08PmYh'&<  'mYh#"P''`',. ,.mYh'&P@@<@T 08PmYh'&<  'mYh#"P''`',. ,.mYh'&P@@<@TU mYh`',.yAmYhmYhmYhQ$f mYhmYhmYhRAmYhmYhmYh6AmYhmYhmYh7AmYhmYhmYh|AmYhmYhmYhAmYhmYhmYhAmYhmYhmYhAmYhmYhmYhAmYhmYhmYhmK$$mYhmYhmYhX`hpx$mYhmYhmYh (0S$\mYhmYhmYh8@HPX`hpxP$tmYhmYhmYh3Q$mYhmYhmYh4JAmYhmYhmYhCmYhmYhmYhAmYhmYhmYhAmYhmYhmYhmmYhmYhmYh (08@HPX`hpx\$mYhmYhmYh}$mYhmYhmYh$>mYhmYhmYh$mYhmYhmYh$smYhmYhmYh$mYhmYhmYhAmYhmYhmYhm mYhmYhmYh$mYhmYhmYh $mYhmYhmYhAmYhmYhmYhAmYhmYhmYhAmYhmYhmYhAmYhmYhmYh$QmYhmYhmYh ($mYhmYhmYh $mYhmYhmYh$mYhmYhmYh$mYhmYhmYh$mYhmYhmYh$mYhmYhmYh$mYhmYhmYhAmYhmYhmYhAmYhmYhmYhAmYhmYhmYhAmYhmYhmYhAmYhmYhmYhAmYhmYhmYhTU_]- v\/exRX?q !"r,5Eybuy& M_bq,CI81 lNcR(j%/#@dG;Jz%f 7e"%LBV!YV+n&16,. . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF4,$4 (@@JJ " "zZzZ $ , , ,, $ , ,NetBSD8nAPaXUSR&ffffUVSʏ(8,,9s 9r[^]UWVSŁÚ(]P PLt,1t&tuAt[^_]Yuڅtft9s1u+z 9suփ 9r}tt~t111us t0#t&wfuUSQE$uԋ}{̋CE29sSU]MȍXE9s1u\tED u|E9rϋU]u9r09Jt*tE9ǍvuUWVS(E@@9s{*;9r[^_]UWVSé(E u -M 8ME @E  -t/tun} ,9s 9rEt E$m,p$_,,9s 9r@"$8ED$E D$E @$$ -MD$ D$ D$$1ɉL$G$x;[$SWD(5u1ƃ5DtЃt[$l_[SW(4uYƃ4t|$[<$ktH?t<$k8tЃ_[UWVSh "h "h- %1t:PB-YxOvh-j XZ3h%h-I h-j j!UEU MsMU HE]TUVS1ۋ݀%tVPW-ZYu ݄%C܍e[^]US9Ph!"h-h-h!"腃% CtsPh!"h-jkUWVSE tuh!" URhc@5- t5-h!"jЍu\#5!#M\#5!#E\#5!#WVSQRP5-h""EE t\#5!#RPh/""  u5-h="" 1e[^_]U5-^@XUjhc 5- t5-hV""j1USRj EPS貖 xU:t Shd""j袌]UPEU Ph}"" JtPh""EEEPhc5-; t5-h""je1UWVSSuE H1ۃv>PW*ZYtC`%uދd%Eh&"W*ZY1tFEEPhc5- t5-h""jӋ1e[^_]US u Sh""j肋]UVS1@%tSPJ*ZYtFSh""jLD%e[^]UWVS ]u} Sh}"" } ~Sh"";1}{EFE} t!v""21UWVS`] u~ uh""Uȹ1Rhc@5-E 5-h!"j -DPEU Eu>M9Mt66EE1EEEK>tt,uh#" 1}}}}}E뺉t9Wuh#"j<U9Uu\}t }uEEEqEeEEVEEċ]9]}t;$}t)}t(u9ut8Eċu9u}l}uE EEEԅu.u9u<E4@%5-h#"d "}t}uuu1ۉ]EuM9~VQuh#"j6k]lSpEYu h#"j1}E1҉Uuĉu܋UUMM]]}}Ph c5- u EX@1}Wuy5-h$"jՅEuPE4@%h#$"yCE rh+$"h3^ElU9U|-h-hW$XZCtCPh1$_Xj ^CtCPCPh@$" CtC"PSha$" Cts؋C4@%h$"k C$Ph$"RZYuwXE\1e[^_]UE-]UEd-]Uh&"jUh-&"j UhD&"jUhZ&"jUE E EE]"Uhjjjuho&"I_--Uhjjjuh&"_l-p-Uhjjjuh&"^--Ujjjjuh&"^--Ujjjjuh#$^X-\----u(Ujjjjuh&"g^X-\--u(Ujjjjuh&"5^--UShjjjuh&"^Ӊ‰؉-- u j]Ujjjjuh&"]0 -u jUWVSuX-1\--1->WXuWh&"j=SY_u Sh'"j貁xxuSh('"]hjjh%EPuu뺋-#H t uhB'" P-WPZ_-t/#=t --tt hr'"BX-ƒtuh'"<ۣt?%t4!t$t -ۣ -h'"j跀-e[^_]UVS-uX-D---H-L-;X-\-rgjD--H-L---X=5-u-E -)EU}t 13A}uke[^]Ë-- t H-L-Uh%hW$jUUh%hW$jUUSË@4URs(PZYts$hW$jS4K(E%= u!HPhm8@QR @ C !jjjQR Bu@u+8uK ]USQ=9s SiZSPEPWjƒ 1uE]UWVSx(w-Ë@4jjWP ƃ y h("j~C4WPs(Xe[^_]UWVS]uVh-j/C4uu s(P(4+8jVj/$ +8؍e[^_]UWVS@-}t H-L- X-\-EUEUEU}uH- t?11ҋ}9׋u} ytEU--E-- t(jRP5h-t-P Bu@u 5d-h("IuSh@-Ɖ 19|4 u5d-h3("%*8t5d-hW$j`}11-E - tKE- -5\-5X-QP$----1ɉ - -5-=-9}u;9uu6E9\-u E9X-t--|--l--9}u9utT`-t%=-u-5d-hE("mXZ`-t5d-hi("j%|)u}H-L-+EUEUH-L-=X- \-9}Er }ME EtURD-)P5@- H-@-D- -- t8----SQRPU! ujhH%jV, e[^_]UVS]M Eu fft3SQHtlpCQSCAQSCAQSCAQSC AQ S C A Q S C A Q SCAQs[^]ÍL$qUWVSQ- -t/jh"jX+ - -tjh"j:+ jEP謘i]eƉߋE׉pti$-% -Ɖߡ(-׋pt)ptZYt puDžp1t5-5-5-5-5-5-5-5-h("jd]S,S$Sj=*- - t7ƃ^K% tJ#QRPh#)"jdSSP$Sj)$-- t7ƃ^K% tJ#QRPh<)"jdSdS$Sj)$-- t7ƃ^K% tJ#QRPhO)"jdSS$Sje)$ --iቍhltpRP4Ɖ׍xPjhtp WVxPhlSQhf)"jd]S~$S$Sj( eY[^_]a&Uuj#UWVS--5- --u3jRP5--P B@;1S0 -v[H0 -S5-5--P$ t-u:5-hW$j&w-uNu<)u-h)"jvt5-hW$4}!XZe[^_]UWVS`-l- p-u?j X-\-%X-RP5h-t-P B@4tAfEEEPhm5h-t-P tS5d-hW$j.v11;5l-p-5X-5@-5h-t-P$ ~fEEEPhm5h-t-P @t;5l-p-s>5X-5@-h@- ;\-C;X-7벍e[^_]UWVSƉ׉ˡ-҃Pj h5!#WVRuV"VShv#(e[^_]UWVStÉ׃=-t%tPh)"h VWh PV蚁 =-ssVPh)"fs$s ssssh*"J0sxs1H- -tP-@5 -X1҉ -YX18-@-D-1UH-t*P1 -ZtP?5 -X1 -ZYuUjh-h-X2 yj$-$-(-$-1 -@=uUSUE L- -L-M -Ћ] Ӊ)~ -@[]Ã06w $%1Ã1D@11D1H1H11 D1 H 1 H 1 H 1 H 1H 1H1HøUWVSӃu]1d-2x-d-@ujjhd-hd-th."hW$=Y^d-h-x-|-`d-)p-k-1d-2x-d-@ujjhd-hd-Bth."hW$g=XZSjjhd-e[^_]UWVSƉӀ:0BZY1=p-Cue[_]UWVS`-9\-1ɉ \-ujjhd-}5d-=h-jjhd-hd-,th."hW$Q;XZ1ۊd-2x-d-Cu5x-=|-u\_uk-v7h/"uPY^#~h%/"hW$:XZ thJ/"`-=`-~\-P\-d-e[^_]US]=\-uU ]`-1\-=`-x\-P\-d-[]U=\-uU`-1\-=`-xU\-]UWVS h[/"=Y18]E }=l-u>؍}01҉U"%]BuʀEt@9uSYthg/"hW$|9XZe[^_]US--9--RPNZYu[w 0VPhb#h-h#% 9-H-ua-tjtJj]-- -u -ųu١-P--M 1]UWVSSU-=-CE;U tM-119~149u1ɉs19~H -9E~@1Aˉt-X[^_]UVS5---19| t!-H<u -1[^]UWVSfEp E}u.h"5-_Z]tjEP_ Y^uD1Gh"R^_FPd-Zy }Ou PP x. E uhr/":-| zf%-Ѓu-h/"RMZYuu h/"6X넋-jEP [_bE --9-=}\SRKZYu[0SPhb#h-Qh#%I6-H--tjj-- -u -uΨuً-EH--8lx #xtދd-PRRe yɍe[^_]U-1----5-LN1҉--H-Yu-tjtjUWVSP- t u h/"5X 6ƅu -8u@-S5T-Ë=T-X9=P-|^SYt=-tj jsPEcUjjjRV蓩;EtGSZyh1e[^_]Ë @-Q@-y ;P-| t8-J 8-Uh8-PYXZUWVS u1ۉ߃=-tVI NyVXHF `=- -9^-؁}U|WQ"IZYU=-- -u-tjtj-u -C1 mCE -9-؁}ULQM5-HZYMUuX@0gPPhb#h-h#%2-H-t -/t1 -- -u- u - KF @t.0OPhb#h-Eh/"=2tt- -}-8=-t=-te[^_]UWVSu VE=--E`-E1ۉ--X=-t5d-11҉UuiEZUU-5-YUt(EEtBDd-PPjAƒ u- -t C-tjtj -u -uݨuEVu9uuHtg}tIu-=-tEu~h-h/"K-Y^=-u3B=-u-d-=-tJE -uh-h/"4KXZ-t!=-t9uuu$-Cu -19uu=-=-M -=-t1ҍe[^_]UWVS];!uh*"CPXZS h*"Pǃ u$0MPShH%h-h/"Ju WYXyh;!u7W Zy40LPShH%h-<h 0"4/Wǃ=-uVh$"h-  d-+E e[^_]UWVSu] }9tU=-t VP*VP/ZYy0 02LPhb#h-h$0".C1e[^_]UWVSQu VJ[=-tW1ۅtW;uRWNZuZW95`-u=-t =-u BRUPu xËUF?륃=-tuX؍e[^_]UWVSPu]>!uhr"FPY_V u Pƒ u$0KPVhH%h-h60"RuSRUǃ Uyl>!u7RZy40JPVhH%h-6hN0".-Rǃ=-uWh$"h- tE)؍X؍e[^_]UWVSW11 -yh-^u-P-s=- -9-؁}U|WQAZYUu[0IPhb#h-Sh#%K,-H--tj j =-- -u -uΨu١-u-1ۉ߉ u\--0--u-@t?0IPhg0"h-hr0"+f%-1--f-9t{t ---މe[^_]UWVSW-C{ u)ÃE-:TRPx Y^tE--9-ށ}VR>@_ZuZ0(HPhb#h-h#%*-H-t1-tj tj 5-- -u -uҨu١-5-ljD s} us*Ext-M| thr/")YoE--9~P-߁}WRZYM5-- -u-ux-Me[^_]UWVSQ]utuh0"XZ} 9EueF95< -}h8-h'%MC^XP^w<\u7\t.ˆUPh0"ZYUtF-0"0"/B000CL r1e[^_]UEH!-EPhht@j x$Efv@ -Efv< -U=L-uET-E P-T-P-9~ 1;`-~h_%='XUWVSSu d-}t69`-+=d-=`-=d-t1C~ Ku"=d-tn`-u=d-t[uSPEZYtI=-Mtj jqP;jjjWult9d-Hh0"Y&X؍e[^_]UWVSP]U u h_%.&XU19`-~BPSYX%KMd-uSwP(x?]9tWZu̸1e[^_]UE -DBuh0"%XP<\-u-E-1UE-DBt\-Eh0"R%XUWVSd---EDJ@t t E@-޹-0U?& } $%}^@- --8f|y@t t@-܃tQ18j h-5-SǍ v8"uh0"A^t-u18UBQ@u^t -uօuh_%$^Q1ۉj h-5-fSÍ v&8"unt@-`-.jd-_t|%1Ƀ/QP_ZYt-M:+@- FP-@PX.t(@-L-;u d- P-`-9Et9`-}؍e[^_]US1L-d-P-T-P-xLL-T-P-- ;tK,tF L-ʃ~L-P-IuAT-H L-˃~L-Iu J -:;vd-l9tT-t1[]UVS-11Å t]9-u 1ۉ-J@։t-[^]UVSuj#2Zu+0S<[t<\t.RiZÅu!h{$ { uh2"-[1C뵉) l-=h-9-Ё}UtVWcZYUu[#0JPhb#h-辳h#%-H-t-tj2\j 5l-h- -u -uΨu١h-5-lj-=-tj jRPe[^_]US-< u h/" XH< u=p-u$h32"XJ -R t8u ӡp-PKXu1p-t=H-u P_X9j p-Yu(0Phb#h-ph#%hK1҉H-5-S5p-s9ƒ p-t+h'h@-PR 5p-1p-R]UWVS-P-M-1ۀx%u}M8Huu-h1"[s9}n-P-- -\P--2< -=-} -U8u-ف}|WuZY=-- -O-tj7jm8uCH-B=-du f%-1-| u6/- -9-؁}tVQZYuV0Phb#h->h#%6-H-j-U5-- -u-|---e[^_]UVSVu] 1- u 1ۉ|-U -< Uu 1w8uA --JπwE1ɉj h-5-) vt8"uh0"1Zgu@-늸e[^]UWVS 5-]t-=x-}+-;|-a&M 9}y;M)9 ڋEE-}RUuZYUu]0Phb#h-Hh#%@-H-t '-tjtjt-x- -U-uΨDϋ x-M9}}EMELE B19}})É>\GVrω0;UU Mr3)9 ڋEEW-}RUu ZYUt-x- -u-t x-M9u}EMELE B19uu)d9|T-ځ}tVu" ZY45t-x- -u-_bx-Cw}9|T-ځ}tVu ZY5t-x- -u-x-؍e[^_]UWVS] Sװ^|=-tj jsPlCjPjuk1ɉ Et-}t9U3 9-ށ}V5x-u _Zu[80_Phb#h-Ӫh#%-H-b-tjGJj5t-x- -u -uΨuك=-tjj   x-NjEpSP-  9~U-΁}V5x-L ZY5t-x- -u-=-tjj S6 x-Nj󤋅  ?u9Ћ)ȉË ؍xt-9<t t tjPjuho-=}tV5x-& Y_5t-x- -u-~+ uEthG2"TZDžW=-tjj S x-Nj󤋅 x-f u1e[^_]UWVSd-T-Hd-1ۉ]1P-+T-9Ud-@d-Pmuu PuƃUd-PP[Zx-3E-1SwYu' --tjtsjd-t PۭFZPPjƃ t9]u -u -uuEd-Gd-E  Euh0"XE tu RRK x1e[^_]UWVSd-E`-E=L -t =H -uhb2"NYm=-t -j--E=-ZZk EtTuaPR@POwGHm uu^13^@p][sHZPJJ@BE4qE@E܋]k  9]}3:}z}z}׉}8up}xK Ń=-t聺L -d-EL -H -`-EH - -u-tjt j`1e[^_]UWVS--Ht7k X< u'ʣ-B0Z9tSe;SaZY1-d-L -`-H -e[^_]US-9-}Pk- -EuCk- -u C-P-k -ZY]d-j Ph- & tPT Phb#h-ȣh#%5-1--1]UxPhr2"h-耣jl @-Q@-y ;P-| t8-J 8-Uh8-PfXZUWVSօt%ˀ9u RPh2"RPh2"~ uqRPh2"i `{tZC<i1ҍ{t2Hs!t ,I< ϊG< ĸ>e[^_]e[^_]UPEEjEP5- UKh4"Ph4"h-Nj:UWVSf@8tXu1Pk1҉hW3à F8#)tSWVZ 룍e[^_]UWVS} 5-fDž<^۾1҉hPj+à t[蝾8菾8u 腾1ۉh#Vf8uFt"SVW yFU8#u5K1ɉjjP @u,8th4"j}h9%)+jWj術fDž=-t fDž9DžjRjO fDž9fDž9-jSV @u{8tJfu ft>(@ufDž=-u#K,-@tftfDžftR@u KfDžCe[^_]UWVSQ}u VWP[ZÅuzjjXZu h 5"j;s jEPWƃ ?tE8thh5"jX8"u wڍF=wfs؍e[^_]Ë@t@Ë@ t@Ë@tË@htË@ttËtËt8UWVSUE x}pHXz}z9zu};zu 9u{9Mtt9u 9MtiH$z$ ~ U~Nx9zu9t):JR ut'p@ u t19Í\ZY[^_]USEE ZAR9QD[]UWVSƉ׋EEE EME19} 9xu90tEEEE1,]9Xu]9XtiB9xt A,9|90uU9P uU9PuACk,QMuVZYMu#Tԉ2zur}z uE1e[^_]Êt"tUWRPDY_}ËBt1UjFL$qUWSQ---w-ڞw ]]5-5-h5"j5-5-h5"j 5-5-h6"j5-5-h6"j 5-5-h36"j5-5-hI6"jE$h_6"jkEPP$hx6"jW =-t>u-1 ujeY[_]aÃ=-tUE Puj UWVS}u _Ph6"j3-B9tT-e[^_]UWVS$ ]5-t(V6$V*=0Y^ugh6" j0Pu % yWp4$_0ZtWVPa u Wh6"Q5%jj0։( y0h6""jju ։ƃ C Wh V%ƒ jjW%‰ V%h _Xuh7"jU[^jh h R(%y RY߉R Zt-w1ҁbt#bt!tu h>7"1 Њ Јt u hJ7"jYu V虀ƅ/ t jZV8 jZVPl djjP7& -0tS SQPR(&,7kPƉ4W 8t t10hb7"j \9s1BFu h7"j 1e[^_]UWVS\]ƍ}ZE5%(,a&V&048EPSSe[^_]UWVSĀ]p$tVP:V9Y^㋃p tV3:V9XZ㍅xPx1RPuuqt5 -9ΉЋt}"Q_85 -VPh7"/e[^_]UWVSP] AEH1RPuuxƉMt1׋C|1׋ujQ1RP<t2uPh7"jE01RPuu˫‹N tkvkk ыEe[^_]UWVSTE>E8Iu EuEEE EE1ҊM t1҉Ƌ] ڋUӉe ƉߋEE$EЋEt\׸ 1ҊM t1҉9ƉЉuԉ}sMԉU1EUE}t EșŰU9UuU9uM] E} uWVE,# E: =-EEIu E5E@1 t1҉ËM ʋUщe ʋ}t}\SQE,c$h#5-觓Ãt#EUSjPV{Ht h7"XSyX--E1--E<1EEt E\]ԋu)։]uEEIu EE1 t1WVuu9E E~1҉ t1EUWVRP譩9E cEEEEuuԋE,#EЃ EtEЍDEȻ8&ELEЍDEȋEۃ0EЋHatE/haQuuPh7"3REЃP2‹EЋ^_9t"ERQuuPh<8"jcE؉E܋EԋU؃EU1ۉ]]]ċEEEЀt)X@}99EEȋ}ȋW:X@9]9EEȋ01}WE9L9U)9E uuE,!EujP1Eă1ɉMEEËE}t;k;xd[}Nj}ljEu 9EcMQRPuEPE]tXpXju5XZ9u9]EE@]k,PuY^Ek,tԉEVFF EUFVEEtP4@0FVGPtP,@(FVGltF Ek,Dԉx(F Ek,Dԉx(@P$]Ep}}EJEt#1 t1EU!X1 t1EUEU9]LEE܃8t)E"9E1EE܃8E\]ԋu)։]uE)‹E#Ju E`Ek1 t1WVuuLPuuh8"jt E܋P @E܋@1ҍMQRPuEPcE0ju31ۋE;pE܋EE9shI9uEtpp E_uuE,#ujP=.EċE1 t1u}C<҃<DEE܋}k,Pu&E_Zu E}81ۋE܋EEE9k,}}܄t3w 0x}܋t|px u}px}Ћw04/81p}܋tpp u}px}Ћw(,px}܋wp J9utGE܋@ EMk,}D$uuE,ujP,EċEk,E‰r(Er$ t1u}CЋ]E<҃<]DE܋EEEE܃8i}Eȋ];\9E}Eȋ}9x }98EЋP9Ut,EQuRuuPh8"jE]E]E Eu--EEUEԉU}E\uԋ})׋E^EXIu EEEÉ1 t1RPWVyPuuSh|8"jE}8LEiEe[^_]UWVS uEPF VM]_9EEr )ӉM܉]Fƒu>uFt 11E`E9sWu h8"jCN1ۋE1)ډEUF@]t[ ][]ԋ]1ҋM])ӉM]E9Es 1)EU1U9ЋU_U܋EЋE]ÍEeM1SQRP耤FVe[^_]UWVS]E 8w1ɉMM9UMK}HPH EU,hj,RW-}EEPhE%ƒyEqRPh9"jxhj,3W}tE1҉ES1EEE9EE}FN9N u;tEUSE 8}tNEEU,뷍e[^_]ÍL$qUWVSQ8΋QRPh/9"1ɉM؉M܉<EPURvSE܉EUjEPURSfMM܋E؉Ẽ1҉UЉU19~k,ŰD$EUGm]<E1Em}----EЋU--ẺEMEPh%ǃ yNQWPh@9"0FPh%ǃ yNQWPhf9"j1eY[^_]aÍL$qUWVSQ9q--,- -?1--1--1h9"VW, ta#DtNJC p7-뷃b$%--C-C-u5 p7*-e5 p7-R5 p7-@-/5 p7--5 p7ý-X p7-h-h9"YX-)lj80!h-h9"XZ=-xh:"!=-x 8u5-t hQ:"jStjj)hw"rh+jj[_@u h:"jj hw"Ehj 00h:"@P詡@ uh:"t|j/SjZYÅu@s-׉hj蟝hj蓝j$8-PB-1urh ;"jju-؉8hDj(803PyP3h(;"jW5-OG9=-=-tf95-~W-4FX烽(ta1(,,9- -_=-tjt-xrP-0j-dh1҉ldPh -%à t$8:ha>"j011ۃ=-*6, -,4@lXRjPjjT($tPhI;"XP :8zJt&Z JZ04z($J 04zh P&1--8Y_9t4VZyPh^;"jPhw;"j; 3‰.Ju lxtH'‰`R840Ph;" tH891҉ t1҉Ӌ+049׋0|9؋4}Y 9؋4}s8014߭0ݝ0y11SQRPњ1ډ߭ %ܝ0v7ء- 40- <0[10=-pݝt{\PdS*y ݅y+؉Ph;"j, jPh;" \`+EU5-9Ɖ 9jSZY@݅u؉NPh;"-ܝp X%ܝ0 LRjP011RPl$01tZL9rKjQ4#^X0290Q_|OlaGl막 9skQ k4 JHJZH XH J HPW4 D2 D2GlFhjP8?8P PuPh<"Y[# 1҉D<5--8Hȉ9r09rÉ014#840Ph<"k840Ph<"jV04 4111W9m09Ћ4J8JZ8<< 89 +4i۷m۶R<8SPh_<"PDPh-SW(~LFD\`HP\Ph-W\DHY, X049Ѹ4}u014"80Ph<"p1ۉ898r;D\`j\Ph-W\D𙋝09މЋ4}88SK t+4i۷m۶hQRSPh<"DPh-SW|$~FL,NY8&D8t-011҉VPh<"K=98~k,0D$Aۉ7<1߭߭------1XT0 11198 P t$k,0Ћ 9Pu9 tyt_|;TRXR801RP K1RP1F P @ 9| ,PQpQRPjW'k,0Љ1;P} PTQXQ8)Q t p|룋Tșڋቅ044؋ቅ=-t 1P-k,8 $98p 9~Љt$DPSh="pPh%ÃJQSPh'="j#tV":t&PhL="j,+ePh^;"jh, E$) 048<11ۅt9 k"j,5-(,{jAY((9-YPh>"j(5-~=-th*>"hP%hh4>"6؍eY[^_]aUE UMQ1]US]C Cs4SjS)1]UWVS}uj Zt"Å~{kP ‰C X1ɅuS[1A9}XM1BBB BUWUYMukC t 404YP+S%XZ1C Es1ɉKE CC{{j8j_u.1{ YC 9}k4GZPX7p 1EZB|DBAB @Ѝe[^_]UWVS]s$tV6VXZs tVV^_{G 9w~k4<FYP2W,1XZe[^_]UE@H]UE@1҉P]UWVSEXC9Cuz@CPhp>"jkCPs kush>"j9C kS41FFF FsZush>"jK kKK E UAQMCSEUCSEURPuu`E UMA Q}} EENjEe RPu13%yEsh>"j$ EC1e[^_]UWVSQEXCE19E~4kK qy9u U|Q 9U UQ} E )C@1Z[^_]UWVS]s4FECS,K0UM{ stQRVu t EW+EC C C[MEHEUBȉEEbMRPsW6%9CugCC\MEHEUBȉEEbMRPsW6%uh>"UYC$Cs4SnXZ1e[^_]t@Ë@ tËÊtBRtUWRPY_}ËBht1UWVS L 1󫍅xPEgE,ZYËEtPhEQuЋ}ԉ t֋Et+ +@|)‰1,0,9r 14DP0,us F(tȃ0tBE;Pdr,9u:s (tvRPYY09us,9uihg(_tZ t @ (jS#EY[t8(w690u9,GjSXZ (w t WV^_Ɖ׋E t1 $DH 9|([ (E9s@(ERPWV0,h>"(  袋9.}*WV0,h*?"j({fk,V4Z1ɉ0PHD0,hP?"jh (X k,4 1󫋝,0rrz E(t=@PtȉB DH9v@l9}&E}t8Phj?"4<@E0]\)Hu E1ҋ] 1ҋ] t1RPWV{kDt 18x, $$y11jDP4Pu2DH1 9؋$}W $) $119ʉ} @H9؋}{ =-h?"jY^wM t1WVSPE(%=DH9}bk,4_$S輽G(Zj0P4t0$h@"j_MH=-tRP0,h(@"j!EHa‹E1tIu$X1IuEC1 E E t14k,kD,49Et@E@8RjPjjEj8P h PR v%<DHk,49s"4jh E% bRPO{@8tGpBuE@- -Xe[^_]ÍL$qUQ 8-4-50-5 -%EM MuQQ$RPhA".YMɍaUS]CtS P S tSPSCr s PZSI <-X]USEPsH) (-,- -Hu0D-Z[9u \-u' \-uh%B"jP4BPQ X4CXZ@]UWVSu EEE# -@-0- <-M11ɅtJA9~ʳ9M}#t0-h9B"ht%hhHB"yr}9x4u }9x(u9p$t버t0-e[^_]UWVS]uuu SO trNj@thjB"hl%h1GGWX9w(~6GthB"hl%hhHB"qwVw 誐G [^WY - -;<-X=T-u =L-uBGWuX-GWtPP-WGtG4WPZWX<-j@j辏Vj贏G _4E UG$W(G,W0wE # -G8@-tz8GC GtWP { _ Ge[^_]USEM PuhB"hd%h4hHB"pP ʉPHPPP s E]XPs2H (-,- -1ɉH H-HH-.1ۉXt X-HX- P-HP-P4JH8@-9t!tXYX tAP]UWVSUu }uWVRcËECUt8-R4-EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMq= -Y,A0Éa,ڋyY I4 s RPWSQ% RPWSQ%e[^_]US]C%CSjS]1]UE UMQ1]Uj,UU Pl-PYtHJ l-@ l-UWVS] h-C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpdC ${s ]e[^_]UWVSuE EEEE%-1҅9su}K}9y,u^}9y(uVK0ts4q4s4 -K0ts0q4--C4d-=h-~ttpRZg{$u{uCuڋ[0n=h-~ tRkX`-l-t$;3uEE EEuCe[^_][؉؍e[^_]UW1h---11҉l-_]tʋTËË@t@Ë@ t@Ë@tË@PtË@dtË@htËtËtËttËLt ËTPUWVSS]CE -K,ϋS0c,ʋ{s K4 es RPWVQ%9Cu CC17RPWVQ%uh>"YC$Cs4SXZōe[^_]UWVS]{4Cu2wC t1t)F@VD)F,C @CWSjS1e[^_]UWtBRBR t RPY_}UVSӋEU tt RPY^CSt RPY^CS e[^]USËt-w1Ɂbt#bt!thbRhB"91 Ȋ ЈS^Z19tPQhB"DN Ћ]Uuu EjDUSt)P8X<)P$[]UWVSƉUMXC0E)ЉEE+}}t/ujRu uVtEjE0rY[EOEmCdpx K}t)Eus ݆C EUP 1׋MXZ1e[^_]tËUWSÉЊӃtTtDptRPY[L(ștșe[_]UWSvh2C"h%h hCC"]gÉЊӃttRPxY[LXștșe[_]UWVSvh2C"h|%h"hCC"fƉӉȊʃt$uҁTXe[^_]UWVS vhhC"h%hhCC"xfƉӉȊʃtutp|tҁT(e[^_]UWVSSÉЋu} 9r4"E t19ur Y[^_]Et# #!Z[^_]UWVS(M}tE1҉EUЉÉ3]3u]u)EUtApE̋ẺEԃ}tC}u}u}11 9E}|])EU 11 9E}|0)EU11 9E}EE EEEE܋EU+EUu؋})׉u؉}܋}E؋U܉WU)ЉG1x EEHEEHE̋E}tUE؋U3E3U tE)ًEU t}!EЋUu؋}܉2zB1r EH)EU랃}tE]ЉEEԃ([^_]UWVST} uU _ ;EEr*t1MEƉ׋E.BuuuURU VuuWu:U ENEEU1MVEUE EtE9Eu%E9EuuuW ut jS[XF EPuuWFË@u7ENEU t1C,S0C CC4SPYNS EkEU+t jS\XZEu} t1 uE0x1e[^_]UEjjuuu Pp$UWVSSE E}E.ptVEX Et ËtRPYYËCt1N9u9Eu1ۉ؍e[^_]UWVS u}j8jËEEC1CC=_C_C 2h1C C$hjqEhjbM쉁j`jPMAdK1AHA 19Et EXEaMQjR t1WVEPUBBRUuu uƃ(Uu7jRmEEpduSEE싀}@u jR^_}E UG(W,}x0xdEtFVtRPYY Fht1҉GW EWW 111E싐E t"EHdMWV‹EZYFM uh-EE %-S0tK0J4--C4-C(tS(P,-C,-މe[^_]UWVS4E$EE tPPED1EEEv#]]܅xL}҃}}܅x.}҃8U }}1E2hyC"h%hqڋE+E 9zEE }uQ@9E}]]B E؋E[CEԋM܋EEȉEyhyC"h%hhC"]@]9~ ]B뫋EEP{E̋E<ƋE_DE EE1 t1u}u}8uE=0E E1u؉uȉuЋEEÉËE _H9MjEEÉE tPPE ÍD19E Et"]9X}98E }]9EXEMQjRu} t1WVu8EE؋P }̋]؉TjPEȃ Et-}1 t1u}.E\]X1 t1u}Et E @E @}9} tuuuU 1ۋEԋEEÃ9I9uEtpp EZƋEEPjVEU t1RPuEE؋P }̋M؉TjP Ee t1u}CL<҃<DEEHE9E PE PEƍD19Esx9Mot }_] 19]u 9MLPuuuhC"}t/EEtP1uuRPhC"辧]9]tSuuuhC"蟧uu] SY[9t$PRuuh-D"su:1҉U u(XE܍e[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEEUu}1ɉMԋE9EEIu EYEdE1ҊM t1҉EȉŰEtE؉UE苀\EE܉+EUuuRPXMeEU9ui9ue 1ҊM t1҉EȉŰE9u E9uu}1ҋE E؉]9]|9}u 9uu}B uϋE‹EÍMQjR t1RPuEX E芀E؃{atjuXZ}uc{EtK 9u׋S(C,K9puċS C$M9ErU؋EPCPWZYU9닋E芀{at WVhyD"wtC M苉9t.CM苉p9t$1SQ1RPWVhD"蠤C(S,C S$]9UrSPWVhD"rWVhD"^ ~}t5EtC(S,C S$9Uu9EtPuhE" EUjuuWVSuEE؃uju [X }t$EtC(C PWVh/E"辣}hFE"h%hhC"UEzEEAEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋ESEMIu E1ҊM t1҉EUEU+EUuuRPDUEuuWV1U9EuQE}lj1ҊM t1҉Ɖ׋EUă+EUuuWVT9Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMju#XZE9Ƌ}E Euu}eY[^_]aUWVS ] }t$Ɖ׋EWVRPhME"臡EuE‰9u+|vEL։A9u9u V9s9sE]Ã}th^E"z8h8-,Y^tCpStCHuRPuuEU}t hE"8ZZEEt};{tua};{p`dKH9}u@9Mu;}Et `d)RPhE"F-6EtM}`d)RPhE" tCpStCH9Uu9Eu ]1EEe[^_]UWVS u }j8j-pE1҉PEMAx[A[A [1ۉY Y$XZ}t.hjoËE쉃P^_ u = -ƉE} t hF"X[1ɉM -EPjh WVu*hjgoËEp }쉻PP P jPXZtS Su -}URjh  t1RPuhjnEEp }}M쉏PP P jPW^_utCHSLC419|} tMh7F"XWY@Et} t#hlF"9WZu uuS9u uxX SoX]=t SZXktLǃ1҉l1AǃLcX1҉ \X`1dt}uWjlƉ_tCtPl^tCtPlFY} }u tCHSLEU#C4EEEt UCHSLC4uuE0jjSu1 h5|SXZ؍e[^_]UE Puj - UWVS]FHljL1RPuu /NEUt1EUEU싃C|1EUEU싃URjW1EURPVtPu hF"@ u~ 1RPuu }LtDTEU"7vkk ׋GEEjV XZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuuL€}tKt19suu苃0uu Se[^_]UWVSE@E@0Et ExEau } tu}}tE1ۉEEƉ׋E t1 9E9ƉM|BEE]Ɖ׋E t19E]WVUEZY‹E@9sq~mE}u1PWVE0ƒ E ]RPʋEEH^_}t EP4PR[ }9}TtuuUEZY|x#] ]Ett E!ËEU t19r^Eމ}t(SuuusE}@,@0E@dpx E\9||>}5EPj|uuuƒE}E}u1Puuً|Eƒ }븍EPEPEPuuuu?ƒE]x]tCu xu}|9|~|uAEE@dPx |xt!@uEڋE u ڋE|<ڋEylp]DžhE.Pssu{‰E{up H1E@,@0S@uIB4dERlp t1r,z0B BRdP_K}w Ea u$EtDE/lpG4WP^hh9|c}uuUEZYPuuuO‰EEtxB,B0(}u }ut x|t |u4EMEzEME|KE?t|URjPWVutWVhF" LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1҉Ѝe[^_]UWVS(}^:EUEU t1҉E܉U7URPuuVEԉU؉ EE1EURPKt1ҋM܋])Ӌ1ҋM܋])ӋG|1)ӉƉƉE܉É֋EƉrvaPJURjujjP>t PhF"XZMA tP@G(W,@G jQYXtG(W,E܉U_(w,G 1҉E܉U_ vbBHMQjPjjRt PhF"`XZEP tZrZP4PR:XEԋE1EUh‰1 t1҉щ‰3EEP tJUЋM9ˉE}#E1ɉHHXpE ϋEM܋]L\}UЃv8M9ˉE}E1ɉHXEkEu܉t6M9ˉE}E1ɉHXE ku E܉D2BHSMQjPjjRt PhF"XZMq EUtF V$FA4QP:E̋@4uP1e[^_]UWVS]vfBHMQjPjjRt PhF"B_XEP trzs({,RS jPHY^$EtC(S,C 1҉EU苋AM؃H/E^1RPuuAAƉ׀}Mt1׋C|1׋URju1RPQtPuhF"d Ep 1RPuu?t֋F Ft:_vkk փ~t*uuhF" tFVC(S,FC vkBHMQjPjjRt PhF"XZEP t~vrzNJP4PR:Xju_XtC(S,C 1 S^Et UC(S,C IvkBHEMQjPjjRt PhF"ZYEP tu}rz}zP4PR:X17-t C0S4C(jjP0uu Se[^_]UVSUE 9| 19[^]USBPPh*G"h-&h-haG" -CtsPh"h-&jUSSE] t$uh!#s5ZY¸tr1EEPhvd5-( @u35-ho"j]UWVSPu }t}~^h"S5Y_DžtFh*"Sy5_Zt)hr"Sh5ZYthyG"SW5[_t뫿}}uha$v(5ZYuUEPhud5-( @u65-ho"j,e[^_]US}tQ,Shzd@5-' @u5-h|G"jRP3=vu%.UWVSQ5$.Ctt+ t&Pσaw <v ;v ju_{Gfw$k A E1E)й 19u5{$ -1TtDQt!@ u 9u1 Z[^_]UMU 9|]UWVSƉ׉M%.%.ÉEE1RPWV2E)Ɖ1UQhx%XZ}Ut%.H9u%.H9u u9rBRWhL" e[^_]U塨!-=$.tvPhM"5$%.5 %.5,%.5(%.50%.hM"t 5 %.5%.5%.5%.5%.h8M"I5t).h_M"9 PhmM"&hwM"$4(%.,%.5!-5$%.5 %.QRP50%.hM",hN"3%.%.5 %.5%.QRP5%.hN" 5%.5%.hnN" UWVSQƉZ21ۉjEPVu >u#ËE8u.28"u w܉1e[^_]US0P#$5!#Ph5!#Ph5!#Ph5!#PShN"h-,joUWVSEM !-9uh9Q"5!- hOQ"jȄًEEUMjؙ]!É]]!Ӊ]uuWBuAtV!-!-=PuR6 3P5.R6 9!-uNE!5.}e[^_]UWVSEUϋE E컙F"ti"EU@uShlQ"ZXZff=Ut+=$.t fuuShQ"ff=u%CthQ"fLJ_f=Ut1=-u ShQ"wY^-tShR"OXZj(VP x0XŃ~X R%.t\fLJᵃVe[^_]UWVS9x).u`).5`).u1Xƃ'.e[^_]W|$wUWVSDEUȉM̋EGWEUċG WEUEER"EEtEZ"11}=!-E%.%.U1҉U܉E1ɉMԹEM]̋ERPSQF-PE؋UEUuuRP)-RPuuȋE؋UEUuuRP-RPE؋UEUuuRP,RPuhMR": ,"uuuuuuuhR"  h-jdh(. u hR"jh-#h(.<+Y[(.U슀(.< <$u z Ћ -DQu<-7j EPh(.IƉ׋EEh%PxEЃEPhR"u& tuhY#u t L =!-Ήʋ5%.11WVSQ+ƉuhR"u誏 ui %.ω%%.Ɖω uEt5%.1Et %.1Et %.1)Et %.1)׋E؋]؉E]h-#S)YZÉ]; t,h(.Zƀ(.uh(.hR",  9uE|E9Ɖ]}.uuuuWVhR" uȋ}u}e[^_]g_USE PuqhR" -H- yh-Y-P-؃ t9@t* -y h-Z-P-8 u hR"jV~1Y]UWVSEM䡘!-E@u hR"j ~!-EӍEƉωؙ!M!EjuuuBu @u!-!-uhuP. nR5.P/ 9!-uVjuu5!-}Bu@t.K!Nju5!-R5!-:. 9!-ue[^_]UWVSRá`).u ƀA Mz΍t). S}8PR t). e[^_]UWVSEыEU u1+ˀ %.1ۉƉ)߉u}};=d).}=h). S"EUEUE9l).p).}=$.t Evt).KiE9t 5`).tމ&ʅu+%.9UE}M1E܋E9E܋U}t0}t}utsƆj/S"ZS"ȃ[^_]UWVS EӋEEht).@Ph`).E 5t).t h~S"jW{EU9E|E9u|`).] }) VRP5`).31fǂU }u@%.5d).֋M)}CsKSCPKSs FSjt).Ee[^_]UWVSE}u&'.ƒ<1IE E#֋EU EUEUE9 %.$%.M@%.19Et\tSMM1ۉ]]9ً]M}3M9MM }S"=$.]@uER%.˃t h). d).t!=$.>x).1hjg`).[^u hNA"jxfǀUEx).EU d).h).EUl).p).t).ytbt]t E^t).QHu`).<=$./hOT">Y7T"gV%.=h).t).;d).KxZ 5`).t1;EM |9UE}=$.t`룅d).E 9h).u;]t~t).H`).1+]9~ Fu%uF PPR  t). *%.1RPEU d).+E`).XZEU d).h).EUl).p).S"S" T"S"Ѝe[^_]UWVSË@S t+5 %.=$%.9u9t hT"Y]sǹ󥉍1󫍍@u'CT" CuF"RhT"v|XZߋe[^_]Ã=$.u x t"1UWVS|Éס4%.tPhYj/S^ZuS5!-h)%h4%.<# Sy4%.Y4%.u hNA"jujP'XZy54%.hW${[^xPSZY@tMuи 9E} 54%.hT"T 54%.hT"?h h.S' 9t54%.hW$?{f=.Ut54%.h U"Y^S'XS'Z tje[^_]UWVSÃ=.u1Ҹ#.f=&.u1f=.I؁=.t#.@%..󤡼.f&.f>'.Ut&.1>'.u[^_]UWVS á&.fE%.%.%.@%.11t#f}u&&.t9r $uɡt).E `).19E~+f:uzti 9t@Ћ $.t=$.uaf}u&.! 9*=$.tu7hU"Y=.t f=.u/hU"hB%XZ=.tT.!94%.=$.tPhRU"_XPhU"ZYt 1=. =.uL#t!%1j.tr.!9tSP54%.hU"+=$.t1~f=&.u3 .54%.h/V"ZYu&. !%te[^_]UWVS(ÉEU EUE؉uF=$.EmV"e[^_]#11ɉD11ɉt<u ȉhjhh@%P%tPQRhvV"T fu1k t Ph5!#hV"WVh5!#hV" =!-RPSQ;PhV"Y[=$.u" %.9u1ۉ)11ɉj-tj)MXZttC9Eċ]|N1ӋF19Eċ]}|]9؉ӋM}EUG롾@%.19}tHt?19Eċ]ȃ|19MċE}]9؉ӋM}EUGu EċUȉEUEU+EUȉEUE Eu hzY" E Et}u9}E}}u%.%.1RPuul u 9tۃ}u E9uuujjRN#EUEPuhY"hY"h-jdh(.u hR"jbh(. [vEHƀ(.t'(. t9EEHPh(.hY" uh(.EP/ uċ}ȋEEă}t6juuWVUċE$.uD<=$.1EjuuWVUċEu=$.tKt$|=$.us=$.t PhW$j[P]juuWVUċEt)/juuWVUċEu}t }tPhW$ja}uf} E U u }EfukE } 1E}t Dm:}ta}tE %.1 d).h).9u19tuugZY `).UӁþ]EU]̊EĈC})}̉Guw OWPE̍HPD3}̍_S^_E}tgfǀuEPkE }P$. =$.u=$.<t t).(hY"Ytfu'uEPkE }P =$.9=$.t hZ"Zu$.}ft=$.hY"[E̊@EċE̊XEčE@‰%.p1WVjjjKZ"E1ɡ%.p1WVjjj^Z"Ã(Uă?1ɋ5%.1WVjjjmZ"^}̊MO_U? ˆWGEĊ_EčG‰%.p1WVjjj~Z"E(1ɡ%.p1WVjjjZ"ËUă?1ɋ5%.1WVjjjZ"}̊MO_U? ˆW(} `).uKye[^_]UVSá$.u hZ" X1ۃ=$.u Sh"Y^jjڸ@%.CXZu҃=$.u=|).thZ"W X1L=t).thZ"u ShZ"+Y^g `).RP1҉8XZ=$.tC$.9t).A=$.~hZ"5`).j5h).5d).RP 믅<f=&.th:[" ^h["s[&.t=h@#_&.Y=uh[""k Ph%["0XZ hZm""XhH% X=$.nPhO["Y[=$.&.PPhk[" j=$.t>u Sh["XZ9t).} h[" X; `).RP1҉u Sh["~Y^jjڸ@%.XZe[^]UWVS ˋDžF" t DžT" @uh["aZYߍ1jh["Sz t 1/9Cu苅9Cus Pj ;Cuă=$.t.{ t(s$s sh["Xe[^_]UVSPE!-;!-u*=$.u!URhmdP y hמ#`X@%.11@uh\"B=.u111H.~ ف.@uh>\":`^E`).01C;t).}. `).d).h).@@uShS\"_Y[1҉U!-;!-u*=$.u!URhmdP4 y hמ#_Xe[^]ËUPhp"h-jUWVS|E|x).wSh$q"h-VjBSCEZuhS6EXZEE FEe[^_]UVSSPPVu ujVSh%a,@uLtv"t"0FZv"tv"PShw"jNj UVS]u VSĤYZu Sh`w"jN;/t"Shuw"XZu Ew"e[^]}e[^]UPhw"h-jUVSPh*"P[^t,PjPuVVt jPZYSXe[^]UWVS EEu EE}]EEE1҉+.%1ɉ +. +.hw"Vu8 NtJb$%1= +. +.$+.+.+.뗡 p7+.jWh%5 p7u hv"j'MPYY(+.J-4E)Ѓt~S6EXZEE FEe[^_]UWVS4SPPWu uuzjPM+XZt1h@$9}PZY uċ2jWShR%]@uLtv"t"v0C^v"tv"PShw"j|Kt%@u=+.p&+._+.MDžw"= +.tDžw"+.t #P=(+.t ~%=$+.t w"=+.t 6$1ۉXPHhw"hU%jJShx"h x"V<u h 5"jJj/G P~ZYt|=Shx"h#x"Vtj/C P3ZYt|B=XjTUVS]u VS YZu Sh`w"jI;/t"Shuw"XZu Ew"e[^]e[^]UPh;x"h-j@UWVS]u1 11҉t11ɉphxx"u u4 athg$@%5 p7`CpX5 p7!CtXDžp5 p7XCxXDžt뀃K|wK|njVh%5 p7ku hv"jHPX<-P;UtU tu4uVEptFuxPV6gY_@t#ECpJtuUxPVg_Z@u8Vhy$jG$HxPVfZY@tuECpECttu E%Cxe[^_]UWVS SVpPtWu uhWpSh "Y,@uSVhx"jGGr@t@1RPh|%hSShx"(j{USP]jEPSPU :9uySu hx"jF]US]SZt@ h"SZY]US]STZt@ h*$SsZY]USP]jEPSYPU 9t :uy Shx"jEF]UVS]u VSfYZu Sh`w"jFF;/t"Shuw"6XZu Ew"e[^]e[^]UEU 19s f3P]UERPZYË@t@Ë@ t@Ë@tË@htË@ltË@ttË@|tËtËtËttËHUVSӋEU tt RP~|Y^CSt RPi|Y^CS e[^]UWVSӋEU ΃tt RP-|Y^CSljtȉlj{he[^_]USt)P8X<)P$[]USt)P@XD)P,[]tËUWVSEUˋuE FUU tJ$1EE ~uJ1EE ~<$ffCRVڋE E CRVڋE uEE }t>}tWWVzY^ƉuuzYYEU0`}tΉȋUʿBUƉ4s {$s({,s0{41{D{@{HUM䉓CPsKC 1sss$S{l} E 5@+.=D+.}t M U JpD1HӉ5@+.=D+.}tCS}t#RPyYYCh}t1ҋM M  t1WVڋE BY^1U ~ 9~}t 1҉TpTt1|(@ԃ} }t1E 1ɉKXE HpED1Hy~Fuh2C"h%h"hCC"}t1҉1҉TX1HF붍e[^_]ÍL$qUWVSQXAAA TAAAAA A$A(Q,A0A4PA8xA<@t1É1ɉWV 1҃t0119s#hx"3+ZRPPH0jjjjXSËP %F߉ȃ ߃@C C!C(1C,ǃ ǃ ǃUƃƃǃ ǃ ǃǃ1ǃ1ǃ1ǃ0xfǃƃbCC CC C8CT Cd@ChClUCqǃǃǃ ǃ ǃǃ1ǃ1ǃ1ǃ<fǃBƃY PChR%VLZYthR%Vhx"( u&;s5;slDž:DžDž u;tU('DžuLDž Dž;DžsDž ~|t~(uydh"y"'^_PDžDžt9t h@y"&Y9~Wthsy"&XZ.DžDž9|ċ9|<t hy"(&Xh5d+.hy"躿Džy(hy"%^_uqhz"YI;rhy"%XZu) u 111(4<81L\0,$H1dH@D uj$_t⋅9t PhPz"G$Y^Ht2{{ @D0{{@D#Zt⋅9t Phpz"#_XG1t{${Q!#^t <8(Ch4CpHt ǃ ǃL@tA"ƸY9t Whz""XZHd 1t1\{ChX\Clg{ OtIhz"h-D8ljPhz"h-t@t)1L@t31#LC LClC XkT,Pxu$xtJxHXCdTCT~*0CPPlxtxp1PF ^t1P YttuxPZt*1 t1s{ %1t t1s)Й t1҉p11Ҋp t1Ҋc t1hl t19s hl)ωptct hlCS s{C`hCpC1ɉt‰ Ju s1 t1WVtpct9Ǎ@4pp4CtǍ@pp11҃ʃʃ p t1ct"uM 1FCXS\u 1Huw?ǃH3Qw ǃt)t%@ @ v#vxǃ ǃxd‰9rw~uZ9$}Ldu2Whz"h- 9Huh-h&{"%XZdѽPho{" dt$h{"h-胿OPh|"ٻ7 v$tpPh.|"註^_j Y@uhL|"h||"XZ+1߭ڍP %WW$h|"BHuƉƉ1 t1 ‹)ЉʋCtSC8S< C$1 t1OD1t 0 ‰D2耽tC|P4YBu@u0&Ph~% tu `duCPODž1v 1񉅰 t1 t19u9t h|"_ tG ?9|$ tj jh}"q$t*uQ1҉Ɖbu 1҉h t1C` t1)CS\)CDž+x|ƒu Q]1 t1҉Ѝ Ɖ1҉"vJt\9Ћ}x|) t19r$mh}"^t+)CS)C +V ‰Ju 1 t15Q‰扅Q‰扅扅tV׉sX{\׉sh{l׉sp{tC`Sd*\ȋΉs<ΉsDCHK@hQYu jj(@1󫋃@t<<f<%fGXD@<f<%fGdDSP1R_ZtT81RP}XZ1ɉtpxpx t WV^^_Ɖ׉ t19s=Pd/D ]j`ƉX P?YP$FZ@HRjPjjt PhF"N>^_@ Gt3~S@1҉P-HG 1ɉO$)~\@HG~F F <@4PXjjXjjS'ptK KS1P1ZY$~dt.<f%Tf-f1GfFjs ,<f%Tf-f1ɉOfFjs1)щ1 t1҉GW jhZY<f%ffAXZ1ɉ19sDA u҉=v D PjVjj{@ Dž%Dž1p_<҃D 9sh~"5`+.ho" Ft Pt#u?RPXY^f*uGɉf1VfN@ tBh1~"h%hqfFu=@ A)G G p 6p<uGG9rhK~"h%hhCC")9rhj~"h%hՉϋ)1󪊓t@@tf)th|~"h%hh~"LP4PRAH‰ljX1OtVjR1RPQytPjhF"66 H TƸ1tvkk ʃ@u51rrrrB 1z0z4z8z<@1OBB~B1ɉJJ(MB 1BBZN9s1BBrz 1BE]9s1BAJ1B$79s1zAJ 1r@4PY=/.u jSqqXZt 1{@{D1s,1ɉ9\FH|‰1RjQ1RQVAtPh}"3‹p JuI!F u1kF FtL<1 t1F tX1 t1 ‰ ‰1 t1ҋtC@SDC,F t 1 t1҉щ‰8ubvVt \Ɖ 1 t19Ɖs)щ‰jVXZ$t,CpSt'CH\+ƃu 1 t1WV@Ή+tC@SDC,)ȉʉщ‰_1v- 1Ҋ t19sƋ1𙉵st'{++C8S<++C$BHQjPjjR t PhF"/^_A |tVC@SDs8{8tGpBuAE/.!-Xe[^_]ÍL$qUQ /./.5/.5!-%EM MuQQ$RPhA"tMɍaUS]CtS P S tSPSCr s ZS /.X]USEPsH) /./. /.Hu0/.Z[9u /.u' /.uh%B"j P4BPQ X4CXZ@]UWVSu EEE#!-/./. /.M11ɅtJA9~ʳ9M}#t/.h9B"hh%hhHB"迲}9x4u }9x(u9p$t버t/.e[^_]UWVS]uuu SO trNj@thjB"h`%h1GGWX9w(~6GthB"h`%hhHB" wVw G [^WY/.!-;/.X=/.u =/.uBGWu/.GWtP/.WGtG4WPZWX/.j@jVjG _4E UG$W(G,W0wE #!-G8/.tz8GC GtWP { _ Ge[^_]USEM PuhB"hX%h4hHB"P ʉPHPPP s E]XPs2H /././.1ɉH /.H/..1ۉXt /.H/. /.H/.P4JH8/.9t!tXYX tAP]UWVSUu }uWVRcËECUt/.R/.EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMq=!-Y,A0Éa,ڋyY I4 s RPWSQ% RPWSQ%e[^_]US]C%CSjS]1]UE UMQ1]UjrUU P 0.PYtHJ 0.@ 0.UWVS] 0.C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpd] CO ${s; ]e[^_]) UWVSuE EEEE% 0.1҅9su}K}9y,u^}9y(uVK0ts4q4s4 0.K0ts0q4 0. 0.C40.=0.~ttpRZg{$u{uCuڋ[0n=0.~ tRkX0. 0.t$;3uEE EEuCe[^_][؉؍e[^_]UW10. @. 0.11҉ 0._]tʋTËË@t@Ë@ t@Ë@tË@PtË@dtË@htËtËtËttËLt ËTPUWVSS]CE!-K,ϋS0c,ʋ{s K4 es RPWVQ%9Cu CC17RPWVQ%uh>"C YC$Cs4SXZōe[^_]UWVS]{4Cu2wC t1t)F@VD)F,C @CWSjS1e[^_]UWtBRBR t RP9;Y_}UVSӋEU tt RP;Y^CSt RP:Y^CS e[^]USËt-w1Ɂbt#bt!thbRhB"91 Ȋ ЈSZ19tPQhB"芎 Ћ]Uuu jUSt)P8X<)P$[]UWVSƉUMXC0E)ЉEE+}}t/ujRu uVtEjE0rY[EOEmCdpx K}t)Eus #C EUP 1׋MXZ1e[^_]tËUWSÉЊӃtTtDptRP'9Y[L(ștșe[_]UWSvh2C"h%h hCC"裧ÉЊӃttRP8Y[LXștșe[_]UWVSvh2C"hp%h"hCC"9ƉӉȊʃt$uҁTXe[^_]UWVS vhhC"h%hhCC"辦ƉӉȊʃtutp|tҁT(e[^_]UWVSSÉЋu} 9r4"E t19ur Y[^_]Et# #!Z[^_]UWVS(M}tE1҉EUЉÉ3]3u]u)EUtApE̋ẺEԃ}tC}u}u}11 9E}|])EU 11 9E}|0)EU11 9E}EE EEEE܋EU+EUu؋})׉u؉}܋}E؋U܉WU)ЉG1x EEHEEHE̋E}tUE؋U3E3U tE)ًEU t}!EЋUu؋}܉2zB1r EH)EU랃}tE]ЉEEԃ([^_]UWVST} uU _ ;EEr*t1MEƉ׋E.BuuuURU VuuWu:U ENEEU1MVEUE EtE9Eu%E9EuuuW ut jS[XF EPuuWFË@u7ENEU t1C,S0C CC4SPYNS EkEU+t jS\XZEu} t1 uE0x1e[^_]UEjjuuu Pp$UWVSSE E}E.ptVEX Et ËtRP3YYËCt1N9u9Eu1ۉ؍e[^_]UWVS u}j8jËEEC1CCCC '1C C$hj跿Ehj訿M쉁j`j薿MAdK1AHA 19Et EXEaMQjR t1WVEPUBBRUuu uƃ(Uu7jRmE@ Epd5 u- S' EE싀}@u jR^_}E UG(W,}x0xdEtFVtRP&1YY Fht1҉GW EWW 111E싐E t"EHdMWV‹EZYFM u0.EE % 0.S0tK0J4 0. 0.C4 @.C(tS(P, @.C, @.މe[^_]UWVS4E$EE tPPED1EEEv#]]܅xL}҃}}܅x.}҃8U }}1E2hyC"h%hqڋE+E 9zEE }uQ@9E}]]B E؋E[CEԋM܋EEȉEyhyC"h%hhC"ɝ@]9~ ]B뫋EEPлE̋E<ƋE_DE EE1 t1u}u}8uE=0E E1u؉uȉuЋEEÉËE _H9MjEEÉE tPPE ÍD19E Et"]9X}98E }]9EXEMQjRu} t1WVu8EE؋P }̋]؉TjPEȃ Et-}1 t1u}.E\]X1 t1u}Et E @E @}9} tuuuU 1ۋEԋEEÃ9I9uEtpp EZƋEEPjVEU t1RPuEE؋P }̋M؉TjP Ee t1u}CL<҃<DEEHE9E PE PEƍD19Esx9Mot }_] 19]u 9MLPuuuhC"}t/EEtP1uuRPhC"{]9]tSuuuhC"\uu] SY[9t$PRuuh-D"0u 1҉U un XE܍e[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEEUu}1ɉMԋE9EEIu EYEdE1ҊM t1҉EȉŰEtE؉UE苀\EE܉+EUuuRP MeEU9ui9ue 1ҊM t1҉EȉŰE9u E9uu}1ҋE E؉]9]|9}u 9uu}B uϋE‹EÍMQjR t1RPuEX E芀E؃{atjuXZ}uc{EtK 9u׋S(C,K9puċS C$M9ErU؋EPCPZYU9닋E芀{at WVhyD"wtC M苉9t.CM苉p9t$1SQ1RPWVhD"]C(S,C S$]9UrSPWVhD"/WVhD" ~}t5EtC(S,C S$9Uu9EtPuhE" EUjuuWVSuEE؃uju [X }t$EtC(C PWVh/E"{}hFE"h%hhC"EzEEAEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋ESEMIu E1ҊM t1҉EUEU+EUuuRP芕EuuWVw9EuQE}lj1ҊM t1҉Ɖ׋EUă+EUuuWV&9Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMju#XZE9Ƌ}E Euu}eY[^_]aUWVS ] }t$Ɖ׋EWVRPhME"DEuE‰9u+|vEL։A9u9u V9s9sE]Ã}th^E"xh8-mY^tCpStCHuRPuuEU}t hE"~ZEEt};{tua};{p`dKH9}u@9Mu;}Et `d)RPhE"$@.6EtM}`d)RPhE" tCpStCH9Uu9Eu ]1EEe[^_]UWVS u }j8jsE1҉PEMA2AA 1ۉY Y$XZ}t.hj2ËE쉃P^_ u =!-ƉE} t hF"Ԙ[1ɉM!-EPjh WVu*hj譯ËEp }쉻PP P jPXZtS Su!-}URjh  t1RPuhjEEp }}M쉏PP P jPW^_utCHSLC419|} tMh7F"螗Y@Et} t#hlF"Zu uuS9u u X S X]=t S XktLǃ1҉l1AǃLcX1҉ \X`1dt}uWjAƉ_tCtP^tCtPFY} }u tCHSLEU#C4EEEt UCHSLC4uuE0jjSu1 h;SXZ؍e[^_]UE Puj!- UWVS]FHljL1RPuu uEUt1EUEU싃C|1EUEU싃URjW1EURPVtPu hF"@ u~ 1RPuu ÌtDTEU"7vkk ׋GEEjV XZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuu €}tKt19suu苃0uu Se[^_]UWVSE@E@0Et ExEau } tu}}tE1ۉEEƉ׋E t1 9E9ƉM|BEE]Ɖ׋E t19E]WVUEZY‹E@9sq~mE}u1PWVE0ƒ E ]RPʋEEH^_}t EP4PR[ }9}TtuuUEZY|x#] ]Ett E!ËEU t19r^Eމ}t(SuuusE}@,@0E@dpx E\9||>}5EPj|uuuƒE}E}u1Puuً|Eƒ }븍EPEPEPuuuu?ƒE]x]tCu xu}|9|~|uAEE@dPx |xt!@uEڋE u ڋE|<ڋEylp]DžhE.Pssu{‰E{up H1E@,@0S@uIB4dERlp t1r,z0B BRdP_K}w Ea u$EtDE/lpG4WP^hh9|c}uuUEZYPuuuO‰EEtxB,B0(}u }ut x|t |u4EMEzEME|KE?t|URjPWVutWVhF" LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1҉Ѝe[^_]UWVS(}^:EUEU t1҉E܉U7URPuuVEԉU؉ EE1EURPKt1ҋM܋])Ӌ1ҋM܋])ӋG|1)ӉƉƉE܉É֋EƉrvaPJURjujjP>t PhF"XZMA tP@G(W,@G jQYXtG(W,E܉U_(w,G 1҉E܉U_ vbBHMQjPjjRt PhF"`XZEP tZrZP4PR:XEԋE1EUh‰1 t1҉щ‰3EEP tJUЋM9ˉE}#E1ɉHHXpE ϋEM܋]L\}UЃv8M9ˉE}E1ɉHXEkEu܉t6M9ˉE}E1ɉHXE ku E܉D2BHSMQjPjjRt PhF"XZMq EUtF V$FA4QP:E̋@4uP1e[^_]UWVS]vfBHMQjPjjRt PhF"B_XEP trzs({,RS jPHY^$EtC(S,C 1҉EU苋AM؃H/E^1RPuu臁Ɖ׀}Mt1׋C|1׋URju1RPQtPuhF"d Ep 1RPuut֋F Ft:_vkk փ~t*uuhF" tFVC(S,FC vkBHMQjPjjRt PhF"XZEP t~vrzNJP4PR:Xju_XtC(S,C 1 S^Et UC(S,C IvkBHEMQjPjjRt PhF"ZYEP tu}rz}zP4PR:X17$@.t C0S4C(jjP0uu Se[^_]Ë@t@Ë@ t@Ë@tË@htË@ltË@|tËtËtËttËLtËXt Ë\UE @(]UVSuE H$X(1y6)tNp1SQRP e[^]UWtBRBR t RP`Y_}ÊtBRtUWRP5Y_}ËBht1UWVSӋEU ΃tt RP Y^CSljtȉlj{he[^_]USt)P@XD)P,[]UStPpXtPH[]Uh"h%hhCC"5|UVSuE H$X(1y9)tNp1SQRP e[^]UVSuE H$X(1y9)tNp1SQRP1 e[^]UWVSEEEH@}W4}t D) D)ƅ  Ex 19}5uVSh"z` E|BD1H)CNjEahE@ EDžp!-pp@tUkl1ɍ9~ډM}}x1:xURjV1RPQdtPERPh}"E‹Mq EJu KE! E1k֋^ jQ XZE4fHEu_ƋEJƋE1 t1E虋uƋEEڋ}tG`Wd}G@e[^_]UWVSEt1Pl@hEUE1EU}+GpWtEUG$:EPDUME@`1҉Ɖ׋E@H+EU)׉u}E@1ɋ}9ȋ}7UMEFuE^$EEtphxlppxt@DƉMAHE)׋EEIu E3E>1 t1҉MRPWVj‰C0E}Mtp`1 t1s(EAHEpNjEƉ1ƋEURjW1WVQ賹tPC01RPh}"kE‹EEp {0E,Ju I! 1kF t2EC 1 t1Ek( ju!EZYv{0t EEBƉ׋EE 1ҊM t19Ɖs)щ‹E[M t1 ))s(댋Eu})׋EEIu E>EI1 t1҉MRPWVhC0EUM t1C(1E܋Etppxtpxx|E@HƉMALE1CCC$C@CECE‹ER t1RPEPEE}8W S E1CCC E}EEDu1 t1ES Et=p`xdrz1BBaB8C1B8BPC41BHC(})8OE@@B 1zBaE>BvB0C1҉PS41p C(})҃0C(E)ЉC,E@rEx<u/.@/./.E@@]CjSJE܍e[^_]UWVS,}E @u +FEHPE؋AHƋE X01ÉURjV1RPQʵtPE @01RPh}"‹EEp E @0E܉F uMMЉF <u v0E@4uPuzE܋E PEHEXYu܃}tC1ɋ9H~@ Ɖ߉UPSUȋ AAMX뷉Oơ(@.,@.Nu"h"h%hXhCC"bt5C0S4C(S,C 3C(S,PTPTC S$pCE @0膮E @BBEPuϦ CPCP赦^Zuî ‰E1 t1҉É։1 t1Yt)G8W<)G$}u h"jE Xu9utpE MAP9q4u8@.<@. y(xH@.L@. @@.D@.A%AQE@P@.T@.EY눋E0@.W~Z} 1e[^_]UWVS<] E@(E؃} G,u1uȃ{1ɉMȃ{E9C(rC,}t-wSu"XZEtEPt@pEЉUvӋE@HEEԋEYE؋E u1 t1EE}P{}̍OKu؋uЋ}ԉ t1WVR8}̉CPP}M؃1ҀMt)}}9s6H 1B׋}d}9sH 1qBC EsE̋E#u1 t1EE)C(C,}K S$u,C,E Ɖ1u)EЉD1E,C,EƉ1u)EЋUԉD1T11E(@.,@.EUE@(E؃} G,uXM9Ms݋}ЋM|UЋMԋ}TLEUh}M)C,E)C(1e[^_]UWVSS] EC1Ex$tPGEGuhV"hP%hhڄ"WGuWuUZYtWSZYuF}S1Ce[^_]UWVS}u EX9F(r <҃<D 9F,s VWXZF,URNMN M芏MuF,Ef@t8EfH.F,Ef@tfHE1ɉC(S,]CS E1҉C(]CE@HE܋EH1ۀ}tX 1RPSQVӉ1Ӏ}tURju1RPut]KPQhF" EE@ Ev1t&EP @SQRP+U]]C8E܋E@1SQRPT}vkk ]UBjufhsLuVWhLuVWs(h=NuVWahMuVWRF tu DF DFF4#F,uF,EfH F,EfHe[^_]UWVS] t@ U f P8dǃ jDrƉ<WrFYZuWhm"1=/.P E fF81FFWh"h- &؍e[^_]UWVS]u }EuEu }]e[^_]jWVSЃSh"%hVV^NjP ѡ P.a5 P.kƃt(@hH%PZYu)5 P.CYu*LSh"h- 7Sh"h-s Fh"PYZu5 P.Z1Sh"h-: P.Ƅ=FVvhPSh1"h-:hPS&n1RPSVH P.;5 P.Bơ P.Xae[^_]UWVSuSB_X؉8/u@1Ҿ1hJC%PXZۋtm;thlu1WP ѡ P.S^5 P.Yt@9uVSBPِ uȋ2lЍe[^_]UVSu@Y1ۉ tÅtƋS ؍e[^]US]3@X]]/R UWVST=@.th8-hN"T[^@. nVUX=@.E}tPuPuS uSEZY~/9jPuSjSh"h"h-]EPSEPS=`@.tuuuuh%SC uSY[fft uN Z5$P.^Xe[^_]UWVS}E U#ÅuWuu h"=hhW ƃ y@Wh "h-h-O0R PhǸ"h-e 1S ѡ P. P.0=Nj[Yځ~RQW  @u550E.5D.5D.h"h-%0LR Ph "J=@.uURQV4  @uG50E.5D.5D.h"h-0R Ph6"h-t$j]%W6 V0 XZe[^_]UEU ]U= "-#tjjh "-h "-04= &-#tjjh &-h &- 4UWVSƉ׉ˉ t;5@.@.rWVh"; e.RPWVe.s{ S$=@.t [$t9{ u9suh0"S<XZe[^_]ËHQ 9u BA ÉʅtJ9u@BUh?"Pb<XZUWVu} 1 tC;5@.@.s.e.RPWVIe.t;x u;pt@$e^_]UWVu} t;5@.@.rWVh`": e.RPWVe.t H$9x u9pu 1pp P$WVh}"i: e^_]UWVSujj[_ÅtJNJ/t tF@PW3WZYt [u Ft[ 1ۉ؍e[^_]UWVVj/P_Zu1,VeY/txtEVh"9XZEe^_]UVSuc.F_.9s%)P6S蹤jj*9tC/vKSh"Q9XZ؍e[^]UWVS}u hū"09[uYƉ XZu hӭ"2YSWV y.&0MG Ph "h-uh"1j(PPV] xVp@.Z YV6 ãf.Zt5 f.11 f.50E.5D.5D.hD"Vh["h-؍e[^]US] =@.tSuh@f.f.P =@.uOj1RS5j.Bu8@u5w0B P50E.5D.5D.h"h-j]U=j.t"f=D.u50E.hï"h": 0E."fD.1҉D.@.@.D.D.=j.t1j.jhj.UVS]u =@.tVSh@f.f.P =@.uHVS5j. @u5~0A P50E.5D.5D.h "h-je[^]US %tuPA ZYt1ۉ؋]US]@.9(*-}Ao.tP< Y P3 o.Zuh-hA"`>jp(*-]UVS]@.Po.=@.tPj |^l@.-j:SZYt"j.pS3[jhy#SpZYh*"hh"Sl@.Y^ud(0O@ Phh"hq"h-h*"h%l@.u(0@ Ph%hq"h-jn s.Vh o.EXZe[^]US`D.dD.EU]S_uPh"h8-. hD.lD.MU ʸ"tS+uZPh"h8- "=D.tD.hC.PhC.5C.h"h-hC.hl#h-$=`@.`D.dD.EUStPh"5`@.w hD.lD.MU" tSttYPh"5`@.A "=D.tD.hC.PhC.5C.h"5`@. hC.h۰"5`@.$5`@.h";XZ`@.@ @t h"jyF]UWVS} u=@.tWh"h8- EE]99ru4=@. ";]u5!#Ph"h8-< {CPCPhȉ"hR.=@.t R3C4,*-h"h8-t}t?SHK))PDPPCPWXK"uSHK))PDPPCPuW+"<SHK))PDPPCPWwW:"@:{Nhα"PfZYt h"POZYtJt%uCDPjW  w"?CDPu蕓ZY\"CDPjW\ g"@{atNt)CDPjW胑 w"?CDPu ZY\"CDPjWԑ g"@t=@.t/Rh"h8- =@.th8-h"8YX=@.th8-j XZe[^_]á8*-x=j.ti0UP9XUWVS  s.}tt=h"]%[15j.5j.t=@. 11ɉ1j.5 s.tj@.j.tWShU%h-;hf3#S G uh-j XZh-h"6h-5l@.hS<l@.@  tS0 X(h-h"6[_}]9@.u j.}Sh="h-nh-hS";6h o.h~"h-K h- 5l@.hWtl@.@ *hGG$WwZYu  tWh o.h o.ƀo. =j.tjjh o.}-jjh o. 8*-@u&h o.h"h-@. @.D@.@o.u?=@.t5j.h"h8-7 h-hس"515@._X!@.9t!QPh"h-1ۉ@.tx;|@.u$;x@.u|=@.9u;@.tRPlPh+"h-hx@.lPhD"h-l1ɉ @. g j.j.=@.t5j.hP"h8- tVf=D.t/@.^ =j.1j.jhj.h=@.h" Zltuj.~K19|f=D.tR5j.^9})Ã=@.t#\#5!#PShu"h-/Kx  Ke[^_]UWVSEo. o.o.9| =@.1H o.h P9~ 1t@u=o. 1o.=j.t WP*XYWP58*-,ƒ = s.ue@.;o.~D=@.tUh8-h" 2[XU졘@.o. s. 9uO5 9u?!t#@. 9tr)ׅ@bhkut =@.u o.PRUhδ"h8-U o.h-h"81D.ZYftCftfHth-h " h-h!"1_X850E.h:"h- 5D.5D.hH"h-=@.uh"k[uj½@. 1=o.=j.tjS)ZYy@jؙRS58*-Bu&@u#02 Pha"h-jjV=@.th8-hz"0[_= s.u @.@1҉@.o.PY&t@. PVhδ"& hhk.5o.VK o.h5o.u+j.j.@ j.e[^_]UWVSÃ=@.FC=TtP=ltIʁlt=Tt1=f.u$=@.th8-h"/XZf.ht=f.0ȉCȉCCȉCC ȉC CȉCCȉCCȉCCȉCC ffC ChRP qY^Chs,s(p_YC(S,C0ȉC0C4ȉC4C8ȉC8C<ȉC  h4"jω؍e[^]UVS u Vh "j]ShS $S5L{.Vu5L{.(9%e[^]USPu uh"jP]SڸDn#c]USU x.Ruh"hSʛڸ"]ËUEPh%"XZffUSFPh+"h-Nh-hQ"*- CtsPh"h-h-hz"@*-XZ CtsPh"h-h-h"j躒UWVS]} t~C7h"V YZt:h*"VYZt-hr"VYZt#hyG"V׮^Zt1 @uha$w訮ZYt|1j}Wjj5.e?E? EEEPWS5.-$e[^_]US}thjEPjj5.]?w5`{.hӿ"XZE5!#@uG"P5`{.h" G"y5!#P5`{.h%"ʚ G"}y5!#P5`{.hQ"覚 ]UWVS(}tE 0qiб]ع1XuEEʉUUfEfEu͍Uι 1EͶEjh'jSj V5.e[^_]UWS}t!]U1E5jh'jjjS5.re[_]UWVS ]} t~7h"V蓬YZt:h*"V肬YZt0hr"VqYZt#hyG"V`^Zt뮾 1uha$w1ZYt|1j}Wjj5.e?E EfEEEPWS5.$e[^_]U }tjEPjj5.*UЃu5`{.h~"萘XZG5!#tG"P5`{.h"l G"Et5!#P5`{.h"H G"}y5!#P5`{.h"$ UW}t5U1jh'jjjR5.}UWS}t]U1Ejh0ujjjS5.De[_]UWS}t]U1EEjh0ujjjS5.e[_]UWS}tY]U1Ejh'jjjS5.e[_]UWS}t]U1EEjh'jjjS5.[e[_]UWS}t]U1Ejh'jjjS5.e[_]UWS}tt]U1Ejh'jjjS5.e[_]UWVS] }~j PW5. Rt$Nuj@EPjW0Ph"j j$pPjj5.EЃf=t Rh"}XZ91׹󪉍,ƅ8fEf;} 14zj 0P3ƒ 08t3h6"j( D,ƅGʉLj Vj5.ƅ914}t1"jhM"sQ: uƅ5jhtj4Pj8P5.%<hQ"ih8-輈[^1ۍ>1ʍu1ɉMfEEE'E0VhQ`5.  @u h]"j:E<u 5`{.hj"<u5`{.h"h-T ~<tP5`{.h"h-5_Pu󥀽_y-`9`%CSh"hh8-軇 j RZ<h"8Xe[^_]UWVSE] h Zu h"j 1󪍕 19}J jQhF"L8 ujQh"-8 u#Fuobu 4jVh^K%7 ÅtIjVh"7 u'jVh"7 uƅ7fDžjh0uhj P5.cƅp9؍t h"SY_uu"-hF"SXZthC"SY_h"SXZhI"SY_u hR"SXZS5p{.5l{.5h{.5`{.hc"@tAtif@ffh"SY_`f@ffh"SXZ!/f@ffh"S賉Y_!u h":ZEVhܒ"$ShW$X4S׃X9uEe[^_]R e[^_]UVS ] }t3h\#V転ZYth%V誢ZYu E'j EPV E U:uy 3h#"Tsh\#VfZYth%VUZYu E-j EPVF E U:uysh6"j1EPhU5. t hF"j5e[^]UVS ] }t3h\#VȡZYth%V跡ZYu E'j EPV E U:uy 3h#"Tsh\#VsZYth%VbZYu E-j EPVS E U:uysh6"j>EPhU5. t hT"jBe[^]USUBBPJ R Ph`"ƍ uEi"]鶯Sh"裍XZ]UP}E 0rEEPhQ5.ft h"jU}tojhQ 5.1 t h"jaU}t:jhU 5. t h"j,UWVS } 11;]}#j4h"`2 uCPQ1󪍕JƅPƅTJjh'jJRjS5. jPj!gW ,jPjAP jRjVRt VRPW5p{.5l{.5h{.5`{.h" rQƅRjh'hVjS5.S ȃf=v1QLhWǀ HLQhW謀 LHtpQƅRjh'hVjS5.9fv1PWhWM h"Wha#LgQƅRjh'hVjS5.Nf=v1h"茬X1G9 5Ct9C LHD04%h%h %$ {y0L%`vRh" 4%h%YXD4%h "ԉXZ1ҀHu6C9s!DLPh1"詉LBYXj 踈XCPShSSye[^_]UWVS,EE܋] h$ E^u h"jEU 1E1E9}t3Vh"ZYtNVh$"ZYtAVh%ZYt4jEPV| U:u=v3h."j1EGEEjh0uhuj EP5.Ep=vhP5`{.hI"OE1E܋U9UE܋EU܋ Ћ\ˉɉʉىӉ1Ɖ׉ Ɖf1u1u M ]1}‰E M ]SQ5`{.hg"赇qEEe[^_] UWVSEEu EBU܉EPF XۋUu hu"je1ߋMEfEfS1j EP6z U:t6h"jTTdDG9}ujh0uuSjEP5.r]e[^_]! UWVSÉM}EU %qtE8uE8At=ʀ@tQVh"Wu%tQh]"Wu WVuL e[^_]UWVSDEU ]utlt"tWJ*P @ VBXHM}P @ j@WE4 &h<%VSrxw!V@4 &S HPw$w}txf@Ph"mutf@ʃ@t%"t"QPWh"VSԃ>"t"PQh"VS賃f@Ph"VS蘃1ۉ؍e[^_]UWVS]}hpVjSzPh "褄{vTh"葄Y {yj h,"yXZ,C@tPhA"aYX,C t PhQ"IXZCȅt Phs"3YX{w j E_CȅtPPh"  S C h:Vh"C t Ph"҃XZhpPjSuj ςXu'tPh"蔃j 讂 W;} } <;u GVh"\YXujh "IXZjh "4^X>9tR;U }MuRlh "ZY1ɋlhlPhk<$܂hAlBXXh"ȤXe[^_]UWVS] }uh"螂^X1C9~D3Ph0"肂FZYj 藁X}CYE (]e[^_]UWVS`u U1Ev]׉EEEEEEEE EE0ShQ`u @u h]"j)EtU`{.<uRh" <uRh "h-K #<u jSRPRh "h-&jxe[^_]UWVSUu]1}EE E EUjh'RujVue[^_]UUM1EEE EUjh'RujQuUWVSUu]1} EUjh'Ru jVuZe[^_]UWVSREUMt2uBItu< }[yt ut܊ y_vCm t4\ 0H2N0H2N0HB]9uX[^_]À\um tf\\M t݈@UXPhB"h-`jLvUh"xUWVSÉ֡.P.uhh.*(Y_.h"h"hW~hr"W_Zu軞h"Ph"j J`. u.h.Ph"h"蓂h["h.Ph5!#h"e1X9ډ}Dh.j  $h"3 t.tWPjh`.j?;9}~ڃ<\# u5!#P<ؙPh"Ձh .YuRh1j;Y[j6^N1<$ 1$jXZh9"RXZ?e[^_]Ujh .~U=.u h{"oXj-tUSh{"Yh1j覛h1j蚛h1j莛h1j肛$hhh{" xVj"h"PLh.j PS6jhP$S)(h`.l$h`.SSh]UcPh"h-kjWsUWVSы-:֍RD{@u1ҊBuT8t9s -DY@tJB[^_]UVSËHuPs8tIS8kC4`9s `R 1s0s4s8X{Xu1ɉKXCXtP Z1CXe[^]UVSu] EPu36qzx9s)e[^]UWVS`ƉUUP 1ۋE9߃u*E|fE|Sh"j EPLzEEEEPh1"j EP(zUfT ȃ-DJu.D=uURIP U_Ce} t EP%Yuh "{XZe[^_]UWVSS1}11#tAEtSWh"P蝜Sh#P茜 @u h&h!"5W }YCu}u#h5!#!EZuh&h&"jEe[^_]Uљh+"Ph?"PhH"PhR"Ph\"Ph}"Ph"h-}8jpU茙Ph "5+-}. t5.Ph"5+-p}E Pu5+- . USÅtN菚.twRtF .tib0 Ph .h"QH. .u=.u2jo .t#0C Ph .hH% tŋ]UWVSEEEEujj}WjVP?L@u"e[^_]ËEƒUt Ph"jP ZtjjWPVuK@u ]=Љ.u5+-uh %wx ms5!#M;Ms"VvvPh"NxE f3#j XwX]e[^_] UWVSEE]EEjj}WjPSJK@u-u YtjjWPuSK@t̓=Љ.uuh "wXZv<9t's sss sssh'"vw ՋE荞 kT؋U9u FE1}h .h="ZYdTEM9Mt?Sjhlj"w :1;{s֋TM4PhP"vG ,j uXue[^_]5 e[^_]UWVS}}} }܃=̉.É΃=Љ.tO=ȉ.u:=ȉ.t }u&}u35+-Rh %Vv. 0h8-juV`bN}u!Rh "#v.Y_~7j 1uX.~#.~}uڋUe[^_]уtut3]ߋMtu*E r4s6Ph%4]ߋMEtPEPhU"b sPh#Ph#cuXZM]ߋMtuuEPh\";u$M] s SQh@$SQh#u }uEe"e[^_]tE e[^_]te[^_]Ã=̉.t.URh .4+-hj"UWVS=ĉ.uh"sj kj=P_Y^Xd 1Dž\ Dž`hj`Ph .\PVSG@u!ڋ\==.jjDž`1Dž\YdX@DŽdj`R`PPQVF@u!h0 Ph .h"WBuh .h":XZ&̉. Љ.uPh .hH%0s e[^_]UWVSWE}u =̉.R˃=Љ.t>=ȉ.u3{=ȉ.tNu%"u25+-Rh %r. .h8-jWS^u"Rh "r.XY~7j q^.~".~uى؍e[^_]it1RE rGK=.tUPh1"rYXUt2=.uUPh"qXZUB9|SWhȉ"q NuEe"e[^_]qE e[^_]pe[^_]UVS]=.t Eh"SpY^uEEY61҉jEPSEUE 9u%Suh" =.jg8u8u̸]1PSEPuVuu0D@u1t =̉.1ȉ. .u}u}tPjUEPj "UENY^tFȉ. .u}u}tjjMUEzjj "UEXZe[^]UWVS]=.t 'EE辐18jjEPEPuuC@uuh"kjS}W u%Suh/"e =.xjejuV{|W%8u|1PSEPxPuueB@u1Ft =̉.x|t1pȉ. .tpjxUEY^?URVEPVhL"jduV2mpPUEG$tkȉ. .tjj|UE~XZEURt蓤EPthL"jd]SljPًUE$e[^_]UWVS(+-8 .t f./. .SVXZYuVh.&e[^_]É)@E̍EӉljDPh.hJC%h.uUWVS`Eh.ZE@&1]M;>r2jPRU Utj@uVRPV3hV"WGjEPjh.RUk0 UuE Eu1}u+E9Eu#/tj@uVRPV3hf"jGQ1EEe[^_]UWVSEUE5̉.$ˋ .ȉ. u'. .h .hv"[^=Љ.tu*jtHu!u05+-uh %k *h8-jSuXHu"uh "kXZ=.~(j jY I~I~uڋEe[^_]1v{9}E0Ph1"mkFYXt Wh"YkXZE e[^_]eje[^_]UVS]EjjEPuVuu_>@u Be}t Sh"j. ȉ.tjIY2=Љ.u Sh "jXZuuuuuh"je[^]UWVS]uEEU E$E. .=ԉ.J. ȉ.t}jjEPjuV~=@tdMt]QM XtMMMjjEPWuVI=@tM;Mt WQ _j .PY}e[^_]0 }tuh .h " = t)tu*Sh]" uSh"Sh1"Sh"SXZe[^_]UVS]E jjEPuVuu<@ul} t Sh"j)EUEU . ȉ.tj cXP Љ.u EP P5+-Sh&%h&IuRPh W$h uRPh"he[^]UVS ]EjjEPuVuu;@u}t Sh"jT. ȉ.tjE=Љ.u5+-Sh %h EU=Љ.h RPI\ t PXuuh"g e[^]UWVS,EE̋}uu<=.t3EjjEPEPh"E܍Pk((U܉UȉMQM. XۋMЋUuwuM1BH(jjURPVW`:@uCEԋU܋M؃t (9t$9uދẺE1uh"j 1C(9~ˋ0x3{px s{ pxs{pxs{p x$s {$A(뼅t%GPh+-uh"jUReUUС. ȉ.t7j(EY(}t GE܃t9]e[^_]j =Љ.uuh "eXZv$v vvvvv vv6h"e,뗍e[^_]UWVS]EhEpEl}󥃽pu@DžtjjtP|Ph"b|<Dž|tW XuJHxjjxPVph/8@ut9xt Sh"jl%EpujjڍE_X=.t=19|Wh+-Sh"jURc jjUE{G ŋ=. =ȉ.t jQ=Љ.u Sh " dY[|~+t4Wh7"cG9|~ hf3#cZj bXue[^_]& e[^_]ÍL$qUVSQ$A QEjjMQuVRP6@u}t Sh"jm. ȉ.tjYd=Љ.u Sh "%cXZEE1҉EЉUm\$E1҉EЉUm\$E1҉EЉUm$hA"beY[^]aUWVS@]=.t Dž S Xuh&hW$j1h-%R胘Y^&18jPSU u.8"uShQ"9t8uShb"j9tҀ8úw܉ h-%ji 1PSPVuu4@u1t =̉.1ǡȉ. .tW EZ)APs<$PUEV tVȉ. .tj EvX1PDs$PًUES5 e[^_]UWVStx|h .rl .$.rYh.h)ȉl)ȉ.u .u|uH1ۋx9t担tH%u5!#RPhU%PPC뿃} t~|P+-xw5!#RPh %PP|PH%xw5!#RPhU%PPU Dž|+-|+-Ã=ԉ.( =Љ.th.h "$_XZh.h .hx" _ EHv h2 $h"<4&h"^_X}uC|@0|psPh"^Y^P|p4h"^ |p@h"^|0.XZpt 5!#6hh5!#h.'hh"h.-%ppu/hWh.hh"h.揃-%ƀt2hWh.hh"h.-%s2hWh.|hh"h.h-% s2hWh.Dhh"h.0-% s2hWh. hh"h.-% s2hWh.hh"h.-% s2hWh.hh"h.-% s2hWh.dhhɬ"h.P-%s2hWh.,hh"h.-%s2hWh.hh"h.-%s2hWh.hhV%h.-%t7Vh26#j VXZhWh.rhVh.b(h.|p%Ph "`[|@H t Ph"E[_X|p(h$"0[j JZ }r=؉.=.u }|xXDž1DžtxTpj`SPPWt-@pu\t|@9uߋ|@(9uΉdQp ^dtNjp󤋅|@XPwPT Y|XX=.uTE tN|@XpHv9} |pUE"<=Љ.uh .h "mYXZ|@XPvh-"PU{X}|ps E z-UEÃ}tP@uj- Ph .h>"jaOs u|xtjh.h .|@@uojjPjxt+@uD. .=ԉ.h .hU"|@@EH{$&|xt|@8d uq=؉.:t.s j|xtjh.h .S . .=ԉ.h .hp"Wtx\=؉.j|@4p\ _+jjPRpx@PtF*@pt*|p`t7|@4`&R& ^Kw8 nЉX1ɉp`9ptkp`|G8É֋X9sV9Ct FHt F9C(u:Nu*PQT ZPtރ NjTCXpsR] X1.d1ۋ|;X4,F\s. .t%xQuujPtC`jjPSxt(@jjjjPSxt}(@UjjDžjjVSxt=(@uIu8 u3赳 XjjVSxt(@u jٺ .|c^_9Sڻ [DžjjPSxt'@tgjjٺ .|^u Yuh .h"5+-W KjjPSxt$'@u jڸ .*S XZhƀ.lƀ .e[^_]UWVSƉLH.j=P>_ZƅTt9sx?u @ƅTGhh#V,Y[.t+-+-8| 8Vs tG=^jh#S P` F<=t:+-M  T=ĉ.u h"s 41Dž81ɉh 1ۉtpƅY1j,Tx=_ZƅtF1ۉH1DžL1<1ۅkj=V>=[ZÉluh-#VdZYu09@llh-#VdZYu D1j,S<ZYDt @DhEa%V|dZYHt;"HuEa%PTh", =.jGr10jlPSD"!8uBp8h|%VKbZYp10jlPSG48l 9uSTh\"8uo8u48,0,90r48h##VaZYuTh" ډlHw^$&PmPaPUPIP=P1P%PTh"1L DžLpB^VTh"u D1މDu DžD<tTh" D$x&)n1ɉjlPVE<@l 9uSTh"8um<@4849Ƹ8r9u-u F0j PV x;3ue[^]UVS@Ë5.=X,-tjtSvQZYuFl6j j5SHFSP$PFSh -%Pþ.5.F PhX"j@]S<Sfe[^]USQtP{=8.uSZ]UVSÉu=8.u VSZYe[^]UWVS׉΋]Uu E E!UuU $t5!#[^_]USt<0„!1=8.uSZ]UWVSLEӋu>hh"VZY)ƒ?EljDUhbSPEUDEj URPEU:*u%jjWSRPEP,tEuj>u' E9hbSVD e[^_]9`,-t3UVSRPjuV:`,-e[^]#@.t ú.=t.u.UWVSƉӊ>uuVh.HtB14.hgp5.V=4.1҉4.hgp5.So9=4.~؍e[^_]UWVS,E90...}]6SP9Y^y#...=,.u. ,.SoZ=X=&wAKw2if.7[nRf.7D=,w$==!f.7=Xf.7=KwJ=w$==` f.7 =%f.7 ===f.7wf.7lf.7af.7Vf.7Kf.7@f.7 5f.7 *f.7 f.7f.7 f.7Eۣ.Eݣ.Eܣ.eẼEfE1E. 5._Sj5.E0.e[^_]USEPhht@j> 1ۅu E]u+hp"eaZtPu.X-%T~.hk"5aYtP\uZy..1ɉ \,-=. .t.0h{"`ZtPu.[#~.hv"`YtPtZy..=. .P]UPUE.1J$& (U"U"lyU"U"U"ۍU"эU"ǍU"뽍U"!u,U" u...1UVSPh"_P_ZYX,-h'<%_[u%1ɉ 8.Ph.R[^Ht 8." t 8.A"."."x.%%t."l."<.!"y1......|..~1҉l.E.U%t.7UJ#u5!#\.U#u5!#X.U"rd.U"`u"T.U"Eu"P.=<.t8=.u/U"L.UT%H.=L.u1H.L.5!#=H.u H.5!#UE$.t8uh..5!#UP%.=t.tt8uh..5!#Ub#^.t8uh..P$U"/.t 8u .5!#1҉p.EPh5!#h5!#h..ܹ$"EP5.5.hx.|. %" EP5.5.hp.t. $#EP5.5.hh.l. $Y# U#Uu5!#d.#t `.ͧ%U $ `.tހ8tٍU#Åu5!#.5!#8t&jjPPuJ,uV1EDE".UN%Åt =\,-u5!#.5!#:t+.HPjRGPu+uVDDE"Y.U|#6u".Uq#Åu5!#U4"…u5!#=x.u5!#É.;u .e[^]Ë.T.n.P.^=D.tg=8.t =.uMU=.t=.u.X.=.u.H.1҉D.]1D.á@.t 1=D.ú.....USc=8.t =.ul=.u<.L.fL.8tH.8t=<.u`.=.u.\.!=.tD.=L.t9.~j CX]6]Uuj5. =T.ud.8t .Ã=X.uUjlXË..q.bUWVSu M1+uAM]-}tue[^_]USÅth$PAZYu "tEPEPS tt<`UxD& "Ux<D& "Ux "Ux"]]ÅtVUVSQ覰Xue[^]t<+u;+uC؍e[^]e[^]U$.h.p.|x.m1@.]UE t <-@t]USuZù¡|.ڡt.ڡl.=.ttS蘯2Xڡ.@.]US=.t@.u ]SJX]US]SZ3@.t]]]UuZu Y9Ã=X,-tUh("Xú`.UWVSu}]E Et#jYu7u21ۉ] E-"jYut$RPyZYtRPjZYuÉE1ɉM EA" t9Et'hÃu1҉U t EX"Eo"vOԺHu Y n1EEU҃Ut<9u t0G9Eu߃sڅu}EU e[^_],1E E"e[^_]@.B@@@ 9uUS]t=h,-tjh"XZh,-]Ã=@,-UWVS.@@ˁ1 }1119މM}Z .9t+9xu"9puUpP5@,-5O Uхtjh"FXZ뛍e[^_]Ë .…t8=.u/US@t &11Ҁu 0@4@[]UWVS$.$@(@u9t9pu9Hu,@;Ps D15d.%uމuv@E9t(}9~u9NuF9,@<vԋ{9t utt=.t @td,-x; @~QMh jˋ ZYMu 1.0 @@@xCSP{x B C{WG B POE܉G1GE@Gw x Ex.$@(@ EUF1҉E܉UEUEUEU9EM|!@uWE9@u E9@t`?@]juu@-Bu@ujh"[^&.M]艈@@h,-Ft*Th,-=.1ɉMܻ.@Mt@@ &T뾹 )QDP@ià u.u}艰0@4@Et]y*jh"XZ1K@,-yZ=.u/@,-x&t"SVTRPK 1E 1E .ؙ@@^}t-=d.uAEEPhW$Od.ZYEU艁0@4@=.u2j2X=.t!=.u+lt.8=t.+.98t<WQ Gz8OW Q JMԍJO]É_ y z,@;F0De[^_]Ë .t&US$@(@ ,@1[]ÃÃ=.tCUu/ .,@w B,@$@(@1]ÃÃ=@,-xzU=.t,5@,-8L@,-5 . 1ɉ .XZá.4@uƃ0@u.jh"nXZ;@tt.tUWVSu} .Uy 9}!@u EU@uG@E䋋@9u9t0E%@؉EPE9t8E;BuE;BtREU$@(@%,@1?E9ƉV.@9@}A@4t.t&[^_]UVSjjY[t@.9t2ʋqY9t9rr}ы扰$@(@1҉,@1҉Ѝe[^]US.u1Q@t@h0@4@[ut RPPZYs@tt.t]UWVS .t @t e[^_]pE11E9t:EP@ EUE@1EU9Ɖ}Ɖ׋EEWVZYe[^_]Ë.,@t H,@cUVS$@(@9}Q@u#%@Ћp9t.9^u9Ntv퉊$@(@,@[^][^]ÃUUx1ud,-]US.@uǃ0@ǃ4@|9t@@@g0@4@.1ɉ@@$@(@,@jjj@&Bu@ujh"XZ]Ujjju&!Ѓ@UVS.0@4@ut@@9} 0@4@[^]UVS]u 5<.q.Yh8@j.@1҉ @@1ɉ@@$@(@,@ǀ@ǀ0@ǀ4@XZtSYu .@5.5<.pXZ.@u@e[^]UVS.@ t4t&9tPQ P莆 X1ɉ @@uB u @iFZ.t ǀ@PI 1.j5<.*p e[^]Ë.1t@UWVSt/Bt/; r"H19|0<9Osr;s B1[^_]UWVSR1ɉM1.G-t.PS0ZYuFFt! ̅ujh2"*j 1e[^_]1UVS]utO=.tڊt <^w7Bt.}t&<*u{t{tjnCPjnSZYuހ>*u:Vt3st!dt1k1uUE 0e[^]UVS h5!#j蓇 hl"Dhd.o hX.e hL.[ h@.Q d.8.h.<.X.0.\.4.L.(.P.,.@. .D.$.hG"0D1[<=:tjh{"?j FWZPÃ$&%VF%  V?F % V? VuF% V? V  VAF%?@ V? V V  V Ѝe[^_]UWVS EU qu=.tw }8׃?π]w}8J ?΀]wu0J?πw]K]?΀]wUQU?ʀJJJ]JE [^_]UWVSE uU=.u~ 9sSCM9sICKB~PR_<9r)S{Y"9sC%[tS[Z1Me[^_]U .E1uN(.Ev¸u61-E^u =D.t,-ED]U .E#1uN0.E¸u601-Eu =D.u,-E]UE=.tE].]USQ]uh"h. w?SSZt'؃@PCYu@Sh"(S5t.SZt. S YtS5p.j h."yE.SEPEXZ.]U8.E¸uH--E]UU 1}Du% ]UWVSSEIuRfP$^X[RVZY1uEV Xt SR$Y-h.jEPVPhuV)ZE8} tE 8؍e[^_]UWVSRh"V:h"J:Sh"PQOucjh"V=Oǃ u.h":Sh"POu0Sh"V O Sh"PNEWx Ete[^_]UVSh"9P9ZYu3hy#V#ZY1t=h%V#Y[1t(VsZt ؍e[^]te[^]UWVSlht`ƍxPVrY[{%=eh*"V#Vw GShV  #jh"V芵  1҉p1ShW  t t u@h"W"YZh"Wx"YZh"Wc"YZt<"u5vptp~HpSPV t!SjEPU)U t1e[^]UE.U .t@]UWVSSuE 8=.u ^9uO tu QMZYMuGCQ9n W3n _Xu s ZYt,jjEu VC EC3FC^ Fe[^_]UU Et1ɉME U]6t E]鋙]á.t);4?-t!Ujh.P.@ UWVS]=.u3.=...uP..Àu.%=ua%=tSSH.%uF .A..9~1!Ph.ZYu(1.K1=.4L.15.=.t1ۉ.UU1;L?-u PS_/EZYKHA$&}e,+1.#1=.15..t.8 1ۉ..=.vx u-x .=.w1ɉ . .5.GZq1..8\<1.I1.E1.:41.)91=..=.v6x u0.=.x Z߀x I.=.w15.1ۉ..8 u.8 o롼.oZ.Y1ɉ .=.=h?-y.-.h?-_h?-[} t9s RUVh. Uuω_1.ItVh...XZ.8=.t }.tPLi 15._.=EP)[¡.u=...u"z.tމU&U; u C9re?-Ed?-E11ɉM.9t)9s"RUuVئ Uu ta}t%8EEF9rL< u+9sJu/8ENu9s,Eu뾉9suՉx1F\..tP h Xj.)@P,..)RSPC.0e?-8uCSm<XuSA._WA.Wg Y[..t{}t1.Ph.o-1ҋE7_Z.E%..9.s졠.u,15../]1ۉ.Ku5.DY..=.v d?-8Huh"(ZuJC%1.v.e[^_],e[^_]UVSQM1uu.EQЀ w[jjjj uuuVtjh"Y[11RjjE0RPuuVuɋE@1҉PU8.uEPjEPc EUeY[^]1.9.|.á.t @@@ Ã=.uUj11Ҹ XUWVS.t`?- 0?- .1Dž|P7@$jjWP3VT:QDQhr"VXZ$fSftxRPZYx,E%=ufSfthP'YXh"%Zud P:X~P?-1Ƀx tA ?-x t tlph"hb#Sq|1ɉx =.u:pl)ыt)Px jjxPh"SSyWVB%Vc Wc XZe[^_]ú9.t9.t 19.‰USR.t>BE.Rc XE=@u$(.t t7tut g ]UVS=\,-u=8.t =.ut/,.0.u ujjj54.RPV p.u)=\,-u^5L..L.1ɉ .-5L..L.1҉.u H5zY6Y5L..e[^]U]UWVSt e9ZƉׅu‰...=t.u0t;5..}jjjG 1.t.ld8e[^_]UWVSQE)ơ$.u$.$.ǁt#t1 2ux%$.Su5$.á$.ƒ$. . t;x- st jk1j1Ztjh%"蹱ZYtV1VJ)Xe[^_]USVá(.$N   tw #5.jCP7tW6%I/f5.S5.5 .q1 .?E4.؋]`$.$.PS5<+u C< uH.tP_ Z;u 1H.SH.X5.jPCP=.SB1X];!t,.tPN_ XSQ6,.Y=.ui,.uh7"h5!#XZMh7"P=.ut71ۉD9tt KtXEC<tiи e[^]Ujj#UP1҉.YYu. ыuUS]t CPX]UPKPEEUWVS<$..@(.e=(.t1(.1.. .=t.t= .tj轳_.t x@jB..Yu*:t!u5<.YBZujQ_=8.t*:t!vu5<.&BYujZ18.=.u1.=.tjh"1.:͹t h#Xt?uh9j::_X Ws^Y=t.we{Ã=t.Z(.$/t.-7iCЃ . jS_Zdteh...^=(.t1ɉ (.d= .u.u_un.ƒ@+t2tA!uI1D!-tȡ .=.uLC1@ ‰.j@.]=. .  =tSZHOEa<.1EЍEPEPEP虝 . tDFEĉE=.u Pw P1_=E@Ƀ}XHNuEЅ:EPh" 15.HY= .S贜 .YuSEЍEPh"C. ..Ht!5.h5!#5.5 .. RߓZt5 .j1ɸ/eu;&7C!$&*t0@tg!=(.7u-%$.=.$.=(.7t%$.$.=.=(.7g=(.7tWjh"j#]S^SvRPσH=(.7t(3$.P_$. tA tS u݃=\,-u yhK5h?-jYO =(.t)SZH Fu]EE1҉UURPvƋEY_tPnXi Fc $`&j1ɺ#7 .19.}.1;..|Ϗ..X=.t5.5.G^_j.19.}.1;..|m..j1;..|.1ɉ .=.u+;..}5.5.YFXZjj5.1;..|.1._jjQjj5.V=jj5.v1;..|.1.=.;..}ze1;..|.1.jj5.1;..|..=.u5.5..E_Xjj=.t5.5. EY^1I+.19.}(.=.u5.5.DXZjj5(.K7 .19.}(.jj5(.8tFm謹G5.1;..|.1..Y5.5.F5.q=.y1.....d9|d u=.t.d1..5.5.H_X..19|, G..19| G{RPEv=.y15.5.5.5.5.YG\x-1EȍEPhW$=<.uEtEPZ9%t...D..x.jYj譧8..$.1;..|.1. $.  . .$.1;..|.1..15 .Ѓt+Ѓ$5 . t $.1;..|.1. .1_5 .x1FP薶XdW[..15.D..1=D.x..1x.h"?맃=.j 4?-" =.z5<.6hy#P u jh&"5<.P7YtjhA"ԝXZj ?-$t5.jPoPt jhl"<;..|.1.5._vt\,t4uj^;..5!#}"EȍEPhy"t jh";..|.1ɉ .5.Zi;..5!#}"EȍEPh":1;..|.1.5.XuMjh"@/1;..|.1.5._u jh"V^ u 5.RP>1;..|.1ɉ .5.ZJjh"?|15<.V`2_kPYt VVT2.1.P臇Zu egjP1..j1ɺzm" =.u) ?-$t~#j=. jh"[Mj1ɺ"L_  1?PSq'@0j1ɺ">^  Sq?@j1ɺ";4Y u lpSrj1ɺ"%[Ze4 t u.Sp_e.j ?-$% j1ɺ"^.19.}.#. ....;. .} .=.+.Y.19.}.#. .....1ɉ . a..=(.it Dj1ɺ:(%iSXZ=4.t.̯UE=.t@]UWS]Sj"XY1ɅxЍe[_]UWVSu}t ME  u ZE EE EuEE܋EEM9EEujEP5ǃ Ethuc;us^ .EPU9@%=EtPU9rtEt>WSXt1E9EsWQMS_ZHMt QXYKEPU8EtWF Zt WDI YWEP.XZ}tE)}+} MJx҃u̓@tAu=. =.B$}mu;.}Rj#;k.XZ끍e[^]UWVSÉU΅!CEC1ɉ}M98P@uBgtB$@ur5X-(@t Att+e=. =.B!5.V9}Pj#Rj.XZ믃DuA1x8tLuxgt;AyuȍIty@8u}O@Gdufu die[^_]U塌..|.r.]gUM U.y1E E"]7]UM U.y1E E."] ]UWVS.Et Eju+[^xPƉUY9E}jV{< XZu WXjjjWqBu@uS@ W^_VSW}EWMș}9u9tSv@ 륉 Et;u{Mu {+u{Gt|3t|3uHVSY[|3Eu3|3nu,|3du%{GEYZuDždDžX?\_pZt9pPhW$<pY4 VWhڋ`j\SdZYyJ`|ppPhW$لp3 VWhڋ`_= .u WYt DžXmdz Zt䋅`ppPhL"脅ZYYtd{VWhڋ` \1ɉX= .uOdxEPZt:`xxPhx"VWhڋ`zt 58.VaX=<.SWh5<.5<.sh,.5<.JD.Xd1ۉ`.$1HPTH;.t.xPlPTPIPTTu PlLXB-?txLRDSVZYƅtVDR$ΉX9Lt~ ujh"So u C: XB-t 1҉HX .t=@.tPXhy#\^_t@xP\\Y[u(EU..x|..H.tP!h@XZ{=@.tuLn1ۉ.h"`<^_t:h4"`&ZYt$`'jP54?-Sk0 =.t R`O0 Ie[^_]UEu1E5<.PzZYEU5.Ztjh"Ӏj茈 hy#UWVSSÉ։M}uS_SsYNxuSIZut.uƸe[^_]UU<.]UuQ1<.jZUU<.]aU1<.jUVSu1SYtPZ9u]e[^]e[^]UWVS}WeWvWWjtAuu$1҉u#1҉tEe[^_]"e[^_]UWVSËu t׉SW W]. u8SL. ZY9uujֆXV@e[^_]UWVS]sESEP [^11VEPZYƅtcVEPEP 1WEPZYDžt.WEPyZY u5<.Xu- Xu- _닅uu_;5<.SY^9<.u uZ1u[X]e[^_]e[^_]USÃ=<.tS$X]1Ҋt%uH%u@suB@Ã=.u*Uh"-Zt. .".á.UWVS jjdхZYEdNyV蛽X tb P tN)EH9|=MMMju{WPECW9, UR$U׋M Ce[^_]Uh "ZZu0"UWVS]S$@P _Xe?-8u"CtZ d?-8u:KuKCBBCPZ;t*tUQMWSi MUuBBCe[^_]UWVSu9EP4_lju11EEtHA8e?-t8d?-uUMSPЮY[MUttEE뮃}ujQXZy1ۅu|Vx$W܃d?-PVe?-Ph"WS BUMMQPDZYUtuRU_UXYFFBu؍e[^_]UWVSRh{#~PY[unVXtaWƉ$T$RUSh"Wh Y%URP S) h*"VEV) E h*"VZYe[^_]UWVSuu1k>tVn_u c|$W$ XZtu hJC%Vh&%WS}tjSTY^y S$) ZPX؍e[^_]Uh"ZjuPbUWVS}1ۊtAP݀u59}s8Gt+8Gt'<.<%t8.tRPY^CGjCŚXZutKH݀u=9us8Ft38Ft1 <.<%t 8.tQPSXSBÃCFe[^_]UWVS]S^u1jjjSBu@thVS ~ˍ19=.t)RP芨ZYu FSW_XSjW]ƒ =.u9P4Yt"SWP;5Pi:vRgZd1e[^_]UWVSu'X=.!8uy#P^h+":PEyZYUt""RUƉ$YPkL$QMWd?-Pe?-PURh4"MQV踽$We& tXUVFZUtRhK"P+?G Sh#P?V& t'YWY>u V% Z S% X؍e[^_]UWVS}1ۃ=.u\WX$S~WhS"SPVuPǃ VP#ZYu S% Y1Wz% Vt% XZ؍e[^_]UVS]hy#S^Zt(h"SZYth4"SZYƉe[^]UVS]SYuVSׇYZu]e[^],~V&~Ze[^]UWVS u=.h.ZjXhc"Y_?|uC؉E-uEhy#V_ZECHtjhW"!u[^Vu&Ɖ<$T$RUF}WuURPNW# V# YtsfGftjEPV Ht-WZKtcu_E18E h4"|XBEP;E8E 0hy#|Y^W2Z;u SQ# X1ۉ؍e[^_]UWVS}u =.j֐h"nZY~1E E"e[^_]sVWSE4$E<$UMT$RU{EWVSURP۹$W" V" E@up" t]e[^_]/e[^_]U|EPuMXY1xE%=@UVS|u= .u1V[t&V$P{VPhB-\|PVMZYy VjXG1ۃ= .uu#jjuuuulƃt*u Ee^_]+e^_]W|$wUWVS4GE̋G EȋGEċ7uu2,=l.u2=.Pk.RPWVcWV4Ɖ׃ - .uWVcY[uu}t.Eu藊t ub EUcuu3uuEUEU9uEt.$ uuP&EU ~ÉEf=.Et& t uEUĆ t t)E]Xȉslz( 艆E }  Eԃt.g} t}uS*(EƉ׃}s}t$ ._E@)1ۉu؉}Z~Nt;} t1҉U诅RPu%à }tA臅E؉Ut.襅t u`Ɖ18. .uM9)ډƉ1ۋM} t} u.Ɖ> t t u* uxuuل)ډƉSDL=.t)} t} u}t裄ƉE„EWu؉}ܹ11Ƀ}t&=.tM\RPj =$ Mj}!SQ{&uu+z^=.tMWVuuRPEU$=0.t;}t5 ut.t t@t!e[^_]g_鵃e[^_]g_UWVQM1yHL¸u 1=.jjPWVeY^_]ÍL$qUWVSQ8QEU1M9ȋ}|'EEH=l.uk.9EE}11軁 .uEU)juuRP蹁EURPǃ[^y=0.tLۂւ t u, ut.<ͅ u@)蔂t.訅 u B@u2E؉Uuu+ZYZuu*_XE؋U܉EЉUuuY[1uuЋ}EEÃt.Ex u5#Å^IJ .MCEă=.XmRPSO!Eă J…u =.~1҉8.uȉ}E=.u  t umU4 Ut u uU Uu uE9ƉM_u}EUI}u}uEę)ԃ=.t t u}tu}EE9ƉMq1҉uȉ}uȉ}̺1EjuRc"uuvt EЋU=.t.WVuuRPE؋UEЋUԍeY[^_]aUWVu} ut\WV趀ZYu[t t u݉5H,-=L,-΂Hw t5P,-=T,-e^_]UWVSu} ucWVHb xb)ޅ~j2ajjjRPV tEjajjRPM)S=.Ee[^_]3rWVEZYt1ۉ] E"e[^_]E\j`EUj`EUEU!YY@tE9ƉEU!ЉE9]}O}t-9uE|#jjjuuE.)HPt%x=u\P-Ux=uOP+Hx=uBP=ÍP^wƅPh"jWD"5j PWO‹ 9u5!#%#hԣ.Ze[^_]ËX.;P.~~P. ̦. T.‰X.US<.X<.Ц..[]É19F-t @uUP`iYt.t.t|.t.UWVS.UjS EjS }tUuu YXtP5.} ljE5Ħ.5Ħ. 5. E.EĦ..XZ1e[^_]UWVSÉ։9.~.Ħ.< +t[^_]UWVS׉ˋ5̦.V̦.Љ[^_]M=.tt*ttt t XÃ=.u[USjm50.胀ZY"t:t1ɺNC=p.tl#t1ɺ*C]Uht#讽0.PYZt 0.?"h#艽,.PƽYZt ,.#jh=U.jh,UĦ..h.h.ނh.Ԃh.ʂ h.轂1|.ZU1}]á`.d.UȦ.1<.1̦.9Ȧ.~".̦.Ħ.1ɉ ̦.@1X.T.P.h.L.H..D.@.(.t.p.l.`.d.h.(h.h.h. h.1҉|.UWV=.uu uƉXZ11. .u=.u u$ZYtl.@=.tʺ@b P,-T,-.ut79MM |-M9 H,-L,-U |l.@x@l.c B.9<.H1Ҹ WVY^1 tj uVRP;FV葤ƃ1.)9~1Ҹ G19tD=G1Ҹ <.X.e^_]á.t.=.u .DUSȦ.9̦.~$Ħ.<u.Ph.€XZCԡȦ.̦.<.X.]UWVS]u }Eu@0tjxYEe[^_]阣=.tW~Z=.tw/P'x_uSQ~[ۃ̦.~K1S|YuSWV~_ZVĦ.t2dZYu̦.Ħ.DV c_tW̦.uVb^ƒt .VĦ.tcZYt t.t.t.Ӊ؍e[^_]UWVSEUMЃtH.} u)}u#=t.M(.}tuEPjEU RPu ugu=.t[l.tR E..ut;UE }EU ..(.u=(.tr1ۉ(.1D=(.uf=(.uJ8u u1ɺZYG9{Ft|.1k À.ك}u E1O. ̦. E1~RjEPy ̦.1҅~ Ħ.TRPuu&Ã=.u}u9EEEE55X.+5h.Ee;5.'EPv_.9h.uY=d.u=`.uEU `.d.1=.~+9=.~.81ɺGh.w|Ym19}E81ɋUG.9h.|1}uEPh.|XZȦ.9̦.~Չ19Ȧ.~=.   Ħ.<<@B)5̦.h.h.9.}1ɋ. JKݸe[^_]UWVSƉPa[=.t<X.+h.;.~u u1ɉZYuFu1e[^_]UWV։PsWV ~ e^_]UWVSƉ19.~  .t .)C1[^_]UWVu} =.uWV1ZY ie^_]á̦. .X..á .̦..X.UU1wR50.wZYUS]1w%SZ1uS5,.vZY]UU1uj jL1҉PPYZUSE] xt+uxxt \tf1҃‰PTx6D&9tu!ـuJD&u'@S$Yu SZt놸]UVS] uVjSu 93sPuCZYHte[^]UWVS ÉUu} L.Ex.=.uuSx.Zt t.1L.x.dSPEZYtJHWVM^_x.xt p.Sh. yWVMZY5x. 1x.Sh.xh.k|. .Pdyh.x|.@}|.2..9h.}%h.xX..=.9=h.| ̦.̦.؉ESjEP8tU$ t9r)ډh.w5x.H 1=x.[^0x.t D.u"uu} U̦. p̦.~@9Ȧ.| .|t Ħ.D0tu u. u#uWV11ҸJt1Jutq.ЉERj]S*sƃ .E9s=)У̦.RjSsNjĦ.̦.?4WtVL)X.~뫣L.m}̦..=.uL.PapY̦. Ħ. M9u3_u(t M:H.t E)M Ma_uM.UK_uFM@t>SrZt H.E)̦..PoSPYtE u1L. t.t =D.uuu} U X.+<.4G- .~9|0G-)ș);.}s.)WV:(%U ZYu K=.tw.PmYtu} U؍e[^_]=.t+=.t"SqZtSarWV WVMUmZYe[^_] UWVS]u }@.t4 u ti5<.58.1ZYt 1@. p.t =D.uVuR=.@. 58.=<.1.._@.1ۉ.i뷃=.tH=. . . (=.t.un. .ÀuWV1҉ZY%=u+%=tSl.5.=._1%ul .A. .9Ph .'l[^5.=.th .lWV .. 0.1ɉ .<..P.1҉..=.uufe[^_]Ã=.~U..1҉.]1UWVSQu} EE@.tt t5<.58.1^XZh.tl=.tc.;X.P.X.T.̦.Q..D;X.~ .=.u.;X.~1N=l.tX.@.9}Թ Qۃ=.tt =.u =.u 11Ҹ *=.t&}t 1Ҹ 1Ҹ11ҡ̦.e[^_]UVS]Ȧ. Ħ.ށ9̦.~tu ډ@[^]UEЦ.E .]USEM =D.t)=.tu ~JH1҉ ;<.9~.Ц.Ȧ.)ЋĦ..[]D.1h.UWVSQSMQyq uu RPG\ZYuh[ƒt1ۃ tt t.t[8.H9UUt Z.[C뮋 .t .teY[^_]UWVSQMQyq 19| RP[ZYu.X.D]E t$t.u}tjU.Et ,ZL.UL.T1;.r H.E)K.Uz11҅t .ىt .eY[^_]UWVS} ]E1ҋE}~[9sWUSjMQjPhUt!SMQPEEP0 E1jRjVE)E뜉+E)Ѝe[^_]UVS.1.SutFjjP t.@11ҡ̦.:.e[^]UWVS5..j:Y119=.~ !AtRP X.9}G؉5.19|)e[^_]UVSu E!y=VY@ w>uVF-S wXZ1jjVM u뾍e[^]UE1҅x F-]=.t&.tUSJZ P+JZ HX[]Ã=P.y-U=.u .1.jh#A5ZYáP.xW@dP.UWV1ɉ P.5H.=L.,9Ɖ}jh#5P.XZe^_]ø`. @= .u1 .`.`.T.@.....1҉.....1ɉ .UWVS EE} MEE..t"C 9Ku}9{u E9C֋s`.T.t `. 1T.ЉpHMH MHxC;4-=T.u`.PHE8}.t'Xp9ډ} EӉEEډÈ}tET.T.@B [^_]ÍL$qUWVSQQEU=.t E]!@u 111]9؋]ع5..tF U9V}}6E9F uE9Fu N^*H.L.1=P..~t-uF"Hh$(V(h"( TEj舦C'j9jWjEj˜by uןXh{#Xu>h!":tu R5_UVXtˋURUTÉ<$JL$QMt5蔻WPURh Y%MQSps W _urVZ5YSjS juujVj8}t&u'h#'X,j &u& VC.u蜬X1҉Ue[^_]UUWVS]EEEEuu OZYt jh#hr"S{YXujh#,XZFh$&S&h"&A%j 8jUjj 葑}u}u)NÃtNN@u,E UM;M MM|E UƉ @tt t MÃuVGjj j`Ujs7B.jTe[^_]UWVSu6EU_}u }tcjT/Ɖ[u u11j:/Y}.uRP*M9Ή]| RPuuBu @ujjuuWVu 0e[^_]ÍPw k.GPw'k.1.'t'.#tUEEPh"#**YX1ÉUS.w$tX.'^<..1....tP X1..mNt jh4"g.K <. ....jh.{/<...Y[뉉txux ujh9#5)XZ1]UVS.1۰#4t'5t C'Ca1ɉNF FFFtP Z1FC6ue[^]UE]UVS E%tYu EP.UEY^u uT@2M5<.sS CKCtP~ Z1C.e[^]UEt*xu x u]?@ @.]U Pu]jEP-UEYYut@ <. ...E..tP Z1..UWVSPEf=.uJ=.uA=.u8<..1.....tP] _15.{u#jPs蓾Cs3 1ɉKs {SC;<.u RWV UP號ZUte[^_]UQMt<.9PtjhF#&XZP@ UVS]u <.1k9.u$9.u9.uPa~#4t P'@5u1҉[^]UU19.uǀ.ǀ.=u]UWVSu薾[1.t:PPV蟀 uE.. 1҉.YS Xue[^_]Ã=.UWVSu hb#up. C Suu.ue[^_]j }WRP` su sʽXhy#VZYtVWsPh_#uZpUWVSEPU8mEP8 UtYÅE8 u@Ej URP!ƃ xuu=.E8 u@Ej URP Ѓ xCU: uBU1҉SK C9~CCtPo Y1Cu,CZe[^_]USE] =.t1E En#tS_, .XLt1ۉ] E#u=@,-x1ɉM E#^S*á .ZtP XS茫P軦 .S 5 .K]s@=@,-y1ɉM E#]J# .EEPh#4#XZ].S-x$Ujh@BRP.RP.USEtzE 8.MU u4@E Qh}%RYS- }t jh#}Qh}%RC }t jh#k.S-aS-y.EEPh#>Ph%#j ]ShSP|~P|0uD]EPh,#"XZ]áS-x$Ujh@BRP.RPh.USEtzE 8.MU u4@E Qh~#R<S- }t jhR#}Qh~#R& }t jhj#k.S-aS-y.EEPh#>Ph%#j ]SgS3{~P|0uD]EPh# XZ]US] }u!jSŽYZt]EPh# XZ]US] }u!jS^YZt]EPh# XZ]UWVSUE t tP(.^w=.t1ۉ] E#e[^_]/ P['PR蠗?UZYt]e[^_]3"SƉ׃utS莗5.WVe[^_]USEU tXtugR%(S-YYR&áS-Zt=S-tP XS|P諢S-YX]] S-EEPh#QXZ]US] }uC=h.tS'H.Y,.hJC%rrSlrXZE@]%r]UVSE] [Y^S&tZ50G-hP#PPhW$e[^]U EU tSuxud?-e?-bJtzt1ɉM E`#e?-d?-7e?- d?-*e?-Ed?-EEEEEPh#IXZUS Et_Ejh@ $EPEPu C]hy#Ssu .Du>.E.*.y#tRGYEEPh#XZ]UEtHw1E E#].]U}u=.u]g.]Q.]UEu=. M.]UEu*=.~!EEPh# .XZUEu*=.~!EEPh#.XZUEu#=.t=<.to5Bu @u]]UUE t#u?S-^u2@t+S-!S-PJFEEPh #@ US E1ɉ . .E 8,t)EPh3$E P }t jh- #3.E 8,uf@E EPh3$E P{ }tjhE #XZ7.05.5.h]f$j]S\]܍EPh_ #u]UVSE] J1 RD+~vQQ r/d~Q wG$8E&t3-tW1Wt'^tM8wt1?:50+̀&Qπw MEPh| #1CSPh.Y.E sEEE sF@tK@sN@ sR@sW@tY @AuU9uE-EUEPh #XZe[^]ø=.u=. 1=.á. .+.UWVS }8uMEPh #Y[1bÉUPn$@PƋUXZt=.t <\u {t C<$ut PWCGZYtFFC؍e[^_]U@uPh #j*h.~ZPRh #j*h.fZ.UuBPh #h@.@.UU1t 1BS]UU"t B tB]U}ou<¸#u1]1=d.Ud..EEPh #KZYUWVSu ]E0`_18-u@JЀ v#tuKuEPh #&j uP yu˅tӉuEPh #Y[뾅t1҉t؍e[^_]UWVSMd.tFPtu)QjP_XDd.ZjPEP 15d.1ۉ]1U:BE<-t><$<~,Ht<+tO<9 ~1EM؉Uu7u*à U܋M~ZEE܃߃A<vG}-tA9u}t%9~-7dZ9Eىu1ۉ] 1ۉ]EFt}u Er]$I}t}t E1EEȋu} t tE Ee[^_]Uh#zYtP譎Z~S-øU =h.u[h.RZtL1h.EEEEjEPjv M9 .tt._kh..;EMMEEE=d.t=@.t=.uS-=.tuPjEP@w EufE=.u);>S-9u t.&P\Xʃ=.t ƒftըu1ɉ h.uu uv 1҉h.=.u&u`.@`.~Fj.Y<1҉`.y!p8mp8#_M9 .tu1 .Ujh.|PUQEPzEUUWVSp0豻 uaÉ4$a|$WVuho"WP!N؍e[^_]US]S耻 ZuSh#hl. l.]ÍL$qUWVSQ Yq AQEU}WRPq1RgˉE؉UM܋EuƉeWuuRPgu؋}׋EUE؉U܋E!E1҉UԋMЋ]M]E1E9M؋Er1EEEUeY[^_]aUuujjdu uUQMAQ jhi@BЙRPq1U EEUiEi@BEjEPtXZUSS-.t,S-.Sh.5S-r 9t .]UES-]Ã=.t 1.s U=S-.r|S-PS-M1.E]UVSPt.t .E1.EPSXZt'u> E.Xu{ VoYCe[^]US]t CPJX]ÍL$qUWVSQ8QEȉŰAEċA Euȋ}̉3E3U)E]uu}MQuuRPYhK}Њ# u؃}yC-^SuzEXZeY[^_]aTUVS]1)EM}I#uyA-NQu #EXZe[^]ÍL$qUWVSQ 1AEI1EEEM؉E܊PЀ wPwW PwO79ʉMЉU}?jjuuuu}W/;jjEԙRPuuW9 ]F8M덃}tE0ƒ}uEUeY[^_]aUWVS1E1EEEEPЀ wPwW PwO7;UU}AjjuuMSQuVs:jjERPERPV69 E8늃} tE u0uEe[^_]UWVS1E1EEEEPЀ wPwW PwM7;UU}?jjuuM1SQuV9jjERPE1RPV8 E8댃} tE MuEe[^_]UWVS U] 1<%tJMP~XBE؊B<%.e[^_]US5à Hw ot tSRX]UWVSu} .ouWV"XZE e[^_]$=.u`~h.WVhS-n.\B1s9. .e[^_]@UEU E 5!#E5!##]UVS]u .uu ]e[^]S-P-ZE #E#؍e[^]KUS]tu uR4=YZtg=. .j ZQuj>X؋]UWVS]uE %= .t >t:SaX$PKfPjjjjSPwf$9twV< Xnjjb1= .1҃=. PSWZ ÃtW _}t-jh#[^tP6Ѭ ZY>1؍e[^_]US]tP3蠬 ZY1]U1}]UWVS|}ue( u YW[E E .x9s^U xu Yw 8u 9Ut 9t'B@9Uuu>}1҉W1ɉNG랋E10E18](11}$1ۉ]]uuPEPjWu ƒ1ۅtEUE}yȍI|5xj9E E HMM9|_y1UE1ɉ e(s )؉ùE(tE}|9|u1Au߉؍e[^_]Åu1뎋M1yyuu$5!#E<:N<%<.uFu RPY[ +!@ *u5<.蜋_vG9^.1u؍U؉ƋU؍C<6$4F& .1Jk.RY19. .{9)ISQRP[[u  u11ERP[_19r .+ .ISQRP%[1.N5<.5<.P5<.PDwS葢 x(t u(5<.pRY EӃMЉ]1۹}9}RP薿Y_9nRPZXZH'u70EЉUsӋEЋ}!@ȉ9څSQZREЉUXE E)ӃMȉ]1۹}9}RPϾY_9RPuu@'u j ]SRPlWIx u ȁ .wt .1&t $EV/";5<.KZtP X@= . . .e[^_]U5S-USH.=h.t¡S-u.PE1҉D.]U5S-*UWVSSË@ 1uuC1uEl@tg}tC E;P p$}p tJ;V ~$}@}tՋpt%lj;Pp|;P p$| putC C 1Z[^_]UVSË Bpt9QuAACPrt[^]UVSË Bpt9QuAACPrt[^]USË@tP Y1CS5Z]UWVSNjXt 39s|=jjj,VC 31CCGtX_CPSk,C e[^_]UWVSÉυu/1ɉH . .13CPJ 1ɉK^։UR(IZ9Us&RUjEP!PV Utܺ1҉S .t  .SuWV>ƒx6Ct PÝ 1CZVH@$jCVP/{1e[^_]UWVSE֋xtBE3ExMAA ;NF |"Gt=NjEFOW9M}ԋE9G(u։NV ΋O W$9M|-G뿋EFOMOMW(]9]]|~E9G(uˉV;NV |9Uu=NV 9Uu9MuuwG\_ t;C$uE;C u K S$=EÉGxG tC X_ h9UuC;G$uM;O uFV G W$WtNZ9^ u;JuurBE(ÉGx GtCX _;C{u 1szp9uHtyt1ۉZY@9Zu9u E[;Zu;Pu E2[1҉PB;XEu [^_] [^_][^_]-.uU5$.Z1=(.UWVSE؉U܋uE)ȋ} )ϋ M]܉M]UUX9QDP9u9u>EU܃EU9EE} UL.9}EU܉EUC뫃[^_]UWVSEUM}EȉE΋E?UtW tP9sFu h@ RPMEUu  @P4E4MEU Cuu h@ 7PMEU9r9ut6F5,.jjWuE)PV5(.5$.$'e[^_]1$.(.,.4.UVS=.t 5p.}uufp.1ۃ=p.uDSgYuu C.H9RPSjY wyr5p.e[^]UWVSP,-ET,-E@u }H,-EܡL,-EH,-L,-P,-T,-=p.u e[^_]=.t11.H9~qWEUwZ}u}tQVkUXE9E܋E؋U|59MEU|!Au#uuoWZI `x t e[^_]Pe[^_]UWVS]3t~v 蛗 V蕗 ZY1CCC `.d.h.l.e[^_]UhL.XUS]$.#t-=L.ujh#XZ]1=p.p.E]Uh<.'XUVSu] t1ٸ<.t;pX[^]UWVSEUE|E x.p$l.h5.u8.tXsmSu Zjj1CCCj y]e[^_]5 8.C8..e[^_]U€u1=8.1]UWVS4h.l.EU`.d.E܉UtE؋M܋]MjEPjujuuu $`.d.u}u܉}Mut}9Nju|M܉]E܋URP ZYh.l.9E}|!@uc1}9}}Uuu[^tDjjuuƉ׃t$EUEUu}M܋]Eu׋EUh.l.E܋U`.d.,jjuuEU}u}tu܋}뙍e[^_]U jEPXZ}u}t j)jRPuujgUj1p.=l.u]]USj5L?-#ZYt8jٸ$.Xx =l.u=p.uS1]U=0.u . .$.,.]xUWVSU EEt :CM@tE3,. s+jh #Eu jh#=l.=.=l.1ɉ p.MMM1ƉӃu]5.+PXZe n=l.=.jh?#_XE:jx^@=p.@1ۉp..1EPM$.Zxl. . j1p.#X=l.t =.TƉP.u}tp.xu }@u}uQ.HEP5.X}tW&jjRP艞ƉӃ*W ƉX}CjYj111 ƉXF=G;=.}W؃&MxuƉYjZGMEPjEPjuujjE Mt=l.t =.tZ}~TJEu2EUutjEU9u9t5.RPy =l.t =.tjFXEe[^_]UhPj:< t.XZ=h.t.Uhyj< t.XZ=h.tUE]Uhj; t.jjm=h.tU}tOhj;YX=.uyPj};hPjq;jjh;hj\; 2jjN;jjE;jj<;jj3; jj';XZUWVSt.1҉t.tijj:/jNjj:jj:sjP{C$hyj:j. tH=.5.y9=.u95.t.@(.h耲.t=.tj"Xe[^_]UWVS E։ϋx.SRUS.$EuUR u.{tUM tuWV袠C SXZ1e[^_]UWVSSE։jj)u-$@PCuPs {E C}u1C%u-$@PCuP؍e[^_]USS-S-t%CBsd s\ SV 1x.|..]UWVS5S-'Vh*"P Z1ɉ .,[ÍhV  i!tSV迿 uNJ< t< utZ8tPt u9_8bPjP蛾 u1Px^u ȋ8t6t2\uG@x9tzP‰1Ҁx$‰uH11WQщ‹MS-S-PS-.ZY{X=.tS-x.|.1e[^_]UWVS u!b1ۉ.S-S--TÅ515.hQ#AP>AZYqTI&STYuQ*Z?*lj4$5*$L9QZVh`#P9tV Xh*"W.2W~ f;?SATYS2Tjjщ‰S-S-PS-. VhP th=t.t-tV5XGP')_t u Ƅ@t V虆[ u- u-DH@ZutfTP@tCu* fLHt@u C@tC fLHuDPttDP@yulDP@tG UDH@cBV4Zt1x.|..%S-S-tx.|.1e[^_]USS-hk#So(ZYuwhq#SW(ZY¸t_hx#S?(ZY¸tGh~#S'(ZY¸t/hy#S(ZY¸tjS;ZYxP^<X1]UZu E ‹E2ttHu jh#jh#jh#XZÍL$qUWVSQ x.p x tWV虛ƉY[jj1EUXZt.uBEPEPWVNE؉U܃E EtEU}u}ujh#=Y[=.tuuuu誗=.tEUju4P4ESj:jEPuuS"4(eEuz Sz XZEЅu u؋}eY[^_]aUWVSx. |.]11~1t2S-t AFKމt x. |.[^_]UWVSx. |.]11~1trS-t IFK݉t x. |.[^_]á.á|.Ëx.tUrIZøUjZZujhh"8ZYyjP8ZYxU.]øURSjEP5.hU ty jXфuHuUS]} t0tu y.39ӻ˻r1u vH[]UE1҉PP]US]tPx Z1CC]UE1҉P]USUBt XZL[]UE]ÍL$qUWVSQʋEqyIZJ ZrʉWVEZYeY[^_]aUWVS]E EC9C|WtjjWVRPCPltjs3ZYtKljE3w XECHKM e[^_]US1;]}E Pu[CXZ]UEU 1ɉHr2P UWVSS] EEMȋEeƉϋE EtuuWV*M9u"9uu uEZYe[^_]Uju-jh.UE=.t&uf=|X-tE#]C.@]]UVS0.1=.uD.1(hj-XZhj,Y[h.^tTjj,XZjj,Y[h##0^.u 1"15|X-=.t j[P ֋54.T-t,PV_!ZYu.8@1ۉ.#Z8,t@8u݋8tH58.R.PZY.@8tSXh*"5$.|^Xuc5$.h "l Y[#S$S5D.I& BP5W-P ^ZtbShV Nh%P#^Zu @׀8 uSY #h-#P#ZYt @׀8 uSX'#8t%8,t8 t@Ћ8tH58.R.PY^.t SZ@.P x#Pe[^]U$.jj)XZUhӣj).XZU! .jh.  @-Q@-y ;P-| t8-J 8-Uh8-PXZUWVSREƈEj}W5D.$ f=X-tk1.5X-jW5D.'1j=.t.V]"Ph7#  Ktjh.5D.# 럍e[^_]USQhN#,jj(jj(| Åt4EP Z9u< hT#@,jjD(jj;(]jj-(jj$(X-j/SڅtPjRSUh-hy#HshY#j~h-hy#-she#j}USQjh#5\.. f=\X-t#E tPE Z+u}f= Y-t WVh? #WVh# jhX.5T.}%h.jjOe[^_]hV #Y"X UWVSEhVh#F 'jh,"5\.%jjjjh.jjϡ(jhX.5H.&cà yh #!X11ft#j`zƉXP%Y~G9uAj5D.虇j~jjjjyV Vhj #Pjf=|X-tjy)RPh| #ejhX.5T.$h.jjjj jjXZe[^_]UWVSE[hVh# 4jh,"5\.#jjjjh.jjj(jhX.5H.$à yh #Y X11st#jxƉXPY~T9uNj5D.4j5D.'j.}jjjj$VVhj #jYf=|X-tjx)RPh| #jhX.5T."h.jjjj jjXZe[^_]US,]S5D. h+"uM.u M e.Sj5D.h.jj]US,]S5D.h+"uEu %ESj5D.訞 ]UShSh # S'EW-[tEW-jhJ$5\.k! UX-tUX-5X-t5X-5X-t5X-f=\X-t_X-t$X-f=X-th+"h#uY%Y-t%Y-,Y-.5Y-t5Y-jZEY-t$EY-f=LY-th+"h#X]Ujh{t 5D.gj8jhzt 5D.NUS]Q1ujP!XZ]US]CStu RZYt1]UVSEh #PZYtP:^yh#?u[Ph #hP8ƅulX-u$!$!X$Z!$!1ɉ $Ph"SSju*ht"tX]!XQ!X1>!$h. à !XP.Y9u tth-h #bXZ댅yh#sxuPh #uPh #h- Cƃ..8 u =.vH@.e[^]USErjPh`.h # uxh`.hhPB<.yh`.h #ZY?hSh # t h`.,GX5|W-5<.S ]UVSjPh`.h!#] h@.h`.PY[vE!#e[^] Hu @.D.5D.hhPeÃy5D.h #XZ+5@.h(!#hVRh4!#SVe[^]UEjPh.h # uXh.gh*"PI uh.h6!#;XZ)j5W-P f=X-uD.E)UVSjPh`.hH!# h@.h`.PY[vEO!#e[^]@.HuD.Rh*"Pà uVh6!#XZ@D.f=X-tPhg!#Pho!#hVVh!#S e[^]Uh-h"#_jUWVS}<1ۉ8.L..%1u~11Ejh U-hJ&#u uK=x.uh-h##_j!t&`'FtrE96/ kU DЉE.뉃a$dI&nEtPt= p7WYvh%#Z?95 p7jh"V裚 jh"V苚 h"V^Zƅh%#jh p7h%SZYkh#SZYLh"SY[Åh%#뫡 p78. p70.Em=L.t h%#s p7j/RUfYZUt L.5Rh1%hL. EPjhjjjj5 p7A.U P5 p7h%#R.teh+&#tM ...=t.1vldZR-E)t8HuR}t hk&#KE h%RUYZUt0." ...hjhjhjhj 5.h&#j hh.4hh.u h&#@u h&#jh8-ZEXZtKth% h#h" Xt 1N11҃=t.1X-LY-=W-1ۉ|X-=.t ,Y-= .t5.' Yu.t h&#j= .u"5. Zt5.h&#jee[^_]U.jh.U4hjgEXZu2EZt1.= .u!uj8YX=.h.Zu(j q=.$uhZYD.jpYD.yuhW$GkXZ.Y=.LjPoXYD.tPYD.!URPXZ=.uM@EPj5D.- jh t 5D.( jj5YX1}UWVSS]=.uh&#zzYu h&#jch'#]zZt8/t PP# XxV-|V- '#ShtV-EP* ƃ 1=L.t6L.8.. .1.=.u'.%;/u%L.jSY_t.t t u!hF'#Sh'#FXZ h%'#8_jsV-9u QRP, V-Euڃ=.u h.h#P. @u .%h.hj$u. @u .=.y15.=L.u\)j:hw'#u" 1҅‰.L.uShz'#"t%=8.u8.=0.u Sh'#jbj:h$%uE" .= .u38.t.tR5L.ZY ..j:hD%u! t X-j:h%u! t X-j:h"u! t LW-j:h}#u! t1LW-j:h$ug! t \X-j:h2#uG! t lX-j:h#u'! t |X-j:h"u! t1|X-j:hO%u t X-j:h%u t1X-j:hyG"u t  Y-j:h$%u t Y-j:hI#um t.j:h#uP t LY-=.u .hV-=.u .`V-.t Ph"|^_.t Ph9"fY[.t Phc%PXZ.t Ph%:_Xh.h%ub+ @u15.h.hb#uB+ @u1ۉ.h.h "u"+ @u . L....tj,S/ZYt@L..؍e[^_]USB Ph'#h-HSh'#h-8j$U=T.thT.htj j U -yh-Zuj-P-=.҃ !Ujj;.h" jh."Uh.jj Uh.jjˋ U E E1ɉ .hRjEXZjjEYXuhW$XZh.eYtnE sujYXujxXZ=.uXE M9Hh-ZtU < tU EE9sE @E -xˡ-P-UE Mtt @8u1]UWVSu@.@.FVtI)~@'#t8u\Q ^@P u f^?봈@@.[^_]UEP^v0.^?<tP@1.2. 0.1.0.]UVSEPh (#XZ@T-;t[Ct =4.uGW-PPh(#sC <Ƀ*PZVQPh(# 렍e[^]UVS,u]S5D.5VSVSmEԀ€Uԃ=.t̃Ef=LY-tMẼeewfEf=X-t %‰USj5D.e[^]UVSuU ]=.tSRV  y@19t @. @8u h$(#E9%e[^],ae[^]UVSPW-EÉ4.@T-t68u-Fu#EPPhW$NSV1%tك 8]tjEP5D. Íe[^]UVS!S 9X<uY8C L{ t VWZYtAEPuWZH YVC Zu h)#Xc9s ts tC Ke[^_]UVSá.H!vd3VY..Swt^'@-H@-x&8-P8- .P."~;P-}h8-j XZf{ u<@.@-H@-y;P-|8-P8-!h8-j!^X3hW$Y[{Vht#.C ^ZtaP;.s Vh)#>Vht#z.C Y[t'PP.$hW$G =."~1.h"2Ze[^]UWVSQu E]K:EE<\t<^up{tfKG^KCxЉwŠSzЉw>#)#t18uG(NJKyЉvK KNjUBbM8t1ۉZ[^_]UWVSS]h%SC^_ug@W-; CteE0ƅUB@tUQMY9MU~ R+#QRh %h-Ãf3#h-j XZe[^_]UsPPPh+#h-yw.t@th.Xj@uUh,#hhJ&hqh,#5.UWVSSt ÉֺK&"h,#h\J&hh,#u :u!USPJZYUu=.e[^_]VSh,#j`jUEuh1#hPJ&hh,#@0h1#,1UEuh1#h@J&hh,#]@0h2#1UEuh1#h4J&hh,#'@0h/2#1UMuh2#hK&jTh2#11f3A@=uUVSEu ]uh1#hK&j`uh2#hK&jah2#t0ffPh2#fPh2#fe[^]Åt$1ɀ8u"UJRPRPyg 1ɅùUWVSÉ,0hv Dž0hU1׋,03s DEsus 8Es <E41R(4L&ZYt4G (uh 3#h%hW$h-O L&E24L&h"h-#C uh-j u_X<sR@8t54V@W$WVbVEPMU1e#sj@HEPS susuh03#uhF3#uhS3#uh^3#uhi3#U$19L&t@ uRh3# 4L&hu3#z[^}tEPh3#dZYh0)uuh3#|X,01e[^_]UWVS]uh1#hK&h{uh4#hK&hh3#q11{ uh4#hK&hWVhPsUu s h14#=ts h>4#ZY1=߶xt uh4#Xʍuu-WVhPsus hW4#J노"=thPs hd4##^e[^_]UWVSSljUQ. ^t#u uSuWÃu V7 ZHWyu uSVW+9uSuV:c u V6 XV6 0벉؍e[^_]UWVS@]uh1#hK&h8C@uh4#hK&h9h3#{ uh4#hK&h:߃uh4#hK&h;ŋuh4#hK&h<뤋1ɿ 9lj}Ph4#99|CƁ t!Ph"5#~ 1jjh V= tS h fUtts h5#_X1jjPZ9u 9t-uRh14#GPRhP5# tu@ku h5#Mu h5#m󥍵ѶxԶx9t PRh 6#`30xPW~ZYjE=\,.RRt .YtaRhuA#XZ2tp)Z4t5$.hW$6(.ZY-ft9tSX>e[^_]Ë @-Q@-y ;P-|< t8-J 8-Uh8-PZYUePPhA#h-ljX`.W|$wUWSˉ1҉`.M]m %h}fU fUm]mURp pSQh]-0hD#h-$e[_]g_UWVS]E }܍p(}p4EPS'Y^tShD#4XZe[^_]UWVSPu} FM% FVFt5RPWà tF1ۃ8t/h]-hD#94[XRPh]-à tŁftvWZYt#/vh]-ZYu}u2}u$h]-hD#3Y[}te=h.u\VlU1҉UtRWeZY@uT8-tRh]-ZY@u"~lth]-hD#Q3[XuVh]-VZYt؍e[^_]UWVSx.dt2h]--h]-Epd h]-!jjEp` @EuphW$2_X-xP=.t . .t 5.t2} F=|.u:xPh]-lK[^@} 1ۃ=|.h]-hE#h--H- yh-Y-P-0 t+@t( -y h-輯Z-P-Ѓ߃Yt`_(,h]-hS{$1`Y DždWxPh]-I[^@t1E%=tEjhGPhh]-à uA 5.uh]-hW$kh]-GPhh]-ÃtNjOGXW\X\t;X\E@hDžl]-X\ptX \TX9и\T<0XPjj`jjPjvTjwXP: X1ɉX\vRLP)TPS L9th]-hW$y/XZDžd:)։1X\=`.tX\hoPTGY^EphW$/XZ=t.Džd1X\t~hh.`}ƃ ~KVh.S( 9th]-뎉X\=`.tX\htP`7XX=t.u` XM=t.t#S`$Y^th]-hE#.XZ`^du S[zt.dtSWLZYd=t.um} tgG t^.9GuTxPS蛱Y^th]-hW$-XZDžd$E9Gud.#G%PSY^uS.Zth]-hW$>-[^Džd=t.tWh]-9ZYde[^_]UVS]hVs u sh7E#'Ƅ} t'h]-Zth]-hDE#,[^.h]-VNZYtVhOE#١t.t jsPZYe[^]US]} th]-}Zt h]-hDE#sh]-ZYth]-h[E#,ZYt.t1E ]]i]US]} th]- Zt h]-hDE#$s$s sh]-7th]-hfE#+ZYt.t1E ]]]U\PPhpE#h-cjOU<PPhE#h-Cj/UWVS|Ӊ΃=/u\B=/t CR|Y_u%=@u",|hW$*XZt#h|V#1 =vQZVSCY_u%=@t=/u^VSB_ZuQ%=@u?V/^u?XPSh)%hS;=΃=/=/|8/uVPiBZYti|hF#UhSW40W+t=|Ph)%hW谭VWBt|hF#p)_XVSsBZY=/S|^_uS|hF#ܧ j/|dZY|tpj/SmdY_xt@xxVN_Zt=/|)~=/ix)؉t=9|u fDž.Nj|ƄPR@ZYkx9Íu fDž.׉ދt󤋅tƄxPR@^_|9;x9 ;p=/h8-dShF#h-膰-H-yFh-W_H=/=/uS|ZY=/u-P-0t- t( -y h-Y-P-΃߃Yth-h G#=/t%=@uS2SZu4=/C1=/ PSj|jtS=/u1#|/PShG#谫޸e[^_]UE TET]鉾UE MQTU TE]nUWVS}E E@PX4]p8u_PK4MK8U9U΋U|4uU9u|,S<9P<|"ETE GTE[^_][^_]UWVSEE} GPX4]p8uMYPK4MK8U9U΋U|4uU9u|*S<9P<| ETE GTE[^_]y[^_]UWVS}E E@PX(]p,u_PK(MK,U9U΋U|4uU9u|,S09P0|"ETE GTE[^_][^_]UWVSEE} GPX(]p,uMYPK(MK,U9U΋U|4uU9u|*S09P0| ETE GTE[^_]r[^_]UWVS}E E@PX@]pDu_PK@MKDU9U΋U|4uU9u|,SH9PH|"ETE GTE[^_][^_]UWVSEE} GPX@]pDuMYPK@MKDU9U΋U|4uU9u|*SH9PH| ETE GTE[^_]k[^_]UWVSSEEU JPqXI\XP{X[\9|9| TU ETEY[^_]Z[^_]UWVSSUE EHPqXI\ZP{X[\9|9|TU ETEY[^_]鷺Z[^_]USU EAHtRSHtG t uF u:] M[]9t=4/uyDutJt] M[]%h/1 []UWVS(U,/ 8/ /01d@DHLP4TX\x|hlEE8jj h5!# SQj]SD@u hG#jU ShG# XZ=5`/FډWVRPG#= a-y hI#jRt)tSuSu XZu`uXY[etju jS "ju jS I#uu jSVV0y hI#ie[^_]UWVS ~1ɉ=(a-u,h~P50a-蓪 ~fDžDžVhm50a- y٤h J#0j諧 7fDžDžVhm50a-軉 y 萤h4J#h~W50a-à  dh^J#h~W50a-軩 t>hI#`fDžDžVhm50a-/ '(a-tithJ#jXZ fDžVhm50a-ш y"蠣ShJ#0jq؍e[^_]HyUPj NXZËJ UWVSH]0a-tPөX0a-1=/=d/=`/=/=h/=40e- D9/4a-8u150a-/ 뗋,a-GShL#0j@$a-d/0Ht u hL#jhM#jܛXZe[^]Ã=\/<=(a-/UWVe-wh8M#j薛XZ=d/h/u6~OfEEEPhm50a-~ y`/~uz1=d/]xl15d/5H/~SuOjjj50a-W~xFjWVRPP)WV50a-,~x(a-"1ɉ d/=(a- hgM#hM#j蓚XZ1e^_]ÃUWVSPE1҉P1;EE (a-h/jjj50a-}Ɖ׃xtEU =h/u8/] ShT#0j][UWVS|uu V_Z@uSt< tNu38xPVZY@tE%=@u1超8؍e[^_]UWVy 0PHx0P xjMƉX)00Pw8URPh/0P@ uˋEU0 0RPAYXh/WZh/g\Yh/iVZjh/XZYuE=//u(8uh/%v$h/h/% h8-WVh/2D-@tohT#0jA '0 0$0(0RPbZYH0P(jh0j讈PU 1e^_]UWVS4y 0PHx0P x"ixjƉX=\0t-5e-،[t蟃hT#0jq = 0tbcyY|1ɉl00PwMpRPh/0P@ u!pt0 0RPBY[th/UZt0 0$0(0h/GZZu؃=0txPh/vY[t0 0tkxPh/R[ZuT0=0t/t/09EE0|/09EE0|Wu09EE0h/SYjh/dU[Zt0h/`0 0$0(0RP  =//u(5uh/As$h/h/" ԣ0 У0tgxPh/NZYuP=ԣ0t4=У0t09EE0|+09EE0|S09EE00t10J~PWVh/~/Ph/1̣0[X0t@t=0uPY=xe-t100 wlPh/ XZ h/@!Ylu_0 0$0(0RPXZy h/^X=0"=̣001̣0=0uSlh/ Y[y;50jS0 0$0(0RPh/p^pPRhh/0P@à =0hu Rh/XZ=0t=̣0t0 1̣0u!pt0 0RP\ZY0 x5e-X0P(jh0j臃e$P 1e[^_]UWVS0x 0t!9t30hT#j葀ZPHx0P x=0u0X t ^y^x0 ܣ0tW50hU#50`̣0 2h/UZt.0 0$0(0RP$ ^_Ht#t=0t4h/d_y#0P(Ɖ$]WVZYyuth/c^^yơ0 ܣ0t"=̣0t50h"-1̣0ZY+Ãujh0jځ ؍e[^_]U=0u y \y0PHx1]]UWVS Džlh 50W = w u}/t 50h>U#h4~/t/CFtP50YZy"0z|Sh\U#0jK=|%=@t50hU#j&~ @YA%ma= 0u )؉h%'2\yDžlh/BSZth/&Zt0 0u#h/%h/XZY )P1=///PV 9hsh/hU#j3}tPWZYu0=0t:t:090W090u090jh/NZYy'jh0j27`% 1ith/,YYSWh/O xݡԣ0 У0u+=050h/O*̣0XZ}tPh/YZu=ԣ0t;=У0t090|090090]40=0t h/ h/Y+00tE t@wpPh/YZ h/Zh/WXjj50~l y80dydRhZT#0j{h/Wjh/XYy#lPh/3h/^W Rdlh/\ dy Rh/ Rh/XZlPh/YX=0~=̣0q01ɉ ̣0Ze[^_]USl"0$0=\"0u 0@\"0\"0=~~ h~PhU#ÁthPhU#jyKX"0Ta-5/CZx&1H"0L"0l"0\"0‰h"0d"0 >y밉؋]Ul"0$0=e-u>\"0t5=~~ h~Ph(V#thPhVV#jy@5/Zx%X"0l"0h"0d"01@"0D"01 yl"0$0Ta-~X"0~UWVS0t hV#jfX"0=\"0Ta-u\"0 yIh"0+d"0EU EUTa-EEuuuusu})׋E9ƉM}u}WVMZY+u}l"0 Ta-19}dd"0 h"0d"0;h"0s5X"0PY_d"0+l"0RP_Zxhl"0Ɖ5d"0Ta-h"0 h"0d"0Ta-X"0EU)@"0D"01ɉ H"0 L"0ze-hV#jwXZ؍e[^_]Ã=Pa-US=e-uhV#jvXZyx1ۉ@"0D"015Ta-5l"0ZY~%l"0d"0‰h"0@"0D"01+Pa-~C9}PhW#jTv yu뙋]ÃUWVuM d"0)ȣd"0^_]UWVS$]CDž$$ x$|$x $=0u15xPu \Q^_y狳sVh9K#0jmvPu'QZYud%\shBW#0j(vۉ15Ta-5l"0u xƒ l"09|Ru -WQQRu<9uUy%urVhjW#0j@u79|$u9x$t hW#jtZPu OZYyqVhW#0jtNjE49}u;0thW#뗋9}3t)1;x$|$}Ru ye[^_]Ã=`"0t1US5Ta-5l"0ZY~'l"0d"0‰h"0@"0D"0=u.=0u`"01$x1@"0D"00]ÍL$qUWVSQ Q1ɉMM u15d"0=h"0)9}Ή5d"0)ډ tƋX"0]؉}܍MQWSRPkƉ׋EUEЉUԉËU֍ ƉύEPWV yEU)u}@"0D"019<h"0+d"0щ9|gx t%u؉}9}M؉]܋Ed"0+u}뢸eY[^_]aUWVSU Ӆ~Hh"0+d"0U U  )څ$ 9~؋5d"0}5d"0)É}봉[^_]UWVS}x$|$hlGdDžp } xAxPu LY[u]%ndhBW#0jqۉtE1҉P`1h9Ɖl  h"0+ d"0 } ^ș9hl}hdSpPtPQ5d"0u O]hlS} yE] Cpt1;x$|$5d"0=00\t`A9\u\d"0)hl} xdptZ;x$|$}L pN;x$|$ap#ƄWVZYp` `D$@$WV:WV'fVhZ#V PPeZYVh[#j_ U]lt lt)w$V#pZYxDžl=ȣ0tVh Z#RjD`뒉l<$8$VO lxDžl0=0u =ģ0tCi<$8$Vy =ģ0t#($tA$u($(($$u ($.($($tbYX$50hO#NYZjV+BYZxPVYZy+J\thA[#0j_WV@1$H%# PVXZ=ģ0u ($jģ0 e- e-t[j $P3VA=e-u =e-t51$PjL$H$X$T$t1e[^_]UWVSu }SE8uEEME;E~])])؋ME8tR<9rt >8u9@}jؙRSu(@Zu hY[#E18}t}t:\0T0E\06SVu譽 9Zu hw[#iX0P0EX0ҍCtPR菝 XY PS Yuhi[#j%\XZ>CPVЉUPTEU 0j\̍<+E e[^_]UVSu] }u1NjjjV?y YSh[#jh0V] yYShw[#0jt\e[^]UVS]u x@P_X=0t*jjL$H$X$T$xe[^]UWVS(]} $(v(11ptWPu R^ ~ pt1@9uNjt9|$up9x$th[#jsZ xPu !6ZYyaXSh9K#OT$9X$u;t h[#jjju a=y$XSh[#0jZp1$1e[^_]US0tP1ۉ00X0um1 -yh-F/Yu9-P-9d-uu%1S 0 t뭅u tډӡ0A0u0 @0tϋ0zyP1ZO밣0j50h0貄0 &1]U=00=0t0=أ0t 0@=0u'h 蛔 0Yuh[#jjXXZ1x0t9UVSut>uh%\#j ? Xuh@\#jXY[FVGZH~ 8/u3E ؉C1C=0u00X01e[^]á0t@=0t 0=0u4=0t+UE$u0tjP50U US=0t801t6{u+uhg\#j(WXZ3hb#h-7 [Ƌ]UWVS]=0u =0u$150yx50K0YtHHQf $3$Pw ShR]#u ShI"V3 Vj b,ZYV#Xe[^_]UWVST]}T$X$uV($eSWVhZ]#aQe[^_]UWVS]u fVfuP-Zt%t0SRjP}WiVW1Cۉu ]e[^_]e[^_]UWVSUM] Ӊ9ss< uB1uZB1J9s]JqЉ w D$qw Dqw)DB qЉwBD9rt1[^_]UWVS EEU1} t EE1EED}u^9r^MHYW wY0Xu}u}} }u,HM0H]u]u} }t9sԍr19r)A9r)‰ð0E E؃ [^_]UWVSS}]u 9yK@G?ș9GG1 Ԋ< u G9r11҃G11ҍO9OYЈ\$ w %Y\$v Y\$w\ D$G맊YЈ\$w0GD$9r h11Y[^_]UWVSUED1}uo9ro]H 9޻r0WHM] M] u uu,HM0Hu} u} } }t9sԍr19r)A9r)‰ð0E E [^_]Ã=0!u%U0hc]#jMXZ1ø1UWVSSu] E}MM1҉ p7=0u0K 009-u B0 -=0u" 0Q0u 001Ҁ=0t7tMM}E] ue[^_]KE] ue[^_]鸉UWP~ZYtU:u W3h]#(x:u9-9} p7@-W3h]#h--?e[^_]1UE E EE]<W|$wUWVSjEPS4Ɖ׃EU E9Es 11M9ttuj,VZY…tUj=V}Y_DžUuh ^#Uj  ZUuh]#jJSs jul0 h0Bh01h0Boe[^_]UWVSQÍEPSC^_u C #ƋE| t@E]Sq Zud01 KDe[^_]Uh-h"^#Đje-t 9tUe-Uh-h^#莐h-hV_#h-h-`#ph-h'a#a jnUWVSPuhJC%S1EZYhJC%S¦_ZÊEhViYXu~GVha#0jOJ }t/1e[^_]UWVSlj/E 0]^_0t@E 0he#P Y[d0e#0`0111҉U11Ejh`a-h7b#u uKzX$O& p7\"05 p7h b#d \"0렸1Pa-덡 p78-uxu1/Ej/[0Q/!b#B03أ0$1e-=e-u'b#>|10p0=p0u 0ģ0e-c0T5 p7=Y10o 0` e-G/8%80 p7`0#0EH9~2MxPV XZMuh]#jFj`EƋ p7`0PM/Y=$100ܣ05 p7E/`e#f/e-W/e-H/e-9/e-*/e-/e- e- p7/01xe-1ɉ `05 p7"DZ40\0-E GEt`0>}15`0jP$Y[yRFEMhb#St2ZY;GCjP[^u}uhb#P,2[Z_uhy#S2Y^-uS(…u_hy#S1ZYtV^=d0tShb#zFtjP8ZYy*h*"S"XZuSBhb#RU1ZYt8jhb#UR  UujjRZYMpjP؃jSu1ɉ Pa-}J/t 88hˢ"~/Zt 8/2" 0!"11jh`d-hc#u usz$lQ&1d-ă뿃 p7\"05 p7h b#00x p7/f 0 T/!b#E0@30΀0  p7 p7h-hc#譄5d-h%h- 5,e-h%h-h-hP$q/8%00 p7ÉѣP"0T"019| 5 p7h6c#%thhMc#jV=X0 p7Sh"X-ZYuPa- S,WPa-Yyhsc#j5 p7Z\@D0/0Phc#j<jJ/1ۉ05 p7Y5 p7*Zܣ0 أ0@|ԣ0gУ0U1xe-I0: p7/+/Y=$`0 - h-j sY[{%E1 u1e-08-nEE ue- Ge%1ɉÁ ue- 095 u e-܋E5 _e-.1 t\50hc#h-v 1 AI!`S&Phn$š-P- e-uu0,e-v/t1jj} 4 --9Em-9Ehd#j9ME M0PZy$ju j} 4g^_'--;E|1ۉPa-e[^_]ál0t Pl0Ã=l0t[U00h7d#jN9 tp0hfd#h-50he#Q)ZYu1UWVSM11JqX?tCt*tK[t~=0ttjMYZF}uvQUtPU!uX1C<]t:m~-u Vt]t:E :U|^:EuĿ1}!9*A8Qt1e[^_]UWVSSÉ։M:NjU8/u@J)ف ~Puhe#j7D։9r KNKNp19r)XӋE}tE9r NKFC1e[^_]UWVS 50he#6[_Vh&f#6hVf#|6hxf#r6h W6h"W'ZYuhf#WM&[= u hf#&6Y덊uhf#6ZX<.uuhf#5X1t3L@LuL@L%H9s tFCC@9u&>t!tWDh>g#j3|tHL@t<uDhag#h-> WDhwg#h-#t@th WDz0 1e[^_]UWVS]t K΄u hg#4<\u FFu8ujn Xuhg#j2^_DžoGjQP苚 t2hVP蛁SVhg#jd2 Wv [띍V֊t\uF8t)FWv Shh#j2YR`Zu%ſWv hg#j1$N1GtYuh7h#j+m XuhLh#j0[^C31CV ZC 1ɉKECE C=0u0|0X|01e[^]US01t6Cu+uhyh#j0XZ3hb#h-> [Ƌ]UWVSu0t$tS=0u S1u=0uSu$t9ut0}FPLYuhh#j/C_Zt/1srCt/1ɉK;WRZC Hǀ?/uC C$c‹@t 9uBSSt 1ɉ$[:hh#ja/XZe[^_]UVSu1ɉ$0u,=0u1=0{C |/t[t0CuPFP3ѱ KVPZuɡ0u '$tVZYx 1$e[^]UWVS]=xe-tjs{.u{.u Ct:u hj#j/VY[_ÅtCF1ɉMMPtMzЉ v@,u}u@E1҉U'.u}tVhj#j& TE@jb Xuh k#j&Y[0t;u GM1GtAt0yVhSk#&O}thE8t`W yuhok#j%Wwj bGƒWt+G 9OG}Vuhk#j%W@j 1G=(0u=(0$0x=$01 hk#e[^_]UWVSM=@0tPÉֹ=1:t9pt@9u9U}tj%a ZUuhk#j$[^1p1ɉH xe[^_]Ã=L0u1Ujh e L0YZt1hl#j$XZ1UWVS}L0$4$E,$E싇0$E E14Et4ËE;CuE;C uC$$9Ku; $trS[uj` YtGGPCZt0 $$$CSEC ECECEC1vSUh Yh/l#j#XZ\Uh 3 Pρ 1$$CHCUwC3g Sg [^e[^_]UWVSML04$$PvrHto,$0$E 1tL};{Su!;s u{}싹$$9{u }; $tCɉ3Fg X]e[^_]6g e[^_]UWVSS=L0t51ۋ4t#1ɉ v0Eg EPf XZuC u͍e[^_]Ã=H0UWVjhG`b H0_ZuhMl#j"Y^Cxl#=050Me-Z@u"50Vhl#0j"50MX1e^_]1Ã=D0u1Ujha D0YZt1hl#jp!XZ1Ã=@0u1Ujh=a @0YZt1hl#j3!XZ1UE$$ $]UWVS(}=@0$ $$$EUE 1҉EU苟,$0$E1҉!މu؉!ȉE9u9tE1!É]!ȉEܾ 1EE11ɋEUÅt#@ u9pu u90g@E]!؉E̋EU!ЉEЋEU3E3UЉ Ӊ] O $$$Å}uIE EtAj[ X11q $$$AQ C AK 1St$00400040 u+0040M!u!9u^9uZtL00540 t:UjY[ Zt+UM܉HUPp K HC $$$3GPhm#jhIm#j$P @ $$$E؉,$Eԉ0$1e[^_]Ã=<0u1Ujh=^ <0YZt1hm#jXZ1Ã=<0tDUVS1<00tjjs sss3觵[$݃uʍe[^]UWVS$EE} EEuEEEU E܉UE$U(EԉU؋ <0=1Et#؋M9Hu9p u M9Hu9xt@$uj(Y X҉UtMuUЉYt4zEBr EBu܋}rzuԋ}؉rz Z$E!Ra XE m#Ee[^_];e[^_]UWVSEEE EM}<0tqȾ=1tZ9{C$u9K uu9suu9stS$Åuڃ/CSMQCS MQ3Ha SBa XZ1e[^_]1UWVS]}E=0t";/tPS^ZuShm#j$]X YuShn#j. hSxZuShn#j ue[^_]` GFG4W8F VG(W,FVGlFF 80F580e[^_]US80tvC80=ģ0u{ t s3hXZe- e-tjjssss 3輲=|e-t s3YX3_ S_ 80XZ놋]UWVSSUE @~ T@119}At41ɉMU1ɉrE1uZ[^_]UWVS u=H0FhGSPl <9tjww 5e-;Wu;G t lh1n#*SR5e-+{ 9؍t@hIn#0j SRٜ yT$X$G9__W1jU Xjjj5e-G WxNS5e-z 9u)T$X$GWH0W8qhan# ehn#0j7 W] Xhn#j#ZYe[^_]UWVSQD0uhn#jXZohu u Eޅt6uY_tcvj T ^t;uƉYt#uGZt _E81QV] XW] _h o#ja[^0^SuZYtS\ u菜F_Zuhn#e[^_]UWVSu} D0t=h7V t&3V%ZYuusV#v [֍e[^_]UWVS EЉ1lj t׉ EE1EEL} t} t} uA HA@ AA4AA (HM0H]u]u} }t9sԍr19r)A9r)‰ð0E E؃ [^_]UVS1۹4Cu񍘜9s CS[^]UWVSЀ| uB=-ȉ19t^p.*u&fDzu!\?uƄ. pƄ9/u Vh1o#h SSyEVh9o#h SSy=VhDo#h SSyVhRo#h StSce[^_]USSˋ t%RQPsE3Y 1U1ɉ EeveRu Pts ]URPh]o#jUjhoø1҃=d0t1UME1҉d01Ҁ<u=Bu} u,J=`0td01҃8]UVS]} ~;uqjhe#P0 u%=e-u e-ho#j0ZY1e-jjPƺ 9؍e[^]UVSiÅ3ho#V ZY[uh1b#SZYt)SVho#jh1b#ho#ho#j e-vSVh$p#jtt0o1e[^]UWVS]u hVZYy\- 1{ǃ4$K<vCVhT0\0 x RhP0X0 U jjFdPG%($jjFlP/8$jjFtP<$$jj F|PEUUEщx$|$ @uAjj PT$X$H$L$`$d$H1$$$$ 2t|,1ǃ$ǃ4$($Qw\1ҀKƒ $x$|$ށ$1$$$ǃ$($w($|/t5uǃ$@($ǃ4$Fǃ$΀($x$|$%$1$$$1|/uDe[^_]UWVS]$Hwv$S&=t0t_hJp#j hsp#hp#hp#Ń d~ Php#뮋p3Sc~Rhp#땹1jdRPOn1ɉ$$$ u#EƄ5/jj o11_Z1u9E2jd PEPmjj o11wE1Ex$|$ƅz ynH0P t9uon19r)J9r)lj°0󪋅 thq#$%$1$0 0t50=0 T$X$($1jjWZY8$1jj_sZY<$1jjgRZYjj {5^_un1jjMZYuJhP٠^_y>jhZYx鋓$  Ѓh-q#e[^_]11UWVS}} ?jhe#V ÅulhRq#V\Y^¡`0 p0 up0hZq#j XZjjPƺ 9tPVhq#j ؍e[^_]UWVSu] hS2ZYy- 1~dž4$1E쀻Yt"h YPWjz/@E K<vM E)ShT0\0} RhP0X0 } jjCdPo%($jj C|PлEUUEщx$|$@uAjj P T$X$H$L$`$d$ƃH<$P)PyjjCtP͹<$ ƃ(8$P PǬZYyjjClP藹8$ 1$$$$@$D$<6tL<5t_<2Pπ2s#hP莕ZYy|jj ԕ[_xl0u$  ЃH5h0PC¡h01ۉl0h0_Yx)ЙRPnZYy넸e[^_]UWVS$ƍ@- 1U ډe[^]wUWVSu>-u~t2h*"V>_Xu$0=J PVh[s#j[-1EPSOZYt/G}vEVWhns#jEUt-u1 SXe[^_]á|0t UU RuPD5|0UVS]u F5x0tRPSB tD3j SZYu1e[^]US]}t 0ܣ0 0t=̣0th-j 1̣0ZY50h "h-tSu h-Dh-j  ]USjhh"?Y[xEhr"P|0YZt&h*"Sx0YZt135|0lZSX= 0thh"hs#j ]UVS] u}t 0ܣ0 0t=̣0th8-j 1ɉ ̣0XZ50h "h-vVuh-C~SG Ph1$h-Kh-j XZe[^]UPhs#h-j0UPhs#h-jUWVSƋ=0tPhs#h- =0u ЉˋQtjPYZt8tɍEPsRXZ=0tVhs#^Xjs:js3:(%} u5!#VWPREPh,t#h-h--H-[yh-Y-P-؃t- t( -y h-Z-P-΃1Ylje[^_]UWVSAօu9VPxmZYt&0hW$LT^_F%=t1jh @txPY[|x^9|u,;u(^9u;F u%=t/p<Zjjj  ׉NX^\19ȉ}{ 9}Dž 1Pz 9y+{ZCjjj2 ' NX^\19ȉ}{ 9}Dž 1P 9+{6KZrjjja VNX^\19ȉ}{ 9}Dž 1P 9+{g|Zjjj NX^\19ȉ 9}Dž 1WG 9PPWi +^{_jjj ~\vX19}p1҉8 u݉19} 1QP& 9u#)][@H0hW$ZOXZ)Ye[^_]UE @E E@E]UVSutYSC t } uC0@0R; s; S; 0H0 u0t+e[^]UVSu0@00؃8t VPjZY\0u 0u0t e[^]e[^]UVS01؋tJ9tFjPZY\0uԉe[^]UWVS0@0ƍPӭY11ɋ0tx?tBA'u9t ht# 0u0th jVSc19}Vpht#pg-HQP yPag-H Z J GSŭXe[^_]UMtA'10]UWVSu^Nj7t#vuJY[Åu jWXZ ׻؍e[^_]UShZ"1ZtaujY1"4H0tP{ ÃH0X؋]UWVSP}U UWRW"ơ0@0$诫WC1҉S URҫC0H0u0t e[^_]\e[^_]UVSuV[t#sV0ZYu} tC t1ى؍e[^]Uju ZYt@UWVSjY1H08u&S;u0ht#5g-XZH0PH0uj=CPѻY_uyjS5_ZDžuSht#5g- Sht#wg-xWP yPg-H YlJ ]@PS3XZKe[^_]UWVS5l0-DCtWjEPVd0h0] `&:MAEI`&uV)PRht#`&tK`0\0C`&u)BUPd0NjUd0Xu,Ƹ^ À~|tH;= ÊV~-t >θ(%)%#Ƹ Ƹ^l0e[^_]U5t0PhRu#UWVSQ5$0\0$0PÉ5$0^=Fg-t ru#uKt;u%1҉jEPSƉ 8uE8t+8tu#``& tBUUue[^_]W|$wUWVSE܉UM7E܍Hw$T&u# u u#!AuEU Ѹu#t݃} uWVuuL WVuu&MΉEEUM EUEU)?EU t1?EU t19uE$1ۋE9Ɖ}$1ۋE9Ɖ}|19uE}11ۉM][EU11 EU11 ۉ]1E.E!EE!EEU11 EU EUEUe[^_]g_UWVS }Ӌ7VT_=p0%us Љ UU_EU=p0&t u#wEd0h0S1 VVڋExYtEUe[^_]UWVS(Ɖӡd0h0EЉUtSUЉt@ vSUиƉX^MƉׅuGMIt!ElM̍YWVщ‰Y[ƉWVh5"j]S>jSu e[^_]US7=p0)u _[]W|$wUWVS4ƉӉMЋ?E1Eă0HId0h0SuЉE뭃$9 "tFكPE4EȉU̸u#=p0#4EEЍpًt(SEȉŨwhfp0SEȉUYEȉŨw>/t[50>t' 0H 0FxFCXVԀ~/u# 0Kh"VZYu$f-9r :ƅuh 0K;/u>thH%VSZYt 0x/4艝X/ |XV>t 0H 0FxފFC9f-u 0x/C <X/= 0u( 00@0|0tP' X0|05f-0j5|0hJv# j50hMv# 0H0u 0uUe[^]UWVSQu} EE𡐥0@0VbG[y 0u 0uyj4á0H0Zu0tt9=f-u =Vg-t'uVhb#Y[50hb#XZt1Ee[^_]UWVS5f-ƅohQv#~Yt p50h)H0p+0pPSh‰$pp ;-u{u|0u0t<.uS{.t H%S^t>h#WZYEth"WZYEuEE1}}FHπ\ut}tnxP0tB<wV$DU&NE1>: 6 2 . * &щǍ@0w\9Eu}g-HyPg-H X JF>/g-HyPg-H X J }u-g-HyPTg-H [ J 5g-g-fBYtfBhv#j(1e[^_]UWVS]u }g-tg-9tx u hg-X00uPh "hg-" 0t0Ph "hg- t&WVhg- x0h9%hg-ZYxS$ PhW$hg-g-HyP'g-H X J Eg-e[^_]e[^_]U塘0u蜫U0jPqUU 100@0tuRj u0t 0U10EEEEjEPj0 =0t=f-tjQjjj U=0u 0E Puj:UEPu u(UE0jUS]Su 0uUuu 0uUEPu juUuu j}uUS] Su0^ ]Uu u0A UE Puj+ Uu uj UMU&ft9uPU t@Qh%j h00á0UWVSP>YuOƋjjPǃ t 3_;ZC jjPǃ t s8{Xe[^_]USh5!#ȨYH08tNf-g-Q0thB sXZ顨0XjjSP5H0#j1]W|$wUWVS ƉӃ=ԥ0uj'ak<ԥ0X ԥ01ƉU1}m %M1EmPP$hnx#jS茳;6u{0ujh1$S5F S ZÀ{0u K{.te[^_]g_1̥00ȥ0ĥ0US]tvUUt[F~#CtVj RPWjEpS:~5j Rs cWE@C us XCX C @C[놋]Ã=إ0USQjj]Sjjh$f-@tBEPإ0Zt,jjSPjh$f-@tإ0PATH@=5إ0 إ0f-Xإ0]áإ0US ]t6;u1Ct*p肪Zt0PjEPCp1(]UWVS }W1t@0B0PWDrE_XZsnEX;t.Ey"xVYz0 Phsx#1Psus ua 0u0t[~5jVNXZ}xuju4 jssYX}yjs_XZxVp^uudYu u|Z upX10 0u0te[^_]UWVS}u g-tu u101E܍]SÌXZ$V&uwYX=g-m=̥0%jw~XZ=g-K0 ̥04jwNYX=g-=̥0=0=0tBVW VW=S- =0t VW=0tjwXZ=g-=̥0u=0uSŋZU ?1=0)=0tuW =0tjuWSi =0tEuWfك=0t,www+1ɉ 0jwXZ1=00jwY_=0tr0f=0tW,S踊XZTjVW S蛊6Rhx#-hg-IS{SpY Sgf1S轊X0t=f-t0t tPtj=e[^_]UWVSE ǃE܍uV5$0ju^1jY=g-tKt>=g-u5tUXUt E܃PuRcXZ=̥0u V苉X^VZu10tje[^_]UWVSWE} _f-f- 0 0HO;t( 0sx&迊P ωʋ7 0tx BM蓊P M҅xJ wH+ f-Q茇^0PS}ZY100e[^_]UVS]ȥ01js&XZ=g-=̥0tT̥0uХ0HХ0x1̥0뼃u Х0QХ0 1ɉ ̥0MwE50=0; ut-t)E Ps50XZ=̥0Ro ȥ050e[^]UWVSu=0=g-u1EPIE؉E܋^Yt$hPSO =̥0b[E؋E1҉ȥ0]؅6F$0=g-Pl0P蒦PGh"=v 5g-xWPyPg-H =_ J=sg-xWPYyPg-H X J 5g-C_jsv E Pv =0=g-uJ̥0t:uХ0HХ0-1ɉ ̥0Hu Х0HХ01҉̥0 ȥ0=0EPPXe[^_]UWVS]uV薅E؉E܋S $0jPsiM[=̥0{tuG$0EpWRZYtV1=̥0uZ=g-uQSC ; t$0u P 0[_.[$0u P0ZYu뇋[g10VlXe[^_]UWVS]} 31EsZ=g-{5$0l0P.Phx#Stj RU5g-UR hx#Xu hx#Xg-HyPZg-H X J 5g-X0@0ujSguSPEq}trt<u4guu 0u0t3js&Wsj0H0u~0tunUu;Rf1ɉ 00H0[0e[^_]Rr00H0Zu0t tJ=g-tA{t;5$0l0PnP#hx#g-Ee[^_]e[^_]USD0EE1EEpX=g-tlExtc5$0l0PZYEP$x#[EXtj S5g-\ [hx#k[5g-XjEPyZYtlE00jXEuKt&:EP$x#X5g-XԋEt0j50W0@0Eģ0j EpXZ1ɉM 0t5u Ep-Y[0@0E0j%X 0t0t뻡0tEt"EPO$x#CX5g-Z]UWVS}] 1CCC =g-EP聀0@0E^y hx#xjWfdjWPyu31ɉ 00tu?jujWu"E؉s 0H0Zu0tEPwXe[^_]UWVSE ,1@0X 0(0$1`0EP{X10E@$0ptEXt8sp_u&C$0hpPSG [u[ċt1ۉEp :^x|EXtC$0sYu|1҉4pjxPSF [븅t4B4닅4P}_0pt0J0H 䋅010T=f-t"=ĥ0u4~0@T40)Љ0=g-u 4fEEQ 5$0l0P聝ZYP4[xuvp1s)Zg-Hy`PXg-H =~=WXtNg-Hy8P_g-H {j=WY^ƅu뽋J=뫋J Ӌp t:g-HyP9Xg-H J sbX뽋EX g-tRSP t [HyPXg-H J 5g-l_gxsjh W&VF u Xԁ}Q ``041 Huw)4)400tX4t-X`0QRUR0af}Zf}tJXZ:-{z-uzu apu CSu>E9, `tfE=0u Ext,AEftfwE= t= tˋE@fet50@0ju^[^[^8<50RuP,_,@0H0=00ujjSA 8nf-9tߋM/t/CUuSO1ɉ 0U^_}9uB0<:ttB1::uBMuZD+f-Ee[^_]k1e[^_]UWVS|uj/S|Y_tAuu VS\, xP6O$_Z@ j6EPǃ tjMy\=0uSuu VWu>躱8t4谱8t*覱8 uxPW#ZY@t 胱WkX뀃 h u tCƒv~ 0PSP6ho"jUWVSuU F^fftfftdN0$U jS$PJPj IU yхtvhpy#XZWTXtkhy#@XtZhy#/_MtIhy#ShW$0@0vP$Pb0H0tShW$RY[?0thy#,Phy# PShy#M~ t-g-HyPbg-H *Z J*g-HyP5g-H X J e[^_]UVSu@f&t"8u%uCVPJZYt؍e[^]UVSue&t8uVPZYuCݍe[^]US,f-1ҋ0tHft fux@ |u[]UWVS}0@00t,Pfu9x fu9=,f-| P X҉΍^x0t 0u0t e[^_]Se[^_]UWVSSu0X'1E8Et$}u <:uWE}:u uW@u6u#<%uUFPhy#uZYUt>:uGFC딃=,f-y t ,f-u1҉MRM ,f-Xe[^_]UWVS0@00t!f{usS XZٍ݉wx0t 0u0t e[^_] e[^_]UWVSutA%<00tCVP̞ZYtdߋ} tX0@0V $eÉ1fCC VCP0H0 u0th=0؍e[^_]USe&tjP)f@SPXZߋ]U塐0@00 Po 0H0Zu0tUWVS] j/u v^_t[EtFxPuZYy 脫8tz8tpffCf1CƋM09tMEthy#Q"mY_tM ju_Zt>HftftfuEEu E u=,f-yƀx u91ETtE,f-tuDYDžDž\DžXDž`juEP` Wd0Z?/xPW\YZ2E%==0NEWbLȉ`+f-$]cWabjuƃfx`QWTfXZF FfF CfF fCFC,f-f~tF\`9\HPhy#pZYtuYDž 50hy#ipYZ`9\~8ܨ8kΨ8]XKWuhy#50@0dTujuY_f~udfF`FDžX t@Et$jXPuhH%5g-Xf`0@0dTujuXZf~udfF~ 0.0!1 e[^_]UWVS$EE111E11EEhy#yEZtPEbw$(W&1EE1ɉMſE뵾뮻E랃}uutjLY1҃}u/}u)}u#uEEEH0810tROft!ftfIu:}fu.} }tуtEЉUSW>XZEЋUԋ?몃|u5g-^g-@hy# [EjWZYt[@ft:,fuu>H0PH08ufHu*}"fu}}t˃=,f-x t0PuЍEPW}t f}uA-tf}tjW~Y_t jPFXZzd]uEԉERuIEe[^_]UVSu 0@0ju!Ë@ZYft&fHu skXfCFC fFC FC 0u0t e[^]e[^]US ]0@0fEEEf-fEu CEEPSL0H0 u0t ]~]UjuTZYtfxup)X1UWVS 1ɉM11uhHz#DvZt(ptvtVuEEлɋE 8ctu ދM Mt4PhLz#Ht}t5h^z#4H0:t/1E H0:5!#H0:%z#RPhz#m [&jjV XZu}jV)XZGfEGEEfGfj/V>mZYEEԡ0}tEjVEPGEP\My`uhb#XZH0PH00Ihz#2j wl hz#whb#H0 8g-HPg-H H0PH00YV_8uVPZYmIwhz#swhb#J H0PH000PjEPV1MfHf5!#t3z#Phz#mY^jVˆ_Zuu hI$JYV`0 Ph"$H0PH00 u%hz#uhz# uh{#jVhb#H0PH00_Xt!H0PH00E.h{#YEE~uhz#넋Ee[^_]UWVSEPyZ0+f-PYf-XY}GE܊_tkta}t\} C<v2u+:t$ t/t6EP=Vg-t"E u 0xB [P}눃= 0u[ 0f-8uu@h"XtVAZ^E %E1bP YuVZZP X VZXu‹E|}u5F< v@ 00y8[P0Csu2b& <w 00yZP08t8}t!߀u8CuEԉEtCW tC̃W8uΉ֋EԀxAȋE1҉U]}t usu]uM΍HMЊ1uEΉEAx<EЍp[<:Mh+{#VOVZYEąM9EЀxupx9u`&EEE9s2>uF9utsE`&tdU9UvsԋUE͈@ĉƃEM9MUP YPEP EXZt\uuЀ>-utF<]tm/uu}NtFuc=|0Uqxvtu@r t@١|0;}u5|0S[rxRPZYyZ9tt1t9s'@ZxvttE]S@ϡ|0;EtP9Uu8/t}G H%JC%P-XE9|0t@/Džp>t F1ptJxw@tu@o0tSYpu{F/uSZt߀x .u o.uǍx jWt tptWu2h5|0 덋EG@WPu@/VP_Xle[^_]UWVS}P v Gu+EHCt5Orxv tpu tAƉ+E[^_]UWVS]{FFu0skY@uP0DVʴY0u+f-,+f-EEt;t}1ɻN)ЉE=Fg-8<@.<*&}tE<VE)HPh.{#(1ۅI~@ 0H 0Cx0P0S։MAP0SM뻍G1҅~օ)xu u܋E%PV1ɀ} k0+f-ыE))00 0@} uSGvZ}EtsŠb& <w2 0x0H 0U@H 0U 0x0H 0U@H 0UԈC뇻11EԀƒ v! 0xM0H 0CuJ 0x0H 0ĈU7@H 0U뫈U@H 0U뫻1111ɋE%Et>@u=L0uM @1 1E @€}E$W&U50Q80^_Uzu LuЉU E PuY[ExU^1 00yB?P050+5f-uuuuVuu%0+f-ʉ0)@ 0uZ0uuuVuiƒeuXE)$0 RhF{#誩}O#uOQVHPRha{##u EEEPVE)HPRh{#gKTu9u1ۅu"uԡ0+f-Pu 1Ҁ}t`]uu E]Etq|wt 0 0׃usuKt@뿃uHuEe[^_]UWVS]E %E1ɉME tEg-0u 0E졠0+f-E;~uE t u SXZE 1Es}B~< O$W&:=J{s{u{y{@u{=uz10E} t 00ys<P0e s 00yI<P0$0 00y#<P0 t=0t"0+f-M9~xuH0 uE uE 11 00y;P0҃}u C< w 00y;P0S 0x0H 0U^;H 0U߈ ts$0E#E PVu R0pl00VrXU 0x0H 0U:H 0U߈E {~=u}1Eu V[X u$0 0x0H 0U`:H 0U߈EE Ru.HZY0+f-jPHP wމe[^_]UWVSEu ]=&g-t1҉0P 0f-0f- 01ɉ 0 0P$0Sp_Xu&0= 0u90 0 00yg9P00+f-Pq600XtAh0W&01҉00Y_ÀtS50+50_Wj6x00Y[k01҉0tNFe[^_]Ujju5f-@E5UWVS$EPEߋ50+5f-hREС 0H 0ZYx0>8P0=f-VWW]S60+f-P+55$0WȕEԉUS6f-򡠦0)Љ0 0 0 70uuh5"j50衜0׉Gu}"tj)PV} 0)O0)= 0EЍe[^_]UWVS]u =01}DPSXZ0= 0u70 0=0}=f-}t }tAL;tWhb#hg-訛j\Y&Et{#PV)KSh{#֡jWV膥+0=0) 0e[^_]UWVS]u=0CvsLE%PuXZ0= 0u560 0=0 f-}M  t?9s@UVWQM MUt <CÍY9s1:UVWQM{ MUS9st{u8u@@9r9sS륍Y9rVSQM, SMt9s{u8u@@9r9sS뺉A9SVSQM u;Mt;uCCӈ)ȉ+00) 0I9tKCCG+00 0x C04P0 0 0e[^_]UVSu]Sc2F 0f-0f- 010jv 0H 0 x04P00+f-P1ju PES2Ee[^]UWVSuFPh#衘g-xWP[_yPg-H Y J19}E 4hZCWh#Cg-xWP_YyP蒖g-H [BJE 4|g-xWPYyPJg-H XC9| J1e[^_]Uh{#Uh{#םUUM 0f-t 9PuH]Ë 01-0f-B t xt 1z1 0 0UWVS}u ]0@00f-z tj.0f-J B ZB$B 0P 0P0P XtK =05 0 0u0t e[^_]re[^_]UWVSQ50f-^ 0@0{t-WRUfZtUD< t< u g-Hg C0C 0C 0F $9tSW X 0u0t e[^_]ӛe[^_]UVS0f-H  0tBu y8 0xxhg-˓hg-XZ0f-=0X0hS0f-py qu 00js8tġ0f-xus8#ujjjy xtPjjy xh{#萔Xu00f-1p 0f-P001ۉXъt< Y0t,1ɉ 0 0h|#Ϛ)щ 0H0! H0)H 03=g-t50ۓ5g-_XZ0P0~e[^] 0x0P0U=~u! 0x0P0]]U0f- 0P 0P0P4f-Pj8r+0f-@1҉P P$P0f-YUVSu] 0@0hZ VwjjV%xtt0f-@~PwY0f-s{uh*CZ1 004f- 0u0t e[^]魘e[^]UWVSĀu0@0jVwY[y Vh"|#ÍxPSN_ZuE%=upjjjS`V u]jtWSzv u"jh0|#W uSxwVh5|#jjjSV tSWwVhR|#MSu^9uS;whl|#2u Px0H0ZYu0t蟗e[^_]UVSu]0@0} t50VaZ 004f- 0u0t e[^]=e[^]US0f-0@0CxPuXCtPl Y{ t0f-SQ 0f-P  0P0P0@4f-0H0Zu0t ]顖]á0f-US]0f-9t =0tD0t h|#і]Á=0f-0uU=0f-0u]U}u"0f-@~Pt0f-1҉PYUE9f-uE f-]UWVSU@0)i5rO9f-t5<0u1#f-(9tC߉9} }t}tVǁ[f-t?iӀu.tiրuf-f-XZ[^_]UVSu9500=02f-tPqsYjhh"Wsf-[Z1@tI5f-rf-hua Ps5f-C~40y;"Swf-Z@uCt SJYth|#%g-X4v;40t jj[XjjCjj:jj1u¡09t Pj@ZY@ul0 hd505f-}Y[@l0ѷ hPh|##}u¡409t&Pj[Z@uql0蘷 hPh|#5405f-|ZY@uBl0i h5f-qf-jjKjjBjj9500e[^]UWVS]u+@0i5rOCSh}#0@019~Qi@tǃu=uFjRZY@uhktP芶 Ph<}#9+@0i5rOCShU}#輒HJ΃utBƃs 0u0t e[^_]e[^_]US]0@09t P; Z1ƃ1҉ 0u0t ]霑]UWVSTÉ։Mt&uPh"Sz =E,EtM}~EtEtCzMB9tMtEttt t tM IuɋE0u#E@VYEEHEvE9u]=@0)i5rO f-+9t# ti1;J-R@Phw}#jEP茊h%"jEPw UR~ZZEUt%‹E0h}#jRUHURRZǃE@T=uh}#RCAYXu*tQh}#jRfhz%jRTu =t̉UQ诳 j URP/E@Ut$RYǸ@)$D=Ph}#d/ U:PYlj$UR胈XZKyS蹇P Y P G~SEPLXZEu EL}tzKySkP _ P KySIP|Y@P|4M}tWh#S蛈 iEM0EKySP Z P EEE}SX>e[^_]UVSMt.t 119}9ivtC䋉11tJiD} u&ƒuu=tă[^]UWVS utF>%~W2.[tW-XY}#*Ft~uH<-tB<%t<+u:f-}#f-i@0}#@0<0E1MxdtS~JH~?u(UFPQM'YZMUt UQW,YZUu뗅uV;-ZtjV,@0<0XJxRt~i90tM΅x29<0~*i@0t"}# }#}#1ۃ} uVPL؍e[^_]UVSh5!#6X=80tYh}#rg-HP9g-H Y膈SnH0Z8PH0xjH00Y^u h}#請=P+@0i5rO@Ph~#< 9DiPh#FXZՋJ ;1e[^]UWVSQ111Uh~#5ZUt$jtptguܿպλǍH~h ~# H0tyt hH~#辊UjPYXUt 1t+@0i5rO@Phf~#t$Ph"+XZ1tiHi0i0h&#g-BHBCY_y3R8X9H g-z99y9H y:؉؍e[^_]Ã=80u!UjuZYu11á80u!<0 @0Jxu 1øUE=f-t@=0t7uR+@0i5rO@Phl~#5g-躂UWVS=80t.5<0@0NxtS{X180<0@0J0B0uh=ViP*Ë<0@0i߉_19~i9uFP? ^@0<0iƄDŽIu<0 0u$0t膇t 󡐥0@0=Ng-1ɉfǃ00)؃} ~iE PZ 0u0t؍e[^_]UWVSu]=0tSSzYXuM1000jcjnz100XZ}u*=f-}u=f-)=g-t u 0Vj`_X}u-V5f-OoZY@u^0 hPh|#\SjrSjr{}t80}u`SjzSjzu }um߃u2`u)jdjh%d th%h"|#Ѕt$=f-tSj`rSjXrSjPr_e[^_]US]U M=g-u1t uEM E[]adUWVS}tE1ۉEPu EPǃ u]80t0@0@0E1i<0M9i MEEM99u]Pu Uu6$уu>t6Uu@ƃP}uuPtуut 1ɉM1҉UY}t-}u tƃ<tƃ1҉[tgu tUP=0t =f-u;u uEɃ@ ;u uEuEug-P 0u0tȂe[^_]UWVSjjjà ~ jjj=g-tQCtN5f-(l3^9t7)P5f-kZY@u/[0V hjPh|#訂1@095<0|btPu=80u>SX5E t t&tt M ڋE8F떍e[^_]US1hv~#,Zt$ltptZu⻀ۻԻ͡H0u t8t PhW$CcjCY[=f-u =Vg-u@t4jH00‰١g-H0PH0YZxuS5g-?XZ1]UWVS411Eh~#+Xt)ntput hz~#&5D0Eƃ}t1E̅u480E̅trHH08uEu=80tO*jjV~ uVh~#jV=Y_t Vh~#蠀=80t}@0 <0=H0Ix.}t ?u1҉1E؋Eԅju4EZYtxu M؉}tDE؀u8jPqZYÅt j7V蚃 =f-)ugXE؊u CM؈`H08tu E؃]ȉ1}ܡ@0<01Jx8t(t uEuEĿʼntEĉE܋E܅u%}jbjuV踂 OuA1ɉM܍EPjj @usE܅u ߉:tU܊jRU_ZNjE؋U9t}uuRY_Eԅtt h#'X6jsjs u7{t1hx#Xh\$jsh$%1[(h #js u hђ#_hI#js { t&u hђ#n^h$#cjs T u hђ#H[h+#h"h/#,XjsZYu hђ#Xh7#js u hђ#Xhq %h"s h#jsyh6#js h<#Cph#s t=jvih"djv U; uhB#hG#A_vhL#s)hQ#s#1#%1i"1 #1 # #S9tRh#j}WboWV^w-C yhy#0ʙXYѕ%u~#jPh#b UWVS}] Fh#UW_9%1ۃH0t H0u7;0PH0`0jP¿`00XZ=<0t6u h#XH H0<0PtH0`0H0T0Q0L01ۉB9tt 5L0 H0e[^]U}ujjjjuXE0@0jcH0Z8tPX 0u 0u1zWUU0 wj jRa Hu1X0Q0UWVSu}Et8uLu+E@1ۉ1۾E?C:-uލBztՃz-uztĊ] :MtKu5>:u$EEEjEPh#}[à uVh#cJz:u벉뮍Hz:xuWمuU6<:u!EEEjEPh#[à tuVh#hg->Pjh#`1H9ujQh#Zà 1Mjh5!#h#Zà M+E@1?1ɉE11ɋU Ph#j MQOhMQhӂ#_Z ÊEEEjMQu EZ( t1E1҉URjTe[^_]UME  hڂ#UP uT0=Q0uX01ɉ \0Q0h\0hX0RppUVSM@0t:u>H0u1:-uztXH0z-uztBu H0ͅtɍr8tuPh#9Yy:u܀y:u.zu H0J H02u Ph#T5D015@0e[^]UWVSj,H0^_zth&#:8->E H01@0jH0Ytzth7#$TL0uD8-u @P5L0P)XgL09ZyhI#9|EPá0@0T0 L0)<}_߉ƋM9sω9s x19r )ЍpkME9s 15X0 0u0tRS[PYL09} h`#0B0)أL0T0ljNx=P0tE7q ZEy1ۍ T01u1X0 0u0tR1e[^_]Ëg-z8U 0x@ 2@g-J8g-z8]ÃxuUSt Pq XK]HÃ8uU1҉P8u]UVSƋXCF~hu1A1ZAf@ fZfXfZfXZfXZXRfPȍe[^]Uj1҉Pg-JHR P UPUSUJtXxv-u~u C $t h4#g-B0+B8PCXe[^_]UWVS4f-E轵=u6E8t hZ&3=f-f- 0} E=f-f- 0\C 0\GJà " 0 G4f-$=k 0H}t 0G u͡4f-@4f-=-} uE( u ´Eu 9E@E苴t9u& u4f-g-HH FՁt| tf(jE)VP' &gx\Wx 0ujTY>tt-uVƉCY;ī0} ;ȫ0~ȫ0}>uQy>u |u &u Utv&uya1ɉKg-dj\dB(g-@(X4f-PZ-g-@(u @  1҉P 蘘y1sg-X$g-@ Sg-\H,hP SRg-pg-@ X P(Xu1 0GD 0r5H"0×jhډMX 0HXq{t `& 0X+5f-T 0`X@Džd{1d#kDžd}tm`&uW-DruJt?:}u5Į0Ů0jjhĮ0Ֆ 1ɉd趖Džd `& 0t> 0x`@`H``&uKЃ wC 0x`@`H`iÃdt@@Ѓ v6t'H 0X`XX, Džd 0x`p=d%:t #u)PhZ&[Z…t!Džd[ShZ&ZY…uH% 0x:F p:Džd 0xF pZ&{`@9Ë`uBW``Dd u(}t# 0x#F p#Džd襔d1ɉdGfxufxt dTf-Jwd@ ӈd ӈ{dNj@f@f@dK@"e&1҉P:'uAW|"e&u1 0X\Nj@@b&f@ 0X$觓H 0JNj@@a&@f@e[^_]UWVSSg-1ۅtXC1g-0x tjRg-1҉P YF8Pv v^S‹FP U8tSjg-pVjhd&P`g-HUJ@ B 茘]e[^_]UHu+]UWhPT0l֘dg-`0\}1󫡨g-X1pjEPZYE00Eg-Tjh\ jhd&Pc g-B t$Pt=^g- hppDžt1ɉxR|T}Eg-jjtP螉 f-pnXg-`g-d蘗Zl0\00u jl:Džp5!#u^j-Džp#Xg-`g-d*Xl0\0pu hpp}UWVS g-@1ۉ]}U g-u@$x @40$tZ&j螿jCjj Cu;jeF EjUBjbjUB뻡g-xu jF Y1҉V @j]j ág-x 14$pCjj_Cjg-@A. ug-x,u pr[u h #j聾 g-PS @0CBg-Yx u`x,uZh2K%p^ZuGu g-up0pY1҉US@PvjjfHu?8j@g-1҉P Pg-J0HCBHYvBg-@-ttjjjCVg-@^Xjg g-B0+B8C j fg-p0C5g- ~ uh2K%vZYt h2K%CEFug-xjƋE0FEYg-xu;g-x  jj p0‰EEU表g-@Zu UBE밡g-xt jj@0FjF g-@Yt-Pv jj u g-@FEM1҉@{j jeC1҉SY^tNjjLX=Vg-tt3jg-@X&}tg-@uWd^_Tjj g-u@$x@1ɉutt;tj 7XZÉs؍e[^_]UWVSV} uE E1ۉ]1]g-xn g-u*p0QƉXYtաg-pZu1뿋H up$E0FE뢋}9u}} uwjg- 4f-H4^S ZYuh#SVqj/v t h>#t g-4f-+A8F%Fg-1x4R@@u} u jj1E1҉j1ɉHEFE F g-@0F[e[^_]UWVSSg-@1uG u=Vg-thP#g-@puWj U1BUj>ËUBpXYUj%&C^Ut1ɉ ֡g-@tj)pZƉe[^_]UUg-1ɉHHPtjjYXg-1҉P t/Ht3g-@jg-Ytrrhc#j&g-1U11ҋE]FUU Et 9Pt]UMԮ0tPt9JuB]US]j螷SCU PUPUP X]UWVSEPe[y hx#%u;5g-~5g-ExWZ=w PWV% `jjj uNuojjjjjjjj$jj SEpujIu!Ee[^_]1=Ю0UWVS}u }t~h@VWvdà VWdZY}t9u9t:WX19t-y!0HH PVWh7#SSVWhQ#$9g-}g-؍e[^_]UWVS]{tN7Gu Ю0} t} t&Wxjw PR+GxP"YWC Z1Ce[^_]USԮ00@0uSwԮ0SB 0H0 u0t ]P#]UVSuԮ0t1u(jS#ZYFxPX6utse[^]UWVSu] 95g-}5g-9g-}g-9t7S9jjSV%9t8VWF PShm# #؍e[^_]USg- @g- g- ~.CPjjk x9g-}g-PX͹ؙ } ̮0]UVSu̮0 ~;ī0|l5̮0j Và x9g-}g-9t PSh#;g-~.g-&=g-}0g-$9g-}g-xjjRU UuRSW0H00t}t g-g-}t g-g-e[^_]UWVS ]1}}p7-1EEh#u Sp0 tu~tvh#S S4[&ZYt vVuQSh"MSh0#EF y)KySP-Y P-Ph#Sq SvXZۍe[^]UVS]0u&=0u h0u0t]=\0uTY=0uZ`0tO`08tCt>`00@0=f-tu0u 0{0[^]US]SVYt ]]ߴhC%S!8 YZtSZu]US]l#t%SZuSh#j hD0D0]UVS]} t"KyS P ^ P VPhW$S  t?uSh" ZY?t.!KvyS9 P X뭋P 롍e[^]US0@0`0t8t P2 1҉Y`0u10 0u0t ])]Ë0u`0t9u=`0u 1UWVSu} =0t=0t?u;`0tۃftGtt;0Wt2<=f-0uQ=<0uH=ng-t?$=f-=g-0u> uU0tY<I<tG<0<#t5<<0uw EPjV @}ttKtR1N=g-t tFv =f-u <t9uyD PVbZY@t\u0u jVZY1E܉EEEN>v  DjEPj[ e[^_]UWVSu] uh%sZYtshZ6$VY_uhl#B j5g-h hy#Vm_ZǾ`0tl0@0`0P/ 1ۉ`0^u 0t0tjW0H0ZYu0tG@u1501ۉ].{h#WZYth&+"WZYu/p[vtEuEu11j1}h%3\ZYDžt}N}u N_}1`0t@taGwuu%hq#WPh% WvPh%C ~h"__1똅t h"L^11`0t\`08uPu%h{#"VPh%'VPh%tC ~ h"[1F@ut h"Y1ۋ`0t7`08t+h#`0P SPh0#C@u}u3=0t63{Zu;?-uu1t 11EFh#EXE=}}uU`0t`0Phb#tY^PƃX?vsh#5g-- h#`0Zu hy# `0P XVPh0# 넍Fuuz0@00@0u1 WݞX`0t`0P+ Y<`0t jVxXZ 00H EEe[^_]UVSuu 0d0tJ8tC0@01P-`0P0H0ZYu0t `0uu e[^]#e[^]UVS]u 0u VSYX0<vjSXZuƃ0e[^]á0=0u t8u1UWVS\01ɉ 0`0u@@u \0e[^_]1҉`0=0u‹`0tX0}W-50SjP5S#* ,t }wW,50Xe@Ht `0tUS]9@0t$jjrjjijj`@0]US\1ɉM=T0u'=\0tX0t EE0P0P000tjEP[Zu Eģ0jEPZYt0@0jEPY[uO8Eģ0=0uы`0tǀ;t 1`0jSXZ몍Eģ0ZjGtX]~ ~Cvv1ɉMMMMEPjFXZjS*YX1EEEEK>v  DjEPj? hSP XZ5P0CUT0EP0]UWVSh ]&PZYj'V身_Zu <)ș19e[^_]á0@0g-t,UP' 1g-g-Z 0u 0t 0u0tUWVS]߅~91Wu u ~ )Dž~E u F ~) 8t̃؍e[^_]US]S t0 9t*Cfx!)QRP yfKC CC]UVS]Cfu`0CfKS u>0@0s2C CC0H0^uV0tMFfu9s0@06CPRC S)S0H0ZYS XKe[^]UVSu] >t/CHCFyS!VH XڊVH 9g-u]e[^]e[^]U5g-uXZU5g-u~XZUPuu EPE u h5#kuPJuU% UEPu u UE Pu5g- UWVSu] Eu]EPu}WfEHE yWEXEEtDe[^_]UWVS u] j'Vz_Ztt~tnh`#V#=ZY<u[KySP"X P"SVKCHC^_yS{P"[P">t%h ]&VZY<tBEt7KyS'P'XEP'1҉U1FVKI't/KyUES AU y;뼅t$KySP'X P'KySP\X P\KySbP'_ P'1}D>;,KyESJ 'YE J 't"KySP'X P'9g-u]e[^_]we[^_]U5g-uXZUhg-Mhg-CXZU8ruPhe#Ph#<UWVSSEPE X85f-f- 0j=RUϥZYj=SåZYU))9~߉Ӊ 0I 0t$<=t xFU萗p UCɅxUrU] Ue[^_]&UE1@u,$0+ 0Rpp h#jh0莸0UWVS]} Mt t9u t113`&ƍCt9t`&u1@t)؉[^_]UWVSS110tZuA=u܍P術EY10t5Nȃu$Ft sVЉZt F6ǃu1Ee[^_]UVS];uE#e[^]h#S8ZYSZ9u;ShW$j'S£Y^ƅu+Sh'%XZ/<'uhʊ#sXuS)Ph͊#t e[^]UWVS]} sSt"CtS҉XuEs1Et Wh>$!Y_}t5uh>$ XZ$g-Jy R` g-z9 _F>=u y:Cu}th2 #FPZYg-HyPg-H X J e[^_]UWVS= 0u0 h4 0Y11ۋ0tJG} tE t8tEt.09P5 0 0%0XZ 01tfzuh jjh^&1zuHh4 jj h_&BRE.uh jjh_&h(#PyZY1u_&UVS|ƉӀ8!uxu :\|fxqpftft!f u&P=Z?;*;"|f uPS~:[^1PS9ZYuNf$ ^&|&E%=E%=@E%= E%=`qE%=bE%=SE%=DE E E 6M;MU؉!].]dL9>(u;)uF C<He[^]UWVSƉ׉ˉ+fx @f$t^&SVLY[SV<_ZYSV/[^SVZYƉ׉11 Ɖ׉11 ylj։91lj։9rlj։g9(Tlj։I9PV|7^_xPSe7ZY04]E9uc9u_E98PV#7^_uWxPS7ZYuD04MU9u9uE98f9]PV6^_t1PxPS6ZYu鋅|9u;xu͋ 3E3U 謖>~u5!uډx!(u;)u{u ?e[^_]UWVSu] h}$3_Zu!Nu xtP!zUWΧYu UR-DPtÅt SMZ@tM}th%6ZYu }tM1EE8%u!Pv^X6h^# _Xz1ɉj EPu裪ljыE 9Et:8u5 t/u u5!# 9uM.8Mt#y޸"uPhm# EGSW YZ@u'#|x"RPhT% Etu jW XZMunUVS@h000058t j=S͉YZt hSLXZP Ph#j@]SjSh#|j hg-h e"k(j hH#hӂ#Wxƒ ѕ%u~#j Ph#2j,h#ht#!j hH#h~#$e[^]UJ=0t 1 00_Og-01000=Ԯ0t jYg-g-g-g-g-tP 1g-ZUj91ɉ 0Nf-100f-Zxt@ۆj0@0jXZ10uƀ0@@u 0u0tUEt]UVS]u tVs XZe[^]UVS]u @h&$`g&Vs [u CEe[^]s 虮VDF4$VsJVs Vs[Vs GsYVDF[ ]VsVs C[XZD[*uFE$Eh`&#VY[EEE8.u(px*u Eh`&#V賯_ZEEu uh׏#}f?f}‹}G}HE @,1e[^_]UVS]ss 3sh#& j&tVTRPh# S贾 S VPh#e[^]UWVS uj:u tZYE u h+#j@E } hk&E PyY_8j=Pt_ZqxEPh[#W$4E #s#?#G#rF#s#G#}O#rN#s#O#[TW#rV#sW#2+ rb#a'X# sY#b#>}w t2j#&j# ui#r#rq#r"q#y#@ux#@t"y#y#Àu!#y-#Àu#PI# r# r##' # r# s### r# r### r# r"##u#t"#~#u#u"#^W#u#t"#70#u#t# u^“#?'a#tb#^“#}wu1ɓ#%ʓ#uɓ#ѓ#uГ#u"Г#ؓ#uד#t1ؓ#`%Yt@ߓ#J#@j#>uMޓ#*tO#i#Mޓ# #i#^#3@#j#^#^#}w s r# rq#%=t)wt=u&0#=u8# ,#4#Qy# rx#<}vw s3##'# r# #r#r###r#s## # r # s# ##r#s##oh#r#s##F?#s#sj#^}uS$#P j&;t3CaP3h+#jd,Ww 1 11ɻ j&;}t SC8t{$(Wh4#j ,(P3wCPh4#j }(P w$A u,PGWAY_1Ƀ bt,P%EPXZe[^_]UyPh9#h-{jmnU塘0#=0u"PRPhȔ#h-M{j9nUWVSQÉ脘10;#uCj EPSVkg 8t ShW$jE8tWSh6#jse[^_]USÊt%<#u"S Zt@0]UE E EE]UWVSÉU}utj VSj @t 9E s 誗8"u"3O;t)t:Et-fDB@fO1e[^_]UWSPh#Zu0.j URP#jà u,8"u h#j}1ҍe[_]UWSPh#Zu0.j URPià uٖ8"u hǕ#j*1ҍe[_]USÃ=0t =0t?09t6t2#t""=u#QRh#n 0100]UVSƻr&t[PVPZYuICƒ00C0Cij0C 1f‰0te[^]% Vh#je[^]UVSÉ֋t8uVh#jURM1YZtVh3#mXZ01EEe[^]UWVS11Dž=0~ VhI#mXZ1 RPhSݟ =t=0Vh_#&f}Uu1.=0Vh#&m[^v49tVh8-h~#Ea6Wh#h8-rvWh#h8-rF (tlrvWh'%h8-+r$E)h8-j xkh8-b e[^_]UWVS]{(u jh9# {,ujhH#g_X{0u jhY#1{4ujhl#PgY^f{Hujh~#6gXZ{8u C,C0C8{<u C8C4C<ujh#fF_X1s(t h#fYujhݙ#fFXZ1s(t h#fXij0z9s9RPh#f 1EuuO9}ЍWRPGaPhW#MfGf뭊EaEG?tPG9C$u ~#EPV8EZY9 uu VG Ph#S t4Ph%S: HtSh-#ZRXZ붋fv(hP#SW Dt0Ph%S HtShk#RY_뻋F(v,h#S t0Ph%S HtSh#QXZ뻋F,v0hȦ#S t0Ph%SL HtSh#lQY_뻋F0v8h #Sm Zt0Ph%S HtSh.#QXZ뻋F8v4hV#S  t0Ph%S HtShk#PY_뻋F4vu_8t/j^} tu Sh#苹 ShU%{_X뿃} tu /Ph#] 벍/PhU%G[^띋$t $PYPZ}tEGjPSe y hH#XAЃu ƀt/tu1PY$u ho"`7 e[^_]UE0E 0]á0á0UE Puh-h-j :jK4UWVS]^8ށu=0t50h "=YX=0t"=0u50hԬ#r=10XZuu | ZYyW]Ph1$G= t7=0t.j Q<X=0t\P50h#=j3e[^_]UE Puj' UE Puj UE Puh UE Pujj&3UWVSx1ۉ0PhJC%^_yh#hVub ]t Ƅ1PSNZYySh!#LY[u%=`uz 9u;u0Shh0LJ ƃ uSh1#뜍xPV_ZyV끋%= VhK#e= u:u*ShV t ÿ"Shi#0Ss[+SgY0hVj u|h0hW$5XZ|듉e[^_]UEPZtPRPh# u uh#hh0n90U0tjXj &ZUSn[j0h{&j_ 0jjXF[]US3[jwjjYXjjPX[]UWVSÉ֋x CPww wwփt=0~j wX0e[^_]UWVS1=00010001 Dž葘u/h#h#2[^Dž SUYu2Åu~3hVi ǃ uVhW$迳XZAP~XEtVhĭ#9 Euu듋CuOHujsVsUYE >9 C 8H1u"Wh֭#h-< Dž CC jhPjVd Ãt'$Phzd@S'> @uS_ [WlJYD -9rDYt)PH0t4KRWQf u <tPȉjbp Wo C1ɉK C C1{;0C00XZ{ t%VwMJYZuVh#0XZ?jo VUo GGo G 9o GG1CG8{DžaETuDž0Eu0} u:E 5j 5Ytsh#6s _Xtvh%i66M 9~=0 1ۋ9U tE 9}?Cԉ a^ EtPs ssh #5…g=\Qs ssh&#h- 9ҋC'BDž 10C0 1F0H0~ + 0(P6^t509F6냽tr0t`5!#:t#hJ#Phd#h-B80t/";tf3#Ps ssh#h- 8͋ Փ Ph#-Y[0F1҉StPVS sxspSj uU89;00?uǃ tuU E t$9{p1҉ e[^_]UWVS]fU ffCffBCffBfCffBs sY^} GW CȉGCȉGCȉGCȉGC ȉG C$ȉG$(s( ЃXsXCdȉBdChȉBhClȉBlCpȉBpCtȉBte[^_]UWVS]fU ffCffBCȉBCȉBC ȉB ss5Y^} GWssY^GWs$s Y^G W$CDȉGDs,s(Y^G(W,C@ȉG@s4s0YYG0W4CHȉGHs(׸e[^_]UWVSá0@4C ECSMEK,ș=0{(;{$S(E9EPʉ;u 1ɉMh#SƋCSM‹{,@UE 0UfB1҉f@@XZt UB 15(0ω{,ș)K$S(#s${(19jC,EM9YE@EMȉE@EMK,E1)׉s${(ș=0E99UʋMUu{50C,)֋C,C,)s$S(;h#S>NjCSMEAE@ufFZ[tA 1(0Ee[^_]UWVSu^8C@Pv$ WVq+j WVu uhS,9sR9500rCWVCP t-f%#f=@uӦ"SRh"%p Sh#`XZe[^_]UEU uRPRP+UWVSLu u]1EE u} u}EEu}u}XY=00tB_EBBpOEBtDESR#e[^_]UWVSuE1;E}  0099ME 9΋u uÍ1ƅDž EU E00_Zt$CSCECS"Cp/Ct!CS =0RP8  PS@"[^u uu uhP*u u00 P@1ɉ50NP t1҉ 91oGƉtNCSWV7 +lCSLCS YWV6 +CS P @1t*T @ G&|@ Gv8^ |=0hl=00XT؋|tTىTQAw0CSSC CS؋tTetxXpPD|KtDlDS Cw0AQ Ah2 (FhtDt1ۉxXp OPhl t19|O0#8@OL!ًtxtxp 0󤡴0H0@Ãx} 0x=09fi-{0B0pC9sjhi-WZ=0 C JPhl t1=00t@I @K 9}#8@#BLpptxbÃxjhi-pPh#=80t h1#:Yh=#˷ZtWC jj0@0 RP Pk^_D0t@0Ɖ =00|L‰ˉы Љ\1ۉЉ\P@)GWWG)GWd|LL1ɉLS C)CS Ch)Ghtp8谽1(0 e[^_]ÍL$qUWVSQQEUAQ I@QRP2$ƃ 9jj0@4 RPjjWV fh-0Hɉfi- fh-fh-fh-fh-Eh-=@0tEh-]E]C WV XZ=00t CpSt+ C(v1ҋ 0I4.xtWV(Y[11tjupEw 0fi-UJ 0@4B9s$Ujhi-QM8M 0 UB fCB u0C‰UjjȼUfPjjSuu褼YZ8tuu蒼YZ8WVStWV,UMPHPH QR_EWVUU$WVDYZ8u(CWV+fXuuf@uu XZA@fAEeY[^_]aÍL$qUWVSQpQAQ A1~ ^_EC:ffӦ"f@t#PhD#蹆=80t+=00tC CC C u$hN#&5Yh]#TZu1=(01_ t貺f@[^0 0jj ¡,i-ƅDž Dž1XY=00tB>BBp+BtPR|[^t00 hg#qY=80t-5(i-jjjj00 h#Zu5,i-RPjjPt0=80toh#3b50=0 t(jj[[XA!HfAWV#100XZ=80tj \_00 tjjRPe0 0u h#+5050[^f%f=@h#hۯ# ZY50=05(i-jjjj00 xRP5,i-jjy\jj5050ƅDž WV@@PP WVf@50505050蹷^_8th#1ɉ (0[00 tCjj RP* {C9s#Qjj RP' N019r)#u 5050u"h#Ah"01(0XZ謶fH^_f@t 5050h"u6!@t%h"50505050)Z[@@fA\5050f@5050Ch/#<$u thF#  =80j XeY[^_]aUWVS}u w wTXZCfEE9uc0t=80t =<0tj jjjw w'u0jhY#W  w wNYXG 09O u,i-;0tf%#f=@uӦ"Rh_#w wgE)Puhm# =80us=<0tRyNj h#XZ=80t2h#\._=80tfE)fCe[^_]Z h#eZHt1ɉ (0x밍e[^_]UWSá0p8hSY t& 0q0RP¡0H01z 1҉Ѝe[_]Ƀ=0tf‰Ã=0tÃ=0tUWRP`Y_}UWVS(}M] U 00;E] w+EU 90p8}E9|+F]!É]E !ЉEEUEU9}"=\0tWN#uVu uh# 50}̉Euuu u** EmEԉU؉E܉U\TtFЋ]!FEU؉E܉UFEUӋEUEU EU9ME FEU}9Ћ}=\0tlSQu uh#  0\Tumq֋]!qISQuuh# ZE̋UEU؋}9Ћ}};=\0tSQu uh#L 0uuh1#1 $럍e[^_]ÍL$qUWVSQ0QEU}9Es9=00EsuuhV#"{0 00sx1uЉ}ԉ t9E}rEU9E}\1ҍMQRPuu ŰEUEUċEƉE؉Uu܁Tt-s։!U!CЉEUuuuu# K` t1Ɖ׋Cu}ܡ0t`s0WVխ00@x1҃ RPuu! M])Ӊ 0 00@x1RPuuY! 0R=00tЍeY[^_]aÍL$qUWVSQ8QEU00Ӄ 00}9u}9u9=00Esuuhv#y00E؉U܋E9EEE0@Ẹ00\1ҍMQRPuu UEUEUEƉEЉUuԁTt-s։!U!CЉEUԋCx1RPuu! K` t1Ɖ׋Cu}ԋKd t1uЉ}ԋE̙=0u 00 00EUܣ00Suu5050腧=00})E50=0019}VVdf%ZYf=u Gvdv`ذYYF`VdvlvhŰYYFhVl1tttpM諰YYM؉DpTtA u1M耰YYM؉Auv<=0u 0(1E؉Ẻ}EċM9MSuu5050躧rVVif%ZYf=u+=L0u"}uFV c9NjErE؃1T(ʉT(@ uFXȉFXF\ȉF\F`ȉF`̡000=000ЍeY[^_]aUWVS u} 0M]1EuuWVH  ‹Mt WVh#u10010 050=050=010=08#AH0=00态1ǣ01ã0050t C0 =0 0Qh>p0ZYu h#te[^_]á0tUPiZ1ɉ 010UWVS u=00tFVFV zEU존0H0AEUSQRP!  w 1҉UtE4P`X30RPuu  01{{E U 1҉CS1CC E UC SEC$EC( 001E v 9st DpTtD(D,T0Gу} w0090ub11tDXGu뺍PRdZY=0u h#r00d0P00e[^_]UWVu} 0RPWVT 0t9xu9p tWVh#re^_]Ã=0tQUS00\;0r 3jgX50Yg50Ng100ZY]á0@ UWVS$Ɖx@t@VЉ_uDž* v vv 0p0vvxNjH0P0@t 1ɋ9}=؋ÉA빋EU RP É19r=0th00tF1ۋ9}&G q10YYQCG W50ɣ[X9}W ʉ@~ 09Ht09Xt~zG=00t T <tYv vh#hR^RV莤t"G=00t 1ɉ ؉L1҉G 1(0C|W50[X"~@)EU 9GG=00t ȋT tdtJ1҉FVuVЉYu uXZ]gE E H1ۉ(0FV RPRPhS¤Sh<#o h`#蟛Xv v!ZY=00t@V+EU FV@V z+EU oFV hn#0gX g؍e[^_]UWVS uE 8t18E 1ۉX0X400tFVFV щ} G$W(ff%f= 0fua(9=0t;9ظu!t F Fu~hu)}t@󥋅 󥋅 w0NӉWVSQ 100 t 0#8tU@DNL!Ή!؉HT t0@8] C t`d E x@1҉(0P @RPRPhS聡Sh<#hl h`#^YHE p p^X=000tp0PCSp0$=00tCCpPh%XZPh#{Y^=80tfPh "`^_=00tCSCS RPh#6 =00tC(C|1RP_iZYE E#e[^_]e[^_]UWVSS]u }s sEZYOu6f%#f=@uӦ"RVhT%fs s_=80t h#YhDz#辒ZH=80u؃00{@tjjjjsHsDs s Suf^_=00t @0@ @0 }s sԚZYe[^_]1(0e[^_]UWVu} WVuuuhͲ#fj WV膚$t uB<v Rhܲ#de^_]ÍL$qUWVSQ81yAE0EЉ tWVZY8t 1u؉}1ۉ]̋E;0E0suuޙEZY8t EU͋E90uE9001ҍMQRWuu EĉEEt0Eȋ19]E s 9sjV}TYXu!Rh#dXZ1E؉ESEpW:Eȋ 9s@t EpXXEt0x0uuԘEY[ 0EƉׁ\TtAЋU!ASA RPh0]500}=0t =0t =0t50u50, EЁxU tU tuh#|cXZ=0th0誗 0_EЍxU uEЋp\ơ01RPuu EH 0ELHh R50蓱5050'=0t0PP膾[^50pf0E%Y=t =t)=@EE@E0p8 Eh0舖 0uuà =00VQAEЉUԋUЋEԉщSpCtZ Ef1{XEPYiEUC S$C0S4C(S,0HT t1CS CSV譟C(Yu EEaf1҉SdEPhE\CC C0HT t1;CS  ChX00=@0tE }̈GE؋U܍eY[^_]aUWVSX0E01RPu ug EEƉׁ\TtCЋU!CQC RPh0豒500}=0t =0t =0t50u50耾 ExU t U tuh@#__X1EU1E EU EURP=Y^=00t@ECECX@pECtECdz EEPS8XZ=00t @0@ @0 u u袓^_}tjjjjuuuu. 00}ExU uEp\ơ01RPu uQ  E@ 0EL@h R505050蕗=0t0PPY[50a0h0A 0XZe[^_]ÍL$qUWVSQ0AQEUA Eċ=0GPE00E}t%f%ƋCS0}E#f%ƋCS 0}E}1҉ft1uމU!U؋U!U܉9E؉}ыu}M t 9|N}tFTFD1҉ zuRP襏}ĉ0@0 E1uȉE1Ẽ9Ή|m+u}̉EUE9ƉU|6+u}EEEUEEE9ƉM}E,E#uuhb#0[EȋỦEUEE؃}t DT1҉ uRP貎à uuuu EU00EԋKMЍEPuuWVo u}}MtT 1҉  c 0q0RP,à MqEĉ0@0eY[^_]aÍL$qUWVSQH900E̅tGWGW EU50F0E}tE1ɉMԋGWEUEE1EԋGhE1҉UNPEU t1҉E؉Uܸ ]9ظ]|bEƅu1%0X0EU=00t`M؃ωT@‹E؃T ؙ]UE؋U܃EUċE9EEċu]Ћu)]uċEԋ]Í E؉UM܋E9EEċu|G]؋u)]uċMЋEȋEԋ]eЉE؉UM܋E9EEċu}E,E#uuh}#ZXEЋUԉE؉UEEȍp}t/B uvEE̅u"EȋTT tډ1G0X0EU=00t# uUDXuRPpẼ uuuu E؉U܋ 00ME̋pEPuuuu' ËEUEUċMtTP :1҉ ueEƅ0@0 EUEU=00tM̋IىTŰRE@ `uũf 0q0RPzẼ 1Mu h#V0@0EU=00tGWEUuGWGW ESGheY[^_]aUMPhڳ#h-UjAUWVSSƉ׉uEPQaU 9t:tWVhL#jWe[^_]UWVS É580PUXZ=\0t=80t hc#VXVScc^_t u=80u1hm#YV[0=80u60Ph#GV7UZYt h#2VXh#'VX=0t8=80t h״#UX=<0t h#UXh#U_=80u h<#U^v(=80u hZ#U[0=80u h{#UYe7=80u h#UZ9=0t=80u h#`UXQR0 $( @8 $(RP50505050hڵ#T0@Di($ʉ1WVRP jj RPQ RPk(dd$WVRP RP ($h#@=\000+00 000 50NF)ڋ~,f,00Ӌ~4DӋF8׉֋ $(+ 00 00 t/SQhF# RPh2# =\09z=0t4h[#0Xtssh# j X=0t4h#o0Xtssh#T j gX1=0=0=0= 0tm0jY04h 50505050脋=0t0PP[^50U0Y=0t1҉(0jX1ۡt00;Z,sDtPEXCPE1t0X=0t =0th#Q(0X= 0 =80u h#zQ_=0t h#fQ^UP0PhJC%Y[u70t-1҉,j,R PhJC%h%ct=80u h4#PXg e[^_]UWVS ]s{{@u(EUE9E;s WVE܃ WVh0#s sD00EU00 E9U}Xs sh@#/P =80thZ#_Ehf#{^u1ۉ(0j jC EE}n}uPE1ɉM؋EԋU0r800jWV tEWVh3#s s00EU00 E9M}s sho#j :Zu#1ɉ (0h#Nhf#z[^px0u001҉ 0 09t9zu9rt9yu9qt0C0S4MEEe[^_]Ƀ=0tf‰Ã=0tÃ=0tUWRP謆Y_}UWVSDRPle00t&uff%GW$Off%GW KftGj`h0GpPm urjh0Pm uNuJG G@j0hh0G(Pm u+j h0GXPlm u uhtkh#LhDz#xHu=*^_=00t @0@ @0 R1ۉ(0 00 0t04A09؉rEA09؉r#f@u;9ظ=\0 h#)=80fh͸#owYHu|XZ=000@4t GWGW f0H0ASQRP y%=\0 RPhܸ#O 00f`t f uf=L0:9hl0G(RKd1RPS50xt h#H=\0t1Sh#MPG(P=00t 1GG1Gh/0(00x_ș9rL=0t;9ظs)(t G Gtht)t 9ظ Dž1~V@tʋ롋 00 9ظC tNDp Dttރ=\0u0D(PSh/#j|(볋DpTtRPShU#5 0119Ћ}{AtRP C뷋ORPh#$ t uC~8|X=\0euDXPh}#^_AWpq[200GfBf[j a1Yu01ɉ (0h#Ehf#q[Zu-jjPH00f@u> ЃW0  B=00=L0tzGf@t`r@GpufGGhtGtSfGyXZ G=f@u10000FV =00tGFDG FHGXGpFDGtFHGd F@VW[X=00=,0t =D0G\uG`Wd uGhWl tlhǹ#Ch#ou 1ɉ (021G\G`GdGhGl f!0XZ=,0ub0X4 ؙN0ʋF4f0F0V4=00LGWF 0W\tF@I0D11 0 G\<#8ts@DYL!É!ÉIT tA8F D`Td uDžFVVV[tbGhd19u 9RPh#mA=80t hA# Yh#7mZ_XF0=00tV4CSCh~@jjv4v0vHvD whN#@hDz#lH ZY=00t @0@ @0 4e[^_]UWVS0E1ۋ 0;Y,EUu\TtA!A1EUAEUEU11tAu}׋E9ƉU}=E1EEU0CBHLY4DEUE9ƉU}:E1EEU0븍U1E 1ɉ 0 0 0 0M0];X,}|1Eu| 0EXZ\Tu]e.Qҋ}!Q1E]]UuI SQh0p500}=0t =0t =0t50u50P =00tE@x 01҉EU=0t60p,kEd1<SVuPhg#h-10=80=<0ExU t1U u E#uh#=_XExU uۋ}G\M]ȋ} }tyt<҉UEyEEt0ËEsM]1EUH뫋u!Ƌ}! uEU9]u9MuډM]EEt0ËE} u 1s<}%?}u}9t uuu'xYuuh#;j:1xM󪋅xC|UEUpt|}9r WV/XZ Mt9uɋp9u|]50=0|U000M]11 19E}eu5t09|]s1-h1l|]+hlȉ uv.t0]1t_}}9u}9to<%?u9tSQh#:j追M]Wx:+Y[M]u Wuh#9MEsE)lj1VEi10e[^_]UWVSEP@EUE@ E}juu# t0t`}9xuPu9puHEuuh3#Ep p{ 0qyEpxu}qy 090u 0u덋=098tEUMK؍e[^_]UWVSTU1EE 00111E0x,9}=0t2kEd1E7uWuPh#h-1=01ɉM0M;9ظVSXZts]u0=00tGuEG.GptEGtEGEGtEVSlZY8tEPWZYuEHEe[^_]UEU @,+B,]Ƀ=0tf‰Ã=0tÃ=0tUWRP4pY_}UWVS EX8=00t 1Q=L0tt1;00slj}1RPk@C^_DžE@4} G0.3ChH%PZY'Mqy u9tXY_8u6950|_ssدFXZC SCS u950|)js s]Ah7#,#h]#%O 3ss訦1ƅs{Dž, ^_=00tBBBpBtVR`ZYu h^#["_PsstQDž ss輥VPtVf@Y[5050~VfHXZ:e[^_]UWVS(EP@EU졬0E0RVuu EEmƉׁ\TtCЋU!CQC RPh0S500}=0t =0t =0t50u50 ExU t U tuh# XZ1ɉME@ Eܾ}juu |EE1E؋UԋMUM0EMB0Åt4}9{u}9{tPHSK0POX#E}tlExU t}G`ǡ0RPuu ӉE1EЋE̋Uǃ00Ex@t+jj0@4 ؙRPEpHpDp pa 0Ez89x t0}t*E@$ EL@ EUMM}ttto0E{89x u^E@EL@jRPEpp K` tPuSYdh 5050:m5050W=0t0PP-zXZ50"0h0zR 0e[^_]Ã=0tUWVS\U1E 1u0X,9] =0t/kEd1VSuPh#h-1ۉ00u1EE1ɉMt0MU;9WVWVQEu} 00tCECECXCpECtECd EEP$|&EXftbWVYZt=\0WVhѾ#!WV^YZt!=\0WVh#I SEP襛XZ0Ѕ9xu39pu.JZHX0RejhY#EPLjhY#$tC CC Cu jh##jh/#EP躴`WVPh7#E?Ee[^_]UWVS00|jj'P1󪋅h_X=T0xX$=80uh[#*G^uhr#)[=80t؋1ɉ$P0h 5050i5050+T=0t0PPvXZ50t0XHXI$~6=#9)U#~$tl<hNjH`ltW,Ћ9G0sVh#$^_n=80tVh#Y[h#EZC=80uՋB,t|Fl$1~H`F|@ltË#XLS50 |^_u h̿#|0P0h 5050HU jhPPH U CdBdPPHH8<8<@D@D0404shRS; e[^_]USEU =00u&xLU E[][]X9ZX 9Z X9ZX9ZX,9Z,X09Z0X49Z4X89Z8XH9ZHu{XL9ZLusXP9ZPukXT9ZTucX`9Z`u[Xd9ZduSXh9ZhuKXt9ZtuCXx9Zxu;9u-9u9u\19\[]UWVSE`0}&Ɖh WP5050#&u+0E苀\1#E1p0RPuuP Ɖh RP5050%tSEU}u0E苀\Uu}u#v=0t^=80th#=i0t h#j3 0=uh# =uh#>"Zu"h#'[=0t h#)Y=0t0PPQXZh 5050D =0t5050QY[0\8 u,0ǃ\T1\T00uSChEZ5#= V p0΋p0ѡp0ƉϋKdC4p0RPWV胡 000 =`0TC,HEƉ׋Eǁ\TtC!C1uCRPh@0'=T0=0t\0PP^PY[0ph5\050'C =0t505\0&PXZ 0\8 u ǁ\T5\0Q50u tc=\0uO#EKh#踢=00shX9s΋9tRP+0Ph#zh050*0 H0[^ D0t[h 50500B5050,=0t0PP#OZY50 0`0X%0e[^_]UWVS]u %00$0xPSY_yr0PSh#f=40t(jS 0_ZyTA0hPSh#5%= tSh]"whf#p u1=i0t 0=80t"h#/_jSp 0ZYySh"#~1ɉ 080  0u Sh4#~XZ1 00000010`0H0L01X0h h 0h hǣ0h h\0h h0  ʅ ʅˆt h;#VS诐Y_¡40t"ujV& _ZyVh"|#^0=40u%RRjPVM8@tl0p0t:`0 80 40PDPj50S7@u Sh`#Y^Tu Sh`#h%tV譏_Zt%h#V蜏ZYtVSh# `LuSh#C\uSh#+50V4uSh#uSh7#f^_uSh^#܍X1‰11p~u 1ۉp0}Tu%HSQRP DžTӃ~ ƅtBtѥPD1D1É1P1RPWV耚 OډSWRP] h#Z1ۅ~;srPƉρ}Tt!1׋ t1`01t ;r5Ch#h#h#h#h%#h>#h_#z5`0hr#@^_=KÅt0\Tu [t1ۡ0! 0=80tth#[u h#YY0 h P50:;5050%=0t0PP-HXZ500_1ۃ=\0t0Ph#xY^0=0uNtJt2= 0#=80t6$Ph#XZ=80u h#X08<00C,01=0C0k NKt鉅 ׉ ЉNj׉   =00=T00=T0x=80t h>#^hc#[01҉XǀP1ɉh P5095050#=0t0PPE^_500[=005=80t h#Yh#ZX0PP #0ǂL1XǂP1\h0RC h 505085050"$=0t0PPD[^500Y0 tyPh#hDz# Hu^0  h P50y75050 "=0t0PPlDXZ50V0_0vuh#gh#`[^Hu\01ɉh P5065050!=0t0PPCXZ500X0@_X50?0`0^0(=00tx<Ph.#JY[=00ăx0(=80uh#ZHuqho#輐_=80th 505005050$=0t0PP=[^50m0`0Y 08<qH։9u9RPhW#q0BHЉ8< =80uh#. ZHuqho#X=80th 5050/5050K=0t0PP<_X500`0^ 0@DqL։9u9RPh|#0BLЉ@D =80uh#U [Huqho# Y=80th 5050.5050r=0t0PP;XZ500`0_@0=000PH҉8<PL҉@D15@00=T00=T0?,=80t h#i[h#I YL00ǀ, 04ǀ(<PH҉8<PL҉@Dh P50-5050=0t0PP|:XZ50f0`0X=00OL9=80t h#lXh#L _P00ǃLǃPǃT\ǃX`B,F$1҅~K`F@#CLh S503,5050=0t0PP&9[^500`0Y =`0tv0=`0uhh P50+5050X=0t0PP8XZ0ph505\0+h@050 50Sh‰L^_u Sh+#1׉1ɉ509)~09~NjLWF8HLNd t1RPS50 t>t Dž)hS#hf#^Zu1ۉ(0j^=0tHWSS6 0WA8HLId t1RPS50 =0t WSS6 0@0 0011ShY£0XYu Shk#1׉^,jSot0_ZuSh#}=0 00 ȉڃ9 sA0001ɉ 0 0jPã0j500…ˆt0Ph#"ShN0_Zu!Sh#[^1(0jZ7&0 <0=40u*t!h#PyZYu 0 p0>hSP5050ƃ 0000=LBALt[=0h#h#Y_jjjjjS6:=0fGW69fG0CJtejPh##k =80uh#BZu9hA#X=80tC=0fGW8fG0_fCff=v]hX#Y=80uhv#Zu8h#芆X=80tfC=0fGWZ8fG0_fCffuih#Y=80uh#lZuDho# _=80tjjjjjS8=0fGW7fG0f{f9}zD3<:uƃu}EEUEURP5l0u uʈ l09ul0E ;}|vp0EUtJ9tFRPؙUEЉEe]EUSQRPN| RPh(#\RPh#\ Fyj [Xe[^_]UWVS}u EUEUEEp0ؙMʋEeEUMuuuVW 9Eu 0UM"wh6#[X19]~KؙEURP5p0VW. p09tؙEURPh#[ p0E e[^_]Ze[^_]UWVSQƉӋJt,B=p0b#9u5!#s sRhm#C 1҉Sss ssV01E1ۋ09)؋r09~ƋL߃=0t VWWj) 0VEA8HLId t1RPW50=0t VWW) 0X0Ede[^_]UEU z t]]UWVS]0Hdu } t109{ u9st7S500uWVs50Cs{ ECe[^_]UVS0500t+NdEU  t19S u9CtCt[0uh#uu uS$SPC00X0K؍e[^]UWVLU1u} uĉ}ȋEER艪Xe^_]US]U tuwtttoPh#9{@uRs s8 RhW$XZ=80th#zYh#Zu 1]UWVE500x=0t50p50 * e^_]0ÍL$qUWVSQQ90 0s RPh#H5t0 01ۍ}WSQRP(p U Ƹ8i-;sAeY[^_]aUWVS\]u EUEUEUEU uEU3E3U u uE JC%)uu1_Z=0u <vuE "]e[^_]<0U1EEƃE9Eu E9EEUEUEUEUEUEUEUE, ]uuMURPZSh)lj$SWwG/ 9raEUEUE Et@EUEUE E"RPMURPcZC1ɉ 01҉010E EtF?N)Eu ]e[^_]UWVS]\TUH} FE 8uh`r} XE u h#h`SPj =\0t h$#`w_L=01@J =0uE PP1$Y^E \=0uPP#XZ1fEfffE@9uރ=0tE PP#_XE \Ǎ=0tE PPy#Y^ C0\C 04C$8<C(@DHLǃ 1҉ Lu(ǃPǃ1e[^_]UEU \T 0H   Lu5PPQ\R\P UWVS}u=L01(00y 0h0P^_=%0=`0=80t h^#v[h|#VY=80u׋0 p0=00ux șRQ]q 00h S50050S2=0t SS XZ50000Xh05050觸h05050茸01t-0t%FS50{s]SWϡ09t )Ph##1=0=0=(00=80t h#^h#[u 1ɉ (0=(00ƀ1҉PTXh P501050S=0t SS(^_50000r[=80u h#qY=H0tsh#q,0h 5050050S4=0t SSXZ50000_=D0tqh#Qq15,0h 5050'050S=0t SSY[50000hZ=\0t"0 0kdPQSh9#N/50v X0Ee[^_]u e[^_]ÍL$qUWVSQ(E11҃}50~8]9 00)ӉMЉ]ԡ0E1҉])؉EȉE9‰؋]1EEЉEEM]KE9t*EȉEËE]̃rAMEEE؉U܁\TtFЋ}!FEU܋0QF EURPh0500=0t =0t =0t50S50 {U tU tuh#XZ=0EUؿEЋEU 0{U tEC`؋Uu؍  0EU9Uuu50=00MLU9P8u+KIjH`URSPU)S$) )Q h 5050 050So=0t SS^_500h0  0EY[E]9]yV11ҍeY[^_]aUWVSu x0!Ut 9rt8R}t-jXu hY#s1rBЍe[^_]USM x0#AUY9u ЋR9uX[]USEU 01!t4^Fu(9u 9t331 É[]UWVSu} ]9WV+ZYWVqZY00t9ZtjSP0 0M]XM ]$HX 0t}9xtju5|0e0 0UMHU M$PH e[^_]ÅtUWVS E uV8}&<}EEH89~kًEuC&E4&ߋE9x8|EU!9u(EU|EUqU߉eMMG빃 [^_]US] EUR`t(t7uS /u<<+  !8]RhX}&hu#UU ME@`t+tDuTɃu:< %ЃPhH}&hu#oUSE MUR`t't6u?Ƀu)3  Rh8}&hu#]USE MUR`t't2uAɃ)u+5 Rh(}&hu#舺]UWVSu E$ %EFlU(EFhUEEM}}~ ExE$E8NpU9r UùupE9} Etуu EFB܉)EX؋})EyEؙ}ǍW?ك9M}tu :JI)ˍD}9~} UEU~E U+EU~E U+EUE$E~CUuI[^_]UWVSu]tV; _uVh"j `1ɉPhd@u G tGRhedAu J @u!Ve8tuh؅"XZ6B<1CB(CB,C B0CB4CJ8KCB@C BBC$BDC(h`$ ƹ ߋSh"V% CPhC"V C Ph"V CPh"V CPh'"V CC,$C,Ph:"VϬ C0PhO"V tPG X}!uhzd@u 6I @RhedAu I @uuh^"j@ 41}󫍅Pu^_@4ȋ99t(Ћ}1ۉ1E1ɉ [Eƀ*P~j PEP81e[^_]UWVS4}jhPjWtGjPjVWV?i u$U ʋMQ؍e[^_]UWVSu] 1PVZY1ɉ%= j/VC_ZxrPRV)Ph#h0W?jP ‹ 19}e WPSZY u$PVZYyA =@uu_auÉ1ɉ PS`[Xuk%=@u/h#h0V>VÉD= jof XZy.hh Hf à 1҉PS!>ZYt-Sf Y 1ۉ 9u 9t0PS6_Zq8T8PRPS3 s>PhFSD yL_8S.f Y h#j$WT=jjW$e Ãy}tWMZt8PhF|@S^D y&hF SLD^_P袥tP荥Y}}Wt9PY袌XZtP:Xiutoߋu0P_t PYt>ZxSd 룅t"X؍e[^_]Ƀ=0tf‰Ã=0tÍL$qUWVSQ0EЋAEqy AEĠz0Eס0X0]؉E܍EPuuWV4U UMUȉM̉E9މEsMp1Mȋ])jj`SQW ǡ0U4ڃr h#迯_W!ʈEċxlEHXx0!9tPRPh#u0u< =80t ho#^^h#2[u 1ɉ (01!EPT@P}ЉWE1҉PPPTeY[^_]aÃ=0tUWRP|Y_}UWVS EԉUMQƉ׋] 0H0ș9Ή}EE5EPWVuP0;B0u Exth#tX0@0RPWV2Y UBEuWVPuU tUB EPE܉UM9E9u9t/MC E܋UM9Mt}u ƉaE9t }tcM܋EPEEPT@PƉ׋]E9u1 ce[^_]UWVS,E @XEȍ]ܹ1juȋEp ޅtPEp[_E P@#EԉU؋VẺUЋE P<@8N^ }9}u}9}u9u9tQSQuuRPuuuȋE0h#ˬ,=80t ho#g[Yh#Zu 1(01)V] CSFV sC8S<e[^_]UWVSPhjjFƉRP/ÃfC9EPjjSN0;B0u UztWV2K_X50u  z0QrRP3 E@ `0M ȐȔh P50T$5050[^=0t0PPEZY50/0Xe[^_]UWVSE XChSlEEUE EE=00tP@P @ƉuOEXuh>#1҉(0YX500@0RPWVqS E@ `ChSlEUE Eu h_#蛩0H0ș9M}sE E>EPuuunL0;B0u Exth#PX0@0RPuuP UBEPT@PChSls}EgUBXEU}GWEU G8W<5x0#uTGPWTEUTE@ U B 9t`1e[^_]UWVS8]tE"d# E*$_#z00}}{rT 9RPYXJ0ws$$&1҉Ut4Vh#=80h#}WXt4Vh#賨=80Fh#KWYRt4h#kj+t4+XZf%f=tC0ڔڐVPh#5=80h#VXEPjjQJ=0;G0u Ext+Crt4ljE G0E1ɉ ‰L_XP=0%JXF^9t(ߔߐVhB#蒧E`QB9uРz08BufJEf9uwhDz#@_uS hDz#/Yu(hDz#Zu1(0}t0ؔؐ,F_X01ɉؐؔ0{rT uDVh`#ʦXZ=80t h#gU^h#YsS50,XZ0t4*EEPjjujH0Z09u Extuhr#1jl)@E܋E=00tP@P @u4puSQRPM EPzƣ0X1}9}~h0X01uE)ù`1j@@P]_X1U9} MȉыU @ۍzEE܍HhhKr EPUEk[^1E9E~+u܍LphKr EPUEatuhlpx1RhK#hf#躼 th0#輐0 ǀdƀah P5015050=0t0PP$^_500[1111 0!PRWVjh0hg#hf#ZYh0#0 ǀdh P50i5050=0t0PP\_X50F^01ۡ0dJatP PhK#hf# h#01ۉdƀah P505050&=0t0PPZY50oX0 Rh#g؍e[^_]Ujh&P UWVS] 1LPTX\`DH&d󥍵dh#uS!z < @VhW$htQDhdv$v tQh#W>,jVjhdv$v W 6lQPl/SklX1e[^_]UWVS ƉUMjQRPtuh#V_XfUt+tuuh?#VSk^111 tuB t@uمtr} }uWuRJtjjh[#V~jjhf#VjSjjjjjV pfuuhy#V~uuh#VjSjjjuuV,E E܋E E EWOM1ۉ]G uuuh#V ~#1ۉESPuuRRh#V EԊWуt=t8juj1RPEUEURPVi u[]PB2EUE UM ]}uSQuщ‰ @tE9 SiX렍e[^_]UWVSu} hjreY[u)Vh#|XZÉEEU(,E$E U$0418%jhSPVJuhVSۂh#Sb<RP;ZY@uh#B$D%=u?$Phd@h @uh#S&^_$uh&#M, ((Phd@ @uh=#뭋, (hS#S딋Eu ǃ$$, (uO1҉MRQWV  ‹MtQhi#SVc! (,u(,EU싋$1҉MRQuu Ɖ׸9ЋM|RVh#StRVQuuh#SWVS @tEjjEP11ɉ @t_jjjSEtHt*jSZYt`@ P$@ t^9sVu jRPS@u7tP& Xh#SSf 1 $ ؍e[^_]USQ]teƒBBuCu'EPhd@ @u%h#SXZuSh #S E]& ]US]jSYZuhO#jS YZuh|#SXZ11;FN|#~$u~,u;FF |F1҅8tZu"[tuY8{&CV$9t N~19};{; N~ 19};{ ;KHEPu+_ZNjF,uVЉ||t2@|jmURj$O8QJUR|P tijWR詍 uYjuWUu!@uuZYjuPUu@v0shJ#us[1e[^_]UWVS]u}SZuBjWPS@tjW p S@tϋE p0hZ#S 1e[^_]ÍL$qUWVSQ qyAQEUy uhd#S{ZY8$E܉E1EuuWV  tuWVhx#SBHEPuuuu Ɖ׋EU tuuuh#뷋]9ً]}eY[^_]aUWVSu 1ۉ^h-%5 p77. _X1td1SщU&M YZMtUBuSh#u} &&  Vh-%j- XZ똉e[^_]US1&&uh#w`u܋]UWVS ]} Wh5!#SXx 1&&E؋E!ЋM#M t:5!#;tf3#UWPSxW&SxUҋE!U!E`uE Et;uuh#juV{5!#;tf3#WPSxWVSx؍e[^_]UWVS]} tEU E U uh#S_X S^u E@P;E sPu h%#S؋E pVSZYEtu hD#S 먋EЉE܋EЉE؋E#G0EE#G4EEU E UG0W4S(_@fVSZYM#H0MM#H4Mu} u }p0x4S^@+u h`#Sn Ee[^_]USP] ;u:j EP5 p7 U:u1҅u5 p7hO"u Ћ]UEUitstau+u PJ uPZYUg@Rh#P UE ft*u 5 p74ZYt5 p7h#uA US] ;u#5 p7艛Y1҅uh#u%XZЋ]USEU MitWat&bt?L,RP@st?ttMr:~h#PY[E1eRP6 $RPn[ZR@8Zfu%S5 p73ZYQh#P\ ֋]UWVSu }jj h5!#WVj]S~ yEWVuh#H}t Sh1$4ZYj LXe[^_]UWVSQ]M tu ET"EF"Qh #S'M $jUXZM uWh$#S 9jVQjjuuS U 1ɅuWhC#SKVY‰ȍe[^_]ÍL$qUWVSQ AQEUA E܋AEjSA_Zth^#2jS,Y^ujjjjSbEUE Eu h#SXZEE$EƋEUuE9Ƌ}s 11҅tEUEU9E}| EUSZxt h#PP @9E}}EU u h#'EUjjjS@ $uSY_u h#jPjuujjS9 uVXh#SZ p EFI FPARTFF \PFVEUF V$UMHV(N,EU+EUEЉUԃF0V4F8PS1_Z@)QFHVL}$E$9EsE܉FPFTy 1;VPsUWS1ZY@UB߃}uujSu@jp juuuuS u h&#a @ r $󤋃 H PAQPA Q$PAHQLEUeY[^_]aUVSĀ]E 9-tE &1҉Ue[^],(hM#)$hX#$1RP,(  RPhi# h{#qjSm uh#XXrX CRPh#2s,s(h#s4s0h#$C8Ph#hxVi-Vh#sPh# 1e[^]UU E$E8E U]UWVSVEUFV E܉UEUEUEUE9E EM|vuah#WE UEUEԉU؋E9EEM}6u&uuuu uuuuh#W(1FM]3M 3] t?uuuE Uà h`#WEXZ맋M܋]3M3] ut.u}t#uuuuu h(#WEFE F E$F$ku}tR#}w+M&#}w M&#w &RQhD#Wx1ɉNE C E$C$E;Eu6E;E u.FCstX^EUEUV#E9Eu2E9Eu*FCstX^E܋U+EUFV vE U+EURPEU }PH SK UMUMUMNU܋M+UMVN VPC^sXPtB؍e[^_]ÍL$qUWVSQ@EAQE؉U܋A QEUqy19WVuu  t/E؋UWVRP щΉE؉UMWVuu?  t/EUWVRP щΉEUMEEċE܋] ؉EE] ؉E}EăxfPEЉUԸ]9ظ]A}tE9E؋E8E؋U^9uEE؋U܉EU}TWVuui EUE Et6EЋUEȉUWVRP? Mȋ])Ӊȉ+EUԉEUEċP @+EUEȉŨ}tE9EȋE̋]9uȋE|E] u?9}EEPWVuu ÉыU Ut%ΉщEȉUM EUEȉUjjjuuȋEЋUEURPuEă Eċ@Eu1EċEčeY[^_]aÍL$qUWVSQ ȋ]yIX P@EUw Uyhq# %uh#urXZ~th#O_ ȉFV E؉U܋E Eu.E؋U܉GW FGFtxM؋]\MЉ]uuuuu M؋])ӉM]MЋ]9]u 9M9ME}uuSQh#uEUGW )ډVFV )ډFV uFGFtxM]SQM؉]uu  ‹M؋]t&M]uuSQM] M])ӋGW EUE9؋UO_ t~tfȉWE؉UjEU)ډM]RPE؋U M]uh`#u+GxpF)^N^ 9MEu h#~t h#FV E؉U܉ȉ+EUEUE9E؋E܋U} h:#E؋U+EUEUFV ȉ+GW VE Eu FGtxM]dM]O_ ˉȉڍeY[^_]aUU Et 9Pt@]UE]UEt ‹@u]UWVSEtf1yAQ $T$D$T$ D$9E E\$ |I11҃yuEԍe[^_]UWVS@]u }(,EUEh#WV43 t(qtsu&jsEPjjS@uvE95-thd&j[^uujjjSlEЉUԃ}u}t.EЋUԃEUE Euuuh#SE$1RP,( Ɖ׃u؉}܋}9ЋU}uuuuh#SjSEZYtE̋EЋ@E Et h#fEЋ@ EjS^_u hO#?jSzZYu h#!x G EG$EjSG jS9 tu h #S^XPH UMċM9Mu"M9Mu}u h##SY[1p GPGT<9s/jh&V|e tV(F,9ŰM}ỦEȃ͋u}+u}9űE|uuhH#4E؋U+EU9E̋M| hy#U9UEUиM}9|E 9ȋU|&}tE؋U܉EUh#SXZE9E؋E܋M u}uU4}u h#SYX UMH0xh#S{XZ1}9}[uujSD@1jp juuEU+EURPS uh#S @ r $󤋃p PF V$1FPF0V4j\VFS H PAQPA Q$PƉ׃q0y4AHQLS@.Eu}U؋Eh#S_X}ffuS7Y^@,h##À}|h#SXZje[^_]UWVS]1uuuuu11hA#uu . btENtoat%itClh%Y1EPS &EPSEPSZY@kq`1;EE}=S0UU܋UUZt&xuPtM9Hu M9uU@օtE 9-uEU t thx&jZYWVRPuSe[^_]UWVS EЋu} jj h5!#RPj]Si yEWVuh#3}t Sh1$ZYj 7Xe[^_]UWVStƉPZt 9St[Rh#V *{ Rh#$1s3щ¸#$1s sщ¸S#WhW$hV (Wh#htS SVDuhh%V=M SVh#"GPh#hS Sh#$jmSj$G8P7Shl#h#G0W4 uh#X1RPhP?Pލe[^_]Ë @-Q@-y ;P-| t8-J 8-Uh8-PXZUWVS֋U} $&E#` u>h#X ׋󫋃V6h#XE#e[^_]h#X8Sh#htS Sh#ush#E#E+#뚋A t h#CXh9#8C SX1ۉ019u 9tCuEC#!#t5!#PPhI% hZ#_tjmWj$8Sɽ1tttSh#Shd#hWWh#=ZY?h#/Xu+u"E#VE Eh#e[^_]e[^_]UWVSxh&% ht#hN#x ht#hz#xà Džp#Džp#s3x pVs sx p9 Ct Ph#K Cs31 W{ WhW$hPD Wh#htV*VPuhh%PH Ph#xXZ{ h0h#hVVh#LVh#A h##4jj h5!#x$K x$cRPjV x$K x$cRPhZE" "jmVj$G8PVhK#hw#G0W4 uWh#{X[tVh#QGPh#hVVhW$-ZYgRPhPPh$"K Cs31 OC tYC 8P)s t󫋆Rh#hVVh#x1e[^_]UWVS}] u1EEEEh#VS$ t^l`~\a wT$&ut:xuCMÃM뽃M뷍EPW EPW6ZY@uM딃M9-th&j^_xjWZYu h#X]t UI;]E}1WUM^t xupt9Hu 9uu@܋Ut4h&% ht#%hN# ht#hz#W+ƃ E#EE#v6 uv v u  FtMPh#XZ N Fv6U vXZp h&"BY볉؍e[^_]UWVSD] 1}󫾐&}E#uh#uu ]" tditHTt*PLt7olt Pwb&h%Y1tukVS_Z@ut6PEPSB @u#tjh&VCV t E 9-th&jZYVhJ EPS&e[^_]UWVu }^_]UWVS]u 1ɉMMMMMhe#uV_! tfitLat%bt0lh%/Y1txEPS~thEPStXEPS"_Z@uG1;EE}1SM}Zt xuPt9xu 9uU@܅t95-th&jeZYuujjuSe[^_]USЋQfPfQfPQPQ P 1Ҋ\ \ Bu[]USÉIQHQH QH QH QH QH QHQHQHQ0h#RSC]UWVSEUPUfPfUP Uf@fEExstExl]uq>1ۍujVk &WS uu wu(A uRCu1jSk &VS u%u vu@ uًU EGue[^_]UWVS}]t?u 1TEPEPEPEPEPEPEPEPEPEPSh#W0j 4 uEyƒt XtPh}#W t,D0Ph&"WE ,D0Ph#W$ ,D0Ph&#W g,D0Ph3#W F,D0Phϻ%W %,D0PhB#W ,D0PhK#W ,D0PhV#W^ ,D0Phc#Wv ,D0Phq#WU ,|u/(~ǁA,$*,D0Ph#W ,D0Ph#W 8 ,fǀUjjj訲Bu@uh?#SC$,h ;$u ^u&H$,ȍt  _Y4t 1󫍽@Whϻ%V: tuh#SjR@ZYu(Wh#V tˍEP@ZYt@h#S hEPh&%V tEPh`$V mEPhP"V SWhn$Vt tj$EP@B sV觴ZYu+C xu"mt s sFYXj 蜠Zu+Xe[^_]UWVSE @80ƅ77Ph"u t 7uCu X0u: ^t h_#0p jVhp(4 Ttg81ƅ9h(@󥍅8Ph#jPS{0Ph#jPuVz{ VSh#jq S3[t hN$j T˅t_S zuR(,WsZY,u1(zu%B sV]ZYu+C xu"t s s>YXj RZuXe[^_]UWVS@J9sr[^_]UWVS]u)ZuPe8E_@u h&hb#u0^uh&hQ#j sP3s WshX$urt t.P EhB$uUt E tZu EYLEPhԍ#u }Chs@Pu @qh#us XZt V~ Yh#us XZt Q` XMEPhԍ#u7 E Mu {hE EEEM؍CU`EPu u @Muh&h#fEftft5fu6t2C t Wh#j3 }tC(Uh #C0ut3h)#j t C0sHtS4KL9sщ}t:s@shu话 us@s`u蚝 @u;4n81t/sl`}t$CU[s@s`ud @uEsd6CptSuZY@u s\h?#s8sXu, @u s\hW$te[^_]UWVSPuo Zu1iu q _tQV[ Yt=Wdu EWu .r MuS2 VC [^PQSNr uV( ZSo X؍e[^_]UPEPh/B$u ƒ 1tEUWVSu\Ph#V t\Mfnj4Zu\VXtd$1jRVAVhiS@tt}f1RPh#u  1e[^_]US]uu S? @t ]]1]UWVSu unp [^u LP~ Y9Es/?V~ Ƌ}M)1Ze[^_]UWVSu up [^u Pl~ Y;Erȵ?Vv~ Ƌ}M)1Ze[^_]UEPhi"u ƒ EurUWVS8uEPhF#V uh%h&hhO#h#V8o _ZtP} ƹ}[E]ShiV5}ĉjS{ Ph#u o ƃ S` Yt=EUu؅yكۉM]! EjEP{ XZuVh#u 7o V He[^_]UWVS1Rhiu4 @t|j7RPh#hSހ>tVh#Vdt j7RPh#hSU;tSh#ђS'\ e[^_]UWVS]h#Sm Y^tVP | Zth#h&jVhO#V| ƍUܹRhiS3@u h#j e[^_]UWh%1󫍅hPhiR3 t|}UWVS\PhF#u uh%h8&h0hM#VdShiu13 tW\`tyƉރ߉\`! ftShiu2 @؍e[^_]UVSuVvZtÍEPhTF$VV uh%h&hhM#莫uS1^Xu h#j CPSx ZYu h&h#Ph#u Ol uh&h#j S1e[^]UVSSu] EPSV @uhP&h#j h#V@k ZYuhZ%hP&hhM#Ī#EuB$PRSk He[^]UVSSu] EPSV @uh&h#j Eu h#j h#Vj ZYuhZ%h&hhM#7Ph#S7k He[^]UWVS}h$Wcj [^uAPx pY@vh#VZu h#jf VPh$W@u h #j xtdPhiWp0 th$#뮉`S8X`e[^_]UWVS}h\#Wi ZYu|rPx pVdYXuh1#DVSh\#WE@u hF#jk 1҉Uu]EPhiW/ @u h_#jj SX1e[^_]UVSÉЉʉƃ ι\#u5!#QuRPShl#e[^]UWVSu1jS,Vhxi P豓@uhx# UЉUPvXۋUu h#j U]Vhxi Wk @uh#ڋE9E~E1}~ WhW$BFXZ;u} j QYj GSj蛃UVSPuVZt"ÍEPu V @u Sh#j" @PNUWVS$ƉUЉhr#Pg [ZtPAv ƹY1@]Shvi V.j Sbt Phr#u h à Vѐ HZe[^_]UWVS0]EPh#Ss uh%hD&hfhM#諦MԋU ;@uE̋UЋM]Mĉ]ȅy+كۉM̉]Ѓ]!ىΉЋU!Љ E UȉƉ׉u}j EPs XZtVhr#u -g V He[^_]UVSuV[thX$VAf ZYuhZ%h`&hhM#ťPt ^fx PS+ZYu h#jE PhX1e[^]US]EPh#S u 讫&juS,ƒ 1Buh(&hW$5XZ]Uh#薬1US]dPhT%S uh%h&hhM#d|lPhiS+ @u h&#X1]US]dPhW%S5 uh%h&hhM#md|lPhiS>+ @u h4#8X1]U1EEpPhiu+ t h$#j 1Uh#uHd ZYuhZ%h&hhM#̣Ph#u d HɃ0 v+BwBÍBwBUԩ]UWU1ERhiuG* @u h_#j 1}W|$wUWSÉЄtGjj h5!#QPj]S蓩 S z5!#t\#PSh?#K h"¸f3#Xe[_]g_UWVS蕧` uh&hW#jA jLhr-0s_Z5!#tK#jmhr-sZY¸Q#u5!#WPShr#h-C=ho-t VW?Xjmhr-rZY¸Q#u5!#SSSSSPSh#h-$V֋ j}UEU P]UEU P]UEU P]UEU P]UE1҉To-To-1]UE1҉\o-\o-1]UE1҉do-do-1]UE1҉lo-lo-1]UE1҉Pto-to-1]US]Shr-qYZt W=CЃ v؃߃Av 5hr-袘Z>u r-1]UE1҃t0]UUpo-t H9t@]UWVS81ۉ]܉]E䀖500EЉ]ԍEPj/LZY@MЋ]u h#EU׉uȉ}̋}50ɚ;EEtJ*EUʚ;EEt$ӃMЉ]ԉ11EȉẺEЉEԍEP[@tEЋU ЉEhN$j' uGEċ@C t@PYEąt݋@EtCt}tMEU9u2U9u+9u}SEZtjEP Y[=0u4]늋U9ыUjSZjujzEPjJZY@UE]9u]9u9}~ 9UȋU}h{"j UWVSÉHPZtP_D 1D1V9"LY@u hl&hb#&RPHSƃ uhl&h#j R1RPh#hWWVh:#9 jVWtWhiL@u WhG#t PhX#XZjVW*Wh~iLȈ@tt Phc#豂Y_j ɁpHZ@uhl&hk# u =`o-j:RPhy#hW?tWh#8W莔| j:hy#hWv?tWh#WH| tHSW?YXjVW Dž@WhiL蕇uh#肁XZjS#jVTW趸Džd1hlWhiL< @t|hXu h2#l@1dWhiL @@u hL#@lhd#̀@R) =?0t%oA"w&Rhr#蒀Y_HS XZ=?0u0=>0u'DjHSDP jV`V臷V>0-{k?PL@u$=>0t#Pj? hj%#0%X thn$f3#X thA"f3#oX th#f3#MX tRPh#H hj%#0j_ thn$f3#^ thA"f3#Y th#f3#Zj }5Xo-X%SV65po-tjHSVv e[^_]UWVS]S^t EPu S @u Wh#jm u V SV Y V Etuht&h#j EPʩEZt hN$j u1EVtRUW赐ZYU}tRUu薐ZYURh/B$SG tFE=0tFtj=0tFu[=0tFtL=0uE=A0u+Hu)}tj 8|Xh8-vtZY U6"=A0tj |XSR uJ u芯jHsUWVS,ÉUP(^uhU#@h$SW ZYucU̹ Rh8i(S @uM8t h$j jh$u2 uh&h$jw Eܣ00u Vh$j. e[^_]UVS։PVSPh$j UWVS]U h-$SV ^_uhV%h&h2h7$K‹0ށ؃E u %ERUd NjURe WP!tDPEV{ZYUu #9ERE ËE É0X1e[^_]UVSP]U Chx$SU ZYu ЛWPWd Swd VP0!Ãt7EPS50裥ƣ0S1Fu9#U0e[^]UVSP]U h$S`U ZYuhV%h&hh7$Pc Sc VP Ãt7EPS50ƣ0Sx1Fu9#U0e[^]UWVSS]U hS$ST ^_uhV%ht&hh7$EƋ0%EV c V*c WPƃt1PuZYu$EM É01e[^_]US]U hEPh$S^ uh%hd&hh7$薓 0%˃ uˁEU ى 01]Uh-h$XZUWVS]hS$SS ^_u3h$SoS ZYu"hx$S^S ^_uh-$SMS ZYtP0 00!‰0d$1󫉕tVh7iS @u h$jB e[^_]US] uPPhW$wE tP͠Yt Ph$wXZEPYtPSh %w -%܋Et Ph$wXZ]UWVSuV[u hU#/VYu1P4Z@u hT&hb#p 81jS8P]8Ph8i(4|@`%1󫍅`PhiVT @uhT&h$j tWph$vX &Ht#t8uP9u Q|XVh$^vXuSh"$o_XjP>Y^u h 5"jc \8Ph8i(4| @uh$H Ph6$uh:(%HH9Tt$h\$uh:(%Tj)tj tP4Z,H%(h$au &_1ҋ0t`&xtO(9u 09t4#HɋL f3#u5!#QPh %t ,딅u h%t^j sYjmZti 119X~M%9u>uW远PhB$t hX$tha$4j sF뫃 u]e[^_]e[^_]UWVSӉϋuu+L 05L Zt2tVWPO u3x 1ɉ [u1Vjx ZVax Ĕ Xe[^_]UVSu]}t 蜔jb NPڋE XZY@uEC s1C1e[^]UWVSu]Et,DžpVRpRtWjP6uBpW [ Y_u  ܋NPڋE Z@tʋEC sF C1e[^_]UWVSW]EtJs$URP}Ɖ׉‰ 9иr E8tn8"uo_;sC| C 9s} >"WV Y^u $ 볋K(PUE Z@tE}G _C G1e[^_]UWSËtPrv X1e[_]UWVSÉUMU1}E;E t[ztMUj8^t`NjUx4uup4x u}x xuup1ɉK(C(E81 S$uS$S(PXC$ue[^_]UWVS1@}u -E@} uE@ } u"PRK [^uPRK ZYu덅LPhi"E 0 tu 112L 17 uu_tHh-%HPR`H,ZYu Dž,%E@0tj/S&Y_0t @0`1DžTXDž\@PTP,Sv^ǃu.@xuP0 jkTtHu@xPS0YZHu.fDžtt0u_SXDž,uTtt,1҃0u$SqZDž,T(j DP0,D (t8t,v ,vq"SX%Dž,(SX(jDž,10dr<wWr<w7 0 u0 Ј0E޹Eވ0 A$(P{_,fCNj ֋$B$@tPX^(S8T S LEHVUE [@2Ex0$,S ZYu,Sh,&h$j @PVS V% uh,&h#j SEpE07G uSo h,&h#j So XE}G }xG }G1e[^_]UWVSu]}t W}Zv W% Yu #NPڋE Z@tEC sF C1e[^_]UWVSU1EX1u܉u؅Cu3}Ej1ɋUE ?E1҉Pupup Y\uu}Wu Pu4EAujn }uE$EXExtHu E؋Exu[}t1}t.EъĊ}ue[^_]UWVSQu}u蒊EX$Cu S{0u3PE 0sD YZun?-uGPRUa|YZUu{(WRL|YZuA{ Cu CuHPE 0 D YZtPE 0D YZu^ډCwH$&PW -w70 w7n XZ1u(7 _uCPh$j ȋK 11PE 2Z@tEF EFC4FCF14 Ue[^_]Ujj$>ZYt$P&U PUPUP UPUPUjjZYtH&U PUPUP UPUWVSu] FtVuVVPX1;}t$jXt0TQ1҉FNG1 VuVVPXFue[^_]UVSuj(jMY[t2@&EC1҉SCCuu SB @u SxX1C؍e[^]UVSj,jY[tDÉ8&E CEC1҉S$C$C(uuuMU @u SX1e[^]UWVSPu]1҉U1+Ei̋M ;}|1_t79r:GM 4WSuVuEsG]15t1jWSuVus]+Mi̋U; r+]i̋UU:e[^_]UWVSP]11;}tCSRuSt,Uu 3u PU҉EVj EtG븍e[^_]UExu@RtE]1]UEP 1tRZ@US]C$u 1ɉK$[Ps S: @uCuu PzZ@u1]US]C u 1ɉK [$(KSs Ps @u܃C4uu P!Z@u1]UVS]u j[Zt$pSuCCC]e[^]e[^]UWVSh$u$? h $u? tÅu'j`h&h$B]ۄ VM S{M Y[@8Fth$^F1󫍅Nv󤍝tJvr󤀽uCU9 t hM$j{ |t uh\$jP jS PhJiu @t1 hx$Xe[^_]Uh-h$aXZUWVS, =@0 ƅƅF1RhKiu3 @PXujP Y_VjWhQRPY!qpujPb XZpVjRhVpQP!h%Wt$,h%RtZY,2 $tRVRSPh$ae[^_]UjhIiup @u h$j 1US]Dt-9t@tu0@50賈 X ujjS0 u Dt-Dt-]UWVS ]UUEt ;0uK-f|JxuEuE} tˆUPu KZYUtC}t:=-‰EHffUtSUBf<fuh$E9r^h)$ E9rh $|YX1_EtE -WtU0 -fW ƒF-C+UE9~)1E؍e[^_]UWVS]u ~;0uS-f|PxtN=-119} fLOu0t ,@t@ޅtt SVh:$SPhȉ"__ %h87$P_Y19};Ph1":_GXZe[^_]UWVS ] uع1}t}u*U UܸM؊MMمx9s1LuÍKكt :M؍AMPsZtfP׋Me[^_]UWVSQUU} uj[Uuhf#RZu hU#jv jPV{ u} ]e[^_]dUWl$1E|Ru ul}UWVS,E u:[u h&hQ#j6Y@uh&hb#j P[Z@u h&hJ$ݍF1jR\ s-p^_C xyDž@Rhib @uh&hY$QZYq:u]S @0PjjhVPRu+t"a%tA$VPh"O\ Xe[^_]UWVSu FPZu|8+u1h~%j4 \`%1juS t \vSh iRa @uy|81to|8/thp$Xpe[^_]UEU =A0uRP*ZYE E$H[UVS] t4sVu*nZYtC P;UuPVZYft1e[^]Uh-h$VXZUWVSSÉ։M1S>_u}uJh$j jh$P; uW-DPtVh:iSf @؍e[^_]UVS]u1ɉh@uhL&h$jz EPh$Sk uz)EfEVh9iSƒ 1Bu h$j+ e[^]UVS ]u1ɉ@uh@&hb#j EPh$S t,juV E؀8t-EPh$S uNz)EfEVh9iS=ƒ 1Bu h$j| e[^]UUE9@t-EMfuu $tURPh$X ËPt<$$Pt2)$P;$Pt/$Pt "ø6$ËtI')$t?6$t2$$;$t/$t "øD$UWVSljӉʋuFEE9s]19tc  ^w@v|USh87$W K 1UvAE9s:2UFPh1")ȉMP#M UuRW u9utD7...}e[^_]i1e[^_]UVS ]uVhiS @u hL$j EPh\$Sֻ uh%h&hhf$qE߉EVhiS uEh$XE1e[^]UWVS$]uӹ!1j EPhH%S?uh&h$j EVhiS @u h$j 1e[^_]UVS ]EPh$S諽 uh%h&hhf$puVhiS @uhL$E؉EVhiS @u h$jK 1e[^]UWVSxhSh $u@uhԤ&h$j DžDžDžDžDžSh$ _Zu?Dž1ɉDžDžDžDžjSh$ u ؉8 -DytRx:uL҃0jWVh-%Pt;9u8tMh$j jRVjPdƒu;u;t 1҉Ŕ@|Phi8uƒ 1Bu h/$jW e[^_]UVS0]juVh $Sо@u hȤ&h?$VI Zu VhR$j Uf@fEލEPhiS4 @u hf$j 1e[^]Uh-hv$XZUWVS] 1}EPh8i(S @t&E1r r%1ʹ|󫍕[!RhiS @[< v Ph% $j hO $R[P\P <fDžLVhiS @t%fNthV $=?0t h` $TRXfDžLVhiS @t%fNthi $=?0t hs $RXfDžL VhiS @t0Nf=) Ph~ $Q_X=?0t h $QYfDžLIVhiS9 @t0Nf=) Ph $QXZ=?0t h $~QX1|󫍅|Phi8S @t}u(j jP$PhiS@)_h $QEEEEĉEEEԉEEEEE|Phi8S^@uh#PXr}uMu u uuBEH~HE-DJtx:t~&jPh$D uWh $bP^_Eyh$JPY111Pt՘hXZGj,=ODYyh$PXh $OY4t8h $OXZ h#OXj N_PhiS= @PhiS! @jh&PJ u ftePh $_O[^Vf"fP Ph $*O ft Ph $OZYj 'NXe[^_]U81EE1҉UUUUUUUUEPhi8uF @u h/$j 1UWU1Rhiu @u hf$j 1}UVS]EPh $S[ uh%h(&hNhf$huVhiS @u h $jR 1e[^]UWVSÉUPhW$MSE`Ǹ) 6 9|jLXe[^_]UWVSƍt1fDžfDžRhiV y h $j h' 1p)֍H(@!P }_9p}p' Džp h $h<%h $h $hx $hp$h6 $pph $gL(G(\G!PO(!W Y0t 0E0tI@tc@tC@tP@ tS@@tB@yA@_GlGdw19~L9}B`fWGu uw%k pfx p@tp d#z= tt= w-g [=wOf?v'k 11?1p%1=$v-- 1p-1ƍG P h0Sld`VPPpph $JG"`G!\ƃ0`*w/wNtA2FltU0W=?0FQSPh5 $h; $IQl=?0= $ $=?0$YdPhW$IXZi"d9 ʃl5!#yJ$lRPh"TIC-%빀=?0FPFPFPhQ $hZ $IF1d^1ɉll9d&j>H[S=?0FFPhD $WKStRTRPhd $HRPhn $H l대=?0FPhu $jHXZlF=Ptlbh $hW$+HY[=?0FPh $ HFPh $G^ fdV\ $t5X\PQh %G\K zm"XdˉX\lT\l $XtWl $Pt $Pt$$Pt"PQh %GlX zm"렊dزT<\t=PuEFu:h $hW$FXZ=?0%FPFPh $F t#=?0l $h $hW$_FY[=?0FPh $AFXZ1D dD ҃L ll\5!#lt# $dRP\Q4@&h $ECuh $hW$E[X=?0FPh $EFPh $E^V l\l $Xt5dlPQh %@ElK zm"dNjXfld\ Td\ $tR\ $t $t$$t"PQh %D\K zm"lXkT؃dPh $^DZYkl=?0.N=?0'$ &( $} $ts $ti[6 $`; $YF $RQ $K[ $Dc $=k $6s $/} $( $! $ $ $ 1 $ $F)`j B)hXh'e[^_]UWVS Eԉ։ˍUع1fuf]1ɉMRhiu uEh $蒽XE1e[^_]UPEPh $ug uh%h&hhf$T]ME\UPEPhj $u uh%h &hhf$ ]MEUVSjjj" y h $ɼ\1ɺxBhPS]h y h+ $萼ZuufiuSGi Xe[^]UpPhiu< ulh: $.Xl$Eu hN $j藵 EE1UPEPh $u' uh%h4&hAhf$[MIE@u hx $jY 1UPEPhQ%uΧ uh%hP&h4hf$x[M E@u h $j 11 w-USE UUXt=EEEE1҃UjURPA` 뺋]UE Puj蕬艬 US]SYPh $j} S_H0PH0~ UuUE Puj6*jq} UE Puj Ã=L0tMUEE EjjEPEPjEPƒEBuh $XÃUSPh jhh&e jSe uSh< $6jPfZ@uShN $j^]UWVSd@u~Q1}=L0tC&;Et7EE jEPjjjV@uuShx $O 1ۉ]]]]]E}W]SjZ^VSjQ^ Ãjh $DZYu $ $1uuuujEPjc E!"1}jh $hv# EPh$` h$h $ju{ jf]u6hD$r[jjj>e jWj]jVj]_1ɉ w-jEPj e uZ^8tihs$Z+U9uU,Rh$jWj)]jVj] yp Ѓu,t$h$BjSc = w-k = w-tjWj\jVj\ w-SӃ  LEEEEEPa Xe[^_]UVS]E pt&I>v <]![^]USQjj]Sjjh w-qth "uT0Zu h 5"j8 jjSPjh w-3u‹EP0]US>[Phd$h-D?h-h$ShV$h-%? j2UE E ]wNUWVSE u}8@D$ 1%$1D$D$ 1 %1ۋ$T$ L$ 1 ډ9t&(  9\$ t̩& &11ҍe[^_]UWVSE u}us8@D$%T$ T$ Љ$$1҉9t&/ $ 9L$t̩& &11Y[[^_]UWVSSE }uJ8p0 Љ$$1҉9t ]& $09tu̩& E&11Y[^_]UWVSE u}uG8@D$T$ Љ$$1҉9t& $9L$t̩& &11Y[[^_]UWVSSE }uK8p% ‰$$1҉9t ]& $9tu̩& E&11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]& $9tu̩& E&11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]& $9tu̩& E&11Y[^_]UWVS UM EuT9|$y|$T$ ʉ1щ9L$t&9T$̩&uwy|$y|$L$ ˋL$ ˉ$4$19t&9L$tb$$9T$tv$ &11 [^_]Uhs jjh@w-u.1҅tPUWVS jEP Eu_X1E9}2uSPIZYt!SPIZY tG1EEe[^_]UVSQË0tRVh$EPpVER{nZe[^]UWVSQ1:nuzouPMnX1҉Uh-%P2l ZYt98nuxouSP蠡ZYu}SP莡ZYuE1V,Ee[^_]U(UPPPh$h-.9j,UWVSÉϋu ,PQ ZYu WhL$1}uHt*hOw"VZY41yG"Uu1u4hJC%,PG^_u)w"~u M}jP讇 ZYt1ih@$DjhZ$W uU jZP,P t% 9|X 뭋QRS u=00u1-ha$Wj Vhq$3Et!#Etu#EtyG"Et6#%\&u0P,Pb* ZY@tjj@9l^_,t#jhZ$S uh$V\,Y[0>w"tSh$ShgL$hVq10 ,Dž@h-%,P{"XZ9 PWkXZڄtVB L<-u.1j=VIY^t$S@Q#S4Q ,t1ɉL=00t>}uh$1_11=40u卅$P Y@u@h#X3=40u"4h%91GXZ9j L0X}ut t6ht"葫X t TXPG=40tj}t0$%X jX j( @u h$%_w-,W3h)%h,R"/P,Râ 5Q8tV,Rh#Ϊ ;u Q8uWVWh$謪jO t f[PYY}u, Ex]('W jj M WS$U ~)t}u2h8-,PܘXZj P$U ~j,PV @u hH#輩X,Ѓu ƀt&mttP'PVho"2(D} =000SV% Y_@uVh$JXZ e[^_]UWVSj Ph$S.;11to`&tZd&t =00t>h&F\$tf3#QPh %- !ǃ 끍W\#\$tf3#WPRh$-udtj\$tf3#Ph $j-u t 0hW$ h#?-XZ=00KtSp+F=00u=00KtSp\$tf3#QRPh$,=00hf3#hW$,sds`sTsPh)$,slshs\sXhE$,0=00~chSjjhOw"ju.t%j S^_tShd$4, h$%/NY'"t#PhW$ ,XZ 5!#He[^_]US] 1t-tPu>ZYu801=80]UWVSEt48nuxou 80PX1uhǾ"X1Y,u@B uP6_uh 5"֥S訒[^ljxj,SkZYt X1e[^_]U}JPh{$h-.jq!UWVS]!11tE1҉p7-111ɉplh$u u 0r=dS6EXZEE FEe[^_]UVSSPPVu ujVSh%蚫 ,@uL0Ftv"t"F0AZv"tv"PShw"j jUVS]u VS? YZu Sh`w"j ;/t"Shuw"XZu Ew"e[^]e[^]U!DPh$h-)(jUWVS]E1ɉ#11d111lhh|$u u豃 HuLf$M,9tQG.C|g$&UC| C|C|C|5 p7 CpZDžlL5 p7CtXDžh.5 p7CxX5 p7Xjuh`&5 p7Qu hv"jh PPX5 p7`XDždC|-P;Ut0ttSxt SxߋM |u4^uWUEhtFlt#uuxPW菵Y^@uRWhy$j蠖 xPWpYZ@tECp'xPWVYZ@tǃluECpECtuE%CxdupV谜V @$XZK|ǃe[^_]UWVS SVdPhWu u hWdSh% ,@uSVhx"j谕 f@tKRPhܰ&hSgSh$ !0jUSP]jEPS U :9uySu hx"j ]US]ScZt@ h"SZY]US]SqhZt@ h*$SsZY]USP]jEPSvU 9t :uy Shx"jb ]UVS]u VS YZu Sh`w"jc ;/t"Shuw"SXZu Ew"e[^]<e[^]Uh$j UV?h$h$h$hK$h{$Ph$h-E# j.UVSQÉj EPS螝 U:uVSh$j荓 e[^]UWVSuEE@t"@0 1VFe[^_]PQ_u hǾ"jd VP ZYuj]e[^_]jUWVSQ]E10u1w-h)$u u.~ 2F$&=0t0뷃=0u0c뛁K뒺a p7C8K t 0hK\cPD p7jC@K@2K&g p7@P s4K I p7C(KK@KEPuh&5 p7qKƃu hv"j踑 Et 0tctKtK@tK t=00 s=0t0c@tKt1҉,x-sc sKsC  sC sh"VQI0Y_Eth8%V9IC$KXZEth$VIC KY_Eth$VIC$KXZEth$VHC ƒ Jujuu s( ]UVSu {81҉uuuVu~C90u7VJu/^˅t)v 680/80ShL&h~$@e[^]UEH؋U PEf]UU otzȉEEȉEE1EjxPjEPjjhuA w/70轂Ph@&ho"z7HxUWVS]u uu uQ fMA1CCS1CC0@0ȉC1҉SCE ȉCЋEȉCԋEȉC؍~E$PWhٗ E$&1t<16 1Ƀ 1Ƀ 1ɅtuRh~"j_u 1ɋuЋ} t1M "8"t$M tM9uM9t Suh"맋E9ƉU}7=0tuuWVSuh9" uuWVSuh9"?9u؋E}<=0tuuWVSuhi"uuWVSuhi"jt e[^_]g_UVS= 0tPhF$h- hz$Ph$h-h-h"ziXZ= 0@&ttsha#h-o jS=0u UPAUWV=Lx-uHH׉=0t&ɉ HffJ=Lx-u f@ffB^_]UWVSƉ˃= 0t/=0t 1}mQ00Pu# Pס0RPSu5(0* 9t 0jPWVh%$j"Te[^_]ÅtUWRP蚪Y_}Ã=0UWVSSƉˋ 0= 0tSu 0Qu S׉ș։ЉEMRPSu5$0) 9t 0@jPWVh&$(j$e[^_]Ã=02W|$wUWVS#Å=T0uP0BB400T0 0 ;0 0ؙ=P0;|*9T0_1)։ؙ540pؙQ Y`&JtRz!9t !9t ҋ1҉ؙ=0Q 3Xe[^_]g_W|$wUWVS,EU؉M܋ P0A Id t1580)X=0t805P0PPV 80xU th-&$^{X80H xU t@\M؋]ȋM؃=0t805P0PP P0A Id t1580P0L0JH,1X9M؋}ruuhD&$ P0\E1ҍMQRPuu lj֋EUEȉŰϋEЉUMԁ}Tt.CЉ‰!!SʉEUԋCx1RPuu K` t1Ɖ׋Cu}ԋKd t1uЉ}ԋK0540P0_\T40@xRPuu@ Ã=0tKSuY^1}|(}؉ʉT(@ uE@XȉCXE@\EȉC\E@`ȉC` ߋu?]%ClRPuu Ã=0t]Su,XZ1EtttptY_DpTtF u1ELY_Fu @ߋu\%CPP0H0540EЋUpXe[^_]g_UWVSQEӃ=01}=Lx-tBBfCUC)f UZ[^_]USÉЃt't7uFɃu0 ='Shn&$h- ]W|$wUWVSLEUȋ P0A Id t1580yY=0t805P0PP 80xU th-&$1҉U؉U܃xh&$_1E؉EP0X`u؋}܉ tu}}zU tStX~KM< ɅP0@8EU܋80J9M؋E܃|R`뮅tGt%b 4!Ή8뗍 ?!8u{!8hvSh&$h- Nt% tSt1\uWEah&$Í Í ? # Sh&$h- P0$~?80EE1uԋEЋUEUClM 80EHP0L0EHesE@E=Lx-nKdu؋} t1RPWV }WTU u}WT }U P}t}}}GXE1}EEċKdu؋} t1RPWV MQuuRP EыEȉEEeƉϋMUeuuRPK Eȋ}EЉEeЉƉϋRPWV }f E9C0u'=0805P0PP K4EDS8)‹}W S8)‰ }W$D4Ɖu}܋80 P09A8~zU tR`˃]1ɉMM]ʋ]؍ @뛋 P0A Id t1580$XE؋U܍e[^_]g_W|$wUWVS։ˋ@1 0=Lx-t@fxfDžAxҘ ‰|fDž y-=Lx-t{-P0@40u 1ۉ,P0@DJL!ȉ!؉ pZ4JdQyt@f fDžA ė ‰P(,iKL04H8'$oY[P00B0 0J4PtPhq'$:_XZP0@4PtPh'$9^_P0@409}RPh'$ P0@0=hPh'$ P0@0=~hPh($ P0B0R49}RPhJ($i 0P0s0;0|Pu 9\\=0ș9|{XCX=0~ Qh($Y[P0PX~~$X0ډPHp4ډPLS8<V@D1҃~BPP1Ƀ~AHTP81Ƀ~AH`~$ؙPSVh($RwP0C4=01ɺtA t@9uKd0 0 t8<=Lx- Ph($jZ 9sRPh($ P0ǁ\Tǁ 1A0QtAx1AA8A$1A@AD<A4=0A|ǁǁ1҉XǁLǁP-ǃ\Tǃ1C0StCx5P0~4F8H GډSWRP> ӋRPSQ ȉN8ؙ)ˉ^ <~Ntn0؋ËቅkF0 HËË048<k9}VRPh0)$V{ 0P0@x<8@)׋@8tD11U0ӉʋKT t1҉ u1RPWV  uDž1WV7 9؉s(WV ȋƉϹ19s11ۉB,$1~ ȋʃƉ׋˃1ɉ1׉11ۃ~hH` tσ1 1Ӌ@0)H11ҋ)׉ߋ1RPWV 1Ɖ׋ȋʋRPWV~ 9sv Dž19s H11WVRP KRPk ȃȻ)щWVRP F 041~ H`9))HRPSQm 1ɉ ؋Fȃ1~H`F9}Sh[)$"G P0C`Cx1CC8<Hщ)9~)׉8<C,B,$1Ʌ~ @SL!Љ=Lx-(C|HL!ЉjjjhjC4Pj£L0uj'P0H41P0H<0L0H0H4 ډD0)ʉ@0@`#PL ~ PhHx-P<0PX0P\01҉PTX Hfǀƀ>P0%ƃC4D8<KC,ș)׋C)ȋ1)׉C8HK` tƉ׋Й)׉!lj!׉11ҋ!~ ) 1҃1)׉@D04=Lx->C s(H10t ǃ^F=0s0Kd t1RP߭ڍ%VV$hy)$ P0 ؙy8PۅI4`%WW$q,h)$ P0A0= @ 00,0= 0u\Tu kУ,0jjjhj5,0j螙£40u009,0uh)$ j& ,01=0L0 09|RPh *$ 0 0540 0&[t?t  Lș)FOu뺸2=0t?jj50S$=0STb 0uPؙVpjV uؙ=0VY40P0Xlj=0t PRXZP0x40\=0~ h!*$I XDž=0~ P0A,XÉƉ׋ǁ\TtA!A1׋AId t1RPh#jjifF-ftRhht@P DžPu ft0=0tu1'1=P01w,1P0;x, h8-L P01҉牅8[9<}Ƌ\TuAЋ!AAA)uky4D1ҁTtYӃY19Ћ|hM*$ (_P01=8080CU C )C5P0$~N`Cp=Lx-u*{tFx9sCxNfKxF,H9u fSCf{CTCXȉC\OK`ȃ~:=0uCh|{lN`Cd9sh*$3 %P[80P0P t+)lj1ɉ1xU u@\€ 80H xU u@\€ 80H ?xU u@`¡P0@`P0$~%80Bl580FP0=Lx-~!{8809rKd1VT~U uVT~U t PFXƋP1~FKd1111f3P0@8P!tx 80)D4)Љ809s?zU tR`ك 280B$C1ҋ9r)P0H`艅 P080BY89&zU tR`A`P0$~%80Bl580FP0=Lx-Kd1VT~U uVT~U t PFXƋP1~FKd1111f{89rNP0580$.Nh񉍸Flx1Dž1҉)D480;xsxU t@` 80@$벋!ʉt:@t@;Npr1tɋ$9~‹GDž붅t$9~‹H0BH0;D0u^=0t@0s4PP <0@<0P0Z4Jd15@0@0H0P0H41[P0Z0 } 40؋580=0t5P040P5804 P0X0540ދvxx P0\t4TuY/%FlG/%CPO붡4000𙋝ڋÉƉ߁TtAЋ!A1׋AId t1P0Y\Tt=0]s8,0){0ƉK`Cx1񉅰69s)9s40.%Cl뀡40,09rߋ P0A01q8𙋝ڋÉƉ߁\TtAЋ!A1׋A׋1Id t1(Z~==0j.X܋ P0𙋝ڋËƉ߁\TtAЋ!A1׋A׋Id t1:(%u5!#WVRh*$9]=0DP0P,t,=0t h"X1j X1b~j X=0tjtx|m_u= 0th*$v5P004=Lx-0FF4+=_w h*$j; 40X󥋅`1=0tR5P0蘾[^40=0t ǃ\8 5P0x\0RP SMY=0tL0P0r4PP蔽 P0X4HdLH t15L0@0Z;H0sE=0tP0r4PP8 <0@<0P0Z4Jd15@0X5,0540YP0@4P5L0nYeY[^_]aÃUWVSu]tV=; _uVh"j9 `1ɉPhd@u I) tGRhedAu  @u!X8tuh؅"?XZ6B<1CB(CB,C B0CB4CJ8KCB@C BBC$BDC(h`$ ƹ ߋSh"V', CPhC"V. C Ph"V. CPh"V- CPh'"V- CC,$C,Ph:"V- C0PhO"V- tP X}!uhzd@u 8 @RhedAu  @uuh^"jB8 41}󫍅PuV^_@4ȋ99t(Ћ}1ۉ1E1ɉ [Eƀ*Pj PEP:D 1e[^_]UWVS4}jhPjW tGjPjVWVA u$U ʋMQ؍e[^_]UVS]u VSڌ YZu Sh`w"j6 ;/t"Shuw"誻XZu Ew"e[^]铻e[^]ÅtUWRPnY_}UWVSuuuu É֋EU)jj`RP Nju 1ۃ`9}.EPl@hFVk`1EUM MAhQlCˍe[^_]UWVS]MpM1}tfF^1 :^F: 1 MKMKfCCCCC s({,C8C1ɉ P2\-h8-h-X22cXZe[^_]W|$wUWSøth`3h2$HXZ52h2$652h2$&3t Ph3$_X2t?29} h!3$[()%MMEuQQ$hD3$ș j ߘ2Z133EE2ۃH~-2]PP$u1  %RR$S2QQ$SEWW$S h-PP$ShW3$<3d2p2!]|22Ezuh%ٞzuh%=2\$=2$h3$肘e[_]g_1UjjvXZ1=2PÎU=`-u =2ujhu-2ZY92~23ueUSáT2P2xFأT2X22p%wx%r\-y1]Y]W|$wUWVS22ff222=29=2u ;22f2f2]f21Ej]Sjj53L yh3$[jh3jjh253e y3t h3$O_EjSjj53aL y h4$j h2j] [^22f23 s$ 2ɡ2ȉ 22s223}f2Bf2H24fpjh3jVP53f Ã9t:y h4$IYSVh`3h%4$h-Z1`-2% 2 32@222󥸈22 2u|22󥾬2󥺬22Av.}fE fEm]mE22%52=2 2222U u}fU fUm]mU}ЉEΉ߃ɚ;~ʚ;Eހ}2 2222H%؉ 22 22E22=ɚ;~ 22-ʚ;22rW 22 22 22222=ɚ;~ 22-ʚ;23t ;3te[^_]g_UWVS<ÉUM3tUUEčs}uyMăA}9}fE؍t E;2uJ122u5}t43u+JEPuh?4$q Ѝe[^_]W|$wUWVSEU܉M7C]3MQURuhR4$ t hp4$XWhv4$3Y_t,%E %RR$Ph~4$赑3t"uC-e[^_]g_}e[^_]g_US%=3u5!#ְSPh=$h-ݔjɇUWVSƉP% ¡D3_tEtPh>$E X39U|} Vh>$j tt-v 1{[ft )уȉCKEsf1}~CpMуt[}D;19Ue[^_]USӃ X31҅w =w"=w'=w?=w W=w F=v=w=w "tft ЃҀJȉCAʉPfPJ:u9r)@[]UVSÉ֊@<t<t,<uPsO PVh>$ SB PVh>$:BhPSjJPVh>$S^PCPVh>$h8-FXe[^]Ãt"¸%?$7t ?$tURZø?$USљRPQhS^h8-S ] @-yUh8-j $XZá8-P8- UWVSDuh8-蓂e[^_]ÉÉh$t/Exuxt VhA$ji p}Pq ju }CtCU/1}#Exux uxuxu xE@E< u2UĹ1jEPEP} ¸%EE耉E 1}EP1E1FXЀ w.XwWEXw7u\M}wRE$@&FXЀ vRXwWȉ<E9sjFXЀ w/ˉBE9rLB1}13B7뷍Xv E`W븉EE9E)ˆu}1ۉj/VnZYÅ}=L3V7 Z/EEPV Y[V7 YV@YV詮ZqP}Wp @0uD VѠ Y{ȋMUPCUe[^_]SEEPVS [Zt?EXSZC YuWEEPV( [Zt#}uσ=L3t$V6 Z@u6'V6 XuX }u MU1% X3U1EDe[^_]US-tuP返ZYtC]UPu*fxu#@PhE$hh373 Htu DP07 P5 ZU}uE ҃' hE$hC$RRhx%PPhE$  UEt#t#F$F$tPhF$E$F$Rh-G#XZUVS$&E׉Íu 9stMtJ@Sh5F$耀XZe[^]UVSU%tYE uLjjEP謫à uU1j.0xkY^ƅth3@P"YZuUuR@ ZhPh3  3e[^]UUE Pjjhh3PR> thh{%h3ok 3UVSE UMYt @ȅu˅t6t1R )˅t8u3jSZYt%u%hPh3< VShFF$hh3}mVPRhCF$hh3}DσVQPRh@F$hh3i}VSQPRh=F$hh3H} 3e[^]UWVS$u} KE 0~y111119Bt} |t 1M LtMw tLxw tHuGC@u?6ttxtu#2 @"@Ƅ9t(Bh1u "ω9)51u- uh%h3v[^vthLF$XvYEPjjhVPP; t h{%V=vXZSVhjQ%hh3k{3e[^_]UVSMQ3Q3يۊ&BZ&XÃ@.)օ~=3uC3[^]UWVS uE Eԃ=4-tL1ɉ 4-hh3$[_u(j.h3@g_Zth@Ph3 3uhh%h3 F<t^<t<udEԉE FEe[^_]!Uڹ1ˍ}fEu jEP [^uԍEPmZY6e[^_]VPFPh^F$hh3y3e[^_]US]U MC<t,<t<u/MU ]]OMU ]]U؋]!S"PCPhfF$hh3cy3]UWVS(uE MMԋ]U~u)ẺUЍ}عjuV _XUЅҋEtuu SVZY SPV }yE EW$e[^_]ztEEԉE E:]#e[^_]yEEԉEE E+"e[^_]yUWVSXEEE EEEEEEE"1EEEE1҉UjjuVjj]SLyh@$)EuhpF$k Xe[^_]P3Xu jj jjVWjSLyhF$݋EEhpF$ XE9^CU!‹M9A}tSyM9,sxEt  Cy;8-t8-PuCyPP C E1ɋEtttHP1DA uЋU؋uЅ~uE'uPsRV~uEuPjjucE#CP>hy#hy#hF$w@-H@-$yh8-j ~XZ8-P8- }e[^_]UUMzuȃ'QPuu RUU} uЃRPjjuUWVS u} EE11һF$~kMUD8-u^@PZMt$Ut:u?DX,t*DX\}uCNv t4}tEEEe[^_]UjjEPEPu u-h?uuum(US賕PhF$h-yShF$h-yShG$h-y$ShG$h-ySh2G$h-vyShMG$h-fy$Sh`G$h-SyShG$h-CyShG$h-3y$jlUVSƃ=3u[3Xi 3}u)VUPrxZYUub`VUPIxZYUu9Rhh3ƒ 3uPhW$jJ K k1e[^_]UVSƻ@-tPVwZYt%VhL$53Oh3 OC St8tPRh{L${ RhL$ {ZYuj 3h3} C33묍e[^]Uj訷X=3t%3fPftjh"P1 jh@3Rd UWVS=83543ÉDžu¿L$RWhL$53Wg53XPhPh-$y'1=T3ShL$53g-fDHfn,f?trfauH43ShL$53f (fptfqt#1҉8353hL$h Y[C1T3Sh u$53kf &SSh M$53Nfe[^_]Ã=T3tO=3tFUVS58343831ɉ 431U58343u1҉T3[^]1T3U0;3j芵Z= 3uj踆X<3t3j蝆jh37b UWVSxEUtk1ut=tu-DSt1@֋]څu$EE%@ -t -fBuӃ}tgh3s[ƋE]tC1ۊ3t8u9s&H3 CuݍHȋ])=~ E봉EE} %Uй 1]13trtl$t\uF8PuQ@@x0~-H8tWDЉ\C8tu\:u;81ɉLЋEǸ3:[tL\t$ HWыu)@,-x$uvX-DZtep0u&E@GOu)~ˍYσ ttD9])ف~mP<,<]B<\t<$uj2-DstX0u"Et@GOu)~ɍAσ ttD9t])ف~Oȋu)=ZJ ]]\tBJuztBX5-D^tS@0uU tZBGOu)~LӍJσ t4tT9t(])ف~Wы})ׁ@E8uhuP EE53hM$V EXZ‹Ee[^_]USEU t~Mã:(%@-3tRQh %P+a#Ph^# 3ZY/t!h3hM$53`13 B]R]UVS]53u93twE 03u13@-8t 9XtSh N$j @u=3th3Ph{L$Ss PhL$CsZYu353e[^]U}u蜢3]ø)N$]U}uw3]ødU%]fU}uR3]ø0N$]AU}t-h3h6N$53_ 3U}th 3hWN$53l_ 3U}tšh`3hzN$538_ 3UWVS1}uEE PPEu jHt}6hN$E PEP] uhN$E PEPB t}E pXE Pu r"3 3t!#O$tVWjVjjhRSxyS HX 3e[^_]U帥+"}u#]U}u ݖhzO$hO$hO$53HT13UWVSE]uu1҅‰uTpuCE xh+"W$ZYu u0Hh#WZYu1t/#@ u븥+"PVhO$53Se[^_]UhO$h,3u uI3U}u3=3t3E EO$] ]UhO$hL3u u3UVSE] u1=H3H3u{+"yt ash+"VZYtBh#VZYu 1H34V^shO$53R 맣D3H3노#PhP$53kR =H3t5D3h*P$53IR 53hQW$ H3Y[t1҉33e[^]Uh@P$h3u u3UhMP$h@3u u3UhcP$h3u u3=3t1H3UhpP$h83u uM3UVSE] t~ ܓ1=33u=sh+"VMZYu3h#V-ZYu139s? 3^hsh3X 333 A 33#8u-#QPRhP$53P33e[^]á3t8u53hP$? 13ZYƋ 3+"UhP$h(3u u3UhP$h3u u3UVSE] u duosh+"VZYu03T3_h#VηZYu1ɉ 03T3HVϻZy$shQ$53wO 1=0303T3t +" 1#T3PQhQ$53+O1=033e[^]UEur3Huh4Q$E PEPc tЋE phpQ$aYZu9=3uJ=3t53hEQ$q XZE phoQ$xaZYu3@31 3USUE 3u DC3Pt ]馐pYteP Z@u ShwQ$ @=@3t"h@3hQ$53M1ɉ 3 53hQ$観 XZ]]镱]UEt~3=HuhN$E PEP tӋE phQ$``ZYu 3USSEu轏3Huh&O$E PEP访 tT3h)Kj E[Xjh@3RI XYE tE ;u1ɉ T3jju 讯à uu=T3tڋtShQ$_[Zu 3E =T3u=3t83831ҋtT383tuj>XZ1ɉ T3]UEu蓎3}Ht}6hQ$E PEP uhQ$E PEPd t}E phQ$^ZYu!E phQ$^ZYu 3UWVSUU] 3E=3t583831ҋE _¡T3t@T3583ujZY1ۉT3EM9t EP蝫Xe[^_]UWVS}u <jj薗ÉXZSPk CYujjfh{#V à u$j/S _ZڅtPhRW =03t653S 3HQPY^y Pj JY^ J }~j53h"WS3  jWS3 ShMR$诽3j9~PD Z9uWj腖[^WjyZYt1 h`R$bX3e[^_]UWVSPEEu豈3%HhR$E PEP袸 EwɋE phR$X^_t 53hR$赫 Y[}hR$赔 Zu ]E XShR$XSjT1 t뙃}hR$k Xu ]E X ShR$PXS T1 t-U}u"E X ShR$XSS1 <3Ce[^_]U3}t\= 3t =@3u#׭=@3u3E ER$鍪 h@3hR$53D13 U3}t=@3u#P=@3u3E EQ$' h@3hS$536D13 UEu茆3{HuhS$E PEP耶 tӋE phWS$VYZu9=3u<=3t53h,S$莩 XZE phVS$VZYu 3UEu3{HuhS$E PEP tӋE phS$6VYZu9=3u<=3t53h^S$ XZE phS$UZYu 3UWVSu huSJ 9}1hE4S F 9~hh:(%S GShW$zUY[Hu jNZ3e[^_]UEu˄3/HuhS$E PEP迴 tu uh5!#- UEu3/HuhS$E PEPs tu uhS$ UEu33[Ht}6h#E PEP uhN$E PEP t}E pphS$NT USE3u贃323Hu hS$TYE phS$SXZ3]USE3PvW323Hu hS$SYE phS$SXZ3]USE3u323Hu hT$ZSYE ph T$GSXZ3]UE} tu覂3=<3thT$SX#U} t}uj3Ã=<3t jjXZj`Y=<3t jjuXZj2Ujjj2UWSREEu3=uE XhT$S Xu]ShR$@RSN1 e[_]UVSEu蕁0HuV$I3X]USEu y=T3u53hCV$k XZH~}~hrV$E PEP u밃=83t53h}V$" Y[j E pkT3`S3P觳 T3 u lS3`C3kPkpS3BlS3klS3-H`S3tz-y h-*Zu!53hV$(-P-< u$T3k9lS3uP{{uPKoC닡-P-8 t -yh-F*Y t@) -yh-+*Z -P-8 u53hV$T3kpS313]UWVEu ZwhHuhN$E PEPU tjE pƉXZutWVE phW$53493e^_]UEt~ vsHuhN$E PEPŦ tjE p胚EUYYBu@t)EPPJPE phW$533M;MU3UEU u9v3]Hu EW$]FBE EW$]FUS] hr"jSu`tssh#W$53`3]UWVSVEuu.HuhN$E PEP败 t݋E p[u 3zh-R$#|Yt8u "RUAÉ4$A|<$豩WURP: Wh:(%S WVS (Si 13SlVf e[^_]UWVSEt~t3HuhN$E PEPϤ th-R$\{Yt8u "S@Ǎ@$|GWS@P{ =H333EU313H333jjh#O$M qVhO$c=H3EU333(VdZe[^_]UWVS]u t s>hTW$WzZYt.h5P%WiZYth[W$WXY[t뷻v[Zt3u6hcW$R0 tT3tT35T35T3hW$R013e[^_]UWVSPU} uRUyZUuUE W$3Ee[^_]}0Ë@t PG1ɉKXW讧CZ=3ttP3hW$53>0e[^_]USEU 3t tt<]~r-t8Cu5!#PRj hW$53/jrr 13]UVSu 3}t e[^] rvxXuvhW$53t/,Ct P>1҉SY3hW$53M/13 e[^]US3}uq3<=L3u3E EW$]֔ 3hX$A3X]USEU 3Hv3q3P=T3u3E E#X$]l 3Hu hPX$nAYrhUX$^AXZ3]USMU 3Avp3Y=L3u3E E]X$] 3BuPhX$@XZrPhX$@ 3]UWVS @Eu} t-p3AHhrV$E PEP tЋ5T3} 19~j k`S3Pww t*Cu%whY$53K-3 h@h3P蠪 1ؿk`S3X 9Xr-DP@tC3<$t<\CFC -K߿DJtm1KԿK߿DJtk ߿DЋԿʋMQ9~mP3)PE 4V让 E 43߿iu6CDžؿ9}~)3)PE 4Vs E 4:ƃF;rT30oXu 53h!T$u!53h6T$s 3^X~ t=<3u 53hbT$΃=3t:53h3- 3HQPYYy Pj b.YX J j 6R蔨 T3P5T3V =,3t3~t-3HQPy;P| J Pj-XZh@Ph3& qT3ET3E 9XCؿt G9}ce[^_]USËt P&1XCt P1ɉKXCt P1CZ]USd0;3jyX=3t>EPhY$jd]S%~!3fJftPSR=K jh3^& USdjkyX=3t>|EPhY$jd]S$~!3fJftPSRJ jh3% UWVSƉӋ:j:WYZuWhZ$V蛦 :WjP|YZtj%WYZtWh!Z$VeWƌC uf{P Huf{tCPh^$V3 hy#V%XZe[^_]UWVS ERUa7ZEE0U;OwuCuRS蟨 uCEÊ u w)tu C;OvE1e[^_]UWVSË@t P̋1s_stV6Y1Ct P裋1CZe[^_]UWVSljӋu3u<MP]wEPMQSW航jEw>yFE8 u@Euh,Z$XZ,HEHwuE1e[^_]Å8UWVSH%Pt=-ufTwfUtePt^ftwftO0Euf]fۃW})߉0ufWӉ)Ӄ@YA]AXZ[^_]UWVSUu u hEZ$j贖 ljjhlZ$P_ uW1ɉK fCPjhtZ$W8 uWC fCjh{Z$W u WC _t36vCvCF C FfC (WuhZ$) Ef: j/RU ^ZEUu R腜8)ЉUHQM ƋMQURP葢 { uEuLCYj@V ZYt_{ u1҉3Mq@Pj:Epn  t@PMAYE@E@tu[uvVj]RU' YZEtH:UttWuVhZ$)PERVMV蟕u WuVhZ$tEx:u-u%p/Uj:V YZUt>t3 3ׄtK3Gpj EPV  >tU:u PvWuVhZ$]/fC*C tt53u53t5!#V軚CZ{uKC%{ tJC%P蛚CX1e[^_]USZKJy ;J| t Y RPA&XZ]UWVSP1ۉDžfDž1jhtZ$P jP^$CZY@tt8tt8uVhZ$uDž8tj;P [_Åth[$PHZYtCh[$S7Y_t>h[$S&_Zuh[$[gVShK[$Dž DžsDžVÉj@PN  t1҉3@PΘYj: ^_@P覘[H8?u1;u11ۃ/j/S^ ZY9u$uHsjhJC%SI cu)uR(31ۅ%pu'j(3u911ۃ=(3Džt*1;t%hk[$SZY11u @11ɉ>t+hk[$V_Z1ɉ=3=<3t jj_XZ=3;hPW 1 t1ɉ$31҉$3QPZ$3<3YZu u*"#Hu9d uWhr[$ u Pj衾PjrY_t ;1$j/S_Zu Jx;hhP%R輛 1ɉ 3Pj=3u/; =3h-h[$蹃 XZt>ut>uGt>t݃t3hSS hhJC%Sƛ hVS躛 $hh6O$SϚ 1 tL5831ɉ 83=3t hh3O$ hh7Y$Sq Wj$583F3uj/V6 [ZtP1ɉ=3t WjWjXZ3-1ۃcÍc؍e[^_]UWVSl<1@DžDžDžDž1048Dž1 ($ Dž1DžfDž1DžfDžE11,jh3 ZYu P^$Y[@SG^5<$!Zffu0t#;th\$S踂ZYt h\$3t$?t?u+u =3uh]$W苑Y,,3t <,j/P{ _Zt@,PEZ P2Y3 t 8uth&]$c1=3=333DžtDžx=3t0 tRPZYu33D3e]$,h*"P+^_44u ,4Pt$PY[u/tx3353=3 t14P_1҉$WVPy,Phl]$=3u=T3<T3 -,Ph]$533 33 3 u53j s[^RPh]$QhSh3c H33p8-/@dj VP 9pd8/Pdx*u,j pPRT pd83 3Gh_$`$d+tXH ׉dR%s^_Džh8HRYtx)`$dtd襁23`$dt])N$dthF`$ Xry`$d`ujh`$ ^_p@9`$d't`$dƅu `$dutPamYV̀Zt<oZu&J3 3h`$ _t 8uh`$ڡ3P3~ h a$ ^}31uQu2P7ZYu=Y63%hX63j5$;3[_Zy hf$-\^Y63=@3<<Y63<[63PZ63P_63P^63P]63P\63PhLf$Ã=<3^=@3Q1҉@3X6363=@3t fZ63$;3tP7 _jjY63P腈$;3 y"hc$3[^ @3=@3u#jXRjhP( @uhe$$X63PhX635$;3背 y%he$ZY5$;3 $;3xT3tjXPjh5$;3賕 DžhX631󫍅hPR5$;3 @he$x=t3,p3=l3 h3t$=l3=h3\tX63<u1ɉj j WhStPtP 53=03u 3WS\h1ɉ 3Dždh*"u _Z\\uu h~#K[^aDžd\fzt \@xRPZYxE%=tu h#h$53 EЋUԣ33Jjh 63 ^_B53=3 hN$uZYthN$uZY3twC\fxu \jWVP \@jWVPayu hl]$I_X+5353hg$  DžT#O$}tEuuhT%l H3T^``u"uhW$*ZY뽡T3h:h$h\&h+hJh$953s&53tP5XT353PH_53j"^l@ujj !ZYl=H3t=3t =3y D31ۡ3`fxt `P\fyt \@S53553 53- uu h14# H_XX8 33\PXY@X t0`Xz33\J뭅t[pt9533|@3#,53)^ptD3pt륋`@ @tu@o` 33<\H Xpt 3933|3 {\@ @tʸ#au h14#FXZ`@ @tjheh$pFXhjXdtd\R^1\`P1ɉ` $b[nhPjXZDžh=T3te$;3xP X$;3`t`P:^1`j[31;33}j;Y 3h@u l@u"hPjoXZ㋅lPj ]^_$;3xP& [$;3du `u)\tꋅd\RY؋`PmXP31҉3333e[^_]UWVS104D3PT3t$1=3=3L333(3$hO$uZYDDu = 3uVu=3t}t}u&E 8-u}tuhg$53 뺋E Phh$53 ɋDtE uPu 1ۉ8Dž<Dž@1=3uDHjh 63 ZYt=T3tzjXh~jNY[hj@^_<}tWE jP1[^E j/P|~ ZYT8tNJ8 tDE Phg$B[^3M E hy#P7_ZE 8|uuU JC%t,H%%E 9u jhJC%E jP^_/ jP|Y[n= 3t 8 uW@8 u"E hP _ZyE Phxh$6= 3t 뽃= 3tE PYE D3uJutYjjjXZ塄39u&ju0^_333ujPiY[=ujh 63 ,_ZDu}u-k33 tRPhg$0 ͋E8t8PuhT% Hh*"?^44uuhW$Y[ȃ}E hy#P1_ZuDž08-15353E 8|uXjj _Z@E hr"@P Y[00u E @PhMR$A15353Dž8=E uPY[00uE Ph~#@XZ#Dž80fzt 0@xRP^_@tE%=t1ۉ33T3ha$hP&h3hJh$9 53s&53tP[,YT3 53PX?Z53jX=H3t=3t =3yD3,1,3Dt@33 t/0f{t 0IjRPQg53 53 530fxt 0P4ft 4@,VSu u08 u33hh$H>^ڃD43 3#0jjjP! 11y=E Phl]$=Y[Z0Jy/0P軻Zt΃ t*;533|0H уԋ0jjjP x N33,334J4P_ td0@ @ul0 u4J4Pƺ^t, VL@L Hu ,PT9ȉ*3#153.XPTD3ډPT33띋4H 0334H PT 39533|3 {4@ @t=ʸ#a8 u33 hh$p;Y݋0@ @tE PhW4#S;XZjX8t80R^104P臷1ɉ4 $I[Lu33y3`LPhh$53 53hh$) XZ뾋D$ u=3uj6 _苅8=ju)[^X\Bu@j`SOR^_X\lp1tE SPC ZY@XP貭$J+‹E $Phh$53`jh 63< ZYt$31;33}4jX Y*hMj^_=T34PP[벋<@u @@u"hY$WZYEt ue[^_]Z2øb#= 3t9l$PhAl$53) -t$= 3t~ tPR2PS$2 SO%YE ]e[^_]鶣 QMZƒMuQWhpl$53诺KSu QWhl$ދ}u#Uj PMQ7 MMEPjUR rPj hW$53W릍e[^_]UVS3 T33$t!uItJuB3313P3-8!- u @ u3tJt 31&33 tGtBB@"u\uXu@!@B؀"@tՈButBT33:T333tHt 31313[^]US33T3T31ɉ 3T31ۉX1T3{P5T3/XZtT3@ڋ]UVS 3=3t,SP] $^Z8tPh>$53d 53$jh@h3h-*y}uB53hl$t.=3t 3Hy Pj -Y[ J 33󥡰333 3XZjPW>3333+33_X39}39=3 3sB3󥋵53= 31w~s9؋}g[WPh~o$hS~3fJftPSR jjj-jh`3˪ =3uh jjujjj =3l%_h"P艣 3Y[tPhW$hP訨x3319߭y%ݝ݅ %߭ٽf f٭۝٭y1d~dVho$)P=PNj3~-3t PvZ)Å~:ùdh5!#)Sh&Pho$)P=P萧ǃ119ʉst @u4&SQho$)P=P2+3 3+ $3y @B%ڽ߭ 3319ظw ȉ߭%s9ٽf f٭߽٭=ٽf f٭߽٭É 9ǿs tA؉ݝ4&%11d PVSho$)PP茥á339lj33)ލ 9lj݅99Ћ}ho$VQ¤à +33߭߭ٽf f٭۝٭?~~ho$rtPh"VQÃh8(%VQ à <ЙRPhp$)PPУÃuh")PP覣à 3fPftSVP eY[^_]aUSjX]á3@ `t1US3HyPYu1ZJ ƒ,uɍPv"u|@33HyP赜ZuJ"\u%3HyP肜ZuJCC3uh'p$ Y@3A33HyP4Zu ZJ, „t@Pv8\u"3HyPYu JCC3uq-=@3th@3P,ZYuC ߸ ]UWVSQƉUh@3P[_tHj.V([_1ۅt6uPZYÅu#)Wh@3V& u1ۀ@31ۉ؍e[^_]À=@?3tUWVSh*"h@?3r3^_u"G8th@?3h@p$Y[1$hSJ_ZyƅEj.S_[^pu Džp5!#1btH uuzG uҋpH3uSpEƅt1;4 3*%u_3uGE uh@3"} h@3P0ZYtE thqn$P[_tB3fPfttRPyZYx|?thPp$ hyp$w$xAE85h@3|}X 3fPfttRP[_x"|?thPp$蚙 hp$萙 E8h@3}z= 3t53PzYt u 3Hy t u53hp$JɋT3u53hCV$XkaS3`S3iS33HyPZu@J-DB@uGG9u uT3u3lS3`C3=3HyP覗YuJkPkpS3BlS3klS3`S33HyPTZuJ< u6T3k`S39lS3u@T3 {u@T3KZCh@3h+q$贗 _X3@tR[[53hGq$ XZ538Y 53hp$ۍe[^_]1US]-uhmq$S ZYuP3DB@tCjhPX$S! u T3Uhrq$Sj ZYu X38hK%SM ZYu \3h~q$S0 ZYu `3]USZKJy ;J| t Y RPXZ]UWVS3=03u 3h>V$萳^tIhq$hD;3 ZYƺ9¸} C;3.uhD;3Vhq$53Gjhq$hD;3t 5 3tjh$hD;3V uSt @3 D313j h)N$h3Y t\h3hM$53 Bt 1@31D3t*j hq$h@;3A u53hq$W ^_L3P3T3X3\3`34;3fhX$Y1u(;3t-fPftjPD 5(;3ɐ1(;3 1ɉ <313jCPZt Shr$j n0e[^]UWVS](3=T3t =<3u$u 1ۉ33Pu7=3uE33P3@1ɉ 3=3h5x3V /thhJC%V hhr$V VyVh+r$'XZ1pP =3Xأ35H331H33} t1= 3P̼Xr"EEt!jjRPPhQ$Z"ҡ3-cvt@;3} t1= 3PbX=35H33h*"V蛛3VT =3uuhPr$轐 ^Pr$53hh34 u53B1ۉ3j h3lZYu3e[^_]UVSQQMq3=03u 3=\3ut953hpr$< Phr$EYZuBj h@;3^Zuj UR@PL M te5-DN@tVu=3u=\3u1ɉ \3t=03u53h@;3 3 XZz3eY[^]UWVSQ4MY=3}=3}=03u 3=P3u}53hr$' fPhr$0^_j hD;3рZYtj.hD;3輀^_thD;3ɧYD;3uKjhr$V: u7Vhr$53̘fE;320hE;3hs$53讘E;3 1}VaZtVh%s$53} EPh=s$V3 tEEP蕆_uu 03u\]3gu=3u=P3u1ɉ P3t+=03u"53h@;3 3 XZE3E3eY[^_]UuhJs$j2h3P<u hds$j 3UWVSP}u jjfhb#jXWhs$V2 ƒu&Whs$V2 ƒ uWhs$V2 ƒ USjEe[^_]Uhh@3b ZYu@3UWVS 3533=03u 3hMv#贩_uSj h@;3Z~ZYtA8thUWS$]؍U1EEEEPSh%uy ƒ1uuw Xe[_]UWVSu] }VuSn u1N tut$tt$fN lS谜ZHˀ; uLUJ9uD -y h-褂Y-H - t@u҅tt$ff t1҉e[^_]UVSQuh3/[á3?vPht$# juht$P2Cƃ3 1҉UUR@)R3Ph-yht$uh u$53jrT319T3 U e[^]UWVSD]} S\j j VhRuWG t&hh"R j h"V 3tzW9Vt vuvvS4 @uTm8jjjhSvvzG thh"Sf /8Shu$Y[4jjSC ƃ u(PPha$h-u$PjS @uPPhZu$fDž=3~"jPA3XZuWS @e8$}uQ8A^PPh^$ >jP+‹Y_+y@Biy1fDžRjPU uY蹧8u=3~{螧8#tLVjS躭 ƒ 1BPPh "nu\< tQDžPPhhS< @u e[^_]UVS]u S?:Xȱ?v.X?v"?tH?uH ?uHɉ[]UWVSƉUʋC1ɃL Muj RP'X F 5454hq|$jP ؍e[^]UWVS ÉUE9C8uqBhzu0t'Phh@3M t Džh@3)ȋDPS4F hY[< u5454h$Ph1hn))=w(SXZDžh@3Phh@3S 5454h=$1_1ss C1C1҃u\#u~nu 44@ f4454H_1+4=4u8#uxnu 4M 1M I t44t]Ut @uKf 4-t41ɉ 4=4;G 44t1BJM pЍe[^_]U塠4@ t=4t/=4t@HyP}IYuԋJ54Pj XZ1UWVS|u=4uQ48u==4t h;$j 4-4ew$48-4("44tQHyPHZt@ J54Pmi 54h4h4腹 ÃYB4=-u 1~1PF[= 4tdh 4苞h 454 y t $ &494r4kP544XZ=4k 541L415H4{u54s( Y[ = 4uuu =L4z H4t5D4CPj V: uL4H @))ӉH4SPVG Ij5`45\4hD4;jjh"hD4j5`45\4hD4Fj5H45D4h\4\ jjh"h\4Aj5H45D4h\4) 54s H4;d-r54h'%ū XZ1@HЉ0,Ph$54E,B 90uH@)< F;5d-r54h'%O Y^54j$> 54j > 4@ @b¸:t}bP裭P54ho"j虵 4 L4u4545H4j5D4-=P4t54j <> XZjhD4g^_1ɉ L4jjh"hD4rjhD4,@=L4545H4j5D4,=P454j = XZ=L4rH4=D4BHPj W5 ƅt*P44)H4P4H8545H4jWP,=P4t54j = Y_8H44P44 L4u4545H4j5D4+=P4t54j < XZj#6494r4kP5494^_=4k 54CFPQYFG=4%=D4CH@u. 4t$P9Qs@4R54Ph$j 5H4j1ɉ@9^Z"1ɉ 04H41҉HLC0tZ4uH 9Hu;Ptj0Wh,4CP Q4pP @9u9t)HL1LH9L}jjQh,44PHσ)HLL'Hj@$YZ"L HjHWh,49Q tUAQ )HLLHj@YZ 4QNu9AuAQ 똋 D4j)ȋ54PQh,4~CP 4P @@DjH+@P@Ph,48 tD4D4P4,4P4,4t<4,4Cxt4545H4j5D4|(=P4t54j 59 XZsF uq=L4u~uhh Pb F @t"5H45D4Cp` ;H4t Cp jh"Cp` Ht1 4=414[=L4h{uhh sa C @t5H45D4s^` ;H4tshW$jw jh"s5` Hփ=\4ujjh5!#h\4o\D4D4P4\4P4\4\=L4H4Hw{5D4=p-t 14H4D49IFTu@1*jjTPkH<9Hs B@9u[0QPV 0uՋ@9s3<jp$(Ph4.<jjVh4 )H*tD4D4P44P44t$4454h$"54< $4 L4u4545H4j5D4%=P4t54j 5 [^?Cv1s  4ue[^_]U 3txt1҉P x{u@jjh5!#h\4US];] ttCtE8teXUX1:"u#C@؍e[^]USP$zYt@Uv‹EBu Shu$j6 ]UWVS Ek< -Ex19~BURE@u9 2u19)VD PRkEh4 ~1]U1҃=\k4i@f4 P1]U<du4 51]U<c4 1]U<@d4 1]U<a4 1]Ua4 1]Uu4q1]Un4e1]Un4ex1]Un4e]1]U`4 B1]Uu4 '1]Ub4 1]Ur4;r41]Udu4 1]Uc4 1]U@d4 1]Uq4 ~1]UE 1҃8i o4 Q1]UVSQ] h%uVE& jVVjjjjh2(Vi Zx9~ʉe[^]UE]2/UEN]"/UE.]/UEg]/UEb].UWVSÉQ-W-VPh$sze[^_]UEU t2t Ju6@d4 'u%du4 a4  c4 ]]UEU wS$ &n4:u4.a4 "@d4 c4  du4 ]]UEU t2t Ju9@d4 'u(du4 n4 c4 ]]UEU t;t)JuB _4/u0 @t4Ƀn4 b4]q]UEU wG$8&u4 .`4 "@d4 c4  du4 ]]UVSuU E$L&1i f`}4ZKh1$P<ZYt u h{+X e[^]je[^]US]E U $`&1Ƀ:i o4 q4 @d4 c4 xdu4 lr4`h1$hr4&<ZY;r4t=;r4t h*X):s4b4@t4Ƀ؋]{]USE h1$P;ZYudhRh5!#h /1]U{4ƀxjjP#US] {4ƀxj3P{4 )t PWXjj3P ]UE 05{4US] {4)thjjXZ9ƀxj3Pyjj35{4j35{4V(]US] {4ƀx3j35{4#]Uju NUju :Uju UVSu jVZYtV"jSPe[^]UVSu jVZYtVSP e[^]USRu ÍEPjSu ugX jjS5 ]Uu 4US]E $&1Ƀ={4iv4 l4Oy4uh1$hy48YZy4t=y4t hc'Z>z42b4&@t4Ƀ5{4aX؋]#]US]E U$&1Ƀ=\k4i@f4 >h4 w@e43k=i4_h1$h=i47YZ[i4t=[i4t h{&Z(Zj4 ~$5\k46`X؋]Q]Uh耷@t41U14jvO1U14jaOc1Uhh$h |4O E Uhh$h |4( E UhhȄ$h |4 E UhhЄ$h |4ڤ E UE.tgzEEPjjp貺 UE.tgzEEPjjo菺 UE.tgzEEPjjfl UE 0^Ph؄$jjcKUE.tgzEEPjjhB UE jUE jɨUE j诨UE j蕨bUJU ]U藬U ]U|U ]U`U ]Uj`U Uj_U U詾U ]U{4,P1RP(U{4,P@1RP(U{4,jh(U{4,jh@i(Ujjǰ1Ujj跰1Ujj觰1Ujj藰1%,Uh݄$\ Uh$[ 1Uh$[ U@1]Un4jM1U許1]Uj.1UJ21]Uq01]U+1]UVSu] h6#C Zwt @t2E0f~ufFsHPh !%h"e[^]Ee[^]#UEU ttu(n4u4 `}4]]UEU ttu(u4 `4  `}4]n]UVSE 0ڸuhX$X hX$X XZjShX$ jShX$ 1e[^]Uz4=z4uhX$iX hX$_X XZ%jhz4hX$ jhz4hX$ 1UZj4<=Zj4uhX$X hX$W XZ%jhZj4hX$9 jhZj4hX$( 1U:s4=:s4uhX$W hX$W XZ%jh:s4hX$ jh:s4hX$ 1Uh1$hy41ZYuy4dehhy4h5!#hy$1Uh1$h=i40ZYu[i4dhh[i4h5!#h+$1Uh1$hr40ZYu;r4dhh;r4h5!#h#1U5{4tZujj5{4 US] {4)thjjQXZ0ƀxj3Pjj35{4S ]UE ]UE ]UE 1҉]UE ]UWVS É։M}}} }PfуP19~Pfz fSC9uho$QuRRs-h:(%QuR6CuDSu0Kx9tF( Fat~UCuBEsQ5})CuS փ9~Of{ufKf9|A)fKsfuu)K9M|9~fs)y1fssf9u|MS9~09},CPuAERuFYXMCu9}ys(unXZ1C9uf{th$uQsCujjs'{ uC}S)Psxsse[^_]UE ]UE 1҉P]UE @]UE @]UE ]UE 1҉]UE ]UE ]UE 1҉]UE ]UE ]UE ]UE ]UE ]UE ]UE 1҉]UE ]UE 1҉]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE @] "U14jB1U14jB1U@d4 G1]Uc4 ,1]Udu4 1]Ub41]Uhv@t41Ub41]UhE@t41Uc4 1]Udu4 y1]U@d4 ^1]Udu4 C1]U@d4 (1]Uc4  1]Uu4q1]U`}41]Uu4 1]U`4 1]Un4e1]UE uU]US] {4)thjj@XZ*ƀxj3Pjj35{4]UWVS ]u t/{u)P/vP< t6vWJC 1ɉMCU9~Y}C48Zt>vPZYt/{u&MVU7MQURPGE뜍e[^_]FUS]Ct>P*uC ZtsPFs 1C sUs 1CZY]UWVSP -1AƉE1U9}HQG t5fu.O)ljPD PRRk5-7V ƃ11Et9}} < uEF5-7mhD$jj5-7 Vjj5-7 $jj5-7葘5-7r5-7Y=5-DBxsqh>tadt\<-u(=tK=tB-wH=Rt/=Su8t4+=4E9s$ X>t 4|h-j XZCnPCf.S K)y1fK)y1fCYCfEECЍP9UK fM)y1s9~fSUʋMM9EL8fKskXxufufCVt%z `~x~Ha (aS9USB CfC> =S=VYv1-DB'h-ji V^p sjC Zt sP;_XsKKYt0F t!u S_Zt Cx~fF ft\uMs4jC ^tsP;s 1ɉK sJs1C4XZu W_XF u|siC Yt sP:XZsyJXCt2Po1s_$uCD0tPoC1҉T0YEC9E|ӋC4tu S_Xs1ɉKC ^t9P1C Z+uuIu5-7ie[^_]UU4U fP]UU1x94~4]UWVSP.5449=  MRPskY_Mu1146444uj@-t-t)94r!DP(; Zt;4s @-`-؋]U54F_144ZU54XU54XUS]uTu PgkSPjQ]US]u+u P>kSPj(]UE Puj UGuPhW$ UuPhW$ US ]uuPjSuuu jPQ$]Uh5!#uuu uUWVS}54v54SXZun},u4u(PGjWPjj ǃE}t'E8tE$9}uY|EE$|9}AE6}Et)~%E8tPtZU$D9EeE} u)@E }y$uw[Ej P ZYtE@M}})ȻEE9~)Ήuu uWQM54h*ÃMu$u uWQh$54J11M@S#,XMtV5-7b-ZYMM54XPS/~54PSjjSp\$SaE @PE@PWMQ54)P,S~ P54}S3P54[u#u(P6hU,Ru$u uuP$t6S[XtSV,VE SK<WP0S*e[^_]Uh5!#u$u uuuuu u/$US]uuPgSuuu jP+$]Uh5!#uuu uUS]u1uPDgSuuu jP$]Uh5!#uuu uUS]uu PfSPj]Uh5!#uXZUS54X54w؋]Ujn US]Ss h"^ P sl =_4t7S螈PhK%5_4$ 5_45_4{1_4=n4t8S^Ph]%5n4 5n45n4;1ɉ n4=4uh-ht%a XZ]UWVS h*"P _Zuoh~RjP觌Phb#h-R S%_ j5 h-#S _Z؉Phx#Y[@&tCVhSO uW $W t ;u뵋Ct{ tዅh-#Rc ZY€:=uZh-#SF ZYh%Sv ZYWSw ;VXe[^_]UEPE 4UWVS 1ɉJ P] ^r Zp j h%V uՃ{ uC W hJC%W+ VW+ WujƋ;7P yC9C u=CPWY_ZuP YaCPsY_ZtۉC{ CP虜GC V}Y^e[^_]Ã=n4u UDt4t uPv XZj Uh" YtPF} Zt hJC%7} YhjhQ~YZ hZjXUWVS 1ɉM܍}1n4j1j蜇[_ ]߉jjPN =n4u:SZxEPj b_X}cjhy[^1=n4U[j{4PgZY~>jh6j{4PgyjhY^=`l4;SZujh_XS^u{41ɉ$HulT&[{4PhW$jXj_{4)t]SVZ4}EEjPV^XEE119EtMԋ 1҅t9t; tB F@܋Ekl9tH41҅t9t; tB Fl19t!4EPbZYu SYYG19tPZtG}WfX1;Us=klE@0 t.Hdt'yt!U؋ Ph q1p8p4kUB19t4UW=ZYmUBSXY_S}Z^u`S[Ohj]jYju8j]SZYu'@֌SVS jj^֍EPXe[^_]UWVShPVYr hh%Vs hVW7r $hh)%Wr VQu1EW@Zt/SSSSSSSSSSSh"h4jj*Y[ WVVXZ뷍e[^_]UVShPVq hh%Vir hVSq $hh)%SDr St VSXZe[^]UWVS}11u܉5n4jj._ZyjVP7J e]{4$*u u^)uYjha Y[,u>tPZt{4$PX{4$S^_EScSGZYS<^_%%S ^5-7Ujj5-7{5-71P5-7UEPj }tChj_jZju,jSZYu%%̉SXe[^_]UWVS}11Eܣn4fjj]ZYxjSPhH xpu{4*u$tPV _XEV\[u4EPj ZY}t!hj`jju VXe[^_]UWVS1HH;E E8u EH1LEL0t < tLEL8PY$}1ۉ889E SnZ9$PuS藒 O]1<%rA <%t)-< u"DB@CC8uj PPS P 9T1ۉFADЋ(DB@ulD:AtaD\t?@@4D@P0ډ,Du,:t0@먍TFX4,!< u-DP@tC8u$C<%^ _=_4t L0sOPh%5_4 jj Pe 9 X8󥋅 ,014,PjjXPh , 8uE 1ۉ#XhVS h#\ ^Ƅu PV$I u1t@ ?uz_4tPWGK 5_4. 8uE hy#P| ZYt f W00fH C 1x% _4xt SP XZSj4U ƒt=$` (U _4^_tP5[1ɉ Dt4< ƒuhMu $t"=th'M Z1e[^_]UShhjh jjjjj jjh-h4y.h-h%I _4Y[t Ph%I XZj jP!Sa ]UWVSEPuhVC }uCxPVrY[tE 1҉Sth*"V _XuA h*"V XZ1ɉtu6_4tVh&h:%P 둿tt txW>E X1lSN pY@ltJG9r7tuvQCFE 1ɉ^dWQBE XZtNp1F1}uSS Xu5_4t,Rh&hQ%P }tS ZSOe[^_] UWVS0u 1EEEPVEP ] 1EԉE܅unVhd%E܍t0SE)Phȉ"V h%S ƒE9E؀8'uE؋E؀x*h:(%u ^_]EԊp<'uMCj'S^_E؃}u SY؉E؋Eԍ4VupAE_ZOSh%jQ j 벍Jg<%u<@T)IB*E6j/V ZYDžuVC EXuVC E̍GE/X}u)_HEuEY M܋}ԍYtqUĀx .tx uuW6 uˋU;2tEԋEԍRUu@EZYUWVE)Ph%E܍DP y;2tVCXu7 XoE܋M1ۉ2]Shht@j f}ufEf}ufEPEt|e s+-7EjP5-7h5-7B6Et55-7<j5-75-7胻AC-7EڋEEEfmEPuuًU܍Edh-\I tE@ Eu ڋEE]^S_ESlXZ;-7hPjjtS9-7ut h"XuSfB_E@;-7uX]UVSh4/$4!$h4h4W =4tR)~4.u4Ph42BZYt+hhH%h4BX hh4h4.X 4e[^]UWVS1ɺ!idu$xtx蔖 jPh`4 W 1ɺ%idu$xtxZ jPh 4V jjj}à < 1jh4VV Vh8i(S|SugL8PhPh 4[V a$8PXt*hVh 4W hSh 4V -%Íe[^_]ÍL$qUWVSQ-P4T[h%(Pj y,_4t Ph-% > ^_h-hP%= j h_3Ƌ([1ۋ(?RXYX9hI$W:T ZYPWVWy hI$W"T |-LDžX-XtMQDN$HDQVxy uHLDAEXhViPT C (uV:W:XZ0iƄV:W:^_ujrjoY[ PDž$Hjj$V(Whh%7 @u"Dž$ jjVWhz%6 @u/ ;Psh%jP|YZt,뱸 ;x|s:h%jPP_Zu(hre^t4DžT jSd5XZYt5Lt4gXDžT 9tf@ @ )htjjjjjjjjjSXjuRL411PDžhjt`hPLϿh uLX8_X 4hiPh4dR jh%h4vt(jh%h4v %%1DžPh%j@$W jjPpPW4 $@t puh4&h4h %h,jct8DžpjpPjj$V4 @tVh%e^[^1=4s(u=4lu 4-DJuPhJC%T ZYt;rPhJC%A ^X1hsH$PY[hsH$P_ZÅu 1DžPkjv<$1󫍽p!󪍍pi\^@u 1ۉ$Nhh%tVZYthh 4h 4jf= 4thh 4h 4hhZ"h % Ãt~Ph%jh\h% %S]\h) %SR\h& %SG\$hD %S9\h 4hO %S)\= 4th 4h[ %S \ hf %S[^_hv %S[h %S[SSh %j[h4h %h(h4h %h$S S.h%h 4ZYh %h 4^_h %h 4Y[h$h 4_Zh"h 4[^h:(%h 4sZY= 4h 4h4h %jtnh4h %$Pj8~ $X$u4_hh 4h 4j~-h%h 4 41ɉ 4hhw %S[^h!_Zh4hw %h %hDÃ3P 4h %\Pj_ ~h\h 4BM \3j h 4X th %\Pj ~h\h |4L \=3j h |4 t= |4t 4h %\Vj ~h\h4L \2_=4u8h %Vjh ~h\h4KL \2Yj h4`_Zt=4t 4hh4sY^u =4u 4111hP$VK hh4h4jxhh4h4jw,PVz^Zt%4Pu*jh`4h`4jytjh@4h@4jzetih`4 Y= 4u=w jh %"P?w jh %-wjh %h 4J jh 4h 4j{hh 4h 4j}4u:1llPj豷XZluhh |4h |4j|VDžH 4= 4u DžH$DžD 4= 4u DžD$@4=@4u$`4=`4u$ 4= 4u% |4= |4u$HDVQRh4Ph4h4h"hV,= 4u DžH$ 4= 4u$`4=`4u$ 4= 4u% |4= |4u$HVQRh4Ph4h4h"h(jjjo %x PiX4RhW$h hZ^L,X#/h %jktj4Y= |4hr"h %m XZu>=_4th5_4P0 hh-P0 j豽 h %jTpWA W WPh %h %VT =4th4h5 %VlT = |4th |4h@ %VPT h %jATjV訽=`4sh@4h`4h4hO %j5ho %h 4ֿ hh 4h 4jjFj jh$<uch %$S蘿 h 4Sdh:(%dP Y_t 8tV XZjj`RPPuf= 4t h 4h`4h4h %jPh`4h4h %j5=4toh4$h4Y [^T=4th4$h45 ZY~=4th4r$h4 _XPu΀= 4t&h %hh 4h %hhh%hr 4j4TXTeY[^_]aUU5!#w&]UWVS] }Vh1$AZYuu ƅ?jh)%yp:jj\f@jh0%M7ZY9t x/t/@?/uGjh0%MXY1iR 4$SRPh8%hu e[^_]UWVSƉˍPh1$7ZY5!#uuE%VQPSSdu4td4PVSWhI%he[^_]Uv4E]ZUS]S+VZй o4؋]9USPEEPj褰EZYt=`u4b4=b4/ub4SPh)%hhm4 1]US]=4ujXE]EPj (EZYtt`u4$SL h4hb#SKSch %jKh4% dZu/h 4hA%KY[hT%Kh4h`%K = 4thw%Kh4h%K tVZj@Xe[^]UWVSUʋM2uBIu tu< }[yt ut܊ y_vDmt4\ 0H2N0H2N0HB]9uXZ[^_]À\umtf\\Mt܈@UWVSdÉE1;{ URWSPLE tkEud Ut/tQjuuSЃt?u4EE,RQURVtjURV GqEe[^_]UVSUE 9| 19[^]UE UJʋ HRP]UE p1]UE @]UWVS lj֋tZRU'É$URWXa u6EPjhjjj EPS E t8u }u1e[^_]UVSMU ZLALttbU M[^]:uEY,t:r,t-9r&9rY8r89r9r9[^]UWVS ƉjR`ZYjh h PWZW uPP=Tt=Tu<x3P9$u%SVhD%hSVhX%h e[^_]UWVSEt6ӉRhf%EP E tjP XZtu^!Y1h%SYZu UEEtPuPht%Vqu!tu9Vh#}W9 hWSujPP$jLZpe[^_]UWVSË@@kPhPpYh蹺Pp 1҉ll;Pl tVqdPRL t{5n41WVxtMRPWVu|8RPdph%uV8 EtjPpVF: hVp1: l?s pC Xe[^_]USExtjj譹Xh蠹SPho"Ep]UWVSEU Ћp$RVSPL @t1҉ t VSЉ ^_5n41WV($RPWV0,RPsh%hTV 8t'hh:(%V 9 h8pV8  t$hh9%V8 h V8 V?Y‹E@9h"DP2 XZVhW$Epz e[^_]UVS]u {t5F fC ][^]~[^]UVSÉ1ɺ%&ujVۻh5!#Sh)"{e[^]UWVS\ƉUM1ۉ]1E9tXE 1;Y sHFE1U9t; u;Zt(@URSQMPL Mt EԃUCGjuEZYu 1ۉ]EjuEZYtMEEE}E9E1ۋE;X skFE1EE9EtE‹E;u;ZtAE߉MEURSuPL MtEuE_E@ XEC덃shjjhjhj_ZExN1jSEp3 SuVSuVt~tg`PRT^[^tEPPRZYtU68t,8u"E@t$RP]^_uh%EPY[tEXt p$l(h,`d04t:$VSd]_Zt'EPV4Ph%hS \EpFjh%ZY@0)h%h%SA#Vh%W5#Wh%S諌$WtPh}DSST@ ?Ph%F t0?u'h%膋[_th%PuZYuXRhϻ%P! tjj h5!#,4,0RPj$W9 Sm- tHLDJ@tSPWVh"%hFP肮 : 41󫍝DžƅDž4DžDžShQVmZ 4Džf=t#fyf4f=NE1f=FX!щ11Ҋ44t'w8X$'wX$$(uJ1󪍕)󪍕$R2ƅ(ƅ,J(,,f0ƅ<@DžDJDž('Dž$ƅ|0RhQ`V!Y^ ?j!jAj.jj h5!#,4,0RPj#R (PW#RVh<%hS Ijj h5!#,4,0RPj$W8 WVh1$hS輫 0E@8@}~P# $uJ< uuƄ$jj h5!#,4,0RPjW SWVh0%hFP# 4be[^_]UVSPjjuVjjhP&@tbu XtSjjVSjhP&j@u SzY2h:(%S-ZYt PuU ^Zu SS[ h:(%j1e[^]U EEE EEh&EPOZYtEU 1ɉMEUhEP%ZYtE1UWVS`NjEA w1h6%w ^ZuhJC%w %ZYthl&3[^G,Vuhl&3ZYt\tBJ@u xt@wHt4{4$t)tVP҉[Xt{4$1ҍ1ɉ9{4PS7YZtXP,40S|ƒt/t#VRЉXZu\RY8pu`$uVP҉XZtً$9jjjjhSQRPx jjjjhSQRPx h-.%P荢 h{4PP* hق"Vb h{4PV* W(R,[XT`a9lhGPPe* h_SVV* Ah-.%SС hwS2* hق"S象 hwS* (uYhK%V膡 hV) hwS) Ph-%Sl^ à ƅG1ɋÅthyG"S襺ZYu!Ph-%j^ à uhN#SsZYthu#SbZYth?H$SQZYth%S@ZYthh"S/ZYtt hhO% hh-%V( hSV( ƅGw PVà {whW$jj9Z؍e[^_]UE1҉UMU ]UEEMU ]UWVSQ]} E10$hlj6S*u ET%4jRHDjjSRǃu E18‰uE@WZڈEV$XEe[^_]UWVS E 1ɉ1D󫍕D1҃=n45-7S h-f 5-7n4 Iuujj_AXZ1Ҁt,DžfDžDž)Dž=v Dž1ۉ11119tD5fDŽ5DŽ5)H5=fDŽ=DŽ=)BC8[ty1t1DŽYfDŽDŽ)DŽBt1DŽWfDŽDŽ)DŽBhjjjjjjjjjRPj谛Ã4uDžhuhW$jJDžPS!tuiu5hjjjjjjjjjPj$ƃ4t@DžPV趐ZY^Hy V֛XS͛_u?t6hhPh-J# {4-Džc=n4yun4Dž<1ۉn49i8511ɉ9=n4t9i85Ht4t(~SW耴YZoڋ d4{4ƀy1҉LPTXjSP;" hCP{4"P$" jShn4" 5{4,, 0$4(804$ u1҉DHPWHDFP${4()l,, 0$4(804 uȉ1DH$=n4 pH DH9jj h5!#RPjVq jj h5!#{4$P@ RPjP> _48t${4VHDPh%R胢 {4$pvơ{4$0`RRVP{4Pjj:5Dž1ɉ$Pj行^_u65{4h^u1Z%$P1$Xu@Pn4P5{4 P.^{4$JZDH-1ۉ,048DHƂ({448<=n45 d4T_Ht4Y d4tu Ht4h £ d4a1X@KyuƆy$tP,40W1$͋e[^_]UMw1vB ]UWVSDž1{4*)PhC%hSޚ %t+he/^ShM%h訽 juehJC%{4Ph1%hSh hJC%Sh% ǃ((hJC%ShjlE0p~11ۉR#YZtsE;klEX{41ɉ Ctʅtƃ{,tjjjRhRs8WPx {jjjRhQs8WPx jjjRhRs8WPxƅ,CP 1҃CL_cLuӟXZ=n4CLS<SRV菍ǃSRjj\ 1jjB6u$&v=IC`,tPhf%hVJ Vhl%PT C`,tPh{%hV CXtPh%jW WVC\tPh%jW̗ WVSTz"t$tH#VPh%P貺 CH@%%GCX,tS\tPh%hVO Vh%PY R%%h%P6 XZ%!%h%P _X%)%h%P Y^%3%%{Tu%PPĹ XZ%:%d1]%%NKPQhT%hcǃ-1ɍPY1e[^_]á{4*;UWVS ƅhB%Qhr"h#脊資PhG%j$=_4t"{4X荇SPh`%5_4y u6hx_4Zt Ph{%/ ^_jj 3Y[h%W*${4[^1҉D)kSPJBZY;PdVŏ P,P貏 Vh%W#TP,PA$T\L1PL9Phl"HPӨZYHuuRS% V,TXhg1TRjPZ*Pn(P V^P1Sh%W" PAVYkDlEXC uDED;rC,u{Pu C0u tCLtċC4jjjjhVs8PRx 1҉LtL{tCH5!#DžH% #CP w$&=11DžP2 $ #"DžPR%u # DžP%hJC%HZY҃5!#uhLP %PLh%Sy؃RPh/%W8!RPhZ%h%讄X11DžP%11DžP%<@hJC%HVZY@v{ ExtSx u^^~1;s}O19t }?;tBx(u PYFËEx uZ&1ۋ;sx(u PXC1ۉ؍e[^_]UWVSu1ۀ~ tB~9s*ًx(u1;tB9uPXC͉Me[^_]e[^_]UWVSQ8ME111ۋE;Xs-E؋MMQrPEPL tu}CˉeY[^_]UEPE P0]UWVS}EjjjjhSuPRx u1=jjjjhVu WPx tVShb%he[^_]UE8b]UE+4Ƃ+4*4fP*4fP1]UEPE ]UE E EE]鮘US]+4)PCC0+4R C*4C*41C1]UWVSÉM1u1sNуtX 44tJ}:0u%1Ƀs1t0uAqt*J EE띃}tB A2BB12EEZY[^_]UWVS1󫍵HEPE jhjjhu,jh5T44jj jPSj|Ã8VPlrS}1e[^_]UWVS<Ɖ׉1E1;S sMQRUSPL <]UBjluZY1҅E1EEE;C M9MMQuSPL k}lE̋UЉQE܅t8tjPQ HL >_4EG8EċUȉGh}jh%*h~VhP$V5m4Ęhx JjW5m4E h.&h.&hSjW5m4 (S聐Zt PSV' JVlV.jh5m4 5m45m4jjh]%XÃ(xj VPƢS e[^_]UWVS։ϋ1׋B˃1t.0uKB1t" 44 44ȍYu1[^_]U1ҋE ]U1ɺE ]UWVS ]ju ^_jdu h%PR u h1%W> 19tNi sQWVH" uΊa<w ~[BjjPǃ :1ɉPhd@WE u u W蟣Z`RhedAWW`9< RFaPu h%W jjWǃF s9"hh"4Wڦ@u W莢Xjh%h"4 u܁="4usjOh"4Pfƅ_ OusƄWu h&%s CRPh1$P $1u2jau h&%s CPPs CtC @C wF-1e[^_]UWVSEEuu&& &*41`&ƃ 44@&u1 44@9uP44j@{h44j4{d44j({`44j{\44j{ƣX44=d44W迋Ëh44$U謋9s}Ë`44RU葋Z9s}Ë\44RUxY9s}VhZ9rVh5!#h%jjw T44EEe[^_]tU|EPu XY1uE%;E Uh@uÀ=n4tuUhn4h%j5 t1Tu4h@d4h%h)%hh`t4v hc4h%h)%hh`k4v (h`t4sZ1Uhu.UQ *4 *4u0EEE jjEPh*4jEPK*4*4UShP$TzhJzjjF h.$hh.$hh %j S SXZ]UVSP]u EPVEP蠘 E u Vh%jX SSPh?%jƘuje[^]UPEEPjeEZYtM`u4SCZghb4Ph)%hh`t4au ;ghb4Ph)%hh`k4Bu (1US 8PhJC%m [X1u?9t3h0!"SCZY¸thm$S+ZY]U ZE\URuhb4PVSuh%j"¸$KEtVSnc VX|à E)ËE9th2%h &h hI%dEe[^_]UWVS EUˋujQEY_tG UR#kuSPQÃtPESXZEEe[^_]e[^_]USj$uyTZYtD1ۉ]XEPjhjjj EPS0U Vt;M rj$S뱋]UEPM U#XUEPM UCXUWVS 1҉<P&jƅ3Phz%V t#hjh%h%j %!hjh%h%j %Ph`}4ua Wj&V  Hvw=4uj輒_1|-Dž`-DžjhhP$jPj(Uu1 h`}4h`-Wݢ 5!#=|-u.h]-h1$zZY5!#u={-uE%WVRh%h谈VSW` =4uj̑XDžjhhP$0iWj'T-=u4+=`4=`}4h%W_ W6 h`}4Wh)%S Wh`4hu4h%jڇ$VSh%jWh %j讇W VSN_ Y^DžWj)SXZX=n4tZ=u4tQ=`}4tHh%W^ Wm h`}4Wh)%S Whn4hu4h*%2;e[^_]USڸstjSk ZYuShD%jʆ ]US13tjS}k ZYuShQ%j芆 ]USS1$tsf1EEPj%REZYtt`Huȃul"hH%fX t&jݡ hH%fYXKuhi%jTXZ1]Ã=!4uiU!4 "I }4%:d4%+$}4Q#`4 5% @}4r "h4]USE] tP7fYSjQxeXZm4E]hUWVS18Z^1Dž@DžDDž<jjZuWU2ЉXt0t0}4haujPjP_SmVg t,}4uQX} tExuh%j老Y_}tuSh%heǃSh%hNǃ V VXZt-t4}4ShW$hajj@=`u4t=@t4tSh%j E@ 44t 8}4e[^_]UVS]u Stt uh$%OX$%JC%2u.%jjPVSe[^]UWVShh%n4_Zt Ph3% [^(}411۸ -P/t 8t 44u uA؄t (}4Dž -{54}4/z;i 44\,}4u1uSZYH0,}454}4j5-7#5-7=5-7=3<}48}4P5(}4hG%ja_1`u4Pj wKtu 44<}4uf<}4ƅ1N1tσ0u@/u(Ht!ȿ1 44uƇ 44Bƅ뼀t/<}4'tju ^_ 44t8}4(}4u9uh_j 0VR5,}45<}450}4PhN%h^ jjY[}u%,44h[%j}XZ/44tkht%h}^_Hu%h+^jY[th%j}XZh%j}h%jw},44,44hJC%LRP urh,%hLxRPq uT|9u;xt8h1%hP%1Q^_thZ%j|hP%h%M迴\[Othi%jT|Y[ju XZ1e[^_]UWVS-{t0u1#W3+PYZtWhW$h\ ك1ujhXZe[^_]UWVS1h%'KPhW$P{ ytQP`[Hh%JPhW$P{ xh%JPhW$P{ y6륋tPYuhW$h2[jjJZxPπh#O$K] à tXyS.Phr"WFLYX1u|S PWuuhW$h2)[jjBUh-#W4w YZu"k$uK t*WhW$V$ ShWcR u<=uDžSVOVPOXZtz^_uY[uNh/Zj_Zu@踀[^t jh1jh2%ZY1|Xn؍e[^_]UWS]S 1E CM [_]Uu uUWVSSu] V 1EStitcklЉE1}9z4u@lM9ut@FjlP‰FXYt*1}9{4ukl4 @lM9uܰ1e[^_]1UVS@]xu1EEEEu1EURURSЃ t1;EE}juuS:URVSPL uF;s rEtEȋỦEUEЋUԉEU؍e[^]UWVS]u 1V,ZtƍCڍe[^_]US]s s$XZCE]UWVS]1;3s8klCxdF@0 ttW X9sklS9zduBd@1;3s>klCx4uFtWXF 9sklS9z4uB4@skXCEe[^_]XUVSjhPjut)uu PZ @uu0S||u0Z1 S{Xe[^]UWS] 1Sh|duw t#S;S t%iSR3VZYt3螻X1e[_]Uu hzd@u)UVSujhPjVt(ju jPVo+S?{y t01e[^]Uu hedAuUU EHJ Ju BP k\oEMt0rt(t h5!#5T4h%vKtstZ~ tS4C8u%uh u hH_hPRߒY[P5T45dl4n41RPss|fRP5T4%5dl4n41RPs$s UfRP5T45T4h%vc=5dl4C S$CS n41SQRPfRP5T4몋P ,\uC( PGP5T4\u CH@L؃PGP5T4:\uCH@LPGP5T4azuCHpX5T45zuCHp\5T45T4h,%mCHP`u&h GP5T45T4h%v3OEERh%jPD hFURjPà P5T45T4h%vS胬kfx5T45T4h5%v趓CH@Hth<%v蝓XZCH@HthC%v腓Y_CH@HthL%vmXZCH@HthS%vUY_CH@Hth_%v=XZCH@H thg%v%Y_CH@H@tho%v XZCH@HE t%FEe[^_]lu%CHP5T45T4h%v轒I+{jPMQKQWsPRdk B(0]EMQP5T4h%vr0e[^_]UWVS] Ep+sk H(L9t[Iw`hWKQVsRPdhWWjjjj@(4I8WVsPRp VsRPh 1e[^_]UVSu hSP t*hSSjjjjhH SPXZ1e[^]UWVSu jFHP]S jSSjjjjj HH-E܃,11t]DS@uu@tA^Ht҈Uthy#WUZYUu CcL'/t C/jWjWS FHHL1e[^_]UVS u vDh%j ]Sm@ j SSjjjjhG0S蛣FDVHB`1e[^]UWVS jj%~[^9hBC <]hBCC<]hBC C,<] E1҅tuB `&tME4}GF <]u/UDEjh誌MEZYU}B}$w"uuh=BF <]X}$th}%h&hh%[jjjjh\hjj jjj%SjM8ƃ4xu Pd.V9S蠧e[^_]UWVSQE @4uE x8u-u uxXZttt =t ujj ݢ^_x 1҉j4@&U艋G ^UBXYu؍{shAh ACh@C h@ǃmjjjjh^hjjjjj SjM7ƃDxu P0-Vp8Sl1e[^_]UWVS] ;G(S119tuklKI0΃@jj h5!#GOOgRPj!W_ jj h5!# A1҉SQыcRPj'Pl_ 8uth?jPPV= E@ tP?jPPV 5!#u h?Xp~?0m?'QWMQVRPpjjAdl4,jB:?SPh1$j -P=< dl4jC?SPh1$j :P< dl40j->SPh1$j GP; jD>h> uOYÃsU4WOZ£U4~ް-T1~CVƄ5T -߉TPh%jPh`U4R; j.3>h`U4P5U45U4GP:P-Ph%hhT4; DhP$CXe[^_]UWVS] {4$DV%Y_TV$ C8@@8 QPVRL !B r0󥋅PHDž 1jjjjRPRPjPQ0Hug $(,Dž<Dž@jjjP84P@L PT} j jjhqehF`jj7jjjjF)ƃ4PVV)E)PB89B4<蔓ZPufLW WPF8PP8 WRPQLP $AMJ}u29Mu-*}tMJ}u 9Mu }ˀuGE }$vE0EDr%=uu r% = uuS% = t;}yhjˏYZ|tTY4t&@t 9t9Y4t@u%}*h4j蟏YZ-OOBOu5(O~% E tSE (!%~ v$ t!%~ v t !%!% E uW!%E fUu)8t$EU {4;\`|ˀ}t4U uWNE (}uƒ ҅u uuth hhXjbZuWhW$h!%V膎e[^_]UWS0]}ȹ 1E1EEE =Y4ujjS@ jP4E܍EPjSm@e[_]UWVSM 1{4f(uD11uFu@uGN t Ƅ[^_]1US0]U t/MQRSPL tsuuh!%j]UWVS4}=Y4PklUVE 0^ZYE UlVSClPػ11CC,C0CLCPCT {4$F( t1;~ sJURWVPL t5E؋K,9u+C0 C0E̋UЉSEċUȉC}}w1] 1ۉMԉ]M]x(Ã}t*3M 3] uM ]M]U9uU9u y;u U| 9u܋U}U;U UU|WU9U܋U]|G9u9uǀǀH vIH uԋ}p x$]C 1҉EE$[^_]á4"UWVSLEԉUȉM]E EUE}ԋwu}9UM}։lj]19؋]| E1ɉM;EE}HuuWV  t4EUuuWVd );uE}u}]ԋEUCSEU1҉ŰEUEU]9]E9ƉMEEEU)EUEE1EЋM9M#} E؀x @11ӉM܉]3M 3]$M]] ]9u܋]9ƉE9ƉUE9EEM܋]Ή߸;EE#EUuuWV);uE}u}E9Ɖ]w)]9؉ы]}EUEЃEE9EE]|Eȉ0xEUAQ EE̋EU׸;EE3u}uuWVA);uE u}E̍e[^_]UWVSEU }}u}M] M]M$](M]M,]0M ]$M]M]M]M]u} M[^_]USQMAQRPRPjjjjU} IuEU11ҍeY[]UE]US]sh%%j ]]dPUWVS]} j/W ZYƃti)PCDPWj ƒuNV`~EJ9s4t'19ty u9t@e[^_]Uju EDPUEvPEDPu @i UVS]=4u i4K$9C |`549s sUjjjjRPRPU t39r,1tu{(u t @9|1e[^]UWVSU}119y u 9;] u}t uz(tt}h}[nЃu"9uǂǂ1J Z$1ɉƀJ C@]t%%1e[^_]UWVSU@11B z(tBBB B fǂ[^_]UVS@Z41ۃ<&t9jS2FFXZSF wH&ӉӉƃ"ue[^]Ã=HZ4uUZ4]øZ4UWVSUu}E EE9E sX11ۀy u9t 9] tC9] r8@9E}tMa}w}uWrVf 0}t.1HR}t PRh &%PRh&%WV R}t PRh%PRh%ԍe[^_]US]uhG%h&hh&%sSLX]]FLUWVSÃ=HZ4uj@Z4u1<@Z41@"t 9u& 4419tp4x(9uB1[^_]UWVSu =4u 4E1҉U19~\UE]FPwu"u ~tu Ex(u}t!C;4GUfˉ}FFN(1tF$1Ft 8tjPkMPrd kMƄF uF }thzUXEEe[^_]UE0U U]UWVS]u=HZ4uw1E1M9bz u :D;E +}ߋE싃E苃E}t }u{(u1+FV C S$FF^N(1tF$1F,MPFtk9t jPRb F tV"}uM9MuǃǃFt$9thI&%hh&hdh&%F t'u@K 9M sM 9rE1e[^_]US]=HZ4u!w k @Z4"1;4s k44C([]US]=HZ4uS1w>&E[]UWVSSÉU=HZ4ud!v=4 41k @Z4B9tp4;u(}u1BRQDZYt룄44k44B4V 1Sh%jRU F hr~ SPh/r%jW F'F(UV,~0F((e[^_]UWVSu]=HZ4uw1E1M91z u :;E  1}1CC1C CkEt CЉSMS K(щS$MPS,U{}ut 9u 9UuKT9u9UutK }u~(uۃ}uՃ~(tτu˃K @N 9M sM 9r E1ZY[^_]U1ҋE ]USR] j EPu U:tt hsX1 R]UWVS0]C{Tuh&%h&h{Xuh&%h&hh&%r{\uh&%h&h߃{`uh&%h&hȃ{duh&%h&hjCDPV^ u h'%V XZ{4uD1ttʋ5-DNuT4@׀{4ujhJk"C4P ؊LD tB:u JN螄 Ph'%W(] hr"W ƃiWh.'%j3jPh='%V!jsXs\s`ha'%V j,Psdhx'%VisTh'%Vi19aW 4&PwP7Ph'%ViG P u"OQPW RPh'%VaiH9~h'%h"V:iZYZh %jiV PPVh'%h'%j Ã(V*Xe[^_]UWVSÃ=4u }4{s1ɸ9|,@89@|1ҁ{v@1҉[^_]UWVSE Eu}hj=[ZtAǀǀjhPju"@uSAY1RC,PhedA4 x0u<;|1ҋ9Ћ}ScA\XZ뙅~1E u CCCs {$s{ECTCd_19G t C <u:?C <yG1ɉPPPG1RP1tA8thtjjhjjjAjjjRVh踼E4URP[u虽V+}51Dž<Dž@;us<`RVSPL t$hl`d<@FjH&4A Y^s1҉8,0$(8;HD8ȋ0`WpVRLW6uVS jj@<0,EU+,0RPjPPS,PTEUjVS4Q 8 tIVPSRL$(u}u} 0,WV)׉<@8ڋE"C t @]fCEf@ DP:Xe[^_]UWVSEMt]X$[ EXUjS$EZYtI-Ut#E@$19tD BMNju1ۋE Ee[^_]UWVS] Ep+s8k H(L9tWIw\hWKQVs4RPdhWWjjjj@(48WVs4PRp Vs4RPh 1e[^_]UWVS0] K4Uus 0RQPVL Utss ssuu3ҥC S1e[^_]UWVS0] K4Uus 0RQPVL Utss3CSuuPR|EU+CS;C {}C S1e[^_]UWVSDÉUEE1uu11;{ sGMQWSPL t2EԨt+M؃9u#F}y tEċUȉEUE̋UЉEUG봅u*}pƋ0VPjhKNtY}yS}ttURURSЃ u1pƋ0VPjhVS1RYt }WSЉXZe[^_]UWVSPu\hP1҉UU:ÍU.WVh %jjjMQR9|ڃRjjh(%1e[^_]UWVSl}1E EEURj`-1[_|ËEPRHEU{4PLEUYE9ƋE|EEE 1}EjP4E̋MEjjuuuun41ҋ}9=n4׋u}EURPjEPQEƒ01EUEUEUEUhjjh%hmhj6jjjuSj莵ƃ4u Sy$ZkEPV$VdS`$}u#EMQ]SP @u uXUEEP tB]fCe[^_]UVSR] 1ɉMS4t&uVRP u uXfC<1e[^]UWVS] E@fHPR0_usCthpW= ƅhWWjjjjp t%RWP@ZYuX붉Ɖse[^_]UWVSLu}1E EVUEURj-CY[tUÍ}UE;P s WRPQL hjjh%hmhj6jjjuSj}4uSj"ZwURPE EPJSF"}u*UE;P s]SWRPu uX1}t UnEx fFe[^_]UWVST]SSPHEU{4PLEUZY1}9M|EE1E}u{3jjuuuukMeRPjEPS,HEUEĉUȃ}uuujP8E؃ jURS @tQEM;M qku0}u jjuuuuuujURSЃ,Hu1~Uع1EUEĉUȋEUẺUЋz!EjR4E؋juVStVPSRLƃ txtjuuSe[^_]UWVS|]{4tf(ttuh(%h&hhp(%xF5n4t\U^4hjjhhhRjFjjjuPh ]4蕰ƃ45^4wY20蜹Ep菹|7肹xwtjj h5!#jh0jUR,jj h5!#jhjMQMQURW|xu{4PjhN@hP$${4$0E{4$pӸEEEEEU׉ u11MQMQSЃ UtEfEE~EĹf@ @ @f@@=4w@ f@*@,htjjjjjjjjjQRḫǃ4t P螮@,ΚEPW^W螯Et11!UMQWSPL UuG;{ r"E EtEuEȅtօt1h\jHY_u_4zPh(% SIZujhQ_XO:jS[^Jsjhse{4@u ǀ@>U1]1EEPVXZ}y1Q1҉u1Hùxt%| q1@ 4S .|GEE;xrB;Us E11ۃ}t E;]sP,C_PYV躭5^4XZ}e[^_]UWVS0EDž}uEk4jSZYt jS^_u"Y15jS_Zu[^ƅ1;44} tE 9[uE(u)tMQRYu';s{Љ E, UHD9Ɖ}djj h5!# WVjWhoƃ 3WVPh(%V2 V\Y ƅ3³P;Y XZ00@ _w%tDž111=u%hmjj h5!#E,}H,DRPjV[E$hn躲RjPESeYSƉ<$IT2 ‰$SP6 S [Xf S $f <$S WV9r$h)%hx&hhp(%uZ1hjjjjjjjjjP菨Ã4tPS+_X19s <19t43@YڅttVZ  tSXe[^_]UWVSljfDžv/ƅujhH%Y^yhhH%S=0 y賟t&誟8t蠟WPh)%hS语 hWS/ =Džp!j/Sd _Zt-xv9tH9s8/t@Q6 YyߍxPW&BYZ%=pu:>hQWl iƄ/u%語QPh %hS賬 %hQS. =@uW6 ZuhWP. =hS| Y_1Ҁ;/u 1Ҁ{‰hSǿp<$賿ZlhЃpDl=w4uhhJC%S. =whWS. =v ?V _y V=YV{ ZV$X1e[^_]USÍEPS?YZx7Et.jSXZxj `PS t SY1$S`Z=vf u]UWVSEUP ^ƃ}t11ɉMVv( Zt{fx vX jh)%SqQ uSuh)%EP @u hi[#<& 3Et}tESWuh)%j>u[zV> XEEe[^_]Ujh)Gj¡ UWVS h%)%011tY+ڸ.)%xuڸ9)%wu#WS=XZuWS=Y^1yah9)%轛hPS+ WS@>1u h?)%藛PShI)%j?ShU)%j7hS=h4)%ShPPO+ WP=u'h_)%SϚPPhI)%jhh)%hPS* Sh%jtPhh)%hr)%j}uh&)%SZhPW* h~)%S=PWhI)%j@,h)%S!hPWv* h)%S PWhI)%j ,h&)%SPh)%jMhC%S˙Ph)%j*h)%hPW) h)%S蒙PWhI)%j(h%)%ʙhPW) h&)%SXyth)%S9 Ph)%j: h)%ohPWi) h)%Sp14 -Ph)%hWզ vtpWhI)%jC utjh*=DXZte[^_]UE^4fP]USE@k &t!&ShWE 0蓭C^4 ]UWVShƍPhW@jS@1jh*%_ZRhW@P  11!tVk &&u Dž"BVP谹ZYu=^4DŽGjjjjhjjjjjj!ShޞÃ4tjPSsS賟Xe[^_]U迖^4tPPRRRh*%jUE 1҉P1]UE @1]UE @1]UE @1]UE @1]UWVS$pxЉ11)ӡn41RPSQ RPh#j]S" ]Сdl4EԃЃ7PURjP:jPPh ^4C& S  e[^_]UWVSĀE@kl} GNjE @u FuG u G08uw0WEU1EEPj גXZ}E MQw8P uEP^G81ۉ]E ];Xwk]lE X{8tIC] su19Mtklu ^c0AO0u uu ]u]u tu9]}UEG0uW+EUu FV}t ]U]EUWE <1e[^_]UWVSd} E@9E Ek] lEpF0tjPPV h"j*!URjP3hP$dl4j-SPh1$jF^S j.ߝ h&PSh$-%hh^4ٚ e[^_]UWVS8Ë@H1{$C$EsCM19tklD>0 tfA A ^ B}lj&fG G5GG G,G01G8@Ep x$+s{ 1ɉMM;H s%MQuPRL t Euu}EыK19tklSB0u+2z@s{`S(xE+C$PREpxP@EUn4n419| EU)AQ1t&Wv @u1]{]4VNUMEP$@ EU]9]s#kElx8uyP@P b]9]r,1]9؋]|ZEM]+HX M]11~8u(V] ]9E]|V1]9؋]}yV9E]}jM9MsWM]+EUuuSQİUUMNk]lUMʋUeʉT EUVEM]+HX M]11ҋ]9]sV]9]s kul7T7]9]s kulD7T7 M])ӉM]19Mt1E9t$E9t8uW t G0u)EUAlʋ}9}}y{9к 9ʺsbkEl}GËSEUu}+u}uuWV)9uE}u}u}EU)SE};xM] uuSQ)ы}ϋUʉӉ]u9ދ}|}9׋u}ȋU}MOQ)EUE@EE}EpxPEU19]EUC<S@9Ɖ|]C0EU9ƉE@9Erk9EkElU‰UM]) Z19ʉ|EXH 9|1ɋEHE0xP0tqP0EH0bEUӋEU)uuSQȭыU2zk]lu΋Uʋ}TE0xEPuFV e[^_]UWVS@PEU 8lSPh-%v\e[^_]UWVSuE ]ƅo$`&h khPWN hh9%W S0pz t7z(u1hh:(%W hRW ,9u|h!pkhPW hh9%W S0pz t7z(t1hh:(%Wb hRWP ,9uWhW$v [[$h":[ h#0[h$&[h%[h&[h'[ h(jSPh-%ve[^_]Ã=`4UWVS11ɉ4P;ZG418t=suB89J4ƅƅs@14k8ƒ|<tcPh-%jP4Ph.%hhh,.%R h4PR G8u4D(~&Ph4.%hWtf hWV 4D,~&Ph;.%hWAf hWV_ 4D0~&PhB.%hWf hWV, P4؃PVhI.%h1Dž884kt1;8 8tuÃuT4B1LVI$$?c)((@6,,A 1ɉ Ph#jS&T jSSjjjjW=[0SJ ZS; Xe[^_]UWVS(]}hy#uVN _4XYu81ɉU &MVPQgZYU9‹M}ƒ$uӃ_4} E $D&h3RV Wtjj5V_h4ku2n41RP tRPh#jEPS h5&tjjUYh6u)tjjUZPhW$jEPR h7t"u h#jEPvR h8t"u$h#jEPAR h9bt"u(h#jEPR h:0t"u,h#jEPQ h;TVP_4Ph%sΡe[^_]UWVSX1ɉt @@_4Ht4t=$txuP1$Xytƃyjh,/%趬_X=`44|uÐ Dž814ktƒ8B1;8 8.T8 RPh)%hWP 5Ht41҅t8t%FWPdZYu Ɔyԋą d4ƀy1LPTXƀ);4ǀ,ǀ<jWP= hW d4"P) =Ht4u/ d41҉Ht4hԯ d4aljY t_Ht4tByu/Ht49uHt4ы9u􋐀뺃G5Ht44@k<Љǹ1󫋅PB osC )t C8$tC81$u19;x sۍRPPL tO@j$xustj_CBk<y׹󫋅PB o$CsC C8RPL u;H ruكtЋSO_Wk<<󫋅PB oCsC C8b]1fD @9s=$}4t1h&󥍅Pg^|&󥍅P6[=`4tcDž DžDž41҉&󥍅PY= }4t1&󥍅PX1B ucTB rl_4yFHfGe[^_]UU J E]UWVS0EЉUĉ1ۋ9}qGE̋GE11ҋũ<tw9tMBu9uSuhU%jEPQJ 5Ht4tFURP^YZtEЉChjXZe[^_]UWVS j; 4tPh/%h+i uq 4tVPh/%hiuK 4th/%hh u, 4th0%hh u 4DpC1e[^_]1US]1{u4{ t; |1C4dv"{x[]Ã=d48UWVS`1Dž11Џ4P~Y5Ht471ɉ$;H QPRL t tt߀8tPR8? RX /thJC%R{XZЏ4 QR^( ZY9st6t-QWZWY99}tt$;H s41VWD Џ4$Vh)%hPLC 5Џ45!#t)"PP= XZtЏ4PtYVPh)%heЏ488  RPVh 0%he$tt;,($ PRPhb0%hue$!PRPh0%hReu&Џ4@40|81e[^_]1US]1{u&{@u1Cԏ4s" {x[]UWVS_4Ht4xtt$u ƃxaPYt0$xtEjjjRt1PZu#_4tSh0%P F pÅt_4tSh0%1=$}4'04P_04p41:uJ Jt @ =u_k 4]ȋủ44BMȋu1k 94u94u94t Bu1҉444e[^]UVSMU194u4r94u;t = u1[^]UWVSGDžHt41|?1$%$;p WVPRL } t} t!} tWVS jVSSx k|<$tjjjjjtVRPx|ǹx󫋅tfDŽDŽ)| Fhtjjjjjj |}@Pjj|Ph0Ã4u1}?PS%S0 |9ṣ_4k<}Ee[^_]US<] EjP_4ZxD1k8|<u$MȉHHt4t5xt$h_Z0jY^tjjXZǃ=_4؍e[^_]UU=h4tuhB2%jPO UVSuu1r$ugjjjVyÃtjjHDjjFPt${4KS;DH} DHe[^]UEx8th#h&hm hV2%@G@UWVSQ} E@E19u~aEX=ru8u?G8.=qu8u/Gx=luWsZ$tfc fK F뚍e[^_]UWVS0uA_Í}Ĺ 1S^uċ$،蒓$zuubPrYtWWZtNjE@ u WV_XWPVD tjVSE@ t VPZYVXjjSƃx_4 e[^_]UWVS] uUYP}Ĺ 1󫃽PuPZt苅P$V_xt2jjjVǃtVYt P$VPHHLd 1Zw j&RjP8x u0h#h&h hV2%DR1t4Q,1t9E t @11tt:[]UVSQMp@19|h3%h&hh2%19ù|@89¹}@1ۉȉڍeY[^]UVS]1C49C s6SrY;C K$}%jjjjRPRPU Ɖe[^]Ã=_4uUh;fXUS]=_4u1;_4s k<_4[]Ã=_4uU_4]á_4UWVSSÃ=_4ut=;t6_45_419t$USF P>(ZYF<ɋUuG1ۉ؍e[^_]UWVSSÉ։M}h'3%R'ZYuj juWC,S0h.3%V'Y_uj ju|WC4S8h43%V'_Zu0j(u Y^ƅj)P _ZFh:3%Vg'ZYuEhB3%VG'Y_u j(uhH3%V,'_Zuj`u@S( OhO3%V'Y^u>hf3#EP XZt(&>ttVP&YZuG C<e[^_]USPQRh[3%EPj3~-h"uIEjh8&P t2uz[1Eh-#EPg XY:tjME+[h"jfIEZYuuzX]UWVS1jhPjEp[ÍPhd@S @S2:EP,[1Dž Džƅ ƅ tfÃuCt=ut2Ѓ  uuЃ A떋Ex@uS@4tPh~3%Pg ƅEpPh3%j3t1EE@@Ep0Et(pv0v,h3%jo3Vy1ɉH0X,t(Eps8s4s0s,h3%j3vE@61C,S0Vщ‹VZ*H{09L;C, P{89T;C4 PCP- ^_;t' Ps0s,h3%jU2s@\PVz#ZYt$Vs0s,h3%j2q{2XZ1}u#]UVSu EP]Su0 tEHwv}t1e[^]UWVSÃ=_4uet<;t5=_45_419t#UuSv ZY;^Z{ƅ1h-#P XZ>tރuJtjaYj jV/G t*t t/j jVFKj jVF u7thh:(%PŅ hVP谅   h#VZYuDG8PW<G4&h+#V8ZYu)+h#VZYu)j hL&VU t򉕨hje^Xۋu0iY19ȋWi[j`RC@PZ C,S0C4S8 u+t)CQ RPYZuƅu_, G 1E u踨 G1ɉOOO_O _$UWG@jhRjPkIƋ_,tjP4tKRPPs0s,VFt'8t"P PXZ@8u ǃC4S8)G W$q1ɉSh|dV iRW_ZugYSh|dV: u܋1;s̋G,tpH,9H0u0;u"H49H8u;t밉jSPŀ BuV 'Z1e[^_]Uc@}4t 1=h4]USÉIQHQH QH QH QH QH QHQHQHQ0h#RS ]UWVSEUPUfPfUP Uf@fEExstExl]uq>1ۍujVk@&W茒 uu wu uRCu1jSk@&VQ u%u vu| uًU EGue[^_]UWVSu] t>u1}WEPEPEPEPEPEPEPEPEPEPEPh#V軨4 u}w1M9Mt ]K1ߋH X$9} 1҉P P$ )H X$EE}Uz=tVwAtLw"Q w=RX<Á@1HøUWVS։M11ۉ9uuRjSP07Gуt `d1ɉMMu]썜SjuRVPEЃc}t09tGE}t"MM슌 MtMuʋ0tt9tGEC01e[^_]UU 1tEMh]UEUUU ]UMEPЃ< u1tE0]UE1҉UU ]U EEEEEEEPU EXUWVS]xu,P4x1p3?J} @0P4x1p3?J} P PH1ҋuVi13k?] 319[^_]UWVS u]}1u܉]EPnU sZu tXz5%PEUEԉU؋}uM9u džN,t1uuuuQt1e[^_]ÍL$qUWVSQhy}y}y }E1EEPEPEPMȋUEaE )EЙ]u)։]u]uEEEPEPEPMԋUE Eܙ]u)։]u]uẺEuE}ƉeE؉U׉֋Ue)ӉM]]ȋuԉMʋEeƉωؙMʋEE)׉ t/E Et'EPWVuuEE Eu}tE}}5E؋EؙRPuuEU{4DH~1ERPWVuuRPEE]ÉUӉыUe9E1EPEPEPMȉEp xKE=A}Ẻ}UeʋMЉ;U;EFuE=~]E}8E]1 9ZXeY[^_]aUE]UWVSQME܋A1҉UE؋E܃0EE1Ɋ t.}uÃt&<t" ,1ۅu9ut@u0Eu1ƒ< PWEpWMUE{11҅xE1ҍeY[^_]UWVS,U$}(E,u01ۉ]]]]]]1ɋ]9ً]| E1ɉM܋]]19U}U19E}E1EEU ẺUЋEHXE;E9ME0juQuMU]M MȉE@E1;EE }H1u}u uWV)׉;u} M}EE)9s U)‰U1҉UM1ۋE1ҋ};}}܃}uu VN^ Eډƹ19 Ee[^_]UVSEP$9p |$1jjjjSQSQjURP>,1҉Ѝe[^]UWVSuMU ];k _(u/ȄtaB 19t Bu,1u.R E@M,9du 1dd[^_]UEUUUUUUEUUURU UEUUE1҉UP0UURݽU UEUUEUUP0UURU ZUE1]US]MEE k B(u#1tAƒ<!Ѓ;ukE U1uQЃ<![]UEUUE1҉UUURU UWVSÉ΃8t2$41jVRp $Rh{dЀ3y jhPjR}7@ue[^_]UEP0RPdUWVS]E EC0E1xp@u{4Lu䋀PE19uuE1tr}t[P,}u]9UuX}ts1t@u}WuSp yуtu G{0Ea;hh ZYohSLZYa }U׍e[^_]UWVSEX01҉U1Eߊt]}tttR<tNwtw A,<vy _4CFU,U9u _4@Ce[^]USE PMk K( : uBu'@ ;Et0j RkU Pm 1]UWVSUE}u NtGtRutG_tvpS% GPh%vS FD64t(vtvPSg e[^_]USR] =_4uj EPu ƒ =w uE8tt hJX1kD`4d4u]U U1vEEUEP/U E7ZÅt*UVS14LFZuSLXe[^]UWVSQu>xp19|h5%hd&hxh5% ]9|@89@|ue[^_]UWVS0uU={4]ډ@E =~Mȉ\1ɉ`Uډ@8;FF| FP1RPz~ tjURjVPL tWEċUȉḾ1 u@dž9|Ӄ!lj! t9ȉ׃}vjhve[^_]UWVS]`t0`󫍓0 Se[^_]UWVS4E E th4%hT&hh5% hjF^_&u CEUY~11ɉKKCSƉ׃s {$Cǃ?ǃjh>RP!@ǃEPuO^_t!ẺEЉEԉEȉC1҉ ؍e[^_]US]=_4uF1Ҹ;_4s)=w9t kD4B1=w kD`4[]Ã=\4u ^X4UWVSƉ $41󫋅 EU RPVh2%h4P E jhPjVC)xShydP @u VsX1VhjSua e[^_]UWVSlu] E EE$EEPSV EPIډzXE8t%E8h6%h&h h5% 1~,u3FuuuUM uxMQWPRL u GF,;x rËEċU9Uu;EuE̋M9Mu;EuՋF,MQMQuuuuWPRxà Y}w}t }t#1A}tPh1%%uPu` "}tPh#.%PhI%uu1 ؍e[^_]UWVS8Ɖ˹1jhPjVP'1ɉDž11؉1u51 RPhSP =|e=ZbƋ!!Љ u9twEXH!ƹLEXfUtƒ<<„t <uh[0101ff=Ut f=u(Ћ,D1ɉNu1󫋽~wRXu[tO ttGEt%,MPP,1RW6P Px rt6t%F,dDž $t tW9,sAu1hjG>^Zt1ɉF1*1҉kX1u1fǃUe[^_]UVS0E E th4%h@&hh5%< hj=^Xu1E u薁 CEUY~11ɉKKCSǃ?ǃjh>RP@ECǃ1҉K0SUE^@uSfAhރ{ u_C$9S }NURjSPL t;M܅t4`4t,`41@=tD9u=uSXe[^]UWVSSMӅtY0uƀ1҉8,0)߅uU,)ƀX[^_]UWVSP}U] J3ȃ<tu&`t$[choXQ1EEJE,K1CB C 1CtqE1ƀEDtP?1҉TY}`t01`1ɉEǃ<t}tAu1ɉM1EE9`uƀ1҉vN09MuCt:6%29Mt΋0ukE00,09u/1O0t0uu 10M`0 e[^_]UWVS,É11@jhRPSyPhd@ @tۋf=tf=Uƀfu fǀf< 󥀼t!,;duB $u͋0u< 󥋅EE 1h1󫋅,t20t"uh#h &hh5%  u/ƁƁƁƁƁƁ} }t~1É1uvB? ڈD>1É1uvB? ڈ49 fDžU1 uAWVhPx30J12XuWV)׋1҉!!S89uE9u=H!؍SS:ș[9-9!gX؍e[^_]UWVS]Euh^6%h,&h .1uEE}lj1Ʌuht%h,&hh5%% s{u}Ɖ 9uE}QRuuK0S[Puu e[^_]UWVSÉЋ{1Ҿ`4`4tBt D9u3{u}s{ u}u}u}v}t Lt4M1;})ωxMH PC u hk"kE UP XZ܍e[^_]UWVSE }Ĺ }Put&`4u{}1ɉt`4t_`41 hr6%h&hh5% D9t Gu]u1ۉ]]]]E1u)E6%}vuuE}t8tރtu݋M\Z]1ɉMZ1]u뼋u^0]M Mt3] ]tu$}rEdu uXM]M9M]uUMUMUMM9M]uP @x|EUx|EUE9}}}EE`ut.1EUEUE9EE}}ދ0Ή1}9}}U|s1EUEU,Mp1t1ptM9ȉЋM|/9t+E9EE|}E1hj1EZYEfǀUƀEEE1҉RPtpu9uu|H1+EUẺUЋE,ujPE}܃ t"49ttPR5Wt 4Y_E0Z}w1u}RPWV)׉E9Ɖ}ME,}ȋ})1ҋu}׉u}uĉ}ȋx|9E}}EU+EUẺUЋEujPE}܃ t"4t9tPs4Wt 4XZ0}9ugucE,9EE}Ohj/Y_uEcLt4}},fǀUƀ0Ë0}00UMыE`E]}v& }v}b}X]puu;u}ʉUHX M]EEjREpRMUEEE1ҋ]9]ЋuEEM1ۉMĉ]ȉ$tuNEEE1҉UH1ډƉuuRP)׉}9ǃ}U1UĉEȋEċUȉEUEU1ҋM]M]9ȉ} +EUẺUЋEp0\EX}T>uuuE}܃ t3UŒED4Ut9tP2Wq }UD4_XE\Fh۳jjP٭ 1}?t;_uE@EuՋE1EE1ҊG9Bt<utE0E}tbExt99BEXEtكt&t!9B1ɉME}tX̋E돃E9\=,ujSE6}܃ 49P0WPp 4XZЍe[^_]UWVSL]E EEEuC,t)uC0EMċUw-:PX{,BC0EMċUHu1uĹ 1jjjj1RP1ҋ};}}EURPjEPS,tEUEĉUȋEUẺUED4jVSUE uaduVh&suuuush&C,u*E̋U19}'SjRPuusl&C, X({,tˋC,tPC,e[^_]UWVSdE}Ĺ u^0]H`4`41@=D9u€t 1ۉ]1}t ߃tu‹};} uE@uǃt"9t}hR]QEEM1H1EUȉƉSQRP)׉u9}1UĉE11҉uts;E @˃tuZ}`tMt;E ti@EMt˃tt9E tA@E}uы0Bp}t E6%E}U1ɉMEċUȉEU1u9E8ƒt<E`EUEUЉEUMEu49MEEE}tIMtƒt6<t2,AE1҉UI1M]‹E9‹EU}0n]уtt@uh#h&hT:u09EE}}h}[UUűEЉEuEEE,EE] E9sEjQEpuMUy}$E7%]]1ɉM1҉]ĉUȋE19u֋M}ẺUЋEuuWME]E EE t];u ǀ]܅t'EDt9tP*SKj DXZEt uDEt ]TE9u/Eu;h۳jjP7 E̋UЉEU1҉}ttBuh#h&hl8EM]M]։u1}9΋}})щ h5% E}uEgEe[^_]UWVS]uh2%h&hk h5% Es0h9tSME M9u㋶0u͋EtP^C,t PY`11d(FZus(X]e[^_](UWVS}G,t PXjhPjwB Ãt7WjR$YXtRVSVX(SSZWXe[^_]UWVS\E0hq_E0h#jP]SN jPSSj Sy Ǎ@^>w̋E0h#jP]S jPSSj SE ƍ@[=wʡ{4EHDEU}~ E1ɉMRWuuSVRPމؙ9Uu9]tAˁ~ƉЋM\1҉`@EWVSuE E0E8e[^_]UWVS]E EEEEEܡ{404}81HDEU}~ E1E}u?9}/jh>uu=~?EEEUE܉0t}܉}UU}} ]e[^_]e[^_]UWVS ]{4480hT%h}WuVEPS$xuuuhT%hWVEPS>tuuuSЃS,e[^_]Ujj je j PUS2 P $5!#PSh8%h-* j U=-u O-4fPftP Z9-UWVEE왉U1E}ujEPjB e^_]U0E E1EԉE؉E܉EEEPEPu ƒ xEÍL$qUWVSQ@@u5jh49O 44h4l444XZjPO h4l4x4|4+44_X49}944s74󥋅441=4uhjjE(t!j$jjV =4u`h"P蹴 `4Y[tPhW$hPع xp4t419߭y%ݝ݅ %߭ٽf f٭۝٭y1d~dVho$)P=P& Nj4~-`4t P Z)Å~:ùdh5!#)Sh&Pho$)P=P ǃ119ʉst @u4&SQho$)P=Pb +44+ 4y @B%ڽ߭ x4|419ظw ȉ߭%s9ٽf f٭߽٭=ٽf f٭߽٭É 9ǿs tA؉ݝ4&%11d PVSho$)PP輶 p4t49ljx4|4)ލ 9lj݅99Ћ}ho$VQ à +h4l4߭߭ٽf f٭۝٭?~~ho$rtPh"VQK Ãh8(%VQ8 à <ЙRPhp$)PP Ãuh")PPմ à 4fPftSVP  eY[^_]aUS j X]UWVSPu ]Ett v9s 71;uuߋuE9s$;ut:GFFPhG%jW& ؍e[^_]UWVSuE E1tpH-td:t_ tZUx}HM=-DWtDOt uxu 1!tjjEP2  FCE덉뉉؍e[^_]UWVSujuBZYt&Vu PW9ul 7؍e[^_]UVSu huà @tuuS_S؍e[^]U|EPuGG ZYtM EUQ1UWVSEE 0Vj S= DžuVjS+ ƅtu)@))։NjE 0E8 uC t  Ȁ# Ȁ;uڊ t%\uB"u#u uB1ۉ؍e[^_]U  StP KSstPtVPV~ t vXVYЋtVPV~ t vZVXsu҉]e[^]UWVS] u 1;uCNVjSV u h@&h9%f~ 7h@&h9%GJGH))րx u@'˅iuh@&h9%;[^T1ɉ PWuEpK(@h@&;! Z8 8#u1Xe[^_]UVShVp F u h&K;Zu SX PVS 1e[^]UWVS]} uPh &h9%; f%fsVFFtNMEUE UEPEPs / @u1 8 t 89th&h9%}:^_S[VtPSV1ɉC F0s {u0Shjs C*.@uh&h9%:XZu s]e[^_]r@ue[^_]US]j$S Yt:XU P UP1҉PPP1ɉHPP 1҉P]UWVSpljӉ΋EftPh &h9%~9 EjEPEPSyà jjP PjS @tpjjS t^PjS @tLVSW t:Phjp ,@u0h &h9%8h &8Yh &8SXZe[^_]UEM M]UEM M1]UVS]uhU YtShujP,@uh0&h9%8XZhU Yt1ShWjP+@uh0&h9%7XZe[^]UVS]t P@X틃1t:P_,xǃ0 @؉Ƌu4P,/ǃ- uȍe[^]UVSlM uEPUZt%ÍEP̼ $VS @u SX؍e[^]UWVS} ~ 7N11;] },E4Vl ZHw̍CWPE e[^_]UWVSUu }u ZZt<v }D&7Ep V軹 YƒwCljt)1E@EȉC,ub Ex txj(Zu hT&M3XYǃ,f@S(P1.1;,s$k(рyus1(D@4u e[^_]UWVSSƉM׋ttU9t7{ t1 ufujuP9 t[뼃 S Vh9%~2 e[^_]UVSÃHt1HL~t9 HXP* 1LXPt1PT~t PYP 1TZ`t1`d~t `XP 1dXt/tV1I,X} 1҉Yt/tVH,XD 1Xt/tVH,X 1Xht/ltVH,lYh 1hZe[^]UVSTjjjVmD@PjVj48@t@сt t t48SVQkXZe[^]US]E ftPhd&h9%/ jP t(@t 4 hd&/YE u1҉U E].(Sh jPe#@uE d&E9%]I/]US]E ftPhP&h9%7/ j|P t@p v|y Z 7`x |>xYZt>1҉Sh"j"@u;E P&E9%]x.hP&n.XE E]']UVSĀptQPhhxVS@u h(&.XV Sh:%- e[^]USË4%uXhF:%S蔔XZ{PtS0Ytp%tSLt<:%Ju+#PSIXZ]UWVSÉ׉΃t t%N:%t1PS迮S]jS`AuV:%t#PSXZe[^_]UWVSÉ֋8 Phe:%,1ɺhXZu]:%VS蘓Sjj$1ɉK 4%ujL%XZe[^_]UWVSUM8tt^@@tR{ tGu}  t1҉CXZ[^_]USÃlt1u?hvPplPh|:%+RPXZlu]Ãx tkUSË%u6SC% Y u=uSmZ S.YuS؜X]US]S=Yuj#XZIpQpcvPh:% +j#Shjdj"]UVS]E ftPh<&h9%* |)RxPf uh<&k*X;|t xD8t|xth8- H 1tf @-yh8-j F Y^8-P8- Sh j@uDE <&E9%e[^])jXZu Ee[^])"e[^]UVSjh%ZYuh%h(|#)[^"VP$ZY@u Vh:%(ZYS)Xe[^]UWVSPu~ % tVXtpE&%Et%`u VYE%@u$t+`u#V+Zu}V+Xt%e[^_]UWVSE48ځ` u %t8tf% tWYt ߉%@ tWP+Zt 翉%` t떁1u ځ u@\e[^_]US];(%P6(jj#jj#4]UVSS]4@tp%@uft0t0VY%t1҃w&R Vh:%&SvSZ%tw4&Vh:%W&[^8%th:%e&jN Shj4u^%@tTS,-1ɉMjEP,۾@u h&"&Z,ǃ,Xe[^]UVS]h{"&48с^t:t0t~ u h]:%VwYXvj\XZe[^] @48]e[^]6UWVSD]u Ctt,PCQPhj@EP耖@uhl&E%EYE{ VEPW3buVWh:%$ {EtSj@VCxP VWh:%$3'`U D@RWP_Cx3_UXZe[^_]UWVSÉMt0x11UjSZYUu 1{ K uRPQM3^UM   t*;xMu;0tQh;%#11҉[Y^{ tHEU  Ѓ t3 Z@uh&#Xe[^_]UWV։ϋD@WVXZe^_]UWVS]%t S &_u Sh*;%"Y[ % ڋFEj EPju{ }PWhB;%"M1҉1;,sYk(jQMu) Mt5j EPjQEPMAPuhN;%#" MQ~G럋 Sr3Z@uC Phe;%*"Y_ t{ uS@2%ZtSudX{ tS5_t>{ u8u %҃RS}ZY@uC Pht;%!Y_t { uSjZt]e[^_]e[^_]UWVS(]} uS$ESẺ{Ls$S$ ({ }u }s uJS蛣Yt?Vh;% S{SdS諤j3XoE ;%]e[^_]nVh;%f h<:%SX11҉ 9C$u/S#Z@%ݴ 8E<&e[^_]G jjSn"SH#@u覴 8t h<& _1EE A]e[^_]2"}{ tC uPh;%Ph;%Y^{PtRStCQEЍ}ԉƉщUStCtZU9uPEPu' t{ t911҉{ t411ɉh+#SS+ES6]e[^_]e[^_]US]C Pt$ZYts$sLP ]]n UWVS];1{Ly)tC$tjjS 14%tutEC$u?tS!Y@u h&xZjjAS @u h&]X]e[^_]US]C][]3UWVS ׉΋U K 9}!E4UQM蛤 YZMUtB;u t9{ ;u u{ t|EUh;%S_jjM%tuuS %tS薞ZSKSX+9t'C jjM$S [e[^_]UWVSS] 84%@tjE1҃ t6HjEP,O @h&h9%_tm>hn%h><%h<%@t+XRDAtxUh<%h <%h<% Uh<%h$<%h<% 1Uh,<%h6<%h<%p 11hE<%hN<%h<%Kt [hV<%hd<%h<%<J@ulhl<%?Y_jjjM KPht<%3<4u544%u dW4XZe[^_]USS]E uPhx&h9% jEP,舴 uhx&j4YuZ8t$hx&h<%vj,,8ǃ, _w$jPhx&h<%j6U8tu h<%mYuSRXZ]US]E U{ u)C щ‰ { t][]~[]UWVS ]]} utSEtXZu ƭ w{ tC Ph<%=%^_CStP }tQSSh[1pEPjEPu Euh&YASuxXZu) ~ WEtKYXt3{ tC Ph=%XZF$C$N>K>tmC**aFVtPMQV1FEtPV2VP~ u!Wh4=%11ɉtY[ۃ} ~EPuu { tSZPHtJHPXEu}OuEPu ؍e[^_]UWVS]DžPPhh@ @uh&hH=%)1XZhW=%%Y^1hPݰF1׃ u Vh=%XZu8 87t. 8 tt Vh=%^_\XPS+ǃuh&r[ttlHp VW ZYu VjS ϋFVt=PVF PtZYt%Vhjj 7u7W1FtPV2VP~ t11ɉ3VhWtPtStPS| e[^_]US]E ftPh&h9%a S躡Z@uD賩 87u ]]蝩 8 t蓩 8Vt艩 8tE&]]UWVSD}U uMtNˉUMPV ZYUtOMv_. 7 }E &Eo"e[^_]G(1f9u2W>G(1f9uW>uxG(f9t& tʉUQPG Ph=%UfW(W>8uHUPVG*Ps  Utn uG>j u G>T tGjt G*ˉe[^_]UWVS,}E EЋEE܋EE؋h>%S ^ZuEE ">%+h)>%S™ ZYu,EЋ@0S ^@E] EЉEe[^_]h9>%S腙 ZYEhI>%Sm [^u EЃHo1E9}E4袘 Y\FSEZE1ҋE9}?E؋ UQMj Ɖ$MQu  )KEƍ@E UB 뺋E@uhR>%u-1-E 1E111EEM̍EPh&hg>%uurMtvkt@(NtT4tW6uE븃UuM@몃ptxtnu딃M뎁M녁MyoEc-E%@4@E܉E1E11ut0tX~ tMڍN U9U~!E4UQM蠗 ZYtUBM9]uuVju EvjEPEp l uot0tR~ uvڍN U9U~!E4UQM ZYtUBM9]uuVu:u @u414E@t詤 UE%  9]u%}uUMhjQt8EE̅x ލW u9u~E4RU> ZYt FUEЉUԋEU E Uԃ}t}t}u}tM 1҉EЋUԉ/tP9]u>t9[E4tY[tEX]9][tSu؋M܉^XZ9e[^_]UWVS] U1{>tNf}fC(ffGfJuj ȋuFZK>s*S>+Ee[^_]UWVSu} lhF%hPVZà t1=whlehF%hh)F% u?G PhCF%( tXZ{>u[C PhF% XZ1hDPWhohnRPhnRÒ =nwHƄn ƄoPRhhF%V@u-h&hF%~ YXhtjWhà phthfF%/ Xϋpe[^_]á4tU塴4P4U4]UE@]UWVS]u }uhF%h|&hG}t}uh G%h|&hHhF% tu "t 9ptIC ujYuTHtAJHt6BXCpf@up MH1҉PfxCM1 K뽉Cȍe[^_]UEM uhF%hh&hhF%) u e t 9JtI BH@MUWVSM Ep}y1yy9s)}_+Yy tʚ;1Ƀ}t}[^_]UWVS$Ǎ]SjND EPGPShEUЋG uʚ;)U܃tHPU1ɉM؋]9ڋ]]s 1҉P1 ])ډPX )9s tJPMىH 봃ue[^_]UWVSU} uhF%hT&huh(G%hT&hhF%萗 }ʚ;vh9G%hT&h܉É΋P t9zuM9Ju JuK$݋S(tJtHK,JjnYtcUUrEB zEBEBC t&H9r 9ux 9}sHJP1C$BS$1e[^_]UWVS]U Eu}xx xʚ;v̜ [^_]É}u M[^_]USEU M]]]] 1ۉ][]nUVS]u E1MMMM i@BU[^]4UWVSUuuhF%h<&h|hF%ܕ B 1ۅtI} t} 9xu5}9xu-t9pu$xtyz$x18z,xB,C볉؍e[^_]UEuhF%h0&hhF%] U PH@LUEuhF%h$&hhF%. @L11UEuhF%h&hhF% U P0UP4UP8UP<1UWVS(]}1Eܳ/E@uhF%h&hYhF%蠔 1҉ỦUЉUԉU1;s4s,C0 I>v  DFu EPj& @u11EEEE1;s4sjEPC04e @tF1e[^_]USjPjo[ZtÍ@Pj? ZY@u SX1/1[1҉S C C1ɉK C C$1C(C(C,CH؋]UWVS]3tg>U t9FuV9u@uEFtB.NtH C1҉KNt R KXVXs@1s@sDCMYC t6HtJKHPڋHtJHPZC uK$HtJHPXC(uK,CNe[^_]US]jSXZ]]KUWVS]uChF%h&hhF%Q 4t,4H44C8tst Ӌ`!ft1f9thWhi6b@؍e[^_]UU1B$t0zLu%1t]UWVS\u~>u P Vv> 7EEEE1]Mu EMQUE UJHOuԊEEjPS&PF PhRG%F>PSVk}(u V*N>׉e[^_]USEtSjS[ ]UE t E]B ]USEtSS[XZ]UVSEu Ʊ9tt ut1t 1@1[^]UWVS}] ?jWS s jWV wmj:VZ ZYDžt?EPjhjjj jGPp C8 }t{ UC8jVCP- F DJu <:tFu}Wjhjjj EPVo C0E t/it.u#Wjhjjj j@P_o C4 }tC41e[^_]UWVS<}u tAu}*EPV[Z1@u0tC WP螀 ZYt[u{e 1ۉ؍e[^_]UWVSSE{ su lZYSs F<t <t3KCtjRPQVsu ju$R{C~uN ufF tUPkjURWPVsu juD(C*WtE4%@u1t(SrZ@uhG%AS SwC@SzvfCDCCHSu @t CPCHC pSHuCL1s@CX_XnƅRe[^_]UWVS4] 1{ SB u%zu_vZEԃ v r u@)u;B.t/t, u'Er uu}tB }| KK9ruEtt 9st[Q ؃4[^_]+ US]S_qZ@u:jhj @tjhj @؋]UVS t=΁u$B Ƅ Ӄt ӁtӃuӃ uӁu [^]UWVSljQ Zuh&LÉEhf3#EPS ZYtfP Xuh&S[_LUj@PV  Uuh&SUR q7SXe[^_]UWVSSƉϋ]jhH%RU UuA}H} L @ð`jh H%Rz u>MP} Tð0M@} DKS0CPp}7uMU E$e[^_]UWVS EӅt΀9uE1҉1j/QKM Y_DžuuV} _ZumVhH%2@EEPjj jjj ju0c }tuh)H%2Y[:t SPs[ZuuVa} ZYt/1tE0Xe[^_]UWVSÉUQMs YM<9"u"OAIQMjիXZMt3t 9us 7QS螫Y[1҉U}u9tEtCE9KEp9ush4#Sl ZYudžEPjjjjjjS }ShH%ZJEPjhjjjjS Z F }ShH%8%EPEPEPEPQEPEPEPMԉډ 8%CEPEPEPEPQEPEPEPMԉډ jSuuuuuQt ShH%fjSuuuuuQujSuuuuuaQ볁111otq;tlj/SB Y_M̅tU@j/PdB _ZDžUuًE#ًE/*O1t1ۉEEEUEPjjjjjjS藠 }}ShI% )‰U썄jYu h%I%R9  T uh/I%oj,SA _ZDžtxu ShRI%V9u:K j@Yu h" t%Ɔ EPjhjjjjSV E, }t hlI%_ )‰UčEPSp _ZHUu-u 7L U䉔) jWY ]̈ T <4t{4u  ;6t{6u @C빅EPjjjjjjS; }!ShI% ~LHL+j,S> _Zt Se P U$U[YUShI%RPR 1ɉW贺Y}Eu Ƈh5hN%Sf ^Zu ƇhhI%Se ZYu Ƈhh.$Se Y^u ƇhSjbE^ZPl跶EZYuh&^lSP#pY[{u Ɔ 1kh"SGe _Zu Ɔ Nh %S*e ZYu Ɔ  1hI%S e Y_thI%Sd _Zu Ɔ ShI%pt$ jٺ@[u hI%1 EEEU | m^O@8%'EPEPEPEPQEPEPEPMԉډ jSuuuuuJjSuuuuujJjSu8%EPEPEPEPQEPEPEPMԉډ jSuuuuuILjSuuuuuI*jSuuuuuIjSu,^j=S ; ZYu hI%@Ej hJ%SG up}u11҃uM#EEEUIj h"J%S u}u:1ۉjh/J%S u0}u 1ɉM1jhVJ%SR t@jhOJ%S> t,jhEJ%S* tjhBJ%S }u'jP%XZWEEąuh^J%OE@MEM̍UE@u E "M1ҍE@tE WB#XEPRU2EPU̍BP2EPU̍B8P1WURP%$1ɉjhxJ%S }u'jP$Y[BM1ҍE@EW{"Z61ɉMURPEK1URE̍PR;1EPE̍P8R+1WEPPH$$1ɉjhJ%S7 tjhJ%S# uB}EPjjjjDjjuz }`uhJ%j hJ%S }uߋEj/u;7 _ZDžtSujz Hu_Sujz HuOƆEPjhjjjjGPĕ }t uhJ%uhJ%11Ƀ}^ٍUE`j/Sh6 Y[uEjP JM JM ٍUEsj/S5 _ZuEj P  J M J M \ETPT'E߉EEUEEEU  %EEEU Ɓ QR󪍖 fFPfFSfFVfF^fdžƆ Ɓ DžtG1ҍEj@P   JM ^Åu  8%t EPEPEPEPQEPEPEPMԉډ jSƐVuuuuA" h 8ShJ% q $IS $Y[ h&> 4%tu h=K%fF@u Sh K%  s d X @I : + uhK%V EEẺUЋ4%t%E̋UЉ1tt h5K%E̋UЀPt @_t1j/S1 _ZDžtGڍEY@uShdK% 1,E̊EE19M k(Pu*t,Uf9Pu#U8uU8PuU8Pu U8P A밁  K  @ED1HEL PETXE\EċE18E1҉uZ }tEHM Eą huK% EH$MH(MąuhK%}tdƅu ShK%r EPjjjjjjS }t ShK%C FÅtMhK%k1uLƅtFj:S/ ZYt8URjhjjjj@PtE 1}̃}t'hK%j=Sq/ _ZE1ɉMt@Eh_$SǯZYu)u hL%p0hU%S药Y_1utčphL%S]YZu( sPu h%L%Uph}#S$YZu(:u h>L%ph"SYZu(u hTL%ph{t8@,9tt(MMċJ]ĉ k,1CC C$C(S_YE{ECs Cǃ}t uQ ZEủ)1 E}t5E- }t }EEHhL%`" S<^ud}Sh M%@dMA2Džt @hd%SP ZYUĉMȅt"hd%SP ZYth%SP ZYuEċU ẺUE%E̋EȉEЋE̋UЉhZM%SqP ZYu\u h%M%30uQWjRl HRhEM%PQWj&l Hu؉߅ hP%WO Y[th`M%WO _Z@   jٺ[u hjM% nbV@JEPjjjjjjS3 }ShqM%tzEPjjjjjjS }ShM%QtEEPjjjjjjSƅ }ShM%PYuhM%XZjE@P(S i(,P,k4EfFFE̅tHEEFEFEFF}u!1}F1uFj/W& Y[Åt/uWji HtJWhJ%1}_X/uWji HtWhJ%}̉XZuf~jCEPjjxjjjjSZF }CShJ%FY[-e[^_]UWVSEu} EEEE1ۉE싀&tM܉UVPL ZYUMtCnuFE샸&uu u E#DEEEE}  &EEe[^_]E8%uu EH%e[^_]e[^_]UWVS]}1-} t]%E苃%`E?EPh&RuuՎtAjj5 p7PًU E=ƒu$E8E%g>%tf>%뢺} t*%Ƌ䟉 u }쉳UaUЍe[^_]UWVSQEE] 1 t 8t R舟ZPX1t 8t R]XPTXEtu7jVu| *$@%8tjjV  txTuxTjP僻DtVr,DX@辞HXLtVE,LH蒞P_TtV,TPfXY\tV,\X:(/XZ]e[^_]e[^_]UWVS0uhdj虙ZYuh&X9Áǀǀǀǀǀ@ `h&P48Y_tt %t 4 4up4@4jjj? tP] 4 4Xjjj tP\ 4 4!D_ 4 4ЃhF+P P =v1 1ɉ} !8%j,jڗ@_Zu h&!Y ǃDj,j讗H_Zu h&Y ǃLj,j肗P_Zu h&Y ǃThh@&WO =vh&hM%XZPPZYh-#P# Y_t u-PP1҉xWE ZD9t t ux\tH@ߋ@D1@DHLPT1HLPTXh\l1X\hP0V*9u0h&ho" ut=w@ƄS0V 91 1} 11PP}YZh-#P! ZYt u t:RD YD9t֊ t uʀx\tH@߅tC%䟉1h7$"D YZ} uj`@Pd u>ju P" d` Zuh&_G`hH%|C ZYu;}uPUC Y_$h#+C YZuA}uPC _ZutDž}tuhM%B ZYtOPPًU mDžY1ɉLu}tSV)P XZ1+u؍e[^_]UE E9r9]UU19U t]UWVSǃEE1fUfQMKZUu8؋Msۍ;ƸE9EsOƋE)Ɖr=89s "@G19r)SEЉ‹E9s )։1e[^_]UWVSSU uJTuhP%hd&h~TuhP%hd&hhP%tH YLGL9t)cCu)U QM<W<ZY8ËMU t u7F|B|u t  tAH+GHu9r9e[^_]UVSjjVà tSV6S襔 ۍe[^]UWVS8}1}عEX}ى‰+E pE؉U EPW_ZuUBtt U Btu VStZYe[^_]UE UU E]rUS]h&P$hx&ØS]US]S Y1t S Z]UWVSuhQ%h&h hP%F Ɖ׉j<|QS CPZtS8j,@ /1z'1zuz uzu 1z1U幀U E]UWVSu] }uhD%h&h{uhR%h&h|hlR%T9 Fu#<u;FuFPhE$WSF @u612WSPFDPhÃVWSPFPR Ã؍e[^_]UWVS}] uhR%h&huhR%h&hhlR%8 GS8t)R78s<t<t1&vvRS Q} e[^_]UWVS(uuhaR%h&h$FE<t<FVU1TF1 G!)JO9t= B@t8t}19sF8}Єɹy$At}!u}@]9s 8t1s= /^1ۀ=4uV}ع1E׈E4S}W=WV&thR%h&h'hlR%6 4؍e[^_]UVS]C<t<t= /g S؉U Y=4t154S6Z;E thR%h&hnhlR%T6 4Ǎe[^]UEU uhaR%h&huh%h&hhlR% 6 fPUWVEu uhaR%h&huh%h&hhlR%5 fe^_]US&tPhR% XZ]UWVSD1}]Sp1Z@j0Sd21uuuu}WS21;5&s/&H>v h;  DF1;5&s/&H>v /;  DFWS2; 1҉u uSjE0EPܝƃ S 1YEt : 0e[^_]UVSuEPu V uVj ZY@t؍e[^]Åt3UWVSƉ׉ˋtPWhR%Vu 1Íe[^_]UWVSU} u19s$@u9s8uhR%h&hC؀xth:S%h&hh S%3 u1X9s%UjKQP t؋UGJ:N9s@u1Ѝe[^_]UWVS`։ϊB _`u1P`Pk~XZ- `S X4%@t _t^Fhv#觢YuNS%PhlS%S @貿 PhtS%S @uWhS%S @dlhh{S%W* YZu@htDžphxDjVYZuGDžphS%WE* YZW) Z|6hS%W* ZYuDžphF:%W) ZYh+#W) ZYh<:%W) ZYh;%W) ZYhr"W) ZYh=%W) ZYuh]:%W) ZYpDžp Džp_t@F PhS%SY @p&tPhS%S2 @84t pNdX#tiT%RhS%S @VL%t #$Ju;%PhS%S @ZvHhS%S @BFPPhS%Sq @(v$hS%SY @VPhS%S=@~Pt?vtFQPhhtR@ttRhT%S @~xu=4%@J1h&tP=tXY#FxPhT%S @uRz u RuARTX,QXtP ZYX9TthT%S ZY@jjtP藫ƒ ttqXjjPx X9u-BTX PhW$SS @XjR뛉Xh:(%hW$S( @Xu^jPSjn @Dh]:%W_& ZYu-dXiT%#h{S%W!& ZYhF:%W & ZYh+#W% ZYhr"W% ZYh<:%W% ZYth;%W% Y_twpulelxOpu VZ;puh/hxDpjVkY_#iT%#Ph*T%S9 @Wh3T%S# @VIuZ%u6u_%u*Ph>T%S @ut:u%uߞ@t>(WtY%uPhNT%S @ubh\T%S_Z@Npubll@lq PVh)%ST@d)%h@pt!pNVh^%S 1huvh@Lt㋍hqPPVh)%SI"@urpt)ptptVS'ZYpujlt l@u1d lqPVh^%SS@d^%QNppuA 8tV _yhpHpDVh^%SW!@WpCPhW$S @tXd 0uS S¾Y^u h&賛Z#_tFP`P u,h&胛X_Džp؍e[^_]UVSË2;tPSe e[^]UWVSQ} utu=GL<:%t +#Htr"}tE1@ۅt"a1ۃuZ xut@xt:HHu 1HH}tE-@uCt WcZt!CE}tS%EE@t]jW[^t WYuu"Ep}tS%Eƃuًt 8u1W Zt^}t8EgÃuˉ؍e[^_]UVS]u tPހ~t9 . :jhnT%S貲 uS/ S\ \ZY9rh8-I X1e[^]UWVSEE} u |Uƃuh|&Y[jhsT%W$ uu Ee[^_]E1҉UWPE PhxT%5EPFƃuuhp&ho"x jEPVx3 @u , 8thp&hH#=1ɉM^_Euƒut Y_th\$S- _Ztj hT%S躮 t%tj.S> ZYt؍e[^_]UVS]u ' F Ct h U% XCt hK% XCt h|# XCt h" XCt hU%t hU%t hU%t h%U% t h,U%@t h4U%t h;U%shFU%ssh%"fshRU%Y sh#$Lsh\U%?shcU%2shjU%%shoU%sh݅# s hwU% XCt h|U% ^Ct hU%x YCt h_$g ZCt hU%V X oE8-e[^] UVSM] X\19t 9t&B,hl19t 9tB,1[^]UWVSu} S Z@uh">%h'D%hU%WVb `PPSh">%h'D%hU%WV8 u.P9r)ǍGPCP$ZYtۍP9r:)e[^_]UWVS EPB EE[tF  >SP ZY} -];уM I+ѻ}hf3#EP ZY;tjh H%S ujhH%S uu1;}1u1;} uJul& [EPjjjjjjS1O }tG,9uSv  ZYEPjjjjjjSN }u9G,nFul% d!ukX1e[^_]UWVSM 1҃}twE8to1tA1]\t.u#]<uu'7t)Kt/@ t @B뼉)It tB[^_]UWVSEEEUE E܋]1ɉME9!1E؉EErE,@x n$ VuQ9uuW$ "E%?B ȃ}uz}E؁}E‹E9r봋E9UrE}DEt.O9Ms # 7뎉ߋM_.MIE)M܋E9,}v# M}}9]ttC }Ut;]tC } t}E[^_]UWVS u }EEE]1EE9EEEPs2 & &Csy7Ku-y)‹ -DAt/rumr^s ‹ -DA@t" t\tFx+B -DAt/t U7" Uu=k#" t#w" 7f\\Ev\0C0C0SEttNCEqt(tsExu EE [^_]UWVSÉ׉U.ƍPSSoYZ@WhW$S @}uSj= _Z@u$p h"S @u@ s=Vu hV}^P~n sVu S?> _ s Vu SD=  uH V* t.Vu PhV@VhW$S?shH#S,ZYsE1D0t<0u FuM )tSP Y_@u|u } 9K;} u@tPh%Sj | ^Z@u3tPh#S @G루tffPh%t&ffPh#S @c t Ph%@tPh#S t%7oPhW$Sk @sWj.VWj1 tcVhW$S/ @tQ?tGuUWVC*PK U[҃VSTm_Zu VSm[^tRXZRYtPt蕉rVS舌_Zu VSZYtX /1  ؍e[^_]UWVS(E̋A tӉ΀ytu xVx}WY@$1FCt}ЉF tCUfCF t#UԀzu ztK|@FtC8F t CXUF0CxFftPEtq_ZF tU tUԋECTt14~t  h8%Et܆CTZYuՃe[^_]UWVS8t1 F1Dž@jB UPP$sfDž ˉhPhiUp UJ>r*hPhip ,؍e[^_]UVS1ƅ@ CtDžC8P^CPƋƒYu9)Zu)CT@fCXP5_u tЃtЀC| t Cxt(1ɉ,uCT1fDž @fp׉މ;tHH tut󥃅 T upVXZtHHt'CstHHt󥃅  t'CXsXtHH)fSP @؍eY[^_]aUWVSDžLDžP"1ۉTEXDž\1`1jjHVjjLPd @OHuWfSY1CPWOXZ$jjVSjLP @u 8 넋H؉@D@9DDx9@sX DD9@r׉F u]dETuGuSXu h'wX?$RuSU ^_u1XZ]]o@UVSË%tJC><vBD&FTttT9t0t&NT9JTuu _: 뻋@À{>v P ShW%Wc e[^]UWVSÉ։h,j9ZYt:PǀcScufǀ,1e[^_]UWVS0ÉRi^@u PhW%qbY[.Gw*hH PhW%Bb %th, Pj8XZt@dtVWv<u?(9x u1Wt cScuGhu @F @(GH>A<wO*󤋅% t&x utmtdf@ tStJSjjPS*V9Ѻrf‹fP@TȋG,CD7LJcSc_$tZDcScuQtu?Odt Ghu;Yt-fǀ2@$)f5XH~$tQ~DcScuHu ~<u|t2<t&)ڃ*f@6Vt4L7Pu"uJƃv9C,m@1;D9s 8 ttBxrhуuL>t4L7Pu"uJƃv9C,VP)HFGWu*)؃f9 ffC tHGY u<)9dCM A 󤋵 \ tC)9C= A󤋵 \tIt @W uD@Wt"@W uv tD)9UC< A 󤋽 \ttRC4%u+@t@Zu)؃fPhP ƃ tt)߅tPjVPYY9qQS  C{fCWVY^g0Q COt/t+VL Z@)9 CKt tRG%t4@^u()؃ftC uO t>P)9rNC A 󤋵 \C))=+w/D@ PhX%^XB3 e[^_]UVS~\jhPF\ uFt 8u!5 -h)X%WY[ Sh'ho"W 1ShjpK@uh'h9%WXZ1e[^]UWVSE}uh6X%h'hhDX% Ӊ΋S IuN EEE싐%tZt Cts mjSu@ u3@C CXJP S@p@P& Z J(H J>r*󤋅uK%t9 t/hQQ@PoPB PhqX%8B>u1DhQPB*P5P RhX%Rhl'GSXe[^_]UWVS$Ɖ1iu1hX%Rf-Xfth$SPà 1GiPV RhX%ZRh$SP6Ãu 8t8iW Vho"R!w h`' VhX%R 1`64%@u"j5S,Y^@uƅS$Zu h`' RX뢍lj󤋅e[^_]UWVSS]Sj8^_t]u1ƀ8tCP9$Ztlje[^_]UWVS$ϋEE EhX%R ZYu}]ƅP6 $#Xۋuh'QYuQVhRSV+<@t-PPzk XZuE'e[^_]P1j6j4a@uƅw x, "j@,Ph@hW;u"WPh " WPh "SVhX%N$v "t[$u)跃PWVhY%yN(莃PWSVhX%ON ]e[^_]C*UWVS] 'tPh0# XZE1E;s31;Et k, 9t@v 6hY%| PV膹G,1;uts 3hY%V PS`F,܍e[^_]UWVSEvpE E] P1}tEu萂SPhjQ%u @tBE^PmPh%ug @t E9sT;] us< v! Juj 虾 ZY@u؍CT9Ub\ "ujc ZY@te[^_]UWVS]u }~EHt t4PWhV+@uxVhW$S Ut" QSj ҽ ZY@tǃ7TPhW$SP @tE)uSj蝽 [^@ux 1e[^_]USS]uEtBSuHPEPjZYu1}ufffDsD]UWVS4E 1҉U@hpuԋ@E܋E E@_tE@o^'EPjyMԋU܋E 5^XtE5!#,EPhMԋU܋E Y[EY%EU1҉Uw|MUu X1E}UċM1uGEEPSuEPCPhEPC8P[Suɖ tEE99w< v YЍBEȉD9EM "1E )уȉEU@t~TCtE@Tt 1ɉMEPj!MԋU܋E XZt؋Euэ<1E9ECEtu :Xu EEU9t M;At;A u1EEIʸy,%=tс1utȉE@uFtEPV֡EPFPɡEPF8P輡Vu* ]E@PEPjMԋU܋E Y^u1҉UU9u XEEPW/EPGP"EPG8PWu胔 ]뤋E؋E%u3E @hu$uЋE Ph!Y%iHE؁ Ee[^_]UWVS(}ƅj4uM{Y[@uƅEXuX uExlSt|Pu hEY%u@ujuMH^Z@t'^1Pu hVY%u誡@u-S1P|Pu hhY%u@ujuMZY@t,E#pV{Pu hzY%u:@@ ؉P{Pu hY%u@ut Ex,u@GhElPhhS@Su hY%u趠$@ut 1;j@E,Ph@hSSu hY%uf$@up;s VgC,X鋇@1ۋ;Ds V>C,Xh1ۋ;ls VC,X鋀1@D;Ή⋍T1P1ҋ9tk,;BፕRPMU[XtxG SVhPu u7裼 8}u@v;WP诱ZYt*SVRhPu u7X ,1;Dsp⋍TPuARPMUZYt&PhG Pu u7л F,낸e[^_]USEtE.1CL[]UWVSujh0juR t)Ej}WjhPqm@u SX\jWjjSRm@tjWh@hS9m@tȍU1EfEDtEjRSc @t؍e[^_]UWVSQÉU0!4%u|GtOI9Hu Et` GdPG`_uh'CY؍e[^_]Sh. jP6@uh'h9%BXZe[^_]W|$wUWVS?E苷EF$E1FH~ t)vFFFF F FFF1ۉ^ ^XNvUE䋀_ ƒYt=Ep+Ev$^vURPShY%AF0FHY%%t$v$%vPShY%AF0FH Z%7~@tFHZ%F0u*F8F4v$uPShZ%lAdwjSh5Z%~AF0 V8F0u0E1Em %}fE fEm}mE؉F8A9r=E1Em %}fE fEm}mE؉F8PShUZ%@ V4F0u0E1Em %}fE fEm}mE؉F4B9V8s=E1Em %}fE fEm}mE؉F4PShZ%@ F0E؃>u,Vdt%F$;BuFhuPtuPShZ%?v$xtuPShZ%@E苀4E%t*FH{S%h{S%WզjE8~HuJFt.Fhu(VJ9Hu~<t>t FH8a%FHZ%>u FHZ%FH[%~0uF8F4bWh:v4jES7Whv8jE:7(Whv0jE7v8v4Sh[%>$E䋀~@uH%u>ViRUSh4[%>vvhUR7 @Uu RhJ[%>Y[^hE䋀t=W[2Zu[E苀8E%t]h:%b>jEH7 >vHWA75juWt(tFdFhӉe[^_]g_e[^_]g_UWVSPuE EtuVjj<6(tl%ub  CiP66V@ t;{t5{<t/s$qPF Ph][%_=1ɺVjj51s p1C Cs`CCCC 1CCECHt V0Y1ɉKdChuVѣXZs1CC C$Zue[^_]ae[^_]W|$wUWVStEUM]EEu\Pg?_EPT%w[%u@'Ht :tRQE Ph}[%;1ۉ]EPLt @v@}GLih Eu>ZYEE1}m5 %EPT%w[%u@'Ht :tSS$RQE Ph[%.;MUEE@iEEE@ht 1ɉMExdtj$PuP% t؋E@$EtˋE@EPWS u{4%t Sh\%5[^jWS t jP&ZYF MpFuWS uh]%h'h hDX%  FdH PF ,Ft'N V$vX]e[^_]e[^_]ËJh1ɺBUWVSËN t9At E9F$E;2UhPC Ph)]%4FiP3EUu~@u kUjRS EtjPn%XZESjj,E%tBFHV:%hV:%S48%Y^ u-j,XZShjj+Ee[^_]UWVS(Ë4%Sjj+V BuB EjEPS u2N }vuu܍EPEPWS%BPt3t P)#uZgP Sh=]%2SAXe[^_]UVSËu<wPh*PBP2 uhx  X\`\u TT1ҋTX#DT9 tj`9r7,_Ph Ph_% \X`#D`9  `T9`rj5dohYZ@u ƅo4\`%th Ph0^%)XZn o`< uBHvWdVhZ^%WdVhq^%c  uWdVh^%uWdVh^%1CLDžXXX\Dpt;jXdhZYtWdVh^%.XXuDžX`m\@6@t:j6dth0ZY@uWdVh^%WdVhX%$dhƃ tPh Ph^%(V; h4%u$h^%hCiPh0豢hhsPjhCPu CP+WdVhE_%;C@FC$CD1C<wPC*PEPq' u%C PF Ph`%uMU[뚍e[^_]UWVS8EE] }uPYt99s&}E EE 'E#`%e[^_])WPSU nЃ<@_{ UfCfEf9>Eȃ(9E؉EċEEċPЉUfffM9f}DC E1ɋUȉjfuwEċEԋEċ@Ef}tuC E܋CEEfEfEfE}uܹ1҉UЍMк EUfҋEftu_RPE PhB`%?(fEfu)T3EPE Xe[^_]UWVS$}E ^\ftPh'h9% cCubh$RS u#>t=G Ph'ho"{WsPRWt^\ue[^_]UWVSE 0xjPu* uE'e[^_]ËOwv%QPw Sh_`%<uu؍e[^_]hx\uu؍e[^_]e[^_]UWVS`(É։ʍDž( 11DžDžDž,ftRh'h9%" t @`jVPn u h'YVSzXZe[^_]UEM ‹]UM 1ҋE]UVSuVXt,swsos g \SVtttt:uj@苃t$Pǃ tPǃY1Ze[^]W|$wUWVS tu}P.YUK>vuu{(Ofu  tu%ue[^_]g_hJ ƉE1Em5 %RR$C Ph`%Sh Vjj(e[^_]g_UVS]Sh jrt~ht j3gXZe[^]UWVS E} wLBuB9{d4G PuF Ph`%VU1CdhV:%V|V GunC t{@;GusPLPF Ph`%%t VXCX{F$E}uEUҊMM섄tLGECЀ8t HD)у@v v M@MH@E}{CHY%j6PesHVv}e[^_]UE1҅tB]UWUBv 0E 1ɉJI} ډу¸)Ј1_]UEt9ʸy,сt1H%]USU MEttt9Xut9X []UEttPf1ҁ]USEttju S u[1]USEtt$ttP] 3#P uI1[]USEtt$ttP] 3#P uI1[]UE1tzhu 1zd]UVSEE t u ~qZt unueAhBhu&FAhRhu tBu 6,cScu=cSc =cSc[^]UWVS\EtE}?Ex 'Eu1E@$ h&EPjju Ã{E8uǀxhtxduh>a%h'h*hJa%辡 h&uVE@dZYx tWu(]Xu1EK|EPdB#B E}WS+kE@d@ EWCPkC9SV^jjEEP( jjEPE }E8Pf_uqE0[^D$NjuuP\C| SEP]juEPEuEPZY@E@$tvtgu[X1uuVSiVCPiE@dEPC8PiE@dEPCXPi SEP1]_Xu[jj}Wà SW+sxC|ZY uC|E@dEPCXPciSu 9tSd[SXX떀{tjSu mà uhSud_tߍC8EPdd^ujju :ƃ t9tEuVGfZYtF ~$1ɊT <2P@A"Puu9tjV븋E@EE\E@$tLu>E@hu5jZt9^duFh1Fd뮉e[^_]UVPuu,jy^uEh' YE1҉@uUWVS]} SE^uh' %t Et09Pt jPoXZjWSk ƅu&j4Xt^FFF`EF EFE0pE78AN }WPhjQ%jQMJ E0A #C$Mt1"PWQ Sha%\ Vj贕@u,1 8th'ha% Y[FtVZ1Ft1E@F0Epe[^_]UWVSQ]tdue%u=t-htGdt jPXZj3ZY^wHSr j3{ZXZ1GdEw$jVS t'W(9P uW,9Pu PC Phb%= 5w8w0G,PG(PVSu 8t둋AhAdjVSh ƅu Sh0b%g ]}tEW$9Pt jP(YXwdGhj3YXZ?uwHSq3 e[^_]UEt tH]UWVS]E EEU}uM MM$MM(Mutu |RPFEZYhPaXu KUjWuR Ã}Ut} tuMUj4XۋUuE'e[^_] ECCC 1ɉK BCZ;C t/C 67=VPhjQ%jC P{ }t EC1CECcHwnEE] Ee[^_]CtNt;C uCECKtHJSHwuSjà ]e[^_]e[^_]UWVSut=t7;Ct+@$ PjCPC PSF PtjR$ōe[^_]USEt6t,ttHJHPX]]y]UWU@Euu' Y_}UWVSQƉ uXӸ'ljU'9r 9EsҸ'ljU'~9M9 uZ[^_]UWVShPLufJ}xv #htAEH@‹EEhЍHdfhdZhKb%hPh蜁Ëh 脛 8thp'hab%XZh?w8j@Zh_uhp'^Lhǀ@h @uhSh8Sa =wPƄ ƄPPhhKb%hY@u$hp'hxb%h1҉Y[hCjydwZXETE`\fu `\\@)ЉD 7RP*RuM UuU]UWSU vǖ 11}}u1g'M[_]UWVSUt΀yv j u1y tËAdr@t$tt @$u@hb%X؋U-ÅtF PSYFP}WWCPYFd@t KthX( u} WC8PY_XC9@VCXPmYZY؍e[^_]UWVSSƉMtGu[x|tGd} u@t1҉t H|PV>LXZ?1e[^_]UWVSQEp1҃t<t 19sDB]۹yAt}u1ۅ}u@9s 8t1щZ[^_]UWVSE Eu}EEEHfw EHfv蜔 Ef9EEEM) u k@w ¸ w w w ?w xK9~% "}u1EEf}tdf}@~9f}? t1҉EUE) t1$t@E) t1u}11ErEUEa ׋UM U MEREC1[^_]UWVS}E uuGd((*1ۃ t%jPG@P ut #wdۉ؍e[^_]UWVSu }WVuw)WVu(pttSHIH9JHs؍e[^_]UVS]CtPV SjjV]e[^]UWVSuFhPF Phb%HVj@u3 81t) 8tݑ 8tӑ 8t hX'JXF@t>jVC@P ‹u#StPWS]e[^_]뾍e[^_]UEttIt:t4x@u HAtx@uxDuxHu xLt@`uR1]US]jjSu'ƒ ujjS0n ]UWVS} uEtMtGu{@uCAEPVTZYt$@u NtHUJNV^C‰؍e[^_]UWVSu 1ۉ]]]EdߋGdEuu;tGu}묋WtSWuJMQ1ɉ uHJt6GuCu;W_IuWYUOuUJOUjW@R06 t)G9Au!%uFEPQXZ8MWG E1҉UE܃YtMuW Xe[^_]UWVS} Et0t[uvtCPEP_ZY@t/C@3#Eu%CD3G#EuCH3G#EuCL3G #Eu붉e[^_]UVSEt0t.ttju CPP t v1ۉ؍e[^]UWVSu ]ENj@t9pu9X t5j|Zuh'YpX 1҉W PG 1e[^_]UExuP u U ffP 1҉P]UU1zuJ u fB f]UWVS4UUuhj_ZfECCdUSǃt_{ u Pu uƍS@ C t@sdKQPuR@u{ s{ u @t{ u j.EPC G{@u RURY^@s@t~{ 1UĊ  L @uj.EPC@Pj tJSRPhjQ%j.ChPpe jC@Pu t @`C`KdK`C`uKd h'SXZ1ۉ؍e[^_]UWVS EEE EEU}uM M܋M$MM(M؅uE苀t2RPe[^_]UUjPR 1t!hRu hc%uItUE1҅t%tHd((uH`ۉ]UVS]u!uu1҃jPS, t8Hu@`tFP^jRPStk1ɉJHB1Hd@ @$ǀ7jPj3|=uhS%SUXZЍe[^]UWVS]C$t1jjSP u苃%uuS9^u묉%u^f{(uGC>Pu<{*Vh'W tVh'W u 菂  VEuU1Ejj@VSHƃ@$@ 1ɉMH P@%t<u,C*FHC+FIC,FJfFKC-FMC.FNC/FO%<uC*FHC.FLVd V8FHtVJ FHE88V* 1ZMjG@PRU U܋Mt?uRG`t%tEGhPG Phc%.VC賀 sj.FhPRj 1E@F0EpjV@e[^_]UWVS]} FtHtJN HPZڅt0jjjVtEE Ee[^_]9jjjVVd1Sjjt$e[^_]US]-XE]UWVSQEvx E 81ۅEjG@PE@P. tGd(1E@`G`}u!GdtGhPuG Phc%eG` ttGd uCtWZOd }u/GdOdt OtHU JOWX}3u1ۉ؍e[^_]UWVSQu E@EhE@PE Pu[ǀS@4uUr4{(s41ҋECEH$Q+B9sȉC$}O : v: K vu9F s} SEZ11BCZ؍e[^_]UVSÉփhPC Phd%VSt VPZY h4'Xe[^]US ]Sj"ڋEXZ]UWVS Et_uVj"XZ؅tt8;Cdt,V PjCPPCP@SF PtjR $če[^_]UWVSEttBu[0tFd%=u1҉vt Pu 0Y_6ϋEu@EtE #1B*Et E @ tt^tTCƅtDGPEPm9WRV=EPFP=C PF8PSji@ut 81tt 8t h'TXES@EPVCPC PRU@Uuhd%YECd׃Cdj.EPRj轇 tSRPhjQ%j.W)R Chh` ShZPja}u[8tMGE9u?Gx1ɅtPd8t+9utU Rhd%XZ?믍e[^_]UWVS׉ΉÅt${ t8CujWC P t؉؍e[^_]UWVS] E1E;s31;Et k,9 t@v 6hY%`R PVjIG,1;uts 3hY%:R PSDIF,܍e[^_]UWVS(EEj:h0j ÍuԹ1Ej}Wj j)S@u S2yXu}uj Vjj:Sl@u_EjWj$j)SP@tEjWj%j)S6@tM@EjWh@hS@u낃؍e[^_]UWVS|]|}1EfEESU|MNM}Թ1ɉMЍMMEMMEMԉME }UxjjS uC Phd%ShC^SE} Eȅ@)@. us Vhe%(Y_xu_jxZuh'bXxh}jPx<@uh'h9%(_XjEP\u @u h'Y|@P|WShC^jj Vh5e%XZe[^_]UWVSUB UPhSe%XU^_u-jj%ËUXYuE'e[^_]^U6SFUJ>_t @ FUMvj±ZYUt0Mt&@}wFH r*NjM;jC 1CUe[^_]W|$wUWVS %ue[^_]g_h ƉE1Em5 %RR$C Phqe%Sh0`Vj4(e[^_]g_UU t,t9PuƀRhfjjUUу1t3wt-tRhL'he% UWVS 1ۉ]]] stqpCuCN@H9AHrot t]t tK{du~du?u~hu0C`PEF`PZY9E~FC3^R6t1EC7UtHJUPe[^_]UWVS<1ۉ]]]E1u1EEE9CEׄCdKTMЅtYURQP蹘 t t0u5CPE Phe%1ɉKd EEt9sEsxF URV4RPG t tlVdtRNhR%tX$QPF Phe%}Vj a@uk 81tk 8t h,'gZ1F$F fdEt9sE6NEtXMPF$Pv藗 t t1F0PC Phe% NtHVujuP ECPEЋCL }ffMM9Ms k KMɉMM̃щu2@uj}t}u^}vXU؋PU}vEUPUt6ut#9Usu)t9s M EEu)u%}uƃEă}v1ɺ1]/tuh7cWjEd}t?E Phf%dEESjE0#hS%u <e[^_]UUt&t9PutƀU]\]UWVS}u1-0t9~t6^xtuu S0 u؍e[^_]UVSEu1(0t^xtuu S u6ډ؍e[^]UWVSu}t9suCxU u1[^_]UWVSSu10EEP 1ZYtU9pu 1ɺPGEttu4@t$Pnǃ e[^_]US]t9XuPxtJd8t 1[]UMU t t9Huut xdt1]USMU t3t-9Huu쀸uX`u @tײy1҉[]UWVS@EPj E _X1EE 9CEuh,f%j uVD CPVh2f%u+ @ursXsTVh=f%u+@tuuVhNf%u+@tCtPVhZf%u+@tC`PC`^E'+"uE5!#fC"t 5!#Au[6$" u5!##@u5!#5!#y,]#uRWVQuVhif%u!+ @&sdVh}f%u+@ C1C;s WJF,Z拀H1C;Ls WJF,XCPECLE}EfE9Es9e SM@ukHL1}9t 98t(A, 1M9t39tF,}čOQ}OQhUXPB PEPu2]G UU)U-sx1t8Fd%u'~ t!GFhPWEPhf%u)@6ċ<e[^_]UVSu Ft%tF9CuuVCxPusݍe[^]UVS]Sjj1҅t#09XuƀلtKj3%Y^u=t hS%S5XZe[^]UWVS] 31g%,k8TPj~C8G`GdfCfGdCu@8FtCt =6v 10u8GhC t8Fl1ƀ1xph4k8@xZYHd ff u0hpg%Y[ 9s0hg% 4ۉ℔`tY}19t 92t A,tr 0hg%P0hg%i@<vw<t<><t0hg%xNj 󥊅zp 0hi%A11Ҁ+u8B,CdtG{$tA1ɉڋ8u.ڋ8ChP0h@i%v1s$ )t1ɉEP8Q )xdu+81҉EP8V2H4818EP8V2p*v>xdu"t0hUi% *?)t49$8xdt⋅4t4^u0hi%聿Y[+(뗋4t=4O8xPc4j40 8Y4jj498jj4 Z8@`y *t[j@t/*tJj4>^_@u80hi%蜾Y[$*0hi% XZ4e[^_]UWVSp]U Dž 11DžDžDž0ftRh'h9%ҽ jWV3W u h'蘽YWSXZe[^_]US]jjS u"C Ph j%Sh'aS]É]]xUWVSPu} UUjWC Pj Utۀ8>j%uk%UPCPC PhNj%kCjV" UuDt&9tH9Kut倸u܃xdtCEe[^_]e[^_]US]Sh'ajSSh0`j> ShC^j&]ú'Jt f9tUWVSEU MftEv0f9sP 1&f9u}tMf9)O [^_]UWVSEu} tRU w O 'fɋ] ] +39sO "1?fҋu1҉]19tu692uA,t[^_]UWVS8EċEȸuѸ1URj uQЉƃuEfǀ<N GfEfwEă Ph[j%sY[f>ff}fuEfǀ<N 1҉1ЉЃEu.Ef}w 0'Phpj%j ]SG, 1:BUP_XۋUuh'ϹXߋMDڸuf}f9<t >Mčq RVhj%P聸S联Ef]f<M 18f}uVhj%}ȃlh(Y[Eċ4%tjαXZE΍e[^_]UWVSSƋ1;,k(f{u{u4{u.{ t&{u&{ u {u{ue{u{tYCUhPCPVUt1ǀ& Kf1ɉHGEe[^_]UWVShEwL EdEEEE@|tXdÀuXdBEAE1ɉMM}qEf9UrZ9]s#L E Phj%蝷XZ0u<}])Ӎ{}ff}ftftfu f9s#K E Phj%4_XLʍ]ĉu)fEE,19t.kM(Mf9HuUjSP; UtGF΅uE4%@u+j EPjEPetPE Phj%f}tHuΉuȋ]ˉ]̅t<9s8j EPjEPtuSVPE Phk%$(g1ủuEEPM1ҋEJE[tE2Eƀ>#f}uEȅWeEEEPjuWƃUЍ M))Ufw# J E Ph'k%萵ZYEܹEȉEUʉU9s'I uuE PhGk%1qEX|ۍEjPSs uCduCdcd{4u EC$U9S tKdS C E}}uuE Phlk%胴 f}t2}O`MQ9rG`E̅tMqduV9rAdE}E؉E};aV}9GhUGhMjhPu~ǀ&EfEĉ{(u 1ECEEe[^_]UWVSljUMu w@ Phk%G 1҉u1ɋUYtG E1ɉKhKdK`ǃu uVjJXZƃ>VuMUZYuC;u}tG Phk%[^덋SDtKHtƃ>VuZYtȍe[^_]USUE M]v]ɉME BE[]F 1[]UWVS ÉUM苰EPjRQRtBf}u;8ύK G=DQwWF(1RPQhk%豱~(WQhk%! EPjSuuAtBf}u;8σ G=DQwWF,1RPShl%W~,WShl%DZ e[^_]W|$wUWVS4E؉UЋuC|t @du'E!Eu@)ЉEEƃ@8l%}tQuЋE؃ PhAl%u18ujjE؋'EPj$`'8u ǃ8Yl%EPj s@s<Qtf}uʁXsXS`1CdChǃJ8u ǃ8al%8u ǃ8hl%8u ǃ8ol%8u ǃ8wl%{`tts|C`t}t8sLCDCLCHCPCFd rFV t#tFhPF Ph@i%褬 1F$upFhPF Phl%譬 Vd s"1F$F VjjF-NtHN rVXV蓮YHE؍p C`;u PVhl%MuVhm%,KdSh tRQPVhm%uK)uVhSm%u4 RVh\%u jE0XZ}uA}t;WVh4[%脫sHsDhWE0 & @u WhJ[%˫_XE؋_|tACdƒ t ujC@Ps? tKd Cd uVhcm% h8u%E0 E؋4u$}؋t%ujȣY[XZ믍e[^_]g_W|$wUWVS,(h1Džh#fDžBDž<"#K8Qff@98tB9rIpr@uHtHu f$8,nt104tj l0\ZYHu" t\10fDž$H8% t#j@wP[(| @p|1(Hx@1NjDC buy(u4tƅ,18$|Dp<@D&v P PhW%, DP4BnFDFLVHVP1ɉNDNHt hN:%SXZP3h SjjMw0%t11҉SY2~Dt h8l%SUXZu Sho%i1ZYe[^]US]?S Rh0o%PF ؋]US]C PhYo%5XZ؋]US]?S Rho%P ؋][US]ShjC Pho%軑؋]US]?S Rho%PfSh^j聉1҉؋]UWVSƋu5hX%觐f-XfthWP* 8PV RhX%ahWP6 Z4%@"PPR @ {TWjuj~ u +)CTSXWjKZY@KhtD1+9}F Ph]%-Y_DsDjbCD_Zu h'qY#Nj󤋅CH_1҉tjhj|P蠗P6 sDj1CDCH e[^_]UWVS] E1E;s31;Et k,9 t@v 6ho%A PVKG,1;uts 3ho% PS%F,܍e[^_]UE@|tPd(t1]USEu1X|tuu Sp u؋]UVSEt0t-uvX|tuu S( u1ۉ؍e[^]1UWVS} 7G@4j.DSFPjF5 4wSho%|)}tE@<"jWu蟚< u h'iG8@Pj48PNj<% tj<01ɉ,0,;(⋍(tx}HlaDP< Phgq%/<;8BPj48ƅ0tfBu0S@tWC<8uOBQjRPDt8fBu.08r$PDP< Phq%R48sunu StHuZ%uGjSƬY^u9ϋt# w~tn0ueeu1t1%thDjVYZ@(@,1҉P|P|10fǀ<fǀ?SjhPxjjS襂u"C Phr%y~ShS詉FSX:Ѝe[^]UEtQw]UM E]UWVS É։M苐t 48UMtSjjPiv u EU S跀Zt~8 1pp@1x xx$3@u Sh'ho"}:SY(hr%SXZP3YXt jjV|P蛅t j3XZwLXGDGLWHWP1҉WDWHYt=t8E%Uu=t}uEr%uSwZYwLWw4WwPhs% YX؃t w t u F17tA9MuuUM7Ph%/ XZUM΃`Ѝe[^_]Uh-hs%gTjw t4h4t9W|$wUWVS41Bh41-% 6f6 s f4.s f4P s1f4f 4f 446 1s44 ut/4x4 |44 4f41=0-Of44ff4f4=@4tjV3| Eȣ4Eȣ4ZY0-X464U1E4]544jh456ƃ x9u hm%c XVS54hyt% 6Hujh,-j  P4\4D4H4 D4u\4\4D45-= -u؉}mrq$-E؉ D4H4 D4H4EL4L4=ɚ;~ D4H4-ʚ;L4\4D4%we[^_]g_UWVS4ƉU)'ht% Y>^ ht% FfVRVRPWSPht% j.]SFPj uj.h"Sh Sht%i j.SFPj uj.h"SSh SF F^(ZU)ڃ<,wJ<w1tR<CSPSPhu%<+ht%"<:tI<<tG<T@8Phuy%P $ '<uT@<w*$4 'hx%Bhy%;h)y%4h|9$-h9$&PhNy%,T@t <uh<$hy%^ Phy%w Y[THLhy%R T@Z<t%w uhy%<uhz%hy%! _hy%Ph5z% [^T@8PhCz% THmhUz%hbz%hmz%h|z%hz%h!e%hz%hz%vhz%lhz%yj.STPj uj.h"SOQ Shz%5 j.STPjM uj.h"SQ Shz%h{% hf3# T@f8fZYfw2$H 'h{%h-{%h;{%h6{%hgx%hU{%}9Huh_{%nhl{%hv{%n S1ɋHU t Sh1$h{%&uj.VSjK h{% [h{% hf3# T@fHfZYfw-$\ 'h'x%!h{%h-{%h;{% h6{%hgx% X6t-T@<m44 'h"Ph<$h ^_6 6uh8- [g v狝t݃{)!C2t!#t1 h{%3th{% C Yh{% C HC SRRPC Ph{% HHǃxPh{% XZ h |%w XCPh |%g Y^19~gVHHYZuVh)|%B XZCj.RPjY uj.h"RN PVh8|% F땋L 9؋t4p4t9~6 4t49p4 =p4P UWVS]u#6tP3^1ۉ66S 6@$ +6Yu U1҉ 65-t:C@;:uS tD~@tB\u JDN@uǀ:u‰1e[^_]UWVSUtWB<:u1<2E 028uFut<@t*}:u<:t"u}:t;EuݍG1ɀ@t1ɉ[^_]UE@-]USE] u:À|u%u@C8t9EsHt:t @|u1[]UWVS4}!}u[=6tQu Wn[^u<56Pi)YtHWPD3XZh5)^1u? Dž)Etw}xjjju !jh@PRE xDž1ɉ1ދ9rqhQuƒ ?tuZ 0S0 0HЀ u%V1It 1:u4:ut75Dž\t&Dž t t11҉V9r)ډ)ށVSj,ZYu"S/^u[Ɖ‰,1i<#au SZYNFS;/XDž@-K1j=h<%S Ɗt F:uFHX)ىMQRPu[Ë tK}t uXWt.^tCu F:^DžBDžtB<:uЋ))ˍ x:t:C؋)ȉ)9))))QWU*ZYu:W-Xt uXx- _<ljljƉlj )PVQ訇 SR蕇 ,Ymt u^)؍P9s&PS:)ZYuS, XË Dže[^_]UPjujM UEU6tP蹻 1҉6Y16 661UWVS1=6uE 6=6uYhi$60X 6^_u=`P56}Y[t?Duz1=66t= 6u 66u@ @uPֺ 166P6@Zu 1Uhi$PAڋ -f\Yf:u#t =6t|0\L6E|0\u 6N1ɍt:uf:Y\tAߍP56BY^u'6tB @Rݹ 16ZD돁NJ|Äu :t@PFjWjM EÍ@ wCe[^_]UVS]u uu ][^]UWVSj=u uj Pjd ^Edu! l4uEdUz}<:<^uFC<:{Mu])CdPV%ZYuV([{<\ůCt}<:tyHЀw1GOD9t0v뛍{1e[^_]UPEPhh`7h7uƒ1uEUWVS} uHu7uuW1ɋUà =d7u u1Ɖ>1e[^_]UPEPhh`7h7uƒ1uEÍP Љ ‰ Љ ‰ @UWVSQBJ Mؙ`&#߉1I wEZ[^_]UE @ U+B ]UM UA+Bu)]UE +E]UWVS(ƉыXB1x}É)M1ENjEE׍9rס<7EС7E=vEiẺMԋEA1PUÉ)‰UM1E‹EЉE܋E؉E]؋U܍9r9Mr(}v k=9s}E܉EEE놋EԉFEFEF ~$Eԃ([^_]UWVSPU} u]RU $URjW $WjV $Vj$S ZE] Ee[^_]kUVS@ÉjjjQjRPv tN9tLtHVP_H ZY@u: j@]S07~ h"Sh%PD-=7t: 1e[^]UWVSSÃ=7tO1t 7<!j茫ơ 7!7)Y9sRUk7Z9Uu)@uÅu,87!1ɉ1ƅtÉ5771e[^_]USX?797r7É7 4t1[]À=7UVSh5!#h5!#h5!#h%D-h5!#h"hZm"h߁%D-D- fC"=7t"}%=7tt%Z"=7tP"QRPh%Ӌ5D-as$=7t%#=7t%i"=7tXs"%=7t%SQRP֋D-U@7h5!#h"Ph%ӋD- Uh5!#h"Ph %ӋD-U7ih5!#h"Ph%ӋD- U7Ah5!#h"Ph)%ӋD-U7h5!#h5!#Ph:%ӋD- UH-h5!#h#PhG%h5!#h5!#h5!#hL%D- e[^]UWVSQË@xtt*BEB$؉‹E¸1DD@J 9s:tt/Ήz}z$߉}1|C@1҉Z[^_]UWVSS(7,7$7k(0h '@PE1ۉ^,<7~0XY1;,7s6U1h 'GPEKGU C(XYk(|0(7,79subC[^]á7uÀ=D7>UWVS 0DžDžDžjjPh@7jS趂 @u @7i <7P871 @H47hSh%P tƄ181ƅGh%n9Xt uʊt͍B<9;$ '7R7F7:7.7"7H-47B9HH-@H-77P-HP-47J9@P-L-HL-47J9~}@L-u7l7c7Z7Q7H7?767-ƅ h"Rh%PD-C7n3 0=7t h~ YP-9L-}L-=L-‰7 <7 07s5,7(747)I $77H 7tH 7 H-7X 7 7Ɖ5757#87tA 757)7=7t*1҉j Ph 5" h 'h7@jТ777h 'h7o@117@7}ã7u&@7 1tD71e[^_]1À=D7u1á7u 7UWVS@É;7;7j¡7_9u739u0PޡY;7u;7)77jVS/ 19Z;P 7PPh7@=7XZVS= Y_@u:a j@}W0T- h"Wh%PD-=7t襝 957u"tX 7PPh7&@XZe[^_]UWVSEЉʋ 7!Ë 47)){ MA L>D=7tMjRP~. M957sxu@)lj|| >;7Fs"J| u| | DT>| T 9Ss$EExSWFAED CSWA?;sss{uISC PAXZ=7uE@,t 7EX,7؍e[^_]e[^_]UWVSƉȋ} 1ۃ9t yYC 47‰ى[^_]UWVS¡ 7!9t> 47)su܋tu 9t)D @!u܋D UEPh7<@ZYe[^_]UWVSQӋ 7!‹ 47)tu)ߍ41Ƀ9t ^NAt#\| DuD0| DJX[^_]UWVS$E܋ 7!9_C E؋ 47E)puЋ|7Uׅu9u)Ӌs V}t Z}܉E)+F$Iu*w ? 'w)? 'w '1;SsS |C@C;Fu ;u1ɉHt SFP>XZN]H9t9sxt PFP<Y_SVt<XZ{EЋT }t Z}܉ыU܋E؍e[^_](E܉EEPh7:Ph7>=7t KZ{ SC 77e[^_]UWVS97t79kjjh7K=ǃ t؋_ jWh72=EWh7=7=7;7r;7rw1ɉ Åuj}먋 71ÅuP=7@u1j Nj 7!‰)[9tP7Y9uō37t]EPh7:XZt>G 9r7 39s0jWh7U<EWh7<7=7}뾉؍e[^_]UWVSÉU 47EC1t}9xts@Ƌuzơ7EF}}1U9sK)K)21ɺCPY^y)VxK)]K)1ɺACPV*MKZ{uoEA)VHXK)P؍e[^_]}O}M&؍e[^_]5e[^_]UWVSSlj1=p-H9s?MjB,@Pr(1 Mu e[^_]C(S,z{,f P{<t[F-01=p-H9s -29se[^_]UWVSfU0P9s'H9r f8f;}ux]u)E-HuVQMt. t uMQ ZU9ufG}uf 1e[^_]UVSË@9r{uCH7CH7KP9s+9s'8[u"x.u. K9r !f3r9s:.u z]u{uCH7CH7[^]èu'B -fAf'f` ЃðUS1u4'觚 ZYuCC u1]UUE ft҉Uż']1]UWVS É1=p-H9s33C8C,E-E-E1E9t*C(p{<t@}f;t5}f;t,Ff9{419ts04f;|f;V~ @1 1{8C pPWZYuF;s$rC8e[^_]UWVS Ë0F;CsGjhD%V , u 1ɺjhK%V+ u1ɺmS j@B@Pr #. u ؍e[^_](K A QrqЉE1}C @t E@<S9s8^u @E@89]u @]-@-9H:9<]<-3K-9)BC9S9{uCH7CH7S9]p9rD-tN[@3K9ȉu,M؋U먀=Vʀ-ux]Z {uCH7CH7{uCH7CH78Dz@U׉DRO^fE11=p-H9}"uQMBZYMt UGjE@$E@PEp + u j}G W$JO$f4PY{uCH7CH7EH9G8:>x]49r{uCH7CH7<]t<-u{uCH7CH7=ȋUC9r{uCH7CH7S9sH9s8=ux]u {C~8-P9x]x-t  -f9=p-f9~0{uC H7CH7f9UG1=p-H9|f9jE@4E@PEp0) u MA0Q4f8fpBQ4EV~{uC H7CH71E, U%Gu48-u@-U;Cr{uC P8]u H7CH7{ Ex8tC @tEHp-E11}tf~)f=t#M9tFfE@fNt/Ex,x4uzx$utx<un@(ffEf=t^U܉zC P U܋pEp(Ep0Ep t1}U܍D2 9Eu'C HC M+H 0؍e[^_]Fe[^_]UWVS$@ @tbF -f tNt - t< -ff9t-;sEщUfE]EӉC;s$[^_]É؃$[^_]UWVS]CE q39\t[p;sr{uCH7CH7Bׁ)>t~+90y<1ɺE {*.MC @+1ɺ(1ɺ4~t6BЉE8NdBM@a C @Dz({PUCxMu*@uC H7CH7{ G7щ3S9ryn3S9Y>*ubF3CHE)PHAKE)PCHE)PXKE)``[^F9>\~{3ƋK9sI:,uDz;9s6J-DJt%9~{uC H7CH7PU:SY9s"H9s8\ux}uDH9r 9r 8\ux}u{uC H7CH7 1($S B@pr@ wML(h/S9s#H9s 8\ux)t)\ wCDLpS9s(H9s!8\ux)up39Zx*{uCH7CH72SUEECE^ ]k3US9֋My*CU z5{NGe[^_]UWVS]x;s?SB< $'^[m\p{|;{r{uCH7CH7S B@xz@ wt(hw;Cs8)t~)p wCDLp@;Cr{uC P8)uH7CH7 1E1ɺC H @$E1ɺ C H @(븺 몋C @t,SUEECE^ ]};US|1ɺ(N`g;{r{uCH7CH7Pu1ɺ1ɺ!Cxu{'{9Jր?u#@}{C {P9sx -Dyu@<,t<{uC CH7I7}{uC H7}~{u9C 0@}t{tEH7CH7+uN+ueH7CH7-H7CH7C H7CH7+tv *t?{CH)VH$K)PrCH)VXK)`L_X5CH)VHK)P^CH)VxK)K)o1ɺCPO^MNj;SsE:,u@BJ-DJt%9~{uC H7CH7PSY9s8}u @48}t#@9r{uC H7CH7 {9s9r։v!?t{u#P9sP-DPt o1e[^_]UWVS} U0E tEp9) W^ [jLYt3SUUw$@@EjP|1҉UYZuS'X ]lp1tEEU1}EuP0p DžhB 1411h1xEEMU싅hE1C CE$C1C C$C(C,C01҉S4S8S qAG9r 9Y-EUEfTPffUu}_uc9wu G 9w sFˆEEDPu }_} uAu&}_f}G9G9wNȋ-DJ<_-9wuDJu _lFfDBfE9wu_t fGDB‰Ѐ>_ €_f} 8;w,-DJu _9wu G9w NDJ_9< u AЋ -DQ<_KED%EukKM2KM=Xw=H=P =8tK!=p =x2=hɆ%NC0Y(9u710E%EGPx utڋ)Mu MA}dʼnM)ыU9ruG PV uE @MC9uEƉ]]uuu uMrE%EEG]4뺋G]90t10uuu UE)PM7MtE%\uuSuM@ SUT\%=uK똋]G؋HUM+W Puuu uMQƃusGUMLa]G؋PH UM+W PP uuu uMƃuGUMTL Ɖe[^_]UWVSEUM} MƋ]U9UE@EEM %=p=8pwL= 3w$==Sf=|=(4=05*=Xw =H =P<=@=`=h=wE=w=xE=D==fzk=tlw=t#=t1z=ofwWf98f=|TEsf>E]fy%Nf<f%fUB ;E!! ؉ʁU! ˅EHU)ЉEM~! d!EtkEȋUt %AE8! ؁UUÁt!! E=؃[^_]UWVS4ljUMȋEEЊEЈE׋G(E؋G0EܸMjPh{PM UE}tEfEE9G t9GuGt E@fEM E1uE9GtfEE fE1ۉ]̋M9Mu }tEEf} u@uIf}t6f} up`@(E}Qf}tP-1Gu@$E~1ɉM1f} u @uDf}t*f}tr1w@(E}{Gt f}tByf~u"| f}G1҉U}@(E1f}u1GuEf}t}u?f~gGuE1}uf~@}u f~u7tÉEVuuuM UEMuf~u;11ۡ-f}UfMQPf_tIf}tAf}uf})E@-Buf}_uڻzf}-EDBu#f}_uff}thf}u4fzXf}tLf}ufztBf}E@Buf}_ufztf}u;rfzu"yVuSuM UEf}tAf}tY -E@Af}_ fE@Af}_ 8uY8E-DBuf}_f}u7E-DBu&f}_tVuhwuM UEUąUt }udU܋E9UtxM9MtpEU9UtNM9MtFЀ}tEVPEPuM UEuuEfEEGE@}t)EG1EEf} -1Ee[^_]UWVSljMuU;u HE%=Xt+=xtM=Ht3VU=Xvd=p*CEMCEӁt @EM=0t8wUBU==(t=Htw =h}EE@EjuVUEju uM‰9EtMIFjSVMU YSVMjuVUEju uM‰9EtMIFEEjSVMU tUU9tESVMUjuVULEju uM‰59EtMIˍ^@U%tjVSMU 9Et(V^@4֋%=uNVSMUXZ?_E+G Cd_E+G CC DEEuTEe[^_]UWVSljM];] AEE%= wF=(w"== =tf2=0t=`T=w"=k=tr===9uFf;EZ9uF9uFEA 9wG9wt39wu G9w ;w~ G9u G9z> qAG9r 9Y-EUEfTPffUu}_uc9wu G 9w sFˆEEDPu }_} uAu&}_f}G9G9wNȋ-DJ<_-9wuDJu _lFfDBfE9wu_t fGDB‰Ѐ>_ €_f} 8;w,-DJu _9wu G9w NDJ_9< u AЋ -DQ<_KED%EukKM2KM=Xw=H=P =8tK!=p =x2=hɆ%NC5Y-9u710E%EGPx utڋ)Mu MA}dʼnM)ыU9ruG PVC uE @MC9uEƉ]]uuu uMwE%EEG]4뺋G]90t10uuu UE)PM7MtE%\uuSuM@ SUT\%=uK똋]G؋HUM+W Puuu uMVƃusGUMLa]G؋PH UM+W PP uuu uMƃuGUMTL Ɖe[^_]UWVSEUM܋}uE fEӋU9UE@EME%=p=8wN= Bw&==fEf=|*=(F=0He=XSw =H=PM=@=`=h=wF=w=xU=o==f}zw=txw=t(=t8=f}wdUf9U?fEf=|E~fEfflEffEff}yPTfEff<@-/f}$(f}UEMA k MM)ʍ M ыEEHM)ȉETMڊEtwMMсt ڍDU7DE%EMȋMI tE؊DEC[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹ƒ}t H}܉E9C t9CuCtEx1EE9CtffEE fE1uԀ}t!puRUc UuEEf u@EuLft:f} upucp(fE}Rf}tT-1ɉMCu p$fE~1fEf} u @uFf}t-ftt1ECEp(fE}{Ct ftAyf}~u fE|f}C1fE}p(1Efu1ECuFEf}tu@f}~kCuMF1Euf}~t}EEHQMuRU tYU9UtQ}̋U֋M}HtuuuREPűM U‹}}f}}t4EC1E>t$E@Ef} -fEEe[^_]UWVSljMuU;u HE%=Xt+=xtM=Ht3VU=Xvd=p*CEMCEӁt @EM=0t8wUBU==(t=Htw =h}EE@EjuVUEju uM‰9EtMIFjSVMU YSVMjuVUwEju uM‰`9EtMIFEEjSVMU: tUU9tESVMUjuVUEju uM‰9EtMIˍ^@U%tjVSMU 9Et(V^@4֋%=uNVSMUXZ?_E+G Cd_E+G CC DEEuTEe[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹ƒ}t H}܉E9C t9CuCtEx1EE9CtfEE fE1uԀ}t!puRU UuEEf u@EuLft:f} upucp(fE}Rf}tT-1ɉMCu p$fE~1fEf} u @uFf}t-ftt1ECEp(fE}{Ct ftAyf}~u fE|f}C1fE}p(1Efu1ECuFEf}tu@f}~kCuMF1Euf}~t}EEHQMuRU tYU9UtQ}̋U֋M}HtuuuREPűM U?‹uuf}}t4EC1E>t$E@Ef} -fEEe[^_]UWVSljMuU;u HE%=Xt+=xtM=Ht3VU=Xvd=p*CEMCEӁt @EM=0t8wUBU==(t=Htw =h}EE@EjuVUEju uM‰9EtMIFjSVMU YSVMjuVU|Eju uM‰e9EtMIFEEjSVMU? tUU9tESVMUjuVU Eju uM‰9EtMIˍ^@U%tjVSMU 9Et(V^@4֋%=uNVSMUXZ?_E+G Cd_E+G CC DEEuTEe[^_]UWVSljM];] AEE%= wF=(w"== =tf2=0t=`T=w"=k=tr===9uFf;EZ9uF9uFEA 9wG9wt39wu G9w ;w~ G9u G9z> qAG9r 9Y-EUEfTPffUu}_uc9wu G 9w sFˆEEDPu }_} uAu&}_f}G9G9wNȋ-DJ<_-9wuDJu _lFfDBfE9wu_t fGDB‰Ѐ>_ €_f} 8;w,-DJu _9wu G9w NDJ_9< u AЋ -DQ<_KED%EukKM2KM=Xw=H=P =8tK!=p =x2=hɆ%NC5Y-9u710E%EGPx utڋ)Mu MA}dʼnM)ыU9ruG PV. uE @MC9uEƉ]]uuu uMwE%EEG]4뺋G]90t10uuu UE)PM7MtE%\uuSuM@ SUT\%=uK똋]G؋HUM+W Puuu uMVƃusGUMLa]G؋PH UM+W PP uuu uMƃuGUMTL Ɖe[^_]UWVSlE} UE8e p >E F E ЃEF@EFEF=p-lt1ۉ]tMEAEWBN YE}M9M) N,F4EF8EtwF uƅthp%l%dwtD$D$<$pKD$9gD$<$ޭD$ D$<$ĭht4D$9gD$<$蠭D$"D$<$膭lzdD$9gD$<$DD$2D$<$* <$S Ġ[^_]ËphOldunu E $ Ġ[^_]Ëhld<D$9gD$<$iD$D$<$O D$9gD$<$D$fD$<$D$9gD$<$D$9D$<$ʫd9M`D$D$t<$葫`u!phD$9gD$<$L'UWVS ü} uttEE7gEEEED$E$ …zEt}׉ƍWOt%%"F9rى׉ƍWOuۋ})9U ĸ [^_]ËE@fEEDžDžUD$ D$D$D$ D$D$E$U6DžDžDžDžDžUE@fE@fMIL$D$ DD$D$$ t$ D$D$ 4$ EDžDžDžUE@MIMI Ɖ ȉ } Dž UE$(D$D$Ɖ$lD$:4$ Ut p9EDžDžDžDžZ DžE@fEEDžDžkzR%KwҋP;V9s%u9sF?V?4 r9i_oJ;gNN9sVu鋽D$ ~D$D$$d V9sNu鋽E@D$ D$D$$ ^V9sNu鋽*N9sVu鋽;gNN9sVu;gNN9sVu=Exy @<ዕt9;gNN9sVu;gNN9sVu y;gNV9sFu鋽Dž6pS;gNV9sFu1fTA D$(A D$$AD$ AD$AD$AD$AD$D$ D$D$ $ ȄLN9sVu鋽AD$AD$AD$D$ dD$D$ $W lBD$D$hBD$D$ <멋AD$\AD$XAD$TAD$PAD$LAD$HAD$DAD$@AD$<AD$8AD$4A D$0A D$,A D$(A D$$A D$ AD$AD$AD$AD$D$ D$D$ $O dAD$TAD$PAD$LAD$HAD$DAD$@A D$<A D$8A D$4A D$0A D$,AD$(AD$$AD$ AD$AD$AD$AD$D$ PD$D$ $ N9sVu鋽N9sVu鋽}nȉN9sVu(@D$ D$D$ $ N9sVuA D$A D$AD$ HgD$D$$ {V9sNu7@D$ D$D$ $ N9sVuD$ D$D$ $6 N9sVuZD$D$D$D$ D$T$U$ "N9sVuEDžDžDžD$D$ D$D$ D$L$U$]tN9sVu*})mUE@D$ ?gD$D$$ EDžDžDžDž DžUyzUWVStx U11 rEEEEEEEEEH>U DEED$ED$$P:U}ĉ|$T$E$4 ƃtdE$3 ƃt'D$ED$$91҃ډZ5 MD$|$E$=4 95 M/5 8D$ED$$9 5 8t[^_]4 UWVSP v qDž/devDž/XtyDžyXXD$cg$S:t-ƍD$D$FtH4$ 4$;D$D$ D$D$y$vV@DžSgp0ƅpD$D$<$s9ƅt訖L$D$<$=uD$<$=tg$9nC>3 P [^_]#3 8u)΃wΉ<$:uD$D$<$8`S9EE ut|$E$ Ut#ED$D$ $qEtED$D$gt $] 1P [^_];DžUVSs ÝED$ED$ E D$ED$E$tK ƃt?uE$L8E$c8[^]ËEUE$%8[^]þ[^]UVS 0s 9 ; D$D$$ t@ $^ ǃ $7ǃƃ 1 [^]0 0ǃ $[7ǃƃ t0 0ǃ $ 7ǃƃ t0 UWVS<r uD$/4$ D$@4$5ƃ%D$T$$a5/ 4$j6Ƅ=D$D$D$D$ D$D$ D$$ tVuw: ul<[^_]À uM- Ɖt$ XD$ lgD$D$4$ = / ? . UVSp i~u 3D$/4$ "t$ $ S D$D$$ BD$ D$D$$` !Ѓ D$D$$}1[^]YRD$D$%@4$b3D$t$ $蹍 , Ɖt$ XD$ lgD$D$4$% =@- ?)$! tƃ Y- 8#t- 0z, 04$ƃt, UE$]fffUWVS an 6|E@ E։υEE y ]]U ] }ED$D$ $D$s&ЉM;MM }$UM T$L$ U$D$=&ЉM9ureMϋE eƉϋ]ڋMщeʃ}u؃ڋ} } ]YpAhQl [^_]1 [^_]ރEE9EE }E2MϋE evUWVSPl ùzD$T$|$$|$D$$D$,H*)R)L$L$|$}<$teEU +D$T$D$T$ \$,K)v)D$T$)iD$T$ e[^_]øUWVS8k y}܉E؉Uȋ-8}tGC@%-Z+]E[t_E@Y‹}DG11]a 5 ‰EtvEЙ׃ЃE؉0xE܃Hʋ]DKEܸ9 }KtO0)Ӊʸ9иbv-t9+E]܃}thEȉE̅um 8[^_]E@ta(uk1f)uAÃPt((uރEPXEȉ 8[^_]18[^_]Éc}ȉk}ȉ^}}Љ}9s]tSÃPuހ.tEȉEt,}-UЋuԍLDFt uf}am}a.m.f}pmR}p.m.1EЉ$] 1E܍,ug'D$D$EЉ$]ͫ t#tWuՉD$EЉ$]  u݋FV }؉WF2}S1}؉}+E܍L}̉}gD$EЉ$] tu}܍"D$EЉ$| KLgD$EЉ$]V Hu݋E܍l}ȉgD$EЉ$] u݋}Љ<$]` |?sE܍lD$EЉ$] uE}u8}DGt.E܍D$EЉ$] u1ۋEЉ t.u}.E}Q} auD$EЉ$] usu̅u#D$EЉ$] uݸUWVSDf tƋ'<'wwEVN)щȉMEED$$cgt_FMȉFD$F$>gt:F]؉F>FDF 1[^_]ÿ'E {UWVSue FsD$\D$`D$dD$hL$tL$D11rD$DD$xD$|$$1D$TD$PID$LD$T>,K\$XD$Xtt$T=qw 9=D$Lt$Xtt$T=qw 9=tD|$P\$XL$HD$TD$dU ID$Tb\$XL$HrCMT$X)Ћ$‹RD$\T$`F3W<D$|t$xt$X$1=\$H\$PD$Ptqwt$H<g9D$XrD$TD$X$Ah$$2hD$Te[^_]D$\D$`CE@$@@(L$XD$|)ЉD$|$)щ$N0lPT$|@A$D$\T$`AQ T$TeD$T!,K\$XL$XD$|)ЉD$|$)ى$NiItсqw 9=lL;$rD$DD$|PT$|X$A$D$\T$`AQ LD$T\$XL$HƉL$HD$|;$rD$DaD$|CPT$|X$P$T$dL$hPH LD$PtD$PD$T$L$HYЋAԉD$81\$(9ډËT$8QˋIL$0;T$@9щ‹L$0ً[I<9qUD$(B$L$HAQD$ D$<Y $\$щ‹EL$XD$|)ЉD$|L$H)ى$NE@ $T$HJZ@U@pHhXl둋$L$HAQD$ D$KC^D$xD$XD$T݉D$xD$XD$TD$dU DD$TD$xD$XD$Tt$P\$Xt $D$|;$rL$PD$DL$PYD$XCD$|PT$|t$Xp$B$\$dt$hZr D$XLD$Pa,KD$H&E@ $D$H$D$HD$\ E@$D$HE@$D$HvE@($D$H_E@$@($D$HDE@$$D$H-E@ D$8_$D$HX4""""9ȸ"""3ȉ)L$8 I] ApAhQl5$D$H@MQX\$Pu D$ ]  E )} W$$D$tD$$D$\$\$PmDžMwl$($,wN$$O $$$$DŽ$DŽ$DŽ$ DŽ$DŽ$DŽ$ DŽ$$DŽ$0DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$uD$P-DBtZDJu9tGL$P$W\$TTdDZED$D$\$D$\ $ $ $t$ $t$ v t$ D$ u9E PD$TT$X$D$Dk > m$($,$u@yރ1D9$($,DŽ$\$P $D$$0$$L$$\$($ \$$D$,$$L$D$DŽ$DŽ$DŽ$DŽ$DŽ$$\$,$à $  .D$ t$$|$(5 D$ t DŽ$L$$$$\$PD$TT$XL$$D$L;$o ;$b D$D;$Q D$<9$@ D$,;$/ D$;$ t$T|$X! $D$DD$D a$4D$P=D$L%w\$Tt$XD$\D$\ t$D9%Gtԋt$Pf WL$T\$XL$l\$pӉD$DŽ$DŽ$DŽ$D$T@D$<t ] 1uUT$$]AtFuɿ [^_]UWVSs8 HFt:>t M1uU T$$NAtFu̿[^_]UWVS 8 Et: >t M1uU T$$@tFu̿[^_]UWVS 7 zEE $| ƋE%EE9gUuUT$$ … U>t M1uUT$$+@t1FűuUEEu54$;E [^_]ËUt }1]uЋu9t!$Uo D$UT$4$ E0E렃}tE1҉UWVSm6 BDu Ex}u 4t+D$4$U?uE)E@ [^_]Ë t 1[^_]Ét$OD$$jGUWVS5 øCE D$E$P D$ED$4$ QNjE8tB 8"tn˜# uOt$ E D$=rD$$҉[^_] 8"u썇v#뱋 t[^_]ÍvҋE D$)rD$$lFUVS4 ûBuF$9F $94$9[^]UWVS4 BE 1t 8u$0E]M $x NjExlD$4$4MA XEU PM9gEED$<$Dž?nED$=<$莼 HE u M D$<$d~kD$E D$ ED$D$4$tWD$D$zd@ $9  $D$$ |$$ƅOD$E D$ ED$D$$$=D$E$vPtD$$}$4$4= 8[^_]À>/uEt$D$<$ t'D$<$^ 8E D$t$E$M}8[^_]ËE D$bD$E$ME D$D$D$ ED$D$O$ş BE D$t$E$3Ng* E D$\rD$E$5MDž1D$ |rD$E D$E$Dž1` E D$\rD$E$L10$z t$ 'D$E D$E$'<$1wrD$E$-D$/4$8 E D$4D$E$LDžDžk E D$TW E D$TWUS(=- ;EEED$D$ED$ ED$D$E$袝 x E([]øUS(, æ:EE>ED$D$ED$ ED$D$E$6 x E([]øUS(e, ::D$ D$$?D$D$D$D$D$ D$D$D$D$ $Ĝ x D$([]øUS+ 9ED$D$ ED$ED$r$)-x E[]øUS+ h9E$iUv+ O9Ut ]Í]UWVS@+ 9}|$E D$E$I9s [^_]N ?|$ t$TD$$[^_]UWVS* ä8}|$E D$E$I9s [^_] ?|$ t$D$$[^_]US `* 58E$n t []ÉErT$$EUS * 7E D$E$m t []ÉErT$$EUVS) á7u4$%t[^]ÅtEt$rT$$EUWVS{) P7u} |$4$)t[^_]ÅttE|$ t$T$$EUVS) 6u t$E$w*t[^]ÅtEt$rT$$EUWVS( Ø6}|$E D$E$K u[^_]É 0|$ E D$D$$[^_]UVSX( -6uE D$4$t[^]ÉEt$rT$$E[^]US( 5ED$E D$E$uErT$$E[]US' Ã5ED$E D$E$duErT$$E[]UWVS$Y' .5D$ D$EUD$T$EUD$ T$E D$D$E$ Ɖ׋D$ u $[^_]: L$ EUD$T$EUD$T$E D$ ED$ D$$$[^_]UWVS$& l4D$ D$EUD$T$EUD$ T$E D$D$E$ Ɖ׋D$ u $[^_]x L$ EUD$T$EUD$T$E D$ ED$\D$$$[^_]U% 3U!OፀL]Íe]Í]Í]Íi]Í"]Ík]ÍS]Í]Ít]Í]Íy]Í ]Í]Íf]ÍS]Í&]ÍS]Í]Íp]Íb]Ík]ÍF]Í<]Í]]ÍW]Í^]Í]Í']ÍT]ÍO]ÍJ]ÍŁ]Í}]ÍA]ffffUWVSP X$Hp)9s L H 9r,P 9s P P P$@(@,[^_]Ë #p VpUWVS,$ 2ƉUx HEU D$ T$ED$9s)L$><$ ~F [^_]D$$ۋP Hx,tP(9s ,P P 9s 

S S KC S$T$ʉs[^]UWVST# 0E}>11L܃r׋EEċE EȋEUEЉUԋEE؍WỦ< <<] E;EriEE؅eEU9s UEUȃE9sv ED#UȅtEDgET[^_]ËU#EE%ju}ču܋EU$T$?uẼƉE wt ~ 1ҋM!E! tE̍PUP v)E;Es MĈEEU̍JMR wډuuUtE;Es U>EE1ۋE؅EyUE9U9v UD#Eȃv UDEȅUDwMaEEEE}ωu΀FE:j=*}_]̋MEU$T$ڋ}i]EE߉]̃{u]bO?_]̋EЋU t1҃EE̍PUt'E;Es MĈEEU̍JMu܉E}ESfO?~w<@p]fEЋU t1҉EU<@t$ t1!E!UGE̋EFE̍PUE]Ȅt&9s MĈE]ȃEU̍JMu9s U=EEEU$T$U]}EEf@E%#jxE%#joEUE_]̀}FGG9U}1 CEt'E;Es MĈEEU̍JMu܉E }EEEv_]̀}fGU}1 HE;Es U=E]̃EQpEЋU t1҉EU<@GE̋E"0]̉EUD$EUD$ T$ED$E D$E$p]fffUVS W*uED$ ED$E D$4$5D$ED$4$U[^]UWVS42 *UEzlj(aED$/<$莤 t<|$7D$ED$ ED$ED$4$/4[^_]ËE AE|$ED$bED$2D$ED$ ED$ED$4$u 8upED$ |$ED$ED$sD$ED$ ED$ED$4$|M? 8u 6EL" 8t ED$|$D$ED$ ED$ED$4$  USw L(EU M]]] ]][] USEU M]]]] ]][]fffUWVSt 'D$L$<$S8t$V#D$<$m1 Dt$D$$imũED$ sD$D$$Yrt UWVS v%D$ED$$t{NjE88/tbD$/4$j…tL)JBU=wsG|wdD$}|$M$v Es(uuE[^_]É[^_]äftUuu%1[^_]MyfUWVS k$}UtlƍxD$4$F tD%=`u'6$U tĄ[^_]f O1Ą[^_]L 1UWVS #}U)tlƍxD$4$AF tD%= u'A$U tĄ[^_] O1Ą[^_] 1US(M "#EEED$D$ED$ ED$D$E$貅 x E([]øUEM tP8u ߉P81]à ]UWVS  Ê"}tc$fUT$U T$$ ƅt/tV$ uDt$D$<$MƉ [^_]ÍD$$u [^_]U  !U T$UT$-7$]U EtUT$U T$$]ø]US  m!E D$E$`=u$ED$ED$-7$ []øUVS D !uED$E D$4$x=uED$ED$4$H [^]øUWVSL E uUŰPUЋPUԋH M؋HM܋HMHMHMH M@$EЅ$EPU@E)99}W~E}ủuĉMEU1NjEĉD$ t$EȉD$E$qE9}u֋UȋED$T$E$J<E$e1L[^_] 7Eԋ U2bL[^_]UVS4 yuЉt$E $^ED$t$E$y4[^]U ` 9U T$UT$-7$D]UWVS/ uEE}ED$E D$4$Z;t}EE u[^_][^_]UWVS4 ä-78ủt$E$聣E D$t$<$4[^_]UWVS [EE}-70E D$ED$4$:t}EE u[^_]?[^_]UWVS4! uED$E D$4$U:t%}̉|$E$轢ED$|$4$4[^_]UWVS4 ×-70E D$ED$4$9t%}̉|$E$YED$|$4$w4[^_]UWVSH^ 3MU }Aq)9y}ȋ:}̋z}Ћz}ĉ}ԋz }؋z}܋z}z}z}z }R$UUątj~;ƍỦUĉEuƉϋEĉD$ EȉD$t$<$!nE9u܋EUȉT$D$ $M8M $1H[^_] 7}ԋ Uy'H[^_]UVS4D uЉt$E $ED$t$E$4[^]U  U T$UT$-7$u]UWVS äuEE}ED$E D$4$7t}EE u[^_][^_]UWVS4o D-78ủt$E$!E D$t$<$4[^_]UWVS& EE}-70E D$ED$4$L7t}EE u[^_]p[^_]UWVS4 ÖuED$E D$4$6t%}̉|$E$]ED$|$4$ 4[^_]UWVS4b 7-70E D$ED$4$6t%}̉|$E$ED$|$4$4[^_]UVS EM thP8t P8Ɛ-7@:t1 [^]ÁP8:D$D$@37@<$GH8붸 [^]UEt @:]ø]UVS T )d-7t^--T$XT$$3Ƅ-7tE$\1-7$S$-7 [^]Í3$2u뎍>s$X$蝞fffUWVS0 vuzE$z~}UU}} M߉ME؉4$#aƒ  UFD$ D$FD$4$蟉U9UX9UF?M- DQEmML$D$4$34$W`ƒ4S;} E8E}E;} tu}MMD$ FD$FD$4$fD$ FD$FD$4$fMAE9N~D$FD$4$!3mFM9ED$FD$4$2EE9;} tɀ}TUD$ ED$FD$4$fEHU9ЋUE9F M10[^_];} D$ uTED$FD$4$eED$FD$4$12xD$ D$FD$4$eeFD$FD$4$GeD$ FD$FD$4$&eFD$FD$4$1}tE9} uD$ FD$FD$4$dFD$FD$4$j1D$ ML$D$4$dFE[^_]UWVS0 E}GDEE-798GH%EW,_]ԋG1ɋ];_]]؋R_]܍49;EM}u5W,M؋ +JMIʉʉʋMUMfF%] ؉Ft$G|$] fFuE9sMF^U9jbځM9OV Df~9E9rMutPG,]؋ˉM+XÍ@‰ЉЍD$ t$EԉD$<$]虁MEE9G~0W,10[^_]Ã]1^E:<$]?}1U -7$]UVS f-7p t4$u N8@[^]ø[^]UVSL !ut4$nu N8@[^]ø[^]US$ E UD$ D$D$D$T$T$ D$D$E$$[]US$ ÌE UD$ D$D$D$T$T$ D$D$E$$[]fffffUWVSN #} uUE%tUG$.Ul 7tUF$U/ 7tBU$U 7,048<@DHLPEtE@$Z 7  $(EtE@$ 7TX\`dhlptxE tE @$$w 7|UUUUUUUUE}$tE$@$X 7U UUUUU U$U(Uċ,Eȋu(tE(@$'9 7ŰUЋUԋU؋U܋UU䋐U苐U싀EE@@t ʋ}wHt ʉt ʉt ʉ,t ʉt ʉ,t ʉt ʉTt ʉt ʉ`T|t ʉt ʉ\|Mt ʉt ʉXUUt%  TŰE@|E@hDž$&' E@,8@1fN9 4>ff~~ tωv$uE@,8@4F uf~n$O HG 9u͋940f|0yW}$G,@fD00f|0y.GDfJT$G|$uĴ[^_]Ë$#E@,8R|)4xLlx9kf+fdG9R)fL29R4 ʋ fbJr tv$uE@,RD 9YUR, rfVAtωp$HN HF 9u͋tp9dl9h0\d$xy DžxEP$ty DžtEL$y DžEԉH$zy Dž4$Ry Džx|Ƌ)΋)ȉlp9`l9E@,H1҉tvf~94>ff~~ t‰ljv$Au}O, I4F uf~0r$C4O HG 9u͋9 Ƌ9p9pDžAlxE@,8@xM8MA,@ƋQHVfF94QDfHD$A|M$uDžGGG GGGGG G$FFF FFFFF F$,B0B4B 8Bff~~ t‰׉v$u}O, 9I4F uf~k$b O HG 9uϋ9 p|9|)ȉ9xE@,@u0F,@‹NHJfB91ЉNDfHD$F|$YuXx-7}9Gx E@,@1fF9x4dff`FF tƉv$uE@,@4F vxfFXl)\N HF 9<$u,9|?EH,|f+f49@)fT094‰PЋLf`\Pp tv$PuEH,@D gE@,pfFE^*LN HF 9-$.utE@,8@1fF9t4PffXFF tƉv$$uE@,@4F otfFMh&LN HF 9;$u9|EH,|f+fD9@f+f|094xH8f`Txx tljv$uEH,@D8 KE@,pfFEЉM,LԉN HF 9Nj$u3|-7}9GG800D$E$/f1UWVS| Uu}}  7M  M 7  7  $( Q 7,048<@DHLP ,,} 7TX\`dhlptxE% TT} V 7|UUUUUUUUEE % ||}$ 7M MMMMM M$M(Mċ,UȋU$ UU}( 7]̋]Ћ]ԋ]؋]܋]]䋙]苙]싉MM( M̍M̉L$ T$D$|$t$D$ D$D$E$|[^_]ÍD$E $tUD$$t1D$4$t,t$<$ct}-T|$E$Dt} |D$E $t}$UT$E$$s}(EM̉L$E($syU$ U$T$ U T$UT$UT$UT$UT$ U T$UT$-7$w]U$c <U$T$ U T$UT$UT$UT$UT$ U T$UT$-7$]US EŒ-7t0ÁtZD.7tu-7 %BH[]US UE t0ÁtZD.7tu-7 %BH[]UWVSg @Eu] %tFDU.7^HFE~TFU1~_V,@M}@t~D8x ߉xf@9uڋ}9}uD$4$]]1[^_]Ã9}uf-7 Y[^_]Us LUT$-7$]UVSY "Et=PHӁ.76u @D [^]Éց-7;1uڸ[^]UWVS< U Etzu<[^_]ËB$E@DE̋E@HEfEE@LfEEẺED$E@|$dEx|U B$tU BMADBEȃvgDE9tKuU M$Y8@MąɋU  AxDE9uU <$U %.71t MAHALQDUEfEfEE}}ȉ|$A|$[|$E$1ҋEH~]E@,<1E@~=U E9p~*W DtL$Eȉ$E9p֋UăE9PD$E$ [<[^_]ËMA|tBf-7 U $@EH|U Uq JUT$-7$_]UWVSG }-70t=Gt6G$,&|$4$D$4$(Z1[^_]ø[^_]UWVS ïu} t=Gt6G$&|$4$D$4$Y1[^_]ø[^_]UVSv KEM tlPHց1.76u7PDQAP|tA\Rtu1[^]Éց-7;3u뭸[^]U UT$-7$J] ǀ UWVS8 xu-7E8-…2-7E̋2-7E؋2-7EЋ2|-7EG x-7EG$t-7E܋GTp-7EȋGXl-7EԋG\h-7EG`b-7Gla-7EGm`-7EGnE0Ћ2E̋2E؋2EЋ2EV EV$E܋VTEȋVXEԋV\EV`FlNmEĈVnE4$"F-71ҋ2‰T$$V -7V-74$4$ 8[^_]-7E-7E-7E|-7Ex-7Et-7Ep-7El-7Eh-7Eb-7a-7E`-7EUWVSv K}D$4$ƅEdž3E Fdž2dž2dž2dž2dž2 3ǃ džh2džl2F`fFddž2dž3F FFFdž3dž3dž3 $3dž34$6t$<$}o2PJpdž2D$D$D$D$ D$D$4$TFD$D$D$D$ D$D$4$F4$a4$譏D$D$D$D$ D$D$4$謡F tjD$$4$$4$t4$4$6HH-7t 3t4$#4$A[^_]Ë2t$fd2$g29tDžu拆3$M4$E1[^_]ËRhD맍3$BDžUWVS7 }2t$c2$ig29tƅu拇2$g"<$a3$3$-798t<$[^_]<$m[^_]UWVS _u, +9uǃ >ǃ <ǃ ^ǃ vǃ #ǃ :ǃ 'ǃ #ǃ #ǃ #ǃ -ǃ -ǃ _ǃ  |ǃ$ oǃ -ǃ -ǃ <ǃ >ǃ *ǃ !ǃ  f2E@tgt.Ex tAu[^_]ËE싀t(VT$&;T$ D$D$E$ 1, Tp=u[^_]US þM1Tp, =u[]UWVS, Í, EƍME$+$FF(9u݋uD$$A8CuxuAD$$ $34T$$7ǃ !ǃ +ǃ !ǃ ,ǃ< !ǃ -ǃd !ǃ .ǃ %ǃ 0ǃ4 %ǃ `ǃ\ %ǃ aǃ$ ǃ fǃL ǃ gǃt %ǃ hǃ &ǃ iǃ %ǃ jǃ %ǃ kǃ %ǃ lǃ< %ǃ mǃd <%ǃ nǃ %ǃ qǃ #ǃ oǃ, #ǃ sǃT %ǃ tǃ| $%ǃ uǃ 4%ǃ vǃ ,%ǃ wǃ %ǃ  xǃ ǃ$ ~ǃ #ǃ pǃ #ǃ rǃ d"ǃ yǃD e"ǃ zǃl ǃ {ǃ `"ǃ |ǃ ǃ  }E2xU, U}tPE}Uu(x<uD>E tAuЃ,[^_]ËE}܋u苗t(MIL$&;L$ D$T$$Ep, }Wp}^X^X^ X ^X^X^X^X^ X ^$X$((9u,[^_]$> $< $^< $vd $# $:\ $'$ $#L $#yt $#g $-U $-C $_1, $| $o $p $r $y $zD ${l $| $} UUS , ]p JHJHJ H JHJHJHJHJ H J$H$((9u[]ffUWVS0q FEU܉MDŽ-772EE4E, fEE$ƒ=4M4%y 4 44fǃ, EDPf~M䋑f8>@E, fWfcftf.MlU܅t-7Q)ʉ$1E$ƒE@ @M M4 /UfB 49}} 4% 44;4yf, @"7f1҉Ѓ0[^_]ËE44%y 4EDPf, y4D$ D$D$$N 4449)‹4L$ T$U؋MȉD$E$ 4;4U}dž4…f, 4xp4fǃ, +E$/t3E$=Ec0U$)4fǃ, E܅U 0tE@ U؋4 E44B%y 44D$ D$E‰T$E$y4%y 4 494114M%y 4;4$fǃ, Mԋ4D$ T$U؋ED$E$U؋M ~4y 4 49411x 4Wy 4 494@"7ff, @}AEE܅U$D-E$ƒUE@ @MM MtU-oE@ U؋4  UfB 9 4)fǃ, &E܅{t-7Q)NUj 4}} 4Hx6 44m4%x4|뿃ߋ 4}} 4%y  44;E@ }fG Ef` -D$ D$!D$$M $WdU Efǂ, ǀ4ǀ4ǀ4ǀ4ǀ 4]UWVSX wuDŽ-7MV8у$33-EEt-7E(V8t@N<)tE11iE}uDX[^_]ËFv3@|-7D$x-7$#ǀ3E AX[^_]EE] (.t&KEEED$D$ F@D$EĉD$Ủ$UuQUT$4$ M)v4$ 33} -!EED$D$ F@D$EĉD$}̉<$P|$4$& E1EE$E%V88uF @t7~ 8t!F }fG %E g3t&|-7D$x-7$M1҉3E@ U腿 ^UT$-7$]UWVS [ 0u}ED$E D$4$t} u [^_]r [^_]UWVS  u-78E D$ED$<$3tu } [^_] [^_]US谾 ÅE$ []fffffUWVS 聾 VƉ$2n $誺…t"ׄtN<$tȃuЃ [^_]ÀF$F Ut p@뮃$<UVS ƍD$4$3n FsD$4$n 4$im vlte110B<1ɀ;Pt0tD~ȃu9mt(B< v-1ɀ;Pu1[^]ø[^]É묀;tD01ɀ ɉ떀>uF[uVmtÃt0ZcWKUWVS0诼 ÄUu :uH2tU$9LUF@fu2ML$ MD$T$<$S2MEPJ(N$JN 3\Ks$JD$D$$XFTTs$D$D$$'FXV ~$x-79|-7NTt-7 p-72P3B0ozpdH12džp2E苂E싂TEtU܉Udžp2ELɉME*EEUwD$Eԉ$U:E܋U؉$HMԉ $=E܅t2džx2EtEJdžx2dž|2UtE.dž|2E؃0[^_]ËHt1@@Dǀ@l@hǀǀǀ<HHpF$B(KE`U܋ED$<$i U|E>U܋ED$<$i Uu p2EU܋ED$<$Ri Up22@@ ,F@f`L$ D$cD$<$2E41E$D$E$h u džx2EED$E$h u x2|$E$Zh x2Et ED$E$*h u dž|2EtD$E$h u |2|$E$g r|2c~ LSMt|$E$wg u x2dž|2EEdžt2džx2dž|2džp2MzEdžt2džx2dž|2EbtW|$E$f uDx2dž|2džt2džx2$dž|2EEdžt2džx2dž|2E&U蛵 t-7D$E$]USs HEx-7H$ |-7H t-7HT p-7HX b-7Hl ˜-72 p2< t28 x24 |20 2$QC[]UԴ M„-7tJXp-71]ø]fffffffUWVSLjMEE_9tBfxft0fu9PuԀ}tMHE 9u[^_]M@EE D$E$UElUUWVS }ƉDHfx 4 [^_]Ëf=tnfDN4f>tM$]߯QPf9uǀFF [^_]ËEFf\Nu]ED$$]衴MME$ ]KUMtbf@f@@ f@@f@@]\]X ]]UU9uU]$ $eF]-D$ D$D$$; $)F]$Ǻ$ FUWVS  Ɖ׉M$a ttLMt5$LVp9uϋ}E$TF [^_]É}UWVSs LEu^9t)fxf8u@$9u׋~1$]9> $]ʵ4$µ[^_]UWVS X9t0fx4ftfu9VuF9uЃ [^_]ÉMFUFҋUMuUM$MUUWVST )}fǃL $zPf9uǀ2ǃP ǃT ǃX lP2@tL$h_ =w4D$T$$N2D9u[^_]Í$۷$ CUS 5 E E„-7t+2UT$$UPE []ø []UϮ UM ~*-7t2t 1]É1]UWVS 腮 ZDŽ-7te3339}}<31 [^_]à D$$褯‹t!3333뱸빋33D$BD$$F 33]\33o'U 諭 E-7t%2UT$$1ɋUE]ø]U] 6M„-7tJTt-71]ø]UWVS) }<$mƃuOG @tIHk 8u?DŽ-73t-|-7D$x-7$yqǀ3[^_]UWVS 説 EU-72El EE$3=X %y P T fǃL LNfu f9qL fmffjMUU$ E$mE@ @ME@ M P %y P T LNfL X T yt鋓P X 9fL y [^_]ËE$At3E$8=DEMR [^_]ÃUfB X T 9|l <X P 9fL [^_]ËP %y P ;T fǃL Eu-E$E@ @aσufF t-7Q)=X T Ef` [^_]ÿ-D$ D$ D$@$2 $=UWVS$( uDŽ-7M~V8у$?p33-M MEt-7BEF8V<F11‹F } MƄ-73322l3UujU22l3 -73@fuT$D$$[^_]ÁU 3P1[^_]ø[^_]U1  D$-7$]U ޠD$-7$]UWVSڒ ïu$$ 33|$ D$D$F$52VT$&;|$ D$PT$$]2VT$|$ D$PT$$/F@:udž3[^_]Ë2VT$|$ D$P<T$$x-78|-78 w+3<$31҉31 US蕑 j:[]~ W-73US] 2-7$Ŝ1[]US1 -73t-3@fuT$$- []1[]US ِ î-73t53@fuT$D$$ []1 []| U-73ts31V /-73tu310  -73tUs3E1]ø ՝-73tUu3E1]1Uȏ -7U31]UVS襏 zƄ-7@@fuUT$D$ht@$2 t Efu5 PwtU$Ѓ[^]Ëǀ3[^]Uftx-7|-7UWVS, ל  }Ƅ-7@@fu|$D$ht@$2 4U|-7fx-7ǐ-7;Pu9HtL$MԉT$U؉$rNMԋU-7;Pu9HtL$T$$JN43@fuT$$%* 3@fuT$D$$8k$$,[^_]EfEfx-7;tǂ3U9ǁ3|-7x-7ybEEEEEE D$}܉|$$WJ ǃ *iD$$kH  ǃ USЌ å t[]ÍiD$$H  ǃ []US肌 W u[]Ë D$$G ǃ []US$:  t$[]ÍybEEEEEE D$ED$$I ǃ $[]US$迋 Ô $[]ÍED$D$$H  9Et $[]D$ D$$H 1UWVS4B Ƅ-73;3@fT$$ '   yǐ-7B$YkD$D$ HQT$PT$@$莣@37@|U:E؉D$D$ $Uԋ@t A:zUԋ}؉|$D$$b|$D$Uԋ@X$@@$ D$ D$D$@$nǀ343@fuT$D$$4[^_]@37@|:M"E܉D$D$$F  9E ǐ-7R뒸 D$$zD ǃ  |14[^_]:MvUԋM؉L$D$8$Uԋ@YD$ D$$E CUWVS,c 8EEEE uԉt$}|$$JEEEED$|$$JD$$ L-73tD$t$$|J,[^_]蚇 s-73trUSu J-73u-3@fuT$$K# []øUS  -73@fuT$D$$5 []USΆ ã-743@fuT$$" []>US 肆 WE U@37RtI|t7:T$D$$x-7ǀ3@$ 1 []Ëxt:T$D$$/-7ǀ3@$ 뵸 []UWVS 蹅 ÎEƄ-72tt_ [^_]@37@tǂ2:T$D$$@$ [^_]@37@@ttǂ2@37@jǂ2U߄ -72$]ffUS]E  }t J;}R ;~1[]ÃUWVSy N}tG8 uZ@u[^_]ËtG~W,EO(G\p;}@ ;~E9uՋu뭉<$VG8UEU t9P| @,]1]ø]UWVSu] UtSx]F9}VxR)9H t7~,}߉ˋF(D$NQT$$U91[^_]É봸UWVSu] UtTx^F9}WҐxR)9H t7~,}߉ˋF(D$NQT$$U191[^_]É봸USEt"H~X,19t t[]1[]UWVSu~~?F,E1ۋF(D$NQT$$ًU9u1[^_]øUWVSu~~?F,E1ۋF(D$NQT$$ًUI9u1[^_]øUWVS}] UuG9)9UtYW,G(tX] UG(uU r9|_9}G(r 9 _9}"E E9E |1[^_]D$OL$$bE9oƉ\UED$ PT$D$$]UWVS}G~CW,EH;}@ ;0~09Ut_(Gt} u̓1[^_]USEP(]U@,M H;}@ ;~1[]UWVS}t@G~2W,EO(G\p;}@ ;~9Uu׋u[^_]UWVS]t]{tVO~Ww,19tItC~2S,EK(Ctx;}@ ;0~09Uu׃[^_]Ëu[^_]UWVSĀX -R433x,}396F8 ,4};~E<E1uuuuủuƉMD>EED$D$ M3@@D$ED$E$OV,UD>UЉ$jUЋM;4ED$ EF,D$D$3$bED>$EENjE94~WD>D$E$AE!эP$U- D$UT$ ED$D$4$;EE[^_]F,D$D$E3$EV2MD$ T$FD$4$D$M2$ҸEE[^_]ErUWVS8 } ƉU̍R4EԉuЋ4M8<$, ƀ?tqE4EEEEE'E$讄M9ErIUU)ր?Et7E܉D$ t$|$E؉$詂Ey8[^_]EEEԋ@tCuҋEԍPMulEEЀ4uŨ8[^_]}E)9ǃEԍPtt$D$ $U. U)uMtMȉ׋uԋ6sRtftE‹u)uEmut$D$ $U UIuE)muuzEfUWVS,{ EօE93}ʅD-?@tDG@uM$Ub* MɋUM4M׍MMu܉ƉUE$2Ut7)ր?t.ED$ t$|$E$|Eyĸ,[^_]Ëu܋U)׉|$$ؽ…tٍNDvu4]Xʉ1,[^_]ø1ɍA1USy ÖEw"SD$$=3[]øUS~y S-7t3tUT$$\[]øUS :y -7t&3tU T$UT$$( []øUSx Ć-7t3tUT$$[]øUS x À-7t&3tU T$UT$$ []øUS`x 5-7t3tUT$$\[]øUSx U -7t*3t ML$ T$UT$$<[]øUVSw Ý-70toƆ43u'3tU$}3${[^]Ë2Ppt%T$$ D$2$[^]øUS 4w U-7t$3tD$T$$ []øUv U-7t~;3TR4]1]USv -7t3t$U[]øUSmv B-7t"3t$Ut DY[]øUWVS $v -70Ɔ43uj33~BE14u_uE;3|Ճ}tO3$y [^_]Ë2Ptt&T$$D$2$ [^_]øUFu U-7MMM ] USu -7t3t$Y[]øUWVS t õ-70E E4ED$ D$MML$${tiP$UpDžtUU UED$ UT$ML$<$^{t&E$U%Ɖ<$ y [^_]þUSt Et3t$gS[]øUWVSs óu3t$"3~#14$nx;3|ߋ4$Ux3ǃdž3D$0$s4t`2PtD@@X~:Ɔ3S$G/2@PX3@$41[^_]Ɔ3UWVSr Øu3t$3~#14$Sw93ߋ4$:w[^_]UWVS]r3Y3KE ~443 u} })u}}11]]9t0z9u}9u]1~39114uu;3|ى[^_]B,B\4u u )lj<)} t7ƉL|G1[^_]ÿUVSp à~utNFX32@@T%D$4$ E D$FX$1[^]øUWVS [p 0~EExD$D$<$_xƅt,)‹M tEt|Etuu)1 [^_]ËE tmEtYutREM.7 u)1MfT$|$E $wE 01f%и [^_]øzUWVSno C}EEuE $&wƒw]}E(1M149rEtfEt1[^_]ÉEE $v,} E9tl$vtEHE 103EE1MM9rMEtfEtЪW‹EHE 1uu1U7U9rUEtfEtE%}.7t]ft  ؉EP1u 9r[^_]ÉE'[EGfmHfmBЪEfmEH>UVS4m zUE ӁttH@[^]Í 7ʋ JHJHJ H JHJHJHJHJ H R$P$ [^]UWVSl hzutv4$}uVȉ‹9u F0$'qF,$q-79pt]9p tJ9pt2t$ $p4$p1[^_]@u@ 9pu@9p uUF4$p>9UtU?$9Uu~X24H90t…#ȋH90utJ$=p2UWVSUk *ylj֋@X2BTttO@ ttO@ ttO@@t tO@@ttO@ttO@ttO@t4tO@ ttO@ @ttO@@ttO@t@tO@t"(ttU<$UtB8tt<$u 1[^_]ËGX2G@%G@RR8t Ɖw@Ѹ[^_]UWVSli AwƉ׋@X2@Ttf@ tf@tf@@tf@tf@tf@tf@tf@ tf@@tf@tf@u=uAuIu 1[^_]@37@@8tf@ۃf@t4$t4$뭸[^_]US%h uMU -7t%t X@t @@f%f1[]ø[]Ug uU-7M u]]]Ug uU-7M u]]UVSg XuE Œ-72Uu0ÁE% úډ1[^]ø[^]US%g tU-7M u8tHX2H@H@[[8u1[] ʉP@[]Uf t-7U]QUf t-7U]UVSf ^t-70tFFX2@Ttf@4$4$@37@@8tf@U1[^]USEM Ut%t X@t @@f%f1[]ø[]UEU Mu]g]UEU Mu]3]USEUu2U Á ӺEڋE1[]ø[]USEU Mu8tHX2H@H@[[8u1[] ʉP@[]UEt@@]ø]UU E]UU E]_UVSd árutFFX2@Ttf@4$4$@37@@8tf@U 1[^]]d 6r@37PT1 t t t@t̀t(t t8t ttLt 1c vq@37PT1 t t t@t̀tt4tt t@t@t(t t8t ttLt 1ffffUVS b Wpu4$2 D$t$-7$) [^]UVS Eb pu 4$ D$t$E$ [^]UWVS b ouE Œ-7:x1u 9t <uЉD$t$<$ [^_]É4$| UWVS a Ào}-70E D$ED$4$׋t<$8 D$|$4$7 [^_]UWVS Qa &ou}ED$E D$4$肋t<$ D$|$4$ [^_]UWVS` n}u-7E D$ED$$U"t/Ux0u 9t<uƉt$|$$k [^_]ÉU<$I ƋUt$|$$C UWVS c` 8n}uED$E D$E$葊t1x5u 9t <fuƉt$|$E$ [^_]É<$ UVS _ þmu Ex2u 9t<uЉD$t$E$~ [^]É4$` fffffffUWVSD_ Vm}EUċEG,4@4E@U }` jE EG@E̋GXpXș)։uȋE;GTEȅ~E1ẺE9ut3EĉD$<$譾uD[^_]à E1D[^_]É$f&EEFEȅZE@$zfEyEGM+M9E O(U @9~F t$fF E@ffO@E % ЩOH ȉFEfFE@EȃvA}$YMLO HG E9uЉ}FMăU U~g։}NjUG tUMȉ$fG UMȋE@A%GGfGfwu}G9uOT9 pO(LE @ 9}Gpt$ EĉD$ED$<$9EEGT9tBuW,u P GG(<$FEP1Ʌt=Uȉ}$XkMTO HG E9uЋ}E  G(MJ9~R 9}ED$ D$ED$<$a&A!E$cBE u E;GTuO,u u6uč @4E;GTQG8 |<$w<$ EE uUčJ‰Uĉy19zuĉ)UBHFBLfFMEy19@E0B,4v4BDfFt$B|U$bu 4M+EOT9E M MO(ʋH93OU9U+GHFGLfFfFUO9UGDt$G|$au3  GHhUMʉUȋu6O, 4I49~X}uEFDfG|$F|$aFHGFLfGEȃ9FEfxmMO(E @ 9}EȉD$ EĉD$ED$<$M MG8 E 8W9)ʍBE G8  a-78u E<$\GG8 <$BEuĉ׉EċE MO(@9E w(t@ 90}0OL$ EĉD$ED$<$EEGT9tAuO,pM E<$0EG8 <$}YmUWVSW e8uE0E,EP@,Dt@ 1H470RM܋E9M܋E׋W~iU1E9w~MG,U[_DUPXfXf@D$G|$]Qu`E9EuM܉r9M׋GD$ D$t$<$]9uuE7fP 1fUI VUT$-7$j]UWVSE89tZ@EOE)w~>EP,G(UW,΋M4}y߉:O9u}?9}u[^_]UEtPt@+B]ø]UEtPt@ +B ]ø]UEt@]ø]UEt@]ø]UEt@]ø]UEt@ ]ø]UEt@]ø]UEt@]ø]UWVS(G ÐU}GDE-798 GH%EWUOMG,E܍40UunыpG9UfFE9svffEF%M ȉFt$G|$Nu¸([^_]ËOU9~VUEEGGE܋D01E_GD$ ED$ED$<$%<$ 1([^_]EUoF HT-7$]USYF &TE]  *t&t  A  1[]øUWVSu} ^(1Ʌ~&1 ~у9tT,y)у9u[^_]UWVS0E ÎSE,Ex-7E   E1|-7EED$D$D$D$ D$T$UE$t!UB UUB(ɋU~CUMT$$Vt=9 ~#tyڅlE)e)Uǃ 10[^_]UWVSD ÄR}W$G(E~w1U9w(~hD,tO L$y؉D$D0$tuED,yD$UЉD$D0$ tD,E9w(E[^_]EyUWVSC Q}G(~"1D0$9D0$=#9w([^_]UWVSC ‰Qu 1~019t% 9 uDŽ  9uۉ[^_]ffffUWVS QC &Q]ƉE׉UM$2L]EPt MA +B A(EEuFF]^]^FT4$]j 1ۋNv]uF,MzF.1ɉU܉fGU9VUGfGFD$]HG |$F|$3Ju [^_]ËEED$E@,$]CtыuF,U)D$F0$]dCtF0V]K +J K( <K,[+ZR,UʉUrprpP 9MuԋEU܋zUED$<$]KUBEE9FEP1 [^_]ËVE}ǍD$uF4$]qBÅF4F0V, M܉ً]Ӊ]u܉HXXXX @x9UuҋE];9NG EOsC9~ HOCU4 9C~FO$w CC 9~ pw C Ѝ197~5U?9u1E)EEE1)ùUWVS? ME]SCJr9~ FCr΋M 9~B1)΅K zB 9~ HK B U9 }B}M :u 1)ȍ<?E C EC$E-791[^_]C:}x-7-79ˆ-79Œ-79S9M 9u M S E|-789E9EE)Dž#EÈ-7tS} x }x$}u UM su 9+E|-78;}~}낸[^_]É1)ƅ.$1NC E1'CM 1U= gKE~M ~„-79B$t ]1]ËE 9B ]UWVS M= "KUE -7Ex$9}h-7P H4 9unfH$p <19} JBzo-7P H4 9u80H$p <19}  0%D$E$hu)-7P H< 9H$p <19} E}x$} x x-7}:|-7} :2u #vt@:u$wvuE$؃ [^_]Ë@ 9E 1 [^_]ËM )U)M )U)M )9)UWVSL; !IEƄ-7ǁ3~^U ~W;A$t^U T$$D$-7$t [^_]ËE D$$t$1[^_]ËQ 9U u1UWVSMU ]tgAt`q;pVq<;xKI8YxQtX ~0@,41z9~R y9:}:9A1[^_]ø[^_]UWVS%: G}M wuGX;P$UWUU;P G)‰UW u)։uwtb9NEU;FvE9F nEU;FaOEG <$|$4${D$<$茸1[^_]ÉFV MȉFE‰V 4$69u뼸[^_]UEM tP8u ⿉P81]Ã@]UWVS 8 FE} O E+H O(w0G~_1U J(B,4B]+C[,H NX^F BU D$ $]7BFU 9z [^_]UWVSEPX2uH8ˁX8p x;z t[^_]ÁuكH8HR$x9tC9uՋMQ ztɋQuut duH8 uX8UWVS(7 ÂEEUMQI$3ƅ1ǀǀǀE܉$3EF,D$E$7ljF0MF4EFXFF]^EF^ F$EFE F F8FD$D$UT$UT$ U T$UT$-7$W]U0 >EU ~@~UE D$ HL$HL$D$D$H +J L$ H+JL$D$$$[]UWVSL/ =Eȋ}M]u$EE y)}1y)1ɋUy +}Ey)1ۋE @9pE@)9Q9?E @;E E E@U +U9.E 9EE)؍EE-EE]H, uq}MMUE M̉L$E $]諎9uriE(tEDP@u|$ED$E $]XEԋFEEF tM̋\@Ӄu]zUEE} 9}9D$E $]U1L[^_])ȍpE)E UWVSL- ;}ljUM@XEpO8G}GW][u9|;E}Eu)x 9Cu9|;U}E )x 9Cj@tfFȃ࿉G8C8C8 G8C8G:EfEMf93э4u)fEfEEfEA]tG(uȋ^W9} V ;~fEEEf;EEXEfE;CMQ,Mċ4 uUO,Uȋ6u؃utS,EM̋AE܋UR(w8uu9Oq 69BMfMM fMM9~)MfMfE fEEfE)փ9~EȋP f+G(ffEҘSu)E9~ f+E)fE]f9]E̋@EfEEEԋM܍EE@4 CE؉FCfFSfVf~HfP$f@fuG:GD9CCfEfEfEuf;ulE̋]؋@E܋EEM]̋ttEEHW(]܋E )9~W(EX E̋p E )9}G8tKW(UEȋ@U ЋU)9~EG(EEȋ@ M ȋM)9}EG8t EYW(E9|UW(M9}ЋM܋9O(]9Ẽ 1L[^_]ÉE*79 M69txF:uFE~F,E11҉uʋ] tËu^+_w, t]C+G_,!‹]9|u69uMEEȋ@U؉PSfPSfPfHfP$f@fuGD9GLfFfFt$G|$]0E̋@E܋]G:{EEȋ@WDWLfPSfPD$G|$]_0tEE̋@E܋]-EfEE fEEfEfEyBEL[^_]9;K8@O8CxCUWVS' þ5@ǐ-7#B@@37~tD@Tt5MU:L$D$$c,"7!A@U!‹MtD@t5MU:L$D$$c("7!A@U!‹MtD@t5MU:L$D$$8c$"7!A@U!‹Mtc@LtTM:T$D$$b`@M.7t-QMT$$LM.7uӋP@#Q@tA(t7t.U:D$D$ $hbH@@UtA8t7t.U:D$D$ $"bH@@UTt3t)U:L$D$$aH@U t8@t)U:L$D$$aH@ Ut8@t)U:L$D$$]aH@U@t8@ t)U:L$D$$ aH@@Uƀt8@t)U:L$D$$`H@Ut8@t)U:L$D$$`H@Ut5@4t&U:L$D$$i`H@Ut5@t&U:L$D$$/`H@U t5@t&U:L$D$$_H@ U@t5@t&U:L$D$$_H@@Ut5@t&U:L$D$$_H@UuLt<@t-Lt#:D$D$$8_H@[^_]Ë@@tU:L$D$$^H@UzUVS " x0@37Rt @u [^]$K:D$D$@$^ [^]UWVS2" 0Eօ}„-7@U}GFGfFt$G $)OfNfUFɋ>8~xfHf@uEfx~SE@uJUR#h2u.78}}$J t$JutE1[^_]f~E@t܉-7fy~ӋUBvuGfd묅t}$:J {뎁T$-7$G}$J G_UEPT$ PT$P T$P$11f]UWVSEu ]MU}}} }uyE]yE˅y1ۉׅy1pu؋M)ًP)utu9nP Uu)H)ыUt29OM)ىʋM) xHMUщMUMʉUuu܉uUU UMU[^_]뭉U델[^_]UWVS] 2-ǐ-7@@Mt@37J y:ED$D$@37@$6[B@$"7#B@t2ED$D$@$ZB@("7#B@~.7t $hD[^_]uW~udt@37:Et:D$D$BL$jZ`@@37:E*@37:EED$D$@T$ZB@,"7#B@&ED$D$@L$Y`@.7[^_]UWVSu F+}ƉӉ$N,4;]u;} t;E"D$E D$ ED$|$$]6[^_]uUWVS *E-7Eԋ3 ]Ð-7]ZJx< XHUE@8@u B8@B B@ ]:t$D$@37E@@D$XEԋ@@HT D$u4$]Hf8E@PhtfEԋsEHȅuvϋE-7EP,11M~9z_{}~r}41҉9} L$M4$]MuՋE̋K,SB9E}E@@%ƋE}9})EU*Ct}EU9/EEPB%9uUEuE}ċE)DžyE9U)E9EEE}ӉʋuEEȋEMȉEЉ]u]9]1MEȉE܋ZE@,}܋xB,p1҉]M؉M9}L$M4$]TuՋM؋E̋]9]EEEȃE]9\]EE90}уAy9Ex$EaE̋K,E؋mEăpSBE܋]؋}̋7N,"XV9EM$^E@8MEԋP]CD$CE$]CD$C$ESPSPU܉EE$]t,M؋E̋E}Љ9}9}r}h}ӋBM E]ȉ]ȋ}MӋBy9nE܋U9~EċEBDM9l tSl BDt$B|$]gFfFEBLfF9uE̋sE;` _C1ɍl UL$D$ <$]U€w֍V)‰։L$D$<$]S‰EЋE̋@` d EȉE]9~]E])؉E؋UĉЋ])؃EEH,E9p]]]E])؋UЋUЉ֙Ӊ]1uu܉1M9| M9]9]9]E؅& 9]܋KȋŰrU9Sf E䍐l E̋@=vuEEE܋Hىωָ   tftEE =wEဃ)ȋ]܋Kωփ~ tftE܋]ЉXE̋BD$ D$ED$$]蚇EIeWdIt$D$$]D-d]:t$D$$CMčGED$D$ E؉D$|$$]M U܉ MDD$)ȉD$ ]؉\$EȉD$$] EE@T]:L$MD$$CU܉E܋ML$D$E@$BE܉؉}܃}EUqd^]̋R, ]9]uE]E@,E]EE9E|EH,EE}؅EX]@E܋}ȋE)NjE@X0ppuCpM}UčJŰ;JSHFEĉD$ML$$](d:t$D$$AD$D$ D$M܉L$U$t$D$U@@p$6AD$D$ EĉD$D$$U@|$$xct$1|$$@E̋@D$D$}@@0$]9ct$D$$@D$D$ D$D$Eĉ$&t$D$@@p$O@D$E܉D$ ED$D$$t uD$1D$ ED$E܉D$E$]1:U؉t$D$E@$]?U؃9uHvtHT1҉Ut$D$E@H$];?U9uUD$1ۉ\$ EĉD$E܉D$E$]|$E@$wa:t$D$$>E)ED$D$ D$D$E$]TE@|$$at$D$$c>D$E܉D$ ED$D$E؉$] H } D$1D$ EĉD$E܉D$E$]1:U؉t$D$E@H$]=U؃9u2 1E@Ut$D$$]}=U9u ppu;t#t}učNŰ;JXLJEĉD$ED$$]_:t$D$$<D$D$ D$M܉L$M $tt$D$U@@p$<D$D$ ED$D$$*U@]؉\$$]^t$1|$$5<E̋@D$D$}@@0$]^t$D$$;D$D$ D$D$EYučD>ED$D$ D$E܉D$E$]TE@t ]̋ ;qtE؉D$$]]:t$D$$C;D$D$ ED$D$EЉ$]E@E؉D$$]:T$D$$:D$E܉D$ ED$D$E$]SE:Ủt$D$E@$]c:Ũut$D$E@L$]):u 3E:t$D$E@$]9uLN E̋];X= iE:Ủt$D$E@L$]y9Ũu)D$D$ ED$E܉D$E$]|$E@9E؋]9Efuucfr 1t`u 9}tQpt$$]uE䍐l E܋HcfwZ]䍓l T$Uu܋F$NU 1ɋE䍸l E䋀d EE܉E9EBEEUWVS q ]Ƅ-719X‰PtAC:uf11ɋCD$ CD$C D$C$KtB[^_]5C9u-7 Q+SxSQ+S x SċKxSt1҉S1҉SQ+S y[^_]U -7$]UWVS ǂu] EM ^\UV`UVdUVhFlNpL$D$T$ED$ ED$\$4$t[^_]FF9u-7 Y+]^y1ۉ^IM+MNy1ɉN[^_]ø[^_]UVS ut$;#vu[^]UWVS Ð}GDE-798GH%E1ɋwG,pGE9M}DMfFE ‰Vt$E@|$tAfFE9s>FVM9utс}9uN uf~xŸ[^_]ËM}9OGD$<$wD$D$<$"1EU~ W-7$]UEU 9u5J9Hu-Hf3Ju @ R u 9u@Rtu1]1]UWVS U} w to1t6~RutF$u1[^_]ÉU$t8U F@RuDžtÉv$DuG 멃UEU  HJHfJHfJU @ E]UVS& utv$u[^]UWVS Mq~X1Q,zQ~>1҉EM׋q tMv${uME9xԋEM9A [^_]US] t.UӋE ȉt %1ȃ9u[]ËE[]UWVS]} 111 ȉt %1ȃu1Lȉt %1ȃuڋK t4u14Ɓt %1uۋIuҋu9h[^_]1[^_]USs HE t$D$ $Vx) 1[]É$1[]øUWVS0 U  E싃 E@37HApEЅb-7EE䋳 utayFEԋE%Ey E܋EԋuƋUE99ЅyBU)u܋UE)‰U.E9EEEƋEU)ЉE9gFEԉu܋ u)y ‹u)֋Uu9Guԅ+^x-7uu܍t9B~ Eԅ3D$D$ $/ǃ EЋ EE1ҋ EMM܀}EEa-7> ; ЋM)ȉEԋHAEЅzEEE9E| E9AT$D$EЉ$$/@P# ǃ ; ^J U -7UfT$D$$. >u Eu@@l8  ; J Alu (D$ E$…y )Љ p t}쉻 }艻 0[^_]Ë=b-7EEU싃 EMM܀})y uyFȉEa-7> -7ЋM)ȉEԋHAEЅ ; }xM9M M9M D$ $) ǃ ; t E܋E9 E"t$D$$, ; ~a p @@xu XD$E$,y)  ;  < t$D$@$,  ;  u؀> u)ʃ|-7E䍃 EԍEfșƍry )ƋE9@M؉L$D$$V+ EE0u9~1$  ]$uXE܉E ;  Ɛ-7u܋R,r@E؍ E0   u R9 E܋EP, 4v4F‰EEu@M؉L$D$$* yu9D$D$EЉ$)ǃ ǃ UNE;H@uRFuLf~-$ D$ D$F $?V f= @$  tD$ Eԉ$װ…y )Љ 덋@lT$D$$(  E9 EЉEԉu($ \] t'D$ Eԉ$$y) $ ǃ D$ $ǯy)  E)ȃ9u@D$D$$' 9  E"t$D$$^' ; ~b @@xuɋ t5D$E$y) $ f0$U됉Ƌ t*D$ $芮y) $ 1ҋ EUWVS ? E苃 |-7M19|  9 x-7E@379 9-7E:E)$ JEu ǃ E98.@@ltˋM t‹UT$D$$%뵉 PBh9}d T$t$$GƅtDE; t4$Ș U :D$D$4$%uU1  [^_]Ë -7Eu@@h9ME4M䉋 E;0 GE  @37p >u~x -7U:t$D$$I$mtGUt @@tut$D$$$@@lu$ gmu ǃ x-7E 9P))Ή $ 둋 xǃ U8 U U U  U 11]U U U U  U E1]ffffffUWVS %-72-7E-7]19u9uV~sF,E1҉MEF~PCH1U 9F~59uuS9~S 9}͉9FˋU9VMIg[^_]Ë]S~Cs,~DUMڋXCӉu΁9u9uu9utɃ9u_ 8@37BH8~NHD~GBlthtËuu拐tt 1 @37@ xUWVS( ƉEY@37EBH8ˁ:ul-7u@D*= }h-7LJ DŽ-7Y\A`fAdBt%]:D$D$ $N EBt8]:D$D$ $ -7p2!P@EBlhzǁl2ǁh2BxT2@@Tƒth2t h2t h2t h2 t h2 @t h2@t h2t h2EHA\$fǁrǁt"fǁ~ǁfǁǁfǁǁfǁǁfǁǁtmfǁǁtLtfǁǁ~/Rrff@f@@ 9uǁp"ǁt"~&p"p"ff@@9u}苇 %ȋp"t"LJ  LJ 2-7E-7E E9tE9tE苘 ZHB~UJr,EEU܉}؉ϋ~HQE% ؉9u9uuҋU܋}D$$]_j1([^_]øEh-7ȋtǁl2wl-7Ћtǁl2Ntttǁl2)UWVSv KEU MfUfMf]h-7;7Lftvl-7949)-7l2tot"уt>]f9p"t"]fp"]fr" 1[^_]Ét"ufp"ufr"fMfvt]fufEftwft8fXfEMfCfE8fufEfEfE}f9r"*t"BfEfE'UVS ºEM ]f„-7;B`N4f1Dfl2t1[^]ftf/ftTfufft9#ft*fuffuffufffff릸yUWVS$ U} uEEEƉEljEf„-7;B\ @ frftufv@37 I ytX2RtE}|$}|$ ut$D$$-;:T$D$$1$[^_]øU6 Efx?„-7;B\}1@rU f tUf vEf1]ø] „-7ǀǀh-7 t% ǂp"ǂt"  u1U勀 %1]UWVSM &}M „-7l2t^ffǀh-7 t) fp"fr"ǂt"  ug1[^_]f3fthfufto'ftVfmcfuؾfLB %1[^_]þ뜻닻. -7h2UVS  Ƅ-7l2tu?@37Rt*:D$D$$0"7M!A@f@d [^]UWVS n tǐ-7} 3x@tOu f„-7f9pdt6l2t*ǐ-7fpdQ@E % ЉA@[^_]΍N} f_f|Sǐ-7UL$2@$7:L$D$$UUULf`L$2@t΍N} ff|ǐ-7UL$2@l$ 7:L$D$$bUUULfL$2@h$6:L$D$$UUǐ-7$UM fxGUǐ-7$sUM fn G-7f@dUWVSP %U-7pFFy ;F|# tH4$h [^_]Ét$${UWVS Uu FFy ;F|# tH4$xh [^_]Ét$$zUWVS c-7x|$E$Ɖ<$&h [^_]UWVSL !} |$E$fƉ<$g [^_]UWVS U-7tJ } xCH9M ;X9}4xp,9"49M uM HP1[^_]Ë#ָ[^_]UWVSEM UtK xEpu9|;p9~4Xx,9"<79Uu7PH1[^_]Ë4&ָ[^_]UWVS Uztzr BEuNjEBw u)]ZڋOM)ʉ x=_]93O9},_w,9~ ! ΋M9u3GWGu [^_]fUWVS@ fE}E E EE E @$]YÅxyGEGE؋E @ G]% upEp-7E_E))9@L$ED$<$]؃@[^_]û놃 uG1뼸@[^_]ËG,U؋E̋pU ʉMDEEЋGU)9|M̃ W(I9~Gt)A$fE9r)UԋAFAFA F AF9sڋMA E @EȉE E%AfYE HvJM܉]ĉ}}$]M \_ XG E9u͋]ċ}EԃUt1Mٍr}}ȉ8)fX@ fH9u}WBO(T M̋I 9}GD$ EЉD$E؉D$<$]Q<$vM1 EGy1G1 <$] E9GT G8  <$]T1E D$<$]v1 UԋUЉE  E9:]ȉMĉ:BD|$B|U$]-UBHGfG9}s*w tUv$]uUG 뜉]ȋMĉU UT$-7$&]UWVS Èu}ED$E D$4$t} u [^_] [^_]UWVS _ 4u-78E D$ED$<$tu } [^_] [^_]ffUWVS| E}}M E $]EQw$]E1EHMGEȋGEEċE @M qMMMp-7M t[E2 $ ]<ÅyEEę)EEĉEċt& uE9GTu G8 )EȋuڋwGEM)ȃM9EEċGEȋE ]EMp-7MU rUUEM  / m$ ]MDžyE]ĉؙ)Mˉ]ME Et MuM} EĉEY,]Eȋ}4{U]tyu4Ur }y([9;~;EȋY}U9ZU@t)G$fE9r)UGFGFG F GF9sڋEȋUUċu}ỦUUĉU]ȉ]UUuEȋ^,EEEF@ED$ED$ED$ ED$ED$4$]&mmuE]4EȋQT$ UT$D$ $M]LE 8 MQA(TE@ 9}E <U1UĉU uKEEEEE E E$]yVMmEEMmEąy1EămyEF$]y)EE9EbEWMFE EĉE_$]LymEHU8mEąy1EċF$]y)E<9e}U&FHGGfGfG9}FD|$F|$]luE$]>|[^_]ËyQUEĉAEȉA $]{MyUQE9ATtNEȃE u{}ω4$]<$qE1|[^_]E $]xyMEu붋E$]=U xU T$UT$-7$q]UWVSn CuEE}ED$E D$4$t}EE u[^_][^_]U D$E D$E$]U D$UT$-7$]UWVS Ìu}ED$E D$4$tE} u [^_]h [^_]UWVS\ 1EE}-70E D$ED$4$t}EE u[^_][^_]UWVS u-78E D$ED$<$#tEu } [^_] [^_]fffUWVS fÉUM-ljEDWp1҉]]3 VTJ>v]D{u܋]4.tH<*t*Ѓ}‰ DOu냉1sUWVS( lEUM؋ufUވM݋U 1ɋU EEԋ}-Et$$UEx}P$u܀G$N Ut}EMU E1‹E Et~MލAf qC$UЙDžNE݉Et$E$Uu0Eu1([^_]À}. G}ԅ~Mȃf wC$UDž~]؉t$$UuUWVSuE ]UUMt{~9G tU9tMV z$uYVRp҉U싿t:?v(MMM] EE[^_]Eu1E1[^_]UVSf +UE tzJ;A t[;tSZ {$u]Z[pۋtA R(D$ ƥt$D$$E[^]ûu111[^]U   D$ ED$E D$E$]Ul E  D$ D$D$E$]UWVS- Nj2FEF<\<^t{Ѝ\-r7%Ӎru<: <&~Hپ!J'JP'EE[^_]ÍFFZ%P- QuJ{E< v^]v.F<-]1DsD]}MMލ[{D~Dyuu}M؍\u2<\u7{ESȍэf  ΍ f )ʃ0Qfv)f )ڍ)Ѓ0P}E[^_]ÍJ{P]1TQu<.tt]<*yMl1nVU}uf%p}O0J%}d J]܈ZQUdEVU}f%p}O0JJMf%ctEF =8}Ef%pPU}W0PUEtEHM%+%c֋EE&VU%p0%Bp0%{B2}%*fB %-}O0JJUECVU%p0%B{10}B%/%{B 16}%B*%p0B%{10B}%m%B+}O0JJUE'UB\E%p0%@p0%?}W0PPEUMU܉ȉMbËE%>%tEU܋EFt E%+%;E֋EEL1<1JfKMC|D7<\F=]EPU\EUVS ú@37t t~9t $sK EED$D$E $`uI tG@t  .7  @x [^]É댋E[^]É @uUWVS( UEtBEE@37E}<$j UT$ D$D$<$u蹵N)) ]U܉e)‹M) ]UѸg4 )3jD$<$j EtTH tCp$1҉}܉ 9t-~fuUE܉D$$mj UuF([^_]1([^_]ËP 3j([^_]UWVS(˹ àUEtBEE@37E܋u4$Pi UT$ D$D$4$襐}kLЍB)\UeЍBM)\UѸ>Љ)<;iD$4$Zi E܋tRH t>x$1҉u܉ 9t(nuME܉D$$i MuՋGy([^_]Ë;i@x([^_]UWVS(w LUEtBEE@37E܋pu4$g UT$ D$D$4$Q}-?L) RЍ)ЍlVGEeE)  IȍE) GE*SRЍ)<;l]D$4$g E܋;p]AQ tJy$E܉u9t(~suED$$g uދF E܃9u؋E܅t EDžEE1LD$4$e  u݉4$0e NjE$e EED8M9s1=MED$E$藶EE9EtqPf, t$$UKU:EML$$K}UUED4EHUE]}<$Hd UĉT$ D$D$<$蝋uĹN))ƋE40e)‹E)ЋM g4 )3jD$<$^d EuEEAuPEEU 9uthuJf, WT$U $MlJU$Qc MT=L$M$UBJM $'c Uƒ9uuEd[^_]ËE$ i}<$b UĉT$ D$D$<$CMĸkLЍB)\EkLeЍBE)\M>Љ)EiD$<$b -VUE}<$-b UĉT$ D$D$<$肉Mĸ-?L) @)ЍlVAE-?LeȋE) @E)AM*SRЍ)l]UD$<$b Ute}tu}cu }uFEE3j$z<EEi$J=p]$0>렃}u E$1҉UffffffUWVS ־E1ҍpNt-%upHptKst!ltpNuӉЃ[^_]Å~;}~;E tىUn Uƍp@Hπw09}맋E D똉Un UUWVS: 48,.օR@08G4<11$rD$ \$4$01󫋅0t=1(}J90t <u 90u狵(P)1~u,H]Y8^4~!%u~V%8H4X0@,q9r0t$$4Q8C,s0K40u4  8$4Ъ8  @0@4$4蜪8G,_G0Gƅ`%4- Dž,Dž$Dž(Dža`0:~LJwDɋ4lXKJw! .ʋ DNt{,4ʍ\qЉ,'~>aDž,>~`B<=w^4lW0)?(t9,> z$t-.(M,Dž,Dž(hDž$YilP[J߸ V8uo'dwEOI PDEG/8W,G4G,[^_]É,] CEP0 ]P,&Vҋ4xmE EP(, B08H4X0@,T9BtD(\$ `T$0\$ȉ$4Gt8C412<'urR1҉,,0O0PD]PEEP08P4H0@,Z9PJ8K40U{UJP,0$4Y 0,OPDŽPUw}7D$$>D$t$$-‰E$20UtYEE[^_]Í3$'ƅSE1ҋEEut$D$$eM$-@ x Utb}ut$sD$$)EJD$$$; Ex t;MEt$sD$$轰D$$觰ED$D$ht@E$uB tEftUft IA(QuEt E1|$t!D$D$$RB($tD$D$$RB끃}D$$ïsD$$譯UVS' EtD$ E D$ED$E$ƋEt$Q,[^]fffffffUWVS ÖƉEωD$$ N tB4$UM ƀ?u1)9tXzzt"D$|<$ & …uۉ<$M 9t 1[^_]Ét$ED$<$n[^_]ÉUt$ED$<$HUu[^_]UWVS  ʪuEUt E<t][  [^_]É΋Ex %1ji˃1҉9rExtftEx(1}fWVu~9Vt"VT$<$]0ljFVEptft]CPSD  Ћ]XgËuVf;h{CftMWҍTRӉEf}]}^ Qu F 8vE9uڋE}f8Pf]s} H u yf}uHD$$%]]C ExD$$!]谚‹EPn!f8t;Pft2]{u0 ftXHt݉f8pxE;x T@$`|$D$$]+ Ex E@$E11MȍV HnsffvrRPMu v@@1҉P 9rjD$$]m]C(11ɍ&mC}G G$t$]胝G$uyf fE@$$]&Ex D$<$]諘]C$f$ffs@sU@@Jru9U@}t*JrHUznnJrfM6fy'bUWVS,U *E׉MT$ sD$D$L E$73=v(VU KU 8,[^_]D$E$jƅtʋE$F UU܉T$}|$ D$ED$4$FltJUMt@:tOE$Eǃu(EPEǃu E䉃, 14$7m,[^_]ËE܉D$ |$BD$4$*ku΋MUD$|$E$wE=D$E$iƅUWVS։Dž)t Pv9s:ut<:t׃u)u͋[^_]ËrtftƄE$txDžiDžUWVS ܔ ñǃ, s$衼8/u$… ${s$dt!4$‹ [^_]Í$1t,D$ sD$D$<$/04$s [^_]Ís$λTI/@$7lj($<$`uDžD$$Nj$!OmtQ<$)4$‹4$|$$)t4$$r<$ts, 눍s, wUWVSY .EEE EUUD$$rtƋM‹E1lj4$tKMUEt81ED$E$AB t' uMȃ[^_]ùȃ[^_]ÍHPEEE[^_]US胑 XO Eu[]ÍED$E $9+[]UWVS֋N ufS[^_]Ë~Of JN fJy8VӋ6s!uu [^_]äftuutYyZfUVS蔐 iƋ$OF$DF$9F@$.F$#F $F0$ 4$[^]UWVS# }wu G9r [^_]Ått$$etw[^_]É4$UWVSϏ ǠU MuR u+ftO؃tXf;0t&nt(suXDuM 1ۉ[^_]ËEx DC볃UWVS H E 0@ Eu Ct8t\tɀ^tăt8uH[^_]ùx1[^_]ÉdUWVS ڔuNE|F9sXtd|$$MtH~NU fFF}t<]fFFF [^_]Ëu1[^_]É<$迂렋}<FUWVS<] 2E@ EE@ 0t$$sM4$E@E܋uFX1tftE$豊u}D$|<$o HM|$E@ $E$a5 xDMED$E@$M;UBNju`P0@|$E@ $k$E4 Ǎ@ED>D$E@$uUu$迉EE<[^_]ËMAOMփEtfEtǤ$wE܉$lEP p,@ @(@$@,׃ EtU?Wx0My ɍL L$ T$D$E$$t8}uWfUE$譈Ep@@LEMA@AHADALudfxA 111D$ T$L$t$D$ED$ ED$D$E$tam7GED7Mnts{HP|1뉃}t>px111rx@11buE4$覇E<[^_]px1113u܉4$~֨u8uDMUUot$wEU r}fm몍ct$8E0GU7UWVS# UJEtB9swt$U$dUt]rJ] fBB ]fBxzE:us:u.u'EBB [^_]Ëu1[^_]äftu%u0tۉ4$}U]EfUWVS uVzF9sHtT|$$dt8~VM f FHNMLF [^_]Ëu1[^_]É<$|UWVSX莀 gED$,E$} D$|$]_xD$|4$] PU4$]/ = t<$/ = E$]/ = D$$P]6ÉE܅F@ t$$<Et E 2t E D$,E$qEN EEE-E̋EE u<.tjDy@u붋}]9 D$ED$4$]赖ËE8g E E܃x f_EĉUED$ EԉD$E썈tL$E $@EċUڍwEJЀv)ύ)ȍLD$4$# u [^_]ÿU s ׀E=w l]1]UWVS r éu4$" UT$ D$D$4$I}-?L) RЍ)ЍlGEeE)  IȍE) GE*S)ύɍlD$4$n" u [^_]ÿUWVS4q ÿufF(}ȉ|$$ t4[^_]É<$C1t9,ufV(4[^_]UWVSq \uL L .7fV E.7 4$@V(EfD$FD$L $U=UwDE |)ʉM싆t7T$UD$E$>U9sUJM|M))‹FtIT$UD$u4$U9r4[^_]1$.7[^_]ËUыU|UVS=p ~utgF$tF$tF$tF $tF$$tF,$t4$t9L t 1[^]ǃL o }L @o ~}L @tÍAfffffffUWVSqo F}lj$U D$$ * Et$UT$,0U$19UuED$$ * 1[^_]ÉUED$$ b* L$3UD$3UD, UWVSdn k|8EE1EEƍLEE> tqE9D$t$U$1Utˋ$20$2UDŽ0?, 5Euu ;t1< tHv0FIU$20$1UDŽ0UWVS<l z8U11ɍLt6u* E+<ȁ<[^_]Ã0u@W@0ƃ:uVƅ/lFu,$ё9L$貑  Ή$k0D$Y0D$D$ D$D$o4$k{qD$@|$/$d:tRP:uVpƅz빉1$L/Ή$[2Ή$*/D$/$ /D$2ω$.D$.B$E$/Uu$ϑƅD$/4$%/tY1ɉL$T$/T$fT$ L$D$4$Dt$^uD$${B1҉T$T$ L$D$4$빉oHuvFUWVS i vu}D$:4$t!D$bT$$Ыt|$E D$4$, [^_]ËU t考 [^_]UVS h ^vuD$:4$t!D$bT$$PtE D$4$=  [^]U5h vEw0t ]1]ÃL]UWVShg þuEu 8MU1ҍx,U0ED$ muD$D$@U$UUƒE9~ЉLEΉ )t$|$ʉUM$*MUӉϋʉU$+uD$+UD% !L}|$t$$X*uU+u h[^_]ËEvUWVS`}f RtEM 8U1ҍp,U0MED$ suD$D$@U$U.UD$$ j! EED$ML$ED$A(;EUT$$ u@2! f!L^ut$L$$'U+uW`[^_] LU$5*ED$&*UED}# UWVS`e rEU8L$\1ɍpwb0tNT$E UD$ T$yuD$D$@T$$T$T$1t>$LuT$ U MT$L$$ L$\+u`[^_]øGUWVS Nd #rExw|,M0t_ƃtAkƍLU$(ED$(UED [^_]ÃLu$(Ɖ [^_]UWVSpc tq}EU 8uM1ɋ]p3,M0mQm8@E~Eߺ81xEM}EL )|$t$ʉUM$]M&MUЉ΋ʉU$]P'}D$A'UD !L\$T$$] ]U+p[^_]ê0f%.t&CD$D$ ]#D$D$@}<$Gj뉉f>~$E~LSC9u1Uf~7g] ];USDa oEPw*0tf -[]ÃLu$([]US` nEPw*0t -[]ÃLuU T$$[]UVS ` gnuD$:4$t!D$bT$$YtE D$4$Ɛ [^]{ - [^]UVS ` muD$:4$t!D$bT$$tE D$D$4$# [^]ËE D$D$4$ [^]US _ imEMPw*0t - []ÃLuL$U T$$# []US1_ mUBw0t1[]ÃLu$[]UVS ^ þluD$:4$qt!D$bT$$谡tE D$4$蝏 [^] - [^]fffffffUWVSe^ 6l}E1E xt=1}t ƒu@u[^_]UWVSĀ] ǻk}E|8xƋE 1@ E0 E|1E]EH Eƒx  EB A ǁE9uʋE%u   EpxEPMHx }1E]uJ˃4x MN K u9uʋ]uE%BzBE9yxE+?1[^_]ËU 1ۍU @t?ELt鸓$I )9uu1믋}@ E1ۍLE0 EEEu1}}}8KtDAuEƃ@E}t,ى%I$))9D E9u }u _]uE^@],1҃DD [ u̓E9uE, a:!@t$EDu۸@u܋} Ƈ ,E}8L8 0u} ]l ]E M }~Et M  ЋU 1ҋMDŽl  r1ɉ]] u]U1 L ȉу9uMՉʉ EMU1 L ȃ9uMՉʉ MEE@ttM Љʃ Љ Ѝ Љ ЋU‹ELt 1itEUEEt @FEǀ ]0UWVSX?X fuE EM8ENjE1ȉ܉ %Ev㪪UUUUUUUU ]% ȉE1EE, EEEƃ4x  EF A Eu1E1EE܉}ԉEEƃ4x  NjF A E؃uĉ}EEHE EEˉuEE܋E؋uu؉EEuuEE]EË}1u!u܋11ًF11}݉]Љۉ]Mɉ]ċEԋ ]3 ]3 ]3 3 3! 3" ]3# 1EEԋ$ ]3% ]3& ]3' 3( 3) 3* ]3+ 1E؋M؋}1ȋ]!؋u܋]3<1Ë}3L>1}u u3 u1E䋼$ u3% E1ljE3 3& 3 3' 3 3( 3! 3) 3" 3* 3# E3+ }m1]E%MɁ ȉEE%MɁ ȉE1E1 EEE0Ãx  NjC A EuċE8upuE+u!1X[^_]ËMEd 4UWVSPT aE̋uM M8EЉNjE19$}܍]]ȉ9u<$…E<_t:t< t<:tMAE̍u}ЋU+ZP[^_]ÉUĉ}؋}1D$ D$E؉D$$u+EҀ09uE؉$tEԀ8*sx0iE̍udEEEEEyD$ D$$<$]W9tD$ )D$|$E؉$Bf}2ae}sha1f}1 }argo}argo}argo}n2d}M̈l _ȍp l MEE Ȁ`QŃ?}<9E ЉEE9uËUċEEԃEM̍q MEM̍M/^Ń?}t}<9U}Ĉ  ڃM4`À@~^뿍^҃?뷀@~Q>Q҃?3}EԉD$4$p< .t&U<:MMEM̍l MME&}n2idN}DEԉD$4$대}EԉD$4$ nEËED$ T$EȉD$}̍ $,EfM ȃ?9K?9K ?9K8EfM ȃ?9K?9K ?9K8CEf?9K ?9K 8CC EEԉD$4$I2}n2i]UWVSN \E8EEXUэuuUS1r 9uZ9MuߋU$U+u[^_]Ë]~UWVS,N Z\E؋U8ENjE1Z}uU܍S1MJ 9uMZ9uڋU܉U} D$ D$|$<$uEUZ8uECу9uF9t܋E}U+u,[^_]ø]蝐UWVSDM v[U uU8‹E1DžDžDžvJ88E+1D[^_]D$D$D$ D$D$$h @D$$ D@D $9sÁ t׉D$@BD$ <$L$ $?293?!~9.?J9)1?߲9%?+59#?x}9#DžTDžJD$$LD$$L(D$$P489ȉ )ڋ09<} D$0ED$,D$(D$$D$ D$D$D$D$D$ D$D$<$n$D$$tD(,481։ 1 <90Dž|Dž@mDž ^DžODž@Dž1RUWVSZI +WEu 8‹E1D$D$H $$zDžDž4$e8$u ut$4$Ɖ$TDžD$$8vu[x=uUT$$ D$$p DžDžDž DžDž9g|$4$3ptjtmt2$AL1U+LĬ[^_]ÍT$$x*tT$$y6OT$$xۋ%t$u$uDž!t$u$DžID$$ƉDžDž|Dž[<Hv2BIڍ{Kz) ЍK!ȹZ) ! ȍ{й9) у! у+у>Ӄ/Ӄ? ЃA! = ЅiD$$?t*D$ 7D$D$p$$XI 4$0|$0|$,D$(|$$D$ T$|$||$D$t$ D$D$$@D$ D$$tD$D$4$tD$D$|4$tD$D$p$ut$%D$uD$-$UVSB Puv$CE‰)Ѓ[^]øh`UWVS4B PÉED$uut$u 4$蒅u3D$ ED$$EE8$E $]Dh`)‰UE E h`9tt$u+E E܋E$]NjED$ut$u t$u܉t$ uD$D$bJ E$J t$|$ ML$D$E$_}v/lj|$t$ ED$D$<$/9]uىE D$E܉D$ED$ED$ ]荃uD$D$b}<$=U^D$O O ȉD$$9EPU9uD$]J J  J ȉD$$EPU@D$D$4$qE4[^_]14[^_]EWfffUWVSˉU23]333 13Ή 3 13 43 1343 1343 1343 1343 13 43 13$43 13(43 13,43 13043 13443 13843 1΋<1щ3 13@ 3 13DE] [^_]UWVSƉEfM䍾}܁H1۹1҉}f;]ǃ? u}19uEE}EE]܉UEEEC9uE荈Eu䍙uΉUEEEC9uu9Muƃ[^_]ÉǻLUWVS; ƮI9ɍL  dH USHlf`TEPƋ@D1\f;`6 uދ\19u111ۍhXdLD1` Ѐtfu Ѐu拕`1Љd1f< Ȁu1hXLTdPhxP9GTP0`DP1\f? uዽ\1Љd1fH Ȁuዕ`1ЉhXLTdh`GP9SP09->1ۋT@D98uԋX1ɉ`T1f|=؃ u9uѻ@TXO9uu⋽`E؉`]BbJ9uߋHfǂLK $2?ƂNK aHLK ƄLK $,T$ uT$D$$7D4$k`D$HD$T$d14U+u{[^_]Íxƅ??tOlEȉDRHuUWVS2 å@u(} 8E14$\$?$u 1H$9u勅)ȉx  @4$+$D$(|$4$D$uD$4$kT$|$4$O}<$$D$(L$<$(T$T$<$ $D$(L$<$|$0, $ $lj~T$,D$4$Dž0Dž4Dž8Dž<$,D$4$Wt&D$uڋ(D$4$1uڋfǃK $1ƃK $ D$D$K $ ND$xuD$ B$Ot$,$1s$D$(D$<$ ɋ D$,D$<$d|$,$B<$ʉ)Ѹ%I$))Љ)‰ :D$,D$<$ ɋuo$D$(D$<$9$D$(D$<$ D$D$<$Z $D$(D$<$3p D$D$<$  ?K K D$06 < ȉD$$K K D$17 = ȉD$$=K K D$28 > ȉD$$K K D$39 ? ȉD$$K K D$4: 5 ȉD$$wK K D$;T$$MK PK @D$D$,$]E+[^_]À$')MDž0Dž4Dž8Dž<Dž Dž Dž(oUWVS(, :MMUu8ƋE1@Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\E[1ۍT009u$.D$@|$<$董E D$D$<$x|$$袥<$D$@t$<$JD$t$<$0|$4$`E+[^_]Éu4$nUT$L$4$Ңt$4$Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\TkfUWVS!( 5utJD$ED$4$'NjE9t.8u),8"tE 81[^_]Ãu1UVS' 5EU ]~Í у? H9u[^]UVS|' E5EU ]~Íу? H9u[^]ffffffUWVS8!' 4ƉUċH0<@,9s1V8UEV(U}ԉEE܉MF4}ĉ}9sMt$}ȉ<$t8[^_]É<$5uEĉ|$4$Eă8[^_]U& M4Et t&t1]ËM t6u]ËE tu]ËE tu]Íu]Íu]Íu]UWVS & 3u} 4$9uw[^_][^_]UWVSd% ×3u}$}(E($!EEE(EEEEEEEE EEEEEEEԋE E؉u܉uEEEE8Euu4$a…u?}4U4…u%tE(usKu?u8M,tE0uVUE(D$}<$ <$)UЃd[^_]äftumt׉UE4D$ ED$E0D$E,$)8UtE(D$}<$} E0D$E,$k <$(jfvE(d9%U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$9]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$`]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$]UVSF! /u4$xu1҉[^][^]UVS! .u4$@u[^][^]UVS è.u4$u[^]}[^]UWVS l.}u <$ …uA}wLU>…u+t"11U2 у9uUɃy Ѓ[^_]úUWVSX -M $ƉEE$1ljE4$$ƉEE EEEED$ML$}<$1t.1EM $_$M $T$4$L$EX[^_]ËuE$EtED$t$<$몸Ǹ1UD$ ED$E D$E$]UD$ ED$E D$E$]UD$ ED$E D$E$]UWVS y,}u <$ …u8T…u+t"11U2 у9uUɃy Ѓ[^_]úUWVS3 ,}u <$b …u=…u+t"11U2 у9uUɃy Ѓ[^_]úUWVS Ò+}u <$ …u=h…u+t"11U2 у9uUɃy Ѓ[^_]úUU "+E##+Pፂu]Í#]Í]Í]Ív]Íyw]Íw]Íw]Íw]Í]Í]Í]Íaw]Í$]ÍH]Íp]Í]Í#v]Í6v]ÍLv]Íav]Ísv]Ív]Ív]Ív]Ív]Ív]Ív]Íw]Í+w]ÍDw]ÍRw]ÍP]Íw]Íw]Íw]Íw]UWVS  )EwrE$c5NjE $V5ƋE$I5E|7E$ 5EU׋E$4ƋE$ 5 [^_]Ãu$ tffffUS ? )U T$D$U$CL []UWS] }Èĉ Ⱥu$u*t 19r[_]êtfUWV}u uu.tft^_]tfUVS]u 1ɋ΋T11Tu[^]UVS' 'u Ee…t5҅u.URу+?҃/ [^]UWVS É։ϋMER)Ѓt$9uuE [^_]ÃEE9sDE11փE? كCwʋE9EuljUt)?UZsEE9rEE [^_]UWVSEUEEEEM4u}Ov(}W];;}}UM0~^z) ҍ^!ڻZ) ! ڍ~л9) Ӄ! ˃+Ӄ>΃/փ? ҃A! ځ}w ҅Uu}M[^_]1[^_]UWVSE0 wG׉1w7  r-у0 v9t}0t ؃[^_]Ã9t1ۉ؃[^_]UWVS u} FEFED$E$O?$ug$EuD$EUT$<$0u?MF8?$u#vu=uGUDžtEF8?$umt [^_]À=uG}t܋UV,8,uрxtuˀx=uŃtUV(8,uxpux=u}tUV0V48$uHEEFiUV8$ZHEEDž>EFFFF F$F<F@FD4$? [^_]øUWVSX) }EE8UE1D$E$wƋẺ$-E+} f$OME Eĉ4$rU9PMMȃ/MU)ƒ$v=yM}BEŰB8D$XUĉT$ D$D$u҉uȉ4$J4$ޚ‹E9\BPBMыE)Ѓ+$m=yM}x}E̋@,D$EĉD$ D$D$uȉ4$I4$W9M@}uȃoMыE)Ѓ,t=yM}EŰB(D$UĉT$ D$D$uȉ4$H4$̙‹E9JBacMыE)Ѓ,p=yM}EŰB0D$UĉT$ D$D$uȉ4$mH4$E‹E9BEЋM)уf$xqE̋H@$i)ƉZf$E̋0QG}̋O $N1}E+/EX[^_]Ë}ȤA}f}ȃ0f0ft&"ffvE}}qM^rEM)M(W}ȃ}f}ȃE҈AyuӉfE҈AyuӉfE҈AyuӉ fE҈AyuӉ$fE)UMR)уtu]UVSU ṽщcw[^]ffffUWVS/ |$`Ѝ$$X03ps$X$\2z9uً$XA$\A$`A $dA$hA$lA$pA$tA $xA$$|A($A,$A0$A4$A8$A<$A@QD5т歁RQ$$AHQL5l>+h$$APQT5kAكD$ T$$AXQ\5y!~[D$pT$t$X$\D$PT$T$x$|$`$dD$@T$D$$$$$h$lD$(T$,$$D$xT$|$p$tD$T$$$D$hT$lD$`T$D$06_D$4:OD$8+D$ $D$PT$T$X$\D$pT$t$$D$8T$<$$$$$$D$@T$D$`$d$$$$D$0T$4$$D$xT$|$$D$(T$,$h$l$$$$D$HT$L$$D$hT$l$$D$T$$p$tD$ T$$$$D$XT$\$$$x$|ȍ$$X3J3Z3 3ZX9ue[^_]UWVS]u {@1ɼCg jC;ʄC gC+Crn+C,hC0kAC4كC8y!~C<[ڍ~@M]u 01pq]u11r9u]u 1[^_]êCf8fUWVSL# uE 8U1҅P?EEEEEEEEEEfEEEEEEEEED$4$U+uDL[^_]D$4$tFXF\FPFT UWVS]Es8U -ST SP!<}J`)ЉE< u zeSC@SDC@SD1EU19EsH{LS`#ǃE}} =%M ȉEC@SDEUC@SD1U9иEs11sH{LʉMM逋E)=w}U `< u s,uu1[^_]äftuauit11t&fuUu<oҹ`^PffE pE땸+UWVS lj(UE u8, M1ɅH?fM?W0E1Dž2Dž6Dž:Dž>0DžBDžFDžJfDžNDžPDžTDžXDž\Dž`DždDžhDžlD$$$&$p 1߃}rMEuQEuHD$\$$$D$$(e1,U+[^_]äfEtD$$$($tBXB\BPBTD$$D$$$Ǽ$t맋(`UWVS\d 9ML$} 8D$‹D$X1D$D$D$ D$$D$(D$,D$0D$4D$8D$<D$@D$DD$HD$LD$PD$T΋9EAT AP1F@VDF@VD1FHVL%t$FPFT)ȍT`D$D$$dV`T$ D$FD$FD$ F D$$FD$(FD$,FD$0FD$4F D$8F$D$~r!D$0 r"D$0 r!D$06 ir"D$0Kr!D$0f -r!D$0Hr!D$0* q!D$0 6q!D$06@ q!D$0Iq!D$0 yq"D$0q[q!D$0v, =q!D$0Xaq"D$0:bq!D$0p!D$0|p!D$0gp!D$0Np"D$0kp!D$0Mp!D$0h6/p!D$0Jp!D$0,o!D$0o!D$0o!D$0,o!D$0m{o!D$0]o"D$0x ?o!D$0Z!o!D$0?EEEpD$D$$]}}GU܉B0G??E VEX}E؉mE؋E@N?EX څ}wOE ]UԋuM؉]]BƃvUԋU]uM؋]EȋM)ȋuFMA :E@O?EЉEEE_ E}M̍}WPGX WTG\GG?} mmEԋE@H?}uЁxE܋UĉP pUԉxuUVߋuԃItftE@t E@ \ )UUԋEHDM)щHDE@uFDF:?9EP UR$tB1ҋ}G9?E@;}W$tB}GDG;?}wCE@Uԋ]uMBƃvUԉ]uM؋}EG< }E̍WU܉BE@Q?UBD?mmEԃ} wCEUԋ]uMBƃ vUԉ]uM؋}]SdCh s`}mw ) }E̍@U܉BE@Q?Uԉ]uM؋}uȋE)} 老B??or]ԉu}벋Et1] 9uE|0C$tH$MtKD;H(s ACDEuEP)uuԉ E@??E21] 9uEE|0C$tHMtKD;H s ACDEuEP )uuԉiUԉ]uMUԉ]uM؋}uȋE)}ԉ]u}W4])Ëw89)W,ƋEPD9sȋ}9s)E)‹]SD}9u}ċEPD @E@R?E&А{9UsBE]ԋu}MCǃ9r]ԉu}MظЋ}!]CDCD})U:f*EEE@P?uȋE)EJ c M)ȋ]]]MYl]ftYt]9]U}E؋UMyQ?x ft }E̍dU܉BAQ?EE1UċuЅ2 E}GDuGH?Uu ЉEE!ȉp@U9Us|E5]ԋuU؉}}xCǃE!MMȋMMHfM@M9r]]؉uu}U؋Um})}؋M}v]ԉu}EǀXPHX׋E!Hp9Es_UԋM؉}؉]]ZBE}E!u4E~v9rĉUU]M؉]m)E؋]艃sD 3Eǀ@??Mu)ƋE@D9E@#E@ u}UU1Ez@ t$EԉD$UB$]#cUB)uuԅ=REǀXPHX׋E!Hp9EMUԉ]E@`E@ 9t$EԉD$UB$]ybUB)uuԅR"EpHXL@K?9]sB}^Uԋu}MBǃ9rUԉu}MظЋU!Ћ}GHU)]m)E؋U艂rDE@M?U4}wC}]ԋu}MCǃv]ԉu}M؋Et }@$t@0NEB))9E}E̍WU܉BE@Q?}/]ԉU-}E̍zEPD@B?} EEUԉu@}E̍{]܉CE@Q?QqItDUЋ])ڋ]ډD$T$ $]̅`EHU܉J0X xEpEu99E̍{U܉BE@Q?EЉEE}U̍{M܉QUBQ?mmE9s55]ԉƉȉs9r]ԉȋ]M)؃1u]M؃w-E̍Y&]fDSt9uE@lu荆4FpFPFXD$FXD$FpD$ D$FtD$$]n}J{]܉CFQ?]ԉu}UT$UEԉD$}G$]F^GUzU}E؋}uȋE)BEԉu]?EED$ED$}G$]]G7}E̍z]܉CE@Q?} ։uU! yf}q<9}swU}]]؉EEIPUuU!Muu4NfMvM9rEԉ}ω]؋E]M)ȉ])E؋M艹EAD<"E@l@E?1EPL@I?]K9s5\]ԉƉȉs9r]ԉȋ])؋MF]tKrM}uMEE@G?} }uȋE)EEP$t EEt E@ E@6?EEfvPjEfED$ED$}G$]c[GGEE}UUԋuȋE)EE>Eԉ}]>@ WlaE@l@F?1E܋UĉP UЉPUԉUPEUPuuEtB0M[^_]äft.t&ft.t&u-uYu5urf } f떻UUWVS 苀 `}u|wFV u*=>?t*U UMu[F [^_]=>?u>D$D$$q\ML$M L$$[\9Ft본FR?UEM t:P t3P$t,Pt%;u!B-4?wB tJ$A01]ø]UWVS$ _Eԋuu8E܉NjEEFE~@@}S?}GS?wH t7P$t0Pt);u%B-4?wB M ttB 1]ø]ÃUEtKH tDP$t=Pt6;u2Jw$C?tL?u +BD]ø]BD]UEt6H t/P$t(Pt!;uB-4?w4Bp)]ø]fffUWVSjw CE}Mx11 rtE xfDU9uEExfG0UofxZUWVS4h vv}̉ÉEЋ@,E܋{t-Ek@^S,sɀ @\Yl])…A8D$ T$D$u4$]x-FlF\4@u FE@@\Yl])…x?A8D$ T$D$u4$]-FlF\1n1N1w1fEP}]ԉU}]ԉUt}]ԉUc}]ԉUR}]ԉUA}]ԉU0}]ԉUUWVS7 ßE} EJEqEp3 Y}OE@ M苔M9~(uaE9tF}L DDF|EE[^_]D$E$E@FtFl9F\EXYtYVDFLfDBDD$D$$dž    9TE,E UWVS]ƋCxPtT$C($S$CPDtT$C($S$CP@tT$C($S$CP8tT$C($S$CD$C($S$Cqt[^_]þUWVS c5 tRET  }9`U릋}>X8Xr‰]f9]s‹EƋE܉D [^_]ËEX8Xrf}U냉E܉D [^_]UWVSLÉ֋EЋJ9}A EǃPǃT=1E1M̉ыU"P\ ƄXE9tf<ufD9uM̃YẺMM}ȉuK}11҃P\ fƄXU)‹}}t T7)t4}뤉MMuEFM̉uȋuЉuM̋uȋPM}̉uu9B3XEfpfq~` UЉv}` UămẺP` ` }Љ6` MȋTMEUĉX MTMȉT Ѝ UȍUffXEX8*%MuET` Eȋ}P FE̋AEAEAEč< 1mu1 9r EЋ}fD}<ET PEE]<)ދ]4 ]EtD9}7]Ѝ DD]9}EfA9u|‹]fC< ]9{11uK: fNuExBuЍ|9t2VtLUԍAfDU1ۉȃ uf9u΃L[^_]Ë]ȋ}tEčPUȍ4C: fEȉC< ftfC< fK< f< Uą$=uS< }ȅt>uă\ 9M|uЍ<L9t)fWmuȋuĉ뤋MċEcȪf1E*ȪfUWVS ERfDHDE1E69t*9}tuf| 1]9Mt>9|9}6}f| tK9U19Muƒ [^_]Åt49]t Ef| Ef u1]z E$f u$1ENf t1E*]1UWVS BE%Z]\ ]1һ}܉fMMc9t|~ | Uf UU)9fGHOOGPWW )UUDu  ډU ʹ)9fGHOOGPWW )ڍL0~E fOWZ_WGX_ )fEu99E1EM9MUUUUVU9D$U:^NjFD$U$1tE 8a [^_]1 [^_]UWVS }GtUD$U]ƋGD$U$h1t+4$P=yarauE 0 [^_]É4$r1 [^_]UWVS U}GtUD$UW]ƋGD$U$0t+4$Ӥ=tciduE 0o [^_]É4$1 [^_]UWVS ED$E D$E$EtSEt4}D<$\ƋED$<$X0tE01[^_][^_]ɽ[^_]UVSp E ut$E D$E$貢t.yaraUFƅu [^]k0[^][0[^]UVS ut$E D$E$Ct.tcidUƅu [^]0[^]0[^]UEU E MMM] UEU E tcidMMM]UVST ) E D$E$vƉ$Ǣ=tciduE0[^]1[^]UVS E D$E$EvƉ$w=loobt 1[^]É4$ŊU[^]UWVS À E$ډt,ƉD$E D$E$vlj4$M [^_]1 [^_]USQ & E D$E$uUT$$dA[]US E D$E$YuUT$$A[]US ô E D$E$ uUT$$A[]US { E D$E$tUT$$)B[]USm B E D$E$tUT$$WB[]US4 E D$E$utUT$$`B[]US E D$E$8t,ƉD$E D$E$`olj4$( [^_]1 [^_]UWVS * E$D$7t,ƉD$E D$E$nlj4$ŗ [^_]1 [^_]UWVS ÜE$D$y7t,ƉD$E D$E$nlj4$c [^_]1 [^_]UWVS e :EU$T$7t,ƉD$E D$E$9nlj4$ [^_]1 [^_]UWVS  E$D$6t,ƉD$E D$E$mlj4$蝖 [^_]1 [^_]UWVS tE$D$6t,ƉD$E D$E$qmlj4$9 [^_]1 [^_]UWVS ; E$D$66t,ƉD$E D$E$mlj4$֕ [^_]1 [^_]UWVS íE$D$5t,ƉD$E D$E$llj4$s [^_]1 [^_]UWVS u JEU$T$q5t,ƉD$E D$E$Illj4$ [^_]1 [^_]UWVS  E$D$5t,ƉD$E D$E$klj4$讔 [^_]1 [^_]UWVS ÅE$D$4t,ƉD$E D$E$klj4$J [^_]1 [^_]UWVS L !E$D$F4t,ƉD$E D$E$klj4$ [^_]1 [^_]UWVS ýE$D$3t,ƉD$E D$E$jlj4$胓 [^_]1 [^_]UWVS ZEU$T$3t,ƉD$E D$E$Yjlj4$! [^_]1 [^_]UVS$ E D$E$eiƉ$藕=gntst 1[^]É4$'tU[^]UWVS ÜE$'%t,ƉD$E D$E$ilj4$j [^_]1 [^_]UWVS l AE$$t,ƉD$E D$E$Gilj4$ [^_]1 [^_]UVS E D$E$ShƉ$腔=atadt 1[^]É4$vtUEt 4$vM[^]UWVS vED$E$tt,ƉD$E D$E$uhlj4$= [^_]1 [^_]UWVS ? ED$E$4ut,ƉD$E D$E$hlj4$ې [^_]1 [^_]UWVS òE D$E$gƉ$P=gntst 1[^_]É4$$P$UDžtڋUT$D$4$$t U:[^_]É<$/UVSS (E D$E$fƉ$ƒ=gntst 1[^]É4$A$tU[^]UWVS E$V"t,ƉD$E D$E$flj4$虏 [^_]1 [^_]UWVS pE$$"t,ƉD$E D$E$vflj4$> [^_]1 [^_]UWVS @ ut*t$E D$E$%flj4$ [^_]1 [^_]UVS E D$E$ʉƉ$c=loobt 1[^]É4$yU[^]UWVS lE$xt,ƉD$E D$E$lj4$9 [^_]1 [^_]UWVS; E $jxt%ƉD$E$蟊lj4$[^_]1[^_]US ýE D$E$ˆUT$$/[]US ÄE D$E$艈UT$$F0[]USv KE D$E$PUT$$0[]US= E D$E$UT$$0[]US E D$E$އUT$$0[]US àE D$E$襇UT$$0[]US gE D$E$lUT$$%1[]USY .E D$E$3UT$$p1[]US E D$E$UT$$1[]US üE D$E$UT$$1[]US ÃE D$E$舆UT$$1[]USu JE D$E$OUT$$1[]US< E D$E$UT$$ 2[]US E D$E$݅UT$$ 2[]US ßE D$E$褅UT$$2[]US fE D$E$kUT$$2[]USX -E D$E$2UT$$2[]US E D$E$UT$$$2[]US ûE D$E$UT$$12[]US ÂE D$E$臄UT$$22[]UWVS r GE$D$#)t,ƉD$E D$E$lj4$ [^_]1 [^_]UWVS E $D$(t%ƉD$E$llj4$豈[^_]1[^_]UWVS ÈE$D$d(t,ƉD$E D$E$lj4$N [^_]1 [^_]UWVSP %E $D$(t%ƉD$E$譄lj4$[^_]1[^_]UWVS E$D$'t,ƉD$E D$E$Clj4$萇 [^_]1 [^_]UWVS gE $D$D't%ƉD$E$lj4$5[^_]1[^_]UWVS 7 E$D$&t,ƉD$E D$E$膂lj4$ӆ [^_]1 [^_]UWVS êE $D$&t%ƉD$E$3lj4$x[^_]1[^_]UWVS z OEU$T$,&t,ƉD$E D$E$Ɂlj4$ [^_]1 [^_]UWVS E U$T$%t%ƉD$E$vlj4$軅[^_]1[^_]UWVS ÒE$D$o%t,ƉD$E D$E$ lj4$Y [^_]1 [^_]UWVS[ 0E $D$ %t%ƉD$E$蹁lj4$[^_]1[^_]UWVS E$D$$t,ƉD$E D$E$Nlj4$蛄 [^_]1 [^_]UWVS rE $D$N$t%ƉD$E$lj4$?[^_]1[^_]UWVS A E$D$#t,ƉD$E D$E$lj4$܃ [^_]1 [^_]UWVS óE $D$#t%ƉD$E$;lj4$考[^_]1[^_]UWVS WE$D$4#t,ƉD$E D$E$~lj4$ [^_]1 [^_]UWVS E $D$"t%ƉD$E$~lj4$Â[^_]1[^_]UWVS ÚEU$T$w"t,ƉD$E D$E$~lj4$a [^_]1 [^_]UWVSc 8E U$T$"t%ƉD$E$~lj4$[^_]1[^_]UWVS  E$D$"t,ƉD$E D$E$U}lj4$袁 [^_]1 [^_]UWVS yE $D$!t%ƉD$E$~lj4$E[^_]1[^_]UWVS G E$D$A!t,ƉD$E D$E$|lj4$ [^_]1 [^_]UWVS øE $D$ t%ƉD$E$?}lj4$脀[^_]1[^_]UWVS [E$D$ t,ƉD$E D$E${lj4$! [^_]1 [^_]UWVS# E $D$ t%ƉD$E$|lj4$[^_]1[^_]UWVS ÜE$D$t,ƉD$E D$E${lj4$b [^_]1 [^_]UWVSd 9E $D$_t%ƉD$E${lj4$[^_]1[^_]UWVS  EU$T$t,ƉD$E D$E$Wzlj4$~ [^_]1 [^_]UWVS {E U$T$t%ƉD$E${lj4$I~[^_]1[^_]UWVS K E$D$Ft,ƉD$E D$E$ylj4$} [^_]1 [^_]UWVS ýE $D$t%ƉD$E$Ezlj4$}[^_]1[^_]UWVS aE$D$t,ƉD$E D$E$xlj4$&} [^_]1 [^_]UWVS( E $D$"t%ƉD$E$ylj4$|[^_]1[^_]UWVS àE$D$t,ƉD$E D$E$xlj4$e| [^_]1 [^_]UWVSg <E $D$at%ƉD$E$xlj4$|[^_]1[^_]UWVS E$D$t,ƉD$E D$E$Xwlj4${ [^_]1 [^_]UWVS |E $D$t%ƉD$E$xlj4$I{[^_]1[^_]UWVS K EU$T$Gt,ƉD$E D$E$vlj4$z [^_]1 [^_]UWVS þE U$T$t%ƉD$E$Gwlj4$z[^_]1[^_]UVS dE D$E$iuƉ$}=gntst 1[^]É4$}tU[^]UWVS 2 E$ t,ƉD$E D$E$ulj4$y [^_]1 [^_]UWVS ìE $7 t%ƉD$E$…t1|$ ED$ML$$UgU1x[^_]1[^_]Í|D$ D$D$U$苃U YUT$7$]UVSY .ut4${[^]|D$ |D$D$}$UWVS utb,9uXFt@~ G$…t>FtAD$$UaU [^_]H4$l [^_]1 [^_]ÍAUWVS i >utJ,9u@~ G$…t,Ft/D$$U`U [^_]1 [^_]ÍAU Et ,9t1]Ë@ ]U Et,9uP@tt ]1҉]ÍA]US aEt ,9t1[]ËU tH Q9Ur@tD$E $`[]ÍAU2 Et ,9t1]Ë@]UWVS }t;,9u1G $ƅtGt"D$4$_[^_]1[^_]ÍAU hEt,9u @t]1]ÍA]UWVSX -ut ,9t 1[^_]ËU tM 9uFtA F EP$UPDžtŋE HɋUtOFt@L$D$ D$T$<$cF~}~ t$sA븍AUWVS iut ,9t 1[^_]ËE FtE $wF EH $M…tFMtI} |$D$ D$L$$U&cFUV}~ t$oA믍|D$ `D$D$;$~US ÁEt ,9t1[]ËM tM 9uL$$)mUSe :Et ,9t1[]Ë@tU T$$v[]ÍAUS Et ,9t1[]Ë@tU T$$=v[]ÍAUS ÒEU tG,9u=t99 u5Rt@tT$$u[]ÍA@uፃAٸfUSS (Et.,9u$@tU T$$u[]ÍAfUWVS  u~(Ft  [^_]D$ED$ D$D$4$1tȋUBU$DžtFD$ED$ UT$|$4$t}M9Muu>uyF8"udF1M Z$ {ƅt',D$4$eFF FE 0 [^_]É<$D$eD$4$ctՋMofffUVSUE 9t4J2Ht"JZxPx3H3X1 [^]1[^]ø[^]USg <h0D$$L $蠍[]US) L $z[]UWVS4 M EpAQAtp|D$ T$L$D$ uԉ4$^D$|$E$ipt2t$E$5mt|$E$^q4[^_]Í14[^_]ÉD$ T$ D$D$ uԉ4$D^y0D$ D$D$|$yUVS E 0t$L $,4$1[^]US ÌD$L $ƋlD$L $1[]UWVSm Blj։MML$ED$G$YWVEU9ErfEG[^_]=8"u1UWVS ùlj։MML$ED$G$諥V!ЃtNEG[^_]~8"u1UVSM UBAt%tOYI2B9r39[^]Äu!YI2B9|9[^]ø[^]ø[^]UWVS ƍh0D$$XL <$7t$L E$t $E4a<$ UЃ[^_]ÉE<$$ ƻUt֍D$ $M`MAFAFA<$證t$E$YMt+$E`<$脉M $UЃ[^_]ÉL$ME$YM9uE<$HUЃ[^_]Í|D$ (D$D$M|$vUVSM UBAt&tQYIrB9r49[^]Äu"YIrB9|9[^]ø[^]ø[^]U EEUM UM]U EEUM UM]U EEUM UME]U EEUM UME]UVS荽 but9u4$^[^]1[^]UE@]UWVSJ Et 9t1[^_]@t9H@1һ9ˉr|9[^_]ËP@Ӂw?Ӂ19ωr-9[^_]ø@[ QUz GEt 9t11]ËP@]UM Et 9t11]ËP@]U Et 9t11]ËP@]U Et 9t11]ËP@]UVS ŽEt 9t 1[^]ËHX@u3ȉEU19ErɋE [^]ËHP9ȸsUVS= Et 9t 1[^]ËHX@u4ȉEU19ErɋE f[^]ËHP9ȸsUS輺 ‰Et 9t1[]ËHX@uȉwދE []ËHP9ȸsUSU "Et 9t1[]ËHX@uȉwދE []ËHP9ȸsU ¼Et 9t1]ËHP@txE P]US謹 yEt 9t1[]ËHX@uȉwދE []ËHP9ȸsUVSA Et 9t 1[^]ËHX@u3ȉEU19ErɋE [^]ËHP9ȸsUVS轸 ŠEt 9t 1[^]ËHX@u4ȉEU19ErɋE f[^]ËHP9ȸsUS< Et 9t1[]ËHX@uȉwދE []ËHP9ȸsUַ £Et 9t1]ËHP@txE P]U蔷 aEt 9t1]ËPH9иrE ]UO Et 9t1]ËPH9иrE f]U Et 9t1]ËHPwE ]U϶ œEt 9t1]ËHPwE ]U蕶 bEt 9t1]ËHP@uxE P]US Et 9t1]ËHPwE ]U Et 9t1]ËPH9иrE ]UԵ ¡Et 9t1]ËPH9иrE f]U莵 [Et 9t1]ËHPwE ]UT !Et 9t1]ËHP@uxE P]US Et 9t1[]ËM tM 9uL$$[U˴ ˜Et 9t1]@tHxUxU M3P3H ]U LEt 9t1]@tHxUxU M3P3H ]US2 Et 9t1[]ËHX@u xExȉ3E 3U []US ±Et 9t1[]ËHX@u xExȉ3E 3U []UWVS荳 ^]1ɍuEEESt [^_]À{(uSU-tn+ti0u UzxtmMMti;t D$coD$$~tU [^_]ù RAu_Uu>fUWVSP~ S<$evH@Ή9w u)D$D$ D$t$<$D$D$ D$t$<$)fuP[^_]Ét$D$$_DžD$D$<$R?D$D$ D$t$<$D$D$ D$t$<$GeuP[^_]UWVS։ʻ1ɍ<0ufPw 7 uuf F[^_]ÍPw W ӍPЀ w 0 1UWVS< ֽ4$}cB BBB$BBB(B8O)Bf^.t{BюDžT$T$4$Є\?D$D$ D$|$4$D$D$ D$|$4$Jcut)B wB8|<[^_]ÿ"[upBSxauZxluTxsuNxeuHxBJB(zxru"xuuxeux̃+)D$D$ |$D$4$D$D$ D$D$4$bu1<[^_]ÍHJx"t%Ml^BB(Mуzc<$N1USEJv[]ÉuUS 襬 zE ;Et1 []ÉD$ED$E$ []UWVS` 5]u}E E $[‹FUJv<F H!uix-x-PVHt|B-ttlB-u<-uz>tBFv1RU/}u*}~,Fǀ  *fu1[^_]À/t>t t  ủ)N] t9uʉT$D$E $]2u?/ F(<>tt uHvf~ t{ lqG u\.x$E]|D$ D$D$$1b t=u)Vx"xPV HЀ"u c"tXuEF(>FFF F$GFV1u)щN$x><UWVS0r KEEu }8X1t9s]<<{<&uKatAlt,gt{qu({uu"{ou{tu{;u"례{tt;10[^_]Kmpu{ouހ{su؀{;u҃'`{;u<M{tu{;u>4EMMt<".E<\tdMt&ȋM)]9t 9rD]6U멀{p'{;CEt)<>tuE$p(r EpD$|t$$t}(u GtXtA1(u~u EpENjE$m[^_]Á8versuxsionuE tE E D$E D$}<$t}DžmD$t$E$z<$D1k~WIUD$E$m]UWVS٢ î$(lp$thD$D$E$zfp0xD$p$S>$MЋEԉhl!tW91!ȉh! D$D$p|$D$ D$T$p$Ƌt0<$fplD$T$4$KkE D$4$NjtPD$T$p4$kpT$4$t$Ĭ[^_]ËlЉhdD$D$p|$D$ D$D$$Ƌt0<$ehD$T$p4$ajD$D$D$D$ D$lD$p$FptdtAT$4$t$ 1p$dt$1UD$E$]fffUE 9E]UWVSП åƅtBD$$Et E$@ۛDžMu% $S1\$@躛DžtE D$<$@D$G$?kEG,w0G4G8G<[^_]US L $ai[]US ÿsSD$̲$DlL $#i[]US謞 ÁD$L $hD$L $v1[]USd 9ED$E $N[]US7 ED$E $zN[]US ܫE$(jE $j[]UWVS(ѝ æUM܋p4@,EEGEt@E<E t;}D$ ,D$D$ $OUWVSЗ åuFt0 9u&x<$cƉ<$c[^_]ÍPD$ D$D$ $bOUWVSX -Ƅt1fƅtptC[^_]ÉUx<$Uc1ɋU5ƅtpt<$4c[^_]ÍPD$ D$D$ $NUS迖 ÔE xt"D$,D$E$C[]ÍI}D$ @D$D$  $`NUSX -UB4tB4R,…t8$ 8[]Ía}D$ D$D$ $M(}D$ D$D$ $MUWVS4ȕ ÝUM@8t 14[^_]ÉƉ׍@E$aMt9pE}<$6Ex4$C7E$a4[^_]ÍsSD$̲$bL ljE؉$_UT$L Mԉ $,E܅$6<$V_V09V4E$`6N4F,E؋U<}Nj2UЉMԃD$E$DMԋU|A)D$|$E؍D$EF,}܉8MHF4F<E؉$^E$CE܃,}<}ܜ$u1<$\0[^_]D$4$=t؋E EtɃF  E䍃E؉}} ED$4$=;EZM9U9PUUE܉4$<E܅UT$,D$4$3~D$4$<4$<U܋T$4$P tEO49H19gEq<$@[Ɖ0[^_]Ë}4$(<E$5mED$4$v9n}э0D$ D$D$ $F}E$l5n 4$;EԉD$4$J=}D$ D$D$ $#FUVS E 0t$L $UF,v UVSy NEU ut 9t 1[^]Åt9 uH49H0r [^]WD$ D$D$  $=UWVS, ʓut 9t,[^_]Í~<$RF8t<$Q,[^_]ÍMU tߋUUUHMN4MtpM9MV,U܋MM9UM)L$M܋U؍TT$$n4F<E$'E$&Ta}D$ PD$D$u $<}D$ PD$D$v $<}D$ PD$D$w $<US蚄 gEM t 9t[]Åt9uM E[]TUSK Et 9t1[]ËM tM 9uL$$*U ݑEt9u]1]U µEt9u]1]US贃 ÉEt 9t1[]ËM tM 9uL$$1*USm BD$E$4[]UWVS @ }U uFt  [^_]ÉU15t~(Ut [^_]ÉUE$)MUt E [^_] $$US谂 Å}><<E]E tE $[^_]Ãt}E9E)>E1}E9E)><<Nkr<[u1R}GEt"E9E7E)ȉ >}> }D$ D$D$e$14=2%D$ D$D$,$3UWVS { î$ xLD$$UUBB BE u Ѓ [^_]ËE $wUtJNju} s5E u%E uBE B Ѓ [^_]äBE B fE tM $1UWVS { ވu} tEt=$-wt%LT$$EAE@px [^_]11UWVSz wuE u@1$vDžtLD$<$GwE G [^_]ËE $vtDǃ} s E uE u뛤ƐfE tM E tE o1UWVS y úu} tEt=$ vt%LT$$EE@px [^_]11UVSy TutGL9u=Fu!F D$F$tH[^]É4$[^]1U'y Et L9t1]Ë@ ]Ux ̆EtL9u@]1]UWVx ¢Et L9t1^_]ËU tP 9Urptt} suuɤfuufUWVS-x EtHL9u>P pt0t{$UAtt!NjUs*ut[^_]Åu!1[^_]ftt鍃PD$ DD$D$$/xD$ DD$D$$_/Ucw 0EtL9u@]1]US/w Et L9t1[]ËM tM 9uL$$US v ýEt L9t1 []ËM9H uU tL$M L$@$է []UWVS v `u>t=~(u7Ft=D$ ZT$VT$$t F$ [^_]ËFD$U$11tՋ}O $MHrEtFVT$U$MUK9}D$CD$4$I$qƅLD$4$FEF~ E 0%3D$ED$F $jljEt\UF$F 9:" }D$ ,D$D$$,E$y [^_]38"uE$y$pƅtEE$cy1 1Ut YEt 9t1]ËM tM 9u9]UVSDt t$L $ƃL t$L $~ƃL 1[^]USs ƁE xtD$E$#[]ÍUVSs Çu}D$$ AtL 4$[^]ÍL UVS_s 4ut9u4$[^]1[^]U.s Et 9t1]@]Us ҀEt 9t1]@]USr åEt 9t1[]ËM tM 9uL$$MUVSr ]uFt [^]À~(tD$ D$FD$F$u_D$ D$FD$F$itW}D$$v?L 4$vE 0[^]Í}D$$??L ǍD$ D$D$$)fffUWVSq VƅtBD$$qEt E$@mDžMu% $v1d$@kmDžtED$E<$vED$G$<EG,w0G4G8G<[^_]USp Î~E$<E $<[]UVSp Y~Pt@9 u6p 9r<&D$4$Xu1<\\D$\4$-tӉT$4$tŃtaD$$Buύ0T$ T$D$# $` t][^_]UVSP ^]u {u3vut&D$$}t,u[^]D$<$Su 1[^]D$/$6t6u Ht>D$$u뼍0T$ T$D$D $/E >][^]UWVS P ]]u {uZ~uvDD$$t4u~ tku btXD$$Yu1[^_]D$<$;t6utwD$$u븋vt%u tD$$u댸[^_]Í0T$ dT$D$c $D$/$;E >][^_]zUWVS N Õ\UEx } $Jƅ$JtzFFF E Ft.ED$4$ׄu`$S14$R [^_]Í<D$4$u뵉4$R1 [^_]D$ 4$ztFu2D$4$kD$ 4$ESD$4$-;>@~D$D$4$-D$ 4$Ex UWVS M ZED$E$5t>Ɖ$E $ U4$Q U [^_]1 [^_]U D$E D$E$l]cUD$E$]UEǀǀ]UVSAL ZutFwyM MJ]ZMJ [^]$Ht|] X]XMH ]X뼍D$ D$D$A $ D$ D$D$B $W1fUWVSFK YUu }t`t`tAtA}tA uutA} $O[^_]1[^_]Ãt  t L ]tL ] MtD ]뙍P D$ D$D$Z $EUWVSED$] u}څu59D$}t }GȋT$[^_]9sut E|$8XD$1σL$uT9r9ڋD$)]t}W뗉u 11҉ËD$\$Z D$)‰$ L$t$ ؉։L$T$ ދT$L$T$ÉӉd$ D$T$9rFt>Et(D$+D$\$ $|$ }_D$9D$sq+D$ T$D$1UWVSu] }Eڅu9sL1҃[^_]Ét$9s [^_]ȃL$ u;9r9r )‰t$D$[^_]Éu 11뛺 L$ )D$T$‹D$ ‰T$D$ L$L$ L$ 4$t$Ɖ9r-t&$)ˉL$|$ ڃ[^_]9$s)T$щUWVS }|$u ]Eu9sA1 [^_]9s11 [^_]u@9r 9\$ىمu 11҉ƋD$ [^_]ú )D$؉D$ L$$\$ ؉t$щ$$9rt 1RT$9sC1<15UWVS M]}  D$\$ۋD$D$ˋuD$u 9ƉD$1MD$9sFȉD$1\$|$tكۋt$t؃ڋuVȉڃ [^_]ËT$ƒD$uy9r9,)|$ȉ뙅u 1t$1҉ljƉ|$PЉD$كۉ\$]U ] } D$ T$)ЉD$ ыT$L$ ЉD$T$\$\$ L$4$Ét$Ӊd$ƉT$9r Ku D$E$(@t[^]fffffff$̀ffff'̀ffffỳrS[tK@[̀rS[TK@[̀rS[4K@[&̀rS[K@[%̀rS[J@[ḅ̀rS[J@[̀rS[ôJ@[ḡ̀rS[ÔJ@[̀rS[tJ@[̀rS[TJ@[:̀rS[4J@[̀rS[J@[̀rS[I@[̀rS[I@[Ḯ̀rS[ôI@[%̀rS[ÔI@[_̀rS[tI@[\̀rS[TI@[;̀rS[4I@[b̀rS[I@[̀rS[H@[̀rS[H@[ḛ̀rS[ôH@[c̀rS[ÔH@[2̀rS[tH@[̀rS[TH@[̀rS[4H@[9̀rS[H@[Ḇ̀rS[G@[ḵ̀rS[G@[8̀rS[ôG@[Ḁ̀rS[ÔG@[̀rS[tG@[Ḅ̀rS[TG@[̀rS[4G@[ ̀rS[G@[̀rS[F@[̀rS[F@[0̀rS[ôF@[Q̀rS[ÔF@[̀rS[tF@[)̀rS[TF@[{̀rS[4F@[|̀rS[F@[#̀rS[E@[)̀rS[E@[=̀rS[ôE@[̀rS[ÔE@[̀rS[tE@["̀rS[TE@[USc7 8EE UD$T$ D$E$ X[]US*7 DEUD$T$D$ ED$E D$E$W[]US6 øDEUD$T$D$ ED$E D$E$W[]ffffYXZQ̀QQrUS6 XDED$ ED$E D$E$[]US K6 DED$E D$E$MX []fffUS6 C9E[]US5 C9E@[]US5 ÞCp7u1[]$S1[]US5 dCp7u1[]$1[]USU5 *Cp7u1[]$1[]US5 Bp7u1[]$1[]US4 öBp7u1[]$k1[]US4 |Bp7u1[]$11[]USm4 BBp7u1[]$1[]US34 Bp7u1[]$1[]US3 Ap7u1[]$1[]US3 ÔAp7u1[]$I1[]US3 ]A P ?jIM  @tM:u DŽM с?x" P ] M \U1[]ÃӅ~M 1  9~:u뙸#[]U2 ·@E@M M 1]U2 •@E@ M ]U2 x@E@DŽM 1]US]Cu U C1[]US _2 4@p7u#ED$E D$E$u []$Y []øUS1 ?US[]US1 ú?$-[]US1 Ñ?$US1 s?p7u1[]$(1[]UE 9E]1UVSO1 $?ut$E EED$D$vt4$[^]ÍD$ 0D$D$; $UVS0 ù>ut/ED$D$wt@4$ x@Eu[^]ÍD$ }u tKt$ttf|[^_]ÉuED$D$t<$n[^_]ÍD$ HD$D$:, $UVS/ á=utD$D$^t 4$[^]ÍD$ TD$D$8P $=UWVSe/ :=u} t~(~$1[^_]ÍXD$ `D$D$7t $~(~$1[^_]UVS. <utE F(1[^]ÍXD$ lD$D$7 $E F(1[^]UVS. q<utE F$1[^]ÍXD$ |D$D$7 $E F$1[^]UVS:. <ut$&ff gFF[^]ÍXD$ D$D$; $UVS- å;ut F([^]ÍXD$ D$D$7 $WF([^]UVSx- M;ut F$[^]ÍXD$ D$D$7< $F$[^]fffffffSL$D$ t9tEA.&f€tuuuu˃t@Au<.t&€tAt9AtAt9Au΋D$[US f, ;:P D$E D$E$5 []fffffffUWVS!, 9u} j%=9~=@U=`b%ໃrGO%ඃwG%@=wK@vu xOG ໃrQඃwA%=0u xQAໃrඃwB\BBxf [^_]=us=@'s=t:= uoc=t@=u w=uFlzpp--sRdHS?4SBBTf [^_]ÍBB-f [^_]ÍBBtf [^_]uF%̃aD$ D$D$9d $AgABfUWVS Q) &7E(D$E$TE= YAD$ED$E${Uǃ8uE$TOEtMEMED$UT$4$kMu E<=tX4E8E4uϋM9|>) ‰L$D$$蟺iX1 [^_]ÉM4$fSM랹čΑD$ D$D$> $넍UWVS' Ñ5Eh+l}ptDžxAEEEEEE|(D$ut$$k]E$D$t$$EDž<Dž@DžDDž8H|$8D$$Dž\Dž`Džd1|X}t Xuĉ4$_XD$4$|$4$D$04$5U8D$hD$t$ D$ФD$0$"G,V4$G,48D$t$0$tD$(D$$D$$D$$D$|$$4[^_]D$Ф$![^_]Dž4c;,Dž4GD$(D$$yD$(D$$D$$D$$UWVS@{$ @2t$0D$T$L$4D$4t "|$GD$8UT$$\$0uL$8ǀ-;+=D$D$4C0ND$D$$D$ D$( D$,D$4 11҉D$8T$<~09L$4xfD$$|$89T$ |$<O|$<1\$81؉ -D$(T$,Ë|$<ߋD$8d$(ډډD$8T$<NyЉ< uA< W9L$4jߋD$8T$e[^_]D$rD$4D$4FL$8D$(T$,D$T$ $D$\$0D$$T$ D$(T$,D$T$ $D$D$L$8D$9\$0V"D$8D$e[^_]D$rD$4D$4FL$8D$(T$,D$T$ $D$\$0D$$T$ D$(T$,D$T$ $D$D$L$8D$9\$0}"D$8D$D$=u4$臒7)EE8EE1҉MԉU*}D9FEE>tHED$|$M $nLuى<$"}9EuEEE>uMԋU܅{UWENjp,-t$E8:tED$ED$$xGxp70E<-<+<::gB9FB 9F <;uEz8;EA-0tE8:tD$W$žp7WE<-QEx:T?Fw E؉Gw t01]E8[^_]ËMԋUEE$XEMt$ T$UD$_ <$'EUMt$ D$D$<$>u4L$ Mt$D$` <$諿EM:L$ t$D$<$3D$ D$D$a $P <:z5E*E!w ]ẼuE MЋM؉<-t(E8:t ED$L$菜EEЋG21p7Eu-t$E8:tED$ED$$&p7zEEzU؉:AP}EЋuAE $MЋzuE-8tE8:tt$${p70-08E8:,ED$$=y:6}9E} }؉L$ MT$UD$`<$ UҋUMD$ T$D$a<$޼t$ t$D$<$MnA-E8:t$$LG MD$ t$D$a<$BMu 4Mt$ t$D$<$McUWVS$ } uP u$ǃP E ;M8-p$x P -A$D$-E$#ǃ P --|$E$tAx:ǃP >u[^_]Ír$ P :u>u t E8:?부xtA$됋>uTx:tL9MA$E8: tZ|$ D$ 1P A$[^_]ÍD$ D$D$R $u D$ D$D$S $譹跽|$ D$D$-$誡E 4=:dUVS dutD$ D$4$[^]ÍD$ D$D$/$UVS' utD$4$e[^]Í1D$ D$D$/0$衸ffffUSØ E$1[]UWVSq Etut4E@D$Ex E@t$9r0E@ 1҃[^_]ÉuU 9E׋EP @D$E@t$9s뿋E@D$M);u ED$1E U9Nj]C E@t$9ANE E HD$ D$D$P$e׋EP @D$0E Ude?D$ D$D$P$6TUWVSó UB EEEu1u}u}9}EE}B269rz])9ErEË}u sHu(u J J ZR9r [^_]ÉftEË}u rucuk량UGD$4$pƅt[UB)ǍD|$D$$7U0MJB E4Xf넃BUWVSZ u} D$$$…0x@@ \D$D$D$ ?D$D$$UDžt)D$$[^_]18U$o$eϹ81Ĺ8US qF E D$ED$-X$ []US: ED$ E D$ED$-X$[]UWVSu} t(ED$ 1D$|$4$gC[^_]Í0D$ D$D$4|$`UVS^ut'D$ D$D$4$B[^]Í0D$ D$D$A|$UWVSu} t)D$ 1D$|$4$B[^_]Í0D$ D$D$6$耲UVS~ut>D$D$ D$D$4$Et [^]1[^]ÍQD$ D$D$0$US&ED$ D$ E D$E$X[]UWVSuttE D$4$~7蒓F0u D$4$蓓[^_]tYF0uҿ@F0뻍0D$ D$D$/$]UUM E=vEM EB]UWVS u] Et?})t6vD$\$$Vu9}tE) [^_]ËE [^_]UEU@ ]UWVShE0x$Jtu[^_]1[^_]UWVSV+} tE}1tGfp f@UPx$MH,UP(UPDUP [^_]þEu51UWVS ð}u$‹EE Bzr EBtytpE tZE EU,1UtnMfH f@PM H$x,p(@DP [^_]ÍE뭋M tE E딉UEU$1 [^_]UWVSïUE trB0~4r,txM q J$tE D$ E 0xt$|$$q[^_]ÉU^D$ D$D$<$UY0D$ D$D$;$蹭U US òED$E D$E$ []USÁED$ ED$E D$E$Z[]UVSsHuf~ D$4$F0tN@9t $F0ǀǀ FFF t1FD$4$ߎ1[^]ËFߍ0D$ D$D$<,${L UWVScEU tdP0~4p,t} r H$t} Lj $>M Q!Ѓ[^_]ÉE^T$ T$D$9P$譫Eg0T$ T$D$8P${E.UWVSrutFD$4$Knx$P8D$4$T[^_]É4$/ڍ0D$ D$D$7t$US ED$E D$E$9 []USöED$ ED$E D$E$7[]UWVS,|Et8uj}ԉF;($&FFF )t$|$$脳,[^_]ÉEԉ$E؍EEEu}wj끋,uU±Ex9(]Ë,]Íj]UWVSTuUE }}8}M1ɉցE-  tM9utID$2@D$u4$4$ߟPEu2}E+ЃT[^_]Àu3p4$譟PEtΉUED$t$E$:U밉t$ D$D$2u4$躋4$\PxU@E 7t"ED$G$賟ut$ 눺%}UD$ (D$D$$§UET$ (T$D$$荧uE7M,ET$ (T$D$$GE]1fUEPt/t]P uE tP f҉Pf@ ]P t uE u]E u]fUEPt.t]P uE tPffP @]P t uE u]E u]ffffffffUEuE w E ]1]UVSnCut;F)F3E uF F[^]1[^]ÍD$ TD$D$Y$ĥUWVSu} Uts~F<FF DWPWPW P F F 1[^_]Í D$ @D$D$v$U`UD$ @D$D$w$̤U+UVSýut~u@~w:E [^]Í D$ (D$D$$_뺸UVSVut~uAF u9<.w5[^]Í D$ D$D$$빸UWVS}u t5u%G u<.w~9|D7[^_]1[^_]Í D$ D$D$$qUWVSnu} t*~uPF uH<.wDx>9؃[^_]Í D$ D$D$$몸UEu E D]1]UWVS}utQEu@D69E r4E D$D$<$+|6GfGG[^_]1[^_]ÍD$ D$D$.$AUWVSi>u} t;~uaVL\WQWQW Q F1[^_]ÍD$ D$D$M$輡뙸UWVS4ƉEԋE} 8uЋU1҅x'PރT$D$<$]GGt_T7<}؋x}p uX]HM܉M HJH JHJ H:rZ}܉z ]9u1}ЋU+4[^_]ÉE܋]ԍT$ T$D$h$臠E܅E܋]ԍ%T$ T$D$i$LEm]U*UVS]2ut~uEFu=:Fr6[^]ÍD$ D$D$$ϟ뵸UWVSu} t9~u)Fu!:Frx9sD>[^_]1[^_]ÍD$ D$D$$EffffffUWVSa6Ɖׅt18u9s1[^_]ÍF9rFލ1D$ D$D$$=uUWVSït ljփu [^_]Rw%FGT$D$<$w[^_]ÉU=D$ D$D$$$UUSK E x[]ÉEZT$ T$D$T$̝E[]UWVSu} Et,tYPσF)F 71[^_]ÍT$ T$D$b$LEuEnT$ T$D$c$ErUWVS/Eu}UxE ;Eà EME9؋M)1L!ȉ)1׉E8E 8t@‰ߋu s}tftËM؋})p)ƉnE0)F=^EX E[^_]EE[^_]ø‰ߋu rbEX]荃|D$ D$D$$oÍ D$ D$D$$>W]荃D$ D$D$$ f;{PUWVSEuM}~ 9)1UD!ЉEUE)‹E1UU ˉM] E )P)‰U|U)G=Mw]_^ ȃ[^_]1ɉȃ[^_]Í^^Í D$ D$D$$輙MM]荃D$ D$D$$脙MkUWVS{u} tt~)F1V J 9\ t+9sw[^_]ÍFፃD$ D$D$$踘] D$ D$D$$艘*UWVSvE} ux)ubHQσwWvPH Y 9r>\ tHډt'9s89t9t!P9r P9sݸ[^_]ú߉1[^_]ÉET$ |T$D$X$舗E6 T$ |T$D$W$VEUUE ttuB]ø]UWVS H!EEEM<v}wwٸu [^_]9]rE}t81ɅU t9u rEtuutit9A=QMVVD$D$$]oMEEFE 0 [^_])Ӊމq̉M]썃D$ hD$D$$M9ME]썓T$ hT$D$$貕ME.UWSE]~OSt<)9U rww؃t6t YXYx1s5u'u[_]Åt:1[_]ê[_]ftu'u1҉[_]úf᪍YUWVS] UЋ}ߋustft[^_]uuBfUWVSu} ]tquit?9sTtH<t3t<MHU SM)[^_]Í^뾉t 뭃먋E[^_]UWVS] U}EEt6u1]t7U9s tCB9rr9s[^_]ËEP8Mt9s܉ uM1+E[^_]UWVS] UЋ}uރstft[^_]uuBfUSD$D$ED$ ED$E D$E$Z[]ffUWVSPãƉЉ8U1҅SƅD$D$D$D$ T$D$4$5t1U+4P[^_]Í1ɉ  rFDžDžD$ T$%D$<$eutjƅD$D$D$D$ t$GD$G$5ut$$tu<$!b $bT$ T$D$$rUWVSTƉ8E1 ƃLP ƅD$D$D$D$ LP D$|$4$4D$D$D$D$ L$|$4$3;DžDžDžDžDžVDžDžDžT$ D$%D$$btjƅD$D$D$D$ t$GD$G$2ut$$趆thuGtLD$ D$<D$$/$_1U+uXT[^_]Ë묋$_ʍD$ (D$D$$qUWVScϋEE uE8E1 JD$D$ D$D$<$輹=/D$ D$D$$2t6D$ D$D$$r[+$D$$D$$o$ɘD$=$[;$蕘$臘*y$舐$Tt$uPp<+<-iq<@pHLDD$ D$LD$r$l藝؉DžH<+tj<--t$X$llPH;v31@U+%[^_]ÉFg<@qs<@PHLDL$ D$D$r$l袜DžHhUTd [4$lL uCF)<@t$X$lj DD$ XD$D$4$lכtthKqUTqUT؉DD$ XD$D$4$lADžHDžL1bUT%LUT LƅplD$ 8D$D$$q0lD$ 8D$D$$lqPlD$ 8D$D$$.qlAUWVSEM(E<}88ƋE1`<ǃ,P U@D$D$ D$DD$<$葜@D$@ D$4$D$pD$4$74H0@@ $@P T$$,t@@$9uD$4$cX,t$D$4$,|%= ,P $K4$0$8E+[^_]þ뿍uD$_$W…tE@u_]Ѕu K[tA|$t$ E D$CD$C$uԉEȋUЉ$]=Eȃ@[^_]Ë]Љ$]l=@[^_]Ë]̍D$ TD$D$^$Jl"ÍyD$ TD$D$\$l]̍D$ TD$D$]$kUVS(8E1EEEEfEfEUUUT$UT$ U T$D$$RU+u([^]É~UVS(薲[8E1EEEEfEfEU UUT$UT$ D$D$E$U+u([^]ÉUWVS,ֿuE EE E ȉEbQE x1wtftE @~uE1EWJЀ JJɉMEE @})șMU9ȸEjE H)ƃ v] ,[^_]EEEU9sWJЀ ?ɉMNEE뽍Jv u(JɉMEUЉE뉅uЃ߃A<wb j@=eD$ D$D$ $hE)șM؉Uܸ9ȸEE H9lD$ D$D$} $ThE @}lj)WD$ D$D$C $hE iE9KM؍DD$ D$D$` $gM4QfUWVS ¶Ep@}\G؉EƂV OE9ÍlV EV uKʀvFu9s\ H9sOpPE9s2E9s7F.Kʀwu9spE9rΉu9sE [^_]À?wglV }w]uCu.}Myt O?9s:}9+V 뢤}Mytft&?뒉tUWVS{Pǘ-<$w7D$ D$E D$E$ZƉ<$w[^_]UWVS "Ǵ-<$sw 7D$D$E$Ɖ<$Mw [^_]fffffffUVS$¬×utXFD$ FD$FD$FD$FD$D$  D$D$V 4$}H$[^]ÍD$ 0D$D$3$dyUVS8!uEUT$UT$UT$UT$UT$ D$D$4$t 18[^]ËEV E䈃V E舃V E숃V EV E􈃱V V 8[^]ÍD$ $D$D$B$!dDUWVSUu 8E1$VuD$ۅ$kHƅ1<$诫D$D$ D$D$4$NDž%8+x$uD$D$D$ D$D$$ YD$D$$$ڪ<$Ī4$P:1U+D[^_]ËD$L$<$aD$$U댉4$9t&c뀍D$ D$D$$ ^$0 V UWVS,E܋}u 8E؉ËE1tstX|$}<$]\1T F TFuF }؋E+uS,[^_]$!]ϠƅuՋ]܍D$ hD$D$4 $][]4UWVS|8 uE 8E1$YD$D$@4$gDžD$t$$7YD$t$<$Rg҉a0<$Yha0u0D$$7U+u>|[^_]1䍃)D$ HD$D$N $[ UWVStְEUU8M1ɅtBE}<$WM L$ED$<$?XED$<$U+u:t[^_]ÉE7L$ EUU8M1ɅtBE}<$M L$ED$<$/ED$<$_U+u:x[^_]ÉE7L$ pL$D$ $wVEfffUWVS芝c ]4u 8$ËE14ENMVU^ ]]~}}^]]ċ~}}ȋ^]]̋^ |]Ћ~$x}ԋ^(p]؋~,l}܋^0`]^4\]~8X}vh}l1u1u1lj]11ωtdn߉Љp}1U1׋|1ljh11ljpu2n׉l}1u1x1Ɖω`11߉lhnlj}u1u1t1lj`11׉hnωU}u1U1׋p1ljߋu11ljd`2n}U1׋U1׋l1lj}11ω`n߉M}U1׋|1ϋh1ljNjU11\Un׉u}M1ϋx1ϋd1lj}uM11ߋMXnlj}M1ϋt1ϋ`1lj}11׉T1nω֋}U1׋p1׋\1lj߉u11ljPu2nE}U1׋l1NjX1lj}U11ωLn߉M}U1׋h1NjT1ljMϋU11HUn׉u|1Ƌd1ƋP1Ɖu11މDnƉًux1މ`1L1ÉމM11Ӊ@Mnى|t1ً\1ًH1M щˋM!ˉ! ً];ܼىxp1X1D1M !׉! M}MܼMωutl1T1@1Ɖuu !! }ܼ։׋ph1ڋP1ڋ]1‰U ӋU!Ӊ! ڋ]ܼЉˋld1ȋL1ȋM1E !! ȉEEMܼEuh`1H1u1MM !! u>ܼΉ׋d\1D1u1‰U ֋U!։! uܼӉƋ`X1؋@1؋]1E !! ؉EE]ܼEÉM\T1ً]1ً]1MM !! ً];ܼˉىXP1ڋ]1ڋ]1‰U ӋU!Ӊ! ڋ]3ܼӉƋTL1؋]1؋]1E !! ؉|E]ܼ|ÉtPH1ً]1ً]1Mt !! ً];ܼˉىLD1ڋ]1ڋ]1‰| Ӌt!Ӊ! ڋ|3ܼӉƋH@1؋]1؋]1x !! ؉pxtܼpÉlD]1ً]1ً]1tl !! ًt;ܼˉى@]1ڋ]1ڋ|1‰p Ӌl!Ӊ! ڋp3ܼӉƋE]1؋]1؋x1E !! ؉hElܼhÉlM]1ً]1ًt1Ml !! ً];ܼˉ]}1}1p1lj} ׋l!߉! }7ܼމu}1}1}1Ɖu Ɖ!׉! hul>ܼhhl}u1|1u1Ɖ11߉ubhUu1x1u1‰֋l11ʉub‰Uu1t1u1‰։ډh11ulbщMu1p1u1΋h11ubˉlEu1M1ȋM1l11ЉMh1bƉ֋UM1ʋM1ʋM1‰ыl11ډM9bU|1ʋM1ʋM1‰щd11‰hlbӉEEx1ȋM1ȋM1ld؋M11lM1b|t1ȋM1ȋM1E11Љ|bӋxp1ʋM1ʋh1‰щl11x]bډtM1ʋM1ʋM1‰ыl11‰t9b׉ :dpM1ȋU1Ћ|1‰11؉pl bȋd]EU1ЋU1Ћx1‰1؋d1؉l2bƉuU1֋U1֋t1Ɖu11ΉU:bM}U1׋h1׋p1ljىߋ]11ljU]b߉EU1ЋU1Ћl1‹E11U bЉEu1|1u1ƉM11؉uMbȉEu1x1u1bʋE11UEu1t1Ћu1ubʉ؋U11EU1Ћp1ЋU1<bËE11؉Ћ402މC(lj{8 F ,EF$E+u~[^_]Ë SD$ D$D$$^@4< _D$ D$D$$ @ 3UVS;ut7#EgFFܺF vT2FFF[^]ÍjD$ D$D$$?UWVS轆ÒE[U Pu щHs H?J]Ӄ?@)Ӊ]<u EEu|UHL$$EU);MEƋ} T$4$dڃ@;Ur)]] U<u sRtft[^_]äfEuMEC] }|:}hjT$ T$D$$=EU xE7T$ T$D$$=ECfm2u KM &fUWVS(}VE}u 8EËE11U1ۃÉу\u݉UD$]䍃D$4$>F%=Ut,D$\$4$F%=u݋UD$T$4$t!1уu}E+uo([^_]Ë]䍃wD$ D$D$$<]䍃jD$ D$D$$;]UWVS0ؐE؋}u 8EԉËE1tstX|$}܉<$]1 F TFuF(}ԋE+uS0[^_]$)]~ƅuՋ]؍D$ D$D$F$;[]UWVS!EE EEu}8U1ҍ $D$@$E \19ȋ})׉ 9}PD$T$$D~3D$T$ $k19|v1?0$E?0t 14?0$E>0D$ $U+uw[^_]D$ D$L$$#$E1몍D$$tыptvUD$D$D$D$ E D$E$]UWVSxØEUU8M1ɅtBE}<$vM L$ED$<$ED$<$_U+u:x[^_]ÉE7L$ L$D$ $7EfffffUE@@#Eg@@ܺ@ vT2@]UWVSE 8puX]H MPUHMX]HMX ]P$UH(Mp,uX0]H4MP8|@yZ<3 h Ӊ 1Ή\uh3n\  1Ӊh]nh  h׉ ؋h1|9n ׉ 1}:nh \ 1ڋ}h;n ҉ 1Njxn \ P҉։h 1΋}\;n <P hӉ\ 1Ӌu0nˋh Nj\ 1u1nЋ\ \1u2n 1ڋt7n \ h҉׉ 1Nju\0n ҉ 1΋Unhމ \1ӋUhn  h ҉Ћh 1Un\ h 1Unh 1!1‰hUܼh  ωh1!1ω}>ܼ<2  h1!΋h1֋UܼƋh 1\!1Uܼ h1!1tܼ\ 1!1ًUܼh 1!1‰\Uܼ\  1׉h!1ω}>ܼ<0 1!1֋Eܼ h 1!1h]ܼh 1!1hEܼh 1!1ىhx ܼh h1ˉڋh!1‹|ܼ 1Ӊ!1ȉËEܼ3h 1É!1։\uh3ܼ\ 1!1Éh]ܼh  1߉h}9NSh  h։ 1t2NS ։ 1ʋu0NSh4h ։ ʋh1u0NS  ֋h ։\1ƋUNS>h Ћ\ 1؋UNSȋ\ \׉ 1‹}9NS 2 h׉ 1ʋ}>NS \ډ ׉ 1Ћ|;NShlj ׉ Љ\1؋}h;NS  Ӌ\ 1Ë}>NS ˋ\ Ɖh1u1NS4  Ӊًh 1]NS h PӉ 1ʋ]NS< @։ ʉL1x0NSPӉH pm h T։\ 1׋]h>pmNjT \Ӊ 1]>pmы\ 1؉hE>pmh‰ 0 1hE>pmh 1Ήh|3>pmhh ։h 1Ӌu7>pm h 1Nju1>pm׋h 1hM >pmh  1ډhU>pmh  1hE>pmh 1Ήhu3>pmh \҉ \1ӋU>pm  h 1Njt>pm \ ׉ 1U>pmh \׉ 1ڋ}8>pm\ 1!1hEvmzh 1!1Ήhu3vmzh 1!1Ӊh]vmzh 1ljh!1Nj]vmz  h1!1]vmzh h1߉!1ڋ}8vmzh h1!1xvmz؋h Ήщ\1!Ƌ\1΋t vmz 1щ!1ӋMvmz\ h1!1NjM\vmz  1!1M vmz  h \1!1ڋ}h8vmz \ 1!1hEvmzh  1!1Ήhu3vmzh 1!1Ӊh]vmzh 1!1ljh|9vmzh 11hMʋh 1ډM1ʋx M1ωx1׋U ߋM x1ʉ1U Ƌx ]11]؍  E 1Ћ]1؋U] U11U] 11ʉUU׋U ljȉ}11׋E M1ȉ1E M 11EE 11؉E|ME 1M1ȋt U11‹M UM 1ʉ׋U1׋U U L ׋XUzp4 <UrU1ЋU1Ћu l@؋uF ЋL ȋH1P]NSdыUȋUBU `HEĸ[^_]UWVSE}O_M]ʃ?@)Ӎ41u}Mqy9rdun?v91۾@ω؋]E D$<$Ov@9s]ËE19s-)] }|u s~tft[^_]19rӃ[^_]Ë}}]}|u skEu[EuREUED$E$U)֋E9r{}؋]HuVu=ffEtuVuƆUUΑD$ LD$D$<$fffffUWVS]k} 8E1}D$D$HtHE$"t=ED$D$<$|;Es1U+[^_]ø"㍅D$E${tt@D$E$Au[ED$bD$<${;EsED$|$ H%D$`d$T$U.ID$ TD$D$BD$蜟UWVS \xjD$V \$E$qƉ؅u [^_]É01UWVSpU\*jUZ ut$$Z @B1E}E1uNjU:ME1uEHt$$xxZ @B1Ƌ}E1NjExME1EH D$E$qu(Z ]ٸ@B1E1؃p[^_]øp[^_]$'蜤Z E8D$ `D$D$H$UWVSZhD$rD$E$|uE-@t&tD$E$u܉[^_]D$D$E${t 1[^_]ËEpD$ZD$4$u{E@<-u?EP-DPtEPD$ ED$$UWuMU9p9g^My+th)ƍF߃1BD$>+D$4$zE@t<+ !M?!UUY"gE?w-t u]Ë u@u1]UYfEP>w -]1]UWVS(Xïfu}܉|$D$4$xINE uG>wlH8EظE! EED$|$4$([^_]Ã>w2H8EظE ExkUWVSXeuD$ toD$D$,[ <$y) [ -t@ [ [^_]ÍU T$ t$)‰T$$h뵍7D$D$,[ <$ffffffUWVSQW&eƉЉυV=vlot ufus  E ] ^}+}-}=uFЃ[^_]Ã+t-uuXE #EFЃ[^_]ÃXtguy-t~F+։} RF F+֍R먉} 룉UņT$ T$D$td$EFlFaUWVSUcu ] EEEE}|$EԉD$$/$v$EvD$|$$EeD$D$Ẻ$wAMẺE0EU-DPuHщMEE1EF$381rUWVS FIWƉU,c tG$ ?uE8rt;F$ u [^_]D$$pn$ [^_]Ë$ FuEx+uD$$/nD$$nF$b Ex+uUWVSxHMVlj֋E8rMD$t@G$EGF$ MUVN ,c ,c [^_]Ë$EFG$ UMUVS(GUEu] WU EUE"Ep7uT]LwmƃtK]wEU $Up7E@([^]Ë]썃D$뙍EU D$ED$]썃}D$ +D$D$Ф$$](0wp7t]썃D$'E$]KE$z E$o 01([^]Ë]썃D$]썃D$ 0D$D$ކ$w]썃D$ 0D$D$ކ$:UVS FSEu2]YUEoEEp7]ktht1EU$UEp7E@ [^]ÍEUED$E D$E$] $:]0p7t]썃D$E$]IE$ E$ ;01 [^]Ë]썃D$B]썃D$,9]썃D$ (D$D$ކ$]]썃D$ (D$D$ކ$+uUWVSPD%R} p71,c 19~uMU<$]UҋM}8D$|$F $t։4$vHE[^_]ÉM썃D$ ,c M[tD$ 밍D$ c,c LD$ D$D$ކ$4$GUWVS\BPEE}|$ ut$E D$E$#t$t$E$eƒЃ\[^_]ÉEEED$$BUt։|$ D$EE D$E$L#MtZEEL$ME$2eƒMtU $FUЃ\[^_]ÉMG8MtE9uWEE뤍D$ 8D$D$>$M$ M~9E~L$$d‹MfffffUWVSPmAFOEu}b]DE E AEEEDE{~ 0jM_U tEExGz;EGEkMddeEUMEEE EFE܋E$]6 8MԍD9E 0>EUM]L$\$ $T$],9tu׉EUM]ىeщٸ9и| E AED$ExD$E܉D$ˉу2΁ȉ%ƉƸQ)1ʉ)i)\i(\ø)\ƋE؉E]ʋUʉD$ T$]!D$E D$E$19} |P[^_]ÍnEEEE`EEAE18[^_]Ãf~*t{uE9sfu!f=?tf=[t]]uuf=?uS`EuLCEFfEf=!E؍FEf}!&f}]AE܉EFE1]ԉ}ЋE܋}]f9uxf]t(fx-uf9r f9Prxf]u؋]ԉ}}ЋE9Su]ΑD$ D$D$9$eAVD$ D$D$9$3EbD$ D$D$9$FEvfuf]SƋ]UWVS8Fu} ttFD$$K4[^_]ÍD$ D$D$D9$duqD$ D$D$E9$6UWS_84Fׅtkt/tPWu 1[_]Ãu[_]ÉMEPT$ T$D$q9$ME뙉ME􍓱T$ T$D$p9$MEZUWVS7qE8U1҅tWF @D$$tV$U+[^_]!h㉅T$ T$D$E9$n{T$ T$D$C9${/cyUWVS$6`D]E։M5_VЍEF t =F}|$$]7DžF\~MfyuE)E $M]02ÅM‹EiFJ‰F u $[^_]Ë}E=v]ԉUE$]1DžUt߅FT$D$<$]'QD$ D$D$9$]썃D$ D$D$9$o$]9FVNUWVS4vBljdhlE`E XuEpEP8<E1h`Xphf?X9r9f>*uf~*u1f~*@DFH9`PD$pD$ HD$XD$`$lhdDž|hfDžDdf8$pD$(D$<$sQp@ @<$P TTp@ @ ,Lt4l8\T$LЅpQ tPNy~ x .5 h\9lHfOfuት\9lD@u5p4d*4|%=H`h#W89sfG/fPD$pD$\$ld=hfDžHDž@DžDdf8tpdHu|%=@1P(X|%=@B9pp/%`2Y븋`{D$ D$D$S9$GM`Zk`1҉p/!UWVSD?(68ƋE1Hf~uQ@ *΍f}f/sP9uݸz0fd"f*ffʃft@f?f[uZx!#qf92f[ʉfuffP u:!N f?ʃDW Ӏ_ Y9t fx*f*ʉك |$|$<$U+D[^_]ÍJfzuf[Qr f2f]u답f[!Vf]tI։ύOf%ff-uFf]fG-Of%fG^Vf]uH Af]N9D$D$ D$D$$ P f 9 9sVfPfu9t.P9fx*P9fx*ʉW 9B +T$ D$)L$pP$覤f[!ʃoV- 0!$xK…DD$D$ D$D$$Y@xf@!EfH9'?|$ D$D$94$|$ D$D$4$djmeUWVSt"I0Ɖ׉MG tMA PQ f>{tBEEft>f{uED$E$quۋE[^_]f~}uf~uM[^_]D$ D$D$9$yMUWVS0!^/)9YË)ډσˉHPftDΉ1ۉff}tYFftf[tWf{uFfuM `E10[^_]ÅtGF랍~Ff]fu뀍rZf]tFrc9r1=f[uSf]fً9CS{f{f,uvu91ҋLf fuM }1uLfAf}=s-%qQf]tyىC)D‹΃tfF!T$ |$D$94$=ɋT$ |$D$4$ T$ T$D$9$u=$SًfvSdfPUWVS(k+u} UDžDžDžDžuBB EBB]uR} UfP9~ʅ\uVtM@ɃfH9Nuft ([^_]É\@x'([^_]B&} U맍D$ D$D$9$U} UhUWVS)EtXEPtF@`<$\c t%Hc u1<$r[^_]ÍHc D$Hc $1x ǃ\c 뵉<$21UWVS Ð`4$ \c tLHc <$P9E s"4$[^_]Åt1Hc } 9r1D$Hc <$<1x ǃ\c h84$US E$/ǃ\c []UWVS8 ñ}u #D$$D$D$D$$D$ T$(T$T$D$4$/}t6t$ T$w3D$41 1ۉL$\$l$ǃ\$ 9r؉e[^_]D$ ÍD$ <D$D$F8$D$$D$D$D$$D$ T$(T$T$D$4$l|t@D$ T$AD$ <D$D$E8$C1ffffffUWVS Q &$.3tƀ8u^AUD$L$ _D$D$`c 4$UE tE 8 [^_]D$ ED$4$*&xT}untHuG<&wHt$/$D$E$t$$`c WuA@9|w뵍8=9,i@뽍>ЉED$E $`EEUD$E $7MEbffffUWVS q FljD$\t$<$Jt8t [^_]UWVS81 8E11҉g r񍃌c g D$ D$D$$g L$$stzg t8#tg g g g D$D$l$跞-g 8#`g Qg t8xuxxu xg 8sxwx|Lg <$g $g U+[8[^_]ǃg ǃg t)$Pg lt$5g D$g D$4$*%9g Dž<$9u؋|t΍| 7tt$$蟶uታg >x~x~61g HT$$At&HUVSÒg tftKg [^]ǃg uD$4$Ҧg ut$r$N1[^]UWVSBuǃg g t0$t$g $btHu1v>uD$<$2g uΉ|$r$1g [^_]ÍΑD$ D$D$$EGUWVSj?uǃg g t-$t$g $芴tEu1>uD$<$]g uщ|$r$1g [^_]ÍΑD$ D$D$$pJUVSkǃg g t$H[^]ÍuD$4$譤g u҉t$r$)1US$g t$mǃg []ffffffUWVSLö]ԉljUĉM؅uą]1E-EEu؃EĉEGET]DCtE- ?*WЍL]DS<*E-}<* tЍ\]]DStڋEЀ*Ҁ[i\U؃B] ȍ{}}\\ ]]DKtE-M9L[^_]À?*vG[\U؃]]Oh}눋}].@렋]у]}ы]]}L[^_]Ë] ȃ]_]_]|}܋}D_]}E-M‹u}[}]ԍD$ D$D$|\$螵D$ D$D${\$o}-};EӋ}E//E/(EEE-EE؃E}}tÍLUDBt EE$ME/uEtveu؉D$/E$]NgEEÄEԉ h EȉD$qD$Ẻ$qqEԉXh EȉD$PD$Ẻ$CqEԉ\h fEpxEfEbxEfEfxEfEoxEfEtxEE`a`h E؉EEEčEEEt}4$TT9u f9t]:/t9r 9֍vtJ:/u9u .t&8:/u9r)vli 9u(Ƅli [^_]Éր>/t>(li ǃstftƄli [^_]ÉڍV#ffffUWVSÖE$q}|L-DB-fkfbfg@菢D$ ED$E$JzEUE8E9t8u|L8"tQ]ڋEƍ EʋM Q1[^_]fmuAxn1bM]9ȸs С[^_]þUSe:D$ E$轧[]fffUWVS1}tz?tu<$ؒD9u p9ti8/t9t`sc~/t9u)=vlm ׃rtftƄlm Ѓ[^_]ø(€8/t Ƹ봸V#US}Ѝ~}E@}GEЅ>MUЅM E؍݈E-D$ ED$T$<$ƉEMEU$c1ɉpƉEE M]ȅt)ExQ)؍)MEH}eMEoMMЅGEP$1ɉƉEM =MEU$nƉEE}GEЅMMU$5xƉEMwu?%}ЅMEU$ ,ƉEE}GEtYMUЅKEP$ ƉEEx @uMEЅM E؍ԈuЅETMEЅE؍ˈM$=1ɋU[ƉEEMEP$1ɉ.ƉEE gMU$ƉEM踓$I )؍))ыEHEMPЀ E MEEЅMU$c1ɉoƉEEȅmEHQ)ȍEE}GMEP$;1MEP$ EEЃ} uG' MEP$1ɉƉEEUMuDBuMU$c1ɉwƉEMEMpMElU$'1ɉ5ƉEE-l}G}eMvMEMEЅ7E؍4=%]ЅE ,}tz]ԋEpE@El‹}̉)ЍH$I )Ѝ))ыUčD)֍D)}G؃Eԃك}}}Gw}Dy@&V؃DY@u] utU܋DB@UЃ@)FUDBb3v%ME)EERUЃAD$1$E؍ډ[t"UB M)i]D$1<$ED-ډM]K U7cU-D$ ED$E D$E$b]UWVSDvKEu q 9PMP lM܋HP UPUPUElS *T$$ML$ ML$ML$ML$M܉L$ML$ D$|$4$^9D[^_]Í>MP M>MIH??? F??? F?? ?F ?:??F:?? F????fF m늍9gfff))L$(¾T$$ED$ ED$ED$ED$E܉D$ED$ D$|$4$]9T1D[^_]U_q D$E$]US8`5EЉD$E D$E$LtUT$$8[]US4EЉD$E$ MtU T$$m4[]USôE$cLtq T$$4[]fUWVS@vUE u8M1ɃtHMċNMȋNM̋N MЋNMԋNM؋NM܋NMN MN$MN(MMuăt,tSt9T~U+@[^_]Ét$D$t,$Ac׉t$D$t,$+ct$D$t,$c뫉E UXL$ L$D$;, $JxE UL$ L$D$:, $xE U(fffffffUWVS!u} tQt!1t  9t)ʉЃ[^_]Í D$ D$D$8T$w볍D$ D$D$7T$^wUWVS膾[MU Etx $MnxMMEpEt';Uu"|$t$F$V9UtމuE tH9uMtFE]ȃ[^_]E千(D$ D$D$Ix$tv=D$ D$D$Hx$EvUWVS n?uU Mt;A t+ ÃutF\$D$$}O [^_]fUWVS MtU D$E$ED$}|$E$ ƃE $KlEL80t6Eu1 [^_]ÉL$M$UTUM $…tU $VUMȉ׋usYtftE|=Eu stf`Z뉋E|떍ΑD$ D$D$C$tU b6D$ D$D$D$sD$E$Gyf5Ef,zE UVS 萺eE UtuD$E$ݻ [^]ÉT$D$E$hƅu E [^]ÃTt wx01lx 1UWVSuE 0E,E(84‹E1wD$D$4$~jhDžDžD$$膃D$h8$ShǀPǀTǀX8<$/8Dž@fDžDfFHDžLTDž\dDž`DžX(D$ ,D$0D$<$苽ƅx <$6JuT4E+u[[^_]ÍD$ D$D$D$pfdvRvUUT$ U T$-D$E$]US ÕED$E D$E$N []US菷dED$ ED$E D$E$L[]UWVS,U*uq}t}ED$4$Q4$HF0tN@9t $ƻF0ǀǀ FF~ :\}EED$ED$4$J NjEtiUM E9Ut}uf~ E FUxSMN7FE؉FyEE$^E UEπ끉E䍋DL$ M܍T$UD$E؉$nEFEF 8KD$4$PE,[^_]ËF$H\}Ef~ FFCFFD$4$+PE,[^_]ÃUML$ T$D$E؉$mEFHUE$-E UtGE0D$ D$D$?$qm`E9Ut!$ϰE UtUEmEUVSV+uD$4$OV(4$,EF u|D$ D$D$F$V(D$T$!ЃF tRF)D$T$F0t F<)D$T$D$4$ND$T$e[^]ËVPNTT$L$utˋt+FD$T$D$4$_NqD$D$D$4$2NUVS/uD$4$MV(4$DF D$ D$D$F$V(EU!ЃF tZF)EUF0t F<)EUD$4$MEUw0E[^]ËVPNTUMutt+FEUpTD$4$MgpD$4$MUWVSҿ}?euw t>EtB[^_]ÍgD$ D$D$M$kj?et[^_]Ft$EV tQFtB1ɉωMT:0$!V T:($V D: $M;NV r$F,t$޵F4t -$ʵF8t$軵4$賵[^_]ÍZD$ D$D$K$|iUVS袰w4$zq D$E$s4$z[^]UVS]24$zq $s4$z[^]UWVS<$ozq D$$jxƉ<$Pz[^_]UWVSӯèuED$@$iED$E $aj…t?t$U$_Ut'zu Ńtt$$_uUEHutU$CEUЃ[^_]ÍΑD$ D$D$<,$g7UVS4$=y,r D$E$h4$ y[^]UVS觮|4$x,r $h4$x[^]UWVSh=<$x,r D$$iƉ<$x[^_]ffffffUWVS0Uz-E܍uu<0 1E1M؋MLYtyu 8<|EuȋM؋uԍE99)11 ؃9ruu\M؋uu9tzwr<.uUy<0BÃ߀Xt\E f)Ǎ|uԄAEDX@30[^_]BD$ D$D$FX$$eUTuԍE9t11UWVS 1iD$D$-<$LE tED$E D$<$荰D$$ ,FE$?US身ÏiUT$ U T$D$E$oUWVS 聫VUEtaEEt88 [^_]à "EE ,獃D$ HD$D$$cpD$ HD$D$$wc:}}43k} ;cluuEU}#Ћu0u9dtt4}t>}9tȋEE T-EE } =U n}E vU -DPum}E 0} Ј3E T-&E 0uE E}E } ;U -DPEE DЍPE}} #}}E1EEu } \Et } %Et } &Et } =uE E 0<EuЈEE} ?U  Ћ}E} } U -DPE K0}E IEE 0<}Ј@E nwtlEE T-ME 0u Ј} -} ^E-u DpuE EE 0uE[EMEEXE+E E6E E"E EE EE EE EEEEEE\EEEcEUdu_s1cduY7E 7P-WEUE-WE EE1NEEtE fUWVS,覤su }EEqE/O]}}؍}}܉MEމU)ߋED$ E؉D$ED$E܉$Uw{(GAM ǃEE@uUD$ E؉D$D$E܉$7U+E,[^_]Í%D$ <D$D$$ӉU;\Ua9ECh6D$ <D$D$$ӉU[U6D$ <D$D$$ӉU[UXEE؍EEaQFtM ƃUED$ E D$D$E$]UD$ E D$D$E$]UD$ ED$E D$E$s]UWVS ulr />3)Ѝ)Ѝ:~ 9w$&tr um"U$Ѓtr U4$Ѕt?w$WD$ D$$UοUЃ[^_]É4$uw$Wt$ XD$D$ $U-=E Ut1҉Ѓ[^_]Ëtr t;U$(%NjU4$CЃ[^_]Ëǃtr 뫋U tuW3ǃtr \r ^D$$=軠lr Jǃ\r 1+1UWVSuhr ))Љ):~ 9w$&pr um"U$Ѓpr U4$Ѕt?w$WD$ D$$UҽUЃ[^_]É4$uw$Wt$ XD$D$ $U1;E Ut1҉Ѓ[^_]Ëpr t;U$()NjU4$CЃ[^_]Ëǃpr 뫋U tuW3ǃpr Xr ^D$$连hr IǃXr 1+1UWVS}E$MDždr fE|81ɃP9u/>3)Ѝ)<7ɉM~=~}|$E$MMAF$U 1[^_]Ëtr VD$ ED$$襻E$@F$맋tr u$Ѓtr $("ƉuE$@Otr at $Ѓtr @~u㋳Tr uED$$=ɜƉdr lǃTr ǃtr IUWVS}E$KDž`r gE|81ɃP9u𸿿)))<7ɉM~=~}|$E$KMAF$U 1[^_]Ëpr VD$ ED$$襹E$@F$맋pr u$Ѓpr $("ƉuE$@Opr at $Ѓpr @~u㋳Pr uED$$ɚƉ`r kǃPr ǃpr IUWVSUEtЋlr t'Ǎt$蜞9uǃlr ǃ\r dr t'Ǎt$a9uǃdr ǃTr ǃtr EE EE1[^_]øUWVS,UEtЋhr t'Ǎt$豝9uǃhr ǃXr `r t'Ǎt$v9uǃ`r ǃPr ǃpr EE EE1[^_]øUWVS:pUE DžXE/tBD$E $p,E $Guv E t E tDž`Dždxhً]/]=Ut Ѓ/u.t+M L +Mkt/l+]utftl+EthD$E $p)%=l /=@_Ot/t?+Mu~.׉ڋt9E щ`p\`d 5lD$D$E $p]YDž`&$`pcED=`=A߉փsetftdl /tf\`Ut9E etE Ĩ[^_]Étzu \`l5p S?t9E tX$pf1nىf t~uf.륃8/utщ$pmE tE XfE pRE /t/tpQpQQ?pQ>Q1UWVS2}E ttrD$<$3'xX[^_]Et$<$}[DžMtAt$$&ymt Q8"tƉ<$胗1[^_]P1fffffUWVS聒V}<$)Br $蛎r ǃr 7ty-E1<:uPyAu-<\u.JDK@ttDK@tBuE<:u1<:tEuE1[^_]Ër t$kǃr ǃr O yEUWVSb7u} u <:tu1[^_]8ut$8tu<@t΃}:t& u}:t;UuF~@t[^_]Ät<:u[^_]ÍD$ D$D$$cIYPD$ D$D$$4IU[4U]UWVSAu} tb 8u$ u|:9ƍt&s :t|tu[^_]ÍΑD$ D$D$$eHoPD$ D$D$$4H:1UWVSlV'ƉE 8E10}!H Mu0r t |$$p$Dž DžUD$ .D$D$4$?*D$D$ D$D$@4$&D$D$@$QE8DžDž1ҋ9slxȀ %:Dž\1҃ t t DžN9 ΋9rD$D$E$P5xȀ Mp@<#D$$2ߍFkDžHD$=D$<$… <:Duz)ED$T$E$EƋt'p<:tu))|:t:Ћ)ȉ)9 )؉D$\$ $MT$t$<$7$艏y?@E<$1Dž:΍N9))t$$i0r1eN1nCȋ)Љ)Ћ))ӉL$$蹊ÉNjÉC:{DžtE$M)P9rg8E+~l[^_]D$ D$D$E$+DžD$<$誉xr $QNjhr D$<$D77lNj4E0<$UE0Dž$D$ D$D$$?D$ D$D$ $?ΑD$ D$D$ $Z?E$MKE$7KƉ<$6$5D$ \$|$4$V tBt(PuADž4$VDžDž$>5H $誁DžL$T$$4$V18XΑD$ D$D$$=<$胉tE$lIB <$DB 4$VB $u!$냋E$HUVS‘EM ut.t^UD$t$$P[^]ÍPT$ T$D$$J<M EuM ET$ T$D$$<M ElM EΑT$ T$D$$;M E1USȐr t$<ǃr ǃxr ǃr ǃ|r 1[]UWVS0蚂oME 8ƋE1Dž]xr r -ur tr uD$r $;D0Dq@:#|r ux|\u ǃ|r ׍:\tWut$r $:lDҀ|\tǃ|r ǃ|r r $l#Ƌr u$(ǃr xr Pxr @&L$$!r dǃxr ǃr ǃ|r f:wu<:tAt<|uD$t$$ƍ@E+0[^_]Ër $2"uhr $ǃr +xr r 0uD$xr $ r 5r t$~ǃr ǃxr ǃr ǃ|r D$ D$D$$7tD$ D$D$$_77ǃr ǃxr ǃr ǃ|r $ǃr !UWVS(~u} tPtzr t$cǃr ǃxr ǃr ǃ|r } u[^_]PD$ D$D$$f6uD$ D$D$$86WUWVS$Y}2Eu} (TED$=|$4$ƅl$d]KyDž<:9}d]V<\ֈmt>}<:tkOML<^uF<:mu‹M])ىύAdD$$]}ljEEd<:u]WF<:XЀvP2MҋM FE1]MVD9ut 0v]M :]U})rtT$<$]|EEM$[^_]Ë]뽸 y]䍃D$ t D$D$$3ÍPD$ t D$D$$3]䍃D$ t D$D$$3z1*E$]_<$]J]8 UWVSYz2Eu} uE0D$=|$4$Dž$d]Kvƅ<:d <:tCZtsu)Cd]D$4$],{Un‰ƹd<:uЉƍX)Ӎst4\$$U]zU@Љ)ӍsűE[^_]Ë]썃D$ h D$D$#$1E]썃D$ h D$D$$$1ÍPD$ h D$D$"$n1Z]썃4D$ h D$D$`$<1)D$4$]yt-M14$]}։4$]|]U6 UWVSw҅}E uD$#D$<$R80tN 1G<w/G9~ƒ9G< w91[^_]ÍG<wG@tftƄ/DžDž)S$O9>:hfL2 81Ƀ4uA )čD$Фpxr󥋵t$D$$%8D$UD$$5|$t$$5D$^D$$5ΑD$ 8 D$D$E$+udurP(1򍳶(rBvBDžqfzOU Ur.8D$E D$E$]UWVS$r}U 8E1EtqMyu )čD$UPtMP}y:u}8T$D$<$36U+ue[^_]ørffffUSsqHD$o$+Ev D$ u$uLv []UWVSH!q~u} }ԋEE8EЉE1D$ $Z>v u}MfMUT$U܉T$ D$ UT$$AFuM vU܋9Eo} uv t%9v t1uЋE+H[^_]Á} u v uD$D$,$\E؅tD EċE؉$`KfxHuPPM3J$z 1 uԋM3JʀuNjPD$EĉD$$U裲DžuED$UȃT$Ẻ$;EsE؉$^ % ЉD$D$ 5D$ED$Ẻ$G ;E1B9EBf9EwB U؍yM|$D$Eȉ$EċMQUUȍD 9E89}r5M̉ωփs1tft1HE؉$]3")UuuB r Ef&US+n|D$r \$ ED$EU $T$u؃[]1[]ffffffUVSåLuEqVt M>$ I}|$T$UD$ D$D$@$ыU'$ tLtF@Ht?|$T$UT$UT$ U T$ML$4$ЉƅuGE([^_]Í}몉U썃D$ D$D$$@HU0E([^_]Ë$ 1ҍ}QUE썋L$ L$D$J $EIUT$ T$D$}|$E]ŏD$ D$D$[|$UU<J-D$ED$ED$ ED$E D$E$]UVS<bJE$ t:t4@8t-UT$ U T$UT$V$Љƅu;E[^]Í D$ D$D$$@8F0E[^]U ;I-D$E D$E$2]UWVS;ÏID$D$-<$Et8ED$ED$<$@|$ D$D$E$E $DD$nxD$$E$US;HD$ ED$E D$E$z[]ffUWVS8:HÉEċ}u t$E$5Eȅuu}EEEE̍Eԉ t1 E U]M!ىˋuM! u t뷋]u!M܉!щME܋UM t1҉EԉU؉ƋM̅t_Mx+Mw&EEԍHwq{E@N4$]L?tEԃ0<Eȅu tEtJM\Eԉ0҉Q0A0q AEЃEЃ8[^_]E@uU\UƀtUMƍBEЉ4$]s>tU@^GE@uQ4$]t>uT tOFvGE Fv5 *-UЉrBEBE-DptGEЉ7EЃ8[^_]ËEԍPE-PUȅE\@sEU\B0E0<UE\@aEE\@nEpE\@vEUE\@fE:E\@rEE\@bEE\@tEE@0@ 0E^?iE\pEUWVS6ýD}U EEuEE tu$UuƋI} t9rcJ8 uv9t<$^($Dž9t4$ (Ё$[^_]ÉUE D$E$K]ffffffUWVS"0ƉЅtK Љ Љ Љ Љ Ѝx|$F$ $tBF~1[^_]ÉUT$ XT$D$yG$3E냸UWVSQ"&0ƅ9N rn~PRuF$D$ D$L$M<$Ģ^M΃ډE:BGuETB[^_]ÉUy(MED$|$F$DMҋMUu~ LЃ[^_]ÉMUD$ @D$D$G$MUMcD$ @D$D$G$M9N r~y(M+ED$|$F$CUMu~ 1UWVS t.ƉυZF(JJrPf~Jtt$ $ uKLQthF%=@=\=DĔ[^_]Ptt38t$tB$Pt9z |1tft Ĕ[^_]fx t~B8z<~ ^z0Z4FB@zT.IBpDp@PDH41ًP01 uH<1t3P8 uҋpx9t<|1tftFĔ[^_] nĔ[^_]ÉtD$ LD$D$G$ttD$ LD$D$G$tkzUtBT%=.8t f{f{UWVSV+E։ʅE@(tvBXU$U@PxTZrtftP,}WP@ @J@ @@[^_]ÍU$txTULYHP놉M썃D$ 4D$D$G$YU"U썃ΑD$ 4D$D$G$!U1]UWVS9*ljօxlxD$$ tE3G4U3W0 u|3G}4F)uGHf fű~t$ u} EHDu@8/tF(t`F[^_]ÉUD$D$@($NǃUtq#F<$b<$ufF몋E@[^_]ÁN(iD$ D$D$1G$F11UWVSÏutpp7u4E4$u(4$M E$F[^_]ËF$$뿋F$$F$$F$$ 뵍D$ D$D$B$ۿaUS -D$ D$D$E D$E$l$]]US ÐED$ D$D$E D$E$l$]]UWVS8{PƉ׉t,M>=U= =T$E؉D$E܉D$ L$|$4$KS=ƒu܍M؁ ʨtUEԃ8[^_]1EEkEhEEMdҺ뱺몋U른"ك88[^_]1UM&-U E]UMU E]ffff̀rS[@[̀rS[@[ ̀rS[ä@[USÈEM u 酔t9u[]1[]UWVSuJu} ttB|$4$趴[^_]ÍD$ D$D$B$u D$ D$D$C$轼UWVSúu} ttB|$4$&[^_]ÍD$ D$D$B$[u D$ D$D$C$-UWVS@b't$0D$T$L$4D$4t "|$GD$8UT$$\$0xuL$8ǀ-;+=D$D$4C0ND$D$$D$ D$( D$,D$4 11҉D$8T$<~09L$4xfD$$|$89T$ |$<O|$<1\$81؉ -D$(T$,Ë|$<ߋD$8d$(ډډD$8T$<NyЉ< uA< W9L$4jߋD$8T$e[^_]D$rD$4D$4FL$8D$(T$,D$T$ $D$\$0ǹD$$T$ D$(T$,D$T$ $D$yD$L$8D$9\$0="D$8D$EEEEUPU+P PE@U UԉP $]?18[^_]ËMЅDE$]D$ D$D$E $imC뫉}UE܉BB$]UB E@@e>E $]OD$@E$\E EUP ]萵]썃4D$ D$D$$uu1]=uUWVSó}G $wt6$uG[^_]UWVSku} t"tL D$ $ͦ[^_]ÍD$ D$D$:8$uD$ D$D$;8$ԮUVS8ut&== = ED$E܉D$E؉D$ T$E D$E$B=t3w Ef>@fFE܋UVtfNȃ8[^]FfF1E@EÿE?EEURҸFfFFfFs1]fffffff̀rS[Ä@[UE]UWVS$]E։ME}E؉Eut[E9UsH߉։]EƋE D$\$4$U~" HS9uE)9ur‹]ڃmu$[^_]Í+=D$ 4D$D$r\$苬EQD$ 4D$D$s\$V"UWVSXwPEu U E } XE EE̋EƉE$]iEȅ EE MȍANjEȉEԃ)֋]ދuމu؋ED$E$M#EȍDMԉED$EED$E$U1ɅM9uREEEȉEEEE؉E܉}ЋEM4u}؉9_u E9s#ED$ED$4$U9Etщuă9UM]+uED$T$U4$U}9NjUt +EMC1ˉUE‹E9rU]}M9MrED$ED$+E$UEEE‹E+EMȉEuM9M}ЋE9 EEE]ԋ}čGU9Eщ}U܉EA‹M)ʋ}č M9xȋU)Ћ}lj}ԋE9E9EM]ED$}|$]$U}]UEE؅:U!ED$\$<$UU9~ ]E9rՋE9M̅pU܋E 9r}G9D)EE܋M܋E}89uM܉E}9}M9M M]E̅uU܋E}Ћ029r}GU9CЃ)E܋}EԉE9DEԉEGED$E$MEEԉEȉEċEEȋE9EEĉ$]1X[^_]Éˋ}M 9sWEƉ}Q+ME }uڋEE‰]MĉEE HZ9Eu]M9r}M8E}ljMĉ]XJM9uˉM]9sMˋUMUuދM9U]3]M9ËED$\$<$UM9Ӊދ]19ME9Ms?}u}9us'<3ED$|$E$UU9~؉9urً}uE9Zu̅U܋E 9rUB9)ӍCEE܋M܋EU‹9uM܉E}9}[M]U9UU̅U܋E}ԋ029rUB}9G)XUE:}܋u9rUB9)]E؉ËuEߤ9uu]]Uމ+]9UED$\$<$UU9ЋUlM9se}؉ߋ]M ֍E9}s8)1ÍED$T$UE؉$UM9ȋU‰9}rȉ}EE%}܋u9r}G9r))]E؉ËuEߤ9uu]]Ҹ}܋uEԤ9r}GU9s/}܋uEФ9r}GU9rщ)EMċU9EȋMĉMȉEU9UrEЉE}ЋEMԉE؋MuuEU)ЉEĉڋE]XJ9u]uE}9EŃ}tuED$}ȉ|$Eĉ$]I}!]D$ DD$D$&\$躢]D$ DD$D$'\$舢ÍD$ LD$D$x\$WE*]D$ LD$D$y\$]茧NU-UT$D$ ED$E D$E$y]fffffffUWVS EuNt4~^ȉMtH1ًP1 uN9H u [^_]ËMM$]t"N^HXVP MF [^_]ÃUWVSP%up7uu[^_]=F$$膲4$*NjF$$q[^_]UWVS}E wuq6tk9uFNW9V uW1ʉUW1 UtGD$ D$L$$GWG1D$<$StG9F [^_]ÍT$ \T$D$i$E LffffffUWVSuE8F}9FiF FD$ D$D$$DFVFD$F D$$FtotfxWFvthV uAzN)91FJ u M ]z u F MЃ[^_]{1}i81F u1UWVS}p7t2G$$MD$<$ƋG$$0[^_]D$<$Ɖ[^_]UWVS lΣEģp70E@$$ïD$E$,ƅ@ ‹} >HE@$$X0tlEM 1 [^_]D$E$ƅt[P } uuuFĢu蹢}8눋E@$$Ǯ蟢uJ蔢}8E Y}If뱤&fvftJ [^_]E xDE xfffffff̀rS[d@[ḃ̀rS[D@[UWVS$Q&utoEEE Em8D$D$ED$ t$D$E$Sƃt 1$[^_]%8 u8ፃΑD$ pD$D$<$sbfffUWVS0fƉE̋]E 8U1xu2  t8u)؋U+0[^_]Í}1 r}̍]ȉT=Ѓu]t; t\="t]y$]uk1d]̍$fffffUWVSV}U utrt<Ѕt .t&HOtuxu)Ѓ[^_]ÉU 6D$ D$D$=$əU 뒍h6D$ D$D$<$蚙U \fffffUWVSÆM} UthtN49t8u)Ή)t3ttu)[^_]1<$Ɖ[^_]ÉUM6D$ D$D$A$ƘUM]h6D$ D$D$@$葘UM$USÇEy |`(9~)ML$-D$E $1[]ÉD$ D$ED$E $֜1[]UVS=Ey |`(;}.D$@-D$v 4$r[^]ÉD$ D$D$@v 4$X[^]UWVSÒu} taEtH-EEt/E9t(TSOLKf9t)ȃ[^_]1[^_]ÍD$ D$D$?@$u D$ D$D$@@$踖FffffffK̀rS[ä@[UVSÊTu imNA90%[^]Ë9r [^]9r싋 UWVS9 } P^Uu}E_ N)BЍ4))Ѝ<)Ǎ)ʉȍA )) E9uu}E]싓L419|[^_]Ë]싃Lu޾ UVS 4$qTu U4$T[^]ËE4$=[^]UWVSØ} EqE$T @}j}wMǃTǃPǃLG EG1E$荥E[^_]Ã}?vB}<6 )ȉЉA[TPLW ЉU艃EPU)ЉB}҃?}Ƀ}Ɓ}tŐD$ D$D$Y$Ӓ`E$`EUWVS ö EEẺEыE)ȉE䍃E$TɋU @TPLEH t)̋Eʉ1E$lE [^_]Ë )ȉGfŐD$ D$D$$xUWVSr<$Ɖ<$ߢ[^_]US d9ED$E D$E$t []US3E$[]ffffffUWVS}tHD$<$ƅt&tt$<$[^_]1[^_]ÍΑD$ D$D$A$JUWVSrGuD$4$9Dž|$4$ t>UT$D$E $;Es17[^_]:"(썃ΑD$ D$D$V$|NUE U9r 9]ø]UU E9r 9]ø]UWVSP% w  w u w 8E1ɍPt-ωD$4$&t  w PEu׉MD$D$4$ MtMljMuD$|$E$  w 8Ftt$E$ 4$LuMEw 9t$$.ǃw ǃw [^_]Éw TD$D$$g[^_]UWVS u} t%>D$4$Itt=t1[^_]À=t[^_]UWVSÅut4t$P<$ƅtD$<$ 4$D[^_]ÍאD$ D$D$$ UWVS5 }G$eƅtx @D$P$f[^_]UVSýut/t$P$tU 9P [^]1[^]ÍאD$ D$D$$JUWVS rGU8E8s7i1}ƉUE D$ED$<$+u E <=,ED$<$Åt:<=t4D$D$<$xU 8D [^_]1 [^_]UVSI,$ju [^]É`01[^]UVS,$'u [^]É01[^]UVSØ,$u [^]Éڍ01[^]UWVSU׃H΃ J JH щHz11ωz3H}t)HtJ ȋMu#B[^_]ÃHPtJ ȃB[^_]UWVSӉ΋t B SuUtBu{QtBunQu Q9tW[u믉 St2tAu(t@uAt@uSI[^_]ËtBuBB[^_]uUEU P@@ ]UWVSEpVUu 3t)+~E D$|$F $EЅu׉[^_]1[^_]UWVSExOtX1҉UM~]t)+wE D$t$G $EЅu҉[^_]ËUt+W։[^_]1UWVSExOtX1҉UMy]t)+wE D$t$G $EЅu҉[^_]ËUt+W։[^_]1UWVSEpEFM ]M19MƃU;\tkCEZE [^_]UE [^_]L돋 u{Etu>E닉Lt9ur 눋}bM υtIMyED1uLC yvyEE)fffffffUWVSƍt$<$ru[^_]D$ FD$t$<$|[^_]ÍD$ D$D$XH$Ok떍D$ D$D$WH$#kcUWVSH}u tt$<$u 1[^_]ÍF D$<$薡tF t6u$FD$<$軚tăt$<$訚뵸[^_]ËFE }F[^_]D$ |D$D$xH$OjRD$ |D$D$wH$ jUWVSEu} t tJD$|$4$菡[^_]ÍD$ D$D$gH$iuHD$ D$D$hH$iUWVS議Â}u tet$<$\u 1[^_]ÍFD$<$t~uD$D$ F D$t$<$W뵍D$ XD$D$H$hqUD$ XD$D$H$hBUWVSɯÞ}u FFt 1[^_]Ét$<$VtFD$<$tӍFD$<$0tF D$<$tt$<$ 랍D$ HD$D$H$gV D$ HD$D$H$g'UWVSƮÛ}u  GtNu$G tWt)FF[^_]F[^_]GF[^_]ËGuS[^_]GFGF[^_]ËGtщEL$ ,L$D$$fE GFG F[^_]ÍD$ 8D$D$$H$mfbL$ M썃8D$D$%H$U5fGUM6G EL$ L$D$ $eE   FFufffìrS[ä@[v̀rS[Ä@[VWST$L$1t8uЄt`B͉ .t&ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUWVSֹu} Mt}t]MF9tDJuMtL} XU tz9ut@[^_]É11fu1[^_]1MpD$ D$D$;l$dMN(D$ D$D$:l$cMfUWVS(øƉЉ8U1҅D$ |$D$$$|z<$DZ@9EED$|$$Fu1U+6([^_]E @NteulN u`L$$ $|YHN tD$ D$D$ $E4t9u΃tft%D0 ΃T$ 0T$D$$am2T$ 0T$D$$daFD$ D$D$ $nDu-uFfUWVSùƉЉU 8M1Ʌt=~t3 E+ȁĈ[^_]ù۹Dž9FfXtvEtoEfD$ D$D$<$C<$V9E]ED$|$$-Vu5F~uN uF=tu ~tMEEhED$ t$|$$w4$U9E}ED$t$$M1@FȉC:9DžM9FF ftV ffuu҉T$D$ D$ȉM)D$4$=Mx 9=EtEȃiviD$t$E$ڿ1T D8D$ D$L$M܋E$G=M܅x9E4FD$ 뻋EYQEE@DEԋ}1AE؍E܍xEЋE؉M؉u E8EЉT$D$ E܉D$t$ $M<MH9@)ƃu1q҉Ű}UT1AE؍E܍xEЋE؉M؉u ET8EЉT$D$ E܉D$t$ $M;9M)ƃ9}u1MFD$ D$D$}<$;<$EOM9L$|$E܉$ԽMUU܉D$ ~D$ȉM)D$$I;M}9nD$T$ DD$L$M܋E$ ;MUWVS@֞ëlj΋E8EG uY$Mato|$$Mbt9wuҋtD$G $Nu1ffh$M@=v1U+|@[^_]ÉЍJƅffЍtftD$D$ |$D$@$sO9Aff9't0G9T$D$G$5t$ |$D$$wbu8u Dž11fBfUVS nCut$F $_E $MUYF t [^]ÉE4$^E [^]fffffff̀rS[ԩ@[UWVSö}E$exkUtD֐6t;F txu@9uD$FD$E $Uu 11$kY8[^_]1[^_]UWVSDut7D$4$5FftID$4$5[^_]Í0D$ |D$D$@$S띿fffffffUE.߃At..t!.t+vPЃ v-u2-.u…uҸ]ÀvPЃ v_u_1]UWVS UE Hzu;9]苰uυ0qD9sDw]Y}D9~D$υt'v@9w@|uxb9wxT9}P [^_]Ät^};tm9tЋ'밋II[:K [^_]Ë9u9tЋ}ND9OD<]][D9^DυYDM9YDM}B4^D9_D(뮅f"f 9DupR?UWVS$E@dtfɍ<ʉ}ЍMԉu7APWЅt#xuPR#l;htՉNj@u݋F9]uAEF$[^_]ÍMUS?Pt@uQPtuHuX uHuxu t1[]PtCu[]U/[]@ tOETD$ ED$4$'TuEt8u x[^]ø[^]ÍD$ <D$D$$NqUWVS(ûƅt Ftt 1([^_]ËFy ([^_]Ãu ӉM܉ЉUUMxy=fuVfǃؔ ؔ f|M܉UD$ HD$D$$MM܋U0u?FtTtG1M}|$ }|$D$$VB0@MQVd;볍3UWVS菔dƉׅt4tdvu 1[^_]É $GuMT$ $T$D$$LMuMT$ $T$D$$LMlMT$ $T$D$$|LM7UWVST蛓p։8E1tDžDžF F`FD$$D$ D$D$D$F D$FD$ D$D$<$u G @u}D$D$ L$D$<$gO @,1ƒ $QD$D$ D$L$<$赕~QG KD$D$D$D$D$ T$L$<$肖KE+ȁT[^_]ËQu7Iffft#fFPЃ6t?rΑD$ D$D$ $I]tt1t dQD7UWVS(c8ƉЉ}8U1҅t\D$t$ D$D$4$ ,=?U+([^_]É4$?PwstP|.ut$T$ D$D$4$+댉ΑT$ T$D$ $"HO UWVS4+}8EЉNjE1A<<EԋAE؋AE܋A EAEAEAEEE}YQ,A<9u1҉M 9t5Kt-!8tyՃw9uˋMȋE9~UĉM̋ uEuЋE+u^Ẽ4[^_]Í}1f1҉9r׾tffEfEAE띋M1|]UWVS贍Élj։MEND$A M$…tKX MH GBG B GBGBZJBB!F^ ߋus%uu Ѓ[^_]äЃ[^_]ftugD$ 4D$D$$E0D$ 4D$D$$bEf mUWVS&`5@<ϋE E(8ƋE1  ( @/ 11 r} !8} t } 0<Hf@fPffL< 8Px HD$ |$ T$L$$‡…L?@@ u+DL<$0ЅLDHDL} t!} t} tDDž6H<$~:=HD ɅLP9yHDžLDžu4 =81HP9H4D)ȉ,D$L$ t$PD$<$HDž@@ uD$0Ѕ[<$.f&G$ƍG$W 8f &} } l} 9U qf&!M8$覈f8G $蔈f,G$肈f&wD$|$ t$PD$<$+…c@@ ։<$O8=>$軄…(88,,D$|$B$触8 ,&Lt!9 ft LL1.Bvq'tlH$i}NjE $\}$~|$t$D$ D$ D$D$$%虑81H L)Pd8pT4ؔ DH8@@11HrLXDž\Dž`HTtDžxDž|$@(4)L$P#LP3谅1.} 1-D$|$ 8D$PD$<$ƅ@@ u<$0Ѕ8Ɖ<$5P9,| rGL"fǃؔ DfGljfWtuˋW҉N{E+&[^_]ÍlW0DD$$Z(FF FFFFl 9u8΍ Gt‹@u iDD$$!H󥋅DD$D$ D$D$$%臍81Lx $·跂15M(18<pfaf14DD$$W 8FNN uuD4$1DD8xD$ D$D$$b:D$ D$D$$3: N͑D$ D$D$$9($D$ D$D$$9D4$0DD8,D$|$D<$"8ЉD1_ <$}w1#Lu .8t189 u拽,t t҉11UWVSp̍Ɖ8NjE1>$|B${11 rFFtGGFUFq=~1ɀ.уu9`d9@ HDPDDžDžDžDž<$<8=}3G u$1ҋ~`{}$臂$y1xƋND$F D$F$Ƌ@ut2OD$G D$G$tF$Ձ$ǁU+p[^_]Ë넅tJPd9\.$1ҋD$ D$D$$uu~d,@}뎃1@<tE12Dž$1ҋ. P{u@ {81.늍ΑD$ D$D$ $3$1ҋgz@u6mwzHDPDE$=&z1jDUWVSHzEhpPt%={8DžthE11҉ rMd11҉`d r`VtA<$8iy^yt[^_]ËhMEEdUMEE$1u`11 rU؅tkhd<$7hE[^_]ËhMEE뀋hMEEd<$7ЉddiX07\P}`1}dX  rOTdDpPۑHXLƋX9H`D$ PD$D$L$@%hL$P T$ D$HD$l$6xWE11҉ rlUEE!$\X;l${9T#X\dwc\$5U`U؉h<$5h(‹d뎋DA‹@uDn> t1҃me9Gh9wGw9uhtQl$|dl 9u`q@D$%l$h[l$w…hl)D$L$4$|XdX`phHP HLT v~u~hxv G<FEu11 rE@t`EEEE<$ ML$ML$D$ |$_D$E$twEЅUp[^_]É<$X MML$UUT$D$ |$RD$E$%t?E$$`_p[^_]ËUEtFE$_gMEԋAE܋A EAEAEAEAEEUԋEg{EЉƋ@ujZUWVS\ Z{h8NjE12 D$ D$ D$ $nƅ8#3D$4$D$4$xDž< < D$4$Wxt$$}t띋AAA AAAADžD$ D$D$4$~#|$$u@uD$$1ҋE+Ё\ [^_]Ët։։vt.t_tދ$닉D$ D$D$ $u3ΑD$ D$D$ $:MUWVS4PW)eEȋE0xU11  rŰ]ȍuD$$qEЋ]̍EЉẺEEtCË@uE)uEЅt $]+EU4[^_]UVSVwduD$F $VtP PH p[^]UWVS@VV+dljE8EG ut$t$$tӋD$$-tD$F $ ue$R@=wI$*‰@=wЋЉ==1U+@[^_]Ë~D$<$Xtu狵1DžЍtftȍtftD$D$ GD$D$@$)9OtD9AD$D$G$t<0L9_YB 9@3t9'9uۉD$D$ $kut$ D$D$$+u9u [u3fvfvBjUWVSqRF`}utHt$F $E $UF t[^_]ÉE4$~E[^_]ÍΑD$ D$D$x$ fffffffUVSÉ1   lLLLL9r[^]UWVSTNjEGEGEG EM]Br 2 r 9u֋]Exj׋]؋M1ȋu!1U V1!1 ‹Mp $1!1ы]3ν1!1 ˋuč|1!1؋uȍ*ƇG1!1 ‹u̍F01!1ыuЍF1!1 ˋuԍؘi1!1؋u؍D1!1 ‹u܍[1!1ыu\1!1 ˋu䍴"k1!1؋u荴q1!1 ‹u썴Cy1!1ыu!I1!1 ˋub%1!1؋u̍@@1!1 ‹uQZ^&1!1ыuǶ1!1 ˋuȍ]/։1!1؋u܍SD1!1 ‹u؉1!1ыuč1!1 ˋu؍!1!1؋u썴7É1!1 ‹u 1!1ыuԍZE1!1 ΋]荜㩉1!1]1!1 ‹]Ѝ og1!1Ӊ]ӉыU1ыU䍔2L*!1 U֋UȍB91UԍqU11 ‹M]"am11ы]썴3 811 ˋuD꾤11؋učK11 ƋUЍ `K11U܍p11 ʋ]荄~(11ӋE0'11 ދE0ԉ11M̍11 U؍9ى11ˋU䍴211 ڋu|11֋EeVĉ11 ED") 1ȋ]Ѝ*C 1 ËU썔2# 1ދUȍ 9 1 M䍄Y[e 1ыE 1 ˋE܍0} 1؋u] 1 ƋUԍ O~o 1U, 1 ʋ]̍C 1ӋE荄0N 1 ދEč~S 1M5: 1 ‹M* 1ы]؍3ӆ 1u uÉ_] GMG T[^_]UVSJüXut0FF#EgFFܺF vT2[^]ÍjD$ $D$D$$HUWVSpJEXEWU P?ωM] 1ÉPHUʉP@)O9]rlڍ<u u|utPE=E);UEމE} ]7E@9rE)uu U<u sPtft[^_]äft.t&N] u]tugjT$ T$D$$EU |E'T$ T$D$$kEGf2u S'fUWVS$8H"Dž@DžL0D$ ,T$4D$8$ƒ8B4D$H$rC4E+Ё[^_]É,D$ D$D$<$n,,D$ D$D$=$0,THt$F BUANUT$ U T$-D$E$]UED$ ED$E D$E$y]U@NUT$ U T$-D$E$B]UWVS$@ZNu4$5uE荓UEEEEED$-xX<$E؉D$<$D$<$ $[^_]UWVS?MEX8TE1D$D$$ބƍ`$1D$XD$$P]PT$D$i4$4$t'pTU+İ[^_]\$V\t~։P6tN~ tu틅XD$F$2uԋPGX$XcP$1A$]UVSe>:LuF tF 1[^]ËF0$CF0F($BF(F,F$BFFN D$2$FtF 뇍uD$G$t F ^YUVS=nKuF uu,F [^]ËF$WFF F tԋ$F F [^]UVS)=JuF uetaF0$AF0F u9D$D$ D$D$$gF0[^]Ë$f 뷸US] $)1U C []UVS{<PJu4$F$,AFFF0$AF0F($AF(F,[^]UWVS<IE@0}  ML$$IJop< t< tAD$4$蔲?x4$fM Ay EpE pED$<$KtbP1tJ< t`< t\E@H9tTE xFE7ED$$tgPuuE @4E [^_]Ã됉U }OD$G$D<DžUtBExE xzt7@ D$$ ;ƋEp0E$01jUWVS$S:,HEuUE@ u*x(9P,ӃCtftEp(ff} GуbF9SNO F|>L)/9!A)‰UtEHE HU1EE.E HFD)ЍtEx9EEPB9uҋEPU@E]OED$UT$E܉$ \M(uTMEHE Hb@ ]D$D$ E$[]0E$E@$6=E@@@0$=E@0@($=E@(@,d01$[^_]ÉT$<$]{9DžqEx(UP,ӃuCu*E $[^_]ËEH!fZUVS~7SEu F tcu.tR4$(tEED$4$+tE[^]èu?V$ED$ ED$T$F$ t,1[^]É4$tF F$F 1볃F$ED$ ED$ED$4$b[^]ÐUWVSh6DE̋UD$D$}Љ|$ D$D$]̍4$vEЉ$2cD$D$|$ D$ED$4$ѦU"}91E1EUxu0P)uftf9XP 9rUEMȃ_UMEȉMȉ$]1EMȋUzUċE]މuL$D$Ɖ$]uUĉfEU{u7Su%uftf;s;s up9rU$]9MAu9rAE01h[^_]@t`X Eub MȍLM9Cu8fE9$e19OK fMču11҉  ruu؋SUU΃EtfEtMtu}ȉ}шUvtft}rMȍTUs!󥍊M9.oEE$]8~E$]7eH MEM1ɉ}f]}tZ߃ uЋ}]E1ɉ}E} tEuЃ̋U؋uVU܉VFSVs u1ɋ}tփ uE1҉]ËEt-EtMtm7E u؋]uV U9t$.t&tZ봻u}ȉ~ utftuN yu MuNEjM}ȉyutft֤Ӻ}E9PEƃEIEuȉp1MrEtfEtuuȃEM}ȉyutftEEfÍUD$ D$D$]$ }]]wUu'u M3fmJM뿉$]4!UVS/æ=ut4$4[^]Í0D$ D$D$/$S4$P4[^]USp/E=ED$E $_[]UWVS @/=E}} 'v?NBCDt]e1 [^_]ÁB u$<>+ƋEEFGEFWUV O MN$W$=WV(F,}E=V-~U V O(N1t)NEȉF99U9} 9U4E E= =w=w=?w=ED$D$ 11 +D$$D$]WF4N:V;m]4$?2P]ۃV(F,}EF-~E F O(NEEfE= =w=w=?w=ED$D$ 11 +D$$D$]PGV0N8F9/r<11͸11UWVS,9D$E$ƍxD$4$}и9ED$D$t$D$ D$|$$at4$SttFD$D$ E D$|$$t Ĝ[^_]É|$t$[1߉4$b1ȉ4$1UE@ ]UWVS*8EEU ;P snH,X<3t;t-?19r09Pr+HE)E1[^_]?SӋ?̋]Ӌ]UWVS$R*'8uF$ED$ F(D$ED$E $O~;N:]f4)ЉMЉF$)É]]]f4)MЉF$)É]Ef4E)MЉF$})lj}F-VMуtitT <ωf0ED$ ED$)N8N9^ )߉|$4$K$[^_]Z D$D$$茹9ԋD$ D$D$<$1-D>DBu.L$$u9ċ;$_!D$D$$ǸZUWVSÍ%EĉED$ED$E $b&D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,yaD$0 Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,aẺEEfEEEfEEEfEEEfEEE`t2 u&FUopU x;uED$|$ -D$hD$E$E`t jED$$;E`FED$ D$D$6$(D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,_(D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,"_D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,^D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,R^rD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,]D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,]ND$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,]D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,\*E`Yl‹w puED$ t$_D$E$l‹w p8uED$ t$ht$E$訲kWZ PH8uED$ T$t$E$ekWu Wz?uED$ T$t$E$'E`t tED$$ ED$$1ɋuEED$$ EED$$@EbED$$EEEf Ef Ef EĈ[^_]Í T$D$ D$D$<$.o D$D$ D$D$$UnU D$D$ D$D$4$n D$D$ D$D$$UnUP D$D$ D$D$4$NnK$D$!D$E$4Ĉ[^_]ËED$ D$D$[$虘ED$ D$D$W$oED$ D$D$S$EED$ D$D$O$ED$ D$D$K$dED$ D$D$G$ǗED$ D$D$C$蝗@ED$ D$D$?$sED$$ IUWVS$ ÑuE }8U1D$L$ t$U‰T$$ xVD$t# $U+u#$[^_]$."1OUED$ D$E D$E$]UWVS æ}ED$|$ ED$ED$E $ x8Ɖ<$WuH;M}"f.E[^_]À|.tH;M|1[^_]UWVS$M "E8E1D$|$ D$E D$E$&…tD$<$E+u Ё$[^_]NUWVS Ï}u Gu 4 Gt*D$4$趞uUt E[^_]ËEtE[^_]UWVSI uZe~M u ( ~t9uUt E[^_]Í L$D$ D$D$<$iEtËE[^_]UWVS Èu} dVu + Vt!9>uMt Ev[^_]Í|$D$ D$D$4$#iEtËE[^_]UVS u,d\ Bt ;2u[^]Ét$D$ D$D$ $hv q[^]Ét$D$ D$D$X 4$\h[^]UWVSd 9U} tdUfc~U ~t;u[^_]Í T$D$ D$D$<$g[^_]ÍUVSñub Bt ;2u[^]Ét$D$ D$D$ $^gv y[^]Ét$D$ D$D$D 4$g[^]UWVS%u6bw$ wWvK B v|@vF[^_]Ávf”[^_]Á i5[^_]Á v,낃@t9u~jtucݔOӔD9.#. 1t$D$ D$(D$<$ceɔUWVS-}>`YD$t$<$`x [^_]É|$D$ D$(D$4$d[^_]UWVSÎ}_ rt;:u[^_]Í |$D$ D$D$4$:d[^_]UWVSLA8E1E <tmD$D$ D$.D$M‰ $McMt#PT$UL$<$U0E+u4L[^_]D$ .M‰L$ME D$$MoGUWVS4vKEEEE$E܍U}}؉EUEEU t 14[^_]Ã?uuU<-E<+u JMB-DK~r1ɍ LH>vD{uU 4u<.}DCuuŰMэMܨ@uM1ҋMDK@u49rMԄMDC@&E DS@tc9rEu ]Ԉ^^FEȉFEȉFEȉF EuuEE9sEiEԋ}DC@u>1ɋUDS@u%9rUȄQUDC@NE9>DS@uE9&ENjUDC@ub1ɉUЋUDS@uF9rUċUЄEĉEDC@Eu9sEDS@t|9rz}BDCz}4BDCu;uJMBEcEE]z}DEBDC1.t&FUWVSǾEM HMHMHMXˁHɁ@ =+-EAE-ENMb֍)É]؉л))Ɖuԉމػ))ƉuЉ]̅EEMbӍ)Mȹ))Ɖ))MUĺQEM)U)MEJ$CEE4$CEE $CEUM^]EaE}d\$DD$@ED$<]\$8T$4]\$0]\$,]ȉ\$(t$$L$ uĉt$ut$u؉t$uԉt$uЉt$ ủt$D$u 4$\E$aEt $PEt $?E Ĉ[^_]ú)‰UiEESEW) u RE ; er@ror:@ unk@ nown@ LOC@ RR @vers@ionE Ĉ[^_]ÍsEs}\$DD$@sD$*tQ<.tAx[^_]ÉȅyE T$ (T$D$$nE[^_]Åt<.1[^_]UWVS0pE VE荰EEEE$PlPHH8|$ x|$x|$@ D$L$T$ 7D$D$4$ ~ Eƀ0[^_]UWVSà u Gt-D$4$Ŏu?E tE [^_]Ë?D$|D$4$ukV-DPtM肹D$ ED$4$J[ҋMyE8m1Ɂ]1VUWVSðu\ Gt-D$4$Սu?E tE [^_]Ë?D$ۛD$4$ukV-DPtM蒸D$ ED$4$ZkҋMyE8m1Ɂ]1VUWVSu D$4$蝔FFy ;F|/} t)P}D$4$葔[^_]Ét$E$襝UStIEM QQy ;Q|< tZ[]ÉL$$W[]UWVS"Eu E$̨EEEEED$4$賓F0u ǀED$4$"D$4$褓[^_]UWVSmmRP`8uWV@tWufFuFuFf~@tJD$4$plj4$$R[^_]ÉV@ut"Fu먉F룉4$xfF@먋FuxUVSë`8Fu t$-XD$ D$ED$4$[^]UVSW`8Fu tE D$ D$ED$4$[^]UVS4 `8Fu wtED$ E D$ED$4$2[^]UVS,ü`8Fu *tNE(D$$E$D$ E D$ED$ED$ED$ED$ E D$ED$4$,[^]ÉED$4$;EUVSX-`8Fu t2ED$ED$ED$ E D$ED$4$[^]ÉED$4$EU`8U]U`8U]USED$`8$[]UVS|Q`8Fu t$ED$ED$ E D$ED$4$[^]US)`8$-[]UVS`8Fu Et2ED$ED$ED$ E D$ED$4$[^]ÉED$4$rEUVS d`8Fu t9ED$ED$ED$ED$ E D$ED$4$ [^]ÉED$4$EUSED$ED$ E D$ED$`8$[]UVSè`8Fu t4$,[^]ZD$$dUSUD$ l D$ED$`8$[]fffffffUWVS 1E8tj׉ƅt|$4$2Qt@u(<.tqAtN<\u~u~t(뺉U)Ѓ [^_]ËU9Ѓ [^_]1ȋU)UWVSs}};ƉӉȋ9uwufu9rى)ڋE1[^_]ÉED$ET$ D$D$ $-EE룤u9sftuu_SfӋ]KUWVS0fE׉΋UU܋U؋U$ªEM9L9MyE荃EEuuE9D$E$yt4$ME+x4$MyuE$EخE؉Eu܉00[^_]ËuE$Exu)y9uωE !T$ "T$D$ $E1UWVS$ ]Uϋu M MUL$T$ L$U‰T$$EEdËUv‹9EuC9@@EJ}B$[^_]Ë]t*]t .]{<|.B]9Z.EM9s;D$U썂D$ D$D$ $-Eډ)؋ux$[^_]ÿ뛉댋]썃D$ x"D$D$ $'뷋]藬EE}8UWVS(-]Ӌ}u UUS9)ÃEM-U썉M u2D$ED$ D$D$E $EJBs1([^_]É4$EEx%([^_]Ë]臫EEUWVS+EuE(M,} M0t8xU1҉}$tt$$JNNƀ?E4$lDžU4T$|$E$Fƅ9s9D$D$ D$D$ $-7)U4E$NjE$|$D$4D$ D$dD$$VJNj $‹>|$ $}Mtq}whM򋽤;qt#t<.)z<7|0.M$ЛU$AD$T$L$D$ D$dD$<$/I‹$90|-f @)ȉ~ DžƋȉD$D$<$<9u׋)$$|o|$ $1ɺ0yf; F01x JDNu.9uҋ‹)‹<$9VƋt)xE+1Ġ+[^_]Á}e}$# M$U$[&D$D$$U `9)F09\Gt1Gt`$D$D$ D$dD$$/‹ $LuP~F$B=  $u|$t$$U <$FQ4$~$XD$JD$ D$dD$$.‹ $<$|~$D$T$ D$dD$$.‹ $s<$fF $F $D$|$D$=D$ D$dD$<$-<$G$|RT$D$t$~D$ D$(D$4$"-‹$}U$r VUUU)ʉЃ=p $-^E$XD$AD$D$D$ D$dD$<$^,$}$fR<$0G$"D$t$@D$ D$2D$@4$+‹$']4$9lj4$F$lj$k$T}lj<$L|$D$$U xt9HD$ "D$D$E $<x}$9Gt1Gt`$D$D$ D$dD$$'‹ $4juP5G GGG GG GGƅ=G GGG GfDž==ƅ=W GGW GW GGW G$,Dž====fDž==e)RD$ @t$E$D$$ y F1E)0~0 $309 4$Ku‹$yD$D$ D$dD$4$$‹$p?2‹9@Dž@DžDDžHDžL@)‰t(19rE4D$ T$t$$˕$s9s3D$D$ D$D$ $-)U49V<$F |$t$b|$D$ D$dD$<$"‹$s7D9D$|$ D$dD$$! $yD$ @t$L$<$8  PF1E)0~0 $K09f4$q‹$yI) 4$lj$|$XD$ D$dD$<$ Nj$‹\T$ $1ɺi$  B4$Nj$u4t$D$<$Dž9s3D$D$ D$D$ $-)u4t$$1ɺ`4$  ?$裿Nj 4$u4t$D$<$Dž9s3D$D$ D$D$ $-)u4t$$1ɺ]4$<$蠾Nj4$u4t$D$<$Dž9s3D$D$ D$D$ $-)u4t$$1ɺZ4$ %5$虽<$u4t$|$$9s3D$D$ D$D$ $-lj)Ɖu44$/Ut$$1ɺm24$ 2 $/_<D$D$$U i}$M$fҋ]PV,Pf҉N,ukǃ ǃǃF(F(V 9~F$F(DF,1 [^_]É~$F(DF,1P 9UHɋ] HN,@fV,9ErgMF,F(F(T~ 9~GF$hF(F,cmN]m]m(ffUWVSM&Eu)M} OV~^m M0ȈE<ƒ?ك}Ou荶,#ULWm ]0وM<O ]O?9E]U\]\U]TT} uU u ;E}[^_]} Oσ!$ˉM_MrUWVS}u 'MYf0x}~E~p1M ɃT 7  ҃{T 7SƒuM9}{C.봋]9|Mȃ[^_]ÍH rȃ[^_]ÉEsT$ p#T$D$g!$^ME# UWVڳu o^_]ø1إL ÐUWVS\ÖϋMM8uM1t$D$ED$ D$2D$M $MQƃM9r,ML$$$<7M)11}U+u\[^_]øUWVS EE E컉e)})ljӉ))эR)É]%I$)‰))ˁ}: EE >u}: w( ]u#M EÉ$Sr?E}~=Ut3}--w\DAtu܋E Ƌ})x [^_]9u]䍃D$ #D$D$e!$s\ÍM U$WEM E$DxgEEM E$HEmx>EM EÉ$MMCxEM UWVSöu4$RH9MX} slu^uVt}} Tр:.utgz\t,р:.tU ƒ.} 1[^_]Ãt=z\tפftu?u&xU 몋E Pf} /`(qUWVS̡áE 8E1D$|$E$xFD$T$$zxT$<$z4U+u [^_]fffffffUVSEuUMx#L$ T$t$$<x9s[^]ÉL$T$$%[^]fffffffUWVS 衠vutcEt\E $F&ljD$4$'u?|$4$#u%džt$|$E$D [^_]É4$#fl^UWVS utcEt\E $%ljD$4$V'u?|$4$"u%džt$|$E$ [^_]É4$"]UWVS Tu t\E$+%ljD$4$&u?|$4$f"u%džt$|$E$  [^_]É4$!S]UVS ̬uD$4$tD$E D$4$5 [^]D$E D$4$ [^]UWVS菞du} tAv-u3D$4$$tD$4$`%F1[^_]{\US#EU tttu P1[]6\UWVSٝî}u t' t:@trt0 wvONuI[[^_]D$<$ $tD$<$y$wFw71[^_]D$<$#tD$<$<$71UWVS}u tPD$<$#tD$$D$,\ZЃL$|P/~ȃ9~D$$)D$,ND$(\$,eED$8D$< D$P!L$8iDI4N\$tcD$t$|4$bD$|8(D$tـ@\$`D$XD$XD$XD$(D$0D$8D$< D$P݄$\$`.D$(FT$H)‹D$<ЉD$PD$X~T$D D$XD$P/bD$P؉ƒtL$tT(݄$4ݜ$D$P-otj݄$D$t$1ҋ\$Ptut ݜ$؅ D$P݄$ݜ$|$Xu DŽ$\$tNQ"݄$\$`$n݄$\$`t$TFD$`ƒߍFXj‰D$|@H0tT$TD$</[|$PT$8T$H 8t|$PT$8}D$hD$|D$,$x D$D$5$<$\$t$$]t$ $D$|$$$\$t݄$\$`t$ptD$|L$DD$`\$`D$`e[^_]Ë|$PȉD$|t^t$HD$PD$0JЃ w(D$PL$8\$| CD$|SJЃ vD$8D$H-0t ˃L$|0t)ÍCD$PBσ\$|BЉD$8D$PD$0\$TD$H|$8\$,Nq$$\$t D$`$ D$h$ D$8$ D$T$s \$P0D$tـL܌$T$`ݜ$D$d\$tD"݄$\$`\$HuD$P$%k)~&U1҉$4DŽ$pD$Pj؋D$tـD\$HL$H\$LـOD$,D$H$%u=D$0[D$H#$$T$P=܄$ݜ$m1ҋD$tU(C$D$\$td$D$4$x$ $$$1D$XD$\𿃼$us$ue|$Pt%=/D$D$T$\$tD$T4D$hD$D$T$\$t1D$XD$\࿋|$P$$\$tL$X܄$ݜ$$C $/$%= D$Txu xD$D$T$\$tD$T|$h|$$$ځ$|$P3'p$\$t.D$`$"D$h$D$8$ D$T$$v|$0$T$Pܬ$ٞwq؋$ݜ$!$1D$XD$\?6$%=+|$\)‰T$\K)!؉$^$DŽ$M9D$0tS$$|$PtN%=w@k)9t:D$0ut$HSD$H#$u΁tz%$1ۉ$$D$Hqݜ$$DŽ$DŽ$$hD$,LDŽ$1ɉ$t'4$)D9t t u 9u[^]UE]UE%]UEt ;E ]ø]UE%t 9E ]ø]US=yEM t.9t*D$ d%D$D$p"$0[]USxöM E%t.9t*D$ d%D$D$p"$0[]UEt t]ËE ]1} ]USDxUE ~;u;t5D$ d%D$D$p"$/[]ǂ[]Ãwǂ[]USwÐEU tt 1[]5UWVSzwO$ sEtc@@5D$D$4$Eg5u E[^_]Q584${B58EE[^_]UWVSvóuthF~O9tHNM 1[^_]ÉU4ED$|$E$蠙U4u=FUF맍D$ %D$D$Z"$/i|UWVS"v}t;t-M tWt1$z;wr$z<$z[^_]UWVSuÙ}tJWt7E1U9}t#E4E D$4$%u߉[^_]1[^_]ÍD$ t%D$D$"$ .UWVS3uE@EEE19ut|Ef-uix. fLD$:$w(1flmUWVS\q]Fk׉u UuU8E1Dn} t>M1U+y \[^_]$(X 9ƉyfQffQ 9>f4ED$D$ T$t$ $X@ u1$ЅD 9MPPHDžPGO9=uDž Dž)D$t$ D$D$$XWDž@ u4$Ѕw8L8 9v<$ZfG$ZNj$YЋ9f}}$} )Q t$$D$t$ L$D$$VDž@  99uQ 04$ =$]C{GvT'tO<$NNjE$N$O|$t$D$ D$ D$$%b1t9s;)d}dDž1 019tl!9hu狍Ƌf4JuZtJ9}A9p@ ‰))9~V׋2${[<))9zrtft1mDt$$*x9P ]u,04$rtx99v8Љ΃tft4$=ȉB9}D$ L&D$D$#$r ͑D$ L&D$D$#$: cD$|$ L$D$$P…s@ 899EP04$=+Ɖ<$uP)9| t$ D$&D$$%g]4$p)9T$T$<$tq8f<$Ѕ%WDž$3W1q΋9 GƋȉfpfJ2r 9t H0f9ًF9}랉t$ FD$|$ L$D$$M…@ 9-<$P9D$|$4$o1r@ yyy )ʉ (D$ $Q‰p<$%O\/D$|$4$an01911)fR9s<04$L2)׃ (D$$PljUWVS$N\u}5EGBt $[^_]øEB $JE!M DžD$ED$ED$ D$ED$<$wI…xkF D$FD$FD$ D$|$E$MEEE$R<$ Et;$[^_]øE9E$R<$ F tD$ X&D$D$#$RE$GRF UWVS@ZM3[Mu8‹E1kFB FBPƋ}ۉ\$D$ D$)D$4$~HƋ9s < tW< tS< 9sz~D$ $)H< u땸1$I@ 2m)փ (D$$5FtƉKD004$A@9]‹tft‰)‰ODžNtftR :)944$S@9o‹fBf 8mDž1 ED$ &D$D$^#$3P$yG9%f)փ (D$$C%Ɖt$Fdf\UWVS`AòOE‰Eu8E1FE D$ .u‰t$L$E$}!EE4$ML$ML$D$ t$ED$ $t`E$EE@ U+`[^_]ÉM $8M>ʍEbMUEƋE$|Eu녍D$ (&D$D$#$B[UWVS(b@7NuE>FE苳 }te_UE<$ML$ML$D$ |$UT$4$贬t,E$DE@ ([^_]ÍR뙋MUEƋE$wDt([^_]Í $٫t: DD$ &D$D$ #$nUWVS5? MƋEtvF u>ED$ ED$ED$E $E1lj4$[^_]ËED$ ED$ED$E $EDžt뼍ΑD$ &D$D$#$A[E1UWVS]>.Lt@ËED$ ED$ED$E$ًU EfƉ$[^_]ËE1[^_]UWVS0=úKE}u  t/10[^_]Ã} uyMMUUUUu|$M L$D$lD$0D$ D$ D$E$&iuE0[^_]Ã} tba8t{bPWPtD@ 7 E #T$ l&T$D$#$_Ex{UWVSXl<AJ}E EЋEEEE8EƋE1$(o81 E؍EEȉMԉ}܉<$@D$D$ D$D$E܉$iDžE؉D$<$蝲ƅtEȉD$|$$ MЋIt9pMЋI t9^Mԉ}UEă< t< tM܋E؉D$4$MPE tJ< < E}9yE؉D$$tPuϋEЋUĉP MH}MHAMQM)ω}9}ЉG)ʋ}9nt1ɉU؋}U9rU؋}ЋO E)׉UA4$@9‹}؃UЋu؉2Ɖuԋu)ƉűEEE6tftuЋVuȋMԉ 2M)ẼEE؋}9SE؍UȋU܋4u4$C@9Ern‹}ԃrjwt%ỦϋU)׃E (D$$:t 8E܋U Mԉ}M܋E$=E܉$=1E1uU+|X[^_]ËEȉD$|$$![t@ EĉỦ $yŰEωM[fPEЋPEEE$fuE̋E_M#Mԉ $nD$D$M $M?U9ЋMs%T$L$4$MU+8[^_]61މU؉E܍h6L$ T'L$D$i# $U؋EEU؉E܍6L$ T'L$D$h# $GU؋EZqUWVS^.3<u} }MME|8E‹E1tAXtL/1uU+Č[^_]Í6D$ E`'T$UD$H#<$MɋUuED$ H'D$D$<$DM11rEEM Tu11Mut*<tty9upu։}uut 9|uU}TE1E‰x}}9u~uYE)ЉNjMD$ >D$|$$Umr9jUЃ}Mt9u }U9P}91:u}zEt }_}RM)ыE U U$mUJuE+|UEČ[^_]u\ǾP}t u}tdPu9shx)‹|9rSt$D$u4$IJuE1E‰xEEjPu91`'#h6D$ ET$D$I<$eExUt7H'D$ t$D$<$+uJ:fE6L$ H't$D$<$E룃}=:UrlUWVS)ô7U- 7qD$E$vE@(t/}}tJD$ l'D$D$$$E@0PSfffffUWVS!/Ɖ׉ʅt5UWVSc8u} tdt0tCt 1[^_]ËEFUT$4$P[^_]ËFUT$4$tƋE[^_]ÍD$ D(D$D$$$rdD$ D(D$D$ $$[CUWVSUuE }t )щʋUt7uzN|$D$4$Q tuUtQFU)U u@ 1N|$D$4$QUt?tFU U u@[^_][^_]1[^_]1[^_]ÉET$ 8(T$D$*$$BE ET$ 8(T$D$0$$ EUWVS/u}U 8E E|$4$_tz9Ur0tpt+uc1T$ED$4$6>t,[^_]Ãu[^_]É<$E [^_]ÉЃtE륍D$ (D$D$$$)E ܞD$ (D$D$$$R}!<$ E 10UD$$U NjE 8Ut E?(D$+$ 1UWVSxu} t tJD$(#|$4$ [^_]ÍD$ 'D$D$?$$uܞD$ 'D$D$@$$UWVS }u tNt 1[^_]ËVUEGUT$<$Pt׋GUT$<$P[^_]ËGUT$<$tGUT$<$tE1҉¸M1 ډV[^_]ÍD$ 'D$D$W$$,!D$ 'D$D$X$$蹿UWVSó}u tNt 1[^_]ËVUEGUT$<$Pt׋GUT$<$P[^_]ËGUT$<$tGUT$<$tE1҉¸M1 ډV[^_]ÍD$ 'D$D${$$达, D$ 'D$D$|$$茾UWVSÆu} tt@} u[^_]rD$ 'D$D$$$)u!D$ 'D$D$$$UWVS#u} tt@} u[^_]D$ 'D$D$$$蛽u D$ 'D$D$$$mUWVSju} tt@} u[^_]VD$ 'D$D$$$ u!D$ 'D$D$$$߼UWVSu} tt@} u[^_]D$ 'D$D$$$u D$ 'D$D$$$QUVSzOuED$t$ ED$E D$E$~>.t[^][^]US'ED$ED$ ED$E D$E$B[]UWVSûuE D$E$t })x[^_]9u􍃼$D$ )D$D$$$OE)UVSEPtY.J.tQ.t&.tPÃ߃Aubv-0 [^]ÉÃ߃AvXЃ wrÉȅu[^]û.HvHw@B.̃v XЃ v-u(rÉȉdJ[0 v1nUE8*u P.tt E]]ÃE]USUtA1.tF1Ƀ\BÅtX߃]w"t1ɃBÅu[]û[]1ۉ[]ÉU[]UU!]wBu]1]USéE D$E$[]USE D$E$[]USTE$r[]US\1E$@[]<`8U/ E Mp7]UEf]UE]UEfU f]UEȋU ]fffffffUWVS(Ɔ u}E EEGE؋U L*uу<9M E9syQ.tf@t|E E9sT@AuwuFcO} o9](([^_]"E E1ɍL*EM[<U|$M $蹃Ut~UM)ȍ<FD$ $艃UUM)ȍE(\.uЋM)ȃE%E}9}EM؈vM؅<.U܃uwUD$]E$yUEE})C~x9F-}ȋ?DG~ruE9E9EEEE1ȉU}f]tEE:UD$ED$ED$ ED$E D$E$y]UWVSDE܋EEpu؋EmE@u8uEU1Ã@;؍sL`uʋE EEEEȋ} EEEċEQuE;EM}ԉ‹EỦ]}?wxEËu)?fpхt@}E]Љˁ?@ ‹EЍpхuEEuEuŨ;U]M}ԈM]lMEFFEE]肬o+E d9] [fEp}1EpBf9utBt&M]܍RD$ ,)D$D$%$:MUWVS$h-E8E1D$D$|$ ED$E D$E$t>ED$D$<$&tE+uЁ$[^_]ú/UWVS$|E MU8E1D$ D$|$E$t-T$L$ ED$D$<$cU+u $[^_]É.US]E M9r 9s9su[][]UWVSEU} E9slUP0ك@t$tNt<]ĩ([^_]9sAAu@u;!E!29rUUX9r1[^_]ËE؃EȉӋUUWVSuE t*X?w#9r6 )ЍXt9Aхu)[^_]É[^_]É()[^_]UWVSZEEUu Ɖu]Ӊ]8]}Y ?w` 0}9sq }9sg9u>zPt$|$$U]C uU270:ۅt9u1[^_]Ë][^_]Ë](1[^_]UWVS ou}E9E |2&6D$D$$ umtF;Gt1 [^_]ø [^_]UWVS3U2E uuW1[^_]É?wZ9rBZML$ ML$)D$D2$x(9E~9}ljr[^_]É(뗉֦?UWVSVEU t_Z1?w%9r8D)ӍV[t9хuލF[^_]É{[^_]Éd(F[^_]øUSE D$E$k []UVSéuD$D$$tD$T$ tV[^]øUVSuU ]t*>t8u9t Ju[^]UWVS,NuE܉U؅Ot A"}܉MGEML$$]ou]NjM-+E0 EEډU1709~Kt$EU9)ߋE^SЀ vSW9U؅ttFE܋E؋u܉0,[^_]ErEJ0AkL$X\$\1ҹ1)ӉL$H\$LD$@,D$ D$Pi)\iT$P(\ЉD$P)\L$(QӺ\D$8\$<9¸(\D$<D$P)\L$(щQ֣p=D$PT$T9 ףD$T\$ ׋D$XT$\19|ID$XT$\D$HT$LD$XT$\m1뷸n1뮁lL$X\$\n9>|$0L$X\$\L$X\$\1҃D$HT$LD$Pi)\iT$P(\ЉD$P)\L$(QӺ\D$8\$<9¸(\D$<D$P)\L$(щQ֣p=D$PT$T9 ףD$T\$@,)׋D$XT$\n9}8D$XT$\D$HT$LD$XT$\ m1미n1릉$D$PD$@,D$8t$X|$\؃!|$\֋T$\ƸQ)ƃt$X|$\)i)\i(\ø)\ykddڋt$X|$\)׋T$\i)\iD$X(\ø)\d$XQ֣p=T$L9ø ףD$LD$H\$XD$0 |$8-9R9~&)уD$P t1ҍR9ڀ|$Pt$$D$XT$\D$XT$\ƋD$XT$\9L$X$uD$t;ÉD$(t$,EaŃ\$(t$,D$t;D$PD$T1$D$HD$dD$8D$tD$0t$X|$\9}Éщ\$dL$hD$HD$ ED$D$8D$D$D$D$`Љ/T$0D$H]D$dT$h\$\1Ӊߋ\$X1 t$P|$T11 7D$PT$T|$X9Ɖ׉ӋD$\D$dT$h D$XT$\D$PT$Tt$X|$\1Ӌt$P|$T1ڋ\$X9؉ӋL$\D$XT$\T$HD$XT$\D$0D$(D$,bT$4L$8\$Kd\$T$4L$8\$$@+7Љʍe[^_]D$D$$D$E$T$(щ€|$?uG D$4xF~T$@D$D$$\$71ۋF|$0>|@u$hFdN-00tD@<@sȉ|$0>$@L$ @D$ D$49t$ G  ӉL$,iF9uڋL$ t$Ή\$4L$4щ\$0iF9dF\$,+dFG D$D$$D$E$T$(Lщ€|$?ED$D$$D$E$L$4T$(щ€|$?D$0dF\$,+dF)1W G D$ 9tG +t$\$49t$ \$bT\$a\$UWVS 螣o}썙]| uu [^_]Ë}|:dNu쉼PuMTډ ?-00tċu! [^_]UWVSt\$XT$T˅. 0xt$\|$`IXPL$d\$<É s {9 l$dyD$<D$dD$<D$ t$lt$D$QD$ D$\T$`$T$\$X[D$\T$`E.‹D$T|$T:)؍))׉|$d)À\$l|$<ljύ))É\$$t$D$:D$ D$\T$`$T$\$XP[D$dT$ht$lt7k9)ʍJ)Љ)))șD$dT$hi"D$dT$ht$l7_u)Љ))щL$\D$X,D$(iT$h)\iD$d(\ )\d$dQ\D$dFEVED$ ED$ED$<$HƅL@U܋M;WW+EỦ9‰FA1EdF1Xn]؉PE܋؉ }<$11ƅE؍(-F(EỦ9sUWVSP賓È\$|ljD$xT$pL$P8D$TƋ$L1fBZ<:\$t\$X4\$x0>D$DD$\$|$ljt$ȃ|$dw|$H1 ڃ9t$xuD$hT$l|$HyD$hT$l\$tCL$\qY؋T$p\D$HTT$8D$h9ËD$l!΋D$HD$\L$pD$hT$lDT\$d߃D$tD$t\$x9D$D#|$t$D$p>11ۉD$x":tt$p>t$x9Kp9|ѿBG|$xkfat&Dߍ$D$xD$|D$xD$P{D$D$x$\$|1[\$|L8T$4<L$@kD$0. \$X))D$Ft>8t$|$pG$D$\t$pD$`k XPD$H1$$D$P\$xD$X($\$HL$`t$t ;C suyt$tD$tT$hFP~L\$t9\\$h}4=}H\$t\\$h\\$PL$x ;>VD$\9]\$x|$dD$d|$pdF$ tftD$dËD$pXT$`D$x$\$|~6ËT$`<|$`1>|$t @ϋt$xs&tftt$`D$x D$hu+uċ\$|8f1D$ht$t IlPӉȉnu6u\$xD$p@f$ $ f |$pdNeND$@1ɉL$8~$D$xUWVS@\$dD$tT$pω<<FD$tp@u1e[^_]Ãt>u)D$lJD$ht$t|$hwǍT$xD$`tD$lD$XGtt$TDD$Pt$p@dPdP`tftߤ1eD@t$p`Pp@D$HD$pf@D$`<9PHЅu>u)Ӊ\$LT$`.u<*t <-~0< wȋt$t)D$lD$hD$TD$P\$pCCD$x؉dFǃhFǃlFǃpFD$XC dN\$lډNjt$ttftt$l0e[^_]~~1D$HD$`*t -~0 wËL$`)ˉ\$LL$LY\$4\$X\D$x-D$|"D$dK$|$$58,,$|$8|$pGD$xD$؉dFLJhFD$|D$؉lFD$lpFƇqFfLJrFD$XD$\D$d,D$D\$@t$8ti)\‰(\= ף|$D4)D$XT$\9D$Tt$PtD$XL$\t뺨1ɋt$pD$d[tlD$TD$P11D$Hy,;T$|| ,;_D$pD$TD$P|$pwt$dD$xD$T>7> 9iFuD$pD؉D$X1\$Pt$p>iF>kFuL$T\$X)ىL\dFuډT$X|$d9u\$PD$T؋|$pdFLJhFD$|؉lFD$lpFƇqFfLJrFGD$pX dN\$lډNjt$tsctftt$l 0D0\$LډNjt$`stftt$L0ɨ뀋|$xT$|1{2D$Xf ndPt$pdPePeP@f2|$pdNeNT$hfM|$pdNeNT$h"fQyT$4\$\$@t$8D$XL$\D$DD$d,D$8L$\$0t$,ri)\P(\wf= ףt$8)D$XT$\p:σ|$@p/|$T9׋t$P}D$X\$\L$@t3빉L$\$0t$,D$,|$,9|$|$D$(D$d,$\$t$i)\P(\= ף$)D$0\$@D$d9)؋L$09ȋL$d؋\$(T$DЙD$XT$\D$8T$<D$ D$8T$CD$(D$DșD$XT$\D$8T$<‹t$FD$(șt$9Ћt$H}D$,D$Dt$0D$XT$\D$XT$\puD$DD$,9}bL$T$$D$@L$T$D$dD$03UL$@D$drD$0;L$dJ\$t$pD$(Fu=|$plFpFdFhFG\$\$@t$Dt$8t$)=D$pf@D$,:D$,D$p1҉PyUWVSyǾ}ƅӀ:tyɉ‰Džt;:1ɉUF E荈M1= ||9}~z>dN$]-)=v޿T[^_]@@@ f@ǀdFǀhFǀdNUTC1[^_]ËE~퍖dNE荄dNNjE%9tUD$4$]lUu_ɉ1DžuUWVSxoNj U$8(=EU~|$, $( 5}# ,-TPdž _y>u E [^_]ÅxE P$RsÉ 2(-TPdž 1뒋WZytىugb1ɍA -dN}D$|$, $UVSvÞ,4$B uƃ 4$B[^]UWVSv]EuM V~6hFhF1P9u dN9ut [^_]Ë]w41[^_]UWVSvUM Z~/dFdFP9u09ut[^_]É4[^_]UVSuÅ,4$A<$4$A[^]UVSmuB,4$A14$A[^]US7u <$[]qUWVSu$R;qt6ÉǹUu [^_]ÉE$y3U1UStÂE$iy[]UED$ D$E D$E$1]UWVS]t2,<$~@<$, D$ D$ED$ $Ɖ<$:@[^_]UWVSs,<$@ u<$貛E D$ D$ED$ $ZƉ<$?[^_]USxsME $11ҋE3t (-P([]US<$) t1$ZEgƉ׋D$$9>[^_]$1ɍZE/ƉUSqßME tEZ[]$E1ɍZ$[]USsqHME t@ tEZ[]$cE1ɍZ$[]pUEt@ E]UWVSq~]} tC }1ɍZ[^_]UVS0pƎ~]D$CD$CD$ C D$CD$CD$C$D$(D$D$$D$$1ɍZL$xLL$ L$KL$ KL$K L$KL$KL$KL$ KL$$K L$(K$L$,K(0[^]UWVS]u } IXP ;r B}y[^_]ÍIlP)׉[^_]UWVS oo}u} ,D$$; t[ t$RXPL$ ;p H}yD$$m; [^_]ËL$RlP)Ӎ<$\UWVSET$RuXP$M ] ;H pDyE U $\$ ;A yyƉ;u ]|o9u ] $\$ ;A qyƉ9u ]|͋M ]11 1ڃ[^_]ÉƉ;u ]}# $\$ ;A y}'yϋM ]11 1)ڃ[^_]Í [ulPƉ)뗍 [ulPƉ)J [ulPƉ)RUlPE UUWVS\m1{,D$ $y9 t< tOUM T$L$$Ɖ׋D$ $?9[^_]Í<$C uu} UWVSlàz}u tstC-t(TSNLKf9t)ȃ[^_]1[^_]Í D$ 0-D$D$B%$%둍D$ 0-D$D$A%$$^US ly0 u#$, tЋE$(UWVSkÛye=t:F$V FtD$$g,4$Lpuƃ[^_]UWVS_k4y}ƃ0 $gtCƉxtD$<$,E FEF e1[^_]ÃUWVSjþxuE} t\Et1UӋ} ׉|$E$Ut!~}} u1ۉ؃[^_]É뻉؃[^_]ÅMuՍD$ <-D$D$H&$#멍fD$ <-D$D$F&$"3D$ <-D$D$H&$"rD$ <-D$ED$G& $Mq"UҋMET$ D$D$H $B"UWVSgi]UcqUT$UT$ -D$E D$E$]UED$ED$ ED$E D$E$]UWVSlcAqD$-FX$F`F`y ;Fp|4} t.FXPVX}D$FX$[^_]ÍFXD$E$USbüpE-Q`Q`y ;Qp|< tQXZYX[]ÍQXT$$[]US bdpE D$ED$-X$g []USXb-pED$ E D$ED$-X$5g[]fffUWVSboM } }E EEED$E$E@ E@U~5M19E}EtfEtME)‰UE$5UE@몋U tE eMpTEfH @1[^_]ËUu G)77wWU<$UtًE)1u EEPCP@@D$$E[^_]ÉЋ}tftE@9y6U&D$ |-D$D$&$E@U)ЋMAD$ $%E[^_]ÍPD$ |-D$D$Q&$.0D$ |-D$D$=&$EurMuMu4UD$E$aEU)1u =fBfmyMyHMXUS _lED$E D$E$c []US^älED$ ED$E D$E$c[]UWVS^jlEED$E $ƅ DžD$ED$E$0"=ifGfw G$G,G(G Eu [^_]D$ D$D$<$[^_]É$"fG 1[^_]ÍD$ -D$D$>&$@UWVSe]:k}t5D$<$w fD$<$![^_]Í0D$ -D$D$;&$ffffUWVS\öju 4$ 9EU9s 9ru׃s$u8u:Ѓ[^_]Í 9rU9tՉ׃ru$u,tftƤЃ[^_] zfUS 0\jE9ErD$E D$E$m []Ԟf!̀rS[i@[UWVS[æiu F0u ǀFFF tHNtA})xT9VnHM9VtnF t tc[^_]É4$N})y9u$'D$ -D$D$W'$+Vr4$t늉4$uS0D$ -D$D$<'$o fffUWVSZVhӉʋ} MM tau!ƒuމ[^_]Ãu1ރƒ0uEtԀ0tσC0[^_]R{} x|1utv҉)Ѓ0CUtʋE9ut OsECExtE1뙸)0KыEÿEX0C[^_]UWVS(Yfljօt:Fu1F[^_]Ét$<$VFF[^_]Í0D$ 0D$D$L'$~UWVS X{fUM9 ?p9s΃ttUUED$t$E$y{MU)UD$D$$E}E01 [^_]ÉUEDED$t$E${M uUEU JHJHJ H JHJHJHRPVU0U$W\0`UWVSLhW=eljT$ L$L$,11 rL$$D$(D$ D$D$L$uct_GЃ%uD$wPZw0-1ҍTPЃFHЃ v$uЉT$…L$t$$|$9|$  |$bD$D$tZFT$| |$t$L$8w%0/L$1L$ 9<΃t$  9D$uʋt$L$9t4$Z1e[^_]Ët$6뼋L$1L$ 9<qt$ 붋L$1L$ 9<IL$ 랋L$ t$ ~64|t$ t$ xL$1L$ 9<y|$ ]t$뽋L$1|$ ?<L$ y|$ 6t$ t$6t$ t$ t$ .t$6<t$ t$ L$D$D@$[QL$L$-~D$|$UUUED$;D$(i D$9D$sD$D$$L$D$ AD$L$D$|$UUUD$;D$(_D$9D$sD$D$$L$D$ AD$'L$D$K|$UUU D$;D$(D$9D$D$$L$D$ AD$L$D$|$UUUT D$;D$(BL$(T$$D$(OHЃ  1t$|PЃpЃ vt$L$<$|$UUUD$;D$(rL$(T$$D$~D$9D$sD$D$$L$D$ AD$L$~*K PЉ FPЃ vD$|$UUU D$;D$(D$9D$ D$$L$D$ AD$ED$fD$|$UUUD$;D$(rL$(T$$D$iD$9D$sD$D$$L$ D$ AD$D$ D$L$L$D$tL|$UUU{ D$;D$(D$9D$ D$$L$D$ AD$9|$UUU D$;D$(D$9D$D$$L$D$ AD$L$ |$UUU D$;D$(ID$9D$TD$$L$D$ AD$D$@࿀ D$|$UUU D$;D$(D$9D$eD$$L$D$ AD$,L$FD$D$i|$UUU D$;D$(L$(T$$D$@D$L|$UUUKD$;D$(qD$9D$sD$D$$L$ D$ AD$oD$D$f|$UUUP D$;D$(D$9D$sD$D$$L$ D$ AD$|$UUU! D$;D$(cD$9D$sD$D$$L$D$ AD$|$UUU D$;D$(D$9D$sD$D$$L$D$ AD$oD$|$UUU D$;D$(L$(T$$D$*|$UUU D$;D$(fL$(T$$D$]L뾉D$vL$|$UUU D$;D$(rL$(T$$D$tD$9D$sD$D$$L$D$ AD$oL$@D$D$D$D$0D$LL$(T$$D$L$(T$$D$oL$(T$$D$PL$(T$$D$1cL$(T$$D$+pL$(T$$D$QL$(T$$D$2UUU? ;|$(rL$(T$$9|$s|$D$$D$ t$1D$|$UUU D$;D$(rL$(T$$D$=D$9D$sD$D$$L$D$ AD$D$ |$UUUD$;D$(D$9D$sD$D$$L$ D$ AD$DD$ |$UUUD$;D$(HD$9D$sD$D$$L$D$ AD$D$ |$UUU{D$;D$(RL$(T$$D$8|L$(T$$D$]L$(T$$D$>9.t&14$>Of"L$(T$$D$}L$(T$$D$uD$  |$UUUD$;D$(rL$(T$$D$DD$9D$sD$D$$L$ D$ AD$D$a|$UUUD$;D$(D$9D$sD$D$$L$D$ AD$KD$|$UUUD$;D$(nD$9D$sD$D$$L$D$ AD$D$[|$UUU"D$;D$(rL$(T$$D$)u<$fnt$1PL$(T$$D$PW|$UUUD$;D$(`D$9D$sD$D$$L$D$ AD$6|$UUURD$;D$(L$(T$$D$rD$|$UUUD$;D$(rL$(T$$D$0D$9D$sD$D$$L$D$ AD$|$UUUD$;D$( L$(T$$D$(L$D$$9$%L L$D$$9$LL$D$$9$KL$D$$9$KD$@tb|$UUUD$;D$(rL$(T$$D${D$9D$sD$D$$L$D$ AD$vD$ |$UUUD$;D$(rL$(T$$D$ D$9D$sD$D$$L$D$ AD$L$(T$$D$^L$D$$9$JL$D$$9$JL$D$$9r$JeL$D$$9U$bJHVJЃ |$1tBЃD$D$JЃ v$q|$UUUD$;D$(rL$(T$$D$yD$9D$sD$D$$L$D$ AD$L$(T$$D$-L$(T$$D$xlL$(T$$D$ ML$(T$$D$.L$D$$9$+IL$D$$9$IL$D$$9$HL$D$$9$HL$D$$9$HUUUwF;t$(rL$(T$$w9t$st$D$$D$ t$L$D$$9?$LH2$|$1댋L$D$$9$HL$D$$9$HL$D$$9$GL$D$$9$GL$D$$9$G4$GL$D$$9r$GeL$D$$9U$bGHL$D$$98$EG+L$D$$9$(GL$D$$9$ GL$D$$9$FL$D$$9$FL$D$$9$FL$D$$9$F}L$D$$9m$zF`L$D$$9P$]FC|$UUUwTD$;D$(rL$(T$$D$D$9D$sD$D$$L$D$ AD$L$D$$9$EL$D$$9$EL$D$$9$EL$D$$9~$EqL$D$$9a$nETL$D$$9D$QE7L$D$$9'$4EUWVSPJ@#N$]$} |$Dut$L}|$P8D$4Nj$L1'D$L'$@0u ǀƄ$D$D$$DD$0$G wf DŽ$D$PD$$$$$DŽ$DŽ$|$L$D$lDŽ$$D$HD$,D$xDŽ$$D$<$D$8$8-$%t >u$)؅$*$$A$$$j$$~Ƅ$Ƅ$FDŽ$DŽ$DŽ$FZ $/ዴ$4$$:+@F f B$fx0\$L<$$DŽ$DŽ$D$$$$D$$8$g$ǁPǁTǁXy 1B<,<tft$F f$f$Ff$F$F,$FD$$L$$DŽ$DŽ$DŽ$D$PD$ D$LD$D$DD$$$$Z5$@$fH @1ۍFЍPwFЃ v$>$FZ$/$Ƅ$$$DŽ$1ҍ$$D$|D$`D$TD$XD$h$t$$؋$9}$D$\s'$$u$$)tB$\$8F$$S$f$$tJƄ$0$t$<3C$$V$O$ǀ'|$|)υ$$$;Kȉ$$W$$$$t$$)-t$\$ZDŽ$$$$8$2\$ltD$l$$V>$$@ @ft DŽ$t$(9t$$>\$4$L+=$e[^_]9.t&S$$K$$r$D$h$_)D$\$${$$j*[,ۼ$D$h$T$$T$$T$ |$\|$D$$$$CDžl6$)D$HD$lt$$<<$$p|D$lv6<$w$$$tƄ$-$D$X=$$߃Gm|$h-($t$X\$\ É$r$D$xt D$Xf)$y DŽ$D$l$D$|D$`D$TD$h$k$D$h$D*D$\$FD$h$D$\$a}/X$1D$hP$$=$$$_$$"a. ,ۼ$$D$$D$$D$$D$T$ <$$>"$$$~|$\$ C#-vL$$$$$1۾ $$$$$$st$\$ 5$+[R$$Ƅ$1ۋ$?D$`$$ D$`$|$\$D$`$D$|$$$$$st$\$ !+[R$$ $$$y$$.,$[$$$$$DŽ$$Ƅ$1҉$$Ƅ$ $t$D4$$8@$4$7@D$x$H@87$|Ѓ01 Z0 4Jу0 vꋔ$$9+$N-v$$$ މ$$Ƅ$+ލW7*a4FЉ1҃ /PwFЃ v뉔$$$$$W$ 0!) $H$p$$$_\$\w*1҉$$$ǁ$Ƅ$x% ǁ$1D$`Ƅ$$p$/$ $$B%$$t A+$D$|$PD$|$y DŽ$D$\$D$|$$$1D$`D$TD$XD$h $ $$$$D$|$+$)$@$D$|$$$$$t$D$$<$$')$9~$Ƅ$$1p$$$$$$$D$|D$lt$$3$($@$$$^*$$$$$$*‰D$l*$$$L 1 t$Dt$$LD$ $D$$D$$5/L$lD$|$$E$@⿀ $n$[$$$4$$$$$K$$L$ 1 $'$ I|$D|$ T$D$$4$$D3.$y DŽ$$$W$ $N$$$5$$$#$$1$$$$ʃT$\  &#ʍRR$$$$$ D$` $$1RƄ$D$x@|$h$h|$lt$H|$|$)t$X9~~@$$7_؉$$V$$y1ۋ|$X)߅|$X$|$x$ $\$0$$$3C$$Q$$$\$|$)$9~~@$$7_؉$$V$$y1ۋ$)߅$*$X$$ A$$vω$4$$$륋$$)߅$&$X$L$@$ ~UA$$vӉ$$$$$L$@$~$$$|$|)υ$$X~$L$|$ ~UA$$vӉ$A$$$$L$|$~$$$ $$;$S$N$*$^$$\$0$$$7Gp$$X $D$HA$$^ $\$H)ޅ$|$,y$$Y$S$t$($h$T$@L$ $T$( ~W1A$$vӋT$@$@$$$$L$ T$($2։Z؉$T$($I $$^L$@$$&$$$L$@gL$@$$s$$$L$@~$$:$$$$T!$h$$ ~U1A$$vӉڋ$&$$$$$3{$$$$I$$X$F$$W$$$ $tB$t$07G$$Q$$$$\$l|$H߉|$|$$$3C$$8$$$$$$ݔ$D$h$T$$T$$T$|$\|$ D$$$/ǁ$'DŽ$$|$X L$\9l)L$\D$\L$zL$|$$ $$$L$|,$$~$$B$$$$$$$֠T$ 1T$D$^L'$$'D$l8N$$`rx$$$$D$\$DŽ$D$|D$`D$TD$Xc$$|$||$\$$PT$xT$$T$ $T$\$$D$`e$)~Td.$$D$|9}$D$|$D$`D$TD$XD$h$9$u$$1۾ $$ $‹$ǁ|$X$DŽ$DŽ$$PD$xD$T$ D$XD$\$$$$K$)$D$|D$\$$X$ `~UA$$vӉ$($$$q$$?o$ $@$  $RD$`$ D$`DŽ$DŽ$ $ $ M$[D$`y \$`Ƅ$-$$$1۾ $b $ID$`,$? $[D$` Ƅ$$11DŽ$DŽ$$$G$$$s$$$$$p$\$h$X$t$`l$`t$h2B$$K$dt$xt$|$)9~΅~9$r$$K$Q\$x y1)E$\$TCL$`C$|$|$9h$\$$$ ~U:B$$vӉ$ $$$$2Z؉$$t$x$$$$ql$xl$T.$$`D$x$$ȃ$|$||$\$$1h$$$g$qD$|$$0$$$-$$\$x L$@$$~$$$$L$@$h$X$$A$$vω$Z$$$륅 |$hD$h$$D$ 1D$D$4L'$$0D$ 1D$D$3L'$D$\$$$D$@$ǁ|$X$$ :$Pu`$3$$$$ $u$)ȉ$D$|:$$|$|0 u䉴$|$|$` )$D$|$$$Ƅ$-$ $D$@$%D$X$$R$D$\$$$$$ DŽ$$P|$|D$xD$T|$($\$`t$d$$ T$|$$ʁы$)уș׉L$`T$d$$)ii̍D$hȿƉ׋D$hljD$p%D$tD$pT$tyD$pT$tT$pD$`1L$`\$d|$|W0G$$D$XD$T<9 $$9~D$|PD$@GD$TxtD$T\$`t$d$$DŽ$V$|$()ы$D$|;$RD$`$BDŽ$DŽ$$$DŽ$$$~$$$L$@$$3$$$L$@ $ [ݔ$$D$$D$$D$$D$ T$$$/Dž%$)D$H$yD$HD$\$uƄ$D$lt$$_<$$WD$l<$$R$$$Q$$[$$$J$$I$$ $@R$ z$ID$`$@h$ $ID$`$$ $R$$$ D$`$@$$$ $I$$$$\ $ $0$$$ƶP$$$$$葶$$$$@|$ 8  $ID$` $D$\D$h$+L$X$ $R׉$4)0ȉуcڋ$s0O9$T)ډщ$$ǃ> tft$$)ЉD$,D$\\$, $$y DŽ$D$l$D$\$D$|D$`D$TD$X(D$P( D$PD$PD$Pn$`8Π$Ƅ$1%t$x<1\$X$1<9)FuދD$\$03$@0)ً$D$|$^Ҡ$$$v$$$\$Xt$xȉL$T|$`$$D$l$D$|D$h$؃|$||$\$$1۾ UD$\$$3$$$̉)1ҋ$$$)iiщƉσ$0$O$$DŽ$$OD$|$P|$h'D$HD$\D$HD$\D$h$1\$P\$PUWVSL! }D$<$ED$ E D$-D$<$豺D$<$[^_]UWVSþ}D$<$蛕ED$ ED$E D$<$QD$<$蕕[^_]ffffUWVSVƉ׉M0itt[t@[^_]ËUuD>ttuf9uE[^_]À<>XuD>t6EtD>t&u9u9tt[^_]ÍD>UWVS}}ED$E D$EE$ԉ1E܋ܽ\$D$D$D$D$%-uMAU$T$ 7ƅXT$ DV 9‰T$ s )HFL$D$$>D$ NT$99sH\$T$9rڃ9uT$9Ѓ9uU@]} ;tL$E$UE tE C9rwN9ue[^_]ËD$%-uMEED$E D$$6Ɖe[^_]ËED$E D$$6Ɖe[^_]ËED$E D$%$~6Ɖe[^_]úT$U~ t^E|tEXrUWVS,î}m|$D$%U <$p 1m܋ܽ|$D$$%-BuM7U$T$=5ƅNT$DV9‰T$s )HFL$D$$D$VL$ 99sB\$L$9nك9uL$9ȃ9uUB]} ;tL$%ɋE$UE$tE$C9ruN9ue[^_]D$$%-@uMEED$E$D$$-4Ɖe[^_]ËED$E$D$$3Ɖe[^_]ËED$E$D$%$3Ɖe[^_]ú$L$U~t^E|tE\pUWVS`$E(|$PD$YUt$X|$0D$0D$H|$ D$$D$L<$6¿1፾ÿD$DED$ED$ED$E D$D$DD$ D$HD$|$ 2$.U:ue[^_]ø랸뗸1ffffffUWVSxt&=E= =D$TEU D$HT$Lu 1ҋE%=D$HT$XzD$T~D$TD$pD$ D$tD$D$X$ʁD$DD$pD$PD$\% ?D$X\$`t$`D$$t$`D$dD$`أP܋܃݃T$`L$`|$nD$n fD$ll$lT$hl$n؋|$P)׉T$h<T(\$X,D$(D$4D$hljD$@D$,} <$00D$`D$tD$ D$PEExD$0|$@t$0L$$ 3t$4$wD$8xD$0L$4ȅt~9 ))D$4)NjD$,tXT$0D$D$8$:yD$8"T$DT$$wD$XT$D$tD$XD$D$.wD$XD$h }~D$0t |$TD$,D$h   )ƒ& <)t$LE'E D$E D$$.D$`D$`e[^_]D$( D$4L$hD$h)D$4މt$,D$@D$h} }~1|$Tƃ}B }}}D$0UD$@‰T$ MDD$P$-D$`O}F|$T;|$PwHL$t |$@ T(D$@ƋE D$HD$`P|$P|$nD$n fD$l9 ؋ Ƀl$l\$hl$nL$h‰L$XL$Xv ɃL$hɉD$hH0Jڞzu؋D$D$rD$`9D$@}U E 0D$`e[^_]ËD$,D$D$D$vD$DD$`D$`e[^_]Ë|$P|$t2} x )D$`D$dl$`\$`t$`D$d-D$$D$TD$T1|$TD$TDD$T@)捊 ym1}} }t=ED$0T$hD$()ȉD$41D$0EED$ D$P_D$hzIl$h?ED$E D$%$*D$`D$`e[^_]úT$4ׅMt$(vT$PD$0t$`L$D%D$D$ $pD$XD$ $L$h+0FL$hQu y 9|$P‰L$D1ɉT$hD$Tt@L$TD$D$D$uD$D|$X|$$vL$T6|$`94 vP9t|$8L$8=D$`0D$E D$$)D$`|$PwuD$t(.D$0L$@T(ȃƉDD$XD$t"U(T$t Ƀ ɃuT$\$8D$8T$ D$PD$4D$,T|$8D$`D$4t$PD0D$(t$DD$XD$4$a'D$,0L$hT$8T$4$PsD$P|$D$X$s…@ fT$T$04$sD$DT$0$tkD$Dy}T$HL$T T$PN~}~L$TT$ht$D~HD$4$UqD$D1t$Xt$$^rT$hV9zT$,1t$4FD$hD$X$jD$h L$8tt$89tD$h4$njD$hƉ|$8D$8$XjF(MZD$PD$D$D$X$$kD$XD$D$D$qD$`p1D$@D$X$iD$8lD$hD$D$X$nD$X86+D$p[T$XBD$k¸ )6D$XD$D$D$pnl$@D$D$ D$D$KjD$DL$0D$ D$P8D$0~)T$4D$HD$`DD$8|$nD$n fD$lt$0l$lT$Hl$nd$HT$H0qٞىt$Ht$0T$Hكڞ.D$XT$\D$HT$LD$tx |$@t$4D$0D$8U(D$Xr D$D$D$8$ZnD$81fu T$hvx0t|$8L$8 t$8F$f…Fz tftD$$mDžYD$PD$4HL$PD$h9L$("D$D$ 4$ hƅ`D$8D$D$ 9D$8$gD$8,D$D$ <$gDž D$PD$4D$8L$؃T\$HD$HT$LD$-@D$D$8أXD$|؋t$`D$XD$8EЉD$@A$&fD$Px}ND$H D$P=N)ȉD$41D$(D$HiD$LZOD$,DD$@T(ƒD$X T$T$L$T$HL$L?U(\$81tD$8 \$8uT$D$8T$0t}D$`D$D$D$t$PD$tD$D$h$TW|D$lP1D$DD$d T$`D$t$OD$HT$`L$`A|$49g)lj|$t|$8D$`)DŽ$D$\D$D$t$SD$t}t$tFD$:QƋD$dD$\rD$0=P}ST$LD$4D$tD$8ЉD$8|$PE@9E  D$8D$LD$\D$0D$`u؋X\$TKD$tD$HEЉD$DT$lD$d)D$8D$LD$,‹|$4)T$\t$`$t$LD$tL$8Ήt$8D$4t$tt$D$H$RD$H#L$hL$$`PD$tL$h $MD$tD$h)t$4t$D$H$SD$H+L$l95vB<9tD$< |$PE@9E D$8D$LD$d|$HG$KKWx q tftD$$ SD$d~D$<؋t$lL$dD$D$h$RD$hL$tL$$SuL$dfD$hx,D$<D$DD$l1D$< ezfu D$tSD$dƒ80tND$<؃T\$TD$TT$XD$$-@D$(D$<أXD$$wi؋D$8XVH؄tJuU tu ؃[^_]11USHEHP$D[]UWVSD Eċ] CE}9G{}ELM܋uűUDE0EH1EЉE9uEEEEEgEU؉Ӊ1ۉMԉ]؋1ۉEE+M]+M]؃EEN9}s] }uAG9Es0uV+E)‰؍M9tGz q s7u/u(UE$]UBEUE다fuuJ z Mq ffUWVS< E8Ex0E }Uxx}؉EԋE@EA…uA…t v0uAE)Ɖ9ME܉pE)E؉p$] )ƋE 9m1E ]9XE pE9)9E @ E؉$]S ]3E"P0[^_]Ë](EbNF10[^_]ʋu< ǀ0^0tʋu<ɉMEJE?$]j E@@E}؉8E @}]?D"b?)։Ut$E؉$]DžUt(N}#bUt$E؉$]puU3]K 8 t 9u~2U)49t$W0T$D$ $Du1[^_]Í~ u u 9}t$O0L$D$ $u뺋}}z1HUWVS0qF}u D$(D$<$\$ D$ T$$D$T$D$,D$4$c\$D$T$D$T$ G+FD$(+D$,~%T$$ЉD$D$\$ D$ t$e[^_]T$)‰T$ D$\$D$ t$e[^_]UWVS}M 2A<w 9uYu߉[^_]1[^_]UWVShAEM]E TsCD9sϥ9r)؃L9s&)D$D$ $]g[^_]UVSEPXM 9} u#9r1[^]Í~M t09tݸ[^]UVS~wl0)ˉލ u썊a)ˉލ u썊A)ˉލ u[^]UWVSU} EZ]9BB[^_]ÍBEuLMuttb )E^M9uUM ЉFCU9rߋUM})}Lt% 9bE9rE})} E)B>[^_]ÉB$MUVS}UBJT19r & 9st9sEE$Ɖ[^]ffffUWVS |Æp7} w+ M4tetB-$F2E$xƋEFEFuFF [^_]úMUE )ȉE w|-$'F"t-$F|UWVS{mut"F w"p7u& 4[^_]É4$&[^_]€-$UEN? 4tU$E[^_]UMtuQtZ]ft11҄uuuut]1҉]ú ]UWVS]CEEƉE EE1ɉu}u܋EDEd}EUƉ׉1u}D9Mlj t"E9C~$E}|C؃[^_]É؃[^_]ËC$2tKSx s stftE$]u2uʉE$Efx s UE=w5=w=w=?v=]1x@u ]Ã]Ã]U$7t UP@]UWVSM CFM9r}ыU܋]9rB+M uUEPE$E$[^_]å9sܥ9rչUWVS}u F_)u)ODT9s290tۃ[^_]UWVS0u] C~)u:NDT9x9t] sމÿx1F$E؅3x F~}ЍUȍtu܍suStuquԉu}11Ẻ] E]EEK1ۋ@1))ڃ1EEʉHM9MrÉu}E̋] {}̉)ك9 }ω}uΉuu9]Mu}EA1)EU1USE9r׋EM܃})}ωuʋ}) t}؉GE؃0[^_]$UE؅t@@E؃0[^_]ù9u9ur }ω1UWVSEx|$Pt~^$2 )‹M  P9|$s`F )׉\$ Éً\$ D$ ?\$V9T$sZV ЉD$ D$ e[^_]à t(D$ ?\$1D$ D$ e[^_]1D$ ?\$D$ D$ e[^_]ù )D$ ?T$9|$r1ҍH ЉD$ D$ e[^_]ËVUWVS $ƅtc] %t D$ED$uDD$$&T$V ~tbM5)NjE8e[^_]ÍD$$T$tI ) |$T$~V~u-2MD$=)딋|$UEM Q tJu]UWVSio>}utD$E $wDžD$D$4$3ptt ʃ9t*xD$4$ t|E%=qt`fx ttpu ffx fp@£P$§P,P(P Ĕ[^_],1Ĕ[^_]ÍD$ 6D$D$E($&Q,1B,O1USmÿ{E UD$T$ D$E$[]UWVSmÄ{utFD$4$]nx$P8D$4$f[^_]É4$Aڍ0D$ ,6D$D$=($%UVS#mzut&nxP[^]É4$[^]Í0D$ 6D$D$I($%ffUWVSlÆzu($n$fUWVSkfyuf~ D$4$0F0ǀǀ F 1F t V$ЅxF F0tN@9t $oF0$oF0ǀǀD$4$FFF [^_]ÿF tF$gop4$D0D$ @6D$D$8($$#( fff̀rS[x@[UVSjwut8F0u ǀ4$uAnP[^]Í0D$ H6D$D$; )$k"뜸fffffUVSiWwut%V 1f t[^]É4$Y[^]Í0D$ P6D$D$;@)$!UWVSivu' 7FF <ufJ.t&fF FF uwFVT$D$F$V$FV fV 1[^_]ËF0tN@9t $-mF0FωVʉNɉ~ ωVʉNɉ~ωVʉ N ɉ~$ωV(ʉN,ɉ~0ω V4ʉ$N8ɉ(~<ω,0123FG4VF5NE6FD7UMFK8VJ9NI:FH;UM<\GLFJ\EZLDJFGFGXLGJLFJLEJLDJ^_^_XLGJLFJ LEJ LDJ ^_^_XLGJ LFJ LEJLDJ^_^_XLGJLFJLEJLDJ^_^_ D$ D$D$T$$s+e=<1ɋ8tBD$D$ N|$\$4$ y8t6D$D$ ~D$L$4$OW8t6D$D$ VL$\$4$ W8t6D$D$ V\$D$4$?O8t6D$D$ NT$D$4$_8t6D$D$ ^D$L$4$?W8t2D$D$ VL$\$4$uwW8t2D$D$ V\$D$4$u7O1$[^_]ËO8,UVS '`mEU uMtTp4u 1 [^]D$D$4$f-u"udž0UWVS_mƋ4D$D$4$ -EtE$dGu͋$ctMtf~ 18t$c9⋎t $#4$cuu&E[^_]U98}]EUWVS^^l]tCƉ$5c[^_]þUWVSI^lljUD$@$^:ƋUu 1[^_]ËOD$M$W^…1]~˃Mt|tatOt=t+tt9EGX<tE[^],[^]UWVSrTKb} D$$TƅǀM]:8bL$ ED$|$]$"mF8FF F FFFF4- ~D1 󫍾󫍕xT$E$]~^ $]F]Um]StV4EHt }Gu]Stt LV1v4s$≕@DDDHN F$D$ D$ IL$4$BF0F(LN,NV<~$Q9~s~]WEP IT$4$0}M1Q\$E$KT$ ML$|$}<$$ ÉX TUMQ D$t$$ËVnNNFVnNNFV n N N F V nNNFVnNNFVnNNFVnNNFVnNN F V!n"N#N$F$V%n&N'N(F(V)n*N+N,F,V-n.N/N0F0V1n2N3N4F4V5n6N7N8F8V9n:N;N<F<V=n>N?N@F@VAnBNCFDXhH *JHXXhHJjJHXX h H JjJH X X hHJjJ9Z1=x>alV]D$ <$ ;F@7NF(șdž‰Dž=N V DDTNꉖD$ T$D$8$]EP D$4$0}4dž$$$wI>pX5P܋x H NXePp[^_]ÿO$4$xQ 81Ë-f T$ ML$|$}<$ 8녋u 8"\ 8F8FF F FFFF4Ǹ- ~D1 󫍾 1$F~ j  811q [ 8ED$4$Bdž0$ 8! 81UWVS$JÒXuF(x~(V0!UN9F9MUD$N $JMUF($N 9} TDTDF F,9sF0 F,|$}|$4$$[^_]ÉUUE$&FEEtlE܋UT$ML$E$ME)UЉL$D$$M $WNEUVU(_US]ED$U $ #C,9C(}#C0[]fffUVS "IVEpFtD$D$$F u  [^]UWVSHÎVE0LHPH THxP@X~t=i`TIX=DHD$$$hHƅǀXHdž$$CljFXDt dž w^GGG G Gz1G9GE UtAtCgFt$Kt$ 4$K1 XxD$ ED$E D$E$XE EuM L dždž QXPtt!ЋPDPP9X1XA1T=+ff]fXD$ L$D$$ 4D$D$$Rfxuu fx!D$D$$E t @E@t Ey [^_]=21DžT1mDžPDžLjmDžXDžTcmPDžXZT t$ T$T$$5D$$/h]8OD$\T$X$TD$XT$$…\@@f@fBB PD$D$T $XD$XL$$ D$PT$$XxD$$( X%=3D$`D$$Iq` =b1щX`abcddefghhijkllmnoppqrsttuvw `b1uYduPh=w=u8t_u+X Љ lp;OX jmmFT!T$ p6T$D$))$TTUWVS$m@BNEpFtD$D$$FUED$E D$4$]iDžEtwD$D$ED$D$ D$|$4$0!@uFЃ$[^_]ÉED$D$$sUЃ$[^_]D$D$$NЃ$[^_]UWVSM?"MuE U VfFFVVfFFVV f F F V V fFFfFFfFF=*F t<[^_]ȉFȉFFȉFF ȉF FȉFFȉF[^_]ft~ɍDNE* EtEЉ‹ȉBȉBE9t'GʉHɉHHttX ˉX X ]X ˉX f9Vɍ\N"BɉHɉH@tH ɉH H ɉH 9uȃ[^_]Í:D$ |6D$D$b)$F xUWVS=JuE E F=F ƒ<NvVVNNvVVNN v V ȉF FfFFfF[^_]ËȉFȉFFȉFF ȉF FȉFFȉF[^_]fN~ɍDNE4 EtEЉ‹ȉBȉB'G9}ɉHɉHHttX ˉX X ]X ˉX fVɍ\NɉHɉH@tH ɉH H ɉH "B9uȋF w:D$ |6D$D$b)$F ƒv1UWVS(:íHEpFtD$D$$FE  D$D$$ݿEb1E}䋎M苖U؉U싖 PUb1@xH M؉HD$D$$$&u 1([^_]UWVS9ÈG}wFtD$D$$\FD$<$tr$WtcFt$>t$ >t$=E4$=<$=E$[^_]øUS 8þFE9ErD$E D$E$& []{UEtu]11ɍT9r]1]fUVS8ZFUE X61rVȉȉȉrȉVȉrȉVȉȃu[^]11ɍv1É11f1놉1_UWVS47vEu|E@Et M 9H 1MEEEEEEMP}GA у@0fuft utpfu{Uzu@G GGBPWxG8GBWO ME9Oft DAfEtD$D$ E܉D$L$4$mVEE@Ex#} EHU ꋀEUEMƒUuXM01ɅMuFBEFEEF0E4[^_]ED$$5E.E@ D$$5UBct MMU Q AUuth}OAMOMW:D$UT$D$ M L$D$E$h}E4[^_]Ë}GMOUW:D$ML$D$ U T$D$E$E ]M؉0fufE@E܃!‹EHM<E0E@}IE@wPD$ 6D$D$)$/|Ex QD$щT$ |$D$E$z E@E܉413'U܍PD$ 6D$D$)$UB$7USEP M TH}[]UWVSm2F@E}9UNFt%O L$D$$]F$6FA4$]6E9t-F uFtUt NuM u6E9u1[^_]D$L$ D$FD$<$]tUSUE @@ @HKYXBP[]ffffffUWVS 11?}ED$E @D$E$t7ƅt|$$t [^_]!84$8UWVSD0Ë>uE 8‹E1lt$D$ ]D$D$<$k=5DžDžDžDžD$D$$<$4ƃtI<$D$D$4$4tntD$4$tSD$D$$VE+uqD[^_]Í܆$NW8D$D$$4$_8Q?qUWVSl.<E EċEE8EEEpFtD$D$$聶F }&Et&}U+nl[^_]ËEċP}O9E!D$D$$茳DžFfN @EW)‰UEċ@UB 9EGf~FED$EĉD$4$ׇ]fdž~ f}EF(<EċP}O9E}9rY|$ED$4$ʉEEEEȉEE@EME؉EEċ@E9s]|$EĉD$4$q?EEEEȉEEċ@EME@Eă9EЉEJ}3D$FD$$бDžFfEEGdžD$|$$ẺD$EĉD$4$:UljEoEf}}?} EEEċPMQ GO)MJ9MsLED$T$UT$ML$ EĉD$|$4$<}  1=f9Ms(UɋU)ɉL$DWD$DW$tUfGG)fGUfDWMċAE@BEB AD$D$$U"UBD$D$MċUQ$F( <u4WGu"f}udžfdžD$|$$  aEED$ |$EĉD$4$A1D$|$$±n9FOFf;EAfF5D$|$$z&E!}GD$D$4$`RE=&҃9 FED$EĉD$4$y~ f}t f}f~ }fdžG=w|҃9UdžEfdMU:D$ 6D$D$b)$OMU>Uč:D$ 6D$D$b)$UOUM:D$ 6D$D$b)$UMjffffUWVS0'5EUE@( EpLB< _Gx ZU)ىL$D$$]҆f}Ufz|rrEXft)ۍLZ]f9sf]f9u]t^J_f+Eft" F]Ff9sf9ufjE@(E <t 10[^_]ËE9PuEP9UsރUfBҋ} 9OO;MG(  UEfEUED$D$D$D$ D$ED$E$]~U_HMUG D$E$]Ƀt_MUFMUD D$E$]蓃tUMUE]䍋:L$ 6L$D$b) $HUEc} 1ut8UUEfEED$E D$E$]wUB=wbF9EEu!BB=bƃ9EUEfEXEH(U]䍃:D$ 6D$D$b)$Mƃ9EUzUUEfEED$E D$E$]~U],2BLU1ɉL$D$E$]{ƅEfEED$E D$E$~UE@(EUUB(D$t$$]oUE}GEfGUUEfEEE D$D$D$D$ D$ED$E$]{UUD$D$E$]zƅE@U=UUEfEED$E D$E$]|Ut_UD$t$E$][UU]䍃:D$ 6D$D$b)$UfE@(ExEH(EH(U1҉T$t$E$]ԩU&]䍃:D$ 6D$D$b)$UUWVS !Ì/}u FuIFu 1 [^_]D$D$$tYVPD$D$$/D$D$$车t!VPD$D$$|{UWVS0!.ljU܃,E싗E9BD$BUD$$9ƅUBfEHMTFEDtU D$<$P~UF=w?uj>t$<$ut$<$ ;0[^_]ÉU썃:D$ 6D$D$b)$UE EF )‰T$L$Eȉ$*EfEfFEDFfENUBft?ЍDVEȉMU؉uuMf9sfUf9uMU؋uԍLQF=f+Eft2Auu}}Af9sf9uu}fnD$t$$ǦE܃8tRE܉D$<$t#fFfFF 묋E܉D$<${nD$D$$W1QD$t$$:1UM䍃:D$ 6D$D$b)$UMUWVS@+}EpFtD$D$$F rt@tf ȃ@[^_]F(tܨȃ@[^_]1EE䍃:E؍6EԉuED$E D$E$FƅEM}$f9t$E D$<$hwFD$ ED$E D$<$E@  V=vE܉UE؉D$ EԉD$D$b) $qE܋Uf9b~E@M=HfNfTf}܉u |$t$E$v,GD$ ED$t$E$7GHfuIfGE@=UEOfO`D$FD$$Dž@=FD$ |$D$4$rG=@MD$|$$MYD$ED$$Ϣ4=jU 1ɉȃ@[^_]ÉM썃:D$ 6D$D$b)$YMKD$|$$B띍:D$ 6D$D$b)$ D$ED$E$NuG}1f;}uD$|$$踡FEčMML$D$4$ CN9|fE:}Ѝ6}̉ωщ>9RAEȅ,D$L$M<$8F,EE9NjM@9ED$L$M$EE9ƋMTFD$FD$$VFEQvMԉE؋EЉD$ ẺD$D$b)$TMԋEA:D$ 6D$D$b)$D$ED$$hD$T$$D$FD$$耝Dž5:D$ 6D$D$b)$F8@xf}܋98}fxXDy|8f@D$L$$"D$|$$貜1jmЃ}uf}D$L$$ڞD$EȉD$$g!VF:D$ 6D$D$b)$y/}suuD$D$$H5D$L$<$ED$EĉD$4$h?[F,E׉J9OMUD$|$$賝U싲1M91D$T$U4$肝EM9΋U;EFD$FD$$…F7ft։EfM܋61ufqpuU+MfPmEDGDED$|$$蛜D$ED$$(Dž@=wU܍:D$ 6D$D$b)$+UBU`fU܉1D$|$U$1҉T$ED$U$菙DžUA։ffffff1̀ffff ̀rS[ä!@[UVSÇ!ut5D$D$ D$ED$4$Ot6E[^]ÍQD$ 6D$D$5)$럸fffffffUWVS UE pu8lE1ptEuAx=EGu4Ѐ:U)hx9׉drD$/$?t)1lU+Ĭ[^_]Ëdr 7d`%$>F 9dgƀ>Xt։`dD$ h)D$|$`$Jpd9r9>/utD$$d"B/|%=@dt~8u)с?hQD$ 6D$D$? *$hM+X\pD$E  D$\$8Xh9Ƌ` 7d)@u08p9hD$d$ޘuvEt)D$\$@JltD$\$@.89d`RfffffffUWVSiEu U9Urz9s 9roǃs"u5u7[^_]Í 9rQ9t׉ǃrިu!u)tftɤ[^_]xfQfUVS ̿4$CD$$D$F $? [^]UWVS Ã}$W$W#1$WD$$D$<$x?t$<$> [^_]US7 ̿$[]US,EEVEEED$D$ED$ ED$D$E$h~t}u E,[]ø,[]US a̿$[]UWVSxÉUʋ1y}IMB EBEBEBERUEEE@EE@EE@ EU܉EEE̋UUUUĉM؋EEȋMMЉ}MUE te kE2-byEnd 3Eexpau֋Uĉ|]11 É]1uM1EMEu1]1 M1ΉMˉ]1uԋM1]1 Ήu1U1ىu؋uU1M1 }11Ήu11 Ɖu1UډU1ЉUE]؍E11 4u11E1]؋Eԍ8M1щM1 :]1؉]1ωE̋E}NjU1]1 1Ӊ]1m}uuUċ|UexpaUnd 3SUԁ2-bySte kS CE}CE}CE}CEȉC E}C$E}C(E}C,E}C0E}C4E}C8E}CffffffUWVSV }lj։ʋM fFfFP@F uzYˉM V)fVfVD$\$$U]eZMUBfFF F D$t$$]蠂1[^_]Ã<Qʋ]C ^)fFfF] H@ L$J UL$ $]YUBeD$B D$$]tH D$D$$&KUWVS$ }E΋xfzfz:E~ F=/M9AfZfZۍ E@ EƋE@tT=$1EAfBB B D$T$E$]1$[^_]=ft1MM\A4f9rM=w(f21f]\F<f9r]UM]:D$ 88D$D$b)$VUZM뢉U]:D$ 88D$D$b)$UZUM]:D$ 88D$D$b)$۰UMUM]:D$ 88D$D$b)$蝰MUU]D$ ,8D$D$*$bUUWVSLY}܉E׉MM  fMꋀEE=EffEGEfE=f}EfE1fE1EEЉ}׉MEuTF2 Z]f;}]9fEA)fAfDYt$T$UȉM؉$]UUԋM؃fuEf;ErEEȃEȃ]f9]xf;}E@ Eƃ=w/.t&E]TCڋ2rEuTF2Ef;}E\E9s|E]9tqf;}MԉU؋]܍!D$ D8D$D$*$MԋUuEE\E9r}D=gU]܍!D$ D8D$D$*$衭UEfpE@(4f;UE Mf)EEEMf9GE1fuuZEH fEV)fV]fT^D$L$$]SfEEUf;U Mf9Mu fEfEG sEHA bE]TCE}D=EfpE@(9H@f;ErfAf;E1EMAGEHMIuMA}f9}u}fGEL[^_]fEEMf981뽋]܍!D$ D8D$D$|*$fJ]܍:D$ 88D$D$b)$4I]܍!D$ D8D$D$*$'M uNf+EfF[1fEi鏂銂f郂.&vsUWVSñ ƉUMED$4$gǍED$4$gÅtxEEGCCGfCfGfCfGUB EC G ED$E D$$M9U[^_]1[^_]UWVS( ƉUMED$4$gEljEfGE}fyUzyAB A u.E B=f9PEU܋ED$$EUMEABAfAEfAB A BtHUD$D$$uU.U}HD$D$$wUED$E D$E$MU܉-E䋆U܉׋usOuCu1u9ut2U܋E$XEU܉E]E([^_]äu9uuΉUftt֋uBfF] fu]E떉UM썃:D$ 88D$D$b)$詧UMEE$1EF z]fU1҉T$ED$$UvUWVStoH Eԋ}uE fEڋE M܃8MED$EډED$EE$U N …%}t Bf+EfBMfDJ MQVP]XP AD$D$$UЋ]MFD$D$uEF$LuE܉EЋE 8G,E9HEEEEԍ:]88EэAD$AMȉD$$]r…MAfEfEڋN g+8 FE EXJB)9&E:D$ED$E$MUȉqEUȋMU EF 4?jEP])ډfPEfTAʉ\$ED$$Uȋ]~KUȉBE܉EȋEEEE 8u*E $MȋU u[D$EЉD$$]sD$t$$ls9MZuEȉE9E܉EȋEED$EЉD$$]'sD$t$$suEȉED$EЉD$$]rD$t$$rG$pt[^_]ËV]XVT$T$$]&J'G{ EJB)9^Mf9s()D$DJD$DJUȉ$]IUfBUEF ]ډ]U܉UfMDYȉEE@=`fP11ҋ]ЉutC3f9ruMEЋA]CfEf+EfCMfDK Vgf11҉MLFf9rMAEEEOD$ED$$]quEȉED$EЉD$$]pD$t$$p1t[^_]Ã(]CfEf+EfCUfDSЍL U]ċP[]ȉڃP]ċD$Eă D$ $]GM܉MȋE@WD$@ D$$]mH D$D$$]oaMڋU܉UfUDJЋUZ}]ЋPUBfEf+EfBfDJVJP{FEċA EE]CZ]u f}YEXEU]E\XËE ]MEčH MML$M $EЉE M9ȋUs XEEXE(EU]PURPEEPvMDAȉE@EPUDB(EUED$ ED$D$b]ԍ) $轞EUjEX 4$MU '$m171MED$ ED$D$b]ԍ)$3MwMUEED$ ED$D$bEԍ)$MUECEMED$ ED$D$b]ԍ)$辝EËMjUEED$ ED$D$b]ԍ) $脝UE‰UЋ]ԍD$ P8D$D$q*$5UTUED$ ED$D$b]ԍ)$EċEUMEED$ ED$D$b]ԍ)$MEEED$ ED$D$b]ԍ)$苜EXLt&@t.&v0tfffffUWVS,V ]ƉUM܋ED$T$4$ NjE  &ЉUUD$L$$]jEGfEf}UB ](9tD$T$$]jUBD$D$$] h`XMfG|$ED$4$]<M9$GfEf}BEGIf9trWu܉V1,[^_]ÉE؉ME:\$ 8\$D$b)$菚E؋M7UE:98uDE܉ufp뛋PUD$D$$]RiUuQ,[^_]D$D$$]%iUE܉ufp8UE:98to$D$T$$ftfGUE]:L$ 8L$D$b) $薙UED$T$$]|hsUWVS<l }EpFtD$D$$=hF w8t<Jut(F(x \8Gv\Ѓ<[^_]F(6ǀ~F,}P/G DGDE䋆fHD$|$$_gD$ED$$dDžVPv:ED$ 8E܉D$D$b)E؉$G WEED$ M܉L$D$bU؉$裗WUԉEDGDE䋆}MԋED$ M܉L$D$bU؉$HMF,OG .GTU䋆f@D$|$$eUD$T$$ucDž@={:D$ 8D$D$b)${TEfEEM8FtM$YF FMF(~UfVF(D$D$ED$D$ E D$L$4$5!@EFЃ<[^_]ËE @ME$MU Q‹MEfEE#tQMVE$MƒMɋMtEVUfVD$D$$@dD$FD$$a9TfC V(VfxD$D$ $ctTD$|$$FaPXOfM2D$|$$bcwSfEEMfMMED$ED$$cU.V(ENfMfMM}fEfEMgωEOfMfMMMV(uNfMHU7Uf9U=ǀSxD$D$ $abD$|$$_PJfMWE5ED$ E܉D$D$bE؉$ܒE EfEV,UMWD$D$ $aD$GD$$=_WfU9uD$D$ $_aE܍:L$ 8L$D$b) $#EEUfUV,UcWD$D$ $`D$GD$$^Hwf9U9u*E܉U:L$ 8L$D$b) $cE܋U뫃fU@  G OfPDWTUD$|$$`D$UT$$]Dž@=vU䍃:D$ 8D$D$b)$蛐UMT9fQTP|D$D$$d_D$|$$\1҅^8@ tfUEfUME䍓:T$ 8T$D$b)$EsfUUVS  uFt$F FF(U VUfVF([^]ffUWVS4Æ }G,EЉ:E؍8ED$t$$[…?G@=fGEfEU܉GfEfft?fE<Ufy ED$E D$ $M50MUt(fuU܉B EftgU܉}B E苇20fHEDBtD$T$$A]B E1뭉UE؉D$ EԉD$D$b)$Uȃ4[^_]ËEMȃ4[^_]É  u8f}u RA=f9uu AM܅uEEfG MD$D$$ ZEtfEED$E D$<$.EMD$L$M܋$\EUGW E9uЋM?E؃9E܉MSD$t$$[EM9}GD$GD$M$2YƅM^GEFU=oM:D$ 8D$D$b)$(M:эwu  Ru fE^MD$T$$XEMr@= MfuED$E D$<$-EMD$L$M$}ZEUGW E9uЋMu7D$L$M܉$>ZE9uЋM EFD$FD$$WuFfEftfm10ufpEpxЉM荃:D$ 8D$D$b)$zMED$$kYMfEED$$LYfED$L$$&Yuf3EfE苇0ufpB‹Uutqt1D$L$$XD$t$$HV@U=UmM܍:D$ 8D$D$b)$EM܋U5D$L$$.Xω1mЃ}Dqt0f@D$L$$WD$t$$mU1u':D$ 8D$D$b)$膈M}Fpfu܋10ufp5ff̀rS[D @[ÌrS[$ @[Ḉ̀rS[ @[̀rS[ @[ḹ̀rS[ @[ 4UWVSEU Mwv9tt*<9t!Xr8t)[^_]1[^_]ÐUWSUtmg jBgBrn(8w68)|>)1ɃtfTȪLB@t@L>))t 19r\$4$)ߺ81tfff녪gf uhuW6ЃE1U U9rU6DfFf\7Ef렉ȪUWVSӉMp x$?tn@)։u|(9uzuރEEM41p x$ut2uˍP(T$$EEutM?Qt@lj\$<$G W$@9ue?Mt)ʍx(5tftM1H X$[^_]Ã}?$x(MQt@uƋSWSWS W SWSWSWSWS W S$W$S(W(S,W,S0W0S4W4S8W8S+B,hB0kAB4كB8y!~B<[zP1uUuFu-u%BHBLB@BD[_]êftэt&f볪UWVSb \uFPEVẺUЋFV EԉU؋FVEUFVTXF V$N(^,M]N0^4x|N8^<`d^PP8}܃L}쉽HEĉUH]ux|]ċuȉ]u]u]ĉuȋ]ԋu؉]u]̋uЉ]ԉu؉ẺUЋE HE @GEU$T$\ Ɖ׋PSE EċUȉEUMċ]ȉEU11ډEUMċ]ȉEU11ڋ]3{Mыx|!ω}M!Ήuu}]!ىMu!MM]3M3]`dEUű}Љ11ڋM̋]Љ11ډ`dEԋU3E3UM̋]Љ!Ɖp!։tEԋU؉ƋM]!Ήh!ډlpt3h3l`dTXu}M]PE}܋M]TXx|`d9LE܉UEPpp)|>Q1tft:7~Qo1uDuQ1s^tft\$4$;ߺp1uwuh"t䪃ުn.f0uGu8rуM1ɉUU9rUif둪ofUWVS ÉT$ʋp@xD)L$|P9L$t$KD$-D$/|$41s@{Ds@{DsCHSLTT$T$T$CPD$$T$D$,CPD$B|$D$؃D$T$ |$ָL$F&tftT$D$D$$is@{Ds@{D9T$rCHSLꀋD$9wT$ ovjBL$D$1T$L$L$$C@SDC@SD9ƉыL$rCHSL逋D$9uT$t<Ѝ{Pt$tft1C@SDC@SDsCHSLe[^_]frЋt$ru^zfD$u[u@L$D$tCP{QBffl$L$L$BKUMt U E]UWVSý } Et.1T$T$MTuۺ1u)u/tft[^_]êtfUWSU؞B]B|6B *)bBp0BZYB9YB/B 1 B$g&3gB(XhB,JB0dB4 . B8OB<HGzP1uQuBu-u%BHBLB@BD[_]êftf뷪UMt U E"]UWVSG } Et.1T$T$_MTuۺ1u)u/tft[^_]êtfUUʋE ]fffffffUVS菶d EDžDž<|<s,<z DE5N ==' ==D$D$D$D$ D$t$q$&D$D$D$ 0D$T$4$6&tp0[^]=t*=uy늸۸ [^]ÍHúSu,t돃DuD$b$o&s̸ XNDd :0&iDžDžDž D$D$D$ 0D$D$$$ D$D$ 04$T$lz1vpDžDžDžD$D$D$ 0D$D$$C$yPD$D$D$ 0D$T$4$#0[^]ødj낺FsGdD$D$D$D$ D$t$$"`&C0D$$0D$$h ~ m ^O@E3D$+*)(&%DžDžRDžDžm G6D$D$D$D$ D$t$ $ /D$D$D$D$ D$t$$O D$D$D$D$ D$t$$ D$D$D$D$ D$t$Ρ$BB DžDž DžD$D$D$ 0D$D$$t0 ><S,BD$D$D$D$ D$t$=$1D$D$D$D$ D$t$%$Qup3``fED$D$EЉD$ D$D$=$u}u tTE E E dt dUWVS ȶ 8<$Dsdt V6ug$Et+ͭ\t V6u<$rE [^_]裭Tt V6uD$<$rE [^_]US$I L t$[]EEED$D$ED$ L D$D$E$tL uD$ >D$D$A*$y`L mUWVS蘧m E U}0@DFƅtIFEM 9GJUD$F D$ $UBUtRFE VJE}9OT$T T$$GF]CE1[^_]ËM!@`B~ :MtEuVMQlj9~ MQT$L$ MQT$lj|$E$u;E]넍GD$|$ BD$F D$E$UME!@~ `UD$ $ltljGUL$$KtMVJ}OUWVS该Ä uURH fu xutlTP<L Du#MEED$E $[^_]ÍD$D$ ED$L$4$uE미뻸UWVSUE xru9rt% 9t 8t)؃[^_]ËE)[^_]UWVS]E xS9sHы0t/}U x9tT8Tt[^_]Ë}U9Ѓ[^_]ÉUWVS > E}E pE0EEE90EuNEU9sщL$MFD$E$]=D$t$$+M)Mt2MVD$T$$])ƅu [^_]1 [^_]ÉUt$E$]Et͋]E0U=UWVS(F E }}8}xEEE3UHD$D$E$*U)MMuE؉D$E$ƅM@@@ @E9s‰M܉T$UED$F$EUMXE)uD$t$E$*1([^_]ø([^_]UWVS$ }E pD$D$$u'tW@ u^JM"D$ED$$D't&M)΋PUD$<$9ur1[^_]ø[^_]D$D$$Q)fffffff̀rS[4 @[̀rS[ @[US # EU D$T$D$ED$ED$ ED$E D$E$ []fffffS[Þ @[.&f̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUE@U +B]UWVSխ tMƋuA~8t:F4@9s3`V8F4@9r$}F8[^_]ÉUWVS舟a E}}u8ENjE1txF8t1ɋ}E+wȁĘ[^_]ËF4E@E$]TF88]E F4F0E|U1E} OxD$`|D$}|$ F8D$L$$]BUF8)UV4V0] RD$ D$`T$ $~4V81}׍ @rPu B8~8BX]9uE~t$]葢F8]R9Ëtt][8 t5UF8M][8F8$)[8F8M$]F8tgD$`|T$|$ D$xD$E$ uUN8].[t?][{]UWVS<謜Á EE M8‹E1%;E = 9ƅDƅdHD$$BƅC8DžD > BD$4$$)D$ |$t$$5Ƅ=DiYD$D$$wCƉ׉4Yg 8X9;-D$BD$d$诹D$D$$菹 {tD$D$$Ot X"U+ <[^_]Á}@ Džh1Dždd <$ND$`D$D$ t$D$$ ~ 9WǸ։ RD$ D$`T$ $A9_Q((1ɋx9zz11ɋ)Y99vЋu@8RщT9PuQ(9P(\n$tD$D$$訵t`UR etD$dD$ $>tUt=6tftt\1Džp8H41`9t9F@FD$$Fu9;dt9FD$FD$$覴F D$ t$D$訳 tD$t$ $o9eu d3D$BD$d$ٳD$D$$@p8/tD$D$$蘲tPRBDž.D$BD$d4$ 89:y``9_$b}d$/C4$#9Q8 t릃O4H4W0P0W8׉P8|tP ILP`9uM$B|tD$DD$$tP?I‹uB8`9r勅9s$4`9u닅$莖'$gAgtOtD$D$ $误D$@$`.Nj@8@P1f^$M@FU$-@=D$?,tLtD$D$ $m+_t΋${?UWVS蠏u l<$YE D$ ED$ED$E$MU EƉ<$Y[^_]UWVS: lj(UuE]8,ϋM1Ƀ:uTtD8} Jtqu(M04Dž븋}|$\$D$ t$E D$$(P,U+F[^_]Åv }`ptu}`u܋(  $ ` 9tTt$_v߉ָ`tft`$`` 9uDž t 1U(1`; uR( Yt Z0$J@p9sˉ$btftr@ K0 97(J (Dž 0$ D$D$<4$(菪4$;HX 8t1؉ϋtft $`901$t $9Cuˉ0B$4BTG{r_lfdf91C$ Yu=a13Z0$ -1uufӋ(US ! EU BJ  D$T$$ []UVS ͉â utEىM)E}|$t$lj$UED$}|$4$UE<ML$|$E$UED$\$<$UED$\$E$UmED$|$E$UM܉]ZGu]E؋} 8MED$ED$ ED$E1uD$E$uMED$ED$ ED$1uD$E)ȉ$@ƋE]XQu]E)ًU)+U9xNuUT$ML$E$UUT$ED$E$UEEML$ED$4$Uut$ED$<$UuML$\$<$UML$\$}<$UU܉u 0sHuuʅ#ML$ED$E$U(EEED$|$E$UDu:}"M`1T$ >T$D$l1$E8E aE T$ >T$D$m1$8E 7U1 UT$iD$ ED$E D$E$]fUVS ~nj EU M9Mr/9r 4 9r$9fu49rL$T$$ [^]}fffffUWVS$~f lj֋ tRT$VT$$$ЋFE1҉EUL$D$ M$T$2;M1 ЋMu`EUD$ T$L$FD$$F;u<tVT$VT$$$Ѐf1$[^_]<UWVS}{ Ƌ; rEu =[t6CuudKStqPCS t[P ؃[^_]ËD$$}Åt@C؃[^_]Éډiu1V룃T UWVS|ð u xD$4$E%=D$($|Džts@@@9uE ED$D$ EЋUԉ$T$E9EČ[^_]`:1Č[^_]UEU U U$]UVS{Ʈ ]ts tWJ}u tFP@Lt1ADTP@SP PS@[^]Ë븉D -D$ D$%D$1$ U D$E D$E$]UWVSzÈ E HMxPpt)rP@t3B E$1[^_]ÃMt P@u͋MAUWVS,zzO }u ;VЃEljE@uyts;puXY LADTPPX Z O@H PWEuH@,[^_]ÉKE苏M1҉E܉UL$D$ $T$61 ЋME܋UD$ T$ED$AMD$$fB9‹Mt+AMT$D$$ MqEAAE@HEHEDAAGA AGtQMT$t$$$ЋMA,[^_]É\ LoD i61o61~BEH M}6O1WUE PMt ʈP1]UVSxՅ ut PtH J H $|u4$|1[^]UWVSwLJ uu #[tCtډu[^_]Ë$;[^_]fVSD$ L$t 8trtl@͉ .&vލ1΁ €t8u.t(8u!t8ut 8uHu1[^UVS vƝ U Et7Mt.ZYutD$D$ $E [^]UWVS iv> } uw vtօu 1 [^_]ËEEUUU܍EEED$E$ED$E$Ku#ED$E$E܃ [^_]ËE+E13TEfH @jUWVS(ug E܋})u UE XBE@ S]KE] :}Z]ru}_]ϋUfBfBKMʋE9s‰EЋutftE])XEUEUE @E)Ћ] Ct8E@ MY ]ϋUlu>}~}uC1([^_]É؁vD$|$$х~~)ËM IM)‹E PtEH,Pu>^E$]AE@ 9E\$ED$E@$EP,…EfH @HE1E‹]9sڋE@][}9Os9~‰ÉϋutftU]$]Uq)UU)UE @E)Ћ] CE[UJЃtUMEED$D$ }<$]e)EE9xsNMʋE9sBȋutftUE}8$])}UEHE9m1)yD$ED$E@$EP,…K)EMu9EPp)׋E 86p9rD$$]/s]+SSUSCslj;C ЉϋutftE)P)UKUE$]1ɋU-[;Q]؋usStft]E)C=EE\D1$. *Í0D$ >D$D$G1$(u ]܍D$ >D$D$H1$(yfvBvBfvEfXfvEf]^-i]K- VUWVSn| utvF tP~tI)>tI1Fu-)t'\$|$F$V,fN @[^_]ËFDu1[^_]ËF봋VU[^_]0D$ $>D$D$V1$ '[UWVS0n| utLD$4$F t$4$D$4$[^_]&, `-4$9-${<lj4$9[^_]ffffL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffVD$L$ t$}t :tw@Nuo͉ эvvR1ʃ€tv:HPu8v8ъPu )t&8ъPu t&8uHt:t@Nu1^ffffUWVSlvz u 7t`F t4VtGF uuQFF1[^_]FF؉Fu(VfF u4$.t&1뮋V0 t~@9t $pV0F FV륍0D$ 0>D$D$<2$|$DfffUWVSkcy u}E Fft[xT$$<xEE%1= ‰UtIM VL=u*9F(uČ[^_]E Č[^_]ËE 千0D$ >D$D$82$v#E 4D$ >D$D$82$A# D$ >D$D$82$#UWVS|4j x u8E1F t)fF FCFFE+O|[^_]ÍED$ED$4$0EF u 9vEE$ek 8K FUEFEuE f F vFft$t܋E f F Rߍ0D$ ?D$D$|82$!FfJD$ ƢD$D$@U$UU$ɐEFEU-DPtMED$D$D$D$ D$D$D$ $ MuEtM MEF %AEEqAEE[EAEE>DD$ ?D$D$82$ 2Ϣ$螏X脪UWVSg`u Ɖ׋@0$1F0PER59EED$$5F0Pt$T$8$2F0PuD$E$V5V0U4U쉂PF0ǀTu Xt$(1[^_]ǀX\D$$4F0NjF0TXtXUlfEt Mp7u]1҉]UWVSBft up78u [^_]ËF0$x0F0P3V09t'Pt($F0[^_]ÃT1݉U3UPV0ǂT1UVSers up7u[^]ËF0$/F0Tt$/[^]ǀP8$0F0U)es MU p7u]É]sUVSdr up7u[^]ËF0$8/F0U t XtTt/$/[^]D$\$2F0ǀP8$20F0UVS8_d4r 8E1EȉD$E$KU+u 8[^] fffffff̀rS[q @[UVSc÷q u tt$D$t,@E$[^]ÍXD$ ?D$D$9\2$UUWVS4}cRq D$(׉΋ED$M L$ UT$ML$9‰ȋL$ L$(GU0Et F"H!D$=!ED$ t$|$D$($v D$$!8!L$EuKD$(9t:D$$T$9ЉL$ 9D$D$=8tyEVnEW\$$D$9ÉL$ |}E9\$L$tD$$4[^_]i MUED$(D$$1D$$4[^_]ÍD$0E|$,E"D$D$$t$ D$$4[^_]ÅtsD$D$$t$먍-D$ ?D$D$K $HL$(= D$ ?D$D$M $E"UWVS-an EU uM] $\$M] -}}$}M] $\$M] e[^_]LUWVSEU ]\$ u}M] $\$](]M$M $\$M]u} L$ e[^_]UWVSn`Cn u} 9vtGFfuUT$|$$#xFP^T[^_]ff [^_]ÍPD$ P?D$D$C2$덍֢D$ P?D$D$A2$x9vVD$ P?D$D$B2$E'UWVSj_?m u} 9vV Ft5ft\D$ D$D$$!Ѓt<V FfV fuUT$|$$O![^_]ø 8V F뱍PD$ D?D$D$V2$R@֢D$ D?D$D$T2$#9vD$ D?D$D$U2$;UVS ^k u9vu`FftAȋED$ E UD$T$ $M!уN tFPVTfN [^]ù뻀fN [^]ÍD$ }1thª|$ D$t$E D$L$T$ 05D$D$4$5D$t$$ &AljUED$ D$E D$E$4UWVS8'GT Eu}8E1>'ªT$ t$D$E D$D$|$ 05D$D$$u(u~5E+8[^_]:|$D$ TD$D$4$D$t$$t,HH󥋅D$ 7D$D$$O:AǃĪ$m…1A<+wLIuىD9u˃u뷃z럃b뇃Jl蜇UED$ D$E D$E$R]UVSwN#T t$ED$EȉD$4$UxE<[^]EӸ<[^].UVSw@ D̍ED$EȉD$4$x E<[^]ø<[^]USDCQ :UT$$K[]CP -f̀ffff7̀rS[P @[>̀rS[äP @[USBÈP D$D$ ED$E D$E$[]USpBEP ED$ ED$E D$E$+[]ff.&&$D$4̀D$̀fffffffT̀rS[O @[PS[íO [USAÊO p7u P8[]&[]f̀rS[TO @[UScA8O $1[]UVSKUWVS,B }U ME8E1GED$ED$ L$T$l6$@L$T$ D$D$$踣=E D$D$ED$ ED$T$<$fU+,[^_]Åx$=wttH|.uT$L$ D$D$$UD$T$l6$(qD$<$y9IUWVS(] E E8‹EE@ I\<$&.&uT$$xE-D$ D$D$4$0 DA@tD$4$cuDJ@utSFNu tDJ@tEpt$|$<$V7$z$h1U+u ([^_]GUWVSLì }u E8E1D$<$]11Ҁ.փu9rMd9G GDGDDžDž\x.uED$D$ED$ED$ D$D$<$zU+L[^_]DžD$ D$D$<$dt9^G#GDGD}1DžED$D$ED$ED$ D$D$<$+GGDGD1DžDžDžDž.UT$T$UT$ML$ D$D$<$t~8=^G1҃‹Otth uAED$D$ED$ED$ D$D$<$RtD$<$9ED$D$ED$ED$ D$D$<$PG tD$<$낀xbV1@<t 1ut$t$ut$ ut$D$<$moGDGDDž0ED$D$ED$ED$ D$D$<$)Dž;D$<$eDžDžDžBfffUWVSlf u} U(Ft}}, ~wBBU(4$ fF@fU(fN  Jf fBUEt[l[^_]ËE$EE$ML$D$ ED$-D$6$ U($},~r EEML$D$ E,D$t$E$6jƉt$E$_EEFD$ $GU(fBMЉU(E,) }|$}|$ D$t$E$Ɖt$$ FD$E$FD$$FD$$ U(fB )Ѕ9}ET$ KT$D$6$ EHE H E, 9/B B U(D$E$U(BD$E$U(BD$$U(BD$E $E U(t5BEE ϋus3tftuu )fB fBl[^_]ÃuuBzE fUWVS / U }E@4E)Ѓ FD$$)FD$E=h$VfFE@ uN1T$$F D$$ G fffG )~ [^_]ø둨u+9u1 [^_]Í $赺U *U$蜺U뿸UWVS M uU E@}ω}EE‰EPE)96UB9E'9}}|$4$GD$u4$W׋u$sxuXuQ}׉+u9ED$4$N+E~[^_]äft.t&9}u1[^_]uvkU7$MUM 9}y6D$ KD$D$=6$jJ^MAyEpfhfffUWVS(Q& ljUM܋EGlE8u䍃KE_E썃wE< t< tD$ED$4$;D$ED$4$;D$ ED$4$;/D$D$4$;G$̷u< tt < u>:([^_]ÍF$~~d ʈdGtD$R$Q닍F$5~GjD$h$SD$ D$4$:tD$ D$4${:uEO F $~GGD$$蛔D$.D$4$:tjD$D$4$9uXO@E܉D$ED$$7$2OWL$T$7$yO >D$D$4$9t*D$ D$4$f9ugOD$D$4$09u O@D$i5D$4$9u OD$D$4$8uZUm D$4$ƒ?v?T$U؉t$E$~EUƄD$ŭD$4$d8uZE D$4$ƒ?v?T$U؉t$E($C~EUƄ(D$ έD$4$7 D$٭D$4$7u OWD$)D$4$75g)UVST{P $@Xt}9|xEEE%EEEEKD$D$D$ D$ED$t$=}tT[^]UVSç Et4D$E$#EEFEF8fF [^]Íp UWVSxuJ 8EEtbUD$E$2#Ef3EfF}<$7D$t$<$虨|$4$FUM+ ux[^_]Íp 5UWVSï }x$萷LJft/1t$_DŽ9Ӄ[^_]UWVS_4 u4$`t&tuOxu:<$džt$džf[^_]É$迶뼋|E69Eut$蜶U– Et]Í ]Ul Et(]Í]UWVSu] }4$sfdž1҅~1u{t뀃9uuV [^_]ËMt31sqsqs q M31sqsqs q 뀃9tuUWVSÑ uD8 E1D$4$YF u uD@@$D4$^4$fF@@1ƅfDž5B dLdǂ`ǂǂǂǂfǂD$$ WWPWPWP ǀip6.ǀarpaƀǀ(ip6.ǀ,intDžDdD$t$<$$w`D$D$4$xƇ_WHwDG` \Dž01'< t/t 201Ƀt&9n< [< uuDž(uD$$贏8Dž4DžHT,8D$ D$D$H$Pj<;t<#tH8domaH8searH8nameH8sortH8optigxionsZ< t< GbD+<< ~< ufxinM< t< L( t t Dw`D$D$4$uƇ_D$4$zctDž0ft DF 4DdLʃ Јd8$PD$D$ $苰x8$g,D$x$هDt6hlp Dx`0DpHH`HD@H@`t_<.ǃu~DD$. $sDFH.D$.$sDqPALD@ $t‹DgDH U+![^_]Áxservfxer< t< 9< t< tD$4$< X11rDž\DžTD$5D$ D$ D$<$HPD$ ,D$|$4$uPB=kDt/RωփtftPB@D<ЉT$L@$oLt׋$ˆL,D$ $L)&D$M7D$4$, D$.4$(oD$D`$8}DǀtǀxDž0Dž(H7$胥D@Dt$D~DD$4$Su덃$D< tt< uDž0<4,LTDD|$@$n<NFVe9xDw@ut;u㈕$<,t$$3<$t]TDLD 44 $4,LTDDDLD<ȅy_%=tdwL$,D$ $rL{;$1!$tDž0pvLusL@DDu|uc'j&D$D$:1ɉfLu LVfqUD$E$#]UWVSXó }u hl3 3 t;D$<$t  F FX[^_]Ë 9puttl|Eq'9EttIKD$D$ED$ D$D$t$OkBt  F F1X[^_]UWVSU E@ E~tE~mEX1&<1|1t_Bꀃ9E~E9Et=}ù{u֋ KJKJK J uv uꀃ9EE[^_]Ë OJOJO J uv uf̀rS[ @[UWVSdó TuD$$]@$DžDžDžDžDžx@ N L$T$ VT$D$$y\T$$r@ 9@ωփsUtfth@ lj)#Pd덋ptŋ t|$$ruf떋P04$o@9‹(tft‰)@0DžuY tftlj)@4#tF4$貍@9r1‹rf$r@ $Uś1d[^_]‹);Wh@ 1ffi$p00P@~~ <9V) 9kVʉ)ȉQ1ҋ?tftH<@ lj)99h΃r뀍ΑD$ KD$D$p7$}x@ $oo4$赊@9>‹ytft‰)‰DžHtftR<lj)944$׉@9`‹yUff^f# PD$+umuTk@ $f+ f넋$(m@ 6UVS{ @7t$`s[^]ÍuD$$y[^]UVSW, @7t$l[^]U$ U]UVS  ut$r[^]ÍuD$$2y[^]UVSÔ ut$ l[^]UWVSb u}t5W¸t[^_]ËF [^_]ÍD$ LD$D$|p7$UWVS }uENH NHuD$$,xƅu!yH L$UT$@$tEG D$GD$ GD$D$4$ u4$jG [^_]É4$j[^_]ËG [^_]ÍD$ KD$D$p7$֎UWVS  EC88 -:)lj}싓 u2E D$ $  [^_]Í t$E$ht$ $ht{ t1= ;txED$D$KhuًED$9D$ED$ D$7D$$ [^_]Í7D$ED$ D$7D$$ [^_]Í,D$ pLD$D$7$EED$JSUWVS X- ''w} )ƉT$U$~tn  UT$ $WtG  D 1 [^_]ÿ'y qUWVS(X LJ LJ LJ  11ҍ TEE5 )Ћ  ڍAw ,LD>ЉD>]T>ӉT>lTMHL>@CD> C kRLRE֋ xzt =w ;LEt =w ;L tH~k LJ yM !؉ MeM썇Hv$  MLJ  M싗 1ɍL]MEUtwM<9ErMtu艷 Ѓ([^_]LJ 5 LJ D>ED>ЉD>]]Ӊ\>lT RLS;D> rU7UsD>HL>PD>HL> HS7Ë ; eLOH P H HLJ S MULJ D>UMD>ЉD>]T>lT R]ف9LLOLJ 롋 LJ LJ D>ЉD>]T>lToMU-E8E䍇 $UMWD$1ۀ} ËE)؉D$ D$7D$$UMLJ D>ELJ D>ELJ D>ELJ D>EqMUD>@6UM^D>E싟 ]X] É %LJ LO f gUUxz Mt ; r tXLO H P H HS Ћ]!LJ j$$ffUWVS0 EЋ u䋸 }9EXuԍLWLUu썰 Vu؍Wu̍WEE]]Ef t1P}艗 P  5R}苗 D$ $ 돋 uЋ Eԋu؋  À8 u }胇9u}U - E苐 -X U苂 }]苃 D$ D$ D$ $RN  >E苀 P[^_]ø]苃 $$E+t…MtO1E-}-E7LEDXtE7<$]sƒ9r̉E8R1KU} MԈ }ԋ EU}ԉ+ E Ћ U }Uċ:O, OŰU苂 U9E2\9ËU)Ӊ]W(EUȉ XND]荃~D$$!_E艘 G,+UU]ȋU̍<Q9uUċ:,^MO uquF_ u؉G D$ $]Gt/U艂 Uċ:MO u#O)ȉƋ_uGE荀81uȉMȁ vE W18 M苹 MċKщˋMD9UUċ]苃 $SUuUȋ]苃 $cUE苸 } M< ЋAE̅+}苇 $  <EU‰ŰY9Q MỦ @D@Eȉ EăU2ŰEȋUЉEu艆 EȋU}̋UUu艾 fEЋ }ԋUM‰T$Uȉ$]MAYۋUBA ,Eǀ GEU<A,E苀 E]~C]苃 $Hb]}8B} $}苇 D$ EȉD$D$ UP$/] tU苚 <AEE苐 U }< Mč[^]ͺ 輺 諺 蚺s 艺b UuN U]U]6 U ]UE U ]0 U U ]UWVS u"$ uމ4$葾LJ LJLJ LJ LJ LJ LJ LJ LJ 1[^_]UST) E$臵[]US1 E D$E$荺[]US E$ý[]øUS޸ó D$ED$D$ D$9D$$[]UVS芸_ ut,D$4$8Sff D$4$LS[^]Í0D$ dYD$D$59$pfffUVS  EpFtD$D$$?F!u  [^] vUWVS詷~ uM.D$ ED$E D$E$5Te>EDžXF\Dž`DždFhDžlDžpF tED$XD$ D$D$F$nDžH V€ʀ UTPtD$ D$D$T$YыU !ȃP{vltat0<$T|T$zDt01[^_]À Vt t0<${  PxD$T$QP^E E DžTED$D$ D$D$$`lDžt HƁ ZLsAs0E/s0 m Gi G :G ` G G^ Gj GD$D$L$9PLPP LЃHtfD$PD$L$;H  D$ $PP D$돉Lq8PLen  P6D$T$CP@ ƒ@ ubc b"b fffUWVS! }EpFtD$D$$:F pY  D$4$u_  t$ur  T$U4$Džu=U9B0E pp[^_]1UD$D$4$Mt̀N(UV$ED$E D$ T$L$M4$ !@MukF[^_]ËX[^_]F(V$tߋ9F(F$PD$D$$ 9[^_]UWVS% EpFtD$D$$8FEE 9s  uy\$4$…u\D$\$4$ ED$D$ D$L$M4$C !@MuFЃ[^_]úЃ[^_]ÉED$D$$7UЃ[^_]ÉLnUWVS$Ľ }9EUEEEE;E MmG$Au݋M…tUL$D$<$AUUD$ ED$}|$4$8u7}UcE;E sQ $[^_]Ɉ뤸$[^_]ÉT$$Pt㉇1UWVS(诮Ä uE䋆EMM܉;E E苷EHMU$@ƃUtY9Euȋ})lj}苊U|$$耯U}낉֋E})lj}unE;E s\ ([^_]É׋Eu)ƉuD$ E܉D$ED$$6u@EE9E 1([^_]D$ ED$ED$4$6l([^_]UWVS(! EU9}] E苊;M 9EE܋E9t<)t29ut&M\$U\$$]>MUD$ E܉D$L$M$U]5M9M Ut%E9s.E9hw1([^_]Á ([^_]É\$<$eDžUt([^_]UWVS(貫 EE] ;M sf]]9suE19r 9t[:u)ÈU]D$ E܉D$L$ME$]4uEFM9M Uu]1([^_]É)맋E ([^_]ø([^_]UWVSҪ EU EpLB< D ?ZU )ىL$D$$] f}U fz|rrE Xft)ۍLZu0f9sfuf09uut^JLB)wmft" F]Ff9sf9ufjE1[^_]ÉMU GD$E$]uU M̉EU ]썋ͮL$ YL$D$9 $+bEU UEU ]썋ͮL$ YL$D$9 $aEU U E]썋:L$ YL$D$b: $aU EUWVSΨã D$T$$tb@D$T$U4$DžUu D$T$$H0[^_]D$T$$(0[^_]ÿUWVS 7 }EpFtD$D$$/Ftt88f [^_]ËE t9sF [^_]F(t‹tF$Pun$ 1 [^_]Ãtރ [^_]UWVSDf; }wFtD$D$$/F}   8CuD$4$D$ D$D$$NJ F$EEEЉE܋G!D$ MԉM̉L$M܉MȉL$<$Ѕt"ND$ ẺD$EȉD$<$Wu.E؉D$EԉD$$h;EtD[^_]ËMN$tD$ D$D$$}I!уtD$T$$7u 1D[^_]ÍUED$ MԉM̉L$M܉MȉL$<$Ѕ_EE$D$ ẺD$EȉD$<$W3EԉEE؉ED$EĉD$$g‹E؃9tD$<$+jD[^_]UWVSв u~GtD$D$$,GD$4$G uUEu@t*$8u*4$jtME[^_]Ë$0itE͋D$$E EUWVS uM Ut'}8BEtbQLPD!@tHx9D$BUD$ $U]C1[^_]Ë]CD$$辤M Udž9D$D$ ED$T$4$u>]uU|$ $KtUx?UWVS 蜢u EE,E}1EED$ED$$]'ƅ@ @=fU1 9M rTVÃf;EuUMUfY]][]]}tH}t8MNDF,D$t$$]u)E!D$DFD$ljU]荃:D$ YD$D$b:$ZU ]{_E}E9}twu})D$D$$](9utAFD$FD$$]<&tVTP‹}u뙋u]^}8 [^_]ËEpE )}fG w [^_]fffffffUWVS$a& uƉЉfMy} ~ϋX9U)ω\$D$M$]bEfC 1U~U 93;DD"=. fLD$ E D$ƉD$$]]ËE XKMǍDUfTTQf[MfTftEff9؃0[^_]Ã9u}ԋGDC$GDM_=ƋC 9Ex}؍Oȅy¸} E PS$u}+D@=D$1]܍:D$$VOR1ۉ؃0[^_]ËC #C$yP}ffw$C4=nE1҉S4UEE܍,\$ Y\$D$D:$*LE XUE_E+w@Euus DDoDuED$ D$} D$$txDOHDVtRE눃E}i}{ HHhD1%UWVS4vO E} wFf~ˉM Ef8LM fMMEHE@D9EmD$ |$EDFD$E$]@ZDžpft6f~wuftLÉEf>fEEԉEf}eMfyvDTQ9.ED$E$E@EMU EHfEEf;E}f]fD M)lj}]U)؉EE|$L$E$]@9E U5]f{vDTS9szED$E$E@EMUEEHfEEf;9]tED$E$1MUEUԋMf9MsFfED$E D$uF D$t$ ED$ED$E$]ruOEEtE@EEEt5@EEESpEE@ =ufufČ[^_]fEEEE]pD$ ZD$D$D:$ AMt !EEfEE:M]oD$ YD$D$SD:$@MgUWVS$躇Ï Ɖ׉MBEF =uMQ)ЉEW UfyMȉE苆t$.ED$$蹇Eu>E9G ED$E@GD$E$gE$[^_]dž(Efuhdž $D$ |$UDBD$4$O…t EME$EPEwD$ |$UDBD$4$N tʋ@f8 $dž mDUWVS, uE xEFEEEE@ETGփ>VMM ‹u9sfU܋u9M ELf+M܉ΉT$U؋ED$$UU)UEftfDuf)tGfLGM yITGփVuJҋu9sM DG)fET$U܋UT$7$1U)UUPMf WfЍL)΁M wdftGuftGfWL$E$E*DEfEfDU܍ͮD$ @ZD$D$y:$<M UaM ͮD$ @ZD$D$:$<M VuM DGƃ=Fu!ͮu䍳@ZuDG)fET$UUT$7$U)UUPMf WfЍL)΁ftGMfLGWMfE HDGƃ=FUt[u9s‰9E8Eu;p)E9pEfDN,[^_]1,[^_]fE D$E$E tˋxLUED$ E܉D$D$:$:UED$ E܉D$D$:$:ͮD$ @ZD$D$:$:D$ @ZD$D$e:$Y:E@EͮD$ @ZD$D$k:$!:D$ @ZD$D$b:$9FE)UWVS  EE @u E1Oft{DPND$ t$D$E$]Iƅt|$E$FfUH]uYfwfuf|Pu E]M IM1M AKEfE@ =\)ځɋ]fTKMfDQE Ht$E$]t9t|$E$Eh81[^_]DPfAfAF^[^_]ÍD)wMfTAhU]썃ͮD$ 0ZD$D$:$8E@ ] UfTK=UWVS# U EzMq uf+4GMM9U t$ED$DM$u)uD$ U T$MDD$E$F…t|xEp uf+w;udLf|Go‹E9u-t$ED$WU$bUu Ѓ[^_]úЃ[^_]úЃ[^_]úUWVS}‹ Eu} 'D$ D$DJD$4$] FtDPfzuft,ˍ< fD$ t$MDD$<$D aLJ(@f8u$LJ 1;D$ t$DHD$<$pD…@ fEB@fE1fEE$#MAE9F ED$EFD$$M1U)fUN fMD$ t$MDD$<$C…ZM_LJ $LJ(14r9UWVS({ E։Mz@ =uW)ЉEN MMȉEGfEt$ED$${UE D$ED$ D$t$$E9F ED$GFD$}E$E([^_]D$ t$DGD$E$\B…t#M L$M $MEEvE8UVSu]ED$E$1ɋU Ct1[^]øUWVS(wyL uD$E$1ɉE/D$ED$E$/EED$E$M fA fJE @EEE@E;EEHppfEHuj/VZYtp%t0MPVZYMu}] EEAe[^_]Vh "hU "h-+UWVS]u 6_h$"VSj tfu p7-ۋ=-)u =-u h$"ŕZt- -$"hj5-1- @u5-h$"j3hXu4'h$"jMUW6ZYMtUBk %u6h$"j~VKSW%P UWVS] 3h5!#juh5!#Sui@t h("-DP4-Zu-ew$1--%5-%jjP0- y 5---J=0 -v-u h("j}d-u#h-d-("t-%t-%-%H%hPR/h- yTt-P-%H%hP5d-ңh- `- y5d-hW$j<}@-'@-\-u-X-u-H-uj@-D--9ӡ--s-táX-p@-t--@-D-- -tp- l-t-%h=`u; p- X-\-l-X-%l-RP5h-t-P -t h("jh -Ph۫j%hj%1=-=-=--hX0 -P0 -V5--- t -- --9щss -- u15-5-5--P$ u15-5-Z- rPPhW$G4Y[-u5j5-5-5--P  t5-hW$XZ-------K-]-]-] --9Uu/9Eu*--ڣ----6esEUӣ-- -----t1--H-L-jS1=-=-XsE--EUMt- -EU-uRR ----=u"=uE=ۣuU-t=H- X-9ȋL-\-s")1=D-X-\-H-L-L- H-t jY[Z-5- tH X-1=@-X-\-H-L- @- D-)։-5- ut-=h-ujPY@u$8th("5h-t-PZ@u h#j,xjhUWVSX ] 3Jh5!#jAo h,"Suc G-$%-1 ----1 --@-z- -1=-Y-J15 --3-$-1ɉ -------=-th?,"= p7tu hd,"j\v1nuou-j,P[YZFt@jVe-^Zu ht,"W8pj,W'ZYt x>1>A!Ph,"h-Ij5--=-t t9h,"Buu/ -t'h-"&=-thG-"--jWNT-ZYu hn-"y;O-=-t11X=-uمtՋ=-jWSY[^t' 9=-tЃ=-t ]tljti ȉ=-\t 1Z01C P4jZP0P蹓t 1B"-~h u)Vb_Zu h-"js15-DRP藒ZYy@ƅu(3%=`uƅu3i- PVPY_=-i =-t9PVYZt=-Vh-" }=-t%" r=-ugh$3h-" Qu =-u7h$V3h-" G=-=-u3hW$xXZ=-t4011Dž8hh)%P -5-8i- 192t;t SY PZ9}D1PL@DXTHL`\PThdX\lp`dtxhl|ptx| t =-u1&--=-t50h";-si GC1e[^_]USEEE EE0][1҃vU|r҉-UEh1"RP:[ tvpt.Et?SuF-Ƀstxu0-볡 p7X---Ph%h- jE-EE)ЉEEt9E8-u/-EH~-)EEEHEj!1ۉ$ZuYhxjXZjjY[hjXZh-Yt1h-h1" dXZh1"$IYh?j[Xo -Et^E8tTE04YtEEj0YZyjdZ,E8!tYEh0h-{ @Et9h-h1"^cYXE8tjZuh1"]HXx*X-tPhW$Y[h8-XAy"=-th@-hb#h- uY=-=-h-h1"bZYh1"G1ۉ$gZ&f%-1-냋-| thr/"GXf%-^1-$x(B5xd-PRR! tt 1j1ɉ -h-h1"a[Xh1"G1$d=-ujpjZuh@-5\-h2"h-h@-hb#h- h-h1"aY[jAZn=-ujh@-5\-h2"h-nUWVSXu} 7>hˢ"FYZu2" fu p7h2"WVV utt -)NvhWE8}W ZE1 % tAB9EsEUPQMWҜ UuMt6QWh2"j)kփ빅u Wh2"AE@t1j URPtE ;F|E8tEph2"jjE1~PS.YXF=mw2=m=m@w=m@m=m8@=mF dUuFfEERhmW$ UWEffEERhm+fEEERhmW 1!EPhm8@W x E%6Sho"jif9tfuPh2"EPsh3"KU1"UK U83"U tUuuuuuh<3"E$uuuuuh\3")uhz3" uh3" XZQURPW x%uSh3" ,URPW yShW$jiPh3"jj2UWVShu E1E1ۃ}~F8-tEh4"_th4"PbZYu -h4"~_th4"P8ZYu h4"kXjh4"h4"覙wEPi<uh5"d0E_t<1ɉMMMMMMJh 5"w p7PuZYh+5"jgEhQ5"WE)PRE @}w}c}6to)}4E뷋Ed$%}8tEKwn뎡 p7Eh'5"5 p7WEXZj p7E]EQEE--}uC-EuS-4>tj@uY[t8P}t Uxu)NjMMU9rxtEE xt}t1ۋtPZ\tS QXIEt'U)RPS sSWÃ~t C}u"h'5"hG$EZYu ha5""}uEEuh-WuuEpEP\uX yj=-y h|5"}tLjuVjhS y h5"kXjVjh5-y h5"kXh'5"vjuVjpS账jVjw5-衦,uu1ɉM̉MЉMԉM_1%H>v  DGu΍EPEPj =-t}t.D1}tE܈jEP4%/ GuݩEy ht"jodVh~f5-Vh~fSSMUEQ}u j uXZjjUE 0UjQmUVSEU 3J -uc1E1ۋ4%Vh.G#uUS@-H@-Y^yh8-j XZ8-P8- Cu 1e[^]ÍL$qUWVSQxq1$.$.$.$.$.$.$.$.$.$.DžDžDž1|h ]"V N @I&/0$ %S'$%1!-!-!-s!-d$.jP5 p7 :uy5 p7hw\"!-$. $.$.$.$.$.$.14D%4@%h\"HC u$.w$.l$. p7j/SAY_Džu ;C3@;tGtG@:t%t%@tj/[ZÅt8@tYt@t3t@tij/IZYDžt+{tQt^@tUt/{t2@t)tG|h\"O$.Ph$.h$.h$.h\"5 p7+u p7<t h\"jJ_=$.u$.fPh%.Ph%.h\"5 p7ĕ~! p7<u%.%.9sh\"뉅 %. p7j/SY_t6PS}_Zu# p7%=@u !- p7.$.!-!- p7$.}5 p7'!-[=~ PZPh]"j^-)ѡ$.=$.t $. $. $. $.tW=$.t t$h@]"4t=$.t=$.uhr]"=$.t=!-uh]"'.wދN1ۉ d).h).F 1ڣl).p).&.5x).11ht).@Ph`). f Nt). `).Éd).h).@u"hZ"X|).1ɉ t).[Ѓ<tπtʊt ȃ<uuutW119l).p).7t).t19ƃƉDžDžf=&.&.&.t P1#DžDžPŃw 1҃.1҉'.t. Ҁ&.t"Hu'.1҉sBu t).`).19}Et3t*pu!1ӉBDžDž$.=$.t u$!-9t).Ph^"$. $.tO$.5!-=$.|1RP1RP h^"Zt=..;8u h_"EX.Ƌ@V=!-RPSQPvvv Wh!_"G [j X%.1jhjjjщ¸c_")%.%.1jhjjjщ¸}_"%.(%.1jj?jjjщ¸_"%.yh_"YqO=!-Ijjjjj1ɉ=!-$tj !-_h(.ƀ(.$-#h(.ZY(.t(.1tFh(.h_"&[^h_"h_"h-jdh(.6hR"ۋuw1ۉ$. $.u !-=$.=$.!-uÃ=$.uMh#`"YtpjhO`"gXZؙjjjjjщڸ{`"h_"ptt Sh`"%^_1&.@u &.$. $. $.1-=$..Džt~ Džh`"&.Y=tk jhjjjщ¸`"ƒti¶ f&.jt).DP-f=&.?&.(%t+%u ù19rGD8&.G&.@%.11ۀt,&.t#u;u u@ $ut&.u돋5t).`).19}{.tK;tFȉ`C219u9t&.A뢡$. $. $. $.=$.uYhia"^=$.tl$.  $.t ha"[h b"YtM`$.$.2`$.~ hEb"Z$.t~ hdb"hXj񋅀Ɖ1ƃu h^"ϡ|'.11;|'.ÍPP0ZYx+=w;)uv%.=%.5%.jStPLU 1eY[^_]aUWVS}] 1ɉ1Dž1hr"SWS3 rfq1stwz1҉j P5 p7J p7 8t :tPh|r"&78"[N5 p7hr"jFGDž-Dž-)OtjhP6P2Ãy2 h).hedAP y hr"= *.9 @f *.1ɋ~Xu uXhr"jh).h8-  tȸor"u5!#Phr" ZYDžf*.h).f*.h).-k~PSyhs"Yu Dž2"hЦ"u>Zu`."h@.W:-P^t.R$r[u jj'XG1ɉHwvtj9uPhǜ"XrWd$Zp- HWPF_Xu-FFDžBUt Y@Cu担)s @.h"WV P5v肙$ %@.j P5 p70@. :t5 p7h"h"Y5 p7Yf.Zu5 p7h#"@.Q@.B p721ۉ!-%@.tRPh@"ji%@.1ɉ !-@.hZ"5 p7`@.[Z5 p7hi"j=%j P5 p7.!- :t5 p7hw"j$th"A@.^@.O@.@-@.u h̝"j$=@.u"# ,;..| )5. .9Ȼ&} VG9ƉS}M)Mt1jjs sM9ȃM} &uXS{&t,;C|j(s^C t"=.u!!>"=.t"=p.t"h`.5`.Sh"jhjDh"=.th"j'=.t3hhh"ƃ xjh"PbVSh"jQh..h&"2j)h.j hH" [=.u=."" ""EE=d.t Eh"E=l.t k"=h.t n"=x.t w"=|.t #=p.t #Z6$ T.PtPH1ɉ h{"jEPS^ 0Shq"j0Sh"$ jjXZj,&UWVS@u} E@h"WV7 tTHth wT$&ЁȀπÀ5 p7~+-X뫡 p7|+-1ɉM똋-)Htl&4jVhق"H tVhق"h %j h..jVXZy VhW$jL ]1uȉuԉufE5+-]SSjWDyh"^jhyt W迨 y8th"95|+-hCt W薨 yh"}tjj#Y[t h"j1҉UUUUčEPXUWVS8]u 1E6谬XhC"VS x`At$Mԉ.ăa$&.܉.؉.+-2 #덡 p7.!Љ.v̉.kȉ.`ĉ.U.J-)Ӄ=.t=ȉ.t&. ܉.t&=̉.utu@=.u7܉.+=ԉ.u =؉.t#u=.u܉. +-8-U1..hXUu hQ"j=܉.tEPWjj11ҍE?1.tjh*"P胤[Xu5.hW$j1ɉ .jjh.jVÃt;tMLSZV+X"4~FMLK1=.e[^_]UWVSE p$.EX1=.h"PZYu .'h "P衲ZYu .j轝@..MhFo KKm5$.h "PBu h.:`"=h.tU #P_tPDX~5+u!zt~Kh%WZYt WCuCt Cnh"o._t8u%h"V.PZYt .#h"1.PnY_t ."1=.tjh"_Z~Pvj?K =@.u&jPYujj=h.t@. .ujh"VXZ臋jBbj!^_=.uhy#5S-蜰Y[uZL~jh"Uj~]5.艈֊Ztjb]ˆ,.0.Bu@t.4.6&u΃=8.t$H~ 18.=.u .=.~jh'"ySTj O jROk詨j\UWVS]u 62 ,.5C(.{ 4.~0.h'#P| u.VSH[^~胱jY1uhf(#j9~!vu0P.h(#VS u%/~k |Љ=.vhz(#5XZš-)Kutm-DPu^S(_=vhh(#hSh. ;tC0..5.h(#j ]S)hj}hjqhjehjY Sש^u h&#j>@uh&#jh8-h(#% u W-$.h"ִ[= .t"5\W-2Yt5\W-h(#j胋t Ph(#j= .u5\W-Zu€=.t8jj5D. y h(#*Pj5D.d xh.j.. .% .%.%.f .. f..hX.Y"hP.O"hH.E"hӣjҷY(#=.tM(#PhW$蜙1S8.^_C6f=\X-t j賏[E8W-ut踲Eڃ=.u*t{8,X-u1f=X-X-< t< uG< t< uMjEP5D. f=Y-{5!#} u"Pպ_8W-u@EE5W-P譯ZYf=X-tCۡ-t -fEjEP5D.h f=Y-uEPmXhe#jw UWVS E 0蜢.W1..h+-#"Y[t *-#F3-#hI-#V"ZtTMBug p78tpjRP_ :uS1ҋ .buV.. .ht.#u uà uC$I&5 p7ha-#..먃 .륃 .뜃 .듺{-# p7W낃 .v p7u#h~-#hJ&h0W .h-#S^_À;1h-#SZYƿJ&t&VRS@* u <2t&h-%SM^_SPh-#肏 . G.O3u8=eRh-# 8=tRh-#BY[\3h-%S^ZƋtt ug(SYSvBeR0G.f"$,M&H $pM&a.t..G.1..a.1. h.?.1.1."..1|.|.1=.x.t.p.l.-)Ӄ.=p.t*thB#. . .tbh C#jt3=.||=.t=||)=.||| Dž|40.jd.PCx<hSh]-+=v ShMC#<h]-\Y]-]-X/tK]-]-1hjXZ=.t.Ph]-S,x/uP]-@]-= ]-wPh]-Y_@u\8Uxt)o%=@xtbK=p.u=.t. .t P62P6_Z@u6hW$j8%=@t /t 1ɉt4h]-h_C#j. p.tDžt Džtt$PZPvЀ8/uj|Vx 1lpupCpQh]-^Zh]-CHfuFs Psho"7zpDžlpx-Xu$wfushuC#yY[ftf tt)]-C,-]-=~TSh]-hC#y o{DsC(huTttCpj/V66YZpt)xph">PYZphp>h)8/t z/t/Bс]-vPh]-hC#x VPRpp]- ]-= ]-vx/uP]-@ߋp=.xt Ph]- Ph]-\^ZSP@xJ9|uD;u@EJ9Mu5;B u0sh]-hC#j/W[2YZtxha%WG_Zu^h5!#VS @ui-)Ãu]p0fZY@u jjKje;LtEPtIFu'/h"G#VSD w~fw$M&1///1////1//t/e/V-4)Ã=/t/-=/t,/=1=/=/u/1ɉ /ttu#H%V1ɋP|=/xt)SW=YZuE%=u dSW XZt WhW$jE%=@9t ÃSpoUWVSu 6萄h5!#jj_ЉÁp1th%VuC tVmtDžtptc5 p7蘇Xu5 p7hB#jhWpW 딡-7hW$qߋ^Xt!DžtpS ZY_yɾߋuڋtVnUWVS}] 3h5!#j hI#SW tUit)ft5huP/σvu?/1//15//뗡-)ǃ4ju/hO# j =/tuϋVPFTtP2l pY[uNj|%=@luh2lQtà =lv2hI#jVltx/tlƄ/CGh>WkZD>8/u 9tH@j/W+ZYtPRd5Y dvWhI#nXZ"@PRl7 t DžphfpkUWVS@] 30-SuN]Sj6uEUEUSj"^_Sjh6ZYuEUEUSj^_SjD6ZYuEUEUSj_XSj 6Y^uEUEUSjXZhCi#:001=0=0=00P]1E؍}ȹE uVSj=xVSj- x"}ujVj y}tVSj xjVj y}tVSj˓ xjVj踓 y{}tVSj蠓 xjVj荓 yP}tEVSj n y1jVj[ yVSjI x螖y y0hKi#0j ^=e-tUjhH%贙e-[^y hki#0jǖ0 #=e-u=xe-t @hЦ"aYt8u`."VZÅt @|/tCP0_uhi#jR0ZYtlj؍P0/h/h: jie- t! ttBGuB@9=/t hi#jP =e-ue- t 00e[^_]UWVS]u 63|h5!#j* 1hT$VS tLtPt9-tЕhMv#_8/u|hs#P#TY^ukhh#ST_ZuZPS?Y^@tHxPhH%)_Z@t2|9u;xuM9 u;Etjj(@Y^uj SÒh8-eXZD-@t h("jjgUWVS}] 3zh5!#j 1hJt#SW ft]/WPtwR)d0벃vtbit6rtxu{0010p100Z0K0<0--9=0zu8QuthTt#hXt0؋Ht ʉA?jl0[0 0u t1=0t =0t@jPWݼǃ uhtt#C =0t.u)WxXCHHf $T&PDs Psho"j=0tC ?ƒuts Psho"f0k=0^KPSCHjSWC 1ɉK +C  Cu>S=0tCHSftYwifu`KPC豑usZ=0u&shW$p0Y[R蟍8XC=0useZuH1蚒tm=0ta8VS8?HE8r50 0$10sBX 8t hB#j]W[hxVSZYu8=0tCjPSho""e0_u=0EE%=@uB=0uSht#d0Y[묃=0t'E%=u,S萓B=0u=tىډuh=@uS-=0u SܹZtXt1=0uShW$^Ƌ8 踋8?誋8u=0S踌X50!a1e[^_]UVS@jj虈^X1EĉEȉEEjEPjϏ 7@L¸9u 9E0j j-Y[ȫ0H ȫ0jī0$5!#jpZYh#sVg-1ۉ]$h0i^Z0tt3Hu:0.[001<0E 000t.U=f-v=0i`Y=0tEPEX100tA:g-HyP蜩Xg-H J hg-2XװEHm00v001EPCXu uVXZu u Y[}um=g-t,Eh#@^E=0u PEuE=f-u}rEjs?^=f-'7=0u#h"w[u\Y&jh#PjEÃPL@$BY|=Vg-uL=0uCEPB$#Zu EPyCX8tEP肉$?XE$01ۀ=ng-t$=<0uEPBX<0ng-u'j4X&-^XC̈́RPxZY=ng-=<04f-$050h"菨$g-XUWVSpE 0!qh5!#j1ۉ]- 1-] ;E9hg#WƄZYEWx_9Euphm#Su tZftatDeuI렃gu=j5 p7螌EZYz5 p7hW$j2^-E ]Su~dZYy hs#yEPhBt @uk y h}#0X}Whht@uk y h# XEPht@ugk y h#Xt$FvE 8uVEPuWSS^1ɉMME 8URu VYZURV4YZuURV^ZuoE 0-DPt"V赡PSKVS覘E9jh#V7 uVSEZYVh#]eE E}tSjuA y h"j}t Whgtu*j y h#XjZUWVSu 6ynh5!#jpe0 xo011ɉhdt`p11ۉljhh-hJ#Vu}lRtf(LtntMH1һ뮃PthtPdtXfuyDž`뇃vuhDžds= p7hDžpYMDžt@Džh1 -E)t 4Hubupt uY00t00pt$t*tt hS#j\ t)00>=0tzj:W@MYZt@0j.WYZlt!h0WP&_Z@lu Bn>t0<#u*$0h0W&ZY@u ۉ68xPWZY@u WhB#j=0tE0E0jSVٯǃ 1uhB#>pu jSWչ WnX CHHf wg$o&s Psho"ZDžlP=s Psho"YttDžl DžlP0ht)KPt;Qu0t;Au A<50RslЃ t"`ushW$Y[dsZـ8t hB#j*VgVUWVSu f00| 0 ʈ00@0 ʈ00̔0%ij0f00h+-#[thџ#Yq&t7GtPSrYZu 3Sh#Wh#j 1hn#VuP A6$ p&,0%ȳ00 (0$00= p7h"W]qYZuh#WEqYZ;U= p7.j j5 p7Qǃ u~8"u 5 p7h!#D=0j j5 p7Qǃ t =0~8"u5 p7h:#jj j5 p7\Qǃ ue~8"t=ij05 p7hS#뺸Y5 p7oZ@u^PA0I0=104 0(0 9tt؉ ij0v jh#uh# 0tt hޟ#j00ǃ;=0u/;0u"0;0u09rt1= h-$0(0  h--=0tP U)4uE=0t=0?04=0tt  1Ljhh0PQ苣PLy h0t=(0uJLxPPYZYLu&%=u$0(0w($p&J0PJPihЦ"@^u`."h#Ph)%hS@YSdǃuShW$Y[hr"PMXZthW蚄h0h@0V5ȳ0h@0V V QX1\`dDžXhVXPj\ Džy0z8#tjVj:ht"TjI_jVjP#nPHh"ƃu#SVhT%TP2{Tu h 5"jjPh"h$h$ÃuVRYSxTPZZ9ujVjg~TH h*"V\LY_uVhW$LXZ@0e׋H󫋅LLOXtPDžu V)[eh#]Xh8-L-H-ZYyh-PX-P-0 t+@t( -y h-P_-P-Ѓ߃NP蔦^ JPk=0u 0 =0u 0 Ph@0Y[J},0 0P= 0X= 0t @09,h0h@0h8-r 5ȳ0h@0h8-h@0Zxdh*"vZ[_uvhW$j( 1JPhmdP hў#jm^~WYu Wh#P@0eȺX0t jSRA h@0ZIPW~LUWVSjj]Sjjhy&))@u h=#j u袴YtjjSPjhy&(@t͋EE11һ9}~T >tItt9Ӆu5U1ۃ jj@QMQ+MQhW$MUU1G맅u) @-yh8-j [XZ8-P8- 1e[^_]UWVS ƅ]-ƅ_1ۉ000150001=0001h#u u ycPtJTtgxPl$y& 0뫃 0q 0 e 0Y 0M5 p70Ye5 p7>Vj:V=?[Zuh#SH0t)XV3fZYXu C[Ӊ0=0t h?,"j p7tuhd,"1Ҁnuxouh-h-%PSC^_t5!#0U֋= p7u 0i5!# p70'Otrhz&Phʫ#h-wVjcI^]040t00t 0-M Tu)tP1ۉXhTm hk 50RzXRrRhu#RL6eZYTLSxjjLRPV9X}XTPT0VhP蘁à uj/SZYuShق"h %hSIPV豯Xu"V̮Xu9S跮^ty2LhVà LVhW$juhyG"LRdZYhN#LRcZYSh#jjhVjSǃu Vh#jh0hzd@PV uWxX0`PhedAWwV @uVh-#WwVbH__9~VhK#(NE X0?0@0}u n-xk-1ƅhr-u u跥ǃ zI`Ntu&At/CcG6$&WBh7$,?_00w0kA0p-Z@0N0p- 60*?00Pjhjjj j5 p7F0 6Pjhjjj j5 p7}F0 5 p7h+%>0_ƻt9ƀ0x讻t!ƀ0l\m 荻u{ƀ0Ct_L1n-%m-n-`k-p-ƅn-p-p-=-=A0uu =0Wjmֽ^G=?0:=>0-=A0uu =0tEjL葽Y=A0t=0=0t Dž PPtVSE PE)P+Džuh &hW#PV: @u hH$6t*HkttWPͫXZuh &hU$GS SYXuVhT h0=h0w h0腹XUh`v-h 0hv-h(0ظh 0h(0h\ h@0Ѹ hV h00豸h[ h80辸h@0h00Ӹh80UVS8y h$@Yh#%&Zy h$&Xjh $%F[^]u[jj}h.$ u=jh$EXY$u$jh=$h3$Ph!"h$/j 7jSPf @t-Et Ph7$~^Xjh $|EZYtj _^hN$Yj N^ w-yp jj hko jjjj j jjjhFo 0jjjjhn jjhn EEEE jjjjjjjj j j jjjuV8jVjc1EEEEEEjSj]jSj]$jTejMejFeEE EjjEPEPjEPƒ$Buy^8L0 w-te[^]UWVS]} DžhDžT1L11PXDžD t h$WS芜 u~fFt/RkDžPgS$t&5 p7DYu5 p7hq$Xu p78#t5 p7fZu[ j dR@P~ d:u P p7XdTX00MTADžHDžL(-)Ǎ4L AÅshu#VTHZYt"hyG"VCHZYthN#V2HY^uPs- ^ZuC 6%u3h$VGZYu%C \u sh$XVhPdƒ uPhW$KCjjHVs XTLj\Pn^_1u?h@$j脨i P\P1ZYu \vF9|1Pt@P67_XTt*u\uO?\u<څ6ȑX6ސX6h$j莧\LP耑^Lt 0h$V?FZYuL1C \äS6XuSQXOWhu#RPEZYt:hyG"PREZYt#hN#PREZYt 6h$&h$RPEZYPu7u\u\tً\w_G PRhPaƒ kjjjPXT6hPaǃ ,P[h$6G ZYsH$@jW@XYXR8t Wh#jϥhWS芲j/SrtXSCZPP1ɉrQ19rPR9rS)P&rjPWÃtMh`0hzd@S6 uS^XX0=0ug\PhedAS6 @uS/X[\&?S!XW CDZYax9}(YZu0XhC%Wi>_Zu 1ɉ 0:h$h$hT%Q= p7h*$W1>YZu 0h"W>YZu 0Wh$Djj5 p7 5 p7h$Phjhj p7$(0 0= p7W]rZu-DPuWh $@=WHg_+= p7=0j:WsZYuj/WeZYth$ ?u hK$j 0-=Lx-=0u= 00p1󫍅l0AuVE)Ћ 0)DžMDž>=0qhw$5r@0jxlP50ph$S@uph$0@th$( jr HM1󫍝`4󫋅 =0u 0tJ 0 0Pt[^@=00 0s=0u;0 0}hRN @uh$P]&ZY@uh$=0h0VSWà uVho"j誛Ph0PMs ujhh0jPWoyh0h$!P%^_@tڋ%=`uh0h$1=0jjh0YM yh0h)$jPyY[uh0h<$jh0hق" 0t#0VRWV9^ZtN xRjVhق" u ƃrVW9YZuSh0hK$j=0u@0`PP50h0_@uh0h &1=00=0u0 h_$Ytc uh0hv$h#S08ZYu&0uh#S 8^_t t Dž0?=0thk"h%S7Y[thps"h0h &Džt'0RP5 050-D0 050= 019|Y<@ t 0SQRPC  50= 019| h$t5 0 09sSQRPh$jtd0 0ˋ 0%0RP5 @u+5 050h$j諗'0P_Z@uh $軝[^ m[_uh0h<$;Dž0jh0hق"葿 u Dž0xxjWhق"S u ƃrW,ZYtWR~,Y_uSh0hK$ 뀍`PPjh0u@uh0h4& =t0ut0u h_$jt] uh0hv$u7h%P+_ZDž0t hs"h0h&j譌Dž0t(t01RP5|05x08x0|0x0|019؋|i<@ t" t01SQRP7 x0|019| h$t5 x0|09sSQRPh$j蠋tMt0x0 |0mRPV @u'5|05x0h$ju1$0PVlY[@uh $莑XZ tj"h=$djjh5!#h!>"h=$d }ujj1jj(jjjj jj jj jj@u h=$jkjjZY@u8th=$=j?4X}ukj,4_j jUZY@u\8t+h=$qY2 u h=$Z W3XVS4h=$p 0:bjjƒ 5!#Bu<=$SPh %jjUWVSDu]  '3h&SVAU v~j cStITtbLu<3뼃dw$\&H38343,3z3k(3\03M$3>-)ƍϜ\3=03tjjh%T3 >Ejjj"觜T3jURh@hP| @u hV%@oY=T3y h~%jh;u=H33 @ WrZ) (    mt /  =H3t1ɉڸ]j1ɉMhjWE؉EhjVE܉EhjVEȉEhjVEĉE hjVEEhjVljEhjVEMU ʃ} ʃ} у} хuu hA"E1҉D38gtj5T3_X1ɉME5!#E5!#FEȅ"CEċS:-0BRUqZH3U$&D3"0-D30-D30-D30- @3uj3[3LP3A91&@uCEċSEP1ɸ uCEċSEP1ɸuCEċSEP1ɸduCEċSEP1ucCEċSEPM̸iECEu/CEċSEP1ɸiXL3uCEċCUv_EuKMċs t^3hw$x&]1R3F3:3 .3@"33 3 3 3 3t# 3 333t13jjV1C RX3u#EPM̉UhEXUUuEPM̉URq,^uCh%sjZY=43uhB$h2B$h<% @3CHw)=43uhJB$heB$h<%T 1@3SEP1ɸgX]ċuX3MuhB$5u>au uhB$"P3EġL3}tuȉuthB$jbMu}t }EEă=@3uMEȉE?10E018 31atctguIE#3E(3"33@343X3,3H33󥡠3@3U9sHxt)ЈX3t]E؊Hw uF:T80D019r)19r)1ELE؃9sIJ 3X3tMutHXSVh3 =$3t =3tØ3B$j]X3tE}tHpVWS踮 =$3t =3tB$]X3tE}tHpVWSj =$3t =3tB$\X3tE}tHpVWS =$3t =3tC$\X3tE}tHpVWSέ =$3t =3tC$2\X3 tE}tHpVWS耭 =$3t =3t C$[ 3f 3=$3t!=3u=X3t\ 3A^=3Sh 35T3 u( 87t \PhUA$XZ9~kPhsA$Y[] 83u =D3tH 8t<3 83 (3 $3PSVr 11ɉډe[^_]_Wae[^_]UWVS } hsI$PZY…Uh~"WubH Ut.at"t=3 p73뽺붡-])Åt>um3t&h#S^_thH$SZYCt/=3u&43xsujRKuEVhzI$h-VhI$h-j=3u.3hI$WubG t@qA3w$P&z=3u3먃=3u3듃=3u3{=3u3c=3z3 G383)33 =3"3@33335 p7#3X=33=33j=3 p73h8%PKY[>3/=3F33)-E)tH:Eu5=3=3t =3=3]=3t =3=3txt4h#WjYZ!hH$WUYZu/ h#W?YZ7hH$W*YZ"h8%W_Z,@JK EpÀ53jj535353lwt53jj535353Cw;E53Sjh 0ShW$j^X3E0o =3mEnjEPjKh @u hI$O^EUuuhI$[Jh`RPhI$t SYyE  1SQ%1RPhJ$HG1=3tu5oXh%S_Zt#h?H$S ZYt?ujwVhJ$j VhQJ$jVUWVS u] 1hIL$SVB tRtfu23ֿϡ-9td1ɉ`d|lPV袬[ZjxPPUuZY%=`=@uxh|uxPhLL$&[^Dž`ddPhV~ ^ =v#j?,I$5 p7ho"j Q3U Ehn$RP\< OP̃D8$t&31=3=33jP5 p7Z -t8{5 p7hqm$ T303Y3J1ɉ (3=jVX5 p7WZG ;3= ;31831=$35 p7V3$y#PZY3- p73313j P5 p7Y 3~8o5 p7hm$jvO3Nj P5 p7GY |3~85 p7hm$뮋5 p7j h"W\ 5 p7U_h-%PZYt"8u5 p7hm$GujPW @A-L3fDž1835 p7*UXB1=3=3/335 p7IYT35 p7hm$T3p7?u8-S 1uPhm$XZ-5 T5p7hm$Phn$/jjj53迄E-)ЉEE E 1T3 33@3tq13DžDžh3RjVt& u0DP _PVhEn$1ɉ DC3 @C3h"Lc^t8t PSZDC3,ux\P Xu;PZ Xt߃=DC3uF t8t P@S_DC363SY@C3DC3=@?3utuhJC%SZDC3ghPh@?3*Y =v&j?D$5DC3hcn$9 @?3hh[n$h@?3Y =w=DC3tj 6R$ hqn$PX j h$VxY h{n$bXX$hX$bX5!#X$hX$aX5!#X$hX$aX5!#X$hX$aY5!#X$hn$a_ "-R$hn$vaXk$#thn$ZaX5!#X$Xhn$>aX5!#X$<V>jEXZh~j*Y^h~j *_Xhj)XZhj)Y^h{j)_XEt7U ESRPà 0;3uSjj)^_jNXE j:00Y[t*E 0JZuU ERPU_X9jh`3Y^uhj6)XZhj ()Y[E 0j@V_ZÅt @hPWjV E @1=$3t1ɉ 3 $3ER@PSXZ=$3=<3uu |3ujSVO =<3t 1ۉ|371҉T3Phn$53G 5|3>Y=<3a뿃jh`3mXZhj(Y[hj '^_Ie[^_]UWVS}u hm!"P,ZYtWhh!"SZYthg!"S ZYu3)~3ltXnuzh={$VWM3 du3׃Vt1PσwB0-뾃cu33 3h&hb#h- jh&hb#h-Sh {$h-j-9u*=3t d^x1]`Gpptƀ8-utxt t1J=3todx1`pp8uJ5-ƍxPVeZYtn=3tSuOR8uCV-Dhl$)1_lhuh 5"Y1thM{$\Y2E%=@uVh\{$=u Qd Vhn{$dYZYS?9X53HUWVSu 60h5!#j'=1ɉ 4 1h"$Vu0 ua`Gt+It2EtHa<$& 4먁%4뜡 p7u5!#44z4k45 p7O$聄5 p7PFh"WK| p71| 4 p7u5!#41҉4jjjh8-{hS$/4jjjh8-l{hw$JX|PPh$h-j~-4 4ut {{>tt{1{聇j5 3Ah8- t h("jC54UWVSP}1ɉMM1h$u W. t3gt!utGu. p7E p7;u p7E85-90t3SZt@E%U.MM@uSh$jB1}1ɉM}t EgE1}t6h-%EP课YZt"8tu h$jBG,DʋE 46VZ@u6hW$jBhH%Y@ttEPWS_Z@uhȃ$}tuY@u h҃$jZBtuRZ@uh4$FtVRP*vhW$j#Bh{#fXXu$jhك$SS\@ShW$jAUWVSĀu] n41@t4u4_4%1Ht4hR,£ d4a1X@&?t2Gt&W =n4uRhn4f!YX RwP8N {4\k4XZtu(xH%}u)xe%xt}tjUxY~jRt-XZlN t%S^_u h>%[-h>%SZYu#h&hB%hB% 101jADž`B%-DžDž$Dž DžDž1((,Dž\EEEEEjj @u1$jj[^@u $jjZY @u$1$1ƅh%g>%tf>% Ph&Ru uP^V4M 6?4uƅ뛃Nw$`&ft'j{$&DžA<%` p7`PlE(5 p7gl^X-Àt ˀDž'<%hDž$Dž$Dž$h%h>%A[q ƅDž9<%{DžQ<%gEH;-t dSMl0ME tEp-U)‰u 0SjjjSވƃu(h% ;-!u uPjSt%huąn h>%, $hB%Y;-u;VS藆jj-u 4S-ƃ u uPjSv覣0t &hB%D@S hC%qLHSkhC%UTPS踻 g dh  t u, @ À翉  dhd%@Sd%uvtSZvd8Sh " ~"t"t5!#hH%PSh%C%j+0PEh5!#h5!#h5!#h%C%j+0PʻdE9-u t1h%t0PY hJC%EZ@uh&h?C%I[Xe`PhD%D ht"D#hhD%h(\,Sh!j\8@3h&h9%DXZh@S_tPh&hD%YD .d%h u =uduA%1Ƀu -} RQ0P @uh&hD%dhǃ >%u5!#>%u5!#>%u -U QWPh&%0WQ@uh&hD%#1҉Lh[PZY@u hE%2CXWhy&j7@uh&h9%C_Xu*dhǁ@u dhQP0PXJ1҅uHh&hE%\4PAHZY$u64h+E%|B_X$P$9x uً4hCE%‹t x t]@h% hnE%P@0Pd% uhE%AY8t tjjM UXZލP0WGPWwE1d%@tW Y8t" t=WDZtڋdh@t) y tI߅uGÁt:Áu- hE%P?0P9 +t'%@t0PhQj&8V0P{0[_~ tVhjj7vՋd%@u hC%?Xu u0S7 [hC%a?dh@_dhShjj]7@Sh j i3@P;$ZYy)h&hE%3?[_ 1ɉ$ 1Dž$d%0uSOZ@uh&hE%>Y_PSBXZt;t HxtyzP P@XR1ɉ_VSy _ZtP^ujS&YS @ SS;-tP/[hƒ@tRt \tBhE%=h@Yu&j$RP @uh&h9%=XZ\9!?lh8-蟥h$tPRh&hC%7h&hC%(%Ѝe[^_]ÍL$qUWVSQ@Y1ɉP4141,0<48h~%S@ ,H01$p '6%65 p7f41Ɋtrat<GtD AtBCt.@Lt,Slt" ctgt#su,'" @f4F누0f4%\1҉Lj LP5 p7&ƉP1 8u! p78tL8u ;PhC|%pj LP5 p7- ~ p7:t L:t5 p7h^|%t4z 6@n2th~|%j" 6jh8- 1ɉ - -$-^_ p7< 6j LP5 p7P,(- p7 :t L9t Rh|%j1"@=Rh|% p74 6 0LP5 p7 p7_Z8tL:t Pv)ݝ |1݅ tjPh|%!%v5 p7h}%AٽFfF fD٭D߽ ٭F $- -߭ %٭D۝ ٭F $-xy5 p7h|% uh}%$-^ 6S0thA}%j LP5 p7*8 x p78tL85 p7h^}%&,%6 6 6 6 p75-tDFu hz}%1B卅(R$R RRRRR RRRRRRRRPh6$Q6VƃH1Ʌ~ )16h/7$(0- x p7:t L:t5 p7h}%=hh}%6% - 6k6%6% 6CLP5 p7觋 4XZL8u5 p7h5$8LP5 p7a4_XL8u5 p7h~%-@)Ht6j.S$Y^u S8Z)؉@?wPSP脔@Ƅ t@ -t -fBۍ1V@KjKPVq@SVdVdP$TVhF~%j/ Hd`hSVj&SOX6t=0- hX~%Xt1DžtDžxDž|Dž:h6VjS.tP苓PhW$jn6BtÉ4ru h~%6Jr rrN6 y h~%<6@t"56h6P&S t hN%<1DžDžDž:PtPj<<tP虒P|4Džd6@t8jdPjh56eZ@9s4@Dž@6=6u#jRj j)PZ@u hq%6,t/҉jRj*j)PY@u7h%LDžjRj+j)PY@u h%6%u) t DžDž j Sjj:56BYy h%6t-DžjSj&j)56 Yt h%w(-0t @u@tb1V_u h%T4541҃0t4P 1 C)C.C,ރ 9s11ۃ4t/04A0BYu4h%b(-tC)C/C 6@"4Džjjj Jà 4y h+%\666f6'u66tjRj.j)SWt h6% =(-tMjh(-jj)SwWt hS%=(-t"jh(-j j)SLWt hu%h6S y h%Ph6S臿 yh%uS_P0-tf9} h%X^jPShh56Vyh܀%$jShh56VyIh%j= ~ h%[DždjdPhh56CVDžjSj$j)56Vy h%YjSj%j)56Uy h%%Z6  r)r  rr0-PR(PhC%6蝺Ph^%˟6舺P88t说h!j諽h!j蟽144@<˽ffffUS V u=ƃV -tLltA)v)v[]ËP PDV UWVS Y EuFN 910u$Xx}xWx U 9s?uɉtE艘|q uxq u쉰tq Eƀq  [^_]ÉtE艘|q uxq u쉰tq 1 [^_]UVSÏ u4$D$4$8t$L $[^]UStI t[]E D$D$ED$ D$D$l3$vt} tǃ []Ë$Ë$Ë<$Ë$Ë $Ë4$U^ps_strings missing ramdiskbinUsage: %s ..., where is one of: %s: %s not compiled in chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodlnmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6usage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s %s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOIELEMinvalid unit number `%s'%s: too few arguments%s: too many arguments%s: CHIOSPICKER%s: CDIOCLOADUNLOADinvalid modifier `%s'invalid element type `%s'%s: inappropriate modifier `%s'%s: CHIOPOSITION%s: CHIOEXCHANGE%s: CHIOMOVE%s: CHIOGPICKERINEABEXENABACCESSEXCEPTIMPEXPFULL%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: status not available Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu f:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %sunloadinvinv1inv2voltags [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortslotportaloflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizeoutput block sizeinput block sizeblock countfile countunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiAvailiUsed %*s %*s %%iCap Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklMmNnPqt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %scannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp filedes_cipherbad hex digit in keybad binary digit in keydecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileEnter key: des_setkeyunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input filecannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionp:sxES ? interruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-f device] command [count] %s=%o%s=%x/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d %s: block location %u internal error: unknown request %ldWriteProtectMounted76543210asfbsfbsreomfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache [-u locuser]usage: %s [-46dn] [-l login] [-p port]%s [login@]host command pollRCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloctcponly super user can use the -u option468KLdel:np:u:wshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrport must be between 1 and %dbytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dusage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: needs_cleaning returned %d%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progress%s: clean_fs returned %d%s: shutdownnfss == 0/usr/src/libexec/lfs_cleanerd/lfs_cleanerd.cLFCNSEGWAITALLincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blockscoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost taildepth <= nbufs/usr/src/sbin/fsck_lfs/bufcache.c!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)bp->b_flags & B_BUSYSuperblock magic number (0x%lx) does not match expected 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) ix < ULFS_NIADDR/usr/include/ufs/lfs/lfs_accessors.hix < ULFS_NDADDRbc >= 0/usr/src/sbin/fsck_lfs/lfs.cNot enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x pseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%x/%d bc > 0sb0 %ju, sb1 %juAttempting to verify newer checkpoint...done.** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data No -b flag given, not attempting to verify checkpointPrimary superblock is no good, using first alternateFirst alternate superblock is no good, using primarylfs: ifile ino %d read %dlfs_balloc: bread bno %lldlfs: ifile read: cleanerinfo: error %d lfs_valloc: inuse inode %d on the free listUsage: %s device %s device command [arg [...]] Available commands: rw%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. successfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringdecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionreallocarrSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT header%s: bootcode too large%s: bootcode too small%s: invalid magicInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?PBR is not bootableNot bootable%s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedbootmenu%s: [%.*s] (space to clear)'%s' is longer than %d characters. Explicitly specify beg/end address?The bootselect code is not installed, do you want to install it now?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: Bootselector , infinite timeout, timeout %d secondsNo active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdB0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks? Geometries of known disks:Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. Boot selector configuration:Timeout value (0 to 3600 seconds, -1 => never)Select the default boot option. Options are: %d: The first active partition %d: Harddisk %d Default boot option We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tableusage: %s [-fqrw] [-s sector] device Invalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. and on-disk sector number (%s) incorrectly specifiedsector number (%s) out of rangefqrs:wget labelNo change; not updating disk label.Updating in-core %sdisk label. set labelNot updating disk label.Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS# %s: type: %u disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdusage: %s [-o options] special node getmntoptsmount table fullincorrect super blockspecified device does not match mounted device%s on %s: %suserquotagroupquotardonlyunionhiddensympermrumpautomountedgetargsrelatimerealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-bdins] [-N nsegs] [-o options] special node bdiN:no:s/libexec/lfs_cleanerd-b-d/var/run/%slfs_cleanerd:m:%s.pid%slfs_cleanerd:s:%s.pidusage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%xWARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too bigfs->lfs_hasolddirfmt == 0reclen > LFS_DIRHEADERSIZE(fs)spacelen > namlenspaceleft == 0/usr/src/sbin/newfs_lfs/make_lfs.csuper-block backups (for fsck -b #) at:%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version preadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld insane maxpartitions value %dinterleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit width%s `%s' is out of range.AB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:bit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume/dev/%sr%s%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -An < LFS_MAXNUMSBnblocks = %d, not %d %s: fragment is not last block%s: ulfs_bmaparray returned %d looking up lbn %lld%s: bread bno %lld%s: no clean segmentslfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_number/usr/src/sbin/fsck_lfs/segwrite.cfs->lfs_is64 == 0devvp is NULL!(bp->b_flags & B_INVAL)idx < lfs_fi_getnblocks(fs, fip)bp->b_flags & B_DELWRICould not allocate %zu bytesdaddr > 0unlock to 0 with no summarySeglock not heldunknown disk type `%s'DIOCGDINFO on %s failedsectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sCan't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytesabsentCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'%s: Unable to allocate table%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingBad number `%s'usage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev ioctl (%s) failedRAIDFRAME_GET_INFO%s is not a component of this deviceYesNohardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_GET_COMPONENT_LABELComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d RAIDFRAME_INIT_LABELSgettimeofday failed!?!?%02d: %3d%% |%s| ETA: %s %cRAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. RAIDFRAME_CHECK_PARITYREWRITE_STATUSParity Re-write is %d%% complete. Reconstruction status:Parity Re-write status:UNKNOWNdisremainstat failure on: %sinvalid device: %smirrorRAIDFRAME_CONFIGURERAIDFRAME_REWRITEPARITYBad last unit %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vUnable to open device file: %sRAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTUnable to create RAIDframe configuration structureRAIDFRAME_FAIL_DISKRAIDFRAME_SET_COMPONENT_LABELInitiating re-write of parity# raidctl config file for %s START array# numCol numSpareSTART disksSTART spare# WARNING: no optimal components; using %s START layout# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c START queuefifo %d Components:%20s: %s Spares:No spares.%s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYParity status: cleanParity status: DIRTYraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure RAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure RAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity %s: Parity Re-write complete RAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANoptimalreconstructingdist_sparedused_spare|/-\ForceSoft*invalid*usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list extract directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseto an alternate location with more disk space.or set environment variable TMPDIRTry making space in %s, %s %s bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer /dev/ttycannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? towards the first. with the last volume and work file(s) are on you should start Unless you know which volume yourYou have not read any tapes yet. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump coresymbolicwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). strdupwho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctl%13u usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable %s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. unable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- : noneinvalid target: %sinvalid lun: %sSCBUSIODETACHSCBUSIOSCAN%8u %4u entire track defective%10u SCIOCDEBUGSCIOCRESETSCBUSIORESETvpd%s: scsibus%d target %d lun %d <%s, %s, %s> VPD Serial:VPD Device IDs: proto%uunable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu unable to allocate defect descriptorinvalid block number: %sbusunknown %s command: %st10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISASresetscantarget lun[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcachesetspeed[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#Diagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xParametersError in %s, Offset %d, bit %dError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:%s: Check Condition on CDB: %02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedWrite ProtectedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This TrackNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare Error%s: SCSI command timed out %s: device is busy %s: device had unknown status %x Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time format/usr/bin/wall%s -n%s: Can't find `%s' (%m)FINAL *** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at poweroff/sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-zCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:tcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s %s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]%x:%llu(%d/%d/%d),%x %s: size mismatch %c%x0x%0*x0x%0*llx -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2xunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorLESSLESSSECUREVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDticmso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYts=tabstop=pcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%c-clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifttildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdvcudiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x), Valid options are:=number=word=stringSupported machines are:usage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap paths != NULL/usr/src/usr.sbin/installboot/installboot.cmach != NULLInvalid machine `%s' from %s (directory)(none)(to be cleared)EditClear$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSInvalid block number `%s'-moption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'fstype != NULL-tInvalid file system type `%s' from %sb:B:cefm:no:t:u:vDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown typeparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s Secondary bootstrap: %s Please specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'params != NULL%s: bootstrap installation is not supported%s: bootstrap removal is not supported%s: bootstrap editing is not supportedalphasumioaddrkeymapresetvideosunsumbootconfboarddtbbb16 != NULL/usr/src/usr.sbin/installboot/sum.cOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x invalid console name, valid names are:Boot options: timeout %d, flags %x, speed %d, ioaddr %x, console %s console %d keymap %s Patch area in stage1 bootstrap is too small/usr/src/usr.sbin/installboot/arch/i386.cparams->fsfd != -1params->filesystem != NULLReading `%s'Reading `%s': short readWriting `%s'Writing `%s': short write, %zd bytes (should be %zu)Invalid magic in existing bootstrapparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)Cannot enable writes to the label sectorWriting `%s': short write, %u bytesamd64i386com0kbdcom1kbdcom2kbdcom3kbdusage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCSWAVELAN[ %s ]SIOCGWAVELAN(wreq %04x)Transmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCSIFFLAGSmust specify interface nameSIOCGIFFLAGSscanning ... AP Information No APs availableap[%d]: ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] string too longUnknown[ Unknown ][ On ][ Off ][ %s ID: %d version: %d.%d ][ 0x%s is already specified to %sa:d:g:hi:m:or:s:A:M:R:DSIOCG80211NWIDbadly formatted addressLucentgeneric PRISM IISamsungD-LinkHost initiatedFirmware initiatedInquiry request from hostWEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: NIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: %s: not a regular filemalloc, using %zu bufferUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv%6d %6s Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx ls: %s: %s total %'llu total %llu humanize_numbertotal %s %'*llu %*llu ????????????????????????%s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too long-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%lu secs (%llu %s/sec)%llu bytesunknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryAlias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDPeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sCannot determine current working directoryunexpected argumentUnable to find current directorystdout: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifiernull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode nul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes[%d] %c %ld RunningDone(%d) (core dumped)No current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d [%d] %ld lpZmore than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${LINENO${#LINENO${#${(((...)$(...)">|>>>&<&<> && || ! | if else fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvb%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) internal error (%c)kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %s+-Unknown option %c%carg for %co missingNETBSD_SHELLNetBSD shell: %s Bad -c optionOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionUsage: shift [n]Usage: rotate [n]can't rotate that manycan't shift that manyallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntil";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %sBad flag `%s'%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error '...'<<nonblockfsyncdsyncrsyncaltionosigpipecloexecEXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLequnknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'evalbgchdirletfalsefdflagsgetoptsfcinputrcprintfsetvarulimitumaskunaliaswordexpPPID20220122 BUILD:20250623150733Z SMALL REJECT_NULSincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s [-L] format [arg ...] Arg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: not completely convertedArg %d: %s: %sArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: %sArg %d: '%s' numeric value requiredformat "%s" too complex#-+ 0'%s: missing format character%s: invalid directiveprint failedoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeol2lnextreprintgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d illegal gfmt1 optionillegal gfmt1 option -- %s%lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqcs5cs6cs7cs8-parity-evenp-oddp-pass8-extproc-parmrk-onlret-cread-parenb-cdtrctsispeed %d baud; ospeed %d baud;lflags %d rows; %d columns; queue = %d; line = %s;-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfoiflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignparoflags-opost-onlcr-ocrnl-oxtabs-onocrcflags-parodd-hupcl-clocal-cstopb-crtscts-mdmbufcchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... %s: invalid %s nameHLPRdfhvthe -L and -h options may not be specified together.DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %dusage:%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/vi%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipszaurus%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraAutomatically adjust partitions [%s]? Invalid answer# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition tablecan't get msgbufrq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %duntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDwrong type to dirscan %dNAME=%s NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** Alternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s can't take snapshot of %sEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) ADD '.' ENTRYREPLACE WITH '.'ADD '..' ENTRYREPLACE WITH '..'DUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKSINFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATE-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %d%.*s/%s%s/XXXXXXXXXX/dev/rfss%dDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %da:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBR[-r]Read failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %juPri%s GPT at sector %juSecGPT partition: type=%s, start=%ju, size=%juMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qpartition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableCreating new secondary GPT headerMoving secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]%s: %lluType: %s (%s) NoneCould not find index %dDetails for index %d: Start (active)UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?]GPT part %lsUnknown %#x %*s index contents %*jx %*ju%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaxGPT not found, displaying data from MBR. %5dshow[-aglux] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changedab:i:L:s:t:U:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]gpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.csector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile] [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] %s: getsockSIOCGIFAFLAG_IN6SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6 inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime %s: getifnameeui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressinet6 address lifetime not allowed for the AFpltimeia6flaginet6IPv6 keywordsia6flagsanycastSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEnetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflag/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTR%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sifcapclonecmdNote: trailers are no longer sent, but always receivedSIOCSIFMETRICSIOCSIFMTU, %s byte%s[-L] [-m] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimeSIOCZIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s input: queue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecatedexec_matches%s: prop_dictionary_augment%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types? media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkmasterno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsCAPSS:NRATE%-*.*s %-17.17s %4s %4s %-7s %3s %4s %-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s> DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): dlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal Error%s: address resolved to multiple valuesassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dFlags%-*.*s %-*.*s %-6.6s Internet6InternetAppleTalkEncap Protocol Family %d: %-6.6s %u.%u.%u.%u/%dillegal prefixlen(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 swaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab MBytesGBytesKBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)PriorityCapacityDevice%-*s %*s %8s %8s %8s %s %-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20241129NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandLPSVEPSVCan't create socket for data connectionwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cWriting to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Usage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpBad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVncan't stat: %s%s is a directory%s is not a regular file.gz%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()works for regular filesin-place editing only%s: %s %s%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtvUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages%-35s %.50s2001:4860:4860::88442001:4860:4860::88888.8.4.48.8.8.8.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page downCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exit9600192003840057600115200BIOSrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/i386 10.99.14 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.99.14 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.99.14 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.99.14 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.99.14 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-10.99.14 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.99.14 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog10.99.14xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/10.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02X/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:ipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.statsnet.inet6.ip6.stats/sbin/route get -inet default/sbin/route get -inet6 defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/i386/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,nosuid,noexec,nodevmtime,nodev,noatime,async,noauto,log/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/i386/../../disks.cbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%sxbdmcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%s/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/i386/../../util.c/tmp/entr.%06xrndctl -S /tmp/entropy-file %s dd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/certctl rehash/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/i386/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd %s cd to %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /EFI/boot/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootablemachdep.bootmethodUEFIOut of memory %d%d%d%d%d%u%uwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_bootsel/usr/mdec/mbr/usr/mdec/mbr_extCan't find %sgpt biosboot -b %llu %s/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdm/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstypeparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ---- %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/i386/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/i386/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errorparts->geo_sec != 0info->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: IAID conflicts with one assigned to %s%s: connected to Access Point: %sNOCARRIERPREINITEXPIRE6EXPIRESTOPPED%s: removing interfaceDUID %spid %d failed to exitdup2 %d%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leases%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z: [ip6] [ip4][manager]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET INET6 DHCPv6/etc/dhcpcd.confInterface options: DHCPv4 options: ND options: DHCPv6 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 starting%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initnd_dhcp6_invalid IP address: %sinvalid CIDR: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6vsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLnrt != NULLkeepingchangingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.clen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefix - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sSTATIC6ROUTERADVERTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIAS%s: if_addrflags6%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_send%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/var/db/dhcpcd/secret%s: cannot read secret%s: cannot write secret%s: IPv6 static DAD completedcannot find a loopback interface to reject via%s: deleting address %stemporary %s: adding %saddress %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u seconds%s_ip6_address=%s%s: waiting for %s to complete%s: pid %d deleted address %s%s: regen temp addr %s%s: too many duplicate temporary addresses%s: waiting for Router Advertisement DAD to complete%s: unable to obtain a stable private addressipv6_makestableprivate%s: Router Advertisement DAD completed%s: delaying Router Solicitation for LL address%s: sending Router Solicitation%s: no IPv6 Routers available%s: soliciting an IPv6 router%s: delaying IPv6 router solicitation for %0.1f seconds%s: impossible RA flag %x%s: %s: router expired%s: expired %s %s%s: expired route %s%s: part of a Router Advertisement expirednd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%sIPv6 ICMP packet too short from %sIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %s%s: delaying IPv6 Router Solicitation for LL addressreachable again%s: %s is %s%s: status truncatedUnknown Status (%d)%s: DHCPv6 REPLY: %s%s: server sent USEMULTICAST%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: %s: DHCPv6 REPLY missing IA Address%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %uTIMEOUT6%s: %s received from %sINFORM6BOUND6RENEW6REBIND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: %s: no valid lifetime%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: waiting for DHCPv6 DAD to completedelayingmulticastingunicasting%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f seconds%s: %s: sendmsg%s: sent %d times with no reply%s: ignoring unicast option as not manager%s: declining failed DHCPv6 addresses%s: DHCPv6 DAD completed%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: soliciting a DHCPv6 lease%s: requesting DHCPv6 information%s: no advertising IPv6 router wants DHCP%s: failed to request DHCPv6 information%s: failed to decline duplicated DHCPv6 addresses%s: failed to request DHCPv6 address%s: DHCPv6 lease expired%s: failed to confirm prior DHCPv6 address%05d %sDHCPv6 packet too short from %s%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: discarding ADVERTISEMENT from %s (%u)%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: ADV (no address) from %s (%u)%s: ADV %s from %s (%u)%s: redirecting DHCP6 message to %s%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 lease%s: delaying DHCPv6 for LL addressSTOP6RELEASE6%s_dhcp6SuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix AvailableSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RECONFIGURE6-%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host ping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmapunknown qtype no address(TTL=infty)(TTL=%u)TTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> RefusedIPv6 address/etc/group/etc/master.passwd: (malloc) Error in munmap(): Z Pu___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumcntrlgraphpunctxdigit%s%s%s 646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d snaparchivedsappendschangesimmutableuappenduchangeuimmutable ,N/Alink#%hu%d:[%d,%d]pqrstuwxyzPQRST/dev/ptm%s%s.pidjanuarygmtmidnightyeara.m.p.m.noonmiddayutcwetbstwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdttomorrowyesterdaytodaylastthiseleventwelveagomonthfortnightweekfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdayfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshautoselect10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTEthernetTokenRingFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT.sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy stringCannot allocate %zu bytesCannot re-allocate %zu bytesCannot open `%s'Cannot format string%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sinitscrESCDELAYTABSIZEcsp != &blank^Gkbskcub1kcud1^M^Junknown error%s: generic terminal%s: hardcopy terminal%s.cdb$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number/usr/bin/rshRCMD_CMDCannot exec %sR%zu W%zu L%lld %d *0*12aargon2idargon2iargon2dargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$$1$Argon2idArgon2iArgon2dOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesMemory allocation errorOutput pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureUnknown error codeacosacosfasinasinfatan2atan2fhypothypotfexpfy0y0fy1y1fynynflgammalgammaflogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error log2: SING error log2: DOMAIN error unknown header flags setincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthsinvalid code lengths setinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeatneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible versionstr != ((void *)0)fmt != ((void *)0)src != ((void *)0)0x%llxrpn == pn!((*cp) == '\0')?xml !DOCTYPE plist