ``0S S S T@P `0S `(0 ( (`%P00 U `V Y 00  Y``VU$@LЍTT T0T P0".Z8 808 40".t `'&h H &%i G-XMp@{P `P@ h00  Z0 {P 40S0- XЍ PP \@ 0 {P \8 8(Pğ  $,4P$ʃ @ ! " xDb(@@ #! P\D@@0,0#P0@Dc>@ @",$P$Dʃ@@ ! "0P Db(@@ #!@ @",PCʃ@@ ! " P Cb(@@ #!,PC@@0,0#0hCc>@`" `& `jDPDC@P! P%@P,#eX @# @$@#D  , $0l̈́ 0 ! ba` ` " X`"0  0#0 e0@ጒ@$ @|ŸdM   " b0T"0  0#0 X0 ,,  b(Ņ` ` "  bMD`!0  0#0ck0 ̑!  Q<P0 P0#0Q5 PP "@ b-@@@P4d , l˂ Da @`` " (p,P! P%  PpLЍxjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ@-@P 0@ @@<  0,0, ,0 ꉫ#EgܺvT2P (G-PPp`6 W* 0!ᣑ000? 0"@@i>V0: >0iS@I"p ` *50V@@p`F GH H0H 0 , ,0, 0 P X( p@- ! 1 0MPP0 00@( T1 `  !? 7R8 bx b$   0 0 0 30X Ѝp@"` `0` 0 ^T@ @0@ 0 Sl dl | @C-0"02 0 M0002"00 @00$ p P`0R   0XS 00 Q !. 0N `!P1 0 0 30 ЍQ  Aa 0s00C 80BS.R ^U* 00ꆐRP 0ES0 S S^*0W >y000@^0 8< 4^*0 8<kkj- MgP Ѝp@-D!D1 @0(MT0$00B  `RP?o2T0S8 0T0R0S A 0 0 $0 30((Ѝp 5(0!@$R0@0T$0B0S \@0S ( !0$ R0D0ih A- rM`PpP: UB @X0^00pAtA S0OHS01 000TAΌ L>TP5  0 SxpP& 0@UP 0 0 1 30 rߍ0 <0 Uh0h h=0 P VV00 0P0ꊏgBf t 0   M Ѝf -- M0 0x ЍЍ/--0 M0( 0 hЍ Ѝ/ep@- MP@c0x x` 0 l0  `@P@X@j0@lT  Ѝp(@ e@-HH1 0M` !000hmp @P 0 J mp l@ 0 0 0 30'ЍlPpW @@T PU 0StP@_TZ=00@׎di,d 0p@-P0@ 0 p0U(0PU(P,PU 0t0PP 0$P 00 0p88MqP 00 0pp4 `  0@-@ 0 0 0 0 0 0 00@- 0 MP @0>U 00P 0 PA?o20c Ѝ02 00 0p@-@P 0U0 0pp@-@PU0PPU(0PU(P,PpO-p0Ph `Pa 0@00 S S0 S S lPP 007PpUp 5 (P@P 0P00S S S@ 0AS A@PQ% 0 PS0Q0000SP  rSPP@0@;@PP G-@ 0`pM,0(Sy: %(T] TppU 00SQ 0 RK@D@T0PF   RB 0@D@D0P0S+ T0V  0 1  @D@TPH 00S#0A S0偠0  f0S000  U0S% 0p@T0ppT(0pT(p,p@Ѝ-SP  (,@(~  Ѝ00@- 0@P M   p P  Ѝ0 0 0$ $ 0P Ѝ0:p 0$  $ 0 1 Ѝ0O-PTMe pE,P@ @0 pp4UPd,^Q`P` 0 pp'UPU,PPU0 @\ \G \Q \C pp 0U00S .QP. p0 0 0@ ` R  R2 R[ R 0 @U 0 `WS 0JX0L 0 TЍ @\L@ 0U  0⼰  0 ` `  p`T  P@ P  @U$(P P P p 0p`` p  p`  p   Q00p`<0< <]0 MR%`  @-@P @@R( (0( 0$ @4R` tX/i'QO-^p8 P`PU<O ( [@$0`  $ X(0,2(``-P p`[ # 3X(0, 0!(`` -0P p`QJ`a!Q0#03U0S` Q:PQ Y5XX030#1!o 0 Q@f000X` SP3 P#51S41PE2s2PEs?SPEY0 h40 Er :0; 0Y< SP3 P#51S41PE2s2PEsSPE70 i00 Er 809 '0PE i{U0 8P0PE hkU4 :P 800 :04PEPE8 @-pMgp( @hp+ `0v0){0{ @Pgu t0 0@P Ѝ|g00@Ѝhog / p@-\ ,@\ \ Q :\ :Ap00p00C-P$0@SMJ  0( U4p :`I;$880IG81GpB70B- 0R R 0000890L>1 0 00LЍ 00!007 0 0@-S@ 3/@Pp@-W Q4S @A P`PE@F$@@  B B&"@D@D"F$@@  B B""@D@DA$@@U  B N B ^ '" ^ q N $P@@DF$EA! BB  D B &"AA!@@  B B!"AA!@@ pQ Q@#`  P`PE@F$NN. B B&"@D@D"F$NN. B B""@D@DA$NNU. B L B \'"\  \ \ , ($P@\ \0 \, \. P@^ ^ N@N P@\ \ \ \D@u4P@d\XTLHy7 4  @-@P @ bK0 /0 =P (p@-1!00 P@0 00D@1011.T 0@\0 S@ P pp0  00C1000L  00t@lKP ʚ; C-P M|뀐pM%ᙞlaapGQQNHH0  @ N 0 Ѝ` Q@-2"00 P0p 0C0@@@m 0@@@f 0C0 @@@@E 0@@@> `0@C0a`.SM @000@000@ 0@E0C2S p 2S 000 @ @  @0`00n l afAdaDn l lA`00@  0@A00  0@@0000@00 @ @@`iI0 C O-``!0P@@R@@ǟ MM|čƟT ਄L<6L0P40 0 0&6 0 P@ < 0D00U000x6h0H0p0,0 0  P00T00S <0`1  TD0PU 0P 0U V HiV0h0S  ,0U?p65P00P 0U7 W,0?p&p5p0= 0Q8 W@0 i@V,0? )R 04pUpP   P*4 %+4 p0:T4P p014 p08(p`4@p8 0 ?0SMP EK0P40[0 ?#3 0 |4 30ݍЍ_3P `0^0S 00T00S <0`1   OL &i40S 0#2 0 |4 304ݍЍOMMPp,0!(?q0r iUY" 8 " \```PT@Xh@F`DV7xT0Რ SO?s t@3 Z 8h pJ  Jh T0 P2L p 0J00 .JX* T@F0 `DVT@X\``ꌱ0   Zl0  0 @10d` `ppG  pGhT0 d`p0L p 0K00 .K* TʴJN nhFFFlJ;T:P:8H0CldBDh\< DO-tM@@ `VPPh0 0PPp 0  0`14S, ἴᾤ0  (6< 0 V 1P80s6< 0B>PU  0R40008 g`1S   ;`1S0 0  0[PJ0  0OP7P  PCP$0  07P0  0+P0  0P0  0P0 0P`1SxYz < P0ppW  0R 0ogpW 0pW  0Rx 0\gpWf 0pWa  0R0 ,0IgpWGpWD 0 PS00 7g`1S   0 ` 0 `@0 `0 `, 000 0I tЍ   Y _2P  0001p 0001p 0001p 0xt1p 0L ftЍ tЍ 0 10 0  0 0  00 {x0 t>H3d1Lx/hDdD$@-@`00AMM0 400p00 >PP0S ]D 80 0 4 30AލЍ.궃7 70,@-@ M pp P>`PP 0S <0000 Ѝ00S.S 0S Ѝ蘘p@-|0|AMPt 0 ` $ 0 @P  8 00 0 4 30Aލph65p@-P@Q`  @Q bPV 00pV00p@-@ M`p5PU 0PU  0\W 00 Ѝ_00P0 `fW00 Ѝp@-@MP` 0S 0 @S 0S@V00ЍpO00@0 P>V00Ѝp40@- MP0@0@0@T  0U Ѝ0p0 0PU:L@@ Ѝ0<00@,0 0P  Ѝ0P)P7Tp@-Q`M x00<@P 0PU  0VЍp_40P 0`Ѝp @@x((p@-MP0@0@=@T  0UЍpt0 0PU:P@@Ѝp <```@,00PЍp' (L(60@-@ MQ Te  T T 1 D0R   T8 2@TP |QTP Ѝ0TM  T/  TJ DQ TP 3^41P( 0@nT T: QTP PTP PTP P TP PPPPPPPPPPPPPPPPPPxPPpPPhPP`PPXPP꒣ 4 (\0@- MP@O@ P Ѝ0 0( 0P Ѝ00@- MPh0h@0@B>@T  0U Ѝ0O,0@ 0P Ѝ0X$Mp@-@ML 0 Q0P0<00P@ ` 0. 0T @D F000T H0 0 <0 30 @Ѝp@Ѝ/.0 TS1aP.<-O-PM@PP g p`0 Q  ЍSs SRPP -\0  0+\0 0 30P0 00L1011 .\ 0 @T@ sq'R Q"  S#3 @ R Q" 0   S # 3!# 0T$+<0+80+40&<0&4 0'< 0'400&( '( ` p0R0` T000@0S Q# 0R#300@0S Q#  00R0#03!3 T 0T @ R P"  S#3 @ R P" 0   S # 3 # 0T}0 0K 0N0 000J00  08(-O-@Q0 dM R 22/18R{20\0QS0N0<0l2a!##\R2b1!A`2aL6RX2eDPQFW0E0@02h8's2a>?2crlqqHL01NਂhLΆbfXT P0H` aNc( _$ [ [P0 T XF Z H Y J (0L0$0\04 0@0,0H0 0<0p 0D `40B[ FZ FY |FdЍ00N\0@R@(@j  0 0dЍXZ HY  8|igMbQ +Գ@-@P 0D .R S0@*ST .P@Q QA.@P@@$ $0$ 0( ̗ (@-$MP>`@P`\0pv> 00pp< pp_p  `Pc$ЍC-@P@ `p MPOP @U H^P@Wt Ѝ @cPt0 0000 \0 P!@T0S0Toᨂ#T$0C-@P@ `p MPx@P @U ^P@Wt Ѝ @Pt0 0000 0 P @0S0Toᨂ##$p@-@P00CS0 S u P `0 Ppa`u0 0CS0pSr P 0 /a@-M@w0  0000 !R !0@Ѝ@--0@S@#0@0Q R#  004S 0@R Q R 8 @0Q    (!Lp@-DPD0P`@0pp 00p@,X0=< Lp@-@ @ `@0Ppp0p@,'LA-DD p@0P`p0 ALC-P0 `0pMrp@ H 0D @ <8 @ЍB90LC-tPp0 `0p MHp@ ( 0  @ Ѝ 9L0 00/L0 00/L 0 00M0ЍLA-TT p@P`M p 0 [ЍL0 00M0Ѝx0LC-tPp0 `0p Mp@ ( 0  L@ Ѝ8LC-|Px0 `0pMp@ 4 00  R@Ѝ8tL0@-P@000 00M 0 0Ѝ0Lp@-D0D 0@0pP p@Lo8pL((  M  0 Ѝo<L R) p@-P`@V P 0S.S  0@S \S 0SBp0S @Dp DU!B2p/@-P0pSp@ M` 0T  0C0 ЍH0H0 p<0<07/0 0 4O-Mp`@PpM WC*00V>:Y ` <1 p0 p, `P 0 p- 0 p 0% Z ` p0 p F0?V0S0 0 fЍl0 op \000000Ѝ(dȌ ,O-M 08/0`Hk= 0PE$P=00P눀4>Hd P0 P` 0 p , 0`%p =000S#=000SH -0 = 0 BR  p  R 0S .S 0S 0S00S.S=<0=0-< R, L C+A0X 10"3" 00;A0==0;A020 0;A1;+A0X!1 000!;A>A C1;w=000+S =<00SpA0@d 0 0t`P0 p{  0 d d0 pm 0@T0DK*P `pPb4` $ Ep 0p%8* t,|} d} xt| z ==Hz ====y зԶl8DдhVUUUl`$İdXl|p Dl l$k 48Ȫ̪(ĨTDKC 0d 0 0 0  p  < 0 BP0DK 0T$*PHqp\N `P倐P 0$VA  R @0 Y$ y0d  0 p @T0-< 1!?C0 SX!(p@ [!p=<00SG 1p0D;2d 0 o P`0 pv <040@C 0 P`4Ph0 p` 0 P`#PWH=<00S =<0x30 ! PD=<030$0d 030 % ! Spu.=<00Sn =<040=@  <<0n p1@m1@000<`Dd4( 0 P@0 #p -< 4B !?C0 S}0 p2=<00SV 0d 050 ! p `VEpD6 1R<@0`P $0@@@@= 0Hp 0X% yWP *( 50@@5 04/$0pG= 0p0VHD 0 S@P00 p @P<0P`40p@C 0 P`FPz0 pr 0 P`5Pi0 pa 0DK 00CSj 70=<00S0 H[= @ 00$ T` *0(P't p07 h07/=@D @P 0`0H[07d 0  ! Ep! 0YD2*`@xp0p DPY V 0  %p `0d  @ 0 p `F@P 0 Y!p(@P< 0@P BP 0 p PDK!0 0@0H0L  h7 = 00@P ( 9 0P9 05/P`/0@)DK1#0Ypv! pp< 0p BPP, 0 p| LjDK`/PD[ d 0 ] 0 pf /PD[ 0d  K 0 xpT /P /0 @/;d 0 @P2 0 _p; H=<00S `+0 S00 =<00S K0@d 0 0 `P0 8p 0p00d D; 0 0 'p  0 d 0 p T< 0DR  =<00SJ :/@7/P4/PP0@D;<@2 0 `p0 p < 0`p BPH 0   <  B}P0Dk 0PCUt@pQ@T 1 W2 R0d  0 p=<00S .@.p>@@2 0Df P`0 pm 0  Pe N@0 D}pY 0  PR 0 DlpH 0  0P@@ 0D; 0Yp5 < 0@` BPr+=<00S 0 C? 0=<00S 0   <  BP0D 0 SP/ C 1#00 Sn!pA0 H{= ` 00"VP *0(/ @0? 04/0-p`F H{D`P!p0 H{= ` 00c"VP *0(. @0> 04/0-p`F H{D`-0 > R =<0>0=<0p>0 0 C`>0 0 CP>0P$ 0 PU0D[:=<0=<0>0P  `PV V }p@P 0T00 Ep[ 00d0V0@D0 qpLP<  @PLTT $}p`P 0V00 ESp/ 00f0T0`F0 Ep 00XS: 0ST.C+SQ/+` 0000  0C Q7ࠃ0ࠓ0CQs 00000  0C Q700C20L0L L?0 404 4>0 $ ܉@G PG A-Pp@KU`, T @ W0``W0 .pPEVp P7000 2000 S70Q00 V00$ $0$ g 00xF l/Do/w,///@-` @0 0DM0<000p2 020 RP/00000C0< 00 0 <0 30DЍi  O-h2hrP0੒ 0 M #r DrgqC2(00B刀B# C@$AR i!dP @`3@CG*TNXWnY1Z$* @ 0 Sp: [ @B0?R0SJ  Ѝ @ 0 Hzp# W0Y[0S    00000000SW 0 Wp@@ 0 DLp XW  0 M?p Y L0L Le0  Ѝ @: %I$ $B 0A-`pP90S-@ T 0D0@D0C .R T  S\RT  S0C\R@D @0.  0 @@U( 0 p@-M P@ ȍp k`\ p Ho4 (0 0 8 30ލph H 0-@- M0@R0  JPP * Ѝ@Ѝ/ + Ѝ@Ѝ/hPRp@- `@PmP[P0 ?p@FI00pPRp@- `@PKP9P0 ?p@F'00pp@-@Q `P+PP0 ?p@F00pp@-P@uFP p@ p@ p@-@P 0PS <0S P 00p{00pQP@- 0R R  h00p@-PP Q@ @Q Q Q ARt032 P00pP @pP Qp@-@P PsP  U  H{@{7@{{5pHHj,UH D10jS#knP \ X6C#: :H L0p1R 006L00H0\H0  @  0 00M 0ЍJ GA-P@U `0pS @ YP 0S U@Dp@-P@dP`P0 S :pSSp 0R:pp808 8e0 ظ$0$ $f0 иg0% 4gDg% gA-P`/@,T*(P/ $P4 pPW 0P P B $$P W 0 P l l0l C0 ⍸T T0T D0 ℸ< <0< E0 {$ \f f# Xfe# Xfe0 0¨@-@PDQO-^ `Pp  A@ 0S 00CS 0 \V0 S  RYWppXpQpW\`\\U0 SP\p" Q@-P0-r-w0-0x000# 00000S wS -S rS  0S /xS  / p@-^ PB2 p 0 pP P//0S/ S S/0S/0S/@-@ᆳ0@0T S R RT/ ?/PP/=?0PQ/?SQ $0$ $p@-0 u/db |b ??SS $0$ $p@-0 a/b ,b?S S S`/Q/AQ/Q Q/?0 H0H Hp@-0 ;Q/?S0?/0?/|a aQP0 ?0/@-S 0  p@-\$P 0P0(@`B P^;0Sp50@&0@`p@-@P`M P0ES  aЍp  P^0S 0 0 Z0 `H `p@-@PpP Q 0S PQ&0PSK&p@H&A-PPp X P@PEX `P@`( (0( 0 `` $_(_O-` MV " p@IV P׳P @0SV F!w0 `F`1 Ѝ Ѝ %` - ^ x 010C. *  $    l A-RP`p(M @x 0 @0@0 P0 P0` P@ 0 (Ѝ 4  X00 5CS  A/0cS#:3 3Q31:0CS! 2#0p@-@PP U Pp S 0\\0 0pD0D DL0 U(0( (M0 (5P \45( [O-PM`p 0FV"S00 0\ Pᜰ@P-UN +UP0+ `p"@0 P00Es Qa0ESW0EA0ES70EVt PSQ @0U0 V)  `0q 0T00S0 S` 0J0 ЍS T 0P 0w0 0R0  Ѝr `00XS 0A0C0A PSVr `Pr ` 0 ?0 EgꙙX `00 0M0ЍTꌟ QO-PMp 0GW"S`@ P-TPr +T [ ?0 0㕰0 ㏰00D P @p P 8Q P  S  R/ !"  P 00Bs ^ a0Bs0SW0BA0Bs0S(70BS%| [Y Q P  S  R!"  Ķ"00꽶"00 0S \0F0 Ѝ[@`K ?0 0"  00b 000Dꓶ00 R0  Ѝ[@`g0TK W@0 p 0 00Dm0T00XS>@ 00DA Bs QR cp >` S0T3 W  0p| px 0@`> p PPL1L!L?0 >0p 0>00D,00XS W#0p 0 000XS W pp p 0A0C0B QSWpP pe0p 0> 0W 0@ p p0@ p 4333333< xU00 0M0ЍD  | 0 Q?0S @-|\-- Mv ЍЍ/G-PP`P VX ᐩ00 !PER !U6@  yPG0 说PU pWW@'oPp X4 00k  @@pG  p፴00[ 聵 0@0 0PT0T TB0 mV808 8C0 c8$\ pR4 HRA-@P5H`H0``@p w>T  S Aܗ "p@-@P00CS0 S u P `0 Pp>`u@-@P  0`00@0 60 L P- M ? Ѝp@-PP@ T 0 0 00 pD0D DD0 ߲T,0, ,,0 ղ`*4 |PMD* TPNA-pP@`& T/ V8 0S 0S 0P Q0 00 R` FQ`00x x0x 60 TX X0X T0 V< <0< 80 O\O hO0Oa HOObO-ß OM4`lPP `p@dh V Vt Z.` AP 30 00 [ .Q Q\.Q _ :!!PX [ 00:[.[#4N[0Q.SH Yf0IS00_00 I Z  0V K P00 0 ` `尭0 0C SA: 0  `0  +00/00P!@1 0 41 30GOߍ:[ 000$0( @,倭0 000 `0P  P00 ZZ00崳00 0 ( 0঱C<4 PPI U.R{  :ၣP o1Z\ 8  7 PL\ `KBO-`PM@  0X0 X0^( 0P> 5000 00 P @ p ˞P 0 "00P > R  R 0 @`V  pWI1:pG`W:\pG`R C0 / ` Z`pG@ R  0 0 00@ߍ R R0 S S  q P| ` Q PD %P@ !T: pu P@D X0P@- #[0k0 ፬Z  ر[` pG Ka  ˱ pG  Vb oXV P 0(P ` `p R R R RT T * P  RPD(P@D PV p@`V2  孭P' T <:`P ᜭP !T014@1:r 0 @ 0\0 0@ 0 @ 0 @0`pP_, 0@ 0@ 0  PP P 0 `@lI4 1pF^@-pp10LM`P0D00@G Lp0PS- @.0 P( U( qp0 0岫 0  >P 0 T  0 0 0 D0 30LЍ=Ptpp P@ 6T@ @0@ <0L įcX \pE8 D DA-PP@M8 q`p@T* X pp00W 0 =P0   0 Ѝpp @T Ѝv=P @, ,0, (0\ pЗ.L. 4B O-ʟ UMMLō|Z|ŝPPpxe刕( 0 (0S 0 S00 ,:0 0(W0P,0  0p P?s0WS#@``O ,0)09 0 L5 30YUލЍ5 00P0  03/P PW: 0B?o2\0R0S<0h ḪP0``P`0,t欠\ 00 H05 00 0T0R?@0 0 pDL48X U^*``0 C 0 Q@PS0  03/PK @ Z*P U$0P0S5<0S0 S  R0{6P0$ 0S!0S H0S0`K`$ 0`V`*X0L0Q*@ 䊯H0``0L@H0X48HQ 0, d0L P0U\ Q  RO ZO[ p P p H `BP0 0 0P[ ! R soQ \ V Spp0XP 50 0W  H0S B@Gq 0SPSPڰP^!P"@Tp`0S 0 ,0`@D @PC0@P0CS`@:Dp` @bL0 C0 0CS`: 0S?0 @0 c@Pe0 z $0SB@叩Y 00@TW @@0P娚`@(`L S  C'SRF0@h0`d0%P `v3#3 0l ભ(0SW#3 l 0M(0P04D0,0_?R0 0  PP0 ; $0ST D0,1Q<*,0`0.P @ `@'0` CR00V048,0@PPp0`P@ CR00T@)P`@7 03/P `v/,0D(@C 0T00Pw  , D00D0D2 0(4PI0  PP0 F $0S|H0S0` T D0,1Q=*,0`,0Ẩ0SL@P`z, 0% xv p  0 Nύ00K@1sHf Ἑ0`@0P``,0[0%P xSPQ nU,0D(@C 0T0M0P , D04( P $&l %;< %x;  A-@PPMD 0 S`04 S/0p 0PPA P< 80 0PXP"  0 0P᪮U 00S S Ѝ0pᖮЍ8 808 40 ] 0 8 t6G-30BMPP040@ 0 00S0/ S  0 "2 0 4 30Bލ @tA~ ` p0v #0G66P@T*X( $"໘2P 0    ! 6@PH `PC 8 0 0@PJ` 0 00 00000 0{0@ET@ 0 p pIP Ԭ00S 0  0pW/   0  0 } 0 v 0 0 ৫_ ϭ 0 dȭ 00S S[ Yᾭ0T{ l{ 4655` 3G-M0`pᔭ@P0P0 V 0   0 pPᓭЍ 0 PP 0   0Q D2A-M`pP^@P , 0 (   P0@bЍ0, 0ЍA-@P M`P@pQ UV'0S9 0S0S9 P`4418(!<P P0 0pP 00 ЍU U, / 0 0 Ѝ0S  0 00S000s S 04 P` @8 808 4 0ɪ0q 1v $0O-$$ğ DM<h@P 0 (PP `pԓ 0 p`P P ,0 0P0Ú RR RR 0 R R$0 S S  @P p 30 00S S S@ 1U e*@ ɗ@P 0S 0 0$0R 0>B PE @ Y6:I S@@1 D @ I@ Y!:  5 U@In E1P`P@G   %I  U=pɥ` V`tr 0  0\!H1 0 <0 30FDЍ(PPE pP 0PE P/ 0 0  0 0 OpP`0 0075 0 )0 000快00pVRp`u r p@-M`@P ),0,0   0kЍp@-M@ $$ 9 ЍDT@-MP` @ᔫpP0P0 ɠ@0@ 0   @0PᓫЍ~~0@-P MP@T 0t  P00 000 P 9 @ Ѝ0X@Tt 00~p~X~C-a@P`PMT U\ !0 `   p 0S  >  0C ^0 .SGW 0  @Ѝ0 XR   9S *@ pG W0 QU 4 8<03?0`0` `m0 ԨUD0D Dn0 ʨ @S ho 4 ) (O-ß3 0,M@Q0$00`P RN Pj PX0`:V000 0m Vo 0 0#@ P@`0 yP ^ PUY @ ZpWP `$pVJ氐0S V0FB S0 s\b 0@r@@2pJ04 TV VT Q/00"1 0 $0 30o ,Ѝ!1 0 $0 30c,ЍO`:V@ p P :Z?U6 0S 0$ S氐P`$$q$ p 0I4 U V V 0@ QT00@ 0 0@ ?0S@^$pk@ `.V `$pVP\sPVixm  '<k k  %\ d%@-1 0,M@P0$00`P& V.  0 0 0 p 1P* w 0 0 $0 30,Ѝ蓩 0 X0X Xh0 V<0< <i0 zPi $i  # #O-ddş tMQl@p 0 R P P/ Z/ 0 %5 0 l0 307tЍTd4P`I0 ?Tx T 0S4 02$4 0 ) 0$40(,04801@ R@0`S U P Q 0S0@S Pt0Su00 Y0S @\T<0000j:000@T `0= Zf 0Sf* 0CR00_:៓o"2 0 l0 30 tЍOP@PUE*0: T00S Ct"H 0 0[P3@T` 0Z00S RZ  @T0`zu YPs S 0 S P0@o Pb0SF:i 0 Y Y Y@L!0Q 0  HP y8 @R0P`P`0H ;W Tr T0 0uA0< P@0 j0| : J0@

$0[' + 4P&p 0;/qp 00P @ P 00 0 00 僛Ѝ軟p p,P 0 Q+ L WY pp 0,P 00 0 SM  00 0;/qp 00PPßQ <PU;И0 {p0 ;/qpP0 r 00 0PUßR <0PUß`X0p\ Ri0徙0dX0P\NS  00Q] <P800CPU0&Z   "  RPPL0i?  P;/qp@ 0P000P @ P f00 0 PZ 00 `P)0S&: I y AJ0C0;PPT 0S  0CPß@1@!@G0 ФAPU0 Z 0CJ P'JPP @0P 0000 00ᄚ0 0 ࢤ0vꝦ 0 nH0H H0 0b X T pH DO-P,MPp@P` T 000S000Z002$0 0PP`W0 00@P $ 0R00SQR+X` P  0P 0C0  VP`P  [XhU,Ѝ CRoo$ b  B0 S $ `R``V8 PB0S0: `P`$ R``VR`%X00S P0D0P \[ TP|[  0P \ PPdP^[ CTs[H U $P` Pd z ᬕP 0S   00S S0S S ^ S@@T000S00Li0\#00& ^@ [ @@ S@ U@0@ @h0 w0K0B  Hp@-@PP` U 00F G p 00p0 60 OUd0d d70 E0 0@p>0TS:00h @  -M0 3/Ѝ/0@-@PP M) U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0@0@ @0 (0( (0   x0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H 0 ෢, ,0, 0 ୢ  xp@-@PP" U 0S S S 0p@0/p0p@0/pH H0H 0 , ,0, 0 vD  p@-@PP" U 0S S S 0p@0/p0p@0/pH H0H 0$ I, ,0, 0$ ?h H@ 0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H D00 0 000 ,00 h T@ 0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H D0@ ǡ0 000 ,0@ ཡ` \ &8  %0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H D0P 0 000 ,0P {X  F0  E0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H D0\ C0 000 Y0\ 9P `  e(  0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H D0l 0 000 a0l L h  $  0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H i0| , ,0, (0| ෠H t    0@-PP@ M T 00~P00 Ѝ0L L0L H0 T0 000 q0 T h 0@-PP@ M T 00P00 Ѝ0L L0L H0 fT0 000 ,0 [ \ 00@-@PP M. U" 0S S S Ѝ00 0S0 02/ Ѝ0003/P 00S00 Ѝ0H H0H D0 0 000 ,0  $@ X0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H D0 ݟ0 000 0 ӟ 8  PA-PP`@7 T- V= 0ppgS S&0  03/P" W 0 A 0/0 03/P W 0 A0/CoP P0P L0 8 808 #0 { X *0 lA-PPp@`M4 W= T& {P R P P P @ЍPX 00@R X# ЍAs 0 & 06 0  0,W 0  0! L P` I0@SPs@@ d t^ȿ H_T Xp@-@PP U  ;p@zL L0L H0 U0 000 ,0 ؞о P $A-PPp@`. X7 W@ T P  R 0 R 0\A/V 0A/ 0  0 0  0Xl l0l h 0WP P0P  0zꬽ ,, @X , 0A-@PMP` 0L U@ 0pS S  pP R`V V V ЍW  s0SP 00Ѝ W`" ]0SPV 0 0 l l0l /0  7 Pp 00ꜻ t 40 4p@-@PP U p@T }P P0P L0 ߝU4 404 0 ԝ(# @? 0@-@PP M0 U9 0S S S Ѝ00 03/P 003/P  0 Ѝ0 00 3/P 003/ Ѝ0L L0L H0C/U0 000 0C/t 4WH 0@-@PP M0 U9 0S S S Ѝ00 03/P 003/P  0 Ѝ0 00 3/P 003/ Ѝ0L L0L H0G/:U0 000 0G//, { p@-@PP U p@QX X0X 0K/U8 808 40K/ p@9ꔷ Th p@-@PP U p@zX X0X T0N/U< <0< 80N/p@b pĶ `Lp@-@PP U p@X X0X 0R/U8 808 40R/⶜p@H  p@-@PP U p@'X X0X T0V/U< <0< 80V/⍜p@ꤵ d$x @-M@P0.S00Ѝ:@-M@kp  B0?R0S Ѝ(0( (0 X0CЍT l0S.G .S > -.\6 AAQ00C S;R .R0P S.S AAQ0B Q)S .S 0SQ0B ^-R 0S .00 R0/0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C//0 0 /9 L0 00/9 8p/0/ 40/0/O- M0 R Pē0 Pm \ Xh@.000\a @\f  X\@PAR0SI <  cSB!  S   XH`#SpP@@P   pGW`W0P@W `0FS@0 R R S*   Q @CT00S<"<2< 0 0T S ,(00@ ЍAS0S010! 0 X@P \P!S" Cr <"+  X 0@Q 0;S@S \S ! C]R X8!#!! Cr  @ D"!!1Cs0#"1 D0DX0@FSP0S pg' 0`a0l pg'!"p0`T0_깜000S*. 0 f   Q4$O-@lğp$M W0P Dd`XV @ppW \W* .W 0E0CH XF0 R S.R? pWP 0E0C 5 X3S0 X ń- PEU*0S0P(pW [W$ >P @Qq 3P @Qp (P @pW7(00$Ѝ] PX p GYN0xSK2  000 B @0XW  /RX ]R=Q P00 !  0]R' @R " XWQQ   Y I b"r RyA  PRA .R pW@Ne@֛@ӛ00Q    Y  " ^  @WX  P0R XW(@Qp59:fX0  0…1^S X ńY PEUV0SPUWX5  0G-TA Q@K*`0S$ RB @RpP00/ 0Y90  ܠ 000 P00`S`00@NT00X0Sx x0x t0G/8AS 0SPQP!00P0Y+(0@0t0 $ (@RO-P3P#RP3 M0U 0p`\ @W @RH R R4 (00 ЍW@ Ġ[? A @ GRPR@\ 40S4  0@0[A[V[ 0 0K/˘  Y*@T*0PÙ 0A\ R!ɑ" 40S04 0 - M} ЍO-pSP$M Y p 0 pS 0S0^@w @^` \rS0  H Y B `@p p@TW @0S @S] pZM ^TP @`T00 S Sn*p 0A>Sc B P_^p0Q ^ QC 6(00H0S 0Q* 0F S0S 0 `  0AS^01"0!0\Yp 00 (00@$ЍAT{0S"@@A@pZ @0Ġ?  0^q0A>Sp0pSݙ000^ 0AA^ AN[ ^( SQ0SP9 Zp? 0.$ @C /Q R 0 0R/⠗ꛙ00@G0?Q0S 0 0R/⅗~ Vs*p+Y P HP @ @0@ <-0p<@ @JԢ tj `p@- M P0 `004p @ !p < 40 0 1 30ލp@?( ' A-P 0 0M `0 10@0 (qp 0 p0 (0 0 1 30ލ?\' ' Q:/R/0S/S:00/ @-R@3 *0\ @^ ^ ^  Q0S0QA\ (000 R!  Q 0 ARL ?R@- RQ0A  RL ?R00C賘(00/C/A-@P`TP% UVT ᒊP @TP 0?Sp 00聘(00QSp@-`@P fP@`VP  0R p/pA-PAUQ?UU@A`pp W ڀ1AP>(009005?00Q @-A?SSRB 0@S A00(00/-- Mt ЍЍ/@-M@ p TЍR/0S0 \ R 0S0000/O-P MPp 0EU"S} `@ᕐP-TR +T} Y >p\`00D" [*SP# K@00Ds P a0Ds0SW0DA0Ds0S70DS| Y[SP;+ꅗꀗ0S \0J0 ЍY@0Tg UGp Pa 0A0C0B QSnUPP#\`E>pa00DO0 0R0   ЍY @~0T- U% Pp8a00D~0T00XS$@ 00DAAs PQ2Pp>cj p>cP0 ?0 @Pp>c00DX00XS UPpb 0L00XS UpbPPp>c 0=U0@PP.@ p>cP433 X 00 0M0Ѝ A-00 rMPPp`, V4 @X0^00pAtA0O `p00TAΌ 00`L PP%0 @t0 0 1 30rߍX0X XF0 V<0< <G0 )= ( l $ĸD 0   M Ѝ|  -- M0 0 ЍЍ/--0 M0( 0 Ѝ Ѝ/ O-@SM \ YXb 0pS000!R !01 PP E`#3`7P*Q30A 0#1#2#4#8 P 8    U 0C  pSOP0 0@pQ 0S  ЍT 0 @00808 8@0  0 0ĕ A-@`Pp㣉0 {0@㣉$0$ 0 M Ѝ0 T@hp@-0 000St@@@pdddPPiW@P@P E0000 0p th4 gp@-P@ፕ p@A-@`Pbppp0php T  4<0   A \.+A-pP@`  F *{000@P p@-@PgPpp@O-@b@R`MP  Bp@v r@0p RD 00m|X1PZ 0S` P U [@0Y P c0@[]P X 0`V P:Z OP4a`0pS PP @T ?P 0S 3/0S 0PU@:W )0@@00M Q|00t@@ЍXЍ0@0 0ʂ , ed Xd,d @-@!BM1M 0pPG040@@@ @@X;aP`d ! R !`0@  P0pA@ P< T1 0P $Ѝ0`0` ``0 ޑUH0H HH0 ԑ= aL ~4 G-@PR  RK \10X20S@ DqDDPp  #)!0PS.00a000S 000  000 000 t000 GP00H H0H D0 edd(P|ԋ A-pP8  0S@P$ 0 @S 0`PP0S PU @P @U000 y 0X@@ P 0 000 ,0 ^] O-@ğlMR  0 S X 4`000Sa# 0S00 K#3  04 4 0/P YP3s唳0@p 0V^ p p @QS  QN P0 Sh @p $ 3/0  0PY@r@RP00SS" 00C0T@lЍxB0@@@m|20\ 000SN  RH2H0(   @(,0T @p 0TTP 0S 0 @00D00@00P 0 S PW @@((0pS,  , @0 R7 1S@X$1$0(   @(,06 0 0&( 0S X 0 0( @lЍ 0 0( @X(  (,0 t] $\H\ [0 t[8[ع Z pp Hb< `aC-@@Ÿ 8MpϠl?2c Q11QQ@AP`\00QE?8@<`@ RdP*W?!1 0 0 30[ЍU00ì?dPER ?\00S T=*0!0 V5 @0S00L0  0T*0 V @0S00U0Pep 0PT*0@0S00 V@@W <0Pe 0Ps7 Q8 XpO-ϟ M|ϟp `0S㨐嬀  Y# 00 0S %SP\ @%0BUS00 0/ ? 0 |0 30Ѝ @Od @040 $ (P,9.##.cR:.c2S?  PP 0 0C@aa0C0C Cr  \\>N>?#c!!"N .  "bQp.5:bQ\. 1h.#c!!2N 0  ]0@ S 0!Yw0`0S00p S `l0 @ pE``0 S00C  B2=Q/0A!b0dP  @YG0`0S00@ S 0   B2<Q/0A!b0dP  @vY'0`0S00 S$0 p@`; Q00dP  @RY0`0S00 S0 p@`\; Q00dP  @)Y0`0S00 Sa/0 b !P :Q00dP  @ Y0`0S00 SB: Q00dP  @Y0`0S00 S*  0 p@n``p0 @`~9 Q0 0dP  @Yo0`0S00h SPQ / b !P  @)0 dP0  @YO0`0S00H S(Q0 0 dP  @Y60`0S00/ S Q |((0 dP0  @kY0`0S00 SU*P#U&P(Q0 0 dP  @JY0`0S00 S7 Q00dP  @2Y0`0S00 Sj0 <008@0 0@D00dPH00L0080 0X0h' Y0 `0S00 SD 0@E0@ S0 Ř Y0`0S00 S-Y@0L& `0S00 S00`&@1?2c 1 R11Aãd0Sâ/c1S0c05dP 0Yh0`0S00a S 08  @8  p480 S0R`05I0dP0 5 0@Y=0`0S006 S0 p@ `'0dPS004 0@hY0`0S00 SY@ 0,$ `0S00 S0 p@` 0@S 8 @ qp  qp 0 @Rh 0<S-Q S b 3Q" "2<0 0"b@ Y V YH ` R  dP Y0`0S00 Y"`0 p@j`0@S 1Y} I` R  t S`pUP 0@Sh P 0P  Y   R ` R  uPP0`p @`E0@ Sf 1h Y<0`0S005 Y0@SV 1 Y)0`0S00" Y| \  lP)\(\ ףm؀ X  t  *~ D~ ̒x} | | $| { D{ X0hHdv Ȋn $IQ0pq < 8  0@ XP(\  cd00Zl  t  0$ (P, VRO gR 0` p `0L, ?A1c$ (P0?"dN2c 1 11N @0?2cQ  111@/ d0 S  á/c1S0c01dP 0Y0`0S00 S 01Q00dP Yp0`0S00i S( ` `o 0P 3 dPC-MP@`lp<0@000 08 @pT `pYpFЍS"00Ѝ@-$$@M Ѝ C-`pP\@\@ M D0D 0 00 @  Ѝp 4C-pP`@XX M s@0( 0 p 0@ e Ѝ 4@-0N~ \0N~@ T \T00\00p@-0@-S`M `+SP0 P( 02c2c200:S V00c0Ѝp;0 P 0 2c100:S<0 P 0 00Ѝp@-0@JS( MS 00C S! 0P 0/S 00 0  P 0.S  0{P 0.S  40n@0 dm A-10#Lc\3j*0Sn SW @Q BW@122e3cPBz :E.€Q_uk9"mnףp= ףe Sc$IųQ\(\Pa ` Q(\)\ `  c 0㔃0 (: 600+$0+>! 0(a`  o`!!!0C0Xÿ0+" ?00 #2>`T[ c 0f (: 600+$0+>! 0!Â!!!0C0(AX Oÿ@1+" ?00 #2>[?W'`FPGp1#1 :#0! a,V"! / 25:$" 0"4#2><"Q0 3 #L201d0U\`25? B4sppp0/S[0 is c 0"(: 600+$0+.2(a1110BX2 o;#0(``T[`o@t c 0Ԃ0#$: 600*$0*.P3$1110B@Tl3 I:#$B0Nt3`0 `cR`@ V0#T Ba!kYC(1 ? c 00㘂0$$(: 600)$0!)>P$ 0Â!!!0C0p$Xxß)" ?00 #2>r/E B 2?A1c1c0R@ 0B 05P!@ 502c(%2c2A@" "b1C S/  0@ p0\X%X:#包  00u!ό#1 W?0}:5$  *4Ϡ! 5*111A T 1#0 0! C2 ! 02">"@T0@000|&  0@00U``PE0S0@P P$ 0Ѝ& t)1?c 0 0ށ0 '):60 0($0,'(>!!!0CD'0YL("1 #2>L<0`0@<' 0 @<0`0@*T 0 @-M0@wP T 00t0(0Ѝ 00p0_ _ O-M 00 S` P@$ 0,  +!/ "b0"b!\ 2J#"  , a p Bt{0Sl+p "?"pWpp'pW00̇#1? @?Z R<0"# aᩀpAjpR?c# ?o `V``&`V00̆ 1>0!/Z0S XϠl a^ZQ `S{ʟ  VP@@%y .X )  W.y 5:IP % ^, Ό3# qdO0 QS@@yWEVPP `@E`E`ȟ(ȟШ K,(aoZ.h 11:hh@h$ ^, pΌ3# d S 0 @W `P(H@ 1S\` VPE 0'!:60 0 $0Ϡ! ' >0!!!0C 0Q d?##. 0Ϡ 0,όក(~C1  ቂᢍ  ǟ 0 Q0 pƟ ' ^, Όp3p#p q\ ` V PE   Uʬ&0 0cPS;Q$0(080` Pp@`PL40#XTu YW W0d#Qp? 00?0S 8@<W 80<8p< 0 5/PS `0Z\ Q@X Q<T Q8P Q4L Q0 p0`S P Q% Q!S, Rfl0Sc pW 0 S J1F P,Pex`0S  BrI00Ѝ#XTxt[ @<8@8 <0RxSR SR W@ 0wYW? pW<8ph` 0W#@ 0_ER$(0<;0Q$00(0;0050S<  80< $0(80 cQ< 00 4$ #3@`TFJ#M @A 0S2 0NpsŸ !" 0<0  0 S 0 P00_҃00<0 S" 01P0 U 0< UP9}p1 !"3p ~0U 0  R!yh&0P l6m&N@pR PB$ 0<02&D @  0|hhNO-0@<SP|M0@S >S 0S >S`@0FS|ЍS*S0S -S0 C R`@0FSHpP [ 0S10ƒ!0 hh "0~Z OX10\1001Z <Z"0 S0S >S@p 0H0N<)`h0hlpt ~*ZZ -Z00J S@0JS0  S ,S;SQHAL f ;S,Se SvH^(- Q 019mPhip@019mo\@ pKpPhiRp@L 9 bp&kg.htlw@ 0 0N\hP:~00 @3~ @ P 1 00Q1 0AP00pP 0,Sd0(0fP 0S  H LɅ bh& `p&g.tl6 w6p,`0 `p촟섟$$cR0#03 1d002c2c# b?0cZY  [  R  `pK T4T$ cR*H$LP 0 S /Gp`0,` 480䃟 0,p0`4cP0#031d002c2c3`?0cPpcs V P  P0T3@;#cP*D3@3,p01c000` S048 0ՙ0#0p 4`<@ @`pD ,8@Z"28#!BcRf:"cR0#03D 1d002c2c3ZTV @R  *hŸ Ytc, Q  \Gce Q!Q*R/ ! !c 0p?0  c@R`(0X$ $ ( 1  1Z Z Y,0p4`8<@@  f>0gΌ ,0p4`8<@t0 HR0C°1yp,`0 0~;  ף)\(\{9 3P8 A-PQ@D 0S! pN,00 01h6l6h`O`P 0:S ]P `VpFPW N hw0PPT`V_pHPNLg@P`EmPpV`P 5 xA-A`P@pM vPPPWkxPqpATS  P;UD |QL l1l!0 t0000`0V m``@ vC P =D0C0CS\@0d/@D  2@DPt00#  1PWPࣹ Q0IUh,hP@P0P P0p0 000X$3 e `lv S2 c 0@-!@ 0 0!R !Xc \ ! L3/L2S @00P2S T/0#03T0#S0 P0P@T@@P20CP2nP2SU PU Ѝ\00P2S `@T 0400P2Spd@4P A-`0P0Q0\\ MS@P1 V9 T@p`0 80xq|q8OQT@D @@`@p8P1TA`NPP]0@ 0 0 1 30ލp0p pP0 vVT0T TQ0 v xT 0  ( $dh 4d>@ d-(0( 00M 00Ѝ`  --8M$ 00  0 0 0wЍЍ/ 0--M0 iЍЍ/p@-0 0@PXk`00CS`0p S u P `X0 X PXkpXs`uꤡ \0\ 0 `00CS`0ppSr P X0X /XT --00 M (0 X' ЍЍ/ᐠ --4 M0( 0 X/Ѝ Ѝ/D G-@SpP^ 0S:X( (S Y" WH k0` V V,* Cv0p0J00PQ`3wT 0 @00 `pp`0P/0`Vp C000 j v0 0SJ 0 00j0 Q0 t0 =0 tIqPX0X X0 t0 0Cj Izq8+ _ __ _--M  yЍ Ѝ/ -- M0 0 ЍЍ/@-aPP`@M8  c/pP& n@P#  K0P S 0p@ 0$  0, 0 (0 0 ЍEv0000@Ѝ 0kЍ808 8>0 ttx 4 ^ (^@-@P 2j 0#C@6j0 ;0 St ]p@-P`@o R T0U:T0T:p@>uR\@-p@-@QPJ 00!R ! 00! \ uP 0B RQ`' Q0AP R 0 U00SpgP#gP `gP0 \0\ \0 Ws 00B808 8<0 su 00d\ 8\ \A- R` P$@ R0 0,°0` 0  a0R00SH PA@\`2 0[1!pP  w0S< 0[1!pqP  w0S p w0SB 0[1!pS w0S, 0[1!pD[O[Mw0S 0[1!p3 P>   w0S pT 0[1!p@@PZ@P"Z P PP 00B S01 00B 0B P$R w0S p% [1 0!p0 *R# 0B Q@ 00B SP i  w0S  qp q  w0S `p  ;  w0SV 0[1!pw0S Cp  0[1!pwX0S 0[1!pw0S 0[1!p}wM0S 0[1!ppw0S  pw/0S 0[1!pWw0S 0[1!pJ pu pn pgs R  0p 0Z  [@ 1, pJ pC  w0S p6  0[1!p  w0S 0[1!p I w0S p J w0S 0[1!p npD gpp T + [p$ Tp MpI Fp)_ w0S 0[1!p] w0S 0[1!p , wt0S p 0[1!pnE w0S p$R_0@' p7 w10S py  0[1!p?w0Sj 0[1!p2w0S pXw[0S pL@ w>0S p?  0[1!p  w 0S p*  0[1!p p P R pC {p tpD mp P 1 0B Q^@ 0B 0B P$R8 w" R 0Kp0 [1@ P  P  P  P  P  P  P  P q0 S p  0[1@!r P $R@00 P  P  P } Pz x Pu s Pp n Pk i Pf d Pa _ P\ Z PW U PR P PM K PH F PC }A P> x< P9 s7 P4 n2 P/ i-, v  P( b& P# ]!w0S p  0[1!p P E  P @ P ; P 6 P 1O-@ϟM M0Pƍ0TH P@ H0S 0T00!R !0010h00 Q 0SN   RT p H 0  0 L (/찍 4 K/@(嘰d 00080l0`0$00@T& `%T @T0PFU$0pJ!(0PQPw00$pT  0 @P `~0-1,0`4 0EZS00 P&bP   R00s H0S P`p>+h1RRhOJh>TQ.`Cnˠ0MPQPDH T,TdD@|8HLI`P$`aP`$`0@ 0@004p00EPqp00E S$UF ,pS2 U zUP 7`0P00(00{0$080S 8D0匠0@0S$00$00ZZ 6,< 0 6 30n$܍ЍUX +;   0m>U`X QP @n~@\X<D-$0\, Q00S@00儰0AXP\ 0,0\K0~@DT#L^0`P0Q ,pAW%S@0$000(000@T0St _paU` P X0 D -1 00 S0 00 SP0100 P000p0 `P 0BL00?V0X r -!S 80S 0P80 0p0S-0~00s<0 P00(S0  Y0P 00M(0S0  pY0P 00<~0S{ 0~Q00t YY0P&( - t QS t IY0P(  t T800NS `U~&o`0 @P0\@X@<@D0S<0SP 0PS@@Z(x_`P(pP@FJZ   0RP0 S Y0P00JZ0  0\0 = 0  SP00 P0Ϡ 0S-0q~0 0@S࠳  　@r R  00P1s 0P0\X\ ̎@X  D@@h  %LQ0#"002(c`38 TD0P 00 S  P000 P000p 0 T0P 00 i0-10l0XDpdP0pPE-S 1,0P`-p x0D RPPS 00C? 0@4S(0?0<0@8`\0X0/GP000 P0ot@dTR堀P(PpH@DT$   0RP0 S  8T0P00 0S  (T0P 00 ,0\@0l@^d? PPb T0p@4  $0@00P0PP00,P 0p0P P0 00~RP0 !0倀P000 0P P0P00P0hEP0 00~RP0 S0  S0P 00(0f$4 0 Xa00CL0/ 00(;?@P@P00ppP00P0 R ~P0!P0 R ~P0P0 R~pP0@TP0PP0bJl(l8l 8 0r`+P0PpP0P0 R~pP0@A 　S(@0(8  0N` B0?V0L @ SP00P0$00 00H 0p 0SP0 , P0P0 R~P0@ #P0 R~pP0@P0 R~ ϠP0qP0 R~P0@#P00ppP00W @P0 R~pP0@P0PpP0kgP0 R~ ϠP0Bc8 :P0PϠP0 @X< R0P( @ < P 0@000S0 P0pO0\0X0P`00E SOpqp00A S$Q0#S/ 1 0P`5 J SP00P0$00 0a 0 0$ 0H 0`p;S0P0`1 ` 000 P0 0H 0Ip% 0SP0  P0 0pxpꑑ@-@`P MDpU@0p0 00t0@U ЍG A-@P`pT0 ^0@TO--@/ pj0@30P     O{(j2):0!**R7 0P000$0110@00S@(@P  p0 0[0S0SS I00S Y Y R R0P0 4[4 0090 0pG04a^ pn0G040S  @(@9U Z$01P00P0 0009 0 00400A-@P`jZUTp 0S*P @[Zp@@TZp$S MZT@pIZ@:L #*460/Q /*460/P@-@00 R@P@Rp@-P`0@0R@*0Pp@ R 0 R Vp@ 0@!%O-0@ MSX@DPa`101 0|TYq`":0 6  R0 R0 W *00S 00CX:X@D* R @  P  00S 0S W0*!1R 0CX:X@D* R @` Ѝ-0UM 0,@P.0L10Xk{ k{d 0 @      SYCY( Ш@-@-@-p@-`P@ TP P0F R V@P  DX00pP P(0( (?0 .WP\p@-@P R`2PP   Xp0 :0 W0<-M Ѝp@-@ P` !LN7T !@Ap- Mx ЍP/D -0")2b3c1@2`M1 |ЍC0@-@PPM {  0{ Pp`Ѝ0(0( (;0 V  Ȧ p@-0@Q r P p0 S P1 ph PP   ! W @0O-`MpD,@0D0QP0+5X! @0S Sj @ 0 1 bP  P T@@  0  WT`p ЍW Qz@0 Q AX0P @0   P 0`00QB@`VRTQ`p0 0"!` b  V0 XT@P@0Q=W 0000! @TQ- 0P0@20d  000W" 0 @000 @M 0Se0T0 2aPPlv"! 0#000 @ 0 l`@Pr 0Q/ R  B / 0RA-@P'`Bp1W@* R0C@C   ,VV X@@pp0 `f360@p1W@:b 8 PPO- -4M@0  P0l0x0 0&P t0p-P 000P0 0 00@ S040x ` 0@t`00@ SVV!Ђ0 @ 0SЍ 0S0 EP 0l0 00S $`,(@S] ?o280$0Q0$0吊g{V VGڐ*5 f01k5UV(0 S (0SH( %0fSt(0| FY 0 S (%Y 1  @ pwPxK |0p0LY|0 9 |0pP0|0 A R< Q0 uCY x YpOyk0p000400 S|  <00S00<00 00 $003 (0,@S A,8$PQ۟䫟˟滟P?@0 0HPL0X@H@A 0P0  L ! _Ux05 P x   !SUp@|2 0PDp0 W,0@0$ 0 @p`C0D,p@`@Q0C @D@`@T00S0S@D`FpG,0SDQN(0SVW 0P0 5 `P 0S0S @  @ PpPppW/ 80  R P" ZO<00 S0l0 $@x T0 @DTQ [ Z0MNpT0 0p$ 0#[00S|0D0I hd @PY dQqsWx  ! x PxH 0Sg p UbD0p |0Z0 0C?o20S )K{8Ik{^Zɋc 0S     &?@V瞯<? ?N00XS ptp0P P0 0<x Qt000Sl00l0R  x lЍ ,$t0t00+S -S( 0C ^0Stt00S 1C\@Z $ R3iS+ $IS( NS,dt`? P% 0l00 00t00(S7 000x P PB \ ,$ EQ0 0,0x tl0)2S "4{LL*"* /B B*  *0CS'ʐ: # 0:II0H   {0  0tV0r0St00S n1CQ 0ESJ 0 Bt@qH  i  d3Y01{ @ )2S#{弣*"* /B B*  *0CS'ʐ:# 0:II0H 7 {0 ; PK [000t0PP p.000(00t00@ `t00C ^^t,t00C ^^0 ,S0,0 V`∀V!Ђ PP`VV! 0Ct00C [ft00N0C [L\Zڸ@(Q@a@nS  x Px p0 0p0ks& 6@08  ,  B1kl00{0 G GjPw|0 00*$&%&*&! IH I `yP  PZ1 0IPT0 uPxG  B\ 0S> p $0 0R0p 0 0P01  P-  q` 0P0t"@ 0P0kxR Px <0| 0C B<0|  x=0P 0ꨋ{ ZNj Z{相80吪SI8" 80S0T00T0␪相T000cT0Pya @P B\\<00 Sp  Bp 0{k{I{7{l0T$P0X@l0 0S |0 0WUSHQO |0R! 00SB S< SR xA0x00 l0000 "aQ!*Q00  0c230 0x S 40S/l0Q000l0y @0l0R"00r @Bx Pxi |0p0C|0EX A??N(0 00 l0x0 R"000 000S0 EP Ru 9!0(l0 0IpT00(0<0080q\ pWW000 0tx0Pl 0x S 0t0,0a$`8(0@0|x<0| 0 <0|  U $PX@ppEW. xr! Px |00C|0$Z{相80吪SI8 80pS 0T0 {Nj0l0 0@,0AS$`( `300c8040 080H 0l000 P6 $@T p@DP-$PX@x <0pP0C|0{Pxt`P t0$0Ct0Pt0 0t00000x l0} !\ \ \ \Q&tp`0C0,0㈀ 0ES0$0,q0x000 0P 0l Q"0x 0J<^@0HPT0 0H PpT0P `t 0 `, $ P:S4( 0P:|6|0 0`$%0 85S(0Á!{'l 0 H P 0 `$,`$Y 508  f{({' A1kl00{'0 _$PX@0 B0T0 08pT0{|0 050`R!00$PX@l00P00l00,Z$PX@h 0S~ xp0   ~\0v !00 00C lp |0Z$PX@^!0[l0 00 p<0SpW`P| P pAk 0 00lx j0S0S 0$PX@x 00000|0P0l0*$&%&*4<(! IH I9[! 7 0l  # U  RIx t Z[ 0l0k $PX@ 3 S 0l00_ Px  pp1JpgpPp00p0!0l0I<00 lS |00CxpP|0b!0l0x0 R70S4004010l0|00CxpP|0Pxl0,0 @-00ЅG-` 0Q`@PH PpPa0s z #8 *8"80 V# F0V B 3E  ^ pG0s#8)80ᴐ^#Y 0U 0 Q 0PP   ! N @P@O-3ß0 M00@Sp 21``C000 0S  0S  S0SB00XS 0Q P@  Q RWU\Q\WI:Q0 X \ 50QR j T0#03\0SWf*0 GV*0F@S3 F B S   3%N0WR 06S PW*@DPD@ Q0B Q0Q l  l>U00XS Q0X j00Q )Q  0Ѝ{;^0  n2>000 )AoR㩒Y 0u Q=0>0l1 c, 0# Q:i0 O-M<0p gHJH:@`00S 000S 0@0S DA R[ % PD  \  P 0PS8 ZPP@Ѝ P0Q[V R 0 BPS10W ^P0E0CSڣ0SnP [ ;HU 0  UE\ PN Q UP   U 0CC10B/P0DS0 SE@TS@DTDX`  `R ߰ BP[10P0+S -S0P: P80 0@B\ P~sPP0 PBU0L[0lZD^ PdP [ 0 S S80S 000 0 b@0N"00IZP0D^0[ @S0 QL 0S@00S P3 4^E *@C #`P `D21 2 Q\` S00 00S@0T@DUQV`Db  218 PE 7 @0T0 T1 T@00@0PS  Z @D@ R, 0 R Q 00PS00= 0P0@E EP 0 C0 RZ@Rh@DU 0S{ S SUUv EPq ZMP@"00ЍSn Sh S4 `Pb@00@0 00V@ !KT 0 PeS5 0 0@0saF PeP\  0 S S FM@"00Ѝ@?0PS- P l@0 Ѝ80S@V 0S S S@80S000L080S80S  0h800c8080S `T0D  RP!@H0@0  B0 QP[ 0Q SP߰ P[A1P0[80S@[- Z0`, D^  000P0E80S 0  BR "@w0P03880S P `Z ^  0`p 1P50PSP P   /A-@> RP`pn3 ^P 0 W@0 p0U0`PEPV 0 BP @` pT  0 BPp0U`98@-- M` p@KU0  B00C2S*ސ* Q6cZKE A Ѝ@-@0AC^ 0S R@-@A0B@SA *@QAAT D B @ qJ0"S1 1  !2R / 3RS/0 |0|0 c Ra X0X0 c RA 4040 c R/᬴ClCh@CA-@T0000bQ1 !0U2. n" p(  U2.0D10C#0R!0 0U U0D1 0CC!S R 0 @-P@M: Q @ 0 R Q @ЍA-(a(1`pP0MS3 U10AT !0S 000 @T  0S0 00Ѝ  @00D1S@0000S 000巴 t|BHl 0p@-@P0p R pPQ`00App@D `ᘴ80 0QApp@茴 t0AH@0  +0#10/sQ#8sQ#4  00/sQ #2#01  //30A-`p@P p1,0@U00p 0Sp1P@P$pP   ! CIl`hP0301#S412ss /"r3J / R//@-@P0@0O-0Z  @ S MpP; PaU* F B  H  ^ !*0I0C X00 ZP`V 060Y00ZP`T@T 06S @ ЍG-聟0PpS%Q@Y A@iV'10SQ`P] 00001010i0S p1t @P4 P1 p@T `P@T10SfP@$ 000S 0J0E@T 0C  pP@h02iV0S <0' ,0R0i l <tq<H8j0;G-`0b@TP塢ڃ0TP$ Zp  G p0   a!  \2)R0L`0C\0030 `.pG \ `$-0P!1^$23\ *G-0@`@DTP  !1QF*32\ H*@@P`P @P @pq0 0S 0S W 0G`WL3 ``PQ@ H 00P0S 3 # Q0 A B  02NS cP 0!0P` A-P@Q`pE: 0` P0T @ *\ l10E T56 501 P56 +C0T `6<#511<?@--` M@P@P : #z:S W 0  C.G B 50c 0 Ѝ v0P c2# RW C>C0C01` Ѝ0S0/0 R /@-`ap`@PMA H1P4PP2 pP,0S  Q5 p 0: S.@P 0uPP0@ 0$  0,  0( 0 0ЍG00Ѝ\PT0T TE0 EG00GO00\ 4[xd}p@-@P X;00CS00 PV;pP0 =0 oE`c@@-@P 00CS00 @ 0  I0 REHc_Уp@-@PPD 0rS= wS+ aS3`0S  +S" e0Cs\S0 0S``p0S0S0S`0`SG 0 p` 0 >0 Dbbp@-@P8 0S> : P00P! !' 0S 3/PP೼000P @ P ;00 00`400aa:d0`` 0p&)8P404 480 DF 0P0]`@-@P 00!R !+P 0C 0 ;0 D\t`8@-@P 0 0 S @70 ;0 xD$\`p@-Q@PPR 100S4 0 XV 5000S: 0#$0 3/0P:s007p00P @ P 00< R 800pI>0PᒰIJ፰7P00s08l l0l J0 D  0@000 p F 0 @00X t^Zd-Ѝ/@-^@S S S  `0@  D0@ eE 0  0@ 6@00 00 0000/<P@- 0At @E41S O- P`c`EM  A 4/p17/9? !0(l (|  p;o7@p:/ `;o$ 7:/(p,$`;o0(, 7:/4p80`;o<48 7:/<`@D L;HL@̀FGpE`JK t (`DI | HpŐp$ ǰĐp@`Xư`0`pA/`pd APpMOĀmX@Q 0pkPSQ 0p}kPHQ 0pskP> Q 0pikP4Q 0p_kP*Q 0pUkP Q 0pKkP@Q 0p@kP YEߍDOD,Eߍ/ԝaQ@-P @41S  P  P0DA-4!@ pPP/1S 0L1  @P!PPPUQPMoP PQp <W Dp_oR{DpxDpp@-@P 0@ϱ@A-@`㏰P] VapPႰPQ V 0E( Q Q Q Q Q Q'  Ǡ    Ǡ   V Ǡ Ǡ Ǡ  V D0@BC@SSO-P M1 Sw$aVp$(q SSp A`TO X`A ( Pʀ ರ[ `(q^ 0P@  Ѝ Co$B/0S (xp Ჰ[ Q @pT`xP0TC G(VK ( 1$! AT$$(0 [ `(0 A^& S :0  @PuC@@,A \$R(!r8 V(, T001000 ZA([$<((~ Q ذ0 0 @A $A !`($aW夰0 /A0(S 0 RqP_ D0^0x$USؔXSHjhj SO-,M0 0 S ! rp2/0, (Q0 Py @`P@P\&$P 0  CZC 0@PUpWW 0 `PQ 0@SPPU2J[Ipp,Ѝ 0 oPPu2  $`oP$`  0 `P% 0@SP㲀0C  P\ \1 \"  gP  0 jP@0`00,Ѝ 0 jP0 0 †Ằ[ PಐU I  kgP(A0DS V(Qp  0poP 0 @-@ ! \ @$.B,(B00,1S@-@0@ B00,1R@-@1  @0B,B ,!O-`ᰙ0S ]M= pPw@P Uq  @| AP 0 hp3 < pɟ00 8p4  Dz@@ v@ PXP V P0pS40X W!3^ TH ^^@43<P3h uD H 0$ phP 02 KA<,0(@ H QPV\^ XP  0p pt 0} V( 0S% A/ 1++< *0)4 p)<(0<( '4 '<.0<. ,4 ,<0 4< < 0 4< $0 #<$* <($0 4< (, 4< ,0 4< 04 4< 804#<8 <80< 4<< < <080  80    0   8|  4p p ̇$  x $ (p < ,Ġ( 0$8 ,  p0̇(,044 4x 8 8<0 @ 4<|8*8p | *̇ <0@)t )  p' pK0  | 嶀S(tpN ) ) x 岰+, t, SZ,CC r AZ2X pG^Բ  9/@P OPᓭ/@P]ߍ|Ÿ 0( P p1DN90  !NVq Q+U0 aPP$4Q$ Pc @Aq!弡Q0 0 ` 0! `]ߍ? ?Qt? R2 < p 800p4  Dt>@ p>? Z ڪ??@Pq?Pn?P?Pd0a?p?p]h Xa`DO-(P`P10p5fS@(Pp5 Rؑ嘫P- (4 ,0[ D D S 1"1 Ohꂡ \P ر !% J= ᢬ؑ@-@ 13/, (Q0@-@Q .00 2? 0 O-fMS` $ [pW 00PЍ p 6 &0P 0@P 0Q10$12PP. 5@X0 20S00500500|50 0t50 0l500d500\5000 S S >00P p R 20 2  00p 0 0gWp W|3Wx# 2[ 00 20120qSG  000 1S 09 G9 @Rr*X w?w?Á Ñ 0 -P0 "  x-P 1S0S1S -0 29 20 29 20S 28 2CPU00S #P+C PwP   R < "4 " 8 p0< S0'4$<'<(0.4<.,,4<(, 4( 80<0480 < 0480<$0 4,8 0 <+$,(0 4+,80 < ,0P0SM p "0!0 ' &@P8 Vi V1 Ve (0aV@ 'TA  v&@P 10CS`*0Fs @崒 0S 0S 0A@T @崒(0QaVU @b,  1& E&@P 0VSa V0F &@ & & @ ⴒ[ @Iy洒 U(01ḑ0CS㣠y'*z0YV+ ` &V &@P 긑0(0 @崒 /`FvVv @: 0 b4 @2"b0 4 @崒, 1g& %@P 1ᴐV0CSy`!*v0Ya V0F1ᴐቐ  10@! C& %@P] ` ` ?1!b0 x40Cs 0 0 0Fs+0!10@崐 & %@P0 10CS`:t0t tb0 K4\0\ \b0 B4P'ggd&Tf$%dfb!ba| a`a``p@-@`PP 0 00(0`00Q(0pO-,@(ƟP LMQDp` %00 2^V  600%5 0 D0 30cLЍ0w R*R* ^p 0$00 <000S0 P8080 0Vk 1S6 $P䑄/  0尡0 0!00 BR{?ⰰ0弰:1S 0[S P 0 ᰰ0000S !L% n P 0崐V` S0! 1 BR,*0  P 20 2r(k i0w Qx $`P_ 0 p %R0CS㣰*{0Y* C00C 1! 0Cs0 ! 11 0  0(0  0RK 1S RQ  RYF  $ 20 2JZ㪠o*zJ [i PcM0V㰐0`0 2 i Sf $ ap 0,00 4000S0(p0000(01 S0"1!{/010CSP *u00C S {?尐!0 b0 2a0y漐ᰐ0`0400\0\ \b0 2D0D Db0 2/ | ZdZ0Z @Z ZZO-(0pM I @aP0`f0PP P FPD1uP0y1JZqa@0 R 0 1Q@@10CS㣰N* 0Ks0S0Cs00 VqS10C1(0  0R/ Ѝ@ Q! R b0 `(0p+ 0  PS  p 0 0 p1 S0C1ȁ,3,#,b0 1T> Y3 0I 1pP(00(0U QPEUP*0EY*0 p1Pu YQEQPEUP*uP0EY Vp崑 (00(0B10CS0I*S ```@0 `p崑P Q "PP @ PArP^(00 (0C#0!0!0 "PPm 1P0CS㣠=*0J 1RP(00  $#0 b0 d10 1p:P(00(00 0b O1u00C SpQPEUP:x0x xb0 >1u`0` `b0 51 "kWW\UDlU UUTTTTp@-@PQQp ?"P 0 0"Q 2"P 0 0"ppO-P,a V0Fj  1"@P! `Vp0ഀ0 0 pq 10CS0s0*S0SU POP 1!b0 0  H 1zp0FV㴠q1p 0 R 0 1Spp10CS㣰4*0Ks0S  Cr 0 S00s060W10C1 >" R `P  0! 0 P%" "(0( (b0 _0RRHQ0XQO-Pp@Q$M "00 2T T E200$Ѝ(  @h 007嘷嘧0 0  `P]  R [t@Y* P 0PeA 2@D @dT㴐: 0 bt@0Y:Aᴐ@DT@* 0t@ @DOoS0CB0  0jp= 0S0C@0  P 10CS0P*s0SUP@  pP 10CS0*s0SG 1 :1@0CS0*s0S#P e!k `!fTy*t@T~P\ 20 2$Ѝ050%0b0 /T A!5%b0 / 4!T` ,!0 0L P+  0SH @`tl S: `V  !q, W@ t@@DXL  q Ws 0G 1g P AᴀW@DT@:b0 -/3#b0 $/   D pPRPp 838#80b /03#b0 .8@W1 @t@ @01p 1 0@1@p01   P@ Iy0  P 0 o@T ({ T"000{` m  Pm ,` 0R X Y qV@D R q0V" @0G 1PL WR  B1r T 崠0@D1 %!0I@Dst0p崠1 加1 0p # P$ 10CS㣐:0 b0 Y.  }P PPh N NM MLM, LM\LD lLK KK K0I@I@-@PM 0 0P Ѝ0 50 .8HO-ŸJM M@Pč`pPg VW00?2$0S 0SNIPIT/ P /00P"D2 0 4 30Jލ Ѝ$ > 0X0 0UXS 00; Iw0. T:+[) P0K/S  0寴0P00: S /000S0I S/?00(1(!(?0 -QP PV# 4- 1p!/0SY  \0 RK Y cPv/00W hp xgP d/@om GH H8F$R Q0P:Q0Q:L.@-@-@@" $ @ - p@-@8P5#)P/$ p@t- 0@-@T M 000 @P 0S  Ѝp, 0O-TM Pp`0H0 @D8  $(4PD 0,0`< @@pLp PP  좟쒟肟 `p  @$ "dXb`%0#  `!,l(a `& `zcna'b(*abf` +l(ldH)c: fj.`d\l` %pଊ眉a*pl&`ah猈b,)` &`dL(bdl+`|.plXp`<%cjgpl& ```ga*aldH(d` &b()`b`j+g .pl\c:%pWpl̠m  tm 3T3A-@P` Aq08q0P00P 0p0S   L| PS00  000 0 S$1  @p  P 00  xP 0 0 0ZO-رK[@pu*{0 80 Pa{`FP 0` 0 VH*vP P  C{沱ᶱ PaP`F ` VB*vP P00 000 0 OVv`:*V 0 rPP:Vv` *V 0 0sPP:1 0 b 0' 0 0b '1 0 b 0'h h0h b 0'L0L LL0 'H/\/(/4/./|..(0L80O-,M01P0CSPᰐ0*10C 1R0 0r0 0*0S) @p`4 00 04 00$PY P P0ES00 01P0P0PYi00CV 0@p P7`Uv`d* 0Pu@S0SZ 000pVwp:@@T$P*t@1@A(0  0R 1 S0"s0&1!V 0 0C01ő YP0P 0Ӂ 0C00V*S 0P0@Pr V @Bt@Q 01Y00!00Se*00CVa YPU:T2T 0&01 P0P P P q01P0 P0P gTP   r` @p0v`@Vt@@TH*t0 Y !0s00 s01,Ѝ   r   rpGwp@@T$PK: 0  0&A0 0  0w& 0 b 0m&t t0t  0c&`@pXxx(+,)d+T`)4+,|)))*C-Mp`@P%  PP 0!0 000 0`r 0@@!! 0 040000 00v@PЍЍO-M@ p8PPN 01 0 0 0رR 0ⲱ 0 1ᰰ0CS`G*v0[: ر `PH 01 00 00Q00岱000 P 0 0<0 00%!p&Vp)@PЍ"pЍ 0p!0@P4 404 b 0% X`&t&O-\M`0儀pS>D0@ P(0$  p@T X6*1#0Cs0 11 " r S 0K 0F 0@SD@ a,^p  l8 00`8,000F 1yPR `V 0`0 v`0CcS00 p㰑1 0CS*0S 00p"@ `V@ 00 0 00CS00 1!R p0p  0  00 0VS00 IY㩐*y扐1 0 0TPLH0PH2/  Wp 00 1p0 pp,0 0#S1 0Cs01 1   00000 0@00DpS, 0S 2  0 t  g ca0S @ R3@p00 ,w 0 S@Dp  E A =\Ѝ3@S00 01040封HX㨀*004 1xpC0wp0qqᰁpHX㨀*0x03@S00 01040封H⨀Xx*X 0 0 sP:400 H x0 岁ᴁqpGpWwp*W 0 0 sP:0 0]  IY㩐`*y0V* C``F  001`01lpL   @  e`V@Dp  0 00Q00 0 P 0 0 0각HX㨀p*x戀1040F각HX㨀[*x戀1040`!1 b 0# 2  03 d?W@ Z 0 0t!t1t b 0#+X!X1X b 0#7  ;1!b0 !0@K{0' 1 0p1p@01 P01 @Dt@ @U0PE10Z!0s00 !(\,l< LdL\R0</ B$0A00 0P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/000/ @-@P L  0 0@ ( " 0"$O-@T2M0\0(P 00$` p @ ` pP03?0% 0g#"," ^0  0#0F &0eA$  "eK$  0 h10\00` pP 0 1 cIC$A$ 00#l!!00%b !b  A@YIH$*E$00@0 @000000 00 0 0 00 000 000 00Ѝ 0G-1?p@P` @g(XS ! 0@0 0$0@`F0($0`Gp& ?V:@F?@( 0@  @T 0 , 0< 0$00T$0?`@p?V @?V@F?@ 0$ <@@ T 0$ ?@@@?`V (T! 0$ a0 0$ A-@PP! $ap:?`V7 ) `0(0 0`0$0d0W 03?R0Ah   08R(@R )@ b (`8  )8 b (`R @-I/ @-@-@P P Ό 0 0@ ( 0"TR @-"/ @-p@-@P X00m]\`  0 Pn 0$$pO-$6LM0^_~?800@( ,0  0 ( 48pH`D  ,$@ 00DA Bs QR cp >` S0T3 W  0p| px 0@`> p PPL1L!L?0 ?0p 0>00D,00XS W#0p 0 000XS W pp p 0A0C0B QSWpP pe0p 0> 0W 0@ p p0@ p 4333333@ds|00 0M0ЍH 0@-PPM @0  JP 8 ,0 0 0 30Ѝ0^8  D0 S4 0 /@-h Pq0 S 0,/00@-qH0 S8 0 / 00@- p0 S 0,/00@-dpH0 S8 0  / 00(@-p$ p0 S 0, /000@-\oH0 S8 0 / 00<@-G lo0 S 0,/00D@-3oH0 S8 0 / 00P@- n0 S 0,/00X@- xnH0 S8 0 / 00d@-8 $n0 S 0,/00l@-mH0 S8 0 / 00x@- m0 S 0,/00@-0mH0 S8 0  / 00@- l0 S 0, /00@-lH0 S8 0 / 00@-zL 8l0 S 0, /00@-fkH0 S8 0 @/ 00@-Q k0 S 0,@/00@-=DkH0 S8 0 / 00@-( j0 S 0,/00@-jH0 S8 0  / 00@-` Lj0 S 0, /00@-iD0 S4 0 / 00@- i0 S 0,/00@-`iD0 S4 0 / 00B@- $i0 S 0,/00@-h @/ /H-M 0ЍA-`@pP@8#pW0PpP@-M/"O R ?#0!PO$P P!Ѝ  0S RP/0?c0 3??oP/p@- MP 0 0000`@`0@PP  7P< (0 0 0 30 Ѝp觬T  A-QPp@` S V '"RSQ P_ 0Cj ?o/o0CS 00cÎ10VS& /o?o BR Z 0b0Î01pϠT\ ^ R0V0 BV  T$ 0d0?oc008/ooAq!  R! b0r8·V pV000e0?o0c80@b>08Qm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ / 0@-@P  000 / RC/A 0\R#R! R/ 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/ 0 ///Q R Q/U/Q0 R Q/00/Q- S 0S  P0 000S00@-Q @% TS 0 C0 P @D^TPPU0N QP Q  00S @R S Q0 S 00 /0 0/U/S 0 0R0Q0 /0 U0/Q@-# S% @P0C S@  PQP @ ^  0@@U0@ @-Q@ S^ QNP  S^ PU@Q @0SQ RU // Q#/  //s R PS 0 0/0 0/U/0 0/SR  Q 0/0 U0/0 0/0/R  -/p@-@RP` R V  U  R 0 p0 0 t]|bQRp@-`P@ 0S0 0 0R0  0p 0   0aDR S 0Q00S0 0/0 0/0 // Q#/Q- S# PQ P P0C S00UPP-Q S0S P 0000S0@-M | @00ee00_ a4 ,0 0 0 30ЍҨ - BMMRč `` T @P   P㍅N2  @ ԟDȟx0@- @-xxŸtr M Mp$ȍP|`@M TF 88" ` (R(" @$@ P0 t!1 0 $8 30jލ ЍBn!`0 @p [ 60 xB^P.`!0 tqL100@A@  ,0 2 P0 \ AL+\ \^  \\\\\1 { C {  P^2Hz ~ T]y 0 K0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A0@-0M 0 0000@>S@P  !0#00  9P0ЍL00!0 @-0M 0 000@>S@ "0!,03,0  P0Ѝ)00@-@I@I0 00/ -$0$0 0M 0>Ѝ -- M0 0 ЍЍ/4 40 00S 0M00Ѝ/ t@-@p@-0@ ,p)pPb0Pp//////r //1O-0pPW`,M 02 00000"00  ( 05/,Ѝ@PM 0S XXX S0 S0S3*0! 00S S( S000S  0S S * RpC 0QW 002 00 0 0 00t0t t0 P0X0X X0 F독@P!$!   @ <U ԔU///O-̟ M00P0Q0S Y [00x< 0 0 0h<00$00%SSppSJ 0 ,p 0HZS00 X 7  0`P, 0,@0 R000  Q 0S00 [0ʄPU*0S [0Ԅ0ʄ`V* 00CS0C [ ʄ0S*00H00H S @  Y 0\0sR^{- S @# %%:P b`(a B0S`tl!h>0dU00`0d?* 000D@D0P0 `prpo@pl 0  `, P ,@0q *XK 00H S V ! 00H S /L|HP @T R 0P  0CR P0bP 0`BC p-x $0pRPRP` p@ 0  0P00Q0< Z"* 00[ʅ Q 00CS0C0 [ʄ0S* 0F ?   0lX pp|  0000Rp&\{0S P`@0  0P00Q0 Z0504p x< 00Ry @0000d0SP0LS0B 0? T0SPA`B 0 Se  0000 +00ipf0S 00`{] <~ 0+ ) R ǣp @#2>!d00 a< 0c  0R000000S# P    pFP`  @ 00CS0C0S*0S/ Z  04,4, (0u 00CS0C  [ʄ0S*0S[ [0S000SS0S j  0000w 00CS0C8` P @ 0 Z0J0 #2 0 0 30Ѝ     000D0@A0 |3 0   [000z 00 S|*.P C,  B0@~0  0@ s0 0!@ s0pp-\A@0p000i0@s0~!1  0! 0  0*@(   ' !0 0/ p!T0 0 DpX꘢@ |UlUlT̐N(` KuILOIpA-@P@ `t0pP@PU J0S 8/`PEuX@pW$0$ $:0  xhH 0SS S  0R @- o/ 0R0@o/O-$$@CM Mp4čP`0@  0 @0 44 30*Cލ Ѝ 0p `0pP jt0t  0p⊄L+  [g 0Vg/ (|=G-0pS+ S'QU$ X!`@0S  0 0#S0S 0S0S0S(  ~P# `VP@ Q@0 R!R  "R0 R R QO- BM 紀ḏxMXčH1 0!p P` X' 0  pR\P@P U]]0 ZPs8PH <0 0 4 30BލЍP\  O-LLAM P MU@čO2 0Y-:0px0(S`4 0t@?s0T!T/ 0 0PU \\  0 P @T t   0[PP D0 0 4 30Aލ Ѝ0x0(S4 , O-M Mtϟ0 p  [ !R & R! ` 0  0 ?8@X@0 90p t  0 H  . R< R30` တuP @R FP p ᰐ5P R!RC1P `XP00S 0 0 0[ Pp@uopp0S 0PS 00 9 S 0S$< d d-  L X- T p P Ra0@0040v?D0\84 0` S1S @ 300S S00X01@ 021帡ZU0H0tSp0<0400SlATi @0CPh D0PPPyf 0;S<@  lP} `@^0PYP , 4 @0 4 D 0 D @0R\80S  H0SQ :<00 p  R  H *P{t`pP|@600P @:/P |+: 0 6 30Oݍ ЍY 4@PD0Py !}D0P0 w  0 ; X0\ D04000SR0X0S@0`S\0c  好`@V  0p`G0?`50$0 P /0(`,0/ 00 ,   F >|PP1 UC(0 0R0O `1  0 90 X0L80Z   80m080F$0 0 0 SP@0b0!0l刐?A9c!|P g0S c@a0P gȟ00( @ |  ,80P80D Q"  (<  0 0P bR`1  0 70TX0 800 00  1 01 080<`0  @{P'  0 Pg`1 q 0 70X0 80_0 M 00 X\6Pa0&0@ 8 XV1a 00 0V$00I@0 ] 0T(0P0 `@vQP  Š20[000Q` ]0 0 v(0 01$000Pv 0 \5@X0 0HP80* 0{P0D u@s0P fğ00d$ @` ⎀0 3 (0d0080fğ00$ @  w0S0(0ʡ@0+S .0CS98P60 @v0@  *@(0Pj#P AQPRm `1S 0    R 0H080{|P8R4`!!! Q0   30 @| X0Q 0H R/ - qW *`\RP|@0p t@7/P `V q0 T2@X0 0`!02 @XUS0 \01S@ 3`0`00S S000`P1; n`0 |{P00 `;zP101@PDXhP p0< 00 y<00P{00P 㸠D5꼫 X؀> l}C0{PzyyHxwwvwV$0QV@0\!R p Âp QVp "@p O-@4;_M M0(+0 ; 0P050O0VU 0 X01)`,7 05p d!  d!. 0`1q1110YPP  @π0ʏ0z p d10 d1u P% `P IY`0DPS_H Y p\ S S00 PpP0S SR#3:0 0CQS0 0CQS000009RvP ~?080}o 0p+07P 1#S;S 0(S# 0(So 0(S> 0(S 0|(S p8 R00sS1 S S0@(  ,8 R1 S S0S00 S S SS@@ `0 X_A0P@00Q"0A'A+S? 7R1 S S00 R00S 0P0 S S00 ,@@0S S 50 p@ @@@@@00@00806uO 0P* 0GPd4P R`P 0d4P 0R@y[W@L0d!S 0 0 2d1p; Qo|F1 |Qqp @ όx0`0S W`0`SHPDHp .Sp0SWP`.pGWV0 0,P % 70 %004 0 5 30_ލ Ѝ4 Rq W W Zʰ$( 0$00,` `ጴ  V V` VV00;V0SJ`V H4 @0p ;V  00@`V  PP   hP 8 Q$h!P ``V;V #0 00@`V;V   DP 8 Zl`(,`| 3 R1 S S0Sq00 S S SS@@f `P mW _AOP@`0DPSH  \ S S00 QP0S R:0 SQ 0 SQ000004+}__P.P `W0!x3!|3p DPeDQ a`sQhX`- P 8 Qh!h!2/R1!RjP!>p>lx>?D!>0A-0PU" 0U"0PUP!q@@ ``FfTP  (^TP 0!E`1(,`P$02~PP'' O-Ff@0 MS`0 4 8 t& ( 0, \F\V@PR8 H601vW00g,1@06 B0R   50,@ 앟ş 1 c0@8' 0p,8 @ P 0,0 P| tup80Sg0S X 8 0SnX6S 8% 8 0S$up40S S 508 RU 8 0000040S4ğ0 , 4XA4*0210S P10q S^ X40, L40$0Sp 04041%40 ,< ,UjP0880^ 30, p ЍqR $0Q*# 043p084,P< p!@,%4%1Ru4#! 30@)!^ ^ ćrp$ S:p 0,"@ !0,0% P^8)20,  p20,@  \20,@  H20,@ 420,@ 20,4 20<  ,0쑟 0,0, 10, 꼑 ,0,10,0 R 00! 0x1x0 0 d10Rp ,8p ЍBp N=p 0y^4nqp2  Z 00K U|xa LH(, п;hLX\0Լt\8D7l76|O-01M0 X B* 1 a001Q0,0`P ^/?^_ +~0 0@S@ 00T 00}O R :R,000P R 0Y $00 ЍPpT`P4@-$0 0nkX .A-@@`V 0 CQPqQP pG #PQP 0`0ĸ|4@-@00 R \\  $0!0D0 0@ ($ Tķ@-@PL  0S  T0S@R}R@zRpP/0-` 00 0Q,000 P0($0 p@-@P0`D P 0(S  1T  0"00`plp@-`0PO@P POP 00p/H2 A- 0@S  P p00  ( $ 8PP(p`P0꼵L+O- ,0吻S 4Ms 0 x+x   / +~` P @<+00{p^/  [@P^_@@ T@ } @Q0 :Q , @T  :R^@Z t:0 hZh:P00<0 0PH` `@ 00H4S   !$R; PSk0 0,0Q090( RC 900 RB ) 0S  Q )0 0($k\Io@(p` 0,90 4 R B ɟ  B QR80  P`0N( ( ( X 0 80P ` |rSp4Ѝh8 0倊`P YP @@8p0 00  ( 00DF0DS:7B0`700G@004  P`0 0 0H0C 0 1 ,Pp$p$p(,(\q*ppQj(pW pA$pW PF@`@`A$ppW0@  ^(0 1,P. @P&t@ @(`P, P  OP P  BR\`Ap0@(`P,  P1#0S0 0 PPp`@(( Up( Pr $0 0@SA @`p  1P$  pW+00^00$p ^P; 0000 @`000)h4000C?00w( $0O$00( P A ,P$ppV (0$0 100!0@`p $P1(P$@ kP@` p$0 V$000\JW 20$1,k, /0, 02B0@ (kP ! R-P( 01 (0jPP$ 0 1(P$@<0 (P$@$10$*[XU 0ppP10<0S  pt! ^O0}ς00P +.000P,! / 1:Q0@ Q10 `@ @0`9T $ ȳܲ\4 8.x$`ذlL+4l'' 'd&@-@P  0Q ^  00$0000 0@ ($ |p@-l@@`VpPPp0U1pPE1PSp ( 0$ 0pQA-pA@PT`QV0.L@P  0P"P` pp``@t$A-p`@LPP T  000P   YVD$d$@-@@0/< 00(/,000/004/00/00/ 00(/ȥ000/ᴥ008/ᠥ008/ጥA-``PU 0AP pqpT0APM404 0 ,(0t KMM/-< <0  M00( $ /P Ѝ䴤 "@-@P 00`00@30 50 R\"@-@Q 00 2 @ 0 G-psPp@M 0㾦p T 0S0{00 0  0 0$ -0{PP 0` 2$ "Z &= " 29  0 0 0qp} X X 000@冤 cj <R 2"00@vZ 2: 2 (dP0 0] 2< 210 010010 010 0100100100P 0 R00   0]T 0 2 13/p ЍTg0-00vPP 0`2 2x00@Z~@Pz0S}X 2: 2p vPx 2 @0 2D001800 lC 8<, C-@`pQP M 000ES90 2 ] 0 R0S 2 %13/PP"?o2R03SH mP (0 $( p 2 P7 ЍP Ѝ00P("- $X000X "R0#03(0 $X "X002S13/p  ЍR Q@-@`pQP M q00U+0`V' 2S * 2 P13/PPF `P 0 p 2 P Ѝ D Ѝ00PO-1PSM3:00 X'*q`I`[ ۖp@ p W 0 L PtZ 2< 2ЍЍЍJP O-MXr=*`00A̱P塖pP W [K DJ@P' Ȃ @1@DT0 @ 0S 2< 2Ѝ1@D0 @0 Pu 0SЍЍC-1`S M.:rWB R* U"R  R00U00SR 0  PpXB Ѝ 2< 2 ЍDJP ЍG-pZ RbM* U0U @ RD0  P XЍ@ 2< 2ЍЍG-P഑p 0@E `` I`Ot1Q1v`01 @Q?zQAq @0 R 0 1Q@10CS㣐3*y0 0 00CSÐy0S Cr   0U0s00R!2 B0C!2pl0l l0 &T0T T0 < <0< b 0p@- @VP P y0@P p @p@-P`@Q 00T T 00p(0 2Sp0Q 2S:AP$AP$00C$0 2:0 2pC-P`@Q4M a00 Vu 2+ RI 13/p)  0[! 2$  00 3 p`0 9/P 0 9/P  _0P 4Ѝp$  0+qp 0 ˔P 2: 24Ѝ?p`(0 0,9/P 0 [00tlhDO-@P`Up M0^000Xg*0QḜ P @PU \000U00SP ^᜜ PЍ`0SP0@ 00S"|@P 0S00 000S` 0 P00080080ЍOʗ  0008(840PЍ0@0 00^00` 0300Cs000 0S;:00Cs0000  PP X0:0 H0ಀ0 0 ` `x x0x 0 70 X X0X 0 0< <0< 0 0 <,\04 0A-s %!@ ::`0$0CQ @A3@D$0@N0qPW T002!@$!ApP 0  < 0V0O- @ştMTP @`夛0P(0j 0 ᜛ P0 b (t@0 000 00P0 R= @ H $ p 0\ D@x 3  H ᲀ@ pRڴ R  D@D H P|  BHL  0@ r00(00@P @r P p4 X $ 0 00CS0s00 R(< @ @r 08pS0Q Ⴠ:8 0@00 00P R 40rS 408<04 R,rP\P0p0,Q0 00 R@P P 000pwpP;0s00 ᳠Z100S B CX TP\p0S$0Q0 00 R 0P 0P 0 $0V 000 PMP,h40S 460 0`00 00  0P(d0S 0$ `@0T$0 hPY 4v0 Br 0X @0: 0H00( Pഀ0000 000tЍ( 084<0Y40SㄠJ|04800<0N\ \0\ L T0# @ @0@ X 0 (PHS4 O-X\p0`S0P @L$P \B #AP' Y  0z S40 º 0(10S0 1$10$10 0S0P 0 P0S 0P  00S 1$10$100O-MYP@000X00 ``FV(:S 1 !r `p pGwp k 0 F pF000H00 B 00p0@000 ``FV>*Yv`G V `!0p pGwp C0I`v`0s0抠G0Zp01`*0ಠ0`0p00`PP~ Y```0S0`0F2"0y 502"0 +Y0v`0``FVm*Xv`W ```2 0 0 00000``FVL*Xv`? Vp1p!w 0S Br p0 0`H`Fv` ѹ0pwp0s0扐F0Y`01p *0ಐ0X0`0p0 00PP @00S80`0FMЍЍ0 00 0 0 0 0 0e 00 0k 0#`t0t tb0 ̷X\̵X\,0G-p`P@ S  R0 ဘU@ T6 P X0SJ0SQ 0R0Ӳ00ô00 00As0R0 BY001*r 00 000`UU800C80| 剐BY001*d KP P0P  0D 0R0ಐ0CS,h$O- R P0@ Br( R(,W B0P P I# @P 0R  Br( Z`pV Z@  P@@p@-P@ 0^\ ^ P0Qỗ Pp\ p pG-@` 0PS 0S  0 Qᚗ@PS"  00S p\: 0 BS P= 0 \~P   00(!S$! 10$1P0 jP @0弐p 02p 0 S 10 B\r ἐIP  $1 0$1(!00 O-\0`0CS0P@Lp M P g? .>P& 0 0  eP 0z S0 Ʒ Ѝ0 0S0P 0 0P000@- M@ P p10 Ѝ0O-@pM 0 0p`Hp` t P PK0SRD0Z 00 @ @ 0 pWM0@r s pGW0J*0@p 0@000S p0Cps0W㲀Ḱ0=*0p00ᴀuPP D0ZPPЍ0 qP 0  0C 0  090 ph h0h d 0+P P0P 0H !0Pf<}G-Ÿw?`0 0MR,@pl2SL:0JSI EPz P崐2Sk1! BRE:0CS㣠j*z0Y* C00C ౶101@0p扐0p⡶  20 2p8!01 0 ,0 30C0Ѝ P0 ZP崐 Z y0 pP202 p 000 p$  ` 0 p -,0, ,b0 l w l |,A-@pPQ`M 00 2   Q Y:1Q|&0" B1"0001 0 VA0 0PU: Q * 2 13/p1  R* 2<00?0 P  R: 2 E0 EP VP V$P "0* " Ѝ00Ѝ0PU Q:(0 $P0PU`P:P   S<P 21 z(=@-0 -M :Sl lP 0PS @P000S 3/|4 !SsT_P 8 80 $0Q/ $0S/ L<<0 0R/$ 0S/̱ T\A-@T 0Slp`/MXP0P@Q0@ @@~X|P 0A/P &1g1%O-@$MpVg|=xTp$Dpd4dD0q$4SO 0! 0  0RpC BP b0@S3S10 3(83 3$$ 3$ $ 3  3$$ |3$ l3($ \3$,$TE 83$8 4 X$Ѝ $40$0($0,$0$0 R20`V! P  2RWPP60 p00Sh岇P\R0 p0 00CS0z p`  RF(4S VZ  4S8 0V0$R0S  W6@) 0@ c6000`006@IU0`00 g 4S !LW6@ 4S $lp ` V V ,4S ^zlp Ivlp4S VMllp -hlp `000 ^^lp V?@0`kjP 2%&9-%2%`%>&XE 22O-@PMp`PfH< @@00,3,#@p: RPGP P 2l f0@3 hP>  2H@ P PxPePXP dP0 02@00t0!C!-\\ R0C0<20pW WT  R/ Y  匂PPXPPqT! f`P "  ㄳPP* ỴP~0SQ thYPdqPcRp`@ 8W%,1 B R  0S V X e 0S X  R 7/P  R 15$ < ^$ < \UY,SR%J3e -%[3333d3p O-yMP*e;0`Hx00 00 (Ap8`K[( 0RI Sd 0 0 LԁvPePRPGPmf0@S (H0@ S aP0000 0`0 00 `00``0 0`0` 00 `0$``(`,`S7 0S 0SP0PK 4P q'k P M@6pP/W  0 10S zQpw0S x&0S0@0@P0P/S TQ 0: S00! [sSQl0: S 00000#/W00S %)0S0(00S00JpW   +0P0H X50 0"0P @/P05%0CS0 $ `; 2 . `p<PP0S 0Sq 00 x  B R\ L` V `,Q% /0 !P@`00 !P` J/R  S/R/  # C  R:  ` 3 t3 0S S/R$ 0\SR& P0sX/ HL!R\0X\!R\ $X00: S   C C `uP0: S P1: S  : S!  Sm  Se jj S^ S L0S !kPN,0SL ! SG0(尥 0Z jZ80 S801!Q p)PPP1: S '00Z0S 80X!0CS!80T1T!TiP R X0O ,0S !k0S !kڱP[(0S0S 0 0 Op!&} 3%34 R%S4R% e4 {434445550&U5 6h5}5 ?5 O-@PbTj9@&?p8464V@(F^lP60P f m0S0 | P/NP :Dm4P0805HP40lP0%/(0@mPP8\P0T P5P%HPNP8P H00 0(%43/00P08004 =m4q 0P01lPP (lP 0 P0 n@0D 0 #oP0; S @ ,0D(0#!H0P85/,TP0P$N2PP P0Qs崓0 CS 01#STlP0 0( ,S* B"!0 0 l8PU H003/p0S@fH0803/p$^PP G0 `0d P 0 S * X  q0 $03/0  0-Q3  S H1m0  0 -1/ 1P0 0 0 0 `0d 0 `0d P0$ ,!dl 0,ذܠ0Z[   P  00h0 l 0 h0l   000 Rm0 0013/t Sk S?kXP\`0P ( (0, PU`00 XP\`? <%Om9% 8'>V%'99H' 8'9'\ ` H'9(X|O-MMa7Gw '=p 0 Q 0  pH0(0`7G@-Pn 0@00$0<00D00000$0100000$000,00$0;0H00L00$060(00P00 00T00080S P}PU R0nR oR0P<0,s`P  4P8l}`P,_PPP{O QoNRN , 0|5 PtPpda4 1SzH0S?80S<@0S9 P0SP tP4PD0S 0$, + p P44X(D`尠XV 0PU 0040D0S mލЍS ,0SP sP 娠=`0@0S0H0S 0  FoP P 3R㓵( F P3m W` A0Z ?P l3  \I4P TT 0<40`FP LPP VoPPT0S/0: SGoPPP4 01! P4L  0R p 0P0 T0StH R 0 T0SH"Dp5oP4T0S 2YX 8SU # $WpVJ    !   !  $ ! ( , ! 0 4   8<  @ D  H L  3]P   lP40SP8`P'-== $=I=Y=s=%=%S> [,>> >K>>s@-0DP000T00Sr0C?o21$;p0 1000C00S8 000-S30 2R(0pP EP SP 0 ,OLsP xP  4 3" 3" 3" 3!00000C06v㚺P#(%"x&\@P Thd傁T(cQJUtPL 32S ,#,O p 2 0S 000S 0{P 0:sPWPC000!S 0 0S <hv000S ;P<24N0Ϸ A1S bVQX P2S 1"@O:Ua`0:EoPQ100S S !0`0001v@P{ Pt uPo  $Pn 2S 0"r r r2SA ЀҹPR2Sw |0"PƹP( T0"p(N< <N'%SB %>B-Tb'OBZB'p0L'PBCA %dB{B?`%@-@MP`/P@@@P8B8r',"k:p 20 ER!aIpsjzwPePLP= PP0; FP f0@ S0 0!C:p|1Q=0 q E - P. R1 R3 R 0!BSQ/ CJP*0: S&<00 &z000 0 0 0 0  Q 盅K  J@P0: SpGP ᅅ@7p'D %D ĉO-`M@ ]3IqpP!9p 10a1S 000`F0PmP pP CQ]P xy`m]P'2[A Lp@,0Z 0IP0 0IP 00,0 * R 0Z /0 0 U:Hp @TJZvIP U:|Hp%-3 O-JM M@{\ 3`R!99p1 @DTP0 aS T  (FJiP fP hP vP00`0` 0QDIpP0: S ! PP xP 0Y/S / J>00$CP@T ᱽ0p/SX/P塽0 S:Lp` Ἡ Îp,'F%FA-`P@M[D4 0 HP  G HP  G HP  G HP  GPh4d3P0\3P P$P@3( 0sP+( mP3( gP7( aP;( [P?P ( PSP( MP P8$@Ѝ(P (?PUP" (0S (0P(0S (&P(0S (P(0S (Pq0S FP|!0S0S Bp T姶`PLa @1R`ṼPU 0E /R .P(YPU  00,0/00*y0 0CS0 ݘP0$0v00S twR0s00ߚL8'%ifPL'Lqf4[%fE?f' h'fp@-@PZa1`LP PP `t 7ph00SVჍPw뉿P $( 0@H%%`%9O-MPZd*1`pXFP&N7p D6@X/,60S ЍfP WP! PP p `RP dP vP iP0p0 `rPxP pp0p0p$ppq [,1@ES (V8e  0P0SP$0`S 0S@ pP܄ CPP40S v ᰻@[*0/S /P0.S0S .S0SZ<  4 0 R  @ 50C SN0 0$S P PP1  00$ @F1 0v0S $ ?RR00R0SV1 $ 01  0SX  ׾P ) 0!0 0C0~ EP 0S' r)0S 5S 0S 0S`FP0 0] 0 0XX  垾PQ#EZ0SJP D0S L0S= H0?S9 D0S#BGS 0 \ 00PU -FP$0 S`0S;D)0: S R=   S/o" R 0: SDP0S J :P SFE 0SE ᖾP 0S 0?S 0S0'~q%|  q3q qG-P@X0|/`p!5p 1 R1 p0C@P FpP vP0p`mDP(p0S VP /ၾP 0S 0S DP0t(p0S E%X' 0@-TM 70 $ CDPD@EU0E0T000D 0DP00OC.޳P3 UP 30S S S" 30S!  R `#6 R D#!SRD3>E 3! $3 003 3  220S ( 2 20S 0S'002@T$P0"y@tB00CS00  0 8 0S60016 R0S 10S<pe0PR<0 01 10SO 10SK(kl1X1PLH10S D10S `1 T1 u0S 160S ,T@1 D01(.o0S0F0S 00Qs0S?0S 00 D@|P@To'`}$\%8't'0''@'<'_ }}0]%8]%},'[%]4'p}4 C-@MP TW-2b@@0 S ~p ڸW"4pC 0 L1 06Pl7h )DPT'Px !DP<&88 DP$&T7 0DS 00S8 @0xL&0QD0@0 0Q%@0SV L 'PQs!a0@S0 @qoBP `s@@L\# $P "P M%P 0@0 00 X@L@*LP*0@0 00 0 巹PLO#~(D0S lx CPXt&D %%hntBt @~ht@t@&H) - gt@-VAjDO-MpyV$-:@0o0C?o`S20@@@ @3#i0p3 X XT 0S9 Z`7 [``3 sRPGPP #(`3H@ P `hP dP fP00vP003@0 0`00`k0T 00B0 S; : ۭP" @( A0S #S(`'<2  ٣`P5 p000#@P/ѽ0Sw '. ḻ0P0 p0p ' Bp r0S<0 0@00tr50C S?0 0S *$ p- p0 R qX  Pp P    3/P00 S ^%$ p, |p[p000S YC 'd]%U%^O) -YZ) ܝ3,'33 XO-M M`p ^hIp^^]5 00 5^5005]9p 00巰P '岰P 舟?P'Q qA0@6S 0Y S~x(1pQ `QX 0,(LȟS SS 8q05505 00505057 P Pn' 7'ꐷ rp0"S lqH `p ꝼ0"S  Op0"S P 06qpS(0z05000001 00 00g0e0c ^< ^  ^ QS00 00055UU - IBY5S50`FV%R" 2) 0%0;bpPp%5S 06AP80: S0558%0IS00 YV05*V-喯4P$040 D⼋p`#PsPP ?`$iB2%h 4t\D00000 0U?ʟPP#2 M?????YPc`0 0S #Ppp@H*c꨻0#S  &?#@ Q0E?o2?  ? `V<DPPu#f/7>*`~tV -PPb@hC 00CS0 tP Pp PNU0 P00CS0t0 V-0S:00S:002V51-1S)1S _'(PdPh!iB2%tb3VZDP 8g)P! +-P0V08 ,P$o0`FV|P@7pP  f/ 夹T  &'P0'. ) ˝-ո?1B[t]%%') jE? PX'`% %vFҮ,%mdp'P@-3 0P @`P@pC p87`00CS`0 PaD@T ЍX0 X @!70(P1 `%D%O-dM@` $1 P 0t̄4 $0N/p0$p@DTlUU!Z rUdU `0=p0@$@;otPcPSP PPL7d @" nP tP0 aPP dU4 RU SU" QU040   opUY [/lUT  .7  $L$ "?p< dЍ $ؤ$ ?pn 8ˤ8 ?p( 8⡸ 8⻤Y  HⵤT@D$PP`p | `TE\8 >pL*P(4"4!( l "03X!  jP Q !~n0P0|nTK  0@SB|A&x08R`P8 pᛷ0PU ,8 㒷 a P P P0ZS 6&`V  d tB0P`||Q-dz%ӳy~D߳D{D|D(#2AM}D^ly ִ%yaratcidO--0`pOaM22242222322$ .-pj>"42`FS 20000b2p^S Rl2SVV10 dbV% ``L0'p L#pP  ``L0'ppd2S P=PX0: S0d2232d2o``Sn`}0 X=}^Ppn0S4 f0  zPRP3P/Pʑ7S@'P <1@P A@P<P 00j0000\ ,2%,00SP TGm<P0d2M042J02G02D02A02>@[ @@Taߍ02.202*02;/PP000S 7p$ 0 0[ / PP000S 6p 0$0U /P000S 6p萝l0*2Z000 0B B3zP 000S 3 S;3p*00HZ 0` zP 000SX"\2R(RX2Y/ ᭧P P<PX0: S 9 PP %/ᖧP L)0  Plr^8;PPX UD;=<p X:{\10  [ *;[ d!14(S;̲03T 8  <803M,87 P 0@B PR[ 2SX 2S0 0sT d :p&d2SL B<pV X!\1 F\1X! 0 \g502T7,2P7(^%.Z`( (k:S 2"0g 2PSb@h 0$    0?;2S2 bV/0@t3@2S5P" ^=0 0?h4@ q5P 1!` V!0Tp2<<23S 52hAS``t2S #>8$)0 G5P G8E88=3<5P ``00"#4,00!`0,"4? 0,! 0 `0(" 4(35P j (@gB 0`V5 `EV ``谝@L 000S&VT"0  :0sLP {<=z 04P(`CQښ. .a0C 2 0g.(-%7 %l7 .(.($=I=_%.(s?.(zd@/(W edA$BhG-p@`㠁Q!k'p$V】 0S 0S h``10pWA P 80S  pW$ZЍyPmPPP fP A n0@ S0  0 0000000000`5NV 0cOPP$UAPQAP 5X-X4(%!9 O-(4M$$` 7P! F6P50pCࣟ00PPP#&p4W00S 0S 0S Pp3 a X( 0S00tP Ho0S 4i,fWPY30S ЍzPOPBP FPG e2P@*P 00 ۬P2 լP2000b 0 dh:0X 0徬P00 8巬P00 0 cdP}x000t00q00n0 md1 P :Lf00000X000T00Q000M000IpG00000A000=P;0SWz XP&zU 0(P`IP=zdZ 4~dZ|F(tx>(-A(%%x$F(p9 ո? 7{d!d_%DO-@MP8@IʰL(PUPE10ůvPlP,HP1 TP3@ ` 5p@&Ͱ  Jqp@0 S < <0@Zt peh2m@ P ` D"%p8 R 0S00!S0  1 ,0Q ᴫP,00S  0( @P@H00-SG 80@0$0 p0ᥟ@P@Ѝ$0W0|1 4t?$040P ?000R0Sp h```8p\0S:0S 00 0@@`p @$@ @P \r 03/p T8-C 0% C <P_%@-44Ҿ,ؾ$0$00ξ Ѝ`%XI(8O-@p8M -P`,@壮0F8 0➮$`^ :p 5p d5 R, 0P T4p80P0\80p|H X6LEUIH吅,5DuHuBh%$p0($5O005SO 05- + 0(0,00(00 0  EsPPP$hd!zS `SNS7 AS( CSdt 0坽p0RDaC Q WS4$  $ 3RD +fK L J sO 05N W WX3pM H $0%0!0 0 Hs ң$0@S ,cI 2Wppi zS ekSLSa"m0C S\00 rUrSXmPH0SI0SO005SP LPL ( pP (0S  0C#P @P!M@~p``%p!? P!9 ߽P|! 0S1`!u3/ 0X|@ PhPP4HP<1p@-P@Ap@-P@A|@-p@-P@Ap@-P@A(pp@-P@xAp0O-nM M800l`4P-P 0H~0 P 4mPF  >R~p>(0$  p@5= 10>0S=D$R$r R  $xmBt $Jɧ<$.}p|0A: x0@ <$0|(0JV-p00 ]`PEB@D4T@@ 0$0<@P < $ P [  x<  h<$$r $pL P 0<$0 00 L 0 0=0(00 L0, ;0@q ]; ;$h0 00 0  x`;Z0!00 d0 | j(; L0(00 ,0*H \:$>0!00 0  N:(00!00 0  @:,"0(00 0  2H:0`:@4:0S  P p: 000 X !00 0 0 :0!00 0  :0!00 0  H940c 00 L0  D: 0!00 0 X 888Ȩ@0S C.0$ FP\FP0@4 P@ 8(\\8@,PD40 PD40D4  H 0P(0u `800 1 1 848Cd7@ P00\7 000  4OL7$G: PeP/ `P Z\0S 0T470 04001<4 4*8X/`- PEU UYx V 0.p 0 PS 4S<4Y1 H4L$0 V,,pk?HL4P80ؕS $EnF?ᨠFHdLV0.= 0 $?ᙠ`t5VLHd4SH$L4R0 %*pP  V ,p  4S@  kF`P  =[  MPP;l%LPP\%\V+p (:: S4%8) $Rf*@P %4(SpP$  ס섟P0HpWZc$R0 >$0@0p!$Tk = x,0帡P,0 r0 4P ⷡP$803m`Tk 40S0X44S.=0@+R$)SR' (8 # *~咡Pb 0T40S凡P 3X#0S T4ShxP`3 s(8`+" R H$L4\* p[`` 0 L4H$Ϡ2#!0^pH2 C  [$0- ;ozpnx j 0P0 T  㸤dL$H?("f4S 0e.?V J`0$$4RT SQ  V   0P)p 0 `VS  S!0$Qf +S0$0 Q$ Qq*4mQ(VjV:Vq %W X-ո?%oVa\Vb\]]@]&V]V]^Wi%L|MaW*WY^]LWbW YV(pWWWXX.XAXQ(WXiXXXQ(Ds XXXȢ{s WY_YzYYYY@Zi%ZZZIYZkVEZZHL$ P,} P+P *+0$PiS0[ 4S$ jP 44崀S04144 0S @4S 0 U0@4,4S $4R#1ѣ1,40 0(0Uu (t (0S 0+Qp@% P' 0d!|-;]P`E} L+ RyP9X+-Q :$4+041$4+ T4S$| )d0,"|, )(((PR)\4$8: H4d4: x0<$+0@ 0)p`^|P Z +ҟPٟPM  <p  T< = '0+- , O-0pMI Mh4, (bpP_8`4pGs04WZ h*  &YaB 4S<44S $$4R0XT('p D he)p , 4 SP,0S x0$Ý t$W0 0L 0$川pW$ t1SC $$4P<*`|YZU CUʧd7DPEUPP bPEUUPP 6 ( 'p00( R0C0s0So p X044s04d0 00 l0 6V0(00 4V0,\0@G D0 00  070*00 +0 +0*00 +00!00  00c 00 x0 @50!00 H 0,00 1 1 |40(40STX00; \$7I0P0D$IXhk(p 4S &PP$l$O`P#T  H(@^P<4(0(00`V Z<0 00p"#7$p = 0CP0 r0 4GP BP #0W3}p$p4S80S4h 1S !1B0"D 0S4P $3" b1p1   $$!0#G[pX2   W$ *wp P tc $ t$4嗂s'4S 0D)+?X   $tR $4'S  4%9X0; 4 $$ X  0 &p0wWXX0:S Q4S  0  &0S Z &c(!ݛX0⫱X+XV(:t -d%.XAXxZ(XY t Po%bda\Vb]]^W YdWXXX]V(v XXX$v _YzYYYYO-GM MP`h Ϡ0t@$$p40PEPEUq@@5P 3oD0403003b3噿(3 p0,0p0T3000D30804<3<#  3@ 3D 2H2"20L02"xd2l"pDl2L"h{$T2 `p0V0 (2VWi2 Np0X01!DW 1<`Op0x0p0d1 O&p㸐%V  |;qpJ0 S F D P 0Z !V0S40SPT0 A/ P 0$ 0 0 @x,)xG@PU Gލ Ѝw x %-HKjjj]jjjxpLpjjkk Y7#kO-` -@Mp L`K@%\UPU %P$ph$$pX `@8< 4$pI( 0{@{0{SH{{S $P{{Z$P<;Sں$P QZ $<Y A׻G8 ({:< (;S[ht `30X2pGS1<+0X2#030S" !.t8@|1Z 1@2TȌp Tpp̌ ňpp3 Pt   T 0@ @ 1 0@T`Pb 0C S_0400000,00(00$00 0000000000 0000000 0/a0p R= @@W'ĂW> 's8;p 00 L0#p8; 00 L0#pD8; 00 ,L0|#p8; 00 dL0n#p 0  | x+ y+ z+d+{+ + + ; '0cy;0z;(0x;p+,,@”p L0A#PX;"0#10@00 0`K`QHD  `   ` 0#PqK0S `` K0#Pd 0  00 45#P@Wd G%0 TT&``\5d%\"P`|5|%|"㯝!2`(10kkkk,a0a4aU 0P````㖝<;SU">@˟ BWz{ A k:L:۟"@ 31WVz{ A k9I:`"2Rgd@' d{ d30S 0 ' U L N@^IN2 X0弅8!pV00 H@+P@0W0 00Dh&@X2 @ppW T p (2O"PL0"0:CS0LF"`pjL1堋{8 {'NjCAZAG@8țIN[T{({*X PKU7 M0S3 z<i0xT0T000p+t pP 80S e#Ύ!t;<000[ W0 0 N|/$ %d2"SS% 0 " $@-C6?8~A@@(b)|l)(z%xOm) l)yzl)CzHz%Qzpc)u%< `G1 PS& 2R`嶐@pYTT0R?L0 d0 0 d20 !  s  `00hl0?phN{{7{{{|3{{ {  M@ q)*3h2 00h232@0d@Wp |#X<0 0H 0@0L2 0BS= (SE; ? 0;$p@0S<9h2!0@0Css0S0 0 0@ s04r $ 0 @ 2币  0h 0S h;    0;$ 0W |B#<0 0H 0@0p0V 01 JrxP<0[9W $0 0RZW |#<0 0H 0@0 0 0D lH_$p0WpHV$@S$p pc)u%vzzzzm)%l)&{| | \{x{{{{$ 0CS0 0 .P \0Q.0 p$$ x|k$30䋟p@0|xtplhd`\0 Pb <0 PY 3Q0 #}#0 P;  #0 P* #0 Pd 0 P Q Q ,(x$v 0 P x0 P 0 P 0 zP 0 qP 0 hPd 0 _P @0 VP R# 09 !50Sj CS^ S W |!<0 0H 0@0p/#H{ |$|=|W|m|||||||}| }}.}<}a}}}}}/~}~K~o~y~~~~~~ ~~l)~SIZ0KWI7L"DDD0J0ZD0 0I) 0K J0KX  QJY0KWD01ʸ+Y vP WD0 "D0J C <帛CWmT"pDDqD0I0YD0  0J#1 KJ" <W"<O-M`P@0-S@8P- @3 pģ#p*30SP a`F0P[:PQ9 JKP9 m D N4P@ 3C d0@S  Lp@20SK@HGG 0c 0{|xX |`NY'ZF`PP`4b 2 R 1  J 0 S %   U+ 0 6 ! 0!00y W p8 0pF0S {W{` p40S*P0pt@@ 0N Vt>{`%l*| j% aZAs{JWO-PAM M@`ᆌ뼦P 倌P60V00-S% @P ዒPM@ p0K0\Z &`F0S0`@DDA@Du% p ,0S@bLpP53 Q  MP -00  `@Z-00  D0B5S0  00S XMPSM0 04P LM0000|400 |4 0S d1M L4 00 8|!P ~  K300S Pl0$0g0(0d0,0at0C?o#2p R0S0$0P㜗t㙗P㔗Xx0H@DT43a00@`FrS= RS iS1 tS xSDa㨢в+ 0p 0@00@00S j 0*Ya0S A5;8< Q (0 B/S ׿$}(0S ̿ 0@(0S (0S |嶿1 0t0\ES @X姿(0S 4坿 0@IjiPp+ru 0 pPUV_E?l*| ۂ-(*Ju%g% %x4u%\%8J czO-PLM'P N n. p=%,# PER a0:  @@0SCKvPcPSP TP LP d0@S0 0D003030800H00 30$30(30,30<00",00@)0,0p qW3S)P  @ Px< P /P LЍO3S 00p,04 8<@ 0RWS[Z0DSPQL  0gS @{$;0 0EY0P aR @L0Y S K0-SH0 @ 3R:  "0 0|: ` P0 0\:0 0H:43043{0830<3@30@3ppzzyyx||{U ,0'U ,0U ,0U ,0U ,0 0 0U ,0L00L0U ,U S S0X0X(0CS0 0 PD#8 D#<#  P Q0P0083 B00b0 X0X 0W@0W0W0W0,0  ,0 P 児PiH0Sx'xxw0>@PH0ST'THk02 ,0XS`X `43 S`0p,/aWF cW1 gW0Bp03S\0S^ 0gS$ H0S!YP 0x&x  00S_ XyZWZV 0S00  j &,Q0O4M8K<I@GDEWLЍ0000H3p0P xH30`pӓD30& 4 004 SSCP 0C00 ,0  4    0R:400,R0t ,0 0Rp B p pz<0S $3S 4p0 00 R  B   0Yz< Q $0Q p0 40 R  B   0Az< Q $0Q p0 80 R  B   0)z< Q $0Qn p0 @0 R  B   0z< Q $0Q\ p0  <0 R  B   0y< Q $0QJ p<0pGSz $3S0S ID0S\ @{p707S ,00'c<sr=hS c f ] x W  Q  K Wڀp꽓0S 00S 0S  Q 0   ytpW E8 30(#0<   X*} %v} Ө} %**~ *Ȩ*Ш*ب***/D\w* |l?s*p*x%2!G-PXMpr+vPHh  6HDP b0@SS0 p80 6`(pT80U ʷ0$60(60,6006046060860<60@60D60H6$&R 4&<  <&,&R 8&R ,4&R <&R 06h'SddQaDPA07=CP  P W0S  fP 0000倌P6T&0 S<?P6P061 (VUvpXJ0+Sp@(86 000)L<00 0/15T& P 0p00 :X6P00G00X,p# h5@P 00 B00C2#S0d0P0 00 B00C2#d v>C 0C0 0@0 B "00P 0P0A1#10C0 0P0A00C1# 0 0P0A00C1#0  00 B00C2#0{qp(4 0P 0PQT3GȋJZp=V w`2o`F#5P0 0SU030#:U 5%$P:+P pd= XP&T6K/r043PvTS0 0 S5# G@Bt SPE_X!EK/r0P3t 0 0<6SR46SR 0&2RRPT2 01kt|6S lP W0`W  0P  s,6S m/%`P 30PQ!V徨<s嶨<6S:46S: l1Q0@6D&S1 0 00Rt!  H&hRd! $&RX! 8&RL! 0&@RC-PGMM x10lL%d0 XPΗ0P) S%60 tilnP9Tx TgP 8h(p4^P 8T(X(f b將P 8h(d40EDS00  `8( D8X(T( 08,8 ~8P 00S~ `8d ?A7, ,, ,q 7,m 7H(if8P+f7, \] h7L(YW+w PR:?@ 0 7P(G7W fpIP|78Ur}PO p 9P/P00@˜7' sXvP3034$p(40pEWQU 4 000`nP C,tPE0S3 4# 3P9630pPl~>`pX PL"}PD304v8 t4S (SsP  a>g P 4SsRssPn l  PpR|},p`bG1/΅<01 1> 110101$1sr   ʈ#2R  )mp`a P^ Q1s0S kh`xqā*rp  lQ00S nsp P *`3P?o20S R=?o20 P P l4s1s0S 0! S7S 0Rqp  \qr=`S 0 0000 ls1s0S v`txꀢ+:2K_r%&~+1 q%%}`%++8 >2 &A@-@`჈|P̓P h1 dq\!xpP10SAF01P> z1)屃P  嬃P 0 nPbP 9P0P   c0@ S0 VP b 00@0 P0  @0  00  y~z0SC2,+ P%>2=2 p%%A-`4C0P@00$ 0 P0 0RP00"|G~뼆랭I'.k?P0r0D0"SșP U 0+0C0SP޾P \p<PPE ʘ妙P 0S垙幙P10嗙岙P1 0Q -U 0S렝P㕝PEl10S `10P$ HQ|0S,1,ʂP#P M{P0qp 000000S _N딑TPP`0S ͤPPt00Sr8@+iJ2l+ddt{+D++%X++<++O-`pPLB`D@`4"p(2 0 qQ pPpGefuP`P GP IP EP 0 C a0@S 000050%5%:% -S5[5b5 -ht@H,5%555gt55O-@Pp`LM @"9p1 UV! Ptp *:gP uP GP \`0S@0000T vPUP   p  ! :fP0P 0S U9 p U H p T p V % p|9PU yW TzxPL@@H 0F9 -6%6 !6H6R6vSvY60O-@|M0t5t%@p5P@h5b `5p@T5b/lDEDeX04%`5,%,E5(%(50`07xP]  Ь P P s @comPC DP3 fP5 CP6 崬pP7 rP|$Vpk6Bh(b P00: S0S00+4oPP, p/uP 00SW p 3 3 CF`00`ᴓ崳pXmWpP  ]ExS\\0@ KbPP D vP v4 㡃 㞃㛃Mp0@00P@ UP@`P I*V ((P,@44`(PV,@0h((P,@404`V(P,@@(~(P,@4`V(P# 0 0S0 0 0 0 0 p \b W-@P I 8D00$1"1uPY 0Q "plB 0 Ѝp%Xk,p,1q,\,p,`,, .k,s,b,p,k,%ѫ"8h,p,˫-\k,T-j,KM Q M \,f\P ep,i,,O-poMQ0 @U 8@0 @$p`T4 W\Y pP 0  %P(0: S) 0T0Z0S㸠f Y T4L@P@   %P y y PD fPf@Pp U4pVaVb`FV` zV" ώ!0 h 0\V 00 083 1  0Dx200t@r pT 0!0 02QX 000ss` pP00 0P* Pt%tf`Ph!!% A" T !0V70!6P B7 㝎  P"   P=0S ㉎ |40S 『`0 0/X0 Pp 0 0  Q   S  R#4sp V`P0S T K ㋁ XU@p0, &% 1<[-z%ht@Fн0O-PMp00@t|Ph `|PTT3 Pߍ(@*.j9$?PX1?/0201 2211$R("T122Fp#?p8p^&[0|n0Z00 `.0X>p:0Hn0C 0 0R080 Ph[0 l10 B1!1pq~0 PPZh0[ = 0ZoR =-00+X 0 80 x=0YSVPMP 6P@ ?P7 4P<8=N@P fP j@P =P <0X1hu<'hVP㼼0V30 [0000z00u( <PoXlPi 0pP 0P #0$Q^ 0 R0 猯PP  0pˮ돶 84'0F00`1ZᯑpXX Fr1SP 9 %ˠT:0P 0@ @ Tp  p }( P0Q819:d!X*`1 L p,< P-$ (010S  0yP` 0Y) Y)  +t)O0 }~`000` ʟO  t9t@ixp$T  X f0S` ( 匟PO 0S Zo F0080`8"/0    2s$8"/0 2sc!"# p: 0<O P# 1 F 00 8@嚜p 1380Ȓ؝PXzLw 7@;p0S h30HX0S<10S 0 Q  8 0 'znpq0S &d apd0S &0P q |wttl˞ؒ0 G S 0⩢p<7 :cp3 P $T0$A>0 0T1 6T@ɚpyXƞu$0 T1 5T@幚p嶞Lp cp P 000Tl妞+H Th0@00 P  ,R0 @40 ὏pP F $ $# 43p ῑ+⳹pf 4@^p8[!R`14`11⊠P0d$}!P0!J00!R00SRd1,`1Z  R! Q01Y; <`1 1pW4180; X >< 490|((☬1PU 0S 2PP 0S  剓 0S ᡞp R080SX R   (0010 S   0`Vca\z0@0@u hVdoR02 HO %@%  %uH Q -Qd 7@54\ 4'#HYo~&Ү1E0:AWjXv H%  Q/0p@-x@0Ppp@ P T07p@ 0 0$010xظx8~/O-1bM!0 Mb  [ !1 b0 0 30Zbݍ Ѝ  0 "m !l\ ${`  $; 0 0 +Hp0Gp( 80G( Gp` x8_S0؀00 00 P00 @G0 ?xP x8##[`@*4xP0 l8 40GPU P0 l8# PHLH0ƒ S$*0@- R P@ 0\ R^ H00"@ 800 0^ 00"@0/Ȗ@-M   Ѝph  0S/ -PM00 0 p 0 S 0 0 Ѝ05P /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b~*/{*/x*/u*/cr*/2o*/l*/i*/9f*/c*/`*/8]*/Z*/W*/T*/Q*/ N*/K*/H*/0E*/QB*/?*/)<*/{9*/|6*/#3*/)0*/=-*/**/'*/"$*/!*/*/*/*/////^*/ */ */<*/*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/S */*/ */|*/y*/v*/Ks*/+/jn*/Ok*/hh*/ie*/vb*/_*/ \*/Y*/V*/S*/P*/M*/!J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*Q/"*/*/*/6*/*///*//7 */>*/ 4T*/@-@z@*/*/*/*/ps_strings missing %juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeara.m.pmp.m.dstmnnoonmiddayiqvwututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!csp != &blank/usr/src/lib/libcurses/refresh.cunknownbel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangeacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error unknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat1.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON/usr/src/common/lib/libprop/prop_number.c%llirpn == pnintegerarray!((*cp) == '\0')/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNELSIOCS80211hidessidsocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)IEEE80211_IOC_FRAGTHRESHOLDIEEE80211_IOC_RTSTHRESHOLD RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: unknown standard formatCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %u%s: can't write sector %u180320360640720123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Checksum error %o, inode %ju file %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctlatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvp%s: unknown mode. TYPE %s %sTYPE %sContinue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20241129NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Can't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! timed out at eol chars transferred in can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular fileusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDtiso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARSLESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadtildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileTag not found%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread commandbranch%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 11.99.3 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.3 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.3 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.3 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.3 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.99.3 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.99.3 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog11.99.3xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv6hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv6hf/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failed executing: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICbase32dtbgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdm/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %u %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartmanlvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorparts->geo_sec != 0t != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interface%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duideloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6vsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %srt != NULL&ctx->froutes != rtsrt->rt_ifp != NULLaddingchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIASepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/etc/group/etc/master.passwd: (malloc) Error in munmap(): JPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSHTVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d ?2P1UEhYb}Li#q1Dw$y1y1 |1p~bp~/Ẽ111vD51,1,͇1س1@G1pRH11h11m11X 242\2\tD `%%`%!2) 2)u\1{H@)2I\0L228OU2WMte:2te k=2 kC2 klJ2lf<pO2,sT20xVz[2̀wt&1// //////////"'+16!**33 $(*,. pushdnepopdneۏ887P@@8A8@@88m8`i  88d@@[2(jkd@@8unblock and -DNO_CONV?Dt htod,llll%,l2llllll8lllllllllll l"(/ll5ll;100 0prtstatTTT(IT@TTTI(1TITTT1sETw#Fm%c9wOdUsage: %s [-] [-ESsx] [-p string] [name] 49;9?ACBD69`hn<|AJ.O? [SV"ekqty2'3Rg!4&4,4411999999999999999999999999999999999999999999999999999e9999ln999999n999999999999$9'+-/91ANPRXPZ\^9b??????????????"%?????????????????????????????????????????????????????? ?????????!&*/?49@?lnuz? abcdfiklnoprstuvwxABDEGHLMPTUVXYZ2 )  A "33"eVeee././@LongLink+LLL<LL!!PXHl'Zha!U8A3>DN#+T QIffffikfXZfffffff\fff^f`fbt t ttttutuqu*u>uEOuZcuxuuu#u u_u^uFu<u>u?uu@NI$2Vkks{PATH=G   6:> vtjPED[[[[>0>&*->>>7;W[_cccc $/:EN%% vy  fxj 5 > & P.ͯ7CYF? &!)#8                  DчDfĸF8^xg|xQ(<׀yk~qhv@;hyhpاˋHHO*^O}WT%d%|<{G\b/d$ť9zK@tlpi|PHNj$ %%%%%""%% """"""&"" $$++BBBBB99BB>IKMOQS    2.*0(, 4 *Žd*ǎ͎( ю= E  a#:)#%#(#`#"#ݐ$$d$Z %} &4#&g4%ďP&|&%ˏ$`#\%[p%p&-159>#=3F#E3M2L3S3R#sz @A@ (7?0 @ & ߏC$ޏCC$CBpv}h@ @  bZ@ɐ ѐяЏُ؏GNU\d k@ ====0==0=9 % /"&),FBXi|~Π֠ޠ@@@@@@@ @@@@$ @"@(@1@9@Ơ@EKRZ`fmsz@@ǡ͡ءߡ  ")18?GEVf̞ߞ,H[fQxn4&*/7<BHNU\`Ģ(fl1NXbkrn4ĢȢ(Ң֢ޢ"Ɵ͟ԟ۟$(/C9BIR[dmxƠ n4&*/7<BHNU\`Ģ(fl1NXbkrn4ĢȢ(Ң֢ޢ"D[D[[V[D[[M[[[[Dn4&*/7<BHNU\`Ģ(fl1NXbkrn4ĢȢ(Ң֢ޢ"m147:'@*TMP-1  ,E*K^  % P l K6[o !&*#&*$&&*1&*23&*4&*56&*8)9/96:O;i<=@ABC*DQEgF|G|H|JLMNOPQRS(T1U9VQWk\uacdef ghip%q&*s&*t&*u;v&*wAxUq/Ok"9Um/7Ȣ(Dgz&*&*&*&* +=Wg(E]{ ;V&*&*&*0`&*) 9Z][-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] W1a$WNXbkrn4ĢȢ(Ң֢ޢ"returning to single-user after filesystem check readDosDirSectionreturning to single-user after filesystem check `gw*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~? wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_read 0t_%@85|_%6:_% =_%@@0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-(3aju`_%KKKEKKAa_%@!/BWi}F^b`dr= 8M = = = B B D I I I J hM (J TJ hJ J M XC (   NXbkrn4ĢȢ(Ң֢ޢ"r_%@E*K^  % P l K6[o !&*#&*$&&*1&*23&*4&*56&*8)9/96:O;i<=@ABC*DQEgF|G|H|JLMNOPQRS(T1U9VQWk\uacdef ghip%q&*s&*t&*u;v&*wAxUq/Ok"9Um/7Ȣ(Dgz&*&*&*&* +=Wg(E]{ ;V&*&*&*0`&*)"w_%@8Fhz_%@!4{_%@#~_%@ ׀`_%*$&(B[   &,_%zKؐ_%@ l_%SFH0eC!(SFU0eC'(ȢHah!IdontNeedEFI1(6((s*K>;@(|nQn- q+K(W(|nQn- q+f(p(|nQn- q+}((|nQn- q+((|nQn- q+("=rGy=iG}((;Mt?((mWC 3KOO((yD<#*=(()3Dh& ))\ M}-%)6)@Mjy֬G)X)-чHi)-чH~)ZIчHW)IчHa)IчH()2IчH)L6 %?a))S'@ )Ѹ))*1@ )Ѹ*1x )Ѹ**]g_%@5,_%backupstore_gptstore_tbl!28_%@in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercaps///[%+-/EYYYYYYYYsetifflagssetifprefixlensetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandsetifmetricsetifmtusetifnetmaskusagestatusn4`7[printallmaindo_setifpreferencedo_setifcaps6zia% yiPa%u.d%Pa%he%8e%m.d%7^d%20e%8Pa% 6c%8Pa%8pd%8pd%8Pa%8Pa%88899 9+979@C9O9[9c9 l90u9@~999X9 99 9@`7[init_current_mediasetmediamodesetmediaoptsetmediasetmediainstv;G;v;5,;-n4`7;- v;-`;;@;;;-5,;media_statusmedia_constructorZ;c;~xj:f%o:c;~xj:f%~xc;~xc;e%m;c;m;Z;e%l;c;W:~xe%d!c;d!Hf%1+ paddr_matchT``4|@``$settunnel<,Pa%<f%print_link_addressessetvlansetvlanif=(g%== g%==(GN=dfJLdddddddddNdddddddddddddddPRTVXZ\^`bsetifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchansethidessidsetapbridgesetiffragsetifrtsjCmCpCsCCg%C Pa%Ch%CC< Pa%K@8h%J@K@ * Pa%Üh%Ch%Cg%C Pa%hh%;@ * Pa%h%>g%C@@ @@ >> ,V4invalid major numberinvalid minor numbertoo many fields for format' !ffs@JK KK%K-KC4KL@S_gkK?KHK ZKJ "IbKuKKKKKKb K@K LL/L@PL W1a1iLnL$wLW|L LL((L Ms66KFiM"I -KZK cIKI@M"M'M0M:M>MCMJM bnorripbgensbextattbnojolietbnocasetransbrrcaseinsL Ms66KFiM"I -KZK cIK4@5FNI@U@BK?KL Ms66KFiM"I -KZK cIKK K4@5FNBKU@MNI@%KL Ms66KFiM"I -KZK cIKI@ & 2L Ms66KFiM"I -KZK cIK4@5I@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirror &)<##03CFI !L Ms66KFiM"I -KZK cIKI@vQQd*Q Q@QQQQQ Q @mPsPQ|PPP P@bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacrecvrpcrpc_getportrpc_callsendrecv $mL Ms66KFiM"I -KZK cIKI@BK?K. 2 0 #:NSao}>(IWlZ%[S[[[[V\m\\\\\].]d]w]]]] ^,^^^^^^^$_%s: can't read disk label; disk type must be specified%s partition type is not `%s' WTWTbSS /+-$ '5GIUamz -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinit  #'+3;CKSW_goy@)kB:kCIkFUkInkLxkNkO3mSkakbkckekflhJliVlkblmplnlolrlslul@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:@@r@h rprp rprp ` rr@ r $1м|^t0 Non-system disk Press any key to reboot bj #'@PSVgmpP\o,{\ %>TrzrrrԼ(().<CTs~bitmask_scan!ipu| !&ADGINPSV]bg9?LhLLL2hw.disknamesfetch_url6sendrequestrecvrequest2B_{ "*.>PTdjlptx|***************************************************************************************************************************************************************************************************************************************@[9>plEt9Vx'1HBHHHP ,:EMT]eit| NetBSD gzip 20240203 0000000)  " $#!%Z^\`[_]a.CH @j18RnMkkk=kkkk>ddddddd+1YMX]G;btH'2;z?5 'ug PD]o!by9GJ]/6ePQWDbQg ] k ] : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. 2&*.)/35;!#%'+-1]8;2"$&(*, " $ & 1!4\V$F -7=QSd+AHddddddddddddddddddddddddd dDMdVdd_qddvddddd--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data> <   {m$ b$*-5?B3}}}}}}=}}Zf}}}}}E}a}}}}}}}}}}}}}}}}J}}Tam}}r})}Q}}}\  . ' &26: #&/)  #&- ),/ $     #3( &" y(x,^,p,g,k,xͭl,ޭ~m,`,+:_,G2}n,Pn,Yo,cr,lt\,.k,k,`k,Wq,y],Ǯ\,Ӯ7q,7`,b,ϭc,d,+6a,I2e,Re,[f,es,qϭt,u,i,2v,v,ůw,collectñf2C`EsP=====NBNXbkrn4ĢȢ(Ң֢ޢ"NAME=$a1|L mount_disks>    "#$%      "#$%&'()*+. str_arg_substget_available_cds!,NXbkrn4ĢȢ(Ң֢ޢ" edit_fs_type_extx D xK      P 1 1 1L e0 u  edit_and_check_label NXbkrn4ĢȢ(Ң֢ޢ"disklabel_freedisklabel_set_part_infodisklabel_write_to_diskijzh u v x s y p l w m Hp `l \l s | $r o g n Ty ` @ g g m m l Hq l disklabel_change_geom v H %7outer_fill_part_menu_optsedit_outer_partsselect_part_schemerD----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_default " %2RAHXblv%/9#AJPV\bhai9258 7:=@C  %0VPS[^agl"'6;Cir{/=O_o %(5%;@(|nQn- q+K(W(|nQn- q+f(p(|nQn- q+}((|nQn- q+((|nQn- q+("=rGy=iG}((;Mt?((mWC 3KOO((yD<#*=(()3Dh& ))\ M}-%)6)@Mjy֬G)X)-чHi)-чH~)ZIчHW)IчHa)IчH()2IчH)L6 %?a))S'@ )Ѹ))*1@ )Ѹ*1x )Ѹ**( $</(KA[Seu mbr_get_generic_part_typembr_init_default_alignmentsmbr_create_new   PđTԄ Ȩt|H`4Ԗ̄\phT(mbr_get_part_devicembr_read_from_diskwrite_mbrmbr_write_to_diskinside_ext_partadjust_ext_partmbr_add_partmbr_free!***************************************************************************************************************************************************************************************************************************************lptx|control_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_start7#&))뙙 dhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_reportssiddhcpcd_readdump2sdhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2025 Roy Marplesmain duid_geteloop_event_addeloop_event_deleteeloop_q_timeout_addeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_signal_maskeloop_startif_discover  dddddddddddddRX]|22+d]222dddddddd.4jn22v2:2?K{21FdgN2/ddd *s%dvdJ!6K`splitvadd_environparse_optionnbcd e)fghijyk lmn.op*qr%s,tuu49v?wxFzyVA\BiC%DpEzFGHFIu.JKL3MNOPQQSťTUVWXZN146|A~!},*3CUcajhow|L ^+i4@L_lzdefault_configread_configrt_compare_protoHRHROOrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_recvrtPPrt_buildrt_deleteOOsa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_initys6.}script_buftoenv7դmake_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_os @$*.37>if_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @CDHDdhcp_openbpfget_leasedhcp_initread_leaselog_dhcp   KA dhcp_bound V      ' dhcp_informdhcp_start1dhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifa OOOOOOO OOOO'O4O>COHOMOOOOOOOOOOOOO OOOO!O.O;@OEOJ` ` t t P P VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B CC D 8DXD xD DlD D|MD E 8EBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ & ! !!     l |M@ !!!cs_pathDX  bc_base_max bc_dim_max bc_scale_max bc_string_max coll_weights_max expr_nest_max  line_max  re_dup_max  posix2_version   posix2_c_bind  posix2_c_dev  posix2_char_term posix2_fort_dev posix2_fort_run posix2_localedef posix2_sw_dev posix2_upe stream_max tzname_max atexit_maxaaaaae%JaaaaaaT[ jxk l ldm n nlPo o|Mp ?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: -o %s: option not supported`]ZWTQNKHEB?<96 0-*'$!c3 d38- sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU HeNKmakech    #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef'++9L.DDҵ;15MS7) q:e%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9,1nn|:pZnF$n20QKGC?:64*(++#+/'++ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>c~QQQQQQQQQQQQQQQQQQQQQQQQQQQQQ~QQQQQuQuQQQbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K| {`ijXFo]H" 64" TB00r | {`ijXFo]H" 64" TB00r " 0C0)8M%'wYj7ghL`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     @@ !1Aa  0@`M #+3;CScs inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_cstringprop_string_create_nocopyprop_string_create_formatprop_string_append_cstring_prop_number_externalize_prop_number_alloc1:74_prop_xml_intern_find_tag_prop_intern_decode_string_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dict_keysym_put_prop_dict_keysym_allocprop_dictionary_set_prop_dictionary_iterator_reset_locked_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equals_prop_dictionary_internalize_continue_prop_dictionary_remove6_prop_data_externalizeABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_equalsprop_data_data_prop_data_internalizetruefalse_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_removeprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_extern_append_char_prop_extern_append_encoded_cstring_prop_extern_append_start_tag_prop_extern_append_end_tag_prop_extern_append_empty_tag _prop_stack_push_prop_stack_pop_tcsetpgrp_tcgetpgrp_tcflush_tcdrain_cfsetspeed_cfsetospeed_cfsetispeed_cfmakeraw_cfgetospeed_cfgetispeedstrmode_unsetenv_int_strtouq_l_int__strtoull_l_int__strtou_l ` F g n t__strsuftollxpermute_args_getopt_longgetopt_internalunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s_getoptatolatofmemstream_seeksetbuffersetlinebufsetbufmkdtempfwidefsetposfpurgefgetposfgetc_regerror__icheckhost__gethostlooprshrcmdrresvport_af_addrrresvportresrcmdorcmd_afrcmd_af__ivaliduser_sairuserok_saruseroklink_addr0123456789abcdef_ether_ntoa_ether_aton_ether_line %x:%x:%x:%x:%x:%x %256s _ether_ntohost_ether_hostton_MD5End0123456789abcdef_MD5File_MD5Data_SHA1End0123456789abcdef_SHA1Data_SHA1Transform_SHA1Init_SHA1Update_SHA1Final_RMD160End0123456789abcdef_RMD160Data_uname_ttyname_r_times   +(&_DB?\\\addcmd_getmodecompress_mode_sethostname_popenpopenve_pclose_initgroupskMGTPEBKMGTPEKMGTPEBkMGTPEhumanize_numbermatchcompareglobextendg_Ctocg_lstatglob3g_opendirglob2g_statglob0globtildeglobexp2globexp1_glob_globfree%%%%%%%%%%%%%%%%%%%%%%%/_getttyent_getttynam_getpassfd_getmntinfo##: _getfsspec_getfsfilefnmatchxgettype_getdiskbyname0%%%%*%%%.%,creatTLS allocation failed, terminating <Q5vf9.z4 }Q5H@5UCmm};Zx0Nm<[y1OnSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec_tcsetattrwcscmp_stresep_setenv_vdprintf_lsetvbuf_regfree_inet_networkCof\$u0LDD????????J^YaTO|wrmhcG unvisAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~fts_pallocfts_sortfts_statfts_allocfts_build_fts_openfts_maxarglen_fts_close_fts_read_fts_set_fts_children_closedir  khwcschr_strcoll_l_int__strtoumax_l_opendir_initdir_alphasortinsertionsort_mergesort_rsetup_seekdir_unlocked_getdomainname @_strncasecmp_initstate_setstate?getenv_getenv_r__freeenvvar__canoverwriteenvvarauthunix_destroyauthunix_marshalmarshal_new_authauthunix_validate_authunix_create_xdr_authunix_parms_xdr_array _xdr_rejected_reply_xdr_opaque_auth_xdr_accepted_reply_xdr_des_block_xdr_replymsg_xdr_callhdr_seterr_replyacceptedrejected_strtok_rs J ip6_parsenumeric_filenoØŘstr2numberget_canonnameres_queryNres_querydomainNget_aigetanswergethostby*.getanswer: asked for "%s", got "%s"res_searchNexplore_numericget_portmatch_freeaddrinfo_getaddrinfoaddrconfigip6_str2scopeid)&_yphostent_gethtent_getservbyname_r_MD5Init_MD5Update_MD5Final @_vasprintf_l_getifaddrs"_freeifaddrsNBCDB atoi**!!**!!SPDGJM d'@Bʚ;__dn_count_labels/b@o@9)d-|""9 *Ҹ, charstraddname0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuv__ns_sprintrrf__ns_skiprr__b64_ntopABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/__b64_pton _inet_nsap_addr_inet_nsap_ntoa__ns_format_ttl=bk54ؗҜ<3#I9=D2[%Cod(h4)$ _posix1e_acl_entry_compare_acl_differs_acl_brand_as_sl_add_sl_find  5_strsep_int_strtoul_l_int__strtoll_lfgetsrewindmap_v4v6_addressmap_v4v6_hostentgethostbyname_internal_yp_hostent_yp_gethtbyaddr_yp_gethtbynamegetanswergethostby*.getanswer: asked for "%s", got "%s"_dns_gethtbyname_dns_gethtbyaddrgethostbyname_rgethostbyaddr_rinet_pton40123456789abcdef0123456789ABCDEF_inet_ptoninet_pton6inet_ntop4_inet_ntopinet_ntop6_fseeko_fparseln__fgetstr_xdr_int_xdr_u_int_xdr_long_xdr_u_long_xdr_int32_t_xdr_u_int32_t_xdr_short_xdr_u_short_xdr_int16_t_xdr_u_int16_t_xdr_char_xdr_u_char_xdr_bool_xdr_enum_xdr_opaque_xdr_bytes_xdr_netobj_xdr_union_xdr_string_xdr_wrapstring_xdr_int64_t_xdr_u_int64_t_xdr_hyper_xdr_u_hyper_xdr_longlong_t_xdr_u_longlong_t__dn_skipname0123456789__ns_name_ntop  __ns_name_ntol__ns_name_unpack2dn_find__ns_name_pack_int_strtol_l_vsprintf_l__getdelim_nsdbtaddsrc_nsdbtdump_nsdbtput_nsdispatchaUQY9~~zejjlN<7]%02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04d-00mnEtc/UTC _strcasecmpbsearch__cxa_atexit_internal__cxa_atexit_vsnprintf_lfreadfopenferror__swbuf333333333JiJJ yYZJjJJJjzZZ  , OOOOOOOOOoGJo>AOc&`0123456789abcdef0123456789ABCDEF__vfprintf_unlocked_l__sbprintfexponent^gYce\Q_strndup_strdup_gethostname" !#&(*-/14}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDؗҜ<3#I9=D2[%Cod( 7yACnF?O8M20HwZm1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG@#d  `\XTPLHDiea]BJ|xtDD0)m920HB;[[9############9YY99Y#########################m]_getpagesizeqsort_r__sfvwrite__sflush__swsetup*!*!__swhatbuf__smakebuf_tcgetattr_int__strtoi_l__sread__swrite__sseek__sclose_int__strtoimax_lCisalnumisalnum_lisalphaisalpha_lisblankisblank_liscntrliscntrl_lisdigitisdigit_lisgraphisgraph_lislowerislower_lisprintisprint_lispunctispunct_lisspaceisspace_lisupperisupper_lisxdigitisxdigit_ltouppertoupper_ltolowertolower_lc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB _citrus_NONE_stdenc_mbtowc_citrus_NONE_stdenc_mbtocs# dl_iterate_phdr_setup|333333333}J<<}0123456789ABCDEF0123456789abcdef_vsnprintf_ss_fwalk {__res_nmkquery__res_nopt__res_nopt_rdata/&_hf_gethtbyname2_hf_gethtbyname_hf_gethtbyaddrD!*07 _nsaddsrctomap ]:[=             WEEEdg          DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::clearerrF7Z77<7O__rec_dleafNEXTINDEXNEXTINDEXputpair__delpair__get_page__add_ovflpagesqueeze_key__free_ovflpageugly_split__split_page__big_insert__big_delete__big_splitN??S??E?NEXTINDEXODdȦԦܦ    ( 4<@HLT\`lt|<( N`'H< Ħ `ĥȥ Хإ  d          $ ( 0 8 @ H  P  X  `  d  p  x     <P x  ~ abaj _j6cWfahakalamaoaoapapbp bqbruÜtbvSw&bw3bx(xzC2z;bBqCpJLbOVbPebSlbTV6VwbXbZbZbbbbb bb b T2bb(li&jh&dmhh<jb(ppqhpuhh<< bb bpbb/dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbinD'}-+?=###%%%} '$'NaX`EVfeҮFnISixLlmC_nfpbu9Á΁q>sہhbvVVxT'@=8]%]%d alX{xZ_\470Zѩ_^y,Z`mY8 <YGA(Xe=HYp~5?XzT]8wmu&|t`ylv whsLvr^% ... ...x}Zp8!!"#$Qx&&&Qx'.'QxJ*+-zԱ\[ 1/Pa%.M (`%AabCdhlNsuvW:w:zp`%x`%`%`%`%T[ 8`%,c%L[ 7a%At[ 8}`L[ AL[ 7`%At[ 8}`t[ 8}`T[ 8da%Lc%T[ 7a%c%T[ 7a%c%T[ 7a%c%\[ 7O b%\[ 1hO @b%\[ 8.Pa%/V lb%\[ 65Pa%1 S b%Dd%b%b%\[ 7Pa%ZI(b%\[ 7c%ZI(b%T[ "8c%Pa% >l[ Pa%d[  K@Pa%* K@d[ Pa%* d[ < CPa% C\[ CPa%Ü` h%KMH!TH!YHX#_HL!gH"7!lH!,  rH$"N!wH"H!H!H"H!  '@@L Ms66KFiM"I -KZK cIK4@I@BK...... ...... lost+founddA.##.3Y! t! p" | $ C + c2\ .C0 C0 Q l s4 ?D5 # F`+DEF>Pcal[shd+ !"$'(+-.03569:a:+ /bin/sh`syyyzz &-8ALW^iowjL ")5@KPȎ )YfmzYzyԷ+Wi%wIg5KȎ2jLIm]Yu l%b%% L%z  * . ` d f o 04?4sz _##)#*#######%%&&H&S&&&&&&&&&&&&&&&&&&&&&&&&&&&'' ' '('('L'L'N'N'S'U'W'W'''''''++P+P+U+U+....////000>0A00001/11111112 2G2P2MNƤ`|0RTfhk`oooopՌ"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp| ( ( ) ) oK_pp0J#%')-Y[ : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----*0-000ooprt} %&,,ĨŨ&-GQ).1256CCLL|| /vz      8 : ? ?   $ ' FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB@4@4G4U4jj0k6kOoOooooo-0Fgi{BD6;luu!#$&*06DJ|%|%|%%%%%|%""%%%% e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ    l h b  w  i x X       0  $  k  j [<t z    is a directory is not a regular file (use -f to see it)%% ($*">L;" P7* 4 = K#X2e8w  ()!9F&{f) 5 e):31%;E6(N4CZ h+v,-.*?rzEE//'F   ;f(`7L IW \{fcm[ u  WmkRkRkYcWbkCkc kG ky wb YMYrWcap%T+-bh%@+t[ UuB`%+cX%P+dP%8+6QP%AD+gDH%(|\ e@%@+f8%+ F0%<+'Qg(%p+uh %,+ i%$+[ -Mej%PU J%!+k%H) ?) v \6 e6< D $   , \, S)     @  |  T 8h 8| 8 v, \6@ e6T 9L) '9\) M9l) s9|) !)   l H (    * d+ + ( 8 * @+ + j * k( X + <, ( 1 W <* <) (  ,) (  x * + + * (  | \ 8    p   `* t( 4   P $       p     u   d < ( h(   &( ' ( ) \     %D    t   4 C  L4 S\ _ g 4 99 ::}6E :$}` K%:(:,:6:La>:Q:Y:<!<>(?AAaAA BBBPllB2C'C C CC?D$EFGH!H@<.HMH`HHHHHHHIVII2JhJJJJJo$sKwKKK2K>LL L0La #b ?tb 7@` Q_ A<] B<] C<] D 8 _ E <] F <] G (<] H I<] I\ Y\ d\ L   1u 1e u "1>LZhw]8\X ]8\ Vx! Cq u y }     f( ]( y (( 0            ۢ +   |M ! " #! $- %: &D 'O (` )r *{ + , - - . .s//D /s01 2 3 4 596 7 8 9 : ; < = > ? @( [o/\< \L ]a ^l ^~ _ _ ` { { | } })~   -dd-ddTdd:dd:dd б ܱ@@` ## ### $,$4$<$@$H%P%X%%d%l&t&&'''(((ȩ)ԩ))*** ++$+,,8,D,H,P-\-h-l-t...///6;Ъ;ܪ00011<<(=4=@>L>X?`2h2t2|333978ī:ث44455 ! (" 4# @$ L% X& d' p( |) * . + , - / ̬0 ܬ1 2 3 4 5 6 (7 48 @9 L: X; d< p= |> ?  @!@"@#@ĭ$@Э%@ܭ&@'@)@*@ +@&`$'`4,@D-@T.@d/@t0@(`1@2@3@)`̮4@خ5@6@7@8@9@(:@8*`H;@X<@h=@x>@?@ `!`+`ȯ,`د"`#`-`$`.`(/`8%`HCXCdDlDxEEFFccddİeeȰ#а#ܰ&&0  $(,08@HPX`hpxȱ̱ $,4ܧ  @@ ,8 @ H P@X@l@p@@@``Į̃ Ԩ@بa D33333333d3333 $\UTC33A%B%$xhL33̰-339㼥ͤtgQ>PNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[Sž<%H%<%% C% 33UU33UU33UU`%vU+"Ō.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf / BܡHRP1%!V1%!$b1%!g1%!ttTP%T !,yR%"!&!&!<̰-!p!1!|!MSGTXTS627 5032 5057 5074 5096 5099 5104 5112 5119 5127 5135 5138 5141 5144 5148 5160 5169 5182 5211 5226 5769 5803 6486 6774 7482 7538 7612 7708 7883 7906 7929 7935 7944 7966 7970 7974 7977 7980 8085 8288 8527 8968 9406 9441 9456 9468 9474 9486 9535 9555 9595 9612 9629 9644 9691 9729 9777 9859 9983 10119 10160 10198 10235 10270 10280 10329 10479 10485 10490 10494 10514 10624 10644 10650 10664 10676 10687 10724 10758 10782 10884 10921 10943 11042 11097 11155 11166 11182 11234 11402 11609 11780 11844 11896 12167 12716 13244 13675 14013 14346 14459 14474 14483 14643 14814 14964 15128 15151 15175 15190 15265 15405 15582 15737 15749 15829 15930 15976 16002 16072 16083 16092 16105 16131 16146 16162 16175 16230 16241 16256 16460 16693 16722 16737 16806 16880 16953 16983 17021 17075 17529 17555 17584 17688 17794 17979 18091 18206 18310 18997 19256 19396 19432 19602 19643 19779 19802 19839 19884 20135 20231 20285 20384 20395 20432 20469 20496 20505 20539 20546 20571 20598 20633 20647 20661 20690 20704 20721 20730 20752 20770 20787 20798 20817 20843 20861 20884 20901 20916 20931 20949 20976 21003 21025 21064 21082 21114 21342 21416 21459 21505 21652 21808 21852 22131 22158 22517 22701 22853 23034 23181 23339 23360 23408 23418 23426 23437 23448 23458 23465 23480 23492 23529 23559 23598 23651 23709 23730 23737 23756 23777 23784 23806 23828 23848 23870 23901 23938 23960 23974 24020 24049 24083 24123 24158 24186 24234 24243 24252 24257 24266 24275 24292 24296 24301 24307 24311 24349 24358 24385 24405 24428 24447 24474 24496 24528 24544 24549 24559 24582 24604 24621 24638 24651 24660 24669 24675 24702 24709 24733 24754 24778 24791 24810 24835 24858 24874 24880 24892 24922 24930 24970 24981 24992 25003 25020 25037 25051 25068 25284 25588 26036 26252 26516 26788 26840 26876 26912 26963 26980 27018 27032 27039 27056 27059 27064 27073 27085 27096 27105 27126 27168 27206 27222 27253 27278 27313 27369 27409 27430 27450 27491 27520 27568 27801 27836 28043 28062 28099 28160 28198 28237 28393 28408 28454 28502 28525 28561 28571 28581 28592 28597 28660 28708 28752 28813 28846 28947 28965 29104 29126 29249 29263 29273 29296 29401 29457 29573 29604 29609 29635 29674 29684 29727 29737 29753 29768 29786 29809 29839 29860 29886 30083 30126 30130 30136 30142 30147 30158 30172 30201 30233 30245 30292 30342 30382 30409 30425 30434 30477 30483 30491 30495 30515 30532 30544 30575 30831 30880 31456 31483 31515 31543 31595 31601 31607 31612 31633 31649 31671 31700 31841 31975 31988 32124 32126 32128 32130 32147 32160 32178 32205 32209 32215 32220 32228 32234 32274 32276 32286 32301 32318 32352 32384 32422 32451 32480 32502 32545 32571 32615 32751 32753 32833 32879 32927 33032 33134 33173 33240 33247 33308 33372 33376 33383 33505 33574 33862 34000 34141 34222 34269 34275 34298 34344 34347 34373 34416 34481 34543 34613 34681 34774 34993 35018 35022 35058 35076 35104 35146 35190 35254 35304 35380 35402 35454 35498 35537 35571 35601 35632 35657 35666 35678 35686 35697 35709 35728 35752 35801 35818 35842 35885 36207 36210 36224 36237 36249 36256 36267 36274 36281 36290 36300 36317 36333 36383 36391 36399 36409 36420 36438 36455 36476 36498 36507 36517 36544 36550 36560 36579 36595 36613 36633 36642 36653 36660 36677 36696 36717 36727 36744 36750 36766 36781 36796 36817 36839 36858 36868 36873 36878 36896 36915 36934 36940 36959 36979 36999 37017 37022 37028 37045 37061 37082 37095 37103 37123 37147 37164 37172 37183 37204 37210 37222 37244 37258 37267 37288 37306 37315 37349 37372 37399 37431 37454 37474 37485 37517 37533 37544 37557 37580 37602 38110 38140 38171 38199 38213 38414 38636 38803 38890 38907 38925 38942 38971 39018 39029 39048 39070 39149 39341 39369 39487 39509 39650 39669 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-11.99.3. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? - wd: SATA, ATA oder IDE - sd: SCSI oder USB-Speicher - ld: NVMe (z.B. M.2-Karte), SD/MMC-Karte oder virtueller Speicher Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis (leer lassen, um abzubrechen)?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-11.99.3 ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-11.99.3 ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-11.99.3 ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-11.99.3 ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Die Installation wird abgebrochen. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-11.99.3 InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-11.99.3 ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPHTTPSNFSCD-ROM / DVD / Medium mit AbbilddateiDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzDas Verzeichnis, in das die alten a.out-Bibliotheken gesichert werden sollten, konnte nicht erstellt werden. Bitte starten Sie die Aktualisierung erneut und stellen Sie sicher, dass alle Dateisysteme gemountet sind.Eins der Verzeichnisse /emul/aout oder /emul war ein symbolischer Link, der auf ein nicht-gemountetes Dateisystem verwies. Der Link wurde mit einer '.old' Erweiterung versehen. Sobald Ihr aktualisiertes System gestartet ist, mssen Sie das neu erstellte /emul/aout mit dem alten Verzeichnis abgleichen. Sendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd (Secure Shell daemon) aktivierenntpd aktivierenntpdate beim Starten ausfhrenMulticast DNS aktivierenxdm (X Display Manager) aktivierencgd aktivieren (kryptografische Laufwerkskonfiguration)lvm (Logical Volume Manager) aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte Partitionierung (Software-RAID, ...)Partitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen? So knnen Sie 'su' verwenden, um Superuser zu werden.Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden? Wenn Sie von einer Diskette gebootet haben, knnen Sie diese jetzt entfernen. Kann den Bootblock des Filecores nicht lesen Kann die RISCiX Partitionstabelle nicht lesen Keine NetBSD Partition in der RISCiX Partitionstabelle gefunden - erstellen eines Labels nicht mglich. Keine NetBSD Partition gefunden (eine Nur-Filecore Platte?) - erstellen eines Labels nicht mglich. Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm rmdir sh stty sync . .. dhcpcd.confgroup master.passwd netconfig protocolsservicesMSGTXTS627 5032 5070 5087 5102 5105 5108 5113 5121 5129 5137 5140 5143 5152 5164 5176 5185 5194 5220 5231 5766 5793 6359 6659 7300 7347 7460 7553 7587 7606 7624 7632 7641 7666 7670 7674 7677 7680 7802 7987 8215 8735 9086 9115 9128 9141 9146 9166 9185 9206 9265 9282 9296 9318 9363 9389 9430 9508 9626 9740 9794 9823 9855 9894 9900 9933 10056 10063 10067 10075 10099 10181 10187 10194 10206 10220 10229 10262 10281 10293 10403 10465 10484 10603 10654 10706 10718 10737 10789 10993 11201 11392 11452 11501 11767 12225 12890 13312 13634 14059 14191 14223 14235 14413 14610 14771 14905 14925 14958 14972 15041 15154 15326 15461 15481 15593 15685 15708 15731 15790 15805 15826 15841 15862 15882 15907 15921 15945 15957 15975 16185 16435 16456 16472 16525 16593 16666 16703 16729 16805 17300 17326 17348 17455 17562 17763 17836 17920 18020 18515 18753 18904 18938 19073 19117 19256 19297 19342 19389 19633 19766 19828 19922 19927 19961 19995 20010 20038 20071 20078 20103 20121 20147 20154 20169 20184 20204 20244 20261 20281 20302 20324 20339 20359 20381 20396 20409 20423 20435 20447 20461 20484 20507 20525 20568 20619 20656 20841 20904 20940 20989 21080 21210 21263 21523 21570 21931 22081 22250 22390 22510 22642 22682 22729 22739 22747 22757 22765 22776 22787 22801 22826 22867 22900 22933 22968 23022 23047 23066 23088 23093 23099 23128 23145 23172 23190 23211 23233 23252 23262 23292 23318 23345 23394 23422 23449 23502 23512 23522 23528 23538 23547 23567 23571 23576 23582 23586 23621 23630 23661 23678 23705 23726 23746 23765 23791 23804 23812 23828 23859 23890 23911 23937 23950 23958 23969 23975 23999 24009 24021 24039 24050 24070 24086 24112 24134 24150 24162 24182 24208 24214 24244 24258 24272 24295 24314 24333 24351 24369 24592 24898 25316 25517 25757 25941 26019 26074 26141 26181 26204 26238 26249 26257 26280 26283 26286 26292 26303 26315 26328 26358 26402 26415 26428 26465 26479 26490 26501 26512 26529 26540 26587 26610 26659 26900 26933 27188 27209 27242 27295 27321 27348 27504 27510 27553 27573 27592 27621 27628 27635 27642 27647 27696 27734 27768 27825 27853 27898 27915 28016 28021 28098 28112 28122 28146 28269 28350 28460 28488 28493 28509 28538 28546 28587 28594 28608 28621 28629 28648 28681 28701 28721 28937 28968 28973 28980 28987 28991 29005 29017 29032 29065 29078 29133 29191 29227 29245 29263 29281 29318 29324 29332 29336 29357 29374 29385 29407 29585 29629 30331 30355 30389 30408 30453 30460 30467 30471 30495 30506 30511 30574 30695 30818 30831 30965 30967 30969 30971 30981 30990 31003 31030 31034 31040 31045 31054 31059 31086 31088 31101 31113 31128 31156 31200 31247 31263 31285 31296 31329 31349 31398 31498 31500 31565 31614 31663 31767 31865 31906 31997 32004 32065 32129 32134 32140 32249 32308 32559 32700 32827 32895 32932 32939 32966 33012 33015 33036 33081 33132 33191 33260 33307 33412 33555 33580 33584 33618 33635 33659 33711 33762 33834 33900 33998 34015 34046 34082 34116 34140 34164 34197 34217 34227 34235 34243 34253 34264 34278 34304 34352 34375 34395 34436 34735 34738 34752 34764 34771 34790 34804 34811 34818 34827 34837 34854 34870 34918 34926 34934 34944 34955 34973 34990 35009 35029 35036 35053 35070 35077 35090 35125 35142 35161 35181 35191 35207 35220 35238 35258 35279 35289 35309 35329 35342 35361 35374 35398 35421 35434 35445 35450 35457 35475 35494 35513 35521 35540 35560 35585 35603 35610 35617 35630 35639 35660 35673 35681 35701 35729 35746 35752 35763 35794 35802 35815 35837 35859 35868 35889 35907 35914 35937 35956 35983 36001 36021 36034 36049 36070 36084 36091 36105 36120 36139 36684 36717 36745 36774 36782 36819 37131 37308 37385 37402 37420 37435 37457 37507 37517 37534 37556 37615 37773 37797 37927 37952 38078 38096 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-11.99.3. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-11.99.3 ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-11.99.3 ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-11.99.3 completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-11.99.3. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. La instalacin ha sido interrumpida. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-11.99.3Salir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-11.99.3Ejecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si ha iniciado desde disquette, ahora debera retirar el disco. No se puede leer el bloque de arranque filecore No se puede leer la tabla de particiones RISCiX No se ha encontrado ninguna particin NetBSD en la tabla de particiones RISCiX - No se puede etiquetar No se ha encontrado ninguna particion NetBSD (disco solo de filecore?) - No se puede etiquetar Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): NcleoThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located. umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS627 5032 5068 5085 5100 5104 5108 5113 5124 5130 5136 5139 5142 5145 5149 5161 5173 5183 5213 5225 5654 5681 6257 6617 7302 7363 7441 7536 7576 7598 7616 7622 7631 7657 7661 7665 7668 7671 7793 7978 8206 8735 9153 9182 9195 9208 9215 9235 9254 9277 9320 9340 9359 9382 9426 9455 9496 9562 9674 9788 9842 9871 9903 9942 9948 9981 10059 10065 10069 10074 10115 10252 10262 10270 10289 10303 10312 10344 10385 10398 10523 10581 10600 10719 10775 10827 10838 10854 10893 11143 11315 11487 11542 11577 11826 12229 12527 12794 13155 13335 13654 13674 13687 13876 14020 14216 14350 14370 14403 14422 14523 14678 14866 15053 15073 15152 15250 15288 15311 15401 15422 15445 15464 15488 15518 15562 15595 15618 15630 15648 15916 16235 16266 16301 16365 16440 16510 16541 16571 16663 17154 17184 17201 17341 17482 17679 17798 17945 18112 18670 18966 19147 19192 19355 19409 19544 19580 19640 19690 19981 20090 20147 20244 20249 20284 20319 20334 20358 20391 20396 20421 20437 20460 20467 20484 20499 20518 20550 20554 20574 20592 20604 20617 20635 20659 20677 20696 20723 20750 20762 20783 20813 20843 20868 20901 20936 20974 21227 21296 21351 21412 21530 21689 21743 22004 22055 22431 22586 22730 22870 22978 23163 23193 23236 23246 23254 23264 23276 23297 23306 23312 23344 23384 23420 23458 23495 23543 23567 23579 23593 23601 23609 23636 23653 23682 23703 23726 23735 23754 23766 23810 23848 23875 23919 23947 23974 24027 24038 24049 24056 24066 24075 24109 24113 24118 24124 24128 24163 24173 24203 24226 24255 24277 24299 24321 24348 24360 24372 24391 24425 24458 24479 24503 24516 24528 24541 24547 24573 24583 24594 24618 24628 24648 24668 24685 24711 24735 24748 24768 24802 24809 24838 24861 24884 24900 24915 24930 24945 24959 25147 25452 25883 26074 26309 26497 26539 26589 26643 26691 26713 26754 26765 26773 26797 26801 26805 26814 26825 26836 26851 26882 26928 26941 26954 26984 26998 27010 27022 27034 27052 27075 27120 27143 27203 27455 27482 27744 27762 27789 27838 27868 27899 28031 28038 28087 28110 28134 28163 28171 28181 28189 28194 28247 28296 28336 28402 28435 28479 28502 28603 28608 28685 28699 28709 28733 28856 28937 29047 29075 29080 29096 29125 29133 29174 29182 29196 29209 29217 29236 29269 29289 29309 29525 29556 29576 29582 29589 29593 29608 29627 29653 29662 29674 29728 29786 29821 29840 29857 29869 29904 29910 29918 29922 29943 29960 29971 29996 30174 30228 30919 30938 30973 31003 31049 31055 31062 31066 31090 31106 31112 31187 31337 31456 31469 31537 31539 31541 31543 31553 31566 31583 31610 31614 31620 31625 31634 31639 31666 31668 31681 31693 31708 31736 31780 31827 31843 31865 31876 31909 31929 31978 32078 32080 32156 32211 32261 32360 32455 32503 32593 32600 32661 32725 32730 32736 32839 32891 33137 33298 33453 33524 33577 33584 33611 33661 33664 33685 33731 33786 33845 33914 33961 34066 34209 34234 34238 34272 34289 34327 34380 34420 34496 34561 34655 34676 34714 34754 34790 34814 34837 34876 34906 34913 34922 34930 34938 34952 34968 34996 35048 35065 35086 35130 35472 35476 35491 35502 35510 35529 35541 35548 35555 35564 35574 35591 35607 35661 35669 35677 35687 35698 35716 35733 35749 35767 35774 35792 35809 35816 35826 35857 35876 35895 35915 35925 35944 35957 35977 35997 36018 36028 36047 36066 36076 36093 36107 36130 36154 36167 36177 36182 36186 36204 36223 36242 36247 36266 36286 36311 36326 36330 36337 36347 36356 36377 36391 36399 36419 36445 36462 36470 36481 36512 36517 36530 36552 36567 36576 36597 36615 36624 36668 36692 36719 36734 36751 36765 36796 36820 36851 36858 36872 36887 36906 37451 37484 37512 37541 37549 37586 37898 38075 38152 38169 38187 38202 38224 38274 38284 38301 38323 38382 38540 38564 38694 38719 38845 38863 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-11.99.3. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-11.99.3 est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-11.99.3 est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-11.99.3 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-11.99.3 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-11.99.3 Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-11.99.3Excuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si vous avez dmarr sur une disquette, vous pouvez maintenant la retirer. Impossible de lire le contenu du secteur de dmarrage Impossible de lire la table de partitions RISCiX Aucune partition NetBSD trouve dans la table de partitions RISCiX. Impossible de crer un label. Aucune partition NetBSD trouve (disque filecore uniquement ?). Impossible de crer un label. Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationditerGroupeMSGTXTS627 5032 5073 5089 5107 5111 5115 5125 5134 5140 5146 5149 5152 5161 5171 5184 5192 5203 5228 5240 5748 5780 6272 6561 7106 7152 7256 7342 7378 7393 7411 7419 7427 7454 7458 7462 7465 7468 7579 7764 7992 8468 8802 8831 8846 8861 8869 8883 8901 8922 8973 8989 8999 9019 9065 9095 9148 9205 9316 9437 9481 9514 9553 9587 9594 9627 9704 9710 9717 9724 9753 9865 9871 9882 9899 9916 9925 9954 9966 9976 10077 10139 10159 10279 10316 10372 10386 10407 10444 10654 10829 10978 11013 11065 11281 11594 12117 12478 12768 13161 13296 13309 13320 13466 13645 13776 13910 13930 13963 13982 14065 14180 14321 14446 14460 14568 14661 14690 14710 14786 14803 14821 14837 14856 14876 14893 14905 14931 14943 14961 15162 15401 15428 15445 15501 15563 15623 15654 15678 15737 16113 16143 16160 16268 16378 16518 16592 16668 16746 17238 17458 17569 17600 17727 17763 17891 17918 17958 18004 18220 18344 18412 18512 18517 18553 18589 18603 18626 18659 18663 18688 18707 18733 18738 18753 18768 18787 18812 18824 18846 18863 18876 18888 18906 18930 18945 18962 18975 18986 18997 19017 19046 19075 19099 19134 19169 19196 19383 19432 19464 19512 19609 19742 19788 19980 20010 20332 20461 20601 20741 20858 20993 21037 21080 21088 21098 21110 21122 21130 21141 21168 21202 21237 21268 21303 21339 21386 21406 21423 21441 21446 21453 21478 21494 21515 21532 21549 21567 21584 21597 21628 21653 21684 21715 21750 21777 21830 21840 21850 21856 21865 21873 21888 21892 21897 21903 21907 21942 21952 21981 21997 22023 22040 22059 22080 22096 22109 22114 22122 22137 22163 22182 22210 22228 22239 22245 22251 22272 22282 22293 22311 22333 22350 22363 22384 22404 22424 22435 22448 22470 22477 22502 22517 22537 22549 22566 22583 22603 22622 22799 23083 23393 23573 23784 23972 24038 24085 24140 24184 24204 24233 24245 24251 24267 24271 24275 24283 24293 24305 24320 24339 24375 24386 24397 24436 24448 24458 24468 24478 24494 24512 24561 24582 24627 24871 24897 25151 25166 25192 25249 25283 25318 25460 25477 25526 25547 25563 25592 25597 25602 25608 25613 25652 25687 25717 25772 25805 25851 25865 25944 25949 26003 26017 26027 26051 26137 26185 26291 26325 26332 26347 26374 26383 26422 26429 26451 26470 26486 26504 26536 26555 26572 26729 26760 26767 26776 26784 26791 26805 26823 26842 26852 26864 26905 26950 26979 27000 27023 27042 27080 27086 27094 27098 27119 27136 27145 27164 27310 27352 27862 27870 27894 27912 27956 27961 27966 27970 28001 28014 28023 28069 28195 28286 28298 28362 28364 28366 28368 28378 28392 28407 28434 28438 28444 28449 28458 28463 28490 28492 28507 28518 28533 28561 28605 28652 28668 28690 28701 28734 28754 28803 28903 28905 28973 29013 29058 29133 29199 29234 29315 29322 29383 29447 29454 29460 29559 29615 29891 30015 30126 30188 30226 30234 30256 30305 30308 30329 30374 30429 30488 30557 30604 30709 30852 30877 30881 30915 30931 30956 31004 31040 31101 31155 31236 31258 31297 31334 31366 31390 31417 31443 31457 31465 31475 31483 31497 31510 31522 31546 31587 31613 31630 31659 31983 31986 32000 32012 32018 32034 32046 32053 32060 32069 32079 32096 32112 32155 32163 32171 32181 32192 32210 32227 32240 32266 32273 32281 32298 32306 32323 32347 32366 32385 32404 32414 32425 32439 32457 32477 32497 32506 32529 32549 32560 32575 32587 32606 32625 32636 32646 32651 32657 32675 32694 32713 32720 32739 32759 32784 32801 32807 32815 32825 32837 32858 32874 32882 32902 32922 32944 32952 32963 32986 32993 33007 33029 33046 33055 33076 33094 33103 33134 33150 33177 33196 33216 33234 33255 33269 33289 33296 33315 33330 33349 33894 33927 33955 33984 33992 34029 34341 34518 34595 34612 34630 34645 34667 34717 34727 34744 34766 34825 34983 35007 35137 35162 35288 35306 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-11.99.3. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-11.99.3 zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-11.99.3 zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-11.99.3 zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-11.99.3 zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Instalacja zostala przerwana. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-11.99.3Wyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-11.99.3Uruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPHTTPSNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Jesli uruchomiles komputer z dyskietki, mozesz ja teraz wyciagnac. Nie moge przeczytac bootbloku filecore Nie moge przeczytac tablicy partycji RISCiX Nie znalazlem partycji NetBSD w tablicy partycji RISCiX - Nie moge nazwac Nie znalazlem partycji NetBSD (dysk filecore?) - Nie moge nazwac Instalowanie bootblokow na %s.... Partycje NetBSD na dysku %s wygladaja teraz tak (Rozmiary i Przesuniecia w %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766:  . ..zerowd3pwd3owd3nwd3mwd3lwd3kwd3jwd3iwd3hwd3g wd3f!wd3e"wd3d#wd3c$wd3b%wd3a& wd3'wd2p(wd2o)wd2n*wd2m+wd2l,wd2k-wd2j.wd2i/wd2h0wd2g1wd2f2wd2e3wd2d4wd2c5wd2b6wd2a7 wd28wd1p9wd1o:wd1n;wd1m<wd1l=wd1k>wd1j?wd1i@wd1hAwd1gBwd1fCwd1eDwd1dEwd1cFwd1bGwd1aH wd1Iwd0pJwd0oKwd0nLwd0mMwd0lNwd0kOwd0jPwd0iQwd0hRwd0gSwd0fTwd0eUwd0dVwd0cWwd0bXwd0aY wd0Zurandom[ttypf\ttype]ttypd^ttypc_ttypb`ttypaattyp9bttyp8cttyp7dttyp6ettyp5fttyp4gttyp3httyp2ittyp1jttyp0ktty01ltty00m ttynstdoutostdinpstderrq st1r st0ssd3ptsd3ousd3nvsd3mwsd3lxsd3kysd3jzsd3i{sd3h|sd3g}sd3f~sd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2a sd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2krwd2jrwd2irwd2hrwd2grwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1erwd1drwd1crwd1brwd1arwd1rwd0prwd0orwd0nrwd0mrwd0lrwd0krwd0jrwd0irwd0hrwd0grwd0frwd0erwd0drwd0crwd0brwd0arwd0rst1rst0rsd3prsd3orsd3nrsd3mrsd3lrsd3krsd3jrsd3irsd3hrsd3grsd3frsd3e rsd3d rsd3c rsd3b rsd3a rsd3rsd2prsd2orsd2nrsd2mrsd2lrsd2krsd2jrsd2irsd2hrsd2grsd2frsd2ersd2drsd2crsd2brsd2arsd2rsd1p rsd1o!rsd1n"rsd1m#rsd1l$rsd1k%rsd1j&rsd1i'rsd1h(rsd1g)rsd1f*rsd1e+rsd1d,rsd1c-rsd1b.rsd1a/rsd10rsd0p1rsd0o2rsd0n3rsd0m4rsd0l5rsd0k6rsd0j7rsd0i8rsd0h9rsd0g:rsd0f;rsd0e<rsd0d=rsd0c>rsd0b?rsd0a@rsd0Armd1cBrmd1aCrmd1Drmd0cErmd0aFrmd0Grld7pHrld7oIrld7nJrld7mKrld7lLrld7kMrld7jNrld7iOrld7hPrld7gQrld7fRrld7eSrld7dTrld7cUrld7bVrld7aWrld7Xrld6pYrld6oZrld6n[rld6m\rld6l]rld6k^rld6j_rld6i`rld6harld6gbrld6fcrld6edrld6derld6cfrld6bgrld6ahrld6irld5pjrld5okrld5nlrld5mmrld5lnrld5korld5jprld5iqrld5hrrld5gsrld5ftrld5eurld5dvrld5cwrld5bxrld5ayrld5zrld4p{rld4o|rld4n}rld4m~rld4lrld4krld4jrld4irld4hrld4grld4frld4erld4drld4crld4brld4arld4rld3prld3orld3nrld3mrld3lrld3krld3jrld3irld3hrld3grld3frld3erld3drld3crld3brld3arld3rld2prld2orld2nrld2mrld2lrld2krld2jrld2irld2hrld2grld2frld2erld2drld2crld2brld2arld2rld1prld1orld1nrld1mrld1lrld1krld1jrld1irld1hrld1grld1frld1erld1drld1crld1brld1arld1rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rflash7rflash6rflash5rflash4rflash3rflash2rflash1rflash0rfd1prfd1orfd1nrfd1mrfd1lrfd1krfd1jrfd1irfd1hrfd1grfd1frfd1erfd1drfd1crfd1brfd1arfd1rfd0prfd0orfd0nrfd0mrfd0lrfd0krfd0jrfd0irfd0hrfd0grfd0frfd0erfd0drfd0crfd0brfd0arfd0rdk7rdk6rdk5rdk4rdk3rdk2rdk1rdk0rcd1crcd1arcd1rcd0crcd0arcd0randomptypf ptype ptypd ptypc ptypb ptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0 memmd1cmd1a  md1!md0c"md0a# md0$ld7p%ld7o&ld7n'ld7m(ld7l)ld7k*ld7j+ld7i,ld7h-ld7g.ld7f/ld7e0ld7d1ld7c2ld7b3ld7a4 ld75ld6p6ld6o7ld6n8ld6m9ld6l:ld6k;ld6j<ld6i=ld6h>ld6g?ld6f@ld6eAld6dBld6cCld6bDld6aE ld6Fld5pGld5oHld5nIld5mJld5lKld5kLld5jMld5iNld5hOld5gPld5fQld5eRld5dSld5cTld5bUld5aV ld5Wld4pXld4oYld4nZld4m[ld4l\ld4k]ld4j^ld4i_ld4h`ld4gald4fbld4ecld4ddld4celd4bfld4ag ld4hld3pild3ojld3nkld3mlld3lmld3knld3jold3ipld3hqld3grld3fsld3etld3duld3cvld3bwld3ax ld3yld2pzld2o{ld2n|ld2m}ld2l~ld2kld2jld2ild2hld2gld2fld2eld2dld2cld2bld2a ld2ld1pld1old1nld1mld1lld1kld1jld1ild1hld1gld1fld1eld1dld1cld1bld1a ld1ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullflash7flash6flash5flash4flash3flash2flash1flash0fd1pfd1ofd1nfd1mfd1lfd1kfd1jfd1ifd1hfd1gfd1ffd1efd1dfd1cfd1bfd1a fd1fd0pfd0ofd0nfd0mfd0lfd0kfd0jfd0ifd0hfd0gfd0ffd0efd0dfd0cfd0bfd0a fd0est1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drvctldrum dk7 dk6 dk5 dk4 dk3 dk2 dk1 dk0consttyconsolecd1ccd1a cd1cd0ccd0a cd0 bpf0 bpf ...# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin  . .. dhcpcd-hooksdhcpcd-run-hooks# $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use fi done # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  . ..20-resolv.conf 30-hostnamen $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime if [ -n "$rdnsstime" ]; then ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers if [ -n "$rdnss" ]; then new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi fi fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime if [ -n "$dnssltime" ]; then ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search if [ -n "$dnssl" ]; then new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi fi fi # Break when we don't have either [ -z "$rdnsstime" ] && [ -z "$dnssltime" ] && return 1 j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf retur# Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dkctl drvctl fdisk fsck fsck_ffs  fsck_msdos gpt halt ifconfig init mknod mount  mount_cd9660  mount_ext2fs  mount_ffs  mount_kernfs  mount_mfs  mount_msdos  mount_nfs  mount_tmpfs newfs  newfs_ext2fs  newfs_msdos ping reboot restore route rrestore shutdown slattach swapctl sysctl dumount ... ... . .. binmdecsbinshare . .. cu ftp gunzip gzcat gzip less more progress sed tar tip Htset ... . .. chroot . ..misc ... . .. db log  run spool ... ...  ...  . .. lock  . ..