08Ph'&<  'hmЁaP''`',. ,.h'&P@@<@T 08Ph'&<  'hmЁaP''`',. ,.h'&P@@<@TU h`',.yAhhhQ$f hhhRAhhh6Ahhh7Ahhh|AhhhAhhhAhhhAhhhAhhhmK$$hhhX`hpx$@hhh (0S$\hhh8@HPX`hpxP$thhh3Q$hhh4JAhhhChhhAhhhAhhhmhhh (08@HPX`hpx\$hhh}$hhh$>hhh$hhh$shhh$hhhAhhhm hhh$hhh $hhhAhhhAhhhAhhhAhhh$Qhhh ($hhh $hhh$hhh$hhh$hhh$hhh$hhhAhhhAhhhAhhhAhhhAhhhAhhh]PPLVJX\)8dMp, \{[!?&u^o! ?qND[,4J;O]oe62,kTPK'| =ZDWpiI}>p_hSeg,. . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF4,$4 (@@ " ":Y:Y $ , , ,, $ , ,NetBSD8nAPaXUSR&ffffUVSAʏ(8,,9s 9r[^]UWVSÚ(]P PLt,1t&tuAt[^_]Yuڅtft9s1u+z 9suփ 9r}tt~t111us t0#t&wfuUSQE$uԋ}{̋CE29sSU]MȍXE9s1u\tED u|E9rϋU]u9r09Jt*t(E9ǍvuUWVSe(E@@9s{*;9r[^_]UWVS$é(E u -M 8ME @E  -t/tu} ,9s 9rEt E$,p$,,9s 9r"$xED$E D$E @$]$ -MD$ D$ D$$1ɉL$4H$;[$SWD(5u1ƃ5DtЃtdZ$l_[SW(4uYƃ4t|$dZ<$ktH?t<$k8tЃ_[UWVSh "h "h- %1t:P-YxOvh-j XZ3hk%h- h-j jaUEU MsMU HE]UVS1ۋ%tVP-ZYu %C܍e[^]US9Ph!"h-h-h!"Ń% CtsPh!"h-jUWVSE tuh!"KURhc@5- t5-h!"juC#1!#MC#1!#EC#1!#WVSQRP5-h""E tC#1!#RPh/""` u5-h=""J1e[^_]U5-@XUjhc 5- t5-hV""j@1USRj EPS xU:t Shd""j]UPEU Ph}"" JtPh""EEEPhc5-{ t5-h""j襌1UWVSSuE H1ۃv>PW;+ZYtCݠ%uދݤ%Eh&"W+ZY1tFEEPhc5- t5-h""j1e[^_]US u Sh""j‹]UVS1%tSP*ZYtFSh""j茋%e[^]UWVS ]u} Sh}"" } ~Sh""{1}{EFE} t!v""r1UWVS`] u~ uh""Uȹ1Rhc@5-*E 5-h!"jM-DPEU Eu>M9Mt66EE1EEEK>tt,uh#" 1}}}}}E뺉t9Wuh#"j|U9Uu\}t }uEEEqEeEEVEEċ]9]}t;$}t)}t(u9ut8Eċu9u}l}uE EEEԅu.u9u<E4ŀ%5-h#" "}t}uuu1ۉ]EuM9~VQuh#"jvk]lSpEYu h#"jX1}E1҉Uuĉu܋UUMM]]}}Ph c5- u EX@1}Wux5-h$"jEuPE4ŀ%h#$"CE rh+$"3^ElU9U|-h-hV$XZCtCPhz1$_Xj ^CtCPCPh@$" CtC"PSha$" Cts؋C4ŀ%h$" C$Ph$"ZYuvXE\1e[^_]UE-]UEd-]Uh&"j[Uh-&"jLUhD&"j=UhZ&"j.UE E EE]"Uhjjjuho&"_--Uhjjjuh&"^_l-p-Uhjjjuh&"3_--Ujjjjuh&" _--Ujjjjuh#$^X-\----u(Ujjjjuh&"^X-\--u(Ujjjjuh&"u^--UShjjjuh&"H^Ӊ‰؉-- u j]Ujjjjuh&"^0 -u jUWVSuX-1\--1->W!XuWh&"j=S-Y_u Sh'"jxxuSh('"]hjjh%EPTuu뺋-#H t uhB'" P-WPZ_-t/#=t --tt hr'"X-ƒtuh'"<ۣt?%t4!t$t -ۣ -h'"j-e[^_]UVS-uX-D---H-L-;X-\-rgjD--H-L---X=5-u-E -)EU}t 13A}uke[^]Ë-- t H-L-Uh%hV$jUUh%hV$jUUSË@4URs(PZYts$hV$jS4K(E%= u!HPhm8@QR @ C !jjjQR Bu@u.,8uK ]USQ}9s ShZSPEPfiƒ 1uE]UWVSx(w-Ë@4jjWP ƃ y h("jC4WPs(Xe[^_]UWVS]uVh-j0C4uu s(P(t+8jVj/$`+8؍e[^_]UWVS@-}t H-L- X-\-EUEUEU}uH- t?11ҋ}9׋u} ytEU--E-- t(jRP5h-t-P Bu@u 5d-h("IuSh@-Ɖ 19|4 u5d-h3("%U*8t5d-hV$j}11-E - tKE- -5\-5X-QPB$----1ɉ - -5-=-9}u;9uu6E9\-u E9X-t--|--l--9}u9utT`-t%=-u-5d-hE("XZ`-t5d-hi("je|)u}H-L-+EUEUH-L-=X- \-9}Er }ME EtURD-)P5@- H-@-D- -- t8----SQRP! ujhF%j, e[^_]UVS]M Eu fft3SQHtlpCQSCAQSCAQSCAQSC AQ S C A Q S C A Q SCAQs[^]ÍL$qUWVSQ- -t/jh"j+ - -tjh"jz+ jEPi]eƉߋE׉pti$-% -Ɖߡ(-׋pt)ptZYt puDžp1t5-5-5-5-5-5-5-5-h("jd]S7,S$Sj}*- - t7ƃI% tJ#QRPh#)"jdSS$Sj5*$-- t7ƃI% tJ#QRPh<)"jdSSH$Sj)$-- t7ƃI% tJ#QRPhO)"jdS\S$Sj)$ --iቍhltpRPuƉ׍xPjhtpU WVxPhlSQhf)"jd]S$S_$Sj) eY[^_]a&UuCjY#UWVS--5- --u3jRP5--P B@;1S0 -v[H0 -S5-5--P$ t-u:5-hV$jfw-uNu<)u-h)"jwt5-hV$t}!XZe[^_]UWVS`-l- p-u?j X-\-%X-RP5h-t-P B@4tAfEEEPhm5h-t-P tS5d-hV$jnv11;5l-p-5X-5@-5h-t-P$ ~fEEEPhm5h-t-P @t;5l-p-s>5X-5@-h@- ;\-C;X-7벍e[^_]UWVSƉ׉ˡ-҃Pj h1!#WVRuVW"VSh\#/(e[^_]UWVStÉ׃=-t%tPh)"h Vh PVځ =-ssVPh)"s$s ssssh*"0sxs04bPhI#h-h."E1[X- T-9-؁}tVQYZYuW0aPhI#h-lh[%$E-H-u-tj#lj{$5X-T- -u -uΨu5H-Sj5T-9uy&;01aPhI#h-h%."ؙ@-D-T-e[^]UM1$-9t $-t!@t$-uhR]%;DXuUWVS] -A-P-9}k5`-09|8 -19to@(-8 -5P-19} @J19|)P-8 -r9*8 -19t RHtMP-8 -@8 -$-1P-11$-9} Bt8 -؅y1P- -u-tj!tj"8 -e[^_]US]5d-ZC`-d-X]UWVSjR[}ƅu+;01_PhI#h-h[%B'? tG+]uh;."jBVJZXZ1H-=8-tTjjP y#0^PhI#h-^h."q5H-@-D-1ɉ 8-X5H-Sju9uyH@-D-P0F^PhI#h-hI."AVY3^@-D-FV EUVwEU@-D-GZe[^_]UVS1ɉ - -j?@wh̦"d}[Z`."tS!Zt|/uShf."Shr."h -r -ujmh."@Vv NPOAYth."PH-YZu1SZ5 -hV$lh."@Vv VzvX1e[^]UH-tlPZy60\P5 -h%h-jh.""@>1H- -tPm@5 -W1҉ -YX18-@-D-1UH-t*Pq -ZtP!@5 -W1 -ZYuUjh-h-X2 yj$-$-(-$-1 -@=uUSUE L- -L-M -Ћ] Ӊ)~ -@[]Ã06w $%1Ã1D@11D1H1H11 D1 H 1 H 1 H 1 H 1H 1H1HøUWVSӃu]1d-2x-d-@ujjhd-hd-th."hV$=Y^d-h-x-|-`d-)p-k-1d-2x-d-@ujjhd-hd-rth."hV$g=XZSjjhd-)e[^_]UWVSƉӀ:0BZY1'>p-Cue[_]UWVS`-9\-1ɉ \-ujjhd-5d-=h-jjhd-hd-\th."hV$Q;XZ1ۊd-2x-d-Cu5x-=|-u\_uk-v7h/"uPY^#~h%/"hV$:XZ thJ/"`-=`-~\-P\-d-e[^_]US]=\-uU ]`-1\-=`-x\-P\-d-[]U=\-uU`-1\-=`-xU\-]UWVS h[/"5>Y18]E }=l-u>؍}01҉U"%]BuʀEt@9uSYthg/"hV$|9XZe[^_]US--9--RPMZYu[ 0UPhI#h-Rh[% 9-H-ua-tjtJj]-- -u -ųu١-P--M 1]UWVSSU-=-CE;U tM-119~149u1ɉs19~H -9E~@1Aˉt-X[^_]UVS5---19| t!-H<u -1[^]UWVSfEp E}u.h"5-T_Z]tjEP_ Y^uD1Gh"R^_FPd-Zy }Ou PP x. E uhr/":-| zf%-Ѓu-h/"RZYuu h/"6X넋-jEP [_bE --9-=}\SRKZYu[0RPhI#h-h[%I6-H--tjj-- -u -uΨuً-EH--8lx #xtދd-PRRe yɍe[^_]U-1----5-[M1҉--H-Yu-tjtjUWVSP- t u h/"5X 6ƅu -8u@-S5T-Ë=T-X9=P-|^SYt=-tj jsPEcUjjjRV袨;EtGSZyh1e[^_]Ë @-Q@-y ;P-| t8-J 8-Uh8-PXZUWVS u1ۉ߃=-tVI NyV)XHF `=- -9^-؁}U|WQ1HZYU=-- -u-tjtj-u -C1 mCE -9-؁}ULQM5-GZYMUuX0vOPhI#h-h[%2-H-t -/t1 -- -u- u - KF @t.0NPhI#h-h/"=2tt- -}-8=-t=-te[^_]UWVSu VE=--E`-E1ۉ--X=-t5d-11҉UuiEZUU-5-YUt(EEtBDd-PPjAƒ u- -t C-tjtj -u -uݨuEVu9uuHtg}tIu-=-tEu~h-h/"K-Y^=-u3B=-u-d-=-tJE -uh-h/"tKXZ-t!=-t9uuu$-Cu -19uu=-=-M -=-t1ҍe[^_]UWVS];!uh&"CPXZS h&"PWǃ u$.0$LPSh%h-h/"Ju WYXyh;!u7WLZy40KPSh%h-|h 0"4/Wǃ=-uVh$"h-L d-+E e[^_]UWVSu] }9tU=-t VP*VPoZYy0K0AKPhI#h-h$0".C1e[^_]UWVSQu VJ[=-tW1ۅtW;uRWNZuZW95`-u=-t =-u BRUPu xËUF?륃=-tuX؍e[^_]UWVSPu]>!uhr"FPY_V u PYƒ u$00&JPVh%h-h60"RuSRUǃ Uyl>!u7RFZy40IPVh%h-vhN0".-Rǃ=-uWh$"h-F tE)؍X؍e[^_]UWVSW11 -yh-^u-P-s=- -9-؁}U|WQAZYUu[0HPhI#h-h[%K,-H--tj j =-- -u -uΨu١-u-1ۉ߉ u\--0--u-@t?30)HPhg0"h-hr0"+f%-1--f-9t{t ---މe[^_]UWVSW-C{ u)ÃE-:TRPx Y^tE--9-ށ}VRM?_ZuZA07GPhI#h-h[%*-H-t1-tj tj 5-- -u -uҨu١-5-ljD s} us*Ext-M| thr/")YoE--9~P-߁}WRK>YZ=-- -u-"%-25-NjM}t/s2PR_Zt-D } +s#- -9|R-؁}tVQ=ZYM5-- -u-ux-Me[^_]UWVSQ]utuh0"YXZ} 9EueF95< -}h8-h%%C^XP^w<\u7\t.ˆUPh0"'ZYUtF-0"0"/B000CL r1e[^_]UEH!-EPhht@jX x$Efv@ -Efv< -U=L-uET-E P-T-P-9~ 1;`-~hR]%='XUWVSSu d-}t69`-+=d-=`-=d-t1C~ Ku"=d-tn`-u=d-t[uSPEZYtI=-Mtj jqP;jjjWu{t9d-Hh0"Y&X؍e[^_]UWVSP]U u hR]%.&XU19`-~BPSYX%KMd-uSwP(x?]9tWZu̸1e[^_]UE -DBuh0"%XP<\-u-E-1UE-DBt\-Eh0"R%XUWVSd---EDJ@t t E@-޹-0U?& } $%}^@- --8f|y@t t@-܃tQ18j h-5-3TǍ v8"uh0"A^t-u18UBQ@u^t -uօuhR]%$^1ۉj h-5-SÍ vf8"unt@-`-.jd-_t|%1Ƀ/QP_ZYt-M:+@- FP-@PX.t(@-L-;u d- P-`-9Et9`-}؍e[^_]US1L-d-P-T-P-xLL-T-P-- ;tK,tF L-ʃ~L-P-IuAT-H L-˃~L-Iu J -:;vd-l9tT-t1[]UVS-11Å t]9-u 1ۉ-J@։t-[^]UVSuj21Zu+U0K>PhI#h-h[%!FV CS FC؍e[^]UME 19tx\uHPQZY1҅‰UWVS=-ujEH!-`-Pjhr"h0"/ykh"@]^tZP[=wJ@ PB0Yt:WPXZ|3/t 3/D3h0"S5`-jhr"SjUM=-tI -QU=-ujEH!-jh-UWVSEd-1ۃ=-u-9t =-| t8f%-=-?u1-B-: u)u ?.u tԍ4-WZu# -uo-tj=t[jd-t PTCXPPj0à t9u- --u른e[^_]UWVSSuP-Z;`-|1ۡT-x-@-9t9u SEWáP-ZYUSWjq/ u -t$195`-~FPVjB/ u)ϋ-tj&jSS<[t<\t.RiZÅu!h{$ { uh2"-[1C뵉) l-=h-9-Ё}UtVWrZYUu[c0YPhI#h-h[%-H-t-tj2\j 5l-h- -u -uΨu١h-5-lj-=-tj jRPe[^_]US-< u h/" XH< u=p-u$h32"XJ -R t8u ӡp-PKXu1p-t=H-u P_X9j p-Yu(0 PhI#h-谲h[%hK1҉H-5-S5p-8ƒ p-t+h'h@-PR 5p-1p-R]UWVS-P-M-1ۀx%u}M8Huu-h1"[s9}n-P-- -\P--2< -=-} -U8u-ف}|WuZY=-- -O-tj7jm8uCH-B=-du f%-1-| u6/- -9-؁}tVQZYuV0PhI#h-~h[%6-H-j-U5-- -u-|---e[^_]UVSVu] 1- u 1ۉ|-U -< Uu 1w8uA --JπwE1ɉj h-5-) v8"uh0"1Zgu@-늸e[^]UWVS 5-]t-=x-}+-;|-a&M 9}y;M)9 ڋEE-}RUu ZYUu]0PhI#h-舮h[%@-H-t '-tjtjt-x- -U-uΨDϋ x-M9}}EMELE B19}})É>\GVrω0;UU Mr3)9 ڋEEW-}RUu ZYUt-x- -u-t x-M9u}EMELE B19uu)d9|T-ځ}tVu1 ZY45t-x- -u-_bx-Cw}9|T-ځ}tVu ZY5t-x- -u-x-؍e[^_]UWVS] Sװ^|=-tj jsPlCjPjuj1ɉ Et-}t9U3 9-ށ}V5x- _Zu[x0nPhI#h-h[%-H-b-tjGJj5t-x- -u -uΨuك=-tjj   x-NjEpSP-  9~U-΁}V5x-[ ZY5t-x- -u-=-tjj S6 x-Nj󤋅  ?u9Ћ)ȉË ؍xt-9<t t tjPjugo-=}tV5x-5Y_5t-x- -u-~+ uEthG2"TZDžW=-tjj S x-Nj󤋅 x-f u1e[^_]UWVSd-T-Hd-1ۉ]1P-+T-9Ud-@d-Pmuu PuƃUd-PP[Zx-3E-1SwYu' --tjtsjd-t PۭFZPPjƃ t9]u -u -uuEd-Gd-E  Euh0"XE tu RRK x1e[^_]UWVSd-E`-E=L -t =H -uhb2"NYm=-t -j--E=-ZZk EtTuaPR@POwGHm uu^13^@p][sHZPJJ@BE4qE@E܋]k  9]}3:}z}z}׉}8up}xK Ń=-t聺L -d-EL -H -`-EH - -u-tjt j`1e[^_]UWVS--Ht7k X< u'ʣ-B0Z9tSe;SpZY1-d-L -`-H -e[^_]US-9-}Pk- -EuCk- -u C-P-k -ZY]d-j Ph-J& tPc PhI#h-h[%5-1--1]U踿Phr2"h-j謖 @-Q@-y ;P-| t8-J 8-Uh8-P覦XZUWVSօt%ˀ9u RPh2"RPh2"辟 uqRPh2"詟 `{tZC<i1ҍ{t2Hs!t ,I< ϊG< ĸ>e[^_]e[^_]UPEEjEP5-- U苾h4"Ph4"h-莢jzUWVSf@8tXu1P諿1҉hW3à 膿8#)tSWV 룍e[^_]UWVS} 5-fDž<^1҉hPjkà t[ݾ8Ͼ8u ž1ۉhԗ#Vf8uFt"SVW yF蕾8#u5苾1ɉjjP @ul8th4"jh8%)+jWjfDž=-t fDž9DžjRj fDž9fDž9-jSVU @u軽8tJfu ft>(@ufDž=-u#K,-@tftfDžftR@u KfDžCe[^_]UWVSQ}u VW+Q[ZÅuzjjXZu h 5"j3;s jEPWƃ ?tE8thh5"j蘼8"u wڍF=wfs؍e[^_]Ë@t@Ë@ t@Ë@tË@htË@ttËtËt8UWVSUE x}pHXz}z9zu};zu 9u{9Mtt9u 9MtiH$z$ ~ U~Nx9zu9t):JR ut'p@ u t19Í\ZY[^_]USEE ZAR9QD[]UWVSƉ׋EEE EME19} 9xu90tEEEE1,]9Xu]9XtiB9xt A,9|90uU9P uU9PuACk,QMueZYMu#Tԉ2zur}z uE1e[^_]Êt"tUWRPEY_}ËBt1Uj膏L$qUWSQ---w-ڞw ]]5-5-h5"j 5-5-h5"j 5-5-h6"j5-5-h6"j 5-5-h36"j5-5-hI6"jE$h_6"jzEPP$hx6"jf =-t>u-1 uj4eY[_]aÃ=-tUE Puj UWVS}u _Ph6"j3-B9tT-e[^_]UWVS$ ]5-t(Vv$Vj=0Y^ugh6" j0Pu  % yW'p4$n0ZtWVP u Wh6"Q5%jj0։( y0h6""jju ։ƃ C Wh V%ƒ jjW%‰ V%h _Xuh7"jd[^jh h R(%y RY߉R Zt-w1ҁbt#bt!tu h>7"1 Њ Јt u hJ7"jYu Vـƅ/ t jZV8 jZVP謀 djjP7& -0tS SQPR(&,7kP-Ɖ4W8t t10hb7"j \9s1BFu h7"j 1e[^_]UWVS\]ƍ}ZE5%(,a&V&048EPSSe[^_]UWVSĀ]p$tVP:V9Y^㋃p tV3:V9XZ㍅xP踑1RPuu豲t5 -9ΉЋt}"Q_85 -VPh7"/e[^_]UWVSP] AEH1RPuu蹭ƉMt1׋C|1׋ujQ1RP<t2uPh7"jE01RPuu ‹N tkvkk ыEe[^_]UWVSTE>E8Iu EuEEE EE1ҊM t1҉Ƌ] ڋUӉe ƉߋEE$EЋEt\׸ 1ҊM t1҉9ƉЉuԉ}sMԉU1EUE}t EșŰU9UuU9uM] E} uWVE,# E: =-EEIu E5E@1 t1҉ËM ʋUщe ʋ}t}\SQE,c$h#5-Ãt#EUSjPV{Ht h7"XS蹆X--E1--E<1EEt E\]ԋu)։]uEEIu EE1 t1WVuu#9E E~1҉ t1EUWVRP9E cEEEEuuԋE,#EЃ EtEЍDEȻ8&ELEЍDEȋEۃ0EЋHatE/haQuuPh7"3REЃP2‹EЋ^_9t"ERQuuPh<8"jrE؉E܋EԋU؃EU1ۉ]]]ċEEEЀt)X@}99EEȋ}ȋW:X@9]9EEȋ01}WE9L9U)9E uuE,!EujP1Eă1ɉMEEËE}t;k;xd[}Nj}ljEu 9EcMQRPuEPE]tXpXju5XZ9u9]EE@]k,Pu!Y^Ek,tԉEVFF EUFVEEtP4@0FVGPtP,@(FVGltF Ek,Dԉx(F Ek,Dԉx(@P$]Ep}}EJEt#1 t1EU!X1 t1EUEU9]LEE܃8t)E"9E1EE܃8E\]ԋu)։]uE)‹E#Ju E`Ek1 t1WVuu荥Puuh8"jt E܋P @E܋@1ҍMQRPuEPcE0ju31ۋE;pE܋EE9shI9uEtpp E_uuE,#ujP=.EċE1 t1u}C<҃<DEE܋}k,Pu5E_Zu E}81ۋE܋EEE9k,}}܄t3w 0x}܋t|px u}px}Ћw04/81p}܋tpp u}px}Ћw(,px}܋wp J9utGE܋@ EMk,}D$uuE,ujP,EċEk,E‰r(Er$ t1u}CЋ]E<҃<]DE܋EEEE܃8i}Eȋ];\9E}Eȋ}9x }98EЋP9Ut,EQuRuuPh8"jE]E]E Eu--EEUEԉU}E\uԋ})׋E^EXIu EEEÉ1 t1RPWV躡PuuSh|8"j E}8LEiEe[^_]UWVS uEPF VM]_9EEr )ӉM܉]Fƒu>uFt 11E`E9sWu h8"jRN1ۋE1)ډEUF@]t[ ][]ԋ]1ҋM])ӉM]E9Es 1)EU1U9ЋU_U܋EЋE]ÍEeM1SQRPFVe[^_]UWVS]E 8w1ɉMM9UMK}HPH EU,hj,RWm}EEPhE%ƒyEqRPh9"jxhj,3W}tE1҉ES1EEE9EE}FN9N u;tEUSE 8}tNEEU,뷍e[^_]ÍL$qUWVSQ8΋QRPh/9"1ɉM؉M܉<EPURvSE܉EUjEPURSfMM܋E؉Ẽ1҉UЉU19~k,ŰD$EUGm]<E1Em}----EЋU--ẺEMEPh%ǃ yNQWPh@9"0FPh%ǃ yNQWPhf9"j1eY[^_]aÍL$qUWVSQ9q--,- -?1--1--1h9"VWl ta#DtNJC p7-뷃b$D%--C-C-u5 p7j-e5 p7-R5 p7E-@-/5 p7$--5 p7-X p7-h-h9"TYX-)lj80!h-h9"$XZ=-xh:"!=-x 8u5-t hQ:"jtjj)hw"h+jj[_@u h:"jj hw"ThjI00h:"@P@ uh:"t|j/S5kZYÅu@r-׉hjߝhjӝj$8-PQ-1urh ;"j jv-؉8hDj7803PyP3h(;"jW5-OG9=-=-tf95-~W-4FX烽(ta1(,,9- -_=-tj.u-xrP-0j-dh1҉ldPh -%à t$#8:ha>"jp11ۃ=-*6, -,4@lXRjPjjT($tPhI;"XP :8zJt&Z JZ04z($J 04zh P&1--8Y_9t4VZyPh^;"jPhw;"jJ 3‰.Ju lxtH'‰`R840Ph;" tH891҉ t1҉Ӌ+049׋0|9؋4}Y 9؋4}s8014߭0ݝ0y11SQRP1ډ߭ $%ܝ0v7ء- 40- <0[10=-pݝt{\PSjy ݅y+؉Ph;"j; *jPh;" \`+EU5-9Ɖ 9jS!ZY@݅u؉NPh;"-ܝp %ܝ0 LRjP011RPl$01tZL9rKjQ4#^X0290Q_|OlaGl막 9skQ k4 JHJZH XH J HPW4 D2 D2GlFhjP88P PuPh<"Y[# 1҉D<5--8Hȉ9r09rÉ014#840Ph<"k840Ph<"je04 4111W9m09Ћ4J8JZ8<< 89 +4i۷m۶R<8SPh_<"PDPh-SW(~LFD\`HP\Ph-W\DHY, X049Ѹ4}u014"80Ph<"p1ۉ898r;D\`j\Ph-W\D𙋝09މЋ4}88SK t+4i۷m۶hQRSPh<"DPh-SW|$~FL,NY8&D8t-011҉VPh<"K=98~k,0D$Aۉ7<1߭߭------1XT0 11198 P t$k,0Ћ 9Pu9 tyt_|;TRXR801RP 茎1RP1F P @ 9| ,PQpQRPjW'k,0Љ1;P} PTQXQ8)Q t p|룋Tșڋቅ044؋ቅ=-t 1P-k,8 $98p 9~Љt$DPSh="pPh%ÃNAJQSPh'="j#tV":t&PhL="j,+ePh^;"jw, E$) 048<11ۅt9 k"j ,5-(,{jAY((9-虎Ph>"j(5-~=-th*>"h%hh4>"v؍eY[^_]aUE UMQ1]US]C Cs4SjS)1]UWVS}uj -Zt"Å~{kP‰C X1ɅuS[1A9}XM1BBB BUWUYMukC t 40CYP:S4XZ1C Es1ɉKE CC{{j8y_u.1{ YC 9}k4GZPX7p 1EZB|DBAB @Ѝe[^_]UWVS]s$tV6VXZs tVV^_{G 9w~k4KFYPAW;1XZe[^_]UE@H]UE@1҉P]UWVSEXC9Cuz@CPhp>"j)kCPs zush>"j9C kS41FFF FsZush>"jK kKK E UAQMCSEUCSEURPuu蠋E UMA Q}} EENjEe RPu13%yEsh>"j3 EC1e[^_]UWVSQEXCE19E~4kK qy9u U|Q 9U UQ} E )C@1Z[^_]UWVS]s4FECS,K0UM{ stQRVu t EW:EC C C[MEHEUBȉEEbMRPsW6%9CugCC\MEHEUBȉEEbMRPsW6 %uh>"dYC$Cs4SnXZ1e[^_]t@Ë@ tËÊtBRtUWRPY_}ËBht1UWVS L 1󫍅xPE;hE,ZYËEtPhEQuЋ}ԉ t֋Et+ +@|)‰1,0,9r 14DP0,us F(tȃ0tBE;Pdr,9u:s (tvRPYY09us,9uihv(_tZ t @ (jS#EY[t8(w690u9,GjSXZ (w t WV^_Ɖ׋E t1 $DH 9|([ (E9s@(ERPWV0,h>"(  袋9.}*WV0,h*?"j(fk,V4Z1ɉ0PHD0,hP?"jw ( X k,4 1󫋝,0rrz E(t=@PtȉB DH9v@l9}&E}t8Phj?"4<@E0]\)Hu E1ҋ] 1ҋ] t1RPWV{kDt 18x, $$y11jDP4Pu2DH1 9؋$}W $) $119ʉ} @H9؋}{ =-h?"j.Y^wM t1WVSPE(%=DH9}bk,4_$S˼G(Zj0P4t0$h@"jnMH=-tRP0,h(@"j0EHa‹E1tIu$X1IuEC1 E E t14k,kD,49Et@E@8RjPjjEj8P h PR v%<DHk,49s"4jh E% bRP{@8tGpBu E@- -Xe[^_]ÍL$qUQ 8-4-50-5 -(%EM MuQQ$RPhA"nYMɍaUS]CtS P S tSPSCr s _ZSX <-X]USEPsH) (-,- -Hu0D-Z[9u \-u' \-uh%B"jP4BPQ X4CXZ@]UWVSu EEE# -@-0- <-M11ɅtJA9~ʳ9M}#t0-h9B"h%hhHB"r}9x4u }9x(u9p$t버t0-e[^_]UWVS]uuu SO trNj@thjB"h%h1GGWX9w(~6GthB"h%hhHB"rwVw ڏG [^WY - -;<-X=T-u =L-uBGWuX-GWtPP-WGtG4WPZWX<-j@jVjG _4E UG$W(G,W0wE # -G8@-tz8GC GtWP { _ Ge[^_]USEM PuhB"h%h4hHB"pP ʉPHPPP s E]XPs2H (-,- -1ɉH H-HH-.1ۉXt X-HX- P-HP-P4JH8@-9t!tXYX tAP]UWVSUu }uWVRcËECUt8-R4-EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMq= -Y,A0Éa,ڋyY I4 s RPWSQ% RPWSQ %e[^_]US]C%CSjS]1]UE UMQ1]Uj\UU Pl-PYtHJ l-@ l-UWVS] h-C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpd&C${s ]e[^_]UWVSuE EEEE%-1҅9su}K}9y,u^}9y(uVK0ts4q4s4 -K0ts0q4--C4d-=h-~ttpRZg{$u{uCuڋ[0n=h-~ tRkX`-l-t$;3uEE EEuCe[^_][؉؍e[^_]UW1h---11҉l-_]tʋTËË@t@Ë@ t@Ë@tË@PtË@dtË@htËtËtËttËLt ËTPUWVSS]CE -K,ϋS0c,ʋ{s K4 es RPWVQ%9Cu CC17RPWVQ %uh>" YC$Cs4SXZōe[^_]UWVS]{4Cu2wC t1t)F@VD)F,C @CWSjS1e[^_]UWtBRBR t RP3Y_}UVSӋEU tt RPY^CSt RPY^CS e[^]USËt-w1Ɂbt#bt!thbRhB"91 Ȋ ЈS^Z19tPQhB"N Ћ]Uuu 腵jDUSt)P8X<)P$[]UWVSƉUMXC0E)ЉEE+}}t/ujRu uVtEjE0rY[EOEmCdpx K}t)Eus C EUP 1׋MXZ1e[^_]tËUWSÉЊӃtTtDptRP!Y[L(ștșe[_]UWSvh2C"h%h hCC"gÉЊӃttRPY[LXștșe[_]UWVSvh2C"h%h"hCC"3gƉӉȊʃt$uҁTXe[^_]UWVS vhhC"h%hhCC"fƉӉȊʃtutp|tҁT(e[^_]UWVSSÉЋu} 9r4"E t19ur Y[^_]Et# #!Z[^_]UWVS(M}tE1҉EUЉÉ3]3u]u)EUtApE̋ẺEԃ}tC}u}u}11 9E}|])EU 11 9E}|0)EU11 9E}EE EEEE܋EU+EUu؋})׉u؉}܋}E؋U܉WU)ЉG1x EEHEEHE̋E}tUE؋U3E3U tE)ًEU t}!EЋUu؋}܉2zB1r EH)EU랃}tE]ЉEEԃ([^_]UWVST} uU _ ;EEr*t1MEƉ׋E.BuuuURU VuuWu:U ENEEU1MVEUE EtE9Eu%E9EuuuW ut jS[XF EPuuWFË@u7ENEU t1C,S0C CC4SPYNS EkEU+t jS\XZEu} t1 uE0x1e[^_]UEjjuuu Pp$UWVSSE E}E.ptVEX Et ËtRPYYËCt1N9u9Eu1ۉ؍e[^_]UWVS u}j8j~ËEEC1CC=_C_C 2h1C C$hj~Ehj~M쉁j`j~MAdK1AHA 19Et EXEaMQjR t1WVEPUBBRUuu uƃ(Uu7jRmE EpduSEE싀}@u jR^_}E UG(W,}x0xdEtFVtRP YY Fht1҉GW EWW 111E싐E t"EHdMWV‹EZYFM uh-EE %-S0tK0J4--C4-C(tS(P,-C,-މe[^_]UWVS4E$EE tPPED1EEEv#]]܅xL}҃}}܅x.}҃8U }}1E2hyC"h%hqڋE+E 9zEE }uQ@9E}]]B E؋E[CEԋM܋EEȉEyhyC"h%hhC"]@]9~ ]B뫋EEPzE̋E<ƋE_DE EE1 t1u}u}8uE=0E E1u؉uȉuЋEEÉËE _H9MjEEÉE tPPE ÍD19E Et"]9X}98E }]9EXEMQjRu} t1WVu8EE؋P }̋]؉TjPEȃ Et-}1 t1u}.E\]X1 t1u}Et E @E @}9} tuuuU 1ۋEԋEEÃ9I9uEtpp EZƋEEPjVEU t1RPuEE؋P }̋M؉TjP Ee t1u}CL<҃<DEEHE9E PE PEƍD19Esx9Mot }_] 19]u 9MLPuuuhC"}t/EEtP1uuRPhC"辧]9]tSuuuhC"蟧uu] SY[9t$PRuuh-D"suI1҉U u7XE܍e[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEEUu}1ɉMԋE9EEIu EYEdE1ҊM t1҉EȉŰEtE؉UE苀\EE܉+EUuuRPYMeEU9ui9ue 1ҊM t1҉EȉŰE9u E9uu}1ҋE E؉]9]|9}u 9uu}B uϋE‹EÍMQjR t1RPuEX E芀E؃{atjuXZ}uc{EtK 9u׋S(C,K9puċS C$M9ErU؋EPCPWZYU9닋E芀{at WVhyD"wtC M苉9t.CM苉p9t$1SQ1RPWVhD"蠤C(S,C S$]9UrSPWVhD"rWVhD"^ ~}t5EtC(S,C S$9Uu9EtPuhE" EUjuuWVSuEE؃uju [X }t$EtC(C PWVh/E"辣}hFE"h%hhC"UEzEEAEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋ESEMIu E1ҊM t1҉EUEU+EUuuRPUEuuWVrU9EuQE}lj1ҊM t1҉Ɖ׋EUă+EUuuWV!U9Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMju#XZE9Ƌ}E Euu}eY[^_]aUWVS ] }t$Ɖ׋EWVRPhME"臡EuE‰9u+|vEL։A9u9u V9s9sE]Ã}th^E"8h8- -Y^tCpStCHuRPuuEU}t hE"xZZEEt};{tua};{p`dKH9}u@9Mu;}Et `d)RPhE"F-6EtM}`d)RPhE" tCpStCH9Uu9Eu ]1EEe[^_]UWVS u }j8j]oE1҉PEMAx[A[A [1ۉY Y$XZ}t.hjoËE쉃P^_ u = -ƉE} t hF"X[1ɉM -EPjh WVu*hjnËEp }쉻PP P jPXZtS Su -}URjh  t1RPuhjmEEp }}M쉏PP P jPW^_utCHSLC419|} tMh7F"WY@Et} t#hlF"yWZu uuS9u u臛X S~X]=t SiXktLǃ1҉l1AǃLcX1҉ \X`1dt}uWj+lƉ_tCtPl^tCtPkFY} }u tCHSLEU#C4EEEt UCHSLC4uuE0jjSu1 h5|SXZ؍e[^_]UE Puj - UWVS]FHljL1RPuu pNEUt1EUEU싃C|1EUEU싃URjW1EURPVtPu hF"@ u~ 1RPuu LtDTEU"7vkk ׋GEEjV XZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuuM€}tKt19suu苃0uu Se[^_]UWVSE@E@0Et ExEau } tu}}tE1ۉEEƉ׋E t1 9E9ƉM|BEE]Ɖ׋E t19E]WVUEZY‹E@9sq~mE}u1PWVE0ƒ E ]RPʋEEH^_}t EP4PR[ }9}TtuuUEZY|x#] ]Ett E!ËEU t19r^Eމ}t(SuuusE}@,@0E@dpx E\9||>}5EPj|uuuƒE}E}u1Puuً|Eƒ }븍EPEPEPuuuu?ƒE]x]tCu xu}|9|~|uAEE@dPx |xt!@uEڋE u ڋE|<ڋEylp]DžhE.Pssu{‰E{up H1E@,@0S@uIB4dERlp t1r,z0B BRdP_K}w Ea u$EtDE/lpG4WP^hh9|c}uuUEZYPuuuO‰EEtxB,B0(}u }ut x|t |u4EMEzEME|KE?t|URjPWVutWVhF" LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1҉Ѝe[^_]UWVS(}^:EUEU t1҉E܉U7URPuuVEԉU؉ EE1EURPKt1ҋM܋])Ӌ1ҋM܋])ӋG|1)ӉƉƉE܉É֋EƉrvaPJURjujjP>t PhF"XZMA tP@G(W,@G jQYXtG(W,E܉U_(w,G 1҉E܉U_ vbBHMQjPjjRt PhF"`XZEP tZrZP4PR:XEԋE1EUh‰1 t1҉щ‰3EEP tJUЋM9ˉE}#E1ɉHHXpE ϋEM܋]L\}UЃv8M9ˉE}E1ɉHXEkEu܉t6M9ˉE}E1ɉHXE ku E܉D2BHSMQjPjjRt PhF"XZMq EUtF V$FA4QP:E̋@4uP1e[^_]UWVS]vfBHMQjPjjRt PhF"B_XEP trzs({,RS jPHY^$EtC(S,C 1҉EU苋AM؃H/E^1RPuuAƉ׀}Mt1׋C|1׋URju1RPQtPuhF"d Ep 1RPuu?t֋F Ft:_vkk փ~t*uuhF" tFVC(S,FC vkBHMQjPjjRt PhF"XZEP t~vrzNJP4PR:Xju_XtC(S,C 1 S^Et UC(S,C IvkBHEMQjPjjRt PhF"ZYEP tu}rz}zP4PR:X17-t C0S4C(jjP0uu Se[^_]UVSUE 9| 19[^]US-CPPh*G"h-4'h-haG" -CtsPh"h-'jUSSE] t$uh#s?6ZY¸tr1EEPhvd5-) @u35-hk"j=]UWVSPu }t}~^h"S5Y_DžtFh&"S5_Zt)hr"S5ZYthyG"S5[_t뫿}}uhG$vh5ZYuUEPhud5-C( @u65-hk"jle[^_]US}tQ,Shzd@5-' @u5-h|G"j e[^_]U05-hk"jUSS}tE Xh/#S)ZYthL"Ss)ZYuEEPhwd5-O @uE ]UQ}trEPhd@5- @uE O5-h4L"XZUS d).h).t `).1Ӊȉ[]UWVSӋ}'.uƍ&.u(PpPP?P*PpPP?PPJE 7 u9tN7k?9[^_]1&.x@uUWVS։ˋ=%. %.11~B? ʋE[^_]U%.?%.jh>RP*4=vu%.UWVSQ5$.Ctt+ t&Pσaw <v ;v ju_{Gfw$k A E1E)й 19u5{$ -1TtDQt!@ u 9u1 Z[^_]UMU 9|]UWVSƉ׉M%.%.ÉEE1RPWV2E)Ɖ1UQhw%9XZ}Ut%.H9u%.H9u u9rBRWhL" e[^_]U塨!-=$.tvPhM"5$%.5 %.5,%.5(%.50%.hM" 5 %.5%.5%.5%.5%.h8M"5t).h_M"y PhmM"fhwM"d4(%.,%.5!-5$%.5 %.QRP50%.hM"',hN""4%.%.5 %.5%.QRP5%.hN" 5%.5%.hnN" UWVSQƉ21ۉjEPV赏 >u#ËE8un28"u w܉1e[^_]US0P#$1!#Ph1!#Ph1!#Ph1!#PShN"h-,jUWVSEM !-9uh9Q"5!- hOQ"jًEEUMjؙ]!É]]!Ӊ]uuWBuAtV!-!-=PuR6 3P5.R6 9!-uNE!5.}e[^_]UWVSEUϋE E컙F"ti"EU@uShlQ"蚊XZff=Ut+=$.t fuuShQ" ff=u%CthQ"fLJ_f=Ut1=-u ShQ"Y^-tShR"XZj(VP9 x0XŃ~X R%.t\fLJᵃVe[^_]UWVS9x).u`).5`).t1Xƃ'.e[^_]W|$wUWVSDEUȉM̋EGWEUċG WEUEER"EEtEZ"11}=!-E%.%.U1҉U܉E1ɉMԹEM]̋ERPSQ-PE؋UEUuuRPi-RPuuȋE؋UEUuuRPE-RPE؋UEUuuRP'-RPuhMR"z ,"uuuuuuuhR"V  h-jdh(. u hR"jCh-#h(.|+Y[(.U슀(.< <$u z Ћ -DQu<-7j EPh(.Ɖ׋EEh-%P踌EЃEPhR"uf tuhU#uO t L =!-Ήʋ5%.11WVSQ+ƉuhR"u ui %.ω%%.Ɖω uEt5%.1Et %.1Et %.1)Et %.1)׋E؋]؉E]h-#S)YZÉ]; t,h(.Zƀ(.uh(.hR"l  9uE|E9Ɖ]}.uuuuWVhR"4 uȋ}u}e[^_]g_USE PurhR" -H- yh-TY-P-؃ t9@t* -y h-"Z-P-8 u hR"j~1Y]UWVSEM䡘!-E@u hR"j`~!-EӍEƉωؙ!M!EjuuuBu @u!-!-uhuP. nR5.P 0 9!-uVjuu5!-Bu@t.K!Nju5!-R5!-z. 9!-ue[^_]UWVSRá`).u ƀA Mz΍t). S}8PR t). e[^_]UWVSEыEU u1+ˀ %.1ۉƉ)߉u}};=d).}=h). S"EUEUE9l).p).}=$.t Evt).KiE9t 5`).tމ&ʅu+%.9UE}M1E܋E9E܋U}t0}t}utsƆj/S"ZS"ȃ[^_]UWVS EӋEEht).@Ph`).(E 5t).t h~S"j{EU9E|E9u|`).] }) VRP5`).31fǂU }u@%.5d).֋M)}CsKSCPKSs FSjt).Ee[^_]UWVSE}u&'.ƒ<1IE E#֋EU EUEUE9 %.$%.M@%.19Et\tSMM1ۉ]]9ً]M}3M9MM }S"=$.]@uER%.˃t h). d).t!=$.>x).1hjf`).[^u hNA"j!yfǀUEx).EU d).h).EUl).p).t).ytbt]t E^t).QHu`).<=$./hOT">Y7T"gV%.=h).t).;d).KxZ 5`).t1;EM |9UE}=$.t`룅d).E 9h).u;]t~t).H`).1+]9~ Fu%uF PPRI t). *%.1RPEU d).+E`).XZEU d).h).EUl).p).S"S" T"S"Ѝe[^_]UWVSË@S t+5 %.=$%.9u9t hT"Y]sǹ󥉍1󫍍@u'CT" CuF"RhT"|XZߋe[^_]Ã=$.u x t"1UWVS|Éס4%.tPhYj/S^ZuS5!-h_'%h4%.|# S蹨4%.Y4%.u hNA"jujP (XZy54%.hV${[^xPSZY@tMuи 9E} 54%.hT"T 54%.hT"?h h.SR' 9t54%.hV${f=.Ut54%.h U"Y^S6(XS-(Z tj'e[^_]UWVSÃ=.u1Ҹ#.f=&.u1f=.I؁=.t#.@%..󤡼.f&.f>'.Ut&.1>'.u[^_]UWVS á&.fE%.%.%.@%.11t#f}u&&.t9r $uɡt).E `).19E~+f:uzti 9t@Ћ $.t=$.uaf}u&.! 9*=$.tu7hU">Y=.t f=.u/hU"h@%XZ=.tT.!94%.=$.tPhRU"_XPhU"ZYt 1=. =.uL#t %1j.tr.!9tSP54%.hU"k=$.t1~f=&.u3 .54%.h/V"ZYu&. %te[^_]UWVS(ÉEU EUE؉uF=$.EmV"e[^_]c11ɉD11ɉt<u ȉhjhh%PY2%tPQRhvV" fu1k t Ph1!#hV"XWVh1!#hV"2 =!-RPSQ{PhV"Y[=$.u" %.9u1ۉ)11ɉj-j)XZttC9Eċ]|N1ӋF19Eċ]}|]9؉ӋM}EUG롾@%.19}tHt?19Eċ]ȃ|19MċE}]9؉ӋM}EUGu EċUȉEUEU+EUȉEUE Eu hzY" E Et}u9}E}}u%.%.1RPuu u 9tۃ}u E9uuujjR4#EUEPuhY"hY"h-jdh(.u hR"jch(.M[vEHƀ(.t'(. t9EEHPh(.hY" uh(.EPo uċ}ȋEEă}t6juuWVUċE$.uD<=$.1EjuuWVUċEu=$.tKt$|=$.us=$.t PhV$j[P]juuWVUċEt)/juuWVUċEu}t }tPhV$ja}uf} E U u }EfukE } 1E}t Dm:}ta}tE %.1 d).h).9u19tuugZY `).UӁþ]EU]̊EĈC})}̉Guw OWPE̍HPD3}̍_S^_E}tgfǀuEPkE }P,$. =$.u=$.<t t).(hY"Ytfu'uEPkE }P =$.9=$.t hZ"Zu$.}ft=$.hY"[E̊@EċE̊XEčE@‰%.p1WVjjjKZ"E1ɡ%.p1WVjjj^Z"Ã(Uă?1ɋ5%.1WVjjjmZ"^}̊MO_U? ˆWGEĊ_EčG‰%.p1WVjjj~Z"E(1ɡ%.p1WVjjjZ"ËUă?1ɋ5%.1WVjjjZ"}̊MO_U? ˆW(} `).uKye[^_]UVSá$.u hZ" X1ۃ=$.u Sh"Y^jjڸ@%.CXZu҃=$.u=|).thZ" X1L=t).thZ"u ShZ"kY^g `).RP1҉8XZ=$.tC$.9t).A=$.~hZ"5`).j5h).5d).RP 믅<f=&.th:[" ^h["[&.t=h@#&.Y=uh[""k Ph%["pXZ hZm"bXhF%_ X=$.nPhO["9Y[=$.&.PPhk[" j=$.t>u Sh["XZ9t).} h[" X; `).RP1҉u Sh["Y^jjڸ@%.XZe[^]UWVS ˋDžF" t DžT" @uh["aZYߍ1jh["Sz t 1/9Cu苅9Cus Pj  ;Cuă=$.t.{ t(s$s sh["e[^_]UVSPE!-;!-u*=$.u!URhmdPW y h#`X@%.11@uh\"B=.u111H.~ ف.@uh>\"z`^E`).01C;t).}. `).d).h).@@uShS\"4`Y[1҉U!-;!-u*=$.u!URhmdPt y h#_Xe[^]ËUPhp"h-jUWVS|E|x).wSh$q"h-jSBEZuhu"I|\us11t\Uhܺ%S UB 9~Sh$HXZ]e[^_]UWVSu} EU MahG8lG,p1pd1ld1pPQhJu"j@tPgC1w,pC1w8p1w,PQhJu"j@UR00URtPhhSu"sQhhau"VC S6EXZEE FEe[^_]UVSSPPVu ujVShF%_a,@uLtv"t"0EZv"tv"PShv"jNjLUVS]u VSYZu Sh\w"jN;/t"Shqw"XZu Ew"e[^]e[^]UPhw"h-jUVSPh&"P=[^t,PjPuV Vt jPZYSXe[^]UWVS EEu EE}]EEE1҉+.%1ɉ +. +.hw"Vu9 NtJb$%1= +. +.$+.+.+.뗡 p7+.jWh@%5 p7u hv"jgMPYY(+.J-4E)Ѓt~S6EXZEE FEe[^_]UWVS4SPPWu uuzjP+XZt1h&$9}P ZY uċ2jWSh%6^@uLtv"t"0B^v"tv"PShv"jKt%@u=+.p&+._+.MDžw"= +.tDžw"+.t #P=(+.t |%=$+.t w"=+.t 5$1ۉXP9Ihw"h%jKShw"hx"V|u h 5"jJj/G PZYt|<Shw"hx"V%tj/C PsZYt|Q<XjUVS]u VSLYZu Sh\w"j,J;/t"Shqw"XZu Ew"e[^]e[^]U.Ph7x"h-6j@"UWVS]u1 11҉t11ɉphtx"u u4 athg$%5 p7`CpX5 p7!CtXDžp5 p7XCxXDžt뀃K|wK|njVh%5 p7u hv"jHPGX<-P;UtU tu4uVEptFuxPVvgY_@t#ECpJtuUxPVSg_Z@u8Vhy$jGdHxPV4gZY@tuECpECttu E%Cxe[^_]UWVS SVpPtWu uhWpSh "Y,@uSVhx"jGGr@t@1RPh%hSShx"C(jUSP]jEPS-QU :9uySu hx"jG]US]SZt@ h"SZY]US]ScZt@ h$SsZY]USP]jEPSPU 9t :uy Shx"jF]UVS]u VS覜YZu Sh\w"jF;/t"Shqw"vXZu Ew"e[^]_e[^]UEU 19s f3P]UERPZYË@t@Ë@ t@Ë@tË@htË@ltË@ttË@|tËtËtËttËHUVSӋEU tt RP|Y^CSt RP|Y^CS e[^]UWVSӋEU ΃tt RPm|Y^CSljtȉlj{he[^_]USt)P8X<)P$[]USt)P@XD)P,[]tËUWVSEUˋuE FUU tJ$1EE ~uJ1EE ~<$ffCRVڋE E CRVڋE uEE }t>}tWWV+{Y^Ɖuu{YYEU0`}tΉȋUʿBUƉ4s {$s({,s0{41{D{@{HUM䉓CPsKC 1sss$S{l} E 5@+.=D+.}t M U JpD1HӉ5@+.=D+.}tCS}t#RPzYYCh}t1ҋM M  t1WVڋE BY^1U ~ 9~}t 1҉TpTt1|(@ԃ} }t1E 1ɉKXE HpED1Hy~Fuh2C"h,%h"hCC"}t1҉1҉TX1HF붍e[^_]ÍL$qUWVSQXAAA TAAAAA A$A(Q,A0A4PA8xA<@t1É1ɉWVK1҃t0119s#hx"3+ZRPPH0jjjjXSËP`%F߉ȃ ߃@C C!C(1C,ǃ ǃ ǃUƃƃǃ ǃ ǃǃ1ǃ1ǃ1ǃ0xfǃƃbCC CC C8CT Cd@ChClUCqǃǃǃ ǃ ǃǃ1ǃ1ǃ1ǃ<fǃBƃY PCh%VZYth%Vhx"( u&;s5;slDž:DžDž u;tU('DžuLDž Dž;DžsDž ~|t~(uydhy"'^_PDžDžt9t h^_@ Gt3~S@1҉P-HG 1ɉO$)~\@HG~F F <@4PXjjXjjS'ptK KS1P1ZY$~dt.<f%Tf-f1GfFjs ,<f%Tf-f1ɉOfFjs1)щ1 t1҉GW jhZY<f%ffAXZ1ɉ19sDA u҉=v D PjVjj{@ Dž@%Dž1p^_<҃D 9sh~"5`+.hk" Ft Pt#u?RPHXY^f*uGɉf1VfN@ tBh-~"h%hqfFu=@ A)G G p 6p<uGG9rhG~"h%hhCC")9rhf~"h%hՉϋ)1󪊓t@@tf)thx~"h %hh~"LP4PRAH‰ljX1OtVjR1RPQytPjhF"66 H TƸ1tvkk ʃ@u51rrrrB 1z0z4z8z<@1OBB~B1ɉJJ(MB 1BBZN9s1BBrz 1BE]9s1BAJ1B$79s1zAJ 1r@4PY=/.u jSqqXZt 1{@{D1s,1ɉ9\FH|‰1RjQ1RQVAtPh}"3‹p JuI!F u1kF FtL<1 t1F tX1 t1 ‰ ‰1 t1ҋtC@SDC,F t 1 t1҉щ‰8ubvVt \Ɖ 1 t19Ɖs)щ‰jVXZ$t,CpSt'CH\+ƃu 1 t1WV,@Ή+tC@SDC,)ȉʉщ‰_1v- 1Ҋ t19sƋ1𙉵st'{++C8S<++C$BHQjPjjR t PhF"/^_A |tVC@SDs8{8tGpBuPE/.!-Xe[^_]ÍL$qUQ /./.5/.5!-(%EM MuQQ$RPhA"贙MɍaUS]CtS P S tSPSCr s ZS /.X]USEPsH) /./. /.Hu0/.Z[9u /.u' /.uh%B"j P4BPQ X4CXZ@]UWVSu EEE#!-/./. /.M11ɅtJA9~ʳ9M}#t/.h9B"h%hhHB"}9x4u }9x(u9p$t버t/.e[^_]UWVS]uuu SO trNj@thjB"h%h1GGWX9w(~6GthB"h%hhHB"`wVw G [^WY/.!-;/.X=/.u =/.uBGWu/.GWtP/.WGtG4WPZWX/.j@j4Vj*G _4E UG$W(G,W0wE #!-G8/.tz8GC GtWP { _ Ge[^_]USEM PuhB"h%h4hHB"%P ʉPHPPP s E]XPs2H /././.1ɉH /.H/..1ۉXt /.H/. /.H/.P4JH8/.9t!tXYX tAP]UWVSUu }uWVRcËECUt/.R/.EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMq=!-Y,A0Éa,ڋyY I4 s RPWSQ% RPWSQ%e[^_]US]C%CSjS]1]UE UMQ1]UjUU P 0.PYtHJ 0.@ 0.UWVS] 0.C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpdl C^ ${sJ ]e[^_]8 UWVSuE EEEE% 0.1҅9su}K}9y,u^}9y(uVK0ts4q4s4 0.K0ts0q4 0. 0.C40.=0.~ttpRZg{$u{uCuڋ[0n=0.~ tRkX0. 0.t$;3uEE EEuCe[^_][؉؍e[^_]UW10. @. 0.11҉ 0._]tʋTËË@t@Ë@ t@Ë@tË@PtË@dtË@htËtËtËttËLt ËTPUWVSS]CE!-K,ϋS0c,ʋ{s K4 es RPWVQ%9Cu CC17RPWVQ%uh>"R YC$Cs4SXZōe[^_]UWVS]{4Cu2wC t1t)F@VD)F,C @CWSjS1e[^_]UWtBRBR t RPy;Y_}UVSӋEU tt RPH;Y^CSt RP3;Y^CS e[^]USËt-w1Ɂbt#bt!thbRhB"91 Ȋ ЈSZ19tPQhB"ʎ Ћ]Uuu j(USt)P8X<)P$[]UWVSƉUMXC0E)ЉEE+}}t/ujRu uVtEjE0rY[EOEmCdpx K}t)Eus SC EUP 1׋MXZ1e[^_]tËUWSÉЊӃtTtDptRPg9Y[L(ștșe[_]UWSvh2C"h%h hCC"ÉЊӃttRP8Y[LXștșe[_]UWVSvh2C"h%h"hCC"yƉӉȊʃt$uҁTXe[^_]UWVS vhhC"h%hhCC"ƉӉȊʃtutp|tҁT(e[^_]UWVSSÉЋu} 9r4"E t19ur Y[^_]Et# #!Z[^_]UWVS(M}tE1҉EUЉÉ3]3u]u)EUtApE̋ẺEԃ}tC}u}u}11 9E}|])EU 11 9E}|0)EU11 9E}EE EEEE܋EU+EUu؋})׉u؉}܋}E؋U܉WU)ЉG1x EEHEEHE̋E}tUE؋U3E3U tE)ًEU t}!EЋUu؋}܉2zB1r EH)EU랃}tE]ЉEEԃ([^_]UWVST} uU _ ;EEr*t1MEƉ׋E.BuuuURU VuuWu:U ENEEU1MVEUE EtE9Eu%E9EuuuW ut jS[XF EPuuWFË@u7ENEU t1C,S0C CC4SPYNS EkEU+t jS\XZEu} t1 uE0x1e[^_]UEjjuuu Pp$UWVSSE E}E.ptVEX Et ËtRPC3YYËCt1N9u9Eu1ۉ؍e[^_]UWVS u}j8j"ËEEC1CCCC '1C C$hjEhjؾM쉁j`jƾMAdK1AHA 19Et EXEaMQjR t1WVEPUBBRUuu uƃ(Uu7jRmEO EpdD u< S6 EE싀}@u jR^_}E UG(W,}x0xdEtFVtRPf1YY Fht1҉GW EWW 111E싐E t"EHdMWV‹EZYFM u0.EE % 0.S0tK0J4 0. 0.C4 @.C(tS(P, @.C, @.މe[^_]UWVS4E$EE tPPED1EEEv#]]܅xL}҃}}܅x.}҃8U }}1E2hyC"h%hqڋE+E 9zEE }uQ@9E}]]B E؋E[CEԋM܋EEȉEyhyC"h%hhC" @]9~ ]B뫋EEPE̋E<ƋE_DE EE1 t1u}u}8uE=0E E1u؉uȉuЋEEÉËE _H9MjEEÉE tPPE ÍD19E Et"]9X}98E }]9EXEMQjRu} t1WVu8EE؋P }̋]؉TjPEȃ Et-}1 t1u}.E\]X1 t1u}Et E @E @}9} tuuuU 1ۋEԋEEÃ9I9uEtpp EZƋEEPjVEU t1RPuEE؋P }̋M؉TjP Ee t1u}CL<҃<DEEHE9E PE PEƍD19Esx9Mot }_] 19]u 9MLPuuuhC"}t/EEtP1uuRPhC"{]9]tSuuuhC"\uu] SY[9t$PRuuh-D"0u 1҉U u} XE܍e[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEEUu}1ɉMԋE9EEIu EYEdE1ҊM t1҉EȉŰEtE؉UE苀\EE܉+EUuuRPKMeEU9ui9ue 1ҊM t1҉EȉŰE9u E9uu}1ҋE E؉]9]|9}u 9uu}B uϋE‹EÍMQjR t1RPuEX E芀E؃{atjuXZ}uc{EtK 9u׋S(C,K9puċS C$M9ErU؋EPCPZYU9닋E芀{at WVhyD"wtC M苉9t.CM苉p9t$1SQ1RPWVhD"]C(S,C S$]9UrSPWVhD"/WVhD" ~}t5EtC(S,C S$9Uu9EtPuhE" EUjuuWVSuEE؃uju [X }t$EtC(C PWVh/E"{}hFE"h%hhC" EzEEAEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋ESEMIu E1ҊM t1҉EUEU+EUuuRP˕EuuWV踕9EuQE}lj1ҊM t1҉Ɖ׋EUă+EUuuWVg9Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMju#XZE9Ƌ}E Euu}eY[^_]aUWVS ] }t$Ɖ׋EWVRPhME"DEuE‰9u+|vEL։A9u9u V9s9sE]Ã}th^E"yh8-SmY^tCpStCHuRPuuEU}t hE"辚ZEEt};{tua};{p`dKH9}u@9Mu;}Et `d)RPhE"$@.6EtM}`d)RPhE" tCpStCH9Uu9Eu ]1EEe[^_]UWVS u }j8j裯E1҉PEMA2AA 1ۉY Y$XZ}t.hjbËE쉃P^_ u =!-ƉE} t hF"[1ɉM!-EPjh WVu*hjݮËEp }쉻PP P jPXZtS Su!-}URjh  t1RPuhjEEEp }}M쉏PP P jPW^_utCHSLC419|} tMh7F"ޗY@Et} t#hlF"迗Zu uuS9u u X S X]=t S XktLǃ1҉l1AǃLcX1҉ \X`1dt}uWjqƉ_tCtPK^tCtP%FY} }u tCHSLEU#C4EEEt UCHSLC4uuE0jjSu1 h;SXZ؍e[^_]UE Puj!- UWVS]FHljL1RPuu 趎EUt1EUEU싃C|1EUEU싃URjW1EURPVtPu hF"@ u~ 1RPuu tDTEU"7vkk ׋GEEjV XZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuuJ€}tKt19suu苃0uu Se[^_]UWVSE@E@0Et ExEau } tu}}tE1ۉEEƉ׋E t1 9E9ƉM|BEE]Ɖ׋E t19E]WVUEZY‹E@9sq~mE}u1PWVE0ƒ E ]RPʋEEH^_}t EP4PR[ }9}TtuuUEZY|x#] ]Ett E!ËEU t19r^Eމ}t(SuuusE}@,@0E@dpx E\9||>}5EPj|uuuƒE}E}u1Puuً|Eƒ }븍EPEPEPuuuu?ƒE]x]tCu xu}|9|~|uAEE@dPx |xt!@uEڋE u ڋE|<ڋEylp]DžhE.Pssu{‰E{up H1E@,@0S@uIB4dERlp t1r,z0B BRdP_K}w Ea u$EtDE/lpG4WP^hh9|c}uuUEZYPuuuO‰EEtxB,B0(}u }ut x|t |u4EMEzEME|KE?t|URjPWVutWVhF" LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1҉Ѝe[^_]UWVS(}^:EUEU t1҉E܉U7URPuuVEԉU؉ EE1EURPKt1ҋM܋])Ӌ1ҋM܋])ӋG|1)ӉƉƉE܉É֋EƉrvaPJURjujjP>t PhF"XZMA tP@G(W,@G jQYXtG(W,E܉U_(w,G 1҉E܉U_ vbBHMQjPjjRt PhF"`XZEP tZrZP4PR:XEԋE1EUh‰1 t1҉щ‰3EEP tJUЋM9ˉE}#E1ɉHHXpE ϋEM܋]L\}UЃv8M9ˉE}E1ɉHXEkEu܉t6M9ˉE}E1ɉHXE ku E܉D2BHSMQjPjjRt PhF"XZMq EUtF V$FA4QP:E̋@4uP1e[^_]UWVS]vfBHMQjPjjRt PhF"B_XEP trzs({,RS jPHY^$EtC(S,C 1҉EU苋AM؃H/E^1RPuuȁƉ׀}Mt1׋C|1׋URju1RPQtPuhF"d Ep 1RPuu(t֋F Ft:_vkk փ~t*uuhF" tFVC(S,FC vkBHMQjPjjRt PhF"XZEP t~vrzNJP4PR:Xju_XtC(S,C 1 S^Et UC(S,C IvkBHEMQjPjjRt PhF"ZYEP tu}rz}zP4PR:X17$@.t C0S4C(jjP0uu Se[^_]Ë@t@Ë@ t@Ë@tË@htË@ltË@|tËtËtËttËLtËXt Ë\UE @(]UVSuE H$X(1y6)tNp1SQRP+ e[^]UWtBRBR t RPY_}ÊtBRtUWRPuY_}ËBht1UWVSӋEU ΃tt RP4Y^CSljtȉlj{he[^_]USt)P@XD)P,[]UStPpXtPH[]Uh"h %hhCC"u|UVSuE H$X(1y9)tNp1SQRP e[^]UVSuE H$X(1y9)tNp1SQRPq e[^]UWVSEEEH@}W4}t D) D)ƅ  Ex 19}5uVSh"` E|BD1H)CNjEahE@ EDžp!-pp@tUkl1ɍ9~ډM}}x1:xURjV1RPQdtPERPh}"E‹Mq EJu KE! E1k֋^ jQ XZE4fHEu_ƋEJƋE1 t1E虋uƋEEڋ}tG`Wd}G@e[^_]UWVSEt1Pl@hEUE1EU}+GpWtEUG$:EPDUME@`1҉Ɖ׋E@H+EU)׉u}E@1ɋ}9ȋ}7UMEFuE^$EEtphxlppxt@DƉMAHE)׋EEIu E3E>1 t1҉MRPWVk‰C0E}Mtp`1 t1s(EAHEpNjEƉ1ƋEURjW1WVQ賹tPC01RPh}"kE‹EEp {0E,Ju I! 1kF t2EC 1 t1Ek( ju!EZYv{0t EEBƉ׋EE 1ҊM t19Ɖs)щ‹E[M t1 ))s(댋Eu})׋EEIu E>EI1 t1҉MRPWV iC0EUM t1C(1E܋Etppxtpxx|E@HƉMALE1CCC$C@CECE‹ER t1RPEPEE}8W S E1CCC E}EEDu1 t1ES Et=p`xdrz1BBaB8C1B8BPC41BHC(})8OE@@B 1zBaE>BvB0C1҉PS41p C(})҃0C(E)ЉC,E@rEx<u/.@/./.E@@]CjSJE܍e[^_]UWVS,}E @u +FEHPE؋AHƋE X01ÉURjV1RPQʵtPE @01RPh}"‹EEp E @0E܉F uMMЉF <u v0E@4uPu誀E܋E PEHEXYu܃}tC1ɋ9H~@ Ɖ߉UPSUȋ AAMX뷉Oơ(@.,@.Nu"h"h%hXhCC"bt5C0S4C(S,C 3C(S,PTPTC S$pCE @0膮E @BBEPuϦ CPCP赦^Zuҭ ‰E1 t1҉É։1 t1Yt)G8W<)G$}u h "jAE Xu9utpE MAP9q4u8@.<@. y(xH@.L@. @@.D@.A%AQE@P@.T@.EY눋E0@.W~Z} 1e[^_]UWVS<] E@(E؃} G,u1uȃ{1ɉMȃ{E9C(rC,}t-wSu"XZEtEPt@pEЉUvӋE@HEEԋEYE؋E u1 t1EE}P{}̍OKu؋uЋ}ԉ t1WVR8}̉CPP}M؃1ҀMt)}}9s6H 1B׋}d}9sH 1qBC EsE̋E#u1 t1EE)C(C,}K S$u,C,E Ɖ1u)EЉD1E,C,EƉ1u)EЋUԉD1T11E(@.,@.EUE@(E؃} G,u#GGG GGPh#S蜙 Hu GGS")XE ;ot$PWh"$ ve[^_]UWVS ] 1h&"u[/ZYuuhV"$_X( "^t uhp""WVPh.%Pt%WVh.%Pt h"C1Ƅa2=u'%Yueao1ɋ0u<1ҍjhm#P tj2WV2 9uX']hh3"PݪƃaĖ"+tWuh8"" 1ɋu׍PPhz"V8uP;Z;v.Phh"v"aPWhɉ"c"@Aƃaa9tRPPhՉ"("ƃaC&*"7^u 1ɉ]uh"VhV>W uVh"! O"j2P`2 9~#1ɋ!thA"u%6"mZt1sZ9{~c1ɋt WhԊ"6VhP_V uVWh"  j2P艨G2 $n"Yt uh_"1ɋ.th"s]PPPPh"V\\\\\]th"XZ4]%t 8t0Rh"k DG(p SP<xG؍e[^_]UWVS]CjP݇ _Z1uh%h+"{[^F9~?{jW襇 ZYu Vh%hH":19~DBh&"u )Y_uu h%hh" z"‰UWW7Zt uƄsh"hP#sh"hP# R:7$RWj DžuƋSS9VhQz u RWh"CPPPPh.%Q$GtRWh,"y ; ȋC AEV_4V^19s~4 FY Z1e[^_]USRÍEPjhjjj jSmU tShK"Rjb]USBPh["h-&Sh"h-&Sh֎"h-&$Sh"h-&Sh"h-&Sh1"h-&$ShT"h-&Shu"h-y&Sh"h-i&$Sh"h-V&ShΏ"h-F&Sh"h-6&$Sh "h-#&Sh9"h-&ShP"h-&$Shg"h-%Sh~"h-%Sh"h-%$Sh"h-%Shא"h-%Sh"h-%$Sh "h-%Sh)"h-z%jfUSRhPP u ShV$jҕ]Uuu u' @uuh@"jҕUWVS(`؟ԟhR"Rh*rPEܟП119П~7̟hW؟ ̟u ԟ0F`ܟv1ܟȉܟ9}J̟hW؟1 ̟u ПԟEܟF`벅u؟he"j苔e[^_]UWVSlj։1EEjh9"%Q t(jh"Sܣ tjh#Sȣ u Ejh"S諣 uEjh/#S萣 t}~Eh"EPhrWh"EPhrW =\@.t="}t"PVhǑ"\ }uE4L%Vh"> e[^_]UWVSÉ`hPdzlb1󫋅dhx|h"VhrS`h"|xh+"0tplhb""u"RPh"Wh";D1҉¸1 RPhޒ"0Ph"XZ"4t"Ph$"84L%h7"Wh"h- &؍e[^_]UWVS]u }EuEu }]e[^_]jWVSЃShC!%hVUV^NjP ѡ P.a5 P.kƃt(@hF%P_ZYu)5 P.CYu*LShܨ"h- 7Shܨ"h- Fh"PYZu5 P.Z1Sh"h-z P.Ƅ=FVvhPSh-"h-*:hPSfn1RPSVH P.;5 P.Bơ P.Xae[^_]UWVSuS_X؉8/u@1Ҿ1hA%PXZۋtm;thlu1WP ѡ P.S^5 P.Yt@9uVSBP uȋ2lЍe[^_]UVSu@Y1ۉ tÅtƋS ؍e[^]US]3X]]>Q UWVST=@.th8-hJ"QT[^@. nVUX=@.E}tPuPuS uS/EZY~/9jPuSjSh"h"h-EPSEPS=`@.tuuuuh%SC uSY[fft uM Z5$P.Xe[^_]UWVS}E U#ÅuWuu h"=hhW ƃ y@Wh "h-h- 0R Phø"h- 1S ѡ P. P.0}Nj[Yځ~RQW  @u550E.5D.5D.hݪ"h-e0[Q Ph"J=@.uURQVt  @uG50E.5D.5D.hݪ"h-0Q Ph2"h-$j%Wv Vp XZe[^_]UEU ]U= "-#tjjh "-h "-p4= &-#tjjh &-h &-L4UWVSƉ׉ˉ t;5@.@.rWVh"; e.RPWVBe.s{ S$=@.t [$t9{ u9suh,"S<XZe[^_]ËHQ 9u BA ÉʅtJ9u@BUh;"Pb<XZUWVu} 1 tC;5@.@.s.e.RPWVe.t;x u;pt@$e^_]UWVu} t;5@.@.rWVh\": e.RPWV%e.t H$9x u9pu 1pp P$WVhy"i: e^_]UWVSujj[_ÅtJNJ/t tF@PW3ZYt [u Ft[ 1ۉ؍e[^_]UWVVj/P\_Zu1,VeY/txtEVh"9XZEe^_]UVSuc.F_.9s%)P6Sjj*9tC/vKSh"Q9XZ؍e[^]UWVS}u h"09[u YƉ e._Zu hf"2^jjjhF%fHwjjuƃ y,0F Ph"h-uh"y2xPV|Y[y,0F Ph"h-]uh":2EЍXjS= XZu hϭ"2YSWV y.f0\F Ph"h-uh"1j(PPV xV@.ZXe[^_]UVS EA.EEEfD.=@.t=@.Tt h;"[hP"Y=j.uhj.<Z0j.EP ËEXE8t1850E.h"Y^Uv"_E-EFA.9ӋU9uu@.HtX50E.h"BXZ݃=@.u;A. EEUPE0| MUUEЉE^XA@.@. uE@.1ۉ@.$M u9t50E.h"ZY11j.e[^]US|=@.th8-h,"lZY=j.tjjh o. = s.t 18*-@jjh o.R 8*-y&0 Ph o.h%h-(@.@.Bo. s. @. o.9~ D@1ۉo. =j.t RQZYRQ58*-l 0 PhM"Yt!hhb"Ph"h-pj\ @.o.=@.tPh"h8-C @.TuF o. j. j.@.@..uh-h"vh-h׹"[X= s.tB=@.%Skk.k.11k.=uI)Уk.=@.u =@.tuhD.lD.@.@.`D.dD.x@.|@.EPhF%@ZYy#0 Ph"h-.jE荐w<*-<*-PtPh"h-j=@.t h-h$"R@.u,=@.t5j.h"h8-議 hF"X=@.th-hd"^jn@.@.=f.u@.]UE Puh- UVS]u =@.u0VSZZYy#`0V PVSh"h-=@.tVSh"h8-گe[^]UVSu@.u8jjhV|2y"0 PVhɺ"h-苯%=@.uVh"h8-f ؍e[^]UWVQM1y;5@.@.s!WVZYt xt@uωeY^_]UWVQM1y9s!WVZYt xt@uωeY^_]US]h"h@s.艤@s.XZCth"h@s.{YXC th"h@s.dXZCth"h@s.MYXCth "h@s.6XZCth%"h@s.YXC@th+"h@s.XZAs.]UWVSQMS=Zt$1tH @.r11Sh4"h- eY[^_]USuhK"h-蚭h-^l@.HQPy PbY J tl@.Hy P?Z J: tl@.@ t1yt nw1y]UE Puh- =@.u(h&"1ʍu1ɉMfEEE'E0VhQ`5.I @u hY"jzE<u 5`{.hf"<u5`{.h"h-蔗 ~<tP5`{.h"h-u_Pu󥀽_y-`9%CSh"訓h8- j (RZ<h"xXe[^_]UWVSE] h Zu h"jJ1󪍕 19}J jQhF"8 ujQh"m8 u#Fuobu 4jVhI% 8 ÅtIjVh" 8 u'jVh"7 uƅ7fDžjh0uhj P5.cƅp9؍t h"S/Y_uu"-hF"SXZth?"S Y_h"SXZhE"SY_u hN"SXZS5p{.5l{.5h{.5`{.h_"=@tAtif@ffh"SUY_`f@ffh"S$XZ!/f@ffh"SY_!u h"zZEVhؒ"dShV$YX4S׃X9uEe[^_]a e[^_]UVS ] }t3hC#VZYthh%VZYu E'j EPV E U:uy 3h"TshC#V覢ZYthh%V蕢ZYu E-j EPV E U:uysh2"jqEPhU5.E t hB"jue[^]UVS ] }t3hC#VZYthh%VZYu E'j EPV E U:uy 3h"TshC#V賡ZYthh%V袡ZYu E-j EPV E U:uysh2"j~EPhU5.R t hP"je[^]USUBBPJ R Ph\" uEe"]Sh|"XZ]UP}E 0EEPhQ5.覓t h"jU}tojhQ 5.q t h"jU}t:jhU 5.< t h"jlUWVS } 11;]}#j4h"2 uCPQ1󪍕JƅPƅTJjh'jJRjS5. jPj!gW ,jPjAP jRjVRt VRPW5p{.5l{.5h{.5`{.h"( rQƅRjh'hVjS5.S ȃf=v1QLhW HLQhW LHtpQƅRjh'hVjS5.9fv1PWhWM h"3WhH# LgQƅRjh'hVjS5.Nf=v1h"̬X1G9 5Ct9C LHD04<%h%hT%d {y0L%`vRh" 4 %hk%-YXD4%h"XZ1ҀHu6C9s!DLPh-"LBYXj XCPShSS蹫e[^_]UWVS,EE܋] h3 E^u h"jU 1E1E9}t3Vh"EZYtNVh "4ZYtAVhh%#ZYt4jEPV| U:u=v3h*"j 1EGEEjh0uhuj EP5.Ep=vhP5`{.hE"菈E1E܋U9UE܋EU܋ Ћ\ˉɉʉىӉ1Ɖ׉ Ɖf1u1u M ]1}‰E M ]SQ5`{.hc"qEEe[^_] UWVSEEu EBU܉EPU XۋUu hq"j1ߋMEfEfS1j EP6({ U:t6h"j^TTdDG9}ujh0uuSjEP5.r]e[^_]0 UWVSÉM}EU`%qtE8uE8At=ʀ@tQVh"WuY%tQhY"WuA WVu e[^_]UWVSDEU ]utlt"tWJ*P @ VBXHM}P @ j@WE4`%h]:%VS貄xw!V@4`%S HPw$w}txf@Ph"mutf@ʃ@t%"t"QPWh"VS>"t"PQh"VSf@Ph"VS؃1ۉ؍e[^_]UWVS]}hpVjSzPh"{vTh"фY {yj h("蹄XZ,C@tPh="衄YX,C t PhM"艄XZCȅt Pho"sYX{w j 腃_CȅtPPh"J S C h:Vh"(C t Ph"XZhpPjSuj Xu'tPh"ԃj  W;} } <;u GVh"蜃YXujh "艃XZjh "t^X>9tR;U }MuRlh "AZY1ɋlhlPhQ<$hAlBXXh"Xe[^_]UWVS] }uh"ނ^X1C9~D3Ph,"‚FZYj ׁX}CYE (]e[^_]UWVS`u U1Ev]׉EEEEEEEE EE0ShQ`u8 @u hY"jiEtU`{.<uRh" <uRh"h-苅 #<u jSRPRh"h-fjOxe[^_]UWVSUu]1}EE E EUjh'RujVue[^_]UUM1EEE EUjh'RujQuUWVSUu]1} EUjh'Ru jVuZe[^_]UWVSREUMt2uBItu< }[yt ut܊ y_vCm t4\ 0H2N0H2N0HB]9uX[^_]À\um tf\\M t݈@U蘟Ph>"h-蠃jvUh|"vXue[^_]D e[^_]UWVS}}} }܃=̉.É΃=Љ.tO=ȉ.u:=ȉ.t }u&}u35+-RhT%v. 0h8-juVbN}u!Rh "cv.Y_~7j quX.~#.~}uڋUe[^_]уtut3]ߋMtu*E r4s6Ph%4]ߋMEtPEPhQ"b sPhs#Ph#uXZM]ߋMtuuEPhX"{u$M] s SQh@$SQhv#Uu }uEa"e[^_]9uE e[^_]Gte[^_]Ã=̉.t.URh .4+-hf"UWVS=ĉ.uh"sjKkj=P_Y^Xd 1Dž\ Dž`hj`Ph .\PVS[G@u!ڋ\==.jjDž`1Dž\YdX@DŽdj`R`PPQV"G@u!訔0 Ph .h"WBuh .h":XZ&̉. Љ.uPh .h%ps e[^_]UWVSWE}u =̉.R˃=Љ.t>=ȉ.u3{=ȉ.tNu%"u25+-RhT%s. .h8-jWS_u"Rh "r.XY~7j q^.~".~uى؍e[^_]it1RE rGK=.tUPh-"^rYXUt2=.uUPh":rXZUB9|SWhĉ""r NuEa"e[^_] rE e[^_]qe[^_]UVS]=.t Eh"S谄Y^uEEYv1҉jEPSCEUE 9u%Suh" =.jg8u'8u̸]1PSEPuVuupD@u1t =̉.1ȉ. .u}u}tPjUEPj "UENY^tFȉ. .u}u}tjjMUEzjj "UEXZe[^]UWVS]=.t 'EE18jjEPEPuuRC@uuh"kjCS}W3 u%Suh+"e =.xj-fjuV)||We8u|1PSEPxPuuB@u1Ft =̉.x|t1pȉ. .tpjxUEY^?URVAEPVhH"jduVrmpPUEG$tkȉ. .tjj|UE~XZEURtӤEPthH"jd]SljPًUE$e[^_]UWVS(+-8 .t f./. .SV7YZYuVh.fe[^_]É)@E̍EӉljDPh.=hA%h..uUWVS`Eh.ZE&1]M;>r2jPRU Utj@uVRP6V3hR"WGjEPjh.RUz/ UuE Eu1}u+E9Eu#/tj@uVRPV3hb"jGQ1EEe[^_]UWVSEUE5̉.$ˋ .ȉ. u'. .h .hr"[^=Љ.tu*jtHu!u05+-uhT%2l *h8-jSuAXHu"uh "lXZ=.~(j kY I~I~uڋEe[^_]1v{9}E0Ph-"kFYXt Wh"kXZE e[^_]je[^_]UVS]EjjEPuVuu>@u Be}t Sh"jB. ȉ.tjIY2=Љ.u Sh "jXZuuuuuh"je[^]UWVS]uEEU E$E. .=ԉ.J. ȉ.t}jjEPjuV=@tdMt]QM XtMMMjjEPWuV=@tM;Mt W` _j .PY}e[^_]? }tuh .h" = t)tu*ShY" uSh"Sh-"Sh"SXZe[^_]UVS]E jjEPuVuu<@ul} t Sh"jiEUEU . ȉ.tj cXP Љ.u EP P5+-Sh^%i&IuRPhV$h uRPh"he[^]UVS ]EjjEPuVuu;@u}t Sh"j. ȉ.tjE=Љ.u5+-ShT%Gh EU=Љ.h RP\ t P$Xuuh" h e[^]UWVS,EE̋}uu<=.t3EjjEPEPh"E܍Pk((U܉UȉMQM= XۋMЋUuwuM1BH(jjURPVW:@uCEԋU܋M؃t (9t$9uދẺE1uh"j 1C(9~ˋ0x3{px s{ pxs{pxs{p x$s {$A(뼅t%GPh+-uh"jURAeUUС. ȉ.t7j(EY(}t GE܃t9]e[^_]y =Љ.uuh ",fXZv$v vvvvv vv6h"f,뗍e[^_]UWVS]EhEpEl}󥃽pu@DžtjjtP|Ph"|<Dž|tW XuJHxjjxPVpho8@ut9xt Sh"jl%EpujjڍE_X=.t=19|Wh+-Sh"jURDc jjUE{G ŋ=. =ȉ.t jQ=Љ.u Sh "KdY[|~+t4Wh3".dG9|~ hb3#dZj /cXue[^_]5 e[^_]ÍL$qUVSQ$A QEjjMQuVRP 7@u}t Sh"j. ȉ.tjYd=Љ.u Sh "ecXZEE1҉EЉUm\$E1҉EЉUm\$E1҉EЉUm$h="ceY[^]aUWVS@]=.t Dž S XuhT&hV$j1he%RØY^f18jPS;V u.D8"uShM"9t8uSh^"jR9tҀ8úw܉ he%ji 1PSPVuu*5@u1t =̉.1ǡȉ. .tW EZ)APs<$PUEV tVȉ. .tj EvX1Ps$PًUESD e[^_]UWVStx|h .6sl .$.sYh.h)ȉl)ȉ.u .u|uH1ۋx9t担tF%u1!#RPh(T%PPC뿃} t~|P+-xw1!#RPhT%PP|PF%xw1!#RPh(T%PPU Dž|+-|+-Ã=ԉ.( =Љ.th.h "d_XZh.h .ht"L_ EHv h $h~"<4,&h~"#__X}uC|@0|psPh"^Y^P|p4h"^ |p@h"^|0.XZpt 1!#6hh1!#h.ghh"h.Se%ppu/hWh.+hh"h.揃e%ƀt2hWh.hh"h.e%s2hWh.hh"h.e% s2hWh.hh"h.pe% s2hWh.Lhh"h.8e% s2hWh.hh"h.e% s2hWh.hh"h.e% s2hWh.hhŬ"h.e%s2hWh.lhh"h.Xe%s2hWh.4hh"h. e%s2hWh.hh5U%h.e%t7Vh.6#j VZhWh.hVh.(h.|p%Ph"[|@H t Ph"[_X|p(h "p[j Z }r=؉.=.u }|xXDž1DžtxTpj`SPPWt.@pu\t|@9uߋ|@(9uΉdQp ^dtNjp󤋅|@XPwPc Y|XX=.uTE tN|@XpHv9} |pUE"<=Љ.uh .h "YXZ|@XPvh)"P{X}|ps E z-UEÃ}tP@uj- Ph .h:"jOs u|xtjh.h .|@@uojjPjxt,@uD. .=ԉ.h .hQ"|@@EH{$@&|xtE|@8d uq=؉.:t.s j|xtjh.h .S . .=ԉ.h .hl"Wtx\=؉.j|@4p\ _+jjPRpx@Pt*@pt*|p`t7|@4`&R5 ^Kw8 nЉX1ɉp`9ptkp`|G8É֋X9sV9Ct FHt F9C(u:Nu*PQT ZPtރ NjTCXpsRl X1.d1ۋ|;X4,F\s. .t%xQuujPtC`jjPSxt(@jjjjPSxt(@UjjDžjjVSxt}(@uIv8 u3IJ XjjVSxt@(@u jٺ .|c^_9S [DžjjPSxt'@tgjjٺ .|^u Yuh .h}"5+-W KjjPSxtd'@u jڸ .*S# XZhƀ.lƀ .e[^_]UWVSƉLH.j=P>_ZƅTt9sx?u @ƅTGhh#V,Y[.t+-+-8| 8Vs tG=^jh#S P` F<=t:+-M  T=ĉ.u h"s 41Dž81ɉh 1ۉtpƅY1j,T=_ZƅtF1ۉH1DžL1<1ۅkj=V~=[ZÉluh-#V%eZYu09@llh-#VdZYu D1j,S=ZYDt @Dh}_%VdZYHt;"Hu}_%PTh", =.jGBr10jlPSE6Ujh="jfUu um ZYuUVSuVQ$@PVP8؍e[^]U4.E]UVSË0>-u F0j PV x;3ue[^]UVS@Ë5.=X,-tjtSvQZYuFl6j j5SHFS&Q$PFShI+%P.5.F PhT"j@]S7=Sfe[^]USQtPQ{=8.uSZ]UVSÉu=8.u VS*ZYe[^]UWVS׉΋]Uu E E!UuUZ$t1!#[^_]USt<0„!1=8.uSZ]UWVSLEӋu>hd"V< ZY)ƒ?EljDUhbSPEUDEj URPEU:*u%jjWSRPEP,tEuj>u( E9hbSVt e[^_]9`,-t3UVSRPjuV4;`,-e[^]#@.t ú.=t.u.UWVSƉӊ>uuVh.HtB14.hgp5.V=4.1҉4.hgp5.S9=4.~؍e[^_]UWVS,E90...}]6SP1:Y^y#...=,.u. ,.SoZ=X=&wAKw2if.7[nRf.7D=,w$==!f.7=Xf.7=KwJ=w$==` f.7 =%f.7 ===f.7wf.7lf.7af.7Vf.7Kf.7@f.7 5f.7 *f.7 f.7f.7 f.7Eۣ.Eݣ.Eܣ.eẼEfE1E. 5.)`Sj5.E0.e[^_]USEPhht@j? 1ۅu E]u+hl"eaZtPu.X,%T~.hg"5aYtPuZy..1ɉ \,-=. .t.0hw"`ZtPPu.[#~.hr"`YtP uZy..=. .P]UPUE.1J$@& (U"U"lyU"U"U"ۍU"эU"ǍU"뽍U"!u,U" u...1UVSPh"_P_ZYX,-hg:%_[u2%1ɉ 8.Ph.[^Ht 8." t 8.A"."."x.]%t.~"l."<.!"y1......|..~1҉l.E.U%t.7UJ#u1!#\.U#u1!#X.U"rd.U"`u"T.U"Eu"P.=<.t8=.u/U"L.U%H.=L.u1H.L.1!#=H.u H.1!#UE$.t8uh..1!#U%.=t.tt8uh..1!#U^#^.t8uh..$U"/.t 8u .1!#1҉p.EPh1!#h1!#h..$"EP5.5.hx.|.B%" EP5.5.hp.t.Z$#EP5.5.hh.l.Z$U# Uʀ#Uu1!#d.ȑ#t `.%U$ `.tހ8tٍUߒ#Åu1!#.1!#8t&jjPPu,uVqEDE".UL%Åt =\,-u1!#.1!#:t+.HPjRwPu,uVEDE"Y.Uc#6u".Uq#Åu1!#U4"…u1!#=x.u1!#É.;u .e[^]Ë.T.n.P.^=D.tg=8.t =.uMU=.t=.u.X.=.u.H.1҉D.]1D.á@.t 1=D.ú.....USc=8.t =.ul=.u<.L.fL.8tH.8t=<.u`.=.u.\.!=.tD.=L.t9.~j CX]6]Uuj5. =T.ud.8t .Ã=X.uUjlXË..q.bUWVSu M1+uAM]-}tue[^_]USÅth/$PBZYu "tEPEPS tt<`Ux&"Ux<& "Ux "Ux"]]ÅtVUVSQ覰Xue[^]t<+u;+uC؍e[^]e[^]U/$.h.p.|x.m1@.]UE t <-@t]USuZù¡|.ڡt.ڡl.=.ttS蘯2Xڡ.@.]US=.t@.u ]SJX]US]SZ3@.t]]]UuZu Y9Ã=X,-tUh$"Xú`.UWVSu}]E Et#jYu7u21ۉ] E)"jYut$RPyZYtRPjZYuÉE1ɉM E=" t9Et'hÃu1҉U t ET"Ek"vOԺHu Y n1EEU҃Ut<9u t0G9Eu߃sڅu}EU e[^_],1E E"e[^_]@.B@@@ 9uUS]t=h,-tjh"XZh,-]Ã=@,-UWVS.@@ˁ1 }1119މM}Z .9t+9xu"9puUpP5@,-uO Uхtjh"FXZ뛍e[^_]Ë .…t8=.u/US@t`&11Ҁu 0@4@[]UWVS$.$@(@u9t9pu9Hu,@;Ps D15d.%uމuv@E9t(}9~u9NuF9,@<vԋ{9t utt=.t @td,-x; @~QMh jڊ ZYMu 1.0 @@@xCSP{x B C{WG B POE܉G1GE@Gw x Ex.$@(@ EUF1҉E܉UEUEUEU9EM|!@uWE9@u E9@t`?@]juu@ .Bu@ujh"[^&.M]艈@@h,-Ft*Th,-=.1ɉMܻ.@Mt@&T뾹 )QDP@ià u.u}艰0@4@Et]y*jh"XZ1K@,-yZ=.u/@,-x&t"SVTRPK 1E 1E .ؙ@@^}t-=d.uAEEPhV$Od.ZYEU艁0@4@=.u2j2X=.t!=.u+lt.8=t.+.98t<WQ Gz8OW Q JMԍJO]É_ y z,@;F0De[^_]Ë .t&US$@(@ ,@1[]ÃÃ=.tCUu/ .,@w B,@$@(@1]ÃÃ=@,-xzU=.t,5@,-xL@,-5 .. 1ɉ .XZá.4@uƃ0@u.jh"nXZ;@tt.tUWVSu} .Uy 9}!@u EU@uG@E䋋@9u9t0E%@؉EPE9t8E;BuE;BtREU$@(@%,@1?E9ƉV.@9@}A@4t.t&[^_]UVSjjY[t@.9t2ʋqY9t9rr}ы扰$@(@1҉,@1҉Ѝe[^]US.u1Q@t@h0@4@[ut RPPZYs@tt.t]UWVS .t @t e[^_]pE11E9t:EP@ EUE@1EU9Ɖ}Ɖ׋EEWVZYe[^_]Ë.,@t H,@cUVS$@(@9}Q@u#%@Ћp9t.9^u9Ntv퉊$@(@,@[^][^]ÃUUx1ud,-]US.@uǃ0@ǃ4@|9t@@@g0@4@.1ɉ@@$@(@,@jjj@ 'Bu@ujh"XZ]Ujjju&!Ѓ@UVS.0@4@ut@@9} 0@4@[^]UVS]u 5<.q.Yh8@j.@1҉ @@1ɉ@@$@(@,@ǀ@ǀ0@ǀ4@XZtSYu .@5.5<.pXZ.@u@e[^]UVS.@ t4t&9tPQ P蝅 X1ɉ @@uB u @FZ.t ǀ@PX 1.j5<.*p e[^]Ë.1t@UWVSt/Bt/; r"H19|0<9Osr;s B1[^_]UWVSR1ɉM1.G-t.PS]0ZYuFFt! ̅ujh."*j 1e[^_]1UVS]utO=.tڊt <^w7Bt.}t&<*u{t{tjnCPjnSZYuހ>*u:Vt3st!dt1k1uUE 0e[^]UVS h1!#j袆 hh"Dhd.o hX.e hL.[ h@.Q d.8.h.<.X.0.\.4.L.(.P.,.@. .D.$.hC"0D1[<=:tjhw"?j FWZPÃ$&%VF%  V?F % V? VuF% V? V  VAF%?@ V? V V  V Ѝe[^_]UWVS EU qu=.tw }8׃?π]w}8J ?΀]wu0J?πw]K]?΀]wUQU?ʀJJJ]JE [^_]UWVSE uU=.u~ 9sSCM9sICKB~PR_<9r)S{Y"9sC%[tS[Z1Me[^_]U .E1uN(.Ev¸u61-E^u =D.t,-ED]U .E#1uN0.E¸u601-Eu =D.u,-E]UE=.tE].]USQ]uh"h. w?SSZt'؃@PCYu@Sh"(S5t.SZt. S YtS5p.j h."yE.SEPEXZ.]U8.E¸uH--E]UU 1}Du% ]UWVSSEIuRfP$^X[RVZY1uEV Xt S$Y-h.jEPVPhuV)ZE8} tE 8؍e[^_]UWVSRh"V:h"J:Sh"PQOucjh"V=Oǃ u.h":Sh"POu0Sh"V O Sh"PNEWw Ete[^_]UVSh"9P9ZYu3h`#V$ZY1t=h%V $Y[1t(VsZt ؍e[^]te[^]UWVSlht`ƍxPV貣Y[{%=eh&"VcVv GShV"  #jh"Vʵ  1҉p1ShW  t t u@h"W"YZh"W"YZh"W"YZt<"u5vptp~HpSPV t!SjEPU)U t1e[^]UE.U .t@]UWVSSuE 8=.u ^9uO tu QM$ZYMuGCQHm WBm _Xu s ZYt,jjEu VC EC3FC^ Fe[^_]UU Et1ɉME U]6t E]鋙]á.t);4?-t!Ujh.P.@ UWVS]=.u3.=...uP..Àu.%=ua%=tSSH.%uF .A..9~1!Ph.ZYu(1.K1=.4L.15.=.t1ۉ.UU1;L?-u PS_/EZYKHA$&}e,+1.#1=.15..t.8 1ۉ..=.vx u-x .=.w1ɉ . .5.GZq1..8\<1.I1.E1.:41.)91=..=.v6x u0.=.x Z߀x I.=.w15.1ۉ..8 u.8 o롼.oZ.Y1ɉ .=.=h?-y.-.h?-_h?-[} t9s RUVh., Uuω_1.ItVh...XZ.8=.t }.tP[h 15._.=EPi[¡.u=...u"z.tމU&U; u C9re?-Ed?-E11ɉM.9t)9s"RUuV Uu ta}t%8EEF9rL< u+9sJu/8ENu9s,Eu뾉9suՉx1F\..tPg Xj.)@P,..)RSP.0e?-8uCSm<XuSA._WA.Wf Y[..t{}t1.Ph.o-1ҋE7_Z.E%..9.s졠.u,15../]1ۉ.Ku5.DY..=.v d?-8Huh"(ZuA%1.v.e[^_],e[^_]UVSQM1uu.EQЀ w[jjjj uuuVtjh"Y[11RjjE0RPuuVuɋE@1҉PU8.uEPjEPc EUeY[^]1.9.|.á.t @@@ Ã=.uUj11Ҹ XUWVS.t`?- 0?- .1Dž|Pw@$jjWPsV]T:QDQhr"VXZ$fSftxRPFZYx,E%=ufSfthP'YXh"%Zud P]:X~P?-1Ƀx tA ?-x t tlph"hI#S|1ɉx =.u:pl)ыt)Px jjxPh"SSWV%Vb Wb XZe[^_]ú9.t9.t 19.‰USR.t>BE.Rb XE=@u$(.t t7tut g ]UVS=\,-u=8.t =.ut/,.0.u ujjj54.RPV p.u)=\,-u^5L..L.1ɉ .-5L..L.1҉.u H5zY6Y5L..e[^]U]UWVSt e9ZƉׅu‰...=t.u0t;5..}jjjG 1.t.ld8e[^_]UWVSQE)ơ$.u$.$.ǁt#t1 2ux%$.Su5$.á$.ƒ$. . t;x- st jk1j1Ztjh!"蹱ZYtV1VJ)Xe[^_]USVá(.$N   tw #5.jCP7tW6%I/f5.S5.5 .q1 .?E4.؋]`$.$.PS5<+u C< uH.tP^ Z;u 1H.SH.X5.jPCP=.SB1X];!t,.tP]^ XSQ6,.Y=.ui,.uh3"h1!#XZMh3"P=.ut71ۉD9tt KtXEC<tiи e[^]Ujj#UP1҉.YYu. ыuUS]t CPX]UPKPEEUWVS<$..@(.e=(.t1(.1.. .=t.t= .tj轳_.t x@jB..Yu*:t!u5<.YBZujQ_=8.t*:t!vu5<.&BYujZ18.=.u1.=.tjh"1.:͹t h~#Xt?uh9j::_X Ws^Y=t.we{Ã=t.Z(.$/t.-7iCЃ . jS_Zdteh...^=(.t1ɉ (.d= .u.u_un.ƒ@+t2tA!uI1D!-tȡ .=.uLC1@ ‰.j@.]=. .  =tSZHOEa<.1EЍEPEPEP虝 . tDFEĉE=.u Pw P1_=E@Ƀ}XHNuEЅ:EPh" 15.HY= .S贜 .YuSEЍEPh"C. ..Ht!5.h1!#5.5 .. RߓZt5 .j1ɸ/eu;&7C!$T&*t0@tg!=(.7u-%$.=.$.=(.7t%$.$.=.=(.7g=(.7tWjh"j#]SH^SvRPσH=(.7t(3$.P_$. tA tS u݃=\,-u yhK5h?-jYO =(.t)SZH Fu]EE1҉UURPvƋEY_tPnXi Fc $&j1ɺh#7 .19.}.1;..|Ϗ..X=.t5.5.G^_j.19.}.1;..|m..j1;..|.1ɉ .=.u+;..}5.5.YFXZjj5.1;..|.1._jjQjj5.V=jj5.v1;..|.1.=.;..}ze1;..|.1.jj5.1;..|..=.u5.5..E_Xjj=.t5.5. EY^1I+.19.}(.=.u5.5.DXZjj5(.K7 .19.}(.jj5(.8tFm謹G5.1;..|.1..Y5.5.F5.q=.y1.....d9|d u=.t.d1..5.5.H_X..19|, G..19| G{RPEv=.y15.5.5.5.5.YG\x-1EȍEPhV$=<.uEtEPZ9%t...D..x.jYj譧8..$.1;..|.1. $.  . .$.1;..|.1..15 .Ѓt+Ѓ$5 . t $.1;..|.1. .1_5 .x1FP薶XdW[..15.D..1=D.x..1x.h"?맃=.j 4?-" =.z5<.6h`#P u jh""5<.P7Ytjh="ԝXZj ?-$t5.jPoPt jhh"<;..|.1.5._vt\,t4uj^;..1!#}"EȍEPhu"t jh";..|.1ɉ .5.Zi;..1!#}"EȍEPh":1;..|.1.5.XuMjh"@/1;..|.1.5._u jh"V^ u 5.RP>1;..|.1ɉ .5.ZJjh"?|15<.V`2_kPYt VVT2.1.P臇Zu egjP1..j1ɺzm" =.u) ?-$t~#j=. jh "[Mj1ɺ"L_  1?PSq'@0j1ɺ">^  Sq?@j1ɺ";4Y u lpSrj1ɺ"%[Ze4 t u.Sp_e.j ?-$% j1ɺ"^.19.}.#. ....;. .} .=.+.Y.19.}.#. .....1ɉ . a..=(.it Dj1ɺz&%iSXZ=4.t.̯UE=.t@]UWS]Sj"XY1ɅxЍe[_]UWVSu}t ME  u ZE EE EuEE܋EEM9EEujEP5ǃ Ethuc;us^ .EPU9@%=EtPU9rtEt>WSXt1E9EsWQMS_ZHMt QXYKEPU8EtWE Zt WSH YWEP.XZ}tE)}+} M ZYtXX1҉Ѝe[^_]1UWVS E1E1@< vEtPENUjjjj uWVuVnu&jjUƒ0RPERPV&uC뙃e[^_]UVSQƍEkyex};uÍEP~};uߍE>Jx҃u̓@tAu=. =.B$}mu;.}Rj#;k.XZ끍e[^]UWVSÉU΅!CEC1ɉ}M98P@uBgtB$@ur5X-(@t Att+e=. =.B!5.V9}Pj#Rj.XZ믃DuA1x8tLuxgt;AyuȍIty@8u}O@Gdufu die[^_]U塌..|.r.]gUM U.y1E E "]7]UM U.y1E E*"] ]UWVS.Et Ejuk[^xPƉUY9E}jV; XZu WXjjjWBu@uS? W^_VSWEWMș}9u9tS? 륉 Et;u{Mu {+u{Gt|3t|3uHVSY[|3Eu3|3nu,|3du%{GEtV_u |$W $ XZtu hA%Vh^%WS}tjSY^y S3( ZP_X؍e[^_]Uh"ZjuPbUWVS}1ۊtAP݀u59}s8Gt+8Gt'<.<%t8.tRPY^CGjCŚXZutKH݀u=9us8Ft38Ft1 <.<%t 8.tQPS蘺SÃCFe[^_]UWVS]S^u1jjjSBu@thVS ~ˍ19=.t)RP芨ZYu FSW_XSjW]ƒ =.u9P4Yt"SWP;5Pi:vRgZd1e[^_]UWVSu'X=.!8u`#P^h'":PEyZYUt"RUƉ$YPkL$QMWd?-Pe?-PURh0"MQV$Wt% tXUVZUtRhG"Pk?G Shu#PY?V)% t'YWY>u V% Z S$ X؍e[^_]UWVS}1ۃ=.u\WX$S~WhO"SP3VuPǃ VPcZYu S$ Y1W$ V$ XZ؍e[^_]UVS]h`#S)^Zt(h"SZYth0"SZYƉe[^]UVS]SYuVSYZu]e[^],~V&~Ze[^]UWVS u=.h.ZjXh_"Y_?|uC؉E-uEh`#V>_ZECHtjhS"!u[^VufƉ<$\T$RUF}WuURP莻W # V" YtsfGftjEPV Ht-WZKtcu_E18E h0"|XBEP;E8E 0h`#|Y^WrZ;u S`" X1ۉ؍e[^_]UWVS}u =.j֐h"nZY~1E E"e[^_]sVWSE4$E<$UMT$RU{EWVSURP$W! V! E@u! t]e[^_]oe[^_]U|EPu4NXY1xE%=@UVS|u= .u1V[t&V0$P{VP'hB-\|PVMZYy VjXG1ۃ= .uu#jjuuuulƃt*u Ee^_]+e^_]W|$wUWVS4GE̋G EȋGEċ7uu2,=l.u2=.Pk.RPWVcWV4Ɖ׃ - .uWVcY[uu}t.Eu藊t ub EUcuu3uuEUEU9uEt.$ uuP&EU ~ÉEf=.Et& t uEUĆ t t)E]Xȉslz( 艆E }  Eԃt.g} t}uS*(EƉ׃}s}t$ ._E@)1ۉu؉}Z~Nt;} t1҉U诅RPu%à }tA臅E؉Ut.襅t u`Ɖ18. .uM9)ډƉ1ۋM} t} u.Ɖ> t t u* uxuuل)ډƉSDL=.t)} t} u}t裄ƉE„EWu؉}ܹ11Ƀ}t&=.tM\RPj =$ Mj}!SQ{&uu+z^=.tMWVuuRPEU$=0.t;}t5 ut.t t@t!e[^_]g_鵃e[^_]g_UWVQM1yHL¸u 1=.jjPWVeY^_]ÍL$qUWVSQ8QEU1M9ȋ}|'EEH=l.uk.9EE}11軁 .uEU)juuRP蹁EURPǃ[^y=0.tLۂւ t u, ut.<ͅ u@)蔂t.訅 u B@u2E؉Uuu+ZYZuu*_XE؋U܉EЉUuuY[1uuЋ}EEÃt.Ex u5#Å^IJ .MCEă=.XmRPSO!Eă J…u =.~1҉8.uȉ}E=.u  t umU4 Ut u uU Uu uE9ƉM_u}EUI}u}uEę)ԃ=.t t u}tu}EE9ƉMq1҉uȉ}uȉ}̺1EjuRc"uuvt EЋU=.t.WVuuRPE؋UEЋUԍeY[^_]aUWVu} ut\WV趀ZYu[t t u݉5H,-=L,-΂Hw t5P,-=T,-e^_]UWVSu} ucWVHb xb)ޅ~j2ajjjRPV tEjajjRPM)S=.Ee[^_]3rWVEZYt1ۉ] E"e[^_]E\j`EUj`EUEU!YY@tE9ƉEU!ЉE9]}O}t-9uE|#jjjuuE.)HPt%x=u\P-Ux=uOP+Hx=uBP=ÍP^wƅPh"jW脙"5j PWO‹ 9u1!#!#討ԣ.Ze[^_]ËX.;P.~~P. ̦. T.‰X.US<.X<.Ц..[]É19F-t @uUP`iYt.t.t|.t.UWVS.UjS EjS }tUuu YXtP5.} ljE5Ħ.5Ħ. 5. E.EĦ..XZ1e[^_]UWVSÉ։9.~.Ħ.< +t[^_]UWVS׉ˋ5̦.V̦.Љ[^_]M=.tt*ttt t XÃ=.u[USjm50.ÀZY"t:t1ɺNC=p.th#t1ɺ*C]Uhp#讽0.PYZt 0.?"h#艽,.PƽYZt ,.#jh=U.jh,UĦ..h.h.ނh.Ԃh.ʂ h.轂1|.ZU1}]á`.d.UȦ.1<.1̦.9Ȧ.~".̦.Ħ.1ɉ ̦.@1X.T.P.h.L.H..D.@.(.t.p.l.`.d.h.(h.h.h. h.1҉|.UWV=.uu uƉXZ11. .u=.u u$ZYtl.@=.tʺ@b P,-T,-.ut79MM |-M9 H,-L,-U |l.@x@l.c B.9<.H1Ҹ WVY^1 tj uVRP;FVѤƃ1.)9~1Ҹ G19tD=G1Ҹ <.X.e^_]á.t.=.u .DUSȦ.9̦.~$Ħ.<u.Ph.€XZCԡȦ.̦.<.X.]UWVS]u }Eu@0tjxYEe[^_]أ=.tW~Z=.tw/P'x_uSQ~[ۃ̦.~K1S|YuSWV~_ZVĦ.t2dZYu̦.Ħ.DV c_tW̦.uVb^ƒt .VĦ.tcZYt t.t.t.Ӊ؍e[^_]UWVSEUMЃtH.} u)}u#=t.M(.}tuEPjEU RPu ugu=.t[l.tR E..ut;UE }EU ..(.u=(.tr1ۉ(.1D=(.uf=(.uJ8u u1ɺZYG9{Ft|.1k À.ك}u E1O. ̦. E1~RjEPy ̦.1҅~ Ħ.TRPuu&Ã=.u}u9EEEE55X.+5h.Ee;5.'EPv_.9h.uY=d.u=`.uEU `.d.1=.~+9=.~.81ɺGh.w|Ym19}E81ɋUG.9h.|1}uEPh.|XZȦ.9̦.~Չ19Ȧ.~=.   Ħ.<<@B)5̦.h.h.9.}1ɋ. JKݸe[^_]UWVSƉP衟[=.t<X.+h.;.~u u1ɉZYuFu1e[^_]UWV։PsWV ~ e^_]UWVSƉ19.~  .t .)C1[^_]UWVu} =.uWV1ZY ie^_]á̦. .X..á .̦..X.UU1wR50.AwZYUS]1w%SZ1uS5,. wZY]UU1uj jL1҉PPYZUSE] xt+uxxt \tf1҃‰PTx6B&9tu!ـuJB&u'@S$Yu SZt놸]UVS] uVjSu 93sPuCZYHte[^]UWVS ÉUu} L.Ex.=.uuSx.Zt t.1L.x.dSPEZYtJHWVM^_x.xt p.Sh. yWVMZY5x." 1x.Sh.xh.k|. .Pdyh.x|.@}|.2..9h.}%h.xX..=.9=h.| ̦.̦.؉ESjEP8tU$ t9r)ډh.w5x.W 1=x.[^0x.t D.u"uu} U̦. p̦.~@9Ȧ.| .|t Ħ.D0tu u. u#uWV11ҸJt1Jutq.ЉERj]S*sƃ .E9s=)У̦.RjSsNjĦ.̦.?4WtVL)X.~뫣L.m}̦..=.uL.PapY̦. Ħ. M9u3_u(t M:H.t E)M Ma_uM.UK_uFM@t>SrZt H.E)̦..PoSPYtE u1L. t.t =D.uuu} U X.+<.4G- .~9|0G-)ș);.}s.)WVz&%U ZYu K=.tw.PmYtu} U؍e[^_]=.t+=.t"SqZtSarWV WVMUmZYe[^_] UWVS]u }@.t4 u ti5<.58.1ZYt 1@. p.t =D.uVuR=.@. 58.=<.1.._@.1ۉ.i뷃=.tH=. . . (=.t.un. .ÀuWV1҉ZY%=u+%=tSl.5.=._1%ul .A. .9Ph .'l[^5.=.th .lWV .. 0.1ɉ .<..P.1҉..=.uufe[^_]Ã=.~U..1҉.]1UWVSQu} EE@.tt t5<.58.1^XZh.tl=.tc.;X.P.X.T.̦.Q..D;X.~ .=.u.;X.~1N=l.tX.@.9}Թ Qۃ=.tt =.u =.u 11Ҹ *=.t&}t 1Ҹ 1Ҹ11ҡ̦.e[^_]UVS]Ȧ. Ħ.ށ9̦.~tu ډ@[^]UEЦ.E .]USEM =D.t)=.tu ~JH1҉ ;<.9~.Ц.Ȧ.)ЋĦ..[]D.1h.UWVSQSMQyq uu RPG\ZYuh[ƒt1ۃ tt t.t[8.H9UUt Z.[C뮋 .t .teY[^_]UWVSQMQyq 19| RP[ZYu.X.D]E t$t.u}tjU.Et ,ZL.UL.T1;.r H.E)K.Uz11҅t .ىt .eY[^_]UWVS} ]E1ҋE}~[9sWUSjMQjPhUt!SMQPEEP? E1jRjVE)E뜉+E)Ѝe[^_]UVS.1.SutFjjP t.@11ҡ̦.:.e[^]UWVS5..j:Y119=.~ !AtRP X.9}G؉5.19|)e[^_]UVSu E!y=VWY@ w>uVF-SKwXZ1jjVM u뾍e[^]UE1҅x F-]=.t&.tUSJZ P+JZ HX[]Ã=P.y-U=.u .1.jh#A5ZYáP.xW@dP.UWV1ɉ P.5H.=L.,9Ɖ}jh#5P.XZe^_]ø`. @= .u1 .`.`.T.@.....1҉.....1ɉ .UWVS EE} MEE..t"C 9Ku}9{u E9C֋s`.T.t `. 1T.ЉpHMH MHxC;4-=T.u`.PHE8}.t'Xp9ډ} EӉEEډÈ}tET.T.@B [^_]ÍL$qUWVSQQEU=.t E]!@u 111]9؋]ع5..tF U9V}}6E9F uE9Fu N^*H.L.1=P..~t-uF"Hh$(V(h"( TEj舦C'j9jWj5Ej by uXhb#Xu>h!":tu R5_UVXtˋURU蔇É<$芇L$QMt5蔻WPURhDW%MQSs W, _urVZ5YS誯S j;uSu+jVj8}t&u'h#'X,j &u& VC.u蜬X1҉Ue[^_]UUWVS]EEEEuu OZYt jh#hr"S軎YXujh #,XZFh$&S&h"&A%j 8jUjj ё}u}u)NÃtNN@u,E UM;M MM|E UƉ @tt t MÃuV臑jj Vj`Ujs7B.jTe[^_]UWVSu6EU_}u }tcjT/Ɖ[u u11j:/Y}.uRP*M9Ή]| RPuuBu @ujjuuWVu 0e[^_]ÍPw k.GPw'k.1.'t'.#tUEEPh#**YX1ÉUS.w$tX.'^<..1....tP X1..mNt jh0"g.K <. ....jh.{/<...Y[뉉txux ujh5#5)XZ1]UVS.1۰#4t'5t C'Ca1ɉNF FFFtP Z1FC6ue[^]UE]UVS E%tYu EP.UEY^u uT@2M5<.sS CKCtP Z1C.e[^]UEt*xu x u]?@ @.]U Pu]jEP-UEYYut@ <. ...E..tP Z1..UWVSPEf=.uJ=.uA=.u8<..1.....tPl _15.{u#jPs蓾CsB 1ɉKs {SC;<.u RWV UP號ZUte[^_]UQMt<.9PtjhB#&XZP@ UVS]u <.1k9.u$9.u9.uPa~#4t P'@5u1҉[^]UU19.uǀ.ǀ.=u]UWVSu薾[1.t:PPV߀ uE.. 1҉.YS Xue[^_]Ã=.UWVSu hI#uq. C Suu.ue[^_]j }WRP` su sʽXh`#V#ZYtVWsPh[#upUWVSEPU8mEP8 UtYÅE8 u@Ej URP!ƃ xuu=.E8 u@Ej URP Ѓ xCU: uBU1҉SK C9~CCtP~ Y1Cu,CZe[^_]USE] =.t1E Ej#tS_, .XLt1ۉ] E#u=@,-x1ɉM E#^S*á .ZtP XS茫P軦 .S 5 .K]s@=@,-y1ɉM E#]J# .EEPh#4#XZ].S-x$Ujh@BRP.RP.USEtzE 8.MU u4@E Qh%RYS- }t jh#}Qh%RC }t jh#k.S-aS-y.EEPh#>Ph!#j ]ShS|~P|0uD]EPh(#"XZ]áS-x$Ujh@BRP.RPh.USEtzE 8.MU u4@E Qh~#R<S- }t jhN#}Qh~#R& }t jhf#k.S-aS-y.EEPh|#>Ph!#j ]SgSs{~P|0uD]EPh# XZ]US] }u!jSŽYZt]EPh# XZ]US] }u!jS^YZt]EPh# XZ]UWVSUE t tP(.^w=.t1ۉ] E#e[^_]/ P['PR蠗?UZYt]e[^_]3"SƉ׃utS莗5.WVe[^_]USEU tXtugR%(S-YYR&áS-Zt=S-tP XS|P諢S-YX]] S-EEPh#QXZ]US] }uC=h.tS'H.Y,.hA%rrSlrXZE@]%r]UVSE] .E.*.`#tRGYEEPh#XZ]UEtHw1E E#].]U}u=.u]g.]Q.]UEu=. M.]UEu*=.~!EEPh# .XZUEu*=.~!EEPh#.XZUEu#=.t=<.to5Bu @u]]UUE t#u?S-^u2@t+S-!S-PJFEEPh #@ US E1ɉ . .E 8,t)EPh3$E P }t jh) #3.E 8,uf@E EPh3$E P{ }tjhA #XZ7.05.5.hCf$j]S8]]܍EPh[ #u]UVSE] J1 RD+~vQQ r/d~Q wG$xC&t3-tW1Wt'^tM8wt1?:50+̀&Qπw MEPhx #1CSPh.Y.E sEEE sF@tK@sN@ sR@sW@tY @AuU9uE-EUEPh #XZe[^]ø=.u=. 1=.á. .+.UWVS }8uMEPh #Y[1bÉUPn$@PƋUXZt=.t <\u {t C<$ut PWGZYtFFC؍e[^_]U@uPh #j*h.ZPRh #j*h.Z.UuBPh #h@.'@.UU1t 1BS]UU"t B tB]U}ou<¸#u1]1=d.Ud..EEPh #KZYUWVSu ]E0`_18-u@JЀ v#tuKuEPh #&j uP yu˅tӉuEPh #Y[뾅t1҉t؍e[^_]UWVSMd.tFPtu)QjP_XDd.ZjPEP 15d.1ۉ]1U:BE<-t><$<~,Ht<+tO<9 ~1EM؉Uu7u*à U܋M~ZEE܃߃A<vG}-tA9u}t%9~-7eZ9Eىu1ۉ] 1ۉ]EFt}u Er]$I}t}t E1EEȋu} t tE Ee[^_]Uh#zYtPZ~S-øU =h.u[h.]RZtL1h.EEEEjEPjw M9 .tt._kh..;EMMEEE=d.t=@.t=.uS-=.tuPjEPw EufE=.u);>S-9u t.&P\Xʃ=.t ƒftըu1ɉ h.uu uv 1҉h.=.u&u`.@`.~Fj.Y<1҉`.y!7q8m)q8#_M9 .tu1 .Ujh.PUQEPEUUWVSp0 u8bÉ4$.b|$WVuhk"WPaN؍e[^_]US]S菺 ZuSh#hl. l.]ÍL$qUWVSQ Yq AQEU}WRPq1gˉE؉UM܋EuƉeWuuRPXgu؋}׋EUE؉U܋E!E1҉UԋMЋ]M]E1E9M؋Er1EEEUeY[^_]aUuujjdu uUQMAQ jhi@BЙRPq1U EEUiEi@BEjEPtXZUSS-.t,S-.Sh.5S-r 9t .]UES-]Ã=.t 1.s U=S-.r|S-PS-M1.E]UVSPt.t .E1.EPSXZt'u> E.Xu{ VoYCe[^]US]t CPJX]ÍL$qUWVSQ8QEȉŰAEċA Euȋ}̉3E3U)E]uu}MQuuRPhK}Њ# u؃}yC-^SuEXZeY[^_]aTUVS]1)EM}I#uyA-NQu cEXZe[^]ÍL$qUWVSQ 1AEI1EEEM؉E܊PЀ wPwW PwO79ʉMЉU}?jjuuuu}W/;jjEԙRPuuW9 ]F8M덃}tE0ƒ}uEUeY[^_]aUWVS1E1EEEEPЀ wPwW PwO7;UU}AjjuuMSQuVs:jjERPERPV69 E8늃} tE u0uEe[^_]UWVS1E1EEEEPЀ wPwW PwM7;UU}?jjuuM1SQuV9jjERPE1RPV8 E8댃} tE MuEe[^_]UWVS U] 1<%tJMP~XBE؊B<%.e[^_]US5à Hw ot tSRX]UWVSu} .ouWV"XZE e[^_]$=.u`~h.WVhS-n.\B1s9. .e[^_]@UEU E 1!#E1!##]UVS]u .uu ]e[^]S-P-ZE #E#؍e[^]KUS]tu uR4=YZtg=. .j ZQuj>X؋]UWVS]uE %= .t >t:SX$PKfPjjjjSPwf$9twVK Xnjjb1= .1҃=. PSWi ÃtW _}t-jh#[^tP@6 ZY>1؍e[^_]US]tP3诫 ZY1]U1}]UWVS|}ue( u W[E E .x9s^U xu Yw 8u 9Ut 9t'B@9Uuu>}1҉W1ɉNG랋E10E18](11}$1ۉ]]uuPEPjWu ƒ1ۅtEUE}yȍI|5xj9E E HMM9|_y1UE1ɉ e(s )؉ùE(tE}|9|u1Au߉؍e[^_]Åu1뎋M1yyuu$1!#E<:N<%<.uFu RPY[ +!@ *u5<.蜋_vG9^.1u؍U؉ƋU؍C<6$tD& .1Jk.RY19. .{9)ISQRP[[u  u11ERP[_19r .+ .ISQRPe[1.N5<.5<.P5<.PDwS蠡 x(t u(5<.pRY EӃMЉ]1۹}9}RP薿Y_9nRPZXZH'u70EЉUsӋEЋ}!@ȉ9څSQZREЉUXE E)ӃMȉ]1۹}9}RPϾY_9RPuu@'u j ]SRPlWIx u ȁ .wt .1&t $EV/";5<.KZtP X@= . . .e[^_]U5S-USH.=h.t¡S-u.PE1҉D.]U5S-*UWVSSË@ 1uuC1uEl@tg}tC E;P p$}p tJ;V ~$}@}tՋpt%lj;Pp|;P p$| putC C 1Z[^_]UVSË Bpt9QuAACPrt[^]UVSË Bpt9QuAACPrt[^]USË@tP Y1CS5Z]UWVSNjXt 39s|=jjj,VC 31CCGtX_CPSk,C e[^_]UWVSÉυu/1ɉH . .13CPY 1ɉK^։URhIZ9Us&RUjEP!Pe Utܺ1҉S .t  .SuWV>ƒx6Ct PҜ 1CZVH@$jCVP/{1e[^_]UWVSE֋xtBE3ExMAA ;NF |"Gt=NjEFOW9M}ԋE9G(u։NV ΋O W$9M|-G뿋EFOMOMW(]9]]|~E9G(uˉV;NV |9Uu=NV 9Uu9MuuwG\_ t;C$uE;C u K S$=EÉGxG tC X_ h9UuC;G$uM;O uFV G W$WtNZ9^ u;JuurBE(ÉGx GtCX _;C{u 1szp9uHtyt1ۉZY@9Zu9u E[;Zu;Pu E2[1҉PB;XEu [^_] [^_][^_]-.uU5$.Z1=(.UWVSE؉U܋uE)ȋ} )ϋ M]܉M]UUX9QDP9u9u>EU܃EU9EE} UL.9}EU܉EUC뫃[^_]UWVSEUM}EȉE΋E?UtW tP9sFu h@ RPMEUu  @P4E4MEU Cuu h@ 7PMEU9r9ut6F5,.jjWuE)PV5(.5$.$'e[^_]1$.(.,.4.UVS=.t 5p.}uufp.1ۃ=p.uDSgYuu C.H9RPSjY wyr5p.e[^]UWVSP,-ET,-E@u }H,-EܡL,-EH,-L,-P,-T,-=p.u e[^_]=.t11.H9~qWEUwZ}u}tQVkUXE9E܋E؋U|59MEU|!Au#uuoWZI `x t e[^_]Pe[^_]UWVS]3t~v 誖 V褖 ZY1CCC `.d.h.l.e[^_]UhL.XUS]$.#t-=L.ujh#XZ]1=p.p.E]Uh<.'XUVSu] t1ٸ<.t;pX[^]UWVSEUE|E x.p$l.h5.u8.tXsmS脍 Zjj1CCCj y]e[^_]D 8.C8..e[^_]U€u1=8.1]UWVS4h.l.EU`.d.E܉UtE؋M܋]MjEPjujuuu $`.d.u}u܉}Mut}9Nju|M܉]E܋URP ZYh.l.9E}|!@uc1}9}}Uuu[^tDjjuuƉ׃t$EUEUu}M܋]Eu׋EUh.l.E܋U`.d.,jjuuEU}u}tu܋}뙍e[^_]U jEPXZ}u}t j)jRPuujgUj1p.=l.u]]USj5L?-#ZYt8jٸ$.Xx =l.u=p.uS1]U=0.u . .$.,.]xUWVSU EEt :CM@tE3,. s+jh#Eu jh#=l.=.=l.1ɉ p.MMM1ƉӃu]5.+PXZe n=l.=.jh;#_XE:jx^@=p.@1ۉp..1EPM$.Zxl. . j1p.#X=l.t =.TƉP.u}tp.xu }@u}uQ.HEP5.X}tW&jjRP艞ƉӃ*W ƉX}CjYj111 ƉXF=G;=.}W؃&MxuƉYjZGMEPjEPjuujjE Mt=l.t =.tZ}~TJEu2EUutjEU9u9t5.RPy =l.t =.tjFXEe[^_]UhPjz< t.XZ=h.t.UhyjQ< t.XZ=h.tUE]Uhj< t.jjm=h.tU}tOhj;YX=.uyPj;hPj;jj;hj; 2jj;jj;jj|;jjs; jjg;XZUWVSt.1҉t.tijj9;/jNjj;jj;jPC$hyj:j. tH=.5.y9=.u95.t.@(.h耲.t=.tj"Xe[^_]UWVS E։ϋx.SRU.$EuUR u.{tUM tuWV袠C SXZ1e[^_]UWVSSE։jj)u!.$@PCuPs {E C}u1C%u-$@PCuP؍e[^_]USS-S-t%CBss sk Se 1x.|..]UWVS5S-'Vh&"P Z1ɉ .-[ÍhV` i!tSV uNJ< t< utZ8tPt u9_8bPjP蛾 u1Px^u ȋ8t6t2\uG@x9tzP‰1Ҁx$‰uH11WQщ‹MS-S-PS-.ZY{X=.tS-x.|.1e[^_]UWVS u!b1ۉ.S-S--TÅ515.hM#AP>AZYqG&STYu*Z*lj4$u*$L9QZVh\#P>9tV~ Xh&"Wn2W} f;?STYSrTjjщ‰S-S-PS-. VhP th=t.t-tV_5XGPg)_t u Ƅ@t Vن[ u- u-DH@ZutfTP@tCu* fLHt@u C@tC fLHuDPttDP@yulDP@tG UDH@cBVO4Zt1x.|..%S-S-tx.|.1e[^_]USS-hg#S(ZYuwhm#S(ZY¸t_ht#S(ZY¸tGhz#Sg(ZY¸t/h`#SO(ZY¸tjS;ZYxP<X1]UZu E ‹E2ttHu jh#jh#jh#XZÍL$qUWVSQ x.p x tWV虛ƉY[jj1EUXZt.uBEPEPWVNE؉U܃E EtEU}u}ujh#=Y[=.tuuuu誗=.tEUju4P4ESj:jEPuuS"4(eEuy Sy XZEЅu u؋}eY[^_]aUWVSx. |.]11~1t2S-t AFKމt x. |.[^_]UWVSx. |.]11~1trS-t IFK݉t x. |.[^_]á.á|.Ëx.tUrIZøUjZujhd"+9ZYyjP9ZYxU.]øURSjEP5.hU ty jXфuHuUS]} t0tu y.39ӻ˻r1u vH[]UE1҉PP]US]tPw Z1CC]UE1҉P]USUBt XZL[]UE]ÍL$qUWVSQʋEqyIZJ ZrʉWVEZYeY[^_]aUWVS]E EC9C|WtjjWVRPCPltjs3ZYtKljE3v XECHKM e[^_]US1;]}E Pu[CXZ]UEU 1ɉHr2P UWVSS] EEMȋEeƉϋE EtuuWV+M9u"9uu uEZYe[^_]Uju-jh.UE=.t&uf=|X-tE#].@]]UVS0.1=.uD.1(hjC-XZhj5-Y[h.^tTjj-XZjj-Y[h#0^.u 1"15|X-=.t j[P ֋54.T-t,PV!ZYu.8@1ۉ.#Z8,t@8u݋8tH58.R.PZY.@8tSXh&"5$.^Xuc5$.h " Y[#S$S5D.I& BP5W-P[ ^ZtbShV# Nh-%P#^Zu @׀8 uSY#h-#P#ZYt @׀8 uSX'#8t%8,t8 t@Ћ8tH58.R.PY^.t SAZ@.P x#Pe[^]U$.jj *XZUhӣj).XZU! .jh.  @-Q@-y ;P-| t8-J 8-Uh8-P2XZUWVSREƈEj}W5D.$ f=X-tk1.5X-BjW5D.g1j-=.t.V]"Ph3#  Ktjh.5D.# 럍e[^_]USQhJ#,jj(jj(| AÅt4EP Z9u< hP#,jj(jj{(]jjm(jjd(X-j/S=څtPjRSh-h`#shU#jP~h-h`#msha#j5~USQjhw#5\.. f=\X-t# h.!$jL$XZjY1= .u=jP5D.L, =.҃J"= .u)uRyY_uՊ< ttJ< uf=|X-tFVh#sXZ)9=W-:WPu Y* 9th#D'_ .VPu "* 9t h# '^f=|X-t$j+$Ph# h.jj账 jhX.5T.) Sj"XZu ,Ye[^_]UVS hVh#Z Pٌ[th#Åyh#D&YhVh # t&z+o+j S*T+hj !5|W-Vjj ! PBZ~<9u6j趋*j貂Vh- #%je[^]UWVS]ujh,"5\.U(1$.hjK!Eh.jj jhX.5H.\) t@t PFXD.f=X-tjURP)) P5j_@_Xj|}EU^111ɉMKy!S#EZ=$.MuCPE=$.)uf= Y-tm[ƃT Y- ufuE 6 u, fu'f=lX-tj ^EEu ft EPY} tf= Y-0f=|X-tGWh#XZf=X-1.5X-ÁXjEP5D.' =.=$.t j葁X,=.#E X-9ujhX< tf= Y-uj Y} u*j{ƉSuj%f=|X-u>E tPE Z+u}f= Y-t WVh; #WVh# jhX.5T.%h.jj菢e[^_]hR #"X UWVSEhVh#F 'jh,"5\.O%jjOjjFh.jj(jhX.5H.Z&裹à yh#!X11ft#jzƉXPeY~G9uAj5D.هj~jjjjV Vhf #j f=|X-tj2z)RPhx #ejhX.5T._$h.jj1jjQ jjEXZe[^_]UWVSE[hVh# 4jh,"5\.#jjjjh.jj誠(jhX.5H.$>à yh# X11st#j;yƉXPY~T9uNj5D.tj5D.gjn}jjPjjG$VVhf #jf=|X-tjx)RPhx #jhX.5T."h.jj迟jj jjXZe[^_]US,]S5D.Jh+"u.u M e.Sj5D.Hh.jj:]US,]S5D.h+"uEu %ESj5D. ]UShSh # S'EW-[tEW-jh0$5\.! UX-tUX-5X-t5X-5X-t5X-f=\X-t_X-t$X-f=X-th+"h#uY%Y-t%Y-,Y-.5Y-t5Y-jZEY-t$EY-f=LY-th+"h#X]Ujh{t 5D.j89jhzt 5D.US]Q1u1jP9"XZ]US]CStu RZYt1]UVSEh #PZYtPz^yh#u[Ph #hPxZƅulX-u$ "$!X%Z!$!1ɉ $Ph"SSju*hp"tX!X!X1~!$h.G à W!XPnY9u tth-h #cXZ댅yhԗ#2txuPh #uPh #h- Cƃ..8 u =.vH@.e[^]USErjPh`.h # uxh`.hhP<.yh`.h #ZY?hSh # t h`.lGX5|W-5<.S ]UVSjPh`.h!#] h@.h`.PY[vE !#e[^]IHu @.D.5D.hhPÃy5D.h #XZ+5@.h$!#hVh0!#SVe[^]UEjPh.h # uXh.gh&"P uh.h2!#{XZ)j5W-P f=X-uD.E*UVSjPh`.hD!# h@.h`.PY[vEK!#e[^]@.HuD.Rh&"Pà uVh2!#XZ@D.f=X-tPhc!#Phk!#hVDVh!#S e[^]Uh-h"#_jUWVS}<1ۉ8.L..%1u~11Ejh U-hF&#u uK=x.uh-h##Q_jat&`'FtrE96/ kU DЉE.뉃a$G&nEtPt= p7WYvh%#Z?95 p7jh"V jh"V˚ h"V^Zƅh%#ji p7h†%SZYkhߓ#SZYLh"SY[Åh%#뫡 p78. p70.Em=L.t h%#s p7j/RUYZUt L.5Rh 0%hL. EPjhjjjj5 p7.U P5 p7h%#RZ.teh'&#tM ...=t.1vldZR-E)t8HuR}t hg&#KE h%RU;YZUt0." ...hjhj hjhj 5.h&#j hh.thh.u h&#@u h&#jh8-[EXZtKth†% hߓ#h" Xt 1N11҃=t.1X-LY-=W-1ۉ|X-=.t ,Y-= .t5.' Yu.t h&#j= .u"5. Zt5.h&#jee[^_]U.jh.U4hjEXZu2EZt1.= .u!ujxYX=.h.Zu(j Oq=.$uZYD.j'qYD.yuhV$kXZ.Y=.LjPoXYD.tP*YD.!URPPXZ=.uM@EPj5D.m jh t 5D.h jjuYX1}UWVSS]=.uh&#zYu h&#j/dh&#zZt8/t P_" XxV-|V-'#ShtV-EP) ƃ 1=L.t6L.8.. .1.=.u'.%;/u%L.jSY_t.t t u!hB'#Sh'#XZ h!'#x_jV-9u QRP+ V-Euڃ=.u h.h#P- @u .%h.h$u- @u .=.y15.=L.u\)j:hs'#u! 1҅‰.L.uShv'#"t%=8.u8.=0.u Sh'#j^bj:hS$uT! .= .u38.t.tR5L.ZY ..j:h|%u t X-j:h%u t X-j:h"u t LW-j:hd#u t1LW-j:h$uv t \X-j:h2#uV t lX-j:hʀ#u6 t |X-j:h"u t1|X-j:hM%u t X-j:hH%u t1X-j:hyG"u t  Y-j:hS$u t Y-j:hI#u| t.j:h#u_ t LY-=.u .hV-=.u .`V-.t Ph"|^_.t Ph5"fY[.t Ph%PXZ.t PhC%:_Xh.h֖%uq* @u15.h.h^#uQ* @u1ۉ.h.h"u1* @u . L....tj,SoZYt@L..؍e[^_]US Ph'#h-Sh'#h-xjdU=T.thT.htj jG U -yh-"Zuj-P-=.҃ !Ujj{.h"Z jh.bUh.jj! Uh.jj  U E E1ɉ .hRjEXZjjEYXuhV$XZh.YtnE sujYXujXZ=.uXE M9Hh-ZtU < tU EE9sE @E -xˡ-P-UE Mtt @8u1]UWVSu@.@.FVtI)~@'#t8u\Q ^@P u f^?봈@@.[^_]UEP^v0.^?<tP@1.2. 0.1.0.]UVSEPh(#QXZ@T-;t[Ct =4.uGW-PPh (#sC <Ƀ*PZVQPh(# 렍e[^]UVS,u]S5D.uVSRVSEԀ€Uԃ=.t̃Ef=LY-tMẼeewfEf=X-t %‰USj5D.5e[^]UVSuU ]=.tSRV/  y@19t @. @8u h (#E8%e[^]lae[^]UVSPW-EÉ4.@T-t68u-Fu#EPPhV$SV1%tك 8]tjEP5D. Íe[^]UVS!S 9X<uY8C L{ t VW@ZYtAEPuWiG YVDC Zu h )#!Xc9s ts tC Ke[^_]UVSá.H!vd3V7Y..Swt^'@-H@-x&8-P8- .P."~;P-}h8-j XZf{ u<@.@-H@-y;P-|8-P8-!h8-j!^X3hV$Y[{Vht#.C ^ZtaP;.s Vh)#>Vht#.C Y[t'PP.$hV$ =."~1.h"rZe[^]UWVSQu E]K:EE<\t<^up{tfKG^KCxЉwŠSzЉw>)#t18uG(NJKyЉvK KNjUBbM8t1ۉZ[^_]UWVSS]hh%S^_ug@W-; CteE0ƅUB@tUQMY9MU~ N+#QRhT%h-Ãb3#h-j DXZe[^_]UPPPh+#h-w.t@th.XjuUh,#hH&hqh,#u.UWVSSt Éֺ J&"h,#hH&hh,#@u :u!USPZYUu=.e[^_]VSh,#`jUEuh1#hH&hh,#@0h1#l1UEuh1#hH&hh,#@0h2#61UEuh1#htH&hh,#g@0h+2#1UMuh2#hI&jTh2#411f3A@=uUVSEu ]uh1#hI&j`uh2#hI&jah2#t0ffPh2#1fPh2#fe[^]Åt$1ɀ8u"UJRPRPg 1ɅùUWVSÉ,0hv Dž0hU1׋,03s DEsus 8Es <E41R(4@J&,ZYt4G (uh3#Sh%hV$h- DJ&E24@J&h"h-cC uh-j _X<sR@8t54VB@W$WVVEPMU1e#sj@HEPUS susuh,3#uhB3#uhO3#uhZ3#uhe3#U$19DJ&t@ uRh}3# 4@J&hq3#[^}tEPh3#ZYh0)uuh3#X,01e[^_]UWVS]uh1#h0J&h{uh3#h0J&hh3#11{ uh4#h0J&hWVhPsu s h-4#=ts h:4#ZY1=߶xt uh4#Xʍuu-WVhPsus hS4#J노"=thPs h`4#c^e[^_]UWVSSljUQ- ^t#u uSuWNÃu V6 ZHWu uSVWk9uSuVzc u V5 XV5 p벉؍e[^_]UWVS@]uh1#h J&h8C@uh3#h J&h9h3#{ uh4#h J&h:߃uh4#h J&h;ŋuh4#h J&h<뤋1ɿ 9lj}Ph4#99|CƁ t!Ph5# 1jjh V= tS h fUtts h5#_X1jjP9u 9t-uRh-4#4HPRhL5# tu@ku h5#Mu h5#m󥍵ѶxԶx9t PRh6#`3e[^_]Ë @-Q@-y ;P-|< t8-J 8-Uh8-PZYUPPhA#h-謾j蘱`.W|$wUWSˉ1҉`.M]m (%h}fU fUm]mURp pSQh]-0hD#h-2$e[_]g_UWVS]E }܍p(}p4EPSgY^tShD#4XZe[^_]UWVSPu} FM% FVFt5RPW9à tF1ۃ8t/h]-hD#y4[XRPh]-@à tŁftvWZYt#/vh]-,ZYu}u2}u$h]-hD#3Y[}te=h.u\VlU(1҉UtRWZY@uT 8-tRh]-)ZY@u"~lth]-hD#3[XuVh]-VZYt؍e[^_]UWVSx.dt2h]-mh]-Epd h]-!jjEp` @EuphV$2_X-xP=.t . .t 5.t2} F=|.u:xPh]-K[^@} 1ۃ=|.h]-hD#h-]-H- yh-.Y-P-0 t+@t( -y h-Z-P-Ѓ߃Yt`_(,h]-h9{$1` DždWxPh]-&J[^@t1E%=tEjhGPhh]-Uà uA 5.uh]-hV$kh]-ZGPhh]-ÃtNjOGXW\X\t;X\E@hDžl]-X\ptX \TX9и\T<0XPjj`jjPjwTjwXPE: X1ɉX\vRLP)TPSQ L9th]-hV$/XZDžd:)։1X\=`.tX\hoPT HY^EphV$F/XZ=t.Džd1X\t~hh.`ƃ ~KVh.Sh 9th]-뎉X\=`.tX\htP`wXX=t.u``XM=t.t#S`"%Y^th]-h E#W.XZ`&^du S[zt.dtSWLZYd=t.um} tgG t^.9GuTxPS۱Y^th]-hV$-XZDžd$E9Gud.#G%PSZY^uSnZth]-hV$~-[^Džd=t.tWh]-9ZYde[^_]UVS]hVs u sh3E#'Ƅ} t'h]-&Zth]-h@E#,[^.h]-VZYtVhKE#١t.t jsPZYe[^]US]} th]-Zt h]-h@E#sh]-ZYth]-hWE#^,ZYt.t1E ]]i]US]} th]-KZt h]-h@E#$s$s sh]-7th]-hbE#+ZYt.t1E ]]]UPPhlE#h-裴j菧U|PPhE#h-胴joUWVS|Ӊ΃=/u\B=/t`CR|Y_u%=@u"l|hV$ +XZt#h|Vc1 =vQZVSCY_u%=@t=/u^VS2C_ZuQ%=@u?VR/^u?XPSh_'%hS{=΃=/=/|8/uVPBZYti|hF#UhSWt0W>,t=|Ph_'%hWVWSBt|hF#)_XVSBZY=/S|^_uS|hF# j/|dZY|tpj/SdY_xt@xxV_Zt=/|)~=/ix)؉t=9|u fDž.Nj|ƄPRAZYkx9Íu fDž.׉ދt󤋅tƄxPR@^_|9;x9 ;p=/h8-褡ShF#h-ư-H-yFh-藥_H=/=/uS|@ZY=/u-P-0t- t( -y h-,Y-P-΃߃Yth-hG#=/t%=@uSY2SZu4=/C1=/ PSj|jOtS=/u1#|/PShG#޸e[^_]UE TET]ɾUE MQTU TE]鮾UWVS}E E@PX4]p8u_PK4MK8U9U΋U|4uU9u|,S<9P<|"ETE GTE[^_]>[^_]UWVSEE} GPX4]p8uMYPK4MK8U9U΋U|4uU9u|*S<9P<| ETE GTE[^_]鹽[^_]UWVS}E E@PX(]p,u_PK(MK,U9U΋U|4uU9u|,S09P0|"ETE GTE[^_]7[^_]UWVSEE} GPX(]p,uMYPK(MK,U9U΋U|4uU9u|*S09P0| ETE GTE[^_]鲼[^_]UWVS}E E@PX@]pDu_PK@MKDU9U΋U|4uU9u|,SH9PH|"ETE GTE[^_]0[^_]UWVSEE} GPX@]pDuMYPK@MKDU9U΋U|4uU9u|*SH9PH| ETE GTE[^_]髻[^_]UWVSSEEU JPqXI\XP{X[\9|9| TU ETEY[^_]PZ[^_]UWVSSUE EHPqXI\ZP{X[\9|9|TU ETEY[^_]Z[^_]USU EAHtRSHtG t uF u:] M[]9t=4/uyDutJt] M[]%h/1 []UWVS(U,/ 8/ /01d@DHLP4TX\x|hlEE8jj h1!# SQj]S脹@u hG#j ShG#KXZ=5`/FډWVRPDG#=Y_@u Sh E#xXZVL\u󥍽hu󥍅\P@蚰 t ShFI#,_Xuu@走 t!Z8t ShTI#Y^||@蜰_Zt ShhI#Y^u@蛰_Zt8-tuShuI# @o^tShV$ZYDXt Dh;I#Ճ=/t%SDhI"賅 ڋDSƉe[^_]g_UWVSÉ։ύEP ZyhI#? a-y hI#jt)tSuSuZ XZu蠬u蘬Y[etju6 jS. "ju jS I#uRuJjSVVpy hI#ie[^_]UWVS ~1ɉ=(a-u,h~P50a-Ӫ ~fDžDžVhm50a-D yhJ#0j諧 7fDžDžVhm50a- y Фh0J#h~W50a-!à  褤hZJ#h~W50a- t~hI#`fDžDžVhm50a-o '(a-tithJ#jXZ fDžVhm50a- y"ShJ#0jq؍e[^_]HyUPj 莉XZËJ UWVSH]0a-tPX0a-1=/=d/=`/=/=h/=40e- D9/4a-8u150a-/ 뗋,a-臚ShL#0j@$a-d/0Ht u hL#jhM#jܛXZe[^]Ã=\/<=(a-/UWVe-wh4M#j薛XZ=d/h/u6~OfEEEPhm50a-~ y`/~uz1=d/]xl15d/5H/~SuOjjj50a-~xFjWVRP萖)WV50a-l~x(a-"1ɉ d/=(a- hcM#hM#j蓚XZ1e^_]ÃUWVSPE1҉P1;EE (a-h/jjj50a-}Ɖ׃xtEU =h/u8/] hM#0jК(a- )}W =h/t1e[^_]ÍL$qUWVQ1y(a-Ih/u9hM#9jjj50a-|y(腗h&N#0j (a-)y11҃=,a-~hSN#ZjRP50a-v|'hxN#~X"019}oMQRPWV>U UthJ#j茘XZjfEEEPhm50a-{ yu貖VhN#0jC'(a-1eY^_]aUWVS8-=e-t-P6+5/=/X u1=0=e-Oh5#WV5D"05@"0賔RPVhN#hWs5D"05@"0hN#hVs0WVhN#hVqs}}t^=/tU5050hN#hV4sVh/hO#hVs(V蹆$Vj^ =e-ubhPr$401WVRP贓RPVhN#hVrV540hO#hPr0h5#H"0L"0@"0D"0WVRPNRPVhN#hRIr5L"05H"0hN#htW'r05D"05@"0hN#hVrRWV540,a-HP00h)O#hPq8}uV50hk"Sv%VM$Vj }*e[^_]Ã=0a-y140d/`/UP0 ܣ0t@=h/u7=̣0t 050hZO#50u50f=/tGh/50a-pZYu1/%=u  = w u}/t 50h:U#h4~/t/CFtP50 YZy"0|ShXU#0jK=|%=@t50hU#j&~ @YA%ma= 0u )؉h%'2\yDžlh/BSZth/&Zt0 0u#h/%h/XZY )P1=///PV 9hsh/hU#j3}tPW9ZYu0=0t:t:090W090u090jh/NZYy'jh0jr7`% 1ith/,YYSWh/O xݡԣ0 У0u+=050h/O*̣0XZ}tPh/YZu=ԣ0t;=У0t090|090090]40=0t h/ h/Y+00tE t@wpPh/YZ h/Zh/WXjj50l y80dFydRhVT#0j{h/Wjh/XYy#lPh/3h/^W Rdlh/\ dy Rh/ Rh/XZlPh/YX=0~=̣0q01ɉ ̣0Ze[^_]USl"0$0=\"0u 0@\"0\"0=~~ h~PhU#ÁthPhU#jyKX"0Ta-5/CZx&1H"0L"0l"0\"0‰h"0d"0 >y밉؋]Ul"0$0=e-u>\"0t5=~~ h~Ph$V#thPhRV#jy@5/Zx%X"0l"0h"0d"01@"0D"01 yl"0$0Ta-~X"0~UWVS0t hV#jfX"0=\"0Ta-u\"0 yIh"0+d"0EU EUTa-EEuuuusu})׋E9ƉM}u}WVMZY+u}l"0 Ta-19}dd"0 h"0d"0;h"0s5X"0PY_d"0+l"0RP_Zxhl"0Ɖ5d"0Ta-h"0 h"0d"0Ta-X"0EU)@"0D"01ɉ H"0 L"0ze-hV#jwXZ؍e[^_]Ã=Pa-US=e-uhV#jvXZyx1ۉ@"0D"015Ta-5l"0ZY~%l"0d"0‰h"0@"0D"01+Pa-~C9}PhW#jTv yu뙋]ÃUWVuM d"0)ȣd"0^_]UWVS$]CDž$$ x$|$x $=0u15xPu Q^_y狳sVh5K#0jmvPugQZYud%sh>W#0j(vۉ15Ta-5l"0u xƒ l"09|Ru -WQQRu<9uUy%rVhfW#0j@u79|$u9x$t hW#jtZPu OZYy?rVhW#0jtNjE49}u;0thW#뗋9}3t)1;x$|$}Ru ye[^_]Ã=`"0t1US5Ta-5l"0ZY~'l"0d"0‰h"0@"0D"0=u.=0u`"01$x1@"0D"00]ÍL$qUWVSQ Q1ɉMM u15d"0=h"0)9}Ή5d"0)ډ tƋX"0]؉}܍MQWSRPkƉ׋EUEЉUԉËU֍ ƉύEPWV yEU)u}@"0D"019<h"0+d"0щ9|gx t%u؉}9}M؉]܋Ed"0+u}뢸eY[^_]aUWVSU Ӆ~Hh"0+d"0U U  )څ$ 9~؋5d"0}5d"0)É}봉[^_]UWVS}x$|$hlGdDžp } xAxPu LY[u]%odh>W#0jqۉtE1҉P`1h9Ɖl  h"0+ d"0 } ^ș9hl}hdSpPtPQ5d"0u O]hlS} yE] Cpt1;x$|$5d"0=00\t`A9\u\d"0)hl} xdptZ;x$|$}L pN;x$|$ap#ƄWVZYp` `D$@$WV:WVgfVhZ#V PeZYVh[#j_ U]lt lt)w$V#pZYxDžl=ȣ0tVhZ#RjD`뒉l<$8$VO lxDžl0=0u =ģ0tCi<$8$Vy =ģ0t#($tA$u($(($$u ($.($($tbYX$50hO#NYZjVkBYZxPVTYZy+\th=[#0j_WV@1$H%# PVXZ=ģ0u ($jģ0 e- e-t[j $P3VA=e-u =e-t51$PjL$H$X$T$t1e[^_]UWVSu }SE8uEEME;E~])])؋ME8tR<9rt >8u9@}jؙRSuh@[u hU[#E18}t}t:\0T0E\06SVu譽 9Zu hs[#iX0P0EX0ҍCtPR螜 XY Pb Yuhe[#j%\XZ>CPVЉUP蔺EU 0j\̍<+E e[^_]UVSu] }u1NjjjVO?y ZSh[#jh0V^ yYShs[#0jt\e[^]UVS]u x@P?`X=0t*jjL$H$X$T$xe[^]UWVS(]} $(v(11ptWPu ^ ~ pt1@9uNjt9|$up9x$th[#jsZ xPu a6ZYyXSh5K#OT$9X$u;t h[#jjju =y$PXSh[#0jZp1$1e[^_]US0tP91ۉ00X0um1 -yh-/Yu9-P-9d-uu%1S 0 t뭅u tډӡ0A0u0 @0tϋ0zyP1ZO밣0j50h00 &1]U=00=0t0=أ0t 0@=0u'h 誓 0Yuh[#jjXXZ1x0t9UVSut>uh!\#j N Xuh<\#jXY[FVGZH~ 8/u3E ؉C1C=0u00X01e[^]á0t@=0t 0=0u4=0t+UE$u0tjP50蕍 US=0t801t6{u+uhc\#j(WXZ3hI#h- 8 [Ƌ]UWVS]=0u =0u$150yx50苇0YtHHQf $|M&=0tȋ@PURURpp p0;9xjjuuuu졘0pph\#j6Vph\#h\#p jW Rph\#p p1҉$$$$ ƃ pP $󥋓($@`w/ @tf%ǃ$ǃ$x$|$$$ǃ$=0L$H$X$T$0$,$$$ $P6$yǃ$mǃ$aǃ$h RPWX y$0pRVh\#0jUƄ  ǃ$h 0pCPܲh 0rP躲50hO#D t10@8e[^_]W|$wUWVS<ÉUMMQEPu}j 9ƉЍM}Qh]#Qh]#j@SLue[^_]g_UWVS\]uCE=0uPhI#Vd4 ue[^_] %}W($ gT$X$E(j8$Ej<$Uu1!#u1!#PjRj4$Wh*]#V3$ w'@$  R%Ph<]#|$x$hG]#V3uEPhR%V~3$Pw ShN]#u ShI"VH3 Vj ,ZYV$Xe[^_]UWVST]}T$X$uV($eSWVhV]#aQe[^_]UWVS]u fVfuPY-Zt%t0SRjP}WiVWqCۉu ]e[^_]Ye[^_]UWVSUM] Ӊ9ss< uB1uZB1J9s]JqЉ w D$qw Dqw)DB qЉwBD9rt1[^_]UWVS EEU1} t EE1EED}u^9r^MHYW wY0Xu}u}} }u,HM0H]u]u} }t9sԍr19r)A9r)‰ð0E E؃ [^_]UWVSS}]u 9yK@G?ș9GG1 Ԋ< u G9r11҃G11ҍO9OYЈ\$ w %Y\$v Y\$w\ D$G맊YЈ\$w0GD$9r h11Y[^_]UWVSUED1}uo9ro]H 9޻r0WHM] M] u uu,HM0Hu} u} } }t9sԍr19r)A9r)‰ð0E E [^_]Ã=0!u%U0h_]#jMXZ1ø1UWVSSu] E}MM1҉ p7=0u0K 009-u B0 -=0u" 0Q0u 001Ҁ=0t7tMM}E] ue[^_]鋀E] ue[^_]UWPZYtU:u W3h]#(x:u9-9} p7@-W3h]#h--?e[^_]1UE E EE]=W|$wUWVSjEPS4Ɖ׃EU E9Es 11M9ttuj,VZY…tUj=VY_DžUuh^#Uj  ZUuh]#jJS肎 jul0 h0Bh01h0Boe[^_]UWVSQÍEPS>D^_u C #ƋE| t@E]S者 Zud01 KDe[^_]Uh-h^#je-t 9tUe-Uh-h^#ΐh-hR_#运h-h)`#谐h-h#a#衐 jUWVSPuhA%SqEZYhA%S_ZÊEhViYXuGVha#0jOJ }t/1e[^_]UWVSlj/E 0^_0t@E 0he#PZ Y[d0e#0`0111҉U11Ejh`a-h3b#u uKzX$M& p7\"05 p7hb#d \"0렸1Pa-덡 p78-uxu1/Ej/[0Q/b#B03أ0$1e-=e-u#b#>|10p0=p0u 0ģ0e-c0T5 p7=Y10o 0` e-G/(7%80 p7`0#0EH9~2MxPV XZMuh]#jFjEƋ p7`0PM/?=$100ܣ05 p7E/\e#f/e-W/e-H/e-9/e-*/e-/e- e- p7/01xe-1ɉ `05 p7"DZ40\0-E GEt`0>}15`0jP$Y[yRFEMhb#S2ZY;GCjP[^u}uhb#Pl2[Z_uh`#SF2Y^-uS(…u_h`#S#2ZYtV^=d0tShb#zFtjP8ZYy*h&"S"XZuSBhb#RU1ZYt8jhb#URK UujjRZYMpjP؃jSu1ɉ Pa-}J/t 88hǢ"辨/Zt 8/2" 0!"11jh`d-hc#u usz$O&1d-ă뿃 p7\"05 p7hb#00x p7/f 0 T/b#E0@30΀0  p7 p7h-hc#5d-hk%h- 5,e-hk%h-h-h$豄/(7%00 p7ÉѣP"0T"019| 5 p7h2c#%thhIc#jV=X0 p7Sh"-ZYuPa- SlWPa-Yyhoc#j5 p7Z\@D0/0Phc#j<j/1ۉ05 p7Y5 p7*Zܣ0 أ0@|ԣ0gУ0U1xe-I0: p7/+/?=$`0 - h-j Y[{%E1 u1e-08-nEE ue- Ge%1ɉÁ ue- 095 u e-܋E5 _e-.1 t\50hc#h- 1 AI!Q&Phm$š-P- e-uu0,e-v/t1jj} 4 --9Em-9Eh d#j9ME M0PZy$j j} 4g^_'--;E|1ۉPa-e[^_]ál0t Pl0Ã=l0t[U00h3d#jN9 tp0hbd#h-950he#)ZYu1UWVSM11JqX?tCt*tK[t~=0ttjMYZF}uvQUtPU!uX1C<]t:m~-u Vt]t:E :U|^:EuĿ1}!9*A8Qt1e[^_]UWVSSÉ։M:NjU8/u@J)ف ~Puhe#j7D։9r KNKNp19r)XӋE}tE9r NKFC1e[^_]UWVS 50he#6[_Vh"f#6hRf#|6htf#r6h W6h"W@'ZYuh}f#W&[= u hf#&6Y덊uhf#6ZX<.uuhf#5X1t3L@LuL@L%H9s tFCC@9u&>t!tWDh:g#j3|tHL@t<uDh]g#h-~ WDhsg#h-ct@th WD躑0 1e[^_]UWVS]t K΄u h}g#4<\u FFu8ujn Xuhg#j2^_DžoGjQP蚙 t2hVPہSVhg#jd2 Wv [띍V֊t\uF8t)F;Wu Shh#j2YR蠶Zu%Wu hg#j1$N1GtYuh3h#j:l XuhHh#j0[^C31CV ZC 1ɉKECE C=0u0|0X|01e[^]US01t6Cu+uhuh#j0XZ3hI#h-~ [Ƌ]UWVSu0t$tS=0u S1u=0uSu$t9ut0}FP茴Yuhh#j/C_Zt/1srCt/1ɉK;WZC Hǀ?/uC C$c‹@t 9uBSS.s 1ɉ$[:hh#ja/XZe[^_]UVSu1ɉ$0u,=0u1=0{C |/t[t0CuPFP3 KVPZuɡ0u '$tVZYx 1$e[^]UWVS]=xe-tjs{.u{.u Ct:u hj#j/V虺[_ÅtCF1ɉMMPtMzЉ v@,u}u@E1҉U'.u}tVhj#j& TE@ja Xuhk#j&Y[0t;u GM1GtAt0yVhOk#&O}thE8t`W yuhkk#j%Wi bGƒWt+G 9OG}Vuhk#j%WOi 1G=(0u=(0$0x=$01 hk#e[^_]UWVSM=@0tPÉֹ=1:t9pt@9u9U}tj4` ZUuhk#j$[^1p1ɉH xe[^_]Ã=L0u1Ujh d L0YZt1hl#j$XZ1UWVS}L0$4$E,$E싇0$E E14Et4ËE;CuE;C uC$$9Ku; $trS[uj(_ YtGGP胨Zt0 $$$CSEC ECECEC1vSdg Yh+l#j#XZ\Uh 3 P 1$$CHCUwC3g Sf [^e[^_]UWVSML04$$PvrHto,$0$E 1tL};{Su!;s u{}싹$$9{u }; $tCɉ3Uf X]e[^_]Ef e[^_]UWVSS=L0t51ۋ4t#1ɉ v0Ef EPf XZuC u͍e[^_]Ã=H0UWVjhGoa H0_ZuhIl#j"Y^Ctl#=050>Ne-Z@u"50+ Vhl#0j"50MX1e^_]1Ã=D0u1Ujh` D0YZt1hl#jp!XZ1Ã=@0u1Ujh=` @0YZt1hl#j3!XZ1UE$$ $]UWVS(}=@0$ $$$EUE 1҉EU苟,$0$E1҉!މu؉!ȉE9u9tE1!É]!ȉEܾ 1EE11ɋEUÅt#@ u9pu u90g@E]!؉E̋EU!ЉEЋEU3E3UЉ Ӊ] O $$$Å}uIE EtAj [ X11q $$$AQ C AK 1St$00400040 u+0040M!u!9u^9uZtL00540 t:UjhZ Zt+UM܉HUPp K HC $$$3GPh m#jhEm#j$P @ $$$E؉,$Eԉ0$1e[^_]Ã=<0u1Ujh=] <0YZt1h{m#jXZ1Ã=<0tDUVS1<00tjjs sss3觵[$݃uʍe[^]UWVS$EE} EEuEEEU E܉UE$U(EԉU؋ <0=1Et#؋M9Hu9p u M9Hu9xt@$uj(X X҉UtMu/UЉYt4zEBr EBu܋}rzuԋ}؉rz Z$E!R a XE m#Ee[^_];e[^_]UWVSEEE EM}<0tqȾ=1tZ9{C$u9K uu9suu9stS$Åuڃ/CSMQCS MQ3W` SQ` XZ1e[^_]1UWVS]}E=0t";/tPS!^ZuShm#j$lW YuShm#j. hS踠ZuShm#j ue[^_]_ GFG4W8F VG(W,FVGlFF 80F580e[^_]US80tvC80=ģ0u{ t s3hXZe- e-tjjssss 3輲=|e-t s3YX3^ S^ 80XZ놋]UWVSSUE @~ T@119}At41ɉMU1ɉrE1uZ[^_]UWVS u=H0FhGSPl <9tjww 5e-;Wu;G t h-n#*SR5e-+{ 9؍thEn#0j SR yT$X$G9__W1jT Xjjj5e-DG WxNS5e-z 9u)T$X$GWH0W8h]n# h}n#0j7 W\ Xhn#j#ZYe[^_]UWVSQD0uhn#jXZohu u Eޅt6u; Y_tcvj S ^t;u5ƉYt#u$GZt _E81QV(\ XW!\ _ho#ja[^0^SuZYtS[ uϜF_Zuhn#e[^_]UWVSu} D0t=h7V t&3VeZYuusVcv [֍e[^_]UWVS EЉ1lj t׉ EE1EEL} t} t} uA HA@ AA4AA (HM0H]u]u} }t9sԍr19r)A9r)‰ð0E E؃ [^_]UVS1۹4Cu񍘜9s CS[^]UWVSЀ| uB=-ȉ19t^p.*u&fDzu!\?uƄ. pƄ9/u Vh-o#h SSyEVh5o#h SSy=Vh@o#h SSyVhNo#h SSce[^_]USSˋ t%RQPsE3Y 1U1ɉ EeveRu Ps ]URPhYo#jUjhoø1҃=d0t1UME1҉d01Ҁ<u=Bu} u,J=`0td01҃8]UVS]} ~;uqjhe#Pp u%=e-u e-ho#j0ZY1e-jjPƺ 9؍e[^]UVSiÅ3ho#VJZY[uh-b#S6ZYt)SVho#jh-b#ho#ho#j e-vSVh p#jtt0o1e[^]UWVS]u hVZYy\- 1{ǃ4$K<vCVhT0\0 x RhP0X0 U jjFdPG%($jjFlP/8$jjFtP<$$jj F|PEUUEщx$|$ @uAjj PT$X$H$L$`$d$H1$$$$ 2t|,1ǃ$ǃ4$($Qw\1ҀKƒ $x$|$ށ$1$$$ǃ$($w($|/t5uǃ$@($ǃ4$Fǃ$΀($x$|$%$1$$$1|/uDe[^_]UWVS]$Hwv$Q&=t0t_hFp#j hop#hp#hp#Ń d~ Php#뮋p3Sc~Rhp#땹1jdRPn1ɉ$$$ u#EƄ5/jj o11_Z1u9E2jd PEP5njj o11wE1Ex$|$ƅz ynH0P t9uon19r)J9r)lj°0󪋅 th q#$%$1$0 0t50=0 T$X$($1jjWZY8$1jj_sZY<$1jjgRZYjj {5^_un1jjMZYuJhP٠^_y>jhZYx鋓$  Ѓh)q#e[^_]11UWVS}} ?jhe#VP ÅulhNq#VY^¡`0 p0 up0hVq#j XZjjPƺ 9tPVhq#j ؍e[^_]UWVSu] hS2ZYy- 1~dž4$1E쀻Yt"h YPWjz/@E K<vM E)ShT0\0} RhP0X0 } jjCdPo%($jj C|PлEUUEщx$|$@uAjj P T$X$H$L$`$d$ƃH<$P)P=yjjCtP͹<$ ƃ(8$P PZYyjjClP藹8$ 1$$$$@$D$<6tL<5t_<2Pπ2 ډe[^]wUWVSu>-u~t2h&"V~_Xu$V0LI PVhWs#j[-1EPSZYt/G}vEVWhjs#jEUt-u1 SXe[^_]á|0t UU RuP!E5|02UVS]u F5x0tRPS tD3j SZYu1e[^]US]}t 0ܣ0 0t=̣0th-j 91̣0ZY50h "h-Su h-XDh-j  ]USjhd"Y[xEhr"P|0YZt&h&"Sx0YZt135|0ZSX= 0thd"hs#j ]UVS] u}t 0ܣ0 0t=̣0th8-j <1ɉ ̣0XZ50h "h-Vuh-ZC~SF Phz1$h-h-j XZe[^]USPhs#h-[jG0U-Phs#h-5j!UWVSƋ=0tPhs#h-  =0u ЉˋQtjPYZt8tɍEPsXZ=0tVhs#O^Xjszjssz&%} u1!#VWPREPh(t#h-Xh--H-[yh-Y-P-؃t- t( -y h-Z-P-΃1Ylje[^_]UWVSAօu9VPmZYt&0hV$T^_F%=t1jhT @txP6Y[|x^9|u,;u(^9u;F u%=t;/<-ZjjjC  ׉NX^\19ȉ}{ 9}Dž 1P 9y+{G\ZCjjjr ' NX^\19ȉ}{ 9}Dž 1P 9+{vZrjjj VNX^\19ȉ}{ 9}Dž 1P 9+{Zjjj NX^\19ȉ 9}Dž 1W 9PPWi +^_jjj ~\vX19}p1҉9 u݉19} 1QPf 9u#)[@H0hV$OXZiYe[^_]UE @E E@E]UVSutYSC t } uC0@0R: s: S: 0H0 u0t e[^]UVSu0@00؃8t VPjZY\0u 0u0t e[^]e[^]UVS01؋tJ9tFjPZY\0uԉe[^]UWVS0@0ƍP貭Y11ɋ0tx?tBA'u9t ht#x 0u0th jVS裶19}Vpht#pg-HQP yP@g-H Z J GS褭Xe[^_]UMtA'10]UWVSu^Nj7t#vuY[Åu jWXZ ׻؍e[^_]UShV"ZtaujY1"4H0tP{ ÃH0X؋]UWVSP}U UWRW"ơ0@0$莫W«C1҉S UR豫C0H0u0t e[^_];e[^_]UVSuV[t#sVpZYu} tC t1ى؍e[^]Uju ZYt@UWVSjX1ۡH08uHSj=FPFY_jVf_ZDžu/Vht#5g- H0PH00u\Vht#w~g-xWP yPg-H Y멋J @PVQXZ뎉؍e[^_]UWVS5l0-DCtWjEPV?d0h0] ^&:MAEI^&uV)PRht#^&tK`0\0C^&u)BUPd0NjUd0Xu,Ƹ^ À~|tH;= ÊV~-t >θ(%)%#Ƹ Ƹ^l0e[^_]U5t0Ph9u#UWVSQ5$0\0$0PÉ5$0^=Fg-t Yu#uKt;uQ%:1҉jEPS^Ɖ! 8uE8t+ 8tju#`^& tBUUue[^_]W|$wUWVSE܉UM7E܍Hw$4S&u# u u#!AuEU Ѹu#t݃} uWVuu WVuu &MΉEEUM EUEU)?EU t1?EU t19uE$1ۋE9Ɖ}$1ۋE9Ɖ}|19uE}11ۉM][EU11 EU11 ۉ]1E.E!EE!EEU11 EU EUEUe[^_]g_UWVS }Ӌ7VT_=p0%us Љ UU_EU=p0&t u#wEd0h0S1 VVڋExYtEUe[^_]UWVS(Ɖӡd0h0EЉUtSUЉt@ vSUиƉX^MƉׅuGMIt!ElM̍YWVщ‰Y[ƉWVh5"j]SjSu e[^_]US7=p0)u _[]W|$wUWVS4ƉӉMЋ?E1Eă0HId0h0SuЉE뭃$9 "tFكPE4EȉU̸u#=p0#4EEЍpًt(SEȉŨwhfp0SEȉUYEȉŨw>/t[50>t' 0H 0FxFCXVԀ~/u# 0Kh"VZYu$f-9r :ƅuh 0K;/u>thF%VZYt 0x/4艝X/ |XV>t 0H 0FxފFC9f-u 0x/C <X/= 0u( 00@0|0tPN& X0|05f-0j5|0h1v# j50h4v# 0H0u 0uUe[^]UWVSQu} EE𡐥0@0VG[y 0u 0uyj4á0H0Zu0tt9=f-u =Vg-t'uVhI#Y[50hI#XZt1Ee[^_]UWVS5f-ƅoh8v#~Yt p50h)H0p+0pPbSLh‰$pVp ;-u{u|0u0t<.uS{.t F%S^t>h#WpZYEth"W\ZYEuEE1}}FHπ\ut}tnxP0tB<wV$S&NE1>: 6 2 . * &щǍ@0w\9Eu}g-HyPg-H X JF>/g-HyPg-H X J }u-g-HyPTg-H [ J 5g-g-fBYtfBhv#j(1e[^_]UWVS]u }g-tg-9tx u hg-X00uPh "hg-" 0t0Ph "hg- t&WVhg- x0h%hg-ZYxS# PhV$hg-g-HyP'g-H X J Eg-e[^_]e[^_]U塘0uU0jPҸUU 100@0tuRj u0t 0U10EEEEjEPj =0t=f-tjQjjjD U=0u 0E Puj:UEPu u(UE0jUS]|Su 0uUauu 0uUEPu juUuu j}uUS] Su0^ ]Uu u0A UE Puj+ Uu uj UMT&ft9uPU t@Qh%j h00á0UWVSP>YuOƋjjPqǃ t 3;ZC jjPKǃ t s{Xe[^_]USh1!#ȨYH08tNf-g-Q0thB sXZ顨0XjjSP5H0#j1]W|$wUWVS ƉӃ=ԥ0uj'~ak<ԥ0X ԥ01ƉU1}m @%M1EmPP$hUx#jS;6u{0ujh1$S,6F SnZÀ{0u K{.te[^_]g_1̥00ȥ0ĥ0US]tvUUt[F~#CtVj RPWjEpS:~5j Rs cWE@C us XCX C @C[놋]Ã=إ0USQjj]Sjjh$f-s@tBEPإ0Zt,jjSPjh$f-B@tإ0PATH@=5إ0  إ0f-Xإ0]áإ0US ]t6;u1Ct*p肪Zt0PjEPCp1(]UWVS }W1t@0B0PWDrE_XZsnEX;t.Ey"xVpY0 PhZx#1Psus ua 0u0t[~5jVNXZ}xu ju4 jssYX}yjs_XZxV^uuYu u|Z upX10 0u0te[^_]UWVS}u g-tu u101E܍]SÌXZ$T&uwYX=g-m=̥0%jw~XZ=g-K0 ̥04jwNYX=g-=̥0=0=0tBVW VW=S- =0t VW=0tjwXZ=g-=̥0u=0uSŋZU ?1=0)=0tuW =0tjuWSi =0tEuWfك=0t,www+1ɉ 0jwXZ1=00jwY_=0tr0f=0tW,S踊XZTjVW S蛊6Rhox#-hg-IS{SpY Sgf1S轊X0t=f-t0t tPtj=e[^_]UWVSE ǃE܍uV5$0ju^1jY=g-tKt>=g-u5tUXUt E܃PuRcXZ=̥0u V苉X^VZu10tje[^_]UWVSWE} _f-f- 0 0HO;t( 0sx&迊P ωʋ7 0tx BM蓊P M҅xJ wH+ f-Q茇^0PS}ZY100e[^_]UVS]ȥ01js&XZ=g-=̥0tT̥0uХ0HХ0x1̥0뼃u Х0QХ0 1ɉ ̥0MwE50=0; ut-t)E Ps50XZ=̥0Ro ȥ050e[^]UWVSu=0=g-u1EPIE؉E܋^Yt$hPSO =̥0b[E؋E1҉ȥ0]؅6F$0=g-Pl0P蒦PGh"=v 5g-xWPyPg-H =_ J=sg-xWPYyPg-H X J 5g-C_jsv E Pv =0=g-uJ̥0t:uХ0HХ0-1ɉ ̥0Hu Х0HХ01҉̥0 ȥ0=0EPPXe[^_]UWVS]uV薅E؉E܋S $0jPsiM[=̥0{tuG$0EpWRZYtV1=̥0uZ=g-uQSC ; t$0u P 0[_.[$0u P0ZYu뇋[g10VlXe[^_]UWVS]} 31EsZ=g-{5$0l0P.Phx#Stj RU5g-UR hx#Xu hx#Xg-HyPZg-H X J 5g-X0@0ujSguSPEq}trt<u4guu 0u0t3js&Wsj0H0u~0tunUu;Rf1ɉ 00H0[0e[^_]Rr00H0Zu0t tJ=g-tA{t;5$0l0PnP#hx#g-Ee[^_]e[^_]USD0EE1EEpX=g-tlExtc5$0l0PZYEP$x#[EXtj S5g-\ [hx#k[5g-XjEPڦZYtlE00jXEuKt&:EP$x#X5g-XԋEt0j50踦0@0Eģ0j EpXZ1ɉM 0t5u Ep-Y[0@0E0j%X 0t0t뻡0tEt"EPO$x#CX5g-Z]UWVS}] 1CCC =g-EP聀0@0E^y hx#xjWfdjWPyu31ɉ 00tujujWuE؉s 0H0Zu0tEPwXe[^_]UWVSE ,1@0X 0(0$1`0EP{X10E@$0ptEXt8sp_u&C$0hpPSG [u[ċt1ۉEp :^x|EXtC$0sYu|1҉4pjxPSF [븅t4B4닅4P}_0pt0J0H 䋅010T=f-t"=ĥ0u4~0@T40)Љ0=g-u 4fEE0 5$0l0P聝ZYP4[xuvp1s)Zg-Hy`PXg-H =~=WXtNg-Hy8P_g-H {j=WY^ƅu뽋J=뫋J Ӌp t:g-HyP9Xg-H J sbX뽋EX g-tRSP t [HyPXg-H J 5g-l_gxsjh`U&VF u Xԁ}0 ``041 Huw)4)400tX4t-X`0QRUR0af}Zf}tJXZ:-{z-uzu apu CSu>E, `tfE=0u Ext,AEftfwE= t= tˋE@fet50@0ju^[^0@E0h!x>[^8<50RuP,_,@0H0=00ujjS 8nf-9tߋM/t/CUuS谋1ɉ 0U^_}9uB0<:ttB1::uBMu^ZD+f-Ee[^_]k1e[^_]UWVS|uj/S}Y_tAuu VS\荲 xP6$_Z@ j6EPǃ tjMy\=0uSuu VWu>8t48t*8 uxPW4$ZY@t WkX뀃 h u tCƒv~ 0PSP6hk"jUWVSuU F^fftfftdN0$U jS$PJPj IU yхtvhWy#XZWTXtkhoy#@XtZhxy#/_MtIhy#ShV$0@0vP$Pb0H0tShV$RY[?0thy#,Phy# PShy#M~ t-g-HyPbg-H *Z J*g-HyP5g-H X J e[^_]UVSud&t"8u%uCVP諡ZYt؍e[^]UVSud&t8uVPyZYuCݍe[^]US,f-1ҋ0tHft fux@ |u[]UWVS}0@00t,Pfu9x fu9=,f-| P X҉΍^x0t 0u0t e[^_]Se[^_]UWVSSu0X'1E8Et$}u <:uWE}:u uW@u6u#<%uUFPhy#uZYUt>:uGFC딃=,f-y t ,f-u1҉MRM ,f-Xe[^_]UWVS0@00t!f{usS XZٍ݉wx0t 0u0t e[^_] e[^_]UWVSutA%<00tCVP-ZYtdߋ} tX0@0Vj$eÉ1fCC VCPS0H0 u0th=0؍e[^_]USd&tjP)f@SPXZߋ]U塐0@00 P 0H0Zu0tUWVS] j/ujv^_t[EtFxPu/ZYy 8t۫8tѫffCf1CƋM09tMEthy#QmY_tM ju_Zt>HftftfuEEu E u=,f-yƀx u91ETtE,f-tuDYDžDž\DžXDž`juEP` Wd0Z?/xPWYZ2E%==0NEWÛLȉ`+f-$]cWabjuƃfx`QWTfXZF FfF CfF fCFC,f-f~tF\`9\HPhy#pZYtuYDž 50hy#ipYZ`9\~8=8k/8]!XKWuhy#50@0dTujuY_f~udfF`FDžX t@Et$jXPuh%5g-Xf`0@0dTujuXZf~udfF~ 0.0!1 e[^_]UWVS$EE111E11EEhy#yEZtPEbw$hU&1EE1ɉMſE뵾뮻E랃}uutjLY1҃}u/}u)}u#uEEEH0810tROft!ftfIu:}fu.} }tуtEЉUSW>XZEЋUԋ?몃|u5g-^g-@hy# [EjWZYt[@ft:,fuu>H0PH08ufHu*}"fu}}t˃=,f-x t0PuЍEPW}t f}uA-tf}tjW~Y_t jPFXZzd]uEԉERuIEe[^_]UVSu 0@0ju!Ë@ZYft&fHu skXfCFC fFC FC 0u0t e[^]e[^]US ]0@0fEEEf-fEu CEEPSL0H0 u0t ]~]UjuTZYtfxup)X1UWVS 1ɉM11uh/z#DvZt(ptvtVuEEлɋE 8ctu ދM Mt4Ph3z#Ht}t5hEz#4H0:t/1E H0:1!#H0: z#RPhhz#m`Y&jjV,XZu}jV)XZGfEGEEfGfj/VmZYEEԡ0}tEjVEPGEP\My`uhI#XZH0PH00Ihz#2j wm hz#whI#H0 8g-HPg-H H0PH00YV_8uVPKZYmIwhz#swhI#J H0PH000PjEPV1MfHf1!#tz#Phz#mY^jV,_Zuu hI$JYV`E0; Ph"$H0PH00 u%hz#uhz# uhz#jVhI#H0PH00_Xt!H0PH00E.h{#YEE~uh}z#넋Ee[^_]UWVSEPyZ0+f-PYf-XY}GE܊_tkta}t\} C<v2u+:t$ t/t6EP=Vg-t"E u 0xB [P}눃= 0u[ 0f-8uu@h"XtVAZ^E %E1byP YuVZZP% X VZXu‹E|}u5F< v@ 00y8[P0Csu2"a& <w 00yZP08t8}t!߀u8CuEԉEtCW tC̃W8uΉ֋EԀxAȋE1҉U]}t usu]uM΍HMЊ1uEΉEAx<EЍp[<:Mh{#VVZYEąM9EЀxupx9u^&EEE9s2>uF9utsE^&tdU9UvsԋUE͈@ĉƃEM9MUP! YPEP< EXZt\uuЀ>-utF<]tm/uu}NtFuc=|0Uqxvtu@r t@١|0;}u5|0S[rxRPZYyZ9tt1t9s'@ZxvttE]S@ϡ|0;EtP9Uu8/t}G F%A%PXE9|0t@/Džp>t F1ptJxw@tu@o0tSNYpu{F/uSZt߀x .u o.uǍx jWt tptWuh5|0 덋EG@WPu@/VP_Xle[^_]UWVS}P v Gu+EHCt5Orxv tpu tAƉ+E[^_]UWVS]{FFu0skY@uP0DVʴY0u+f-,+f-EEt;t}1ɻN)ЉE=Fg-8<@.<*&}tE<VE)HPh{#(1ۅI~@ 0H 0Cx0P0S։MAP0SM뻍G1҅~օ)xu u܋E%PV1ɀ} k0+f-ыE))00 0@} uSvZ}EtsŠ"a& <w2 0x0H 0U@H 0U 0x0H 0U@H 0UԈC뇻11EԀƒ v! 0xM0H 0CuJ 0x0H 0ĈU7@H 0U뫈U@H 0U뫻1111ɋE%Et>@u=L0uM @1 1E @€}E$U&U50Q80^_Uzu LuЉU E PuY[ExU^1 00yB?P050+5f-uuuuVuu%0+f-ʉ0)@ 0uZ0uuuVuiƒeuXE)$0 Rh-{#誩}O#uOQVHPRhH{##u EEEPVE)HPRhk{#gTu9u1ۅu"uԡ0+f-Pu 1Ҁ}t`]uu E]Etq|wt 0 0׃usuKt@뿃uHuEe[^_]UWVS]E %E1ɉME tEg-0u 0E졠0+f-E;~uE t u SXZE 1Es}B~< O$,V&:=J{s{u{y{@u{=uz10E} t 00ys<P0e s 00yI<P0$0 00y#<P0 t=0t"0+f-M9~xuH0 uE uE 11 00y;P0҃}u C< w 00y;P0S 0x0H 0U^;H 0U߈ ts$0E#E PVu R0pl00VrXU 0x0H 0U:H 0U߈E {~=u}1Eu V[X u$0 0x0H 0U`:H 0U߈EE RuHZY0+f-jPHP wމe[^_]UWVSEu ]=&g-t1҉0P 0f-0f- 01ɉ 0 0P$0Sp_Xu&0= 0u90 0 00yg9P00+f-Pq600XtAh0W&01҉00Y_ÀtS50+50_Wj6x00Y[k01҉0tNFe[^_]Ujju5f-@E5UWVS$EPEߋ50+5f-hREС 0H 0ZYx0>8P0=f-VWW]S60+f-P+55$0WȕEԉUS6f-򡠦0)Љ0 0 0 70uuh5"j50衜0׉Gu}"tj)PV} 0)O0)= 0EЍe[^_]UWVS]u =01}DPSXZ0= 0u70 0=0}=f-}t }tA\M;tWhI#hg-訛jW&Et{#PV)KSh{#֡jWV膥+0=0) 0e[^_]UWVS]u=0CvLE%PuXZ0= 0u560 0=0 f-}M  t?9s@UVWQM MUt <CÍY9s1:UVWQM{ MUS9st{u8u@@9r9sS륍Y9rVSQM, SMt9s{u8u@@9r9sS뺉A9SVSQM u;Mt;uCCӈ)ȉ+00) 0I9tKCCG+00 0x C04P0 0 0e[^_]UVSu]Sc2F 0f-0f- 010jv 0H 0 x04P00+f-P1ju PES2Ee[^]UWVSuFPh#衘g-xWP[_yPg-H Y J19}E 4hZCWh#Cg-xWP_YyP蒖g-H [BJE 4|g-xWPYyPJg-H XC9| J1e[^_]Uh{#Uh{#םUUM 0f-t 9PuH]Ë 01-0f-B t xt 1z1 0 0UWVS}u ]0@00f-z tj.0f-J B ZB$B 0P 0P0P XtK =05 0 0u0t e[^_]re[^_]UWVSQ50f-^ 0@0{t-WRUfZtUD< t< u g-Hg C0C 0C 0F $9tS臺 X 0u0t e[^_]ӛe[^_]UVS0f-H  0tBu y8 0xxhg-˓hg-XZ0f-=0X0hS0f-py qu 00jVt8tġ0f-xuAt8#ujjj`z xtPjjHz xh{#萔Xu00f-1p 0f-P001ۉXъt< Y0t,1ɉ 0 0h{#Ϛ)щ 0H0! H0)H 03=g-t50ۓ5g-_XZ0P0~e[^] 0x0P0U=~u! 0x0P0]]U0f- 0P 0P0P4f-Pj8r+0f-@1҉P P$P0f-YUVSu] 0@0hY VwjjVxtt0f-@~PwY0f-s{uh*CZ1 004f- 0u0t e[^]魘e[^]UWVSĀu0@0jVrwY[y Vh |#ÍxPSRO_ZuE%=upjjjSV u]jtWSv u"jh|#WF uSwVh|#jjjSuV tSwVh9|#MSu^9uSwhS|#2u Px0H0ZYu0t蟗e[^_]UVSu]0@0} t50V%bZ 004f- 0u0t e[^]=e[^]US0f-0@0CxPuXCtP蜵 Y{ t0f-S聵 0f-P  0P0P0@4f-0H0Zu0t ]顖]á0f-US]0f-9t =0tD0t hk|#і]Á=0f-0uU=0f-0u]U}u"0f-@~Pt0f-1҉PYUE9f-uE f-]UWVSU@0)i5rO9f-t5<0u1#f-(9tC߉9} }t}tVǁ[f-t?iӀu.tiրuf-f-XZ[^_]UVSu9500=02f-tPqsYjhd"sf-[Z1@tI5f-rf-hTa Ps5f-~40y;"Srwf-Z@uCt SKYth|#%g-X4zv;40t jj[XjjCjj:jj1Gv¡09t PjZY@u8m0. hd505f-{}Y[@ m0 hPh|##u¡409t&Pj;[Z@ul0ȶ hPh|#5405f-}ZY@ul0虶 h5f-qf-jjKjjBjj9500e[^]UWVS]u+@0i5rOCSh|#0@019~Qi@tǃu=uFjRrZY@uktP躵 Ph#}#9+@0i5rOCSh<}#輒HJ΃utBƃs 0u0t e[^_]e[^_]US]0@09t Pk Z1ƃ1҉ 0u0t ]霑]UWVSTÉ։Mt&uPh"Sz =E,EtM}~EtEtCzMB9tMtEttt t tM IuɋE0u#E@VYEEHEvE9u]=@0)i5rO f-+9t# ti1;J-R@Ph^}#jEP茊h!"jEPw URZZEUt%‹E0hg}#jRUHURZǃE@T=uhl}#RAYXu*tQht}#jRfhx%jRTu =t̉UQ߲ j URP/E@Ut$R#ZǸ@)$D=Ph}}#d/ U:PYlj$UR胈XZKyS蹇P Y P G~SEPLXZEu EL}tzKySkP _ P KySIP|Y@P|4M}tWh#S蛈 iEM0EKySP Z P EEE}SX>e[^_]UVSMt.t 119}9ivtC䋉11tJiD} u&ƒuu=tă[^]UWVS utF>%~W2.[tW-XY}#*Ft~uH<-tB<%t<+u:f-}#f-i@0}#@0<0E1MxdtS~JH~?u(UFPQM'YZMUt UQW,YZUu뗅uV;-ZtjV,@0<0XJxRt~i90tM΅x29<0~*i@0t"}# }#}#1ۃ} uVPL؍e[^_]UVSh1!#6X=80tYh}#rg-HP9g-H Y膈SnH0Z8PH0xjH00Y^u h}#請=P+@0i5rO@Ph}#< 9DiPh#FXZՋJ ;1e[^]UWVSQ111Uh~#5ZUt$jtptguܿպλǍH~h~# H0tyt h/~#辊UjPYXUt 1t+@0i5rO@PhM~#t$Ph"+XZ1tiHi0i0h&#g-BHBCY_y3R8X9H g-z99y9H y:؉؍e[^_]Ã=80u!UjuZYu11á80u!<0 @0Jxu 1øUE=f-t@=0t7uR+@0i5rO@PhS~#5g-躂UWVS=80t.5<0@0NxtS{X180<0@0J0B0uh=ViP*Ë<0@0i߉_19~i9uFPo ^@0<0iƄDŽIu<0 0u$0t膇t 󡐥0@0=Ng-1ɉfǃ00)؃} ~iE PZ 0u0t؍e[^_]UWVSu]=0tSSzYXuM1000jcjnz100XZ}u*=f-}u=f-)=g-t u U0Vj_X}u-V5f-oZY@uD_0: hPh|#\SjrSjr{}t80}u`SjzSjzu }um߃u2`u)jRejh%fd th%h |#Ѕt$=f-tSj`rSjXrSjPr_e[^_]US]U M=g-u1t uEM E[]dUWVS}tE1ۉEPu EPǃ u]80t0@0@0E1i<0M9i MEEM99u]Pu Uu6$уu>t6Uu@ƃP}uuPtуut 1ɉM1҉UY}t-}u tƃ<tƃ1҉[tgu tUP=0t =f-u;u uEɃ@ ;u uEuEug-P 0u0tȂe[^_]UWVSjjjà ~ jjj=g-tQCtN5f-l^9t7P5f-lZY@u[0膥 hjPh|#訂1@095<0|btPu=80u>SX5E t t&tt M ڋE8F떍e[^_]US1h]~#,Zt$ltptZu⻀ۻԻ͡H0u t8t PhV$t h#'X6jsjs u7{t1hx#Xh\$jsh\%1[(h#js u h#_hE#js { t&u h#n^h #cjs T u h#H[h#h"h#,XjsZYu h#Xh#js u h#Xh%h"s h#jsyh#js h##Cph#s t=jvih"djv U; uh)#h.#A_vh3#s)h8#s~#1~#%1e"1~#1~# ~#S9tRh#j}WboWV^w-C yh`#0+XY %u~#jPhށ#b UWVS}] Fh#UW_%1ۃH0t H0u7;0PH0`0jP¿`00XZ=<0t6u hz#XH H0<0PtH0`0H0T0Q0L01ۉB9tt 5L0 H0e[^]U}ujjjjuXE0@0jcH0Z8tPX 0u 0u1zWUU0 wj jR Hu1X0Q0UWVSu}Et8uLu+E@1ۉ1۾E?C:-uލBztՃz-uztĊ] :MtKu5>:u$EEEjEPh#}[à uVh#cJz:u벉뮍Hz:xuWمuU6<:u!EEEjEPh#[à tuVh#hg->Pjh#`1H9ujQh#Zà 1Mjh1!#h#Zà M+E@1?1ɉE11ɋU Ph#j MQOhMQh#_Z ÊEEEjMQu EZ( t1E1҉URjTe[^_]UME  h#UP uT0=Q0uX01ɉ \0Q0h\0hX0RppUVSM@0t:u>H0u1:-uztXH0z-uztBu H0ͅtɍr8tuPh#9Yy:u܀y:u.zu H0J H02u Ph#T5D015@0e[^]UWVSj,H0^_zth #:8->E H01@0jH0Ytzth#$TL0uD8-u @P5L0P)XgL09Zyh0#9|EPá0@0T0 L0)<}_߉ƋM9sω9s x19r )ЍpkME9s 15X0 0u0tRS[PYL09} hG#0B0)أL0T0ljNx=P0tE7p ZEy1ۍ T01u1X0 0u0tR1e[^_]Ëg-z8U 0x@ 2@g-J8g-z8]ÃxuUSt PKp XK]HÃ8uU1҉P8u]UVSƋXCF~hu1A1ZAf@ fZfXfZfXZfXZXRfPȍe[^]Uj1҉Pg-JHR P UPUSUJtXxv-u~u C $t h#g-B0+B8PCXe[^_]UWVS4f-E轵=u6E8t h(Y&3=f-f- 0} E=f-f- 0\C 0\GJà " 0 G4f-$=k 0H}t 0G u͡4f-@4f-=-} uE( u ´Eu 9E@E苴t9u& u4f-g-HH FՁt| tf(jE)VP' &gx\Wx 0#\u5\uhU#ރ?bDžd Džd11`PЃ `w t0)Pw t0Pw t0胡 Ad9ud(=w hm#0= 0 á 0HCw6 0?ʀJ R 0CC@wj 0 ?ʀJ w 0CC 0?ʀJ vH 0H@ 0qwj 0 ?ʀJ w 0CC 0?ʀJ vH 0H@ 0;wj 0?ʀJ w 0CC 0 ?ɀQ vP 0P@ 0 ? 0?ʀJ w 0CC 0?ʀJ vH 0H@ 0 ?ȀP vQ 0QA 0?ȀH vJ 0JB 0?ʀB< vA 0AA 0ph#} ~€ u 0st] t%脡't:\uu=uh# 4f-g-xtjjFX  Š"a& <w 0C 0sfxt @ 0C=u 0s\ u'4f-g-@8xtjj^WHtujTY>tt-uVƉCY;ī0} ;ȫ0~ȫ0}>uQy>u |u &u Utv&uya1ɉKg-dj\dB(g-@(X4f-PZ-g-@(u @  1҉P 蘘y1sg-X$g-@ Sg-\H,hP SRg-pg-@ X P(Xu1 0GD 0r5H"0×jhډMX 0HXq{t ^& 0X+5f-T 0`X@Džd{1d#kDžd}tm^&uW-DruJt?:}u5Į0Ů0jjhĮ0Ֆ 1ɉd趖Džd ^& 0t> 0x`@`H`^&uKЃ wC 0x`@`H`iÃdt@@Ѓ v6t'H 0X`XX, Džd 0x`p=d%:t #u)Ph Y&6[Z…t!Džd[Sh Y&ZY…uH% 0x:F p:Džd 0xF pY&{`@9Ë`uBW``Dd u(}t# 0x#F p#Džd襔d1ɉdGfxufxt dTf-Jwd@ ӈd ӈ{dNj@f@f@dK@bc&1҉P:'uAW|bc&u1 0X\Nj@@"a&f@ 0X$觓H 0JNj@@`&@f@e[^_]UWVSSg-1ۅtXC1g-0x tjRg-1҉P YF8Pv v^S‹FP U8tSjg-pVjhBb&P`g-HUJ@ B 茘]e[^_]UHu+]UWhPT0l֘dg-`0\}1󫡨g-X1pjEPuZYE00Eg-Tjh\ jhBb&Pc g-B t$Pt=^g- hppDžt1ɉxR|T}Eg-jjtP螉 f-pnXg-`g-d蘗Zl0\00u jlDžp1!#u^j-Džp؅#Xg-`g-d*Xl0\0pu hpp}UWVS g-@1ۉ]}U g-u@$x @40$X&j螿jCjj Cu;jeF EjUBjbjUB뻡g-xu jF Y1҉V @j]j ág-x 14$pCjj_Cjg-@A. ug-x,u pr[u h#j聾 g-PS @0CBg-Yx u`x,uZhrI%p0^ZuGu g-up0pY1҉US@PvjjfHu?8j@g-1҉P Pg-J0HCBHYvBg-@-ttjjjCVg-@^Xjg g-B0+B8C j fg-p0C5g- ~ uhrI%vZYt hrI%CEFug-xjƋE0FEYg-xu;g-x  jj p0‰EEU表g-@Zu UBE밡g-xt jj@0FjF g-@Yt-Pv jj u g-@FEM1҉@{j jeC1҉SY^tNjjLX=Vg-tt3jg-@X&}tg-@uWd^_Tjj g-u@$x@1ɉutt;tj 7XZÉs؍e[^_]UWVSV} uE E1ۉ]1]g-xn g-u*p0QƉXYtաg-pZu1뿋H up$E0FE뢋}9u}} uwjg- 4f-H4^S ZYuh#SVqj/vv t h%#t g-4f-+A8F%Fg-1x4R@@u} u jj1E1҉j1ɉHEFE F g-@0F[e[^_]UWVSSg-@1uG u=Vg-th7#g-@puWj U1BUj>ËUBpXYUj%&C^Ut1ɉ ֡g-@tj)pZƉe[^_]UUg-1ɉHHPtjjYXg-1҉P t/Ht3g-@jg-YtrrhJ#j&g-1U11ҋE]FUU Et 9Pt]UMԮ0tPt9JuB]US]j螷SCU PUPUP X]UWVSEP=f[y hx#%u;5g-~5g-ExWZ=w PWV% `jjj uNujjpjjgjj^jjU$jj ISEpujuEe[^_]1=Ю0UWVS}u }t~h@VWdà VWdZY}t9u9t:W!X19t-y0xG PVWh#SSVWh8#$9g-}g-؍e[^_]UWVS]{tN7Gu Ю0} t} t&Wxjw PR+GxPYWGB Z1Ce[^_]USԮ00@0uSwԮ0S B 0H0 u0t ]P#]UVSuԮ0t1u(jS#ZYFxPX6utse[^]UWVSu] 95g-}5g-9g-}g-9t7SjjSV%9t8V{WE PShT# #؍e[^_]USg- @g- g- ~.CPjj x9g-}g-PX͹ؙ } ̮0]UVSu̮0 ~;ī0|l5̮0j V]à x9g-}g-9t PShc#bSUZ9US XISwYZOjS' ZY1҉UxE䡐0@0=̮0 ̮0ȫ09}@PjS ƒ EHt UtoE5̮0jS ƒ yAh8ujjS ƒ y$ I8t?05= PShf#;g-~.g-&=g-}0g-$9g-}g-xjjRU UuRSW0H00t}t g-g-}t g-g-e[^_]UWVS ]1}}p7-1EEhh#u S0 tu~tvh#S S4`00@0=f-tu0u 00[^]US]SVYt ]]ߴhA%SQ7 YZtS^Zu]US]S#t%S*ZuSh#j hD0<D0]UVS]} t"KyS P ^ P VPhV$S  t?uSh" ZY?t.!KvyS9 P X뭋P 롍e[^]US0@0`0t8t P1 1҉Y`0u10 0u0t ])]Ë0u`0t9u=`0u 1UWVSu} =0t=0t?u;`0tۃftGtt;0Wt2<=f-0uQ=<0uH=ng-t?$=f-=g-0u> uU0tY<I<tG<0<#t5<<0uw EPjV @}ttKtR1N=g-t tFv =f-u <t9uy# PVZY@t\u0u jVEZY1E܉EEEN>v R DjEPj e[^_]UWVSu] uhy%s ZYtsh@6$VY_uhS#B j5g-h h`#V_ZǾ`0tl0@0`0P. 1ۉ`0^u 0t0tjW0H0ZYu0tG@u1501ۉ].{h#WZYth&+"WZYu/p[vtEuEu11j1}hy%3ZYDžt}N}u N_}1`0t@taGwuu%hX#WPhk% WvPhk%C ~h"__1똅t h"L^11`0t\`08uPu%hb#"VPhk%'VPhk%tC ~ h"[1F@ut h"Y1ۋ`0t7`08t+hm#`0P SPh0#C@u}u3=0t63{Zu;?-uu1t 11EFhv#EXE=}}uU`0t`0PhI#tY^PƃX?vsh#5g-- hm#`0Zu h`# `0P XVPh0# 넍Fuuz0@00@0u1 WݞX`0t`0P+ Y<`0t jVxXZ 00H EEe[^_]UVSuu 0d0tJ8tC0@01P-`0P0H0ZYu0t `0uu e[^]#e[^]UVS]u 0u VSYX0<vjSXZuƃ0e[^]á0=0u t8u1UWVS\01ɉ 0`0u@@u \0e[^_]1҉`0=0u‹`0tX0}W-50SjP5SS) ,t }wW,50Xe@Ht `0tUS]9@0t$jjrjjijj`@0]US\1ɉM=T0u'=\0tX0t EE0P0P000tjEP3[Zu Eģ0jEPZYt0@0jEPY[uO8Eģ0=0uы`0tǀ;t 1`0jSXZ몍Eģ0ZjGtX]~ ~Cvv1ɉMMMMEPj|FXZjSYX1EEEEK>v 6 DjEPj hSP XZ5P0UT0EP0]UWVSh`[&PGZYj'V_Zu <)ș19e[^_]á0@0g-t,UP& 1g-g-Z 0u 0t 0u0tUWVS]߅~91Wu uM ~ )Dž~E u F ~) 8t̃؍e[^_]US]S t0 9t*Cfx!)QRP yfKC CC]UVS]Cfu`0CfKS u>0@0s2C CC0H0^uV0tMFfu9s0@06CPRC S)S0H0ZYS XKe[^]UVSu] >t/CHCFyS!VH XڊVH 9g-u]e[^]e[^]U5g-uXZU5g-u~XZUPuu EPE u h#kuPJu$ UEPu u UE Pu5g- UWVSu] Eu]EPu}WfEHE yWEXEEtDe[^_]UWVS u] j'Vۨ_Ztt~tnhG#V=ZY<u[KySP"X P"SVKCHC^_yS{P"[P">t%h`[&VqZY<tBEt7KyS'P'XEP'1҉U1FVKI't/KyUES AU y;뼅t$KySP'X P'KySP\X P\KySbP'_ P'1}D>;,KyESJ 'YE J 't"KySP'X P'9g-u]e[^_]we[^_]U5g-uXZUhg-Mhg-CXZU8ruPhL#Phl#<UWVSSEPE X85f-f- 0j=RU0ZYj=S$ZYU))9~߉Ӊ 0I 0t$<=t xFU萗p UCɅxUrU] Ue[^_]UE1@u,$0+ 0Rpp h#jh00UWVS]} Mt t9u t113^&ƍCt9t^&u1@t)؉[^_]UWVSS110tZuA=u܍P術EY10t5Nȃu$Ft sVЉZt F6ǃu1Ee[^_]UVS];uEj#e[^]h#S9ZYSXZ9u;ShV$j'S#Y^ƅu+Sh&%XZ/<'uh#sXuS)Ph#t e[^]UWVS]} sSt"CtS҉XuEs1Et Wh$$!Y_}t5uh$$ XZ$g-Jy R` g-z9 _F>=u y:Cu}th. #FPZYg-HyPg-H X J e[^_]UWVS= 0u0 h4 0Y11ۋ0tJG} tE t8tEt.09P5 0 0%0XZ 0 ZCFC FCFS% X`e[^_]UWVS111Eh=#{Xt2vt&etfuEՃxuп뽋E uH0t0}tUP( YUtW2U XZUʉ؍e[^_]UUE  E U?t hB#jpp 1UWVSUUu 0@0j胅XU:-u0zu*5f-gf- f-C 1ɉK^1jEPRUǃ UuSj=R趖_ZUtRRVP?VjR E81ɉK C1s@C O t0KOKGt u tGG <=uRU轄VP tjRULXZU w(0u1 40< =u0H 0{00 0u0t e[^_]e[^_]US]tu s?XZ]US1ۅuhb##NtxtIuht#貜Yu H0PH0t SPXZ]UEU )]USME )u AR)[]W|$wUWVSP1҉j EPSƉ7 8t9*8"u/EUE9EsSh#-9]u Sh#EMDJ@t@E}u9tՉe[^_]g_UWVSQƉukIe9Fu[~4O9uJjjROY_UP$PUR)O Hx N9 uW XF!؍e[^_]UŠH8-u>1tfzuh jjh ]&1zuHh jj h]&BR覟.uh jjh0^&h#PںZY1u(^&UVS|ƉӀ8!uxu :\|fxqpftft!f u&P螥Z?;*;"|f uPS:[^1PSG:ZYuNf$`\&|&E%=E%=@E%= E%=`qE%=bE%=SE%=DE E E 6M;MU؉!]菈]L9>(u;)uF C<He[^]UWVSƉ׉ˉ+fx @f$\&SV譸Y[SV蝸_ZYSV萸[^SVZYƉ׉11 Ɖ׉11 ylj։91lj։9rlj։g9(Tlj։I9PV7^_xPS7ZY04]E9uc9u_E98PV7^_uWxPSq7ZYuD04MU9u9uE98f9]PV-7^_t1PxPS7ZYu鋅|9u;xu͋ 3E3U  >~u5!uډx!(u;)u{u ?e[^_]UWVSu] hc$3P_Zu!Nu xtP!zUW/Yu UR-DPtÅt S让Z@tM}thy%6HZYu }tM1EE8%u!Pv^X6hE# _Xz1ɉj EPuljыE 9Et:8u5 t/u u1!# 9uM8Mt#y޸"uPhT# EGSWL YZ@u'#|x"RPhR% Etu jW XZMunUVS@h000058t j=S.YZt hSLXZ Ph#j@]SvjShɍ#|j hg-h e"k(j h.#h#Wـƒ %u~#j Phށ#2j,h΍#h[#!j h.#h~#$e[^]UJ=0t 1 00_Og-01000=Ԯ0t jYg-g-g-g-g-tP 1g-ZUjZ1ɉ 0Nf-100f-Zxt@ۆj0@0jXZ10uƀ0@@u 0u0tUEt]UVS]u tVs XZe[^]UVS]u f&$e&Vs [u CEe[^]s VDF4$VsJVs Vs[Vs Gs躮VDF[ ]VsVs C[XZD[*uFE$Eh\&#VNY[EEE8.u(px*u Eh\&#V_ZEEu uh#}f?f}‹}G}S] DH/}^uQ?t -tЃU D:H u ED>HE @,1e[^_]UVS]ss 3shː#臊`h&tVTRPh#e S Se VPh#Ce[^]UWVS uj:u _uZYE u h#j"@E } hDi&E PyY_8j=Pu_ZqxEPhB#W4E 10Z0]Átv@wURh#jh0蔁0€tf0M-0uf0^?0%0^H@P H&#0UVSË50uP50hk"[&P诔ZƃHvhkq$AShV$6 Shk%#0ZY0e[^]UWVSu} V V譶 YZ9tPShp#݁à Sh#ˁXZ}w-tj ׀^ #vX^ #crGPPh#聁à }tuh#i_X}tuh#RZYu^ #)j S^ #Xr2ƒ#&ǒ#rƒ#~ϒ#ÀuΒ#Àu#Β#^WՒ# rԒ# r"Ԓ#5.ݒ#uܒ#u"ܒ##u#t"##u#t"##u#t"##u#t"#rk#@u#@t"#KD # u # t# #$# r# s!##x#y##&#r%#s#&#.#r-#s#.#}6#r5#s#6#[T>#r=#s>#2+ rI#a'?# s@#I#>}w t2Q#&Q# uP#Y#rX#r"X#`#@u_#@t"`#yg#Àu!f#y-g#Àuf#PIn# rm# r#m#' t# rs# s#t#{# rz# r#z## r# r"##u#t"#~#u#u"#^W#u#t"#70#u#t# u^#?'H#tI#^#}wu1#%#u##u#u"##u#t1#`%Yt@Ɠ#JΓ#@Q#>uMœ#*tO͓#P#Mœ# ͓#P#^ԓ#3@Γ#Q#^ԓ#^ԓ#}w s Y# rX#%=t)wt=u&#=u# ##Q`# r_#<}vw s3ܓ##'ܓ# rۓ# #r#r###r#s### r# s###r#s##oh#r#s##F?g#sh#sjh#^}uS #P`h&;t3CaP3h#jd,Wx 1 11ɻ`h&;}t SC8t{$(Wh#j ,(PwCPh#j }(Pmw$A u,P訚W袚Y_1Ƀ bt,P膚EP}XZe[^_]UڗPh #h-{jnU塘0#=0u"PRPh#h-{jnUWVSQÉ10;#uCj EPSkȘ 8t ShV$jE8tWSh#je[^_]USÊt%<#u"S:Zt@0]UE E EE]cUWVSÉU}utj VS k @t 9E s 8"u"3O;t)t:Et-fDB@fO1e[^_]UWSPho#cZu0.j URPjà u荗8"u h#j1ҍe[_]UWSPh#Zu0.j URP1jà u:8"u h#j1ҍe[_]USÃ=0t =0t?09t6t2#t""=u#QRh͕#,o 0100]UVSƻ q&t[PV豈ZYuICƒ00C0Cij0C 1f‰0te[^]% Vh#jhe[^]UVSÉ֋t8uVh#jURM1YZtVh#LnXZ01EEe[^]UWVS11Dž=0~ Vh0#mXZ1 RPhS> =t=0VhF#&f}Uu1.=0Vhg#m[^v49tVh8-he# Ea6Wh#h8-svWh#h8-rF (tl#fGf뭊EaEG?tPG9C$u ~#EPV9EZY9 uu VG Ph#S t4Ph%S HtSh#RXZ붋fv(h7#SW Dt0Ph%SI HtShR#iRY_뻋F(v,hl#S t0Ph%S HtSh#RXZ뻋F,v0h#S t0Ph%S HtShԦ#QY_뻋F0v8h#Sm Zt0Ph%S_ HtSh#QXZ뻋F8v4h=#S  t0Ph%S HtShR#1QY_뻋F4vu" |\us11t\Uhܺ%SMUB 9~Sh$̲XZ]e[^_]=UWVSu} EU MahG8lG,p1pd1ld1pPQhJu"j@tP`GC1w,pC1w8p1w,PQhJu"j@UR)G0URtPhhSu"sQhhau"VKC PSXZk`8u>uY`8t/j^} tu Sh# Sh%ܹ_X뿃} tu /Ph#边 벍/Ph%訹[^띋$t $P5YP(Z}tEGjPSSf y hH#SXAЃu ƀt/tu1P艩$u hk"7 e[^_]UE0E 0]á0á0UE Puh-~h-j ';j4UWVS]^8ށu=0t50h "=YX=0t"=0u50h#=10XZuu ݤ ZYyW荨Phz1$= t7=0t.j <X=0t\P50hɬ#q=j3e[^_]UE Puj' UE Puj UE Puh UE Pujj3UWVSx1ۉ0PhA%^_yh#hVub ]t Ƅ1PSZYySh#LY[u%=`uz 9u;u0Shh0 ƃ uSh#뜍xPV2_ZyV끋%= Vh2#e= u:u*ShV` t ÿ"ShP#0Sԙ[+SșY0hVCj u|h0hV$5XZ|듉e[^_]UEPZtPRPhm# u uh|#hh090U0tjXj ZUS[j0hy&j_ 0jjX[]US[jBxjjXjjXt[]UWVSÉ֋x CPww wwփt=0~j wX0e[^_]UWVS1=00010001 Džu/h#h#&3[^Dž SUYu蓖Åu~3hV`h ǃ uVhV$ XZAP~XEtVh#i9 Euu듋CuOHujsVsUYE >9 C 8H1u"Wh#h-s< Dž CC jhPjV Ãt'$Phzd@S> @uS_ [WJYD -9rDYt)PH0t4KRWQ u <tPȉjo Wo C1ɉK C C1{;0C00XZ{ t%VwJYZuVhϭ#0XZ?jAo Vn Gn G n GG1CG8{DžaETuDž0Eu0} u:E 5j 6Ytsh#6s _Xtvhk%66M 9~=0 1ۋ9U tE 9}?Cԉ a^ EtPs ssh#,6…g=\Qs ssh #h-n9ҋC'BDž 10C0 1F0H0~ + 0(P6^t509F6냽tr0t`1!#:tw#h1#PhK#h-80t/";tb3#Ps sshs#h-n8͋ 6 Ph#-Y[0F1҉StPVS s訚s蠚S蚚 uU89;00?uǃ tuU E t$9{p1҉ e[^_]UWVS]fU ffCffBCffBfCffBs siY^} GW CȉGCȉGCȉGCȉGC ȉG C$ȉG$(s( ЃXsXCdȉBdChȉBhClȉBlCpȉBpCtȉBte[^_]UWVS]fU ffCffBCȉBCȉBC ȉB ssY^} GWssY^GWs$s mY^G W$CDȉGDs,s(RY^G(W,C@ȉG@s4s07YYG0W4CHȉGHsNjCSMEAE@ufFZ[tA 1(0Ee[^_]UWVSu^8C@PvBBp+BtPR|[^t00 hN#qY=80t-5(i-jjjj00 hf#Zu5,i-RPjjPt0=80tohm#4b50=0 t(jj[[XA!HfAWV#100XZ=80tj _00 tjjRPe0 0u hx#+5050[^f%f=@h#h¯# ZY50=05(i-jjjj00 xRP5,i-jjy\jj5050ƅDž WV@@PP WVf@50505050蹷^_8thͯ#1ɉ (0[00 tCjj RP+ {C9s#Qjj RP!( N019r)#u 5050u"h#Ah"`11(0XZ謶fH^_f@t 5050h"u6!@t%h"50505050)Z[@@fA\5050f@5050Ch#<$u th-# =80j & XeY[^_]aUWVS}u w wTXZCfEE9uc0t=80t =<0tj jjjw w'u0jh@#W  w wNYXG 09O u,i-;0tf%#f=@uϦ"RhF#w wgE)PuhT# =80us=<0tRyNj hk#XZ=80t2h#._=80tfE)fCe[^_]Z h#eZHt1ɉ (0x밍e[^_]UWSá0p8hSY t& 0q0RP¡0H01z 1҉Ѝe[_]Ƀ=0tf‰Ã=0tÃ=0tUWRPY_}UWVS(}M] U 00;E] w+EU 90p8}E9|+F]!É]E !ЉEEUEU9}"=\0tWN#uVu uh# 50}̉Euuu u* EmEԉU؉E܉U\TtFЋ]!FEU؉E܉UFEUӋEUEU EU9ME FEU}9Ћ}=\0tlSQu uhǰ#H  0\Tumq֋]!qISQuuh߰# ZE̋UEU؋}9Ћ}};=\0tSQu uh# 0uuh# $럍e[^_]ÍL$qUWVSQ0QEU}9Es9=00Esuuh=#"{0 00sx1uЉ}ԉ t9E}rEU9E}\1ҍMQRPuu&! ŰEUEUċEƉE؉Uu܁Tt-s։!U!CЉEUuuuui# K` t1Ɖ׋Cu}ܡ0t`s0WVխ00@x1҃ RPuu! M])Ӊ 0 00@x1RPuu! 0R=00tЍeY[^_]aÍL$qUWVSQ8QEU00Ӄ 00}9u}9u9=00Esuuh]#y00E؉U܋E9EEE0@Ẹ00\1ҍMQRPuu( UEUEUEƉEЉUuԁTt-s։!U!CЉEUԋCx1RPuuj! K` t1Ɖ׋Cu}ԋKd t1uЉ}ԋE̙=0u 00 00EUܣ00Suu5050腧=00})E50=0019}VVdf%ZYf=u Gvdv`9YYF`Vdvlvh&YYFhVl1tttpM YYM؉DpTtA u1MYYM؉Auv<=0u 0(1E؉Ẻ}EċM9MSuu5050躧rVVif%ZYf=u+=L0u"}uFV c9NjErE؃1T(ʉT(@ uFXȉFXF\ȉF\F`ȉF`̡000=000ЍeY[^_]aUWVS u} 0M]1EuuWV  ‹Mt WVh#u10010 050=050=010=08#AH0=00态1ǣ01ã0050t C0 =0 0Qhno0ZYu h#te[^_]á0tUPhZ1ɉ 010UWVS u=00tFVFV zEU존0H0AEUSQRP!  w 1҉UtE4P_X30RPuu  01{{E U 1҉CS1CC E UC SEC$EC( 001E v 9st DpTtD(D,T0Gу} w0090ub11tDXGu뺍PRcZY=0u ẖ#r00d0P00e[^_]UWVu} 0RPWV 0t9xu9p tWVh#re^_]Ã=0tQUS00\;0r 3fX50f50~f100ZY]á0@ UWVS$Ɖx@t@VЉ_uDž v vv 0p0vvxNjH0P0@t 1ɋ9}=؋ÉA빋EU RP É19r=0th00tF1ۋ9}&G q1葪YYQCG W50ɣ[X9}W ʉ@~ 09Ht09Xt~zG=00t T <tYv vh#hRRV莤t"G=00t 1ɉ ؉L1҉G 1(0C|W50[X"~@)EU 9GG=00t ȋT tdtJ1҉FVuVЉYu uXZ]gE E H1ۉ(0FV RPRPhS¤Sh##o hG#蟛Xv v!ZY=00t@V+EU FV@V z+EU oFV hU#]0gX g؍e[^_]UWVS uE 8t18E 1ۉX0X400tFVFV щ} G$W(ff%f= 0fua(9=0t;9ظu!t F Fu~hu)}t@󥋅 󥋅 w0NӉWVSQ 100 t 0#8tU@DNL!Ή!؉HT t0@8] C t`d E x@1҉(0P @RPRPhS聡Sh##hl hG#^YHE p p^X=000tp0PCSp0 ЃW0  B=00=L0tzGf@t`r@GpufGGhtGtSfGyXZ G=f@u10000FV =00tGFDG FHGXGpFDGtFHGd F@VW[X=00=,0t =D0G\uG`Wd uGhWl tlh#Ch͹#ou 1ɉ (021G\G`GdGhGl f!0XZ=,0ub0X4 ؙN0ʋF4f0F0V4=00LGWF 0W\tF@I0D11 0 G\<#8ts@DYL!É!ÉIT tA8F D`Td uDžFVVV[tbGhd19u 9RPh#mA=80t h(#jYh#7mZ_XF0=00tV4CSCh~@jjv4v0vHvD wh5#@h#lH ZY=00t @0@ @0 4e[^_]UWVS0E1ۋ 0;Y,EUu\TtA!A1EUAEUEU11tAu}׋E9ƉU}=E1EEU0CBHLY4DEUE9ƉU}:E1EEU0븍U1E 1ɉ 0 0 0 0M0];X,}|1Eu| 0EXZ\Tu]e.Qҋ}!Q1E]]UuI SQh0p500}=0t =0t =0t50u50P =00tE@x 01҉EU=0t60p,kEd1<SVuPhN#h-10=80=<0ExU t1U u E#uhv#=_XExU uۋ}G\M]ȋ} }tyt<҉UEyEEt0ËEsM]1EUH뫋u!Ƌ}! uEU9]u9MuډM]EEt0ËE} u 1s<}%?}u}9t uuu&xYuuh#;j蛿1xM󪋅xC|UEUpt|}9r WV/XZ Mt9uɋp9u|]50=0|U000M]11 19E}eu5t09|]s1-h1l|]+hlȉ uv.t0]1t_}}9u}9to<%?u9tSQh#:j M]Wxj*Y[M]u Wuhɺ#9MEsE)lj1VEi10e[^_]UWVSEP@EUE@ E}juu# t0t`}9xuPu9puHEuuh#Ep p{ 0qyEpxu}qy 090u 0u덋=098tEUMK؍e[^_]UWVSTU1EE 00111E0x,9}=0t2kEd1E7uWuPh#h-f1=01ɉM0M;9ظVSXZts]u0=00tGuEG.GptEGtEGEGtEVSlZY8tEPWZYuEHEe[^_]UEU @,+B,]Ƀ=0tf‰Ã=0tÃ=0tUWRPpY_}UWVS EX8=00t 1Q=L0tt1;00slj}1RPk@C^_DžE@4} G0.3ChF%P ZY'Mqy u9t#;tCPh#2Y^M#P^ZtguE@0P4=\0t h,#XH1x CfPh>#;^^u@@ uE@0P4=\0t h,#Yx1҉P C;ufWSـ a4 +fCPSV趀fWS蜀u}G0W41RPefH[_DžCMq0y4<wP{.uJ9}:uh;# { .u)hK#Ep p袝1ɉ h޽#\Ep0x41900s h\#=@0tqHuW{tQhr#1RPEp pb=0%Ch޽#U\ZHHt{t1q1RPdXYu-uY};G0G4~.h#1RPEp p趛hk#[k1=(0SB<M;A0A4 t!=80=<0 g#_#R1RPEp phk#,[H]1RP襲_X4f%f=@AfF1RPXZG GU;B0B4R ARPRPhPc ‰1RP1RQhPdc0Ph#Ph#L.=80t h#IXhk#ZYHU;B0B4} R AGW=@0tTSF9tHh¼#1RPEp p虙FCh޽#YHt 1҉(0 DžfNPRhѼ#},u Dž 1 e[^_]UWVSdjja_ZP$z&h#-hį#X[^u 1ɉ (0_hjjjj赢 h#+h#,h¯#X_ZuC1ۉ(0hM#X^jfjh6#p,h¯#iXZYt#jjhjjjj%kh޽#6X_9jj软[^L%@?f PhO#+=@0tjju`fXZh j5050>1ƅDž 5009k=0tD+0=0kX*WSPhk#h-10C$ w0h#ss 趗 0A 1C$h޽#=0WC SRPRPhW_=<0C$t50RPWh#h#*50RPWh#h#*=80t h#Y 0C$D1C$=80t2ss ԭXZ=00C$u*uGW %h# VYHt1=(0 KGWԍ@1=00@fC$1 S( v Dž 19}L,@ HLPtfC$1C( v Dž 19}T,L0`d@݃ vHC SCSt1`d~PPXZ=0u0h501=09s؋{$@1=00@uzfC$1S(19tL,@C SCSug`dakfC$1zC(19tT,L0`d@1/PP请Y[HX u9r.x$tڋP @Ή11׉ t!@tSQZXZ@ FuRVFFV =\0thȽ#vv RPh"pppp /fKXY_8u6950|_ssدFXZC SCS u950|)js s]Ah#,#hD#%O 3ss訦1ƅs{Dž ^_=00tBBBpBtVR`ZYu hE#["_PsstQDžԹ ss輥VPtVf@Y[5050~VfHXZ:e[^_]UWVS(EP@EU졬0E0RVuuP EEmƉׁ\TtCЋU!CQC RPh0S500}=0t =0t =0t50u50 ExU t U tuhm# XZ1ɉME@ Eܾ}juu |EE1E؋UԋMUM0EMB0Åt4}9{u}9{tPHSK0PX#E}tlExU t}G`ǡ0RPuu$ ӉE1EЋE̋Uǃ00Ex@t+jj0@4 ؙRPEpHpDp pa 0Ez89x t0}t*E@$ EL@ EUMM}ttto0E{89x u^E@EL@jRPEpp K` tPuSYdh 5050m5050W=0t0PP-zXZ50"0h0zR 0e[^_]Ã=0tUWVS\U1E 1u0X,9] =0t/kEd1VSuPh#h-i1ۉ00u1EE1ɉMt0MU;9WVWVQEu} 00tCECECXCpECtECd EEP$z&EXftbWVYZt=\0WVh#!WV^YZt!=\0WVh#誩 SEP襛XZ0Ѕ9xu39pu.JZHX0Rjh@#EPLjh@#$tC CC Cu jh #jh#EP躴`WVPh#E?Ee[^_]UWVS00|jj'P1󪋅h_X=T0xX$=80uhB#*G^uhY#)[=80t؋1ɉ$P0h 5050i5050+T=0t0PPvXZ50t0XHXI$~6$#9)<#~$tl<hNjH`ltW,Ћ9G0sVhs#$^_n=80tVh#Y[h#EZC=80uՋB,t|Fl$1~H`F|@ltË#XLS50|^_u h#|0P0h 5050g5050Q=0t0PP/tY[500Z00tt DžPLDžHLPP1󪋅lPP TCHX$~@=0u\t`H`CXDžU X)Xtu{xlLtuQ+HhVHXDžU 1DžPDžhDž\TPhο#1hDž\L1 L0׍G@tutL9t G@L9uՍ1󫋅<8tx@8txؙ!lj!׻9tx}^x`1d`dtx0ttx1tX,9t=0t4ktd1=VStPh#h-Х10tl1p𙋝ttƉߋ\Tt#@`Ћt!؋C1Q@ RPh0F50|=0t =0t #=0t50|50r =P0u-|xU tU tth#[^=0th0(H 0Y=T0t =0u0 H0 D0 0Ah`𙋝lڋpÉlƉ߁\TtAЋt!A1`AId t1RP5050kC 0𙋽l׋pЉ`Ɖ׋`ǁ\TtAЋt!A1qhARPh@0E=T0tth9#XZX0ph5\050a =0t505\0*n_X0\8 uǀ\T5050KY^=T0thc#PE_Zu)5050CY^u9,0u 0Ah`𙋝lڋpÉlƉ߁\TtAЋt!A1`AId t1RP5050Aj50HXZΉlߋpËlቅlpplp8T<DT9ƉD} TD00Tl)Ƌ|@`ui@,L`tLH9t||`t||`tLH9tușD1ff1h$~lj1w8d1 |@(9r1|@,9r1 |@09r1$1t|@x9sЉl(1󫍕HU u H1׋h󪍕U u P1׋Xu"xLu DžU t11ۋ;WVBZY< <<tt<<tM U u P`ك⋍`9s WVPh# CVtuPU u PU u P1ɉ`T9lpD08lp1ۉL1[8L9˃<1҉@<@8 rRځU uT ڋ`Lى4ً4 @LC99hHd`1HU u HU t PLP1~\Hd`11ы1Ƌ1f$H```ktgU u Tjj(R``)ٺ!PMH8șlp`3$\`x`11;dsV`!։lt @lt$9~؃҃u`GCl뢅t$9~ș`l tLjS P) =\0`t'W3VslsQs th#ޕ(h#PX<ZYtej PSWh 5050W5050A =0t0PP-d_X50 0^1ۉ(0=P0tP|x\|P( uT|PTxU u |PTHU u HhRP( h#\P@;ZYtw\S|V HU uHڋ|xU tT |GThRPGVh0c; 01(0=<0u)|xU |P\1ۋ9PU u P|U u |W\ !8uC<1ɉt[|xU t |B\u0tȉlPh#,YXlAu1ۋ|@H9=U t | |G`U u T !8uC<1ɉt[|xU t |B\u0tȉlPh;#OXZlAu농U u PXRP% txhZ#P8Y[taU u P|xU t |G\XRPSh08 0t j SVK%  =\0ts hu#Dh#Pu7_Zts󥋅ƀƀh 5050R5050<=0t0PP<_Y[50&0Z1(0e[^_]UVS1;] s8Sh,%H^X1E0Ph#0FZYuj ?XÍe[^]á0!UVS1ۍsrT =80t40i-h#ďYX"#t#P.Zty=80uɡ0t4象01ɉ Lh P50jQ5050;=0t0PP]XZ500X15(0Kt00=80t h #[h*#-Yti=80uۡ0 h P50P5050:=0t0PP:]XZ50$0X1(0jWjWYXuj]Zuj]Xe[^]UE0E 0]á0á0UE Puh-=h-j jkUWVS]踮8ށu=0t50h "趍YX= 0t"=0u50h#蒍1 0XZuu ZYyWLPhz1$g t7=0t.j qX=0t踬P50hɬ#0j諃e[^_]UE Puj' UE Puj UE Puh UE PujjFUWVSx1ۉ0PhA%^_yh#hVu袲 ]t Ƅ1PSnZYySh#LY[u%=`uz 9u;u0Shh0ƃ uSh#뜍xPV_ZyV끋%= Vh2#e= u:u*ShV t ÿ"ShP#0S [+S Y0hV u|h0hV$5XZ|듉e[^_]UEP,ZtPRPhm# u uh|#hh@0莉@0U$0tjXj FUS莫j0h{&j譯 (0jj裨f]USSjjjyjjp3]Åt3USӃ=80tPh ")YXShQ#XZ]USu=T=Tu =Tt=Tt=8 uI 0t=u 111100 001<=T=Tu = 8u1ہ= 0묃[]UE,0 H0t,\Tu ǀ\8 Tu ǀ\ 8=D0t,\8 u ǀ\T 8u ǀ\T]UWVS]U CBC B 󥋃CXBXC"Zu"h#'[=0t h#)Y=0t0PPQXZh 5050E =0t5050QY[0\8 u,0ǃ\T1\T00uSChEZ#= V p0΋p0ѡp0ƉϋKdC4p0RPWV 000 =`0TC,HEƉ׋Eǁ\TtC!C1uCRPh@0'=T0=0t\0PP^PY[0ph5\050C =0t505\0&PXZ 0\8 u ǁ\T5\0Q50u tc=\0u6#EKhs#=00shX9s΋9tRP+0Ph#ۀh050*0 H0[^ D0t[h 5050B5050,=0t0PP#OZY50 0`0X%0e[^_]UWVS]u %00$0xPSY_yӠ0PSh#f=40t(jSa 0_ZyT袠0PSh#5%= tSh]"whM#p u1{=i0t 0=80t"h#/_jSѥ 0ZYySh #-1ɉ 080  0u Sh# XZ1 00000010`0H0L01X0h h90h hǣ0h h \0h h0  ʅ ʅˆt h"#VSY_¡40t"ujV臤 _ZyVh |#z^0=40u%RRjPVM8@tl0p0t:`0 80 40PDPj50S7@u ShG#Y^Tu ShG#hi%tV_Zt%ht#VZYtVSh}# `LuSh#C\uSh#+50V4uSh#uSh#f^_uShE#܍X1‰11p~u 1ۉp0}Tu%HSQRPx DžTӃ~ ƅtBtѥPD1D1É1P1RPWV OډSWRP辚 ht#Z1ۅ~;srPƉρ}Tt!1׋ t1`01t ;r5Ch#h#h#h#h #h%#hF#cz5`0hY#@^_=KÅt0\Tu [t1ۡ0! 0=80tth{#[u h#YY0 h P50;5050%=0t0PP-HXZ500_1ۃ=\0t0Ph#?yY^0=0uNtJt2= 0#=80t5$Ph#XZ=80u h#X08<00C,01=0C0k NKt鉅 ׉ ЉNj׉   =00=T00=T0x=80t h%#^hJ#[01҉XǀP1ɉh P50a95050#=0t0PPE^_500[=005=80t hk#Yh#ZX0PP #0ǂL1XǂP1\h0RC h 5050e85050"$=0t0PPD[^500Y0 tyPh#h# Hu^0  h P5075050 "=0t0PPlDXZ50V0_0vuh#gh#`[^Hu\01ɉh P50W75050!=0t0PPCXZ500X0@_X50?0`0^0(=00tx<Ph#JY[=00ăx0(=80uh޽#ZHuqhV#_=80th 505005050$=0t0PP=[^50m0`0Y 08<qH։9u9RPh>#q0BHЉ8< =80uh޽#. ZHuqhV#DX=80th 505005050K=0t0PP<_X500`0^ 0@DqL։9u9RPhc#0BLЉ@D =80uh޽#U [HuqhV#kY=80th 5050?/5050r=0t0PP;XZ500`0_@0=000PH҉8<PL҉@D15@00=T00=T0?,=80t h#i[h#I YL00ǀ, 04ǀ(<PH҉8<PL҉@Dh P50-5050=0t0PP|:XZ50f0`0X=00OL9=80t h#lXh#L _P00ǃLǃPǃT\ǃX`B,F$1҅~K`F@#CLh S50,5050=0t0PP&9[^500`0Y =`0tv0=`0uhh P50%,5050X=0t0PP8XZ0ph505\0+h@050 50ShO‰L^_u Sh#1׉1ɉ509)~09~NjLWF8HLNd t1RPS50 t>t Dž)h:#hM#^Zu1ۉ(0jU_=0tHWSS6 0WA8HLId t1RPS50 =0t WSS6 0@0 0011Sh£0XYu ShR#1׉^,jSt0_ZuShv#}=0 00 ȉڃ9 sA0001ɉ 0 0jPã0j500…ˆt0Ph#"Sh~0_Zu!Sh#[^1(0jZ7&0 <0=40u*t!ht#P}yZYu 0 p0>hSP5050ƃ 0000=LBALt[=0h#h޽#Y_jjjjjS6:=0fGW69fG0CJtejPh #k =80uh#BZu9h(#WX=80tC=0fGW8fG0_fCff=v]h>#Y=80uh\#Zu8he#X=80tfC=0fGWZ8fG0_fCffuihr#Y=80uh޽#lZuDhV#聆_=80tjjjjjS8=0fGW7fG0f{f9}zD3<:uƃu}EEUEURP5l0u u+ l09ul0E ;}|vp0EUtJ9tFRPؙUEЉEe]EUSQRP| RPh#]RPhi#\ Fyj \Xe[^_]UWVS}u EUEUEEp0ؙMʋEeEUMuuuVW 9Eu 0UM"wh#J\X19]~KؙEURP5p0VW菇 p09tؙEURPhi#\ p0E e[^_][e[^_]UWVSQƉӋJt,B=p0H#9u1!#s sRhS#C 1҉Sss ssV01E1ۋ09)؋r09~ƋL߃=0t VWWj) 0VEA8HLId t1RPW50=0t VWW) 0X0Ede[^_]UEU z t]]UWVS]0Hdu } t109{ u9st7S500uWVs50Cs{ ECe[^_]UVS0500t+NdEU  t19S u9CtCt[0uhy#uu uS$SPC00X0K؍e[^]UWVLU1u} uĉ}ȋEER艪Xe^_]US]U tuwtttoPh#9{@uRs s8 RhV$XZ=80th#{Yh#Zu 1]UWVE500x=0t50p50 * e^_]0ÍL$qUWVSQQ90 0s RPh#H5t0 01ۍ}WSQRPp U Ƹ8i-;sAeY[^_]aUWVS\]u EUEUEUEU uEU3E3U u uE A%)uu1_Z=0u <vuE "]e[^_]0U1EEƃE9Eu E9EEUEUEUEUEUEUEUE ]uuMURPZSOi)lj$SWwG/ 9raEUEUE Et@EUEUEa E"RPMURPcZC1ɉ 01҉010E EtF?N)Eu ]e[^_]8UWVS]\TUH} FE 8uh`袳} XE u h#h`SP =\0t h #w_L=01@J =0uE PP1$Y^E \=0uPP#XZ1fEfffE@9uރ=0tE PP#_XE \Ǎ=0tE PPy#Y^ C0\C 04C$8<C(@DHLǃ 1҉ Lu(ǃPǃ1e[^_]UEU \T 0H   Lu5PPQ\R\P UWVS}u=L01(00y 0h0P^_=%0=`0=80t hD#v[hb#VY=80u׋0 p0=00ux șRQq 00h S50050S2=0t SS XZ50000Xh05050׷h05050輷01t-0t%FS50{s荷S臷ϡ09t )Ph}##1=0=0=(00=80t h#^h#[u 1ɉ (0=(00ƀ1҉PTXh P50050S=0t SS(^_50000r[=80u h#BrY=H0tsh#.r,0h 5050050S4=0t SSXZ50000_=D0tqh#q15,0h 5050050S=0t SSY[50000hZ=\0t"0 0kdPQSh#O/50tv X0Ee[^_]_v e[^_]ÍL$qUWVSQ(E11҃}50~8]9 00)ӉMЉ]ԡ0E1҉])؉EȉE9‰؋]1EEЉEEM]KE9t*EȉEËE]̃rAMEEE؉U܁\TtFЋ}!FEU܋0QF EURPh0500=0t =0t =0t50S50 {U tU tuhm#XZ=0EUؿEЋEU 0{U tEC`؋Uu؍  0EU9Uuu50=00MLU9P8u+KIjH`URSPU)S$) )Q h 5050=050So=0t SS^_500h0  0EY[E]9]yV11ҍeY[^_]aUWVSu x0!Ut 9rt8R}t-jBXu h?#s1rBЍe[^_]USM x0#AUY9u ЋR9uX[]USEU 01!t4^Fu(9u 9t331 É[]UWVSu} ]9WV+ZYWVqZY00t9ZtjSP0 0M]XM ]$HX 0t}9xtju5|0e0 0UMHU M$PH e[^_]ÅtUWVS E uV8{&<}EEH89~kًEuC@~&E4~&ߋE9x8|EU!9u(EU|EUqU߉eMMG빃 [^_]US] EUR`t(t7uS /u<<+  !8]Rh{&h[#UU ME@`t+tDuTɃu:< %ЃPh{&h[#oUSE MUR`t't6u?Ƀu)3  Rhx{&h[#]USE MUR`t't2uAɃ)u+5 Rhh{&h[#舺]UWVSu E$ %EFlU(EFhUEEM}}~ ExE$E8NpU9r UùupE9} Etуu EFB܉)EX؋})EyEؙ}ǍW?ك9M}tu :JI)ˍD}9~} UEU~E U+EU~E U+EUE$E~CUuI[^_]UWVSu]tV蜺 _uVh"jW `1ɉPhd@u 蘧 tGRhedAu J @u!e8tuhԅ"XXZ6B<1CB(CB,C B0CB4CJ8KCB@C BBC$BDC(h$1 ƹ ߋSh"Vv CPh?"Vh C Ph"VV CPh"VG CPh#"V8 CC,$C,Ph6"V C0PhK"V tP X}!uhzd@u I @RhedAu yI @uuhZ"j衷 41}󫍅Pu]^_@4ȋ9?9t(Ћ}1ۉ1E1ɉ [Eƀ*PF~j PEP1e[^_]UWVS4}jhPjWftGjPjVWVi u$U ʋMQ؍e[^_]UWVSu] 1PVtZY1ɉ%= j/V_ZxrPRV)Phw#h0W(@jP{ ‹ 19}e WP:TZY u$PV/ZYyA =@uuauÉ1ɉ PS[Xuk%=@u/h#h0V!?VEÉD= jf XZy.hh f à 1҉PS>ZYt-SHg Y 1ۉ 9u 9t0P6_Zq8T8PRPS4 s>PhFS:E yL`8Sf Y h#j$W=jjWe Ãy}tWMZt8PhF|@SD y&hF SD^_PҤtP轤Y}}Wt9P艤XZtPjXiutЌߋu0P7_t P*Yt蟌ZxSDe 룅t背X؍e[^_]Ƀ=0tf‰Ã=0tÍL$qUWVSQ0EЋAEqy AEĠz0Eס0X0]؉E܍EPuuWVU UMUȉM̉E9މEsMp1Mȋ])jj`SQX ǡ0U4ڃr h#迯_W!ʈEċxlEHXx0!9tPRPh#u0u< =80t hV#e^^h޽#2[u 1ɉ (01!EPT@P}ЉWE1҉PPPTeY[^_]aÃ=0tUWRPY_}UWVS EԉUMQƉ׋] 0H0ș9Ή}EE5EPWVuP0;B0u Exth#tX0@0RPWVY UBEuWVPuU tUB EPE܉UM9E9u9t/MC E܋UM9Mt}u ƉaE9t }tcM܋EPEEPT@PƉ׋]E9u1 ce[^_]UWVS,E @XEȍ]ܹ1juȋEp ޅtPEp[_E P@#EԉU؋VẺUЋE P<@8N^ }9}u}9}u9u9tQSQuuRPuuuȋE0h#ˬ,=80t hV#[Yh޽#Zu 1(01)V] CSFV sC8S<e[^_]UWVSPhjjFƉRP/ÃfC9EPjjSN0;B0u UztWV2K_X50u  z0QrRP3 E@ `0M ȐȔh P50$5050[^=0t0PPEZY50/0Xe[^_]UWVSE XChSlEEUE EE=00tP@P @ƉuOEXuh$#1҉(0YX500@0RPWVqS E@ `ChSlEUE Eu hE#蛩0H0ș9M}sE E>EPuuunL0;B0u Exthw#PX0@0RPuu1Q UBEPT@PChSls}EgUBXEU}GWEU G8W<5x0#uTGPWTEUTE@ U B 9t`1e[^_]UWVS8]tE"K# E$F#z00}}{rT 9RPYXJ0ws$d~&1҉Ut4Vh#=80h#WXt4Vh#賨=80Fh#WYRt4h#kj,t4+XZf%f=tC0ڔڐVPh#5=80h#.WXEPjjQJ=0;G0u Ext+Crt4ljE G0E1ɉ ‰L_XP=0%JXF^9t(ߔߐVh(#蒧E`QB9uРz08BufJEf9uwh#@_uS h#/Yu(h#Zu1(0}t0ؔؐ,F_X01ɉؐؔ0{rT uDVhF#ʦXZ=80t hm#U^hf#YsS50,XZ0t4*EEPjjujH0Z09u ExtuhX#1j)@E܋E=00tP@P @u4puSQRP$N EP誐ƣ0X1}9}~h0X01uE)ù`1j@@P荔_X1U9} MȉыU @ۍzEE܍Hhh*r EPUEk[^1E9E~+u܍Lph*r EPUEVhV$htQDhdv$v tQh#W>,jVjhdv$v W 6lQPl/SkX1e[^_]UWVS ƉUMjQRPtuhe#V_XfUt+tuuh%#VS,k^111 tuB t@uمtr} }uWuRJtjjhA#V~jjhL#VjSjjjjjV pfuuh_#V~uuh#VjSjjjuuV,E E܋E E EWOM1ۉ]G uuuh|#V ~#1ۉESPuuRRh#V EԊWуt=t8juj1RPEUEURPVi u[]PB2EUE UM ]}uSQuщ‰ @tE9 S*iX렍e[^_]UWVSu} hjdY[u)Vh#C}XZÉEEU(,E$E U$0418%jhSPVUIuhVS<h#Sb<RPZY@uh#B$D%=u?$Phd@ @uh#S&^_$uh #M, ((Phd@x @uh##뭋, (h9#S딋Eu ǃ$$, (uO1҉MRQWV.  ‹MtQhO#SV! (,u(,EU싋$1҉MRQuu2 Ɖ׸9ЋM|RVh~#StRVQuuh#SWVS @tEjjEP11ɉ @t_jjjSEtHt*jSZYt`@ P$@ t^9sVu jRPS@u7tP' Xh#SSe 1 $ ؍e[^_]USQ]teƒBBuCu'EPhd@B @u%h#SXZuSh#S E]u& ]US]jSYZuh5#jS YZuhb#SXZ11;FN|#~$u~,u;FF |F1҅8tZu"[tuY8{&CV$9t N~19};{; N~ 19};{ ;KHEPu+_ZNjF,uVЉ||t2@|jmURj$O8QJUR|PL tijWR  uYjuWUu!@uuZYjuPUu@v0sh0#us[1e[^_]UWVS]u}SZuBjWPS@tjW p S@tϋE p0h@#S 1e[^_]ÍL$qUWVSQ qyAQEUy uhJ#S{ZY8$E܉E1EuuWV4  tuWVh^#SBHEPuuuu Ɖ׋EU tuuuh#뷋]9ً]}eY[^_]aUWVSu 1ۉ^he%5 p7. _X1td1SщU&MH YZMtUBuSh#u} &&  Vhe%j0. XZ똉e[^_]US1&&uh#`u܋]UWVS ]} Wh1!#Sx 1&&E؋E!ЋM#M t:1!#;tb3#UWPSLyW&S?yUҋE!U!E`uE Et;uuh#juV1!#;tb3#WPSxWVSx؍e[^_]UWVS]} tEU E U uh#S_X S^u E@P;E sPu h #S؋E pVSZYEtu h*#S 먋EЉE܋EЉE؋E#G0EE#G4EEU E UG0W4S(_@fVSZYM#H0MM#H4Mu} u }p0x4S^@+u hF#Sn Ee[^_]USP] ;u:j EP5 p7u U:u1҅u5 p7hK"u Ћ]UEUitstau+u PJ uPZYUg@Rhf#P UE ft*u 5 p74ZYt5 p7h#uA US] ;u#5 p7Y1҅uh#u%XZЋ]USEU MitWat&bt?L,RP@st?ttMr:~h#PY[E1eRP6 $RPn[ZR@8Zfu%S5 p73ZYQh#P\ ֋]UWVSu }jj h1!#WVj]S yEWVuh#}t Shz1$ZYj Xe[^_]UWVSQ]M tu ET"EF"Qh#S'M $jUXZM uWh #S 9jVQjjuuS U 1ɅuWh)#SKVY‰ȍe[^_]ÍL$qUWVSQ AQEUA E܋AEjSA_ZthD#2jS,Y^ujjjjSbEUE Eu ht#SXZEE$EƋEUuE9Ƌ}s 11҅tEUEU9E}| EUSZxt h#PP @9E}}EU u h#'EUjjjS@ $u#SY_u h#jPjuujjS9 uVKWh#SZ p EFI FPARTFF \PFVEUF V$UMHV(N,EU+EUEЉUԃF0V4F8PS1_Z@)QFHVL}$E$9EsE܉FPFTy 1;VPsUWS1ZY@UB߃}uujSu@jp juuuuS u h #a @ r $󤋃 H PAQPA Q$PAHQLEUeY[^_]aUVSĀ]E 9-tE @&1҉Ue[^],(h3#)$h>#$1RP,( RPhO# ha#jSm uhv#XrX CRPh#s,s(h#s4s0h#$C8Ph#hxVi-Vh#KsPh#> 1e[^]UU E$E8E U]UWVSVEUFV E܉UEUEUEUE9E EM|vuah#WE UEUEԉU؋E9EEM}6u&uuuu uuuuh#W(1FM]3M 3] t?uuuE Uà hF#WEXZ맋M܋]3M3] ut.u}t#uuuuu h#WEFE F E$F$ku}tR#}w+M&#}w M&#w &RQh*#Wx1ɉNE C E$C$E;Eu6E;E u.FCstX^EUEUV#E9Eu2E9Eu*FCstX^E܋U+EUFV vE U+EURPEU }PH SK UMUMUMNU܋M+UMVN VPC^sXPtB؍e[^_]ÍL$qUWVSQ@EAQE؉U܋A QEUqy19WVuu  t/E؋UWVRP8 щΉE؉UMWVuu  t/EUWVRP щΉEUMEEċE܋] ؉EE] ؉E}EăxfPEЉUԸ]9ظ]A}tE9E؋E8E؋U^9uEE؋U܉EU}TWVuu EUE Et6EЋUEȉUWVRP Mȋ])Ӊȉ+EUԉEUEċP @+EUEȉŨ}tE9EȋE̋]9uȋE|E] u?9}EEPWVuu ÉыU Ut%ΉщEȉUM EUEȉUjjjuuȋEЋUEURPuEă Eċ@Eu1EċEčeY[^_]aÍL$qUWVSQ ȋ]yIX P@EUw UyhW# %uhr#urXZ~th#O_ ȉFV E؉U܋E Eu.E؋U܉GW FGFtxM؋]\MЉ]uuuu M؋])ӉM]MЋ]9]u 9M9ME}uuSQh#uEUGW )ډVFV )ډFV uFGFtxM]SQM؉]uu&  ‹M؋]t&M]uuSQM] M])ӋGW EUE9؋UO_ t~tfȉWE؉UjEU)ډM]RPE؋U M]uhF#u+GxpF)^N^ 9MEu h#~t h#FV E؉U܉ȉ+EUEUE9E؋E܋U} h #E؋U+EUEUFV ȉ+GW VE Eu FGtxM]dM]O_ ˉȉڍeY[^_]aUU Et 9Pt@]UE]UEt ‹@u]UWVSEtf1yAQ $T$D$T$ D$9E E\$ |I11҃yuEԍe[^_]UWVS@]u }(,EUEhe#WV3 t(qtsu&jsEPjjS@uvE95-th&j[^uujjjSlEЉUԃ}u}t.EЋUԃEUE Euuuhi#SE$1RP,( Ɖ׃u؉}܋}9ЋU}uuuuh#SjSEZYtE̋EЋ@E Et h#fEЋ@ EjS^_u h5#?jSzZYu h#!x G EG$EjSG jS9 tu h#S^XPH UMċM9Mu"M9Mu}u h #SY[1p GPGT<9s/jhЏ&Ve tV(F,9ŰM}ỦEȃ͋u}+u}9űE|uuh.#4E؋U+EU9E̋M| h_#U9UEUиM}9|E 9ȋU|&}tE؋U܉EUh#SXZE9E؋E܋M u}uU4}u h#SYX UMH0xh#S{XZ1}9}[uujSD@1jp juuEU+EURPS uh#S @ r $󤋃p PF V$1FPF0V4j\VFS H PAQPA Q$PƉ׃q0y4AHQLS@.Eu}U؋Eh#S_X}ffuS7Y^@,h #À}|h#SXZje[^_]UWVS]1uuuuu11h'#uu o. btENtoat%itClh%Y1EPS &EPSEPSZY@kq`1;EE}=S0UU܋UUZt&xuPtM9Hu M9uU@օtE 9-uEU t th&jZYWVRPuSe[^_]UWVS EЋu} jj h1!#RPj]S yEWVuhr#}t Shz1$ZYj Xe[^_]UWVStƉPZt 9St[Rh#V *{ Rh#$1s3щ¸#$1s sщ¸9#WhV$hV (Wh#htS SVuhh2%VM SVh{#GPh#hS Sh#d$jmSj$G8P7ShR#Bh~#8G0W4 uh#'X1RPhP?P ލe[^_]Ë @-Q@-y ;P-| t8-J 8-Uh8-PpXZUWVS֋U} $̌&E#` u>h#aX ׋󫋃V6h##XE#e[^_]h#X8Sh#htS Sh#sh#E#E#뚋A t h#Xh#C SX1ۉ019u 9tCuE)#!#t1!#PPh% h@#_tjmWj$8Sɽ1tttSh#ShJ#hWWh#ZY?h#Xu+u"E#VE EN#e[^_][e[^_]UWVSxht% hZ#*h4#x hZ#h`# xà Džpy#Džpr#s3x ps sx p Ct Ph#gK Cs31 W{ WhV$hPD Wh#htV*VPuhh2%PH Ph#XZ{ h0h#hVVh#Vh# h #jj h1!#x$K x$cRPjVw x$K x$cRPhZE"# "jmVj$G8PVh1#h]#G0W4 uWh#X[tVh#GPh#hVVhV$ZYgRPhPPvh "_K Cs31 OC tYC 8P)s t󫋆Rh#hVVh#1e[^_]UWVS}] u1EEEEh#VS% t^l`~\a wT$&ut:xuCMÃM뽃M뷍EPW EPW6ZY@uM딃M9-th &j^_xjWZYu h#X]t UI;]E}1WUM^t xupt9Hu 9uu@܋Ut4ht% hZ#h4# hZ#qh`#oW+ƃ Ey#EEr#v6 u,v v u  FtMPh#XZ N Fv6U vXZp h""Y볉؍e[^_]UWVSD] 1}Џ&}E#uh#uu " tditHTt*PLt7olt Pwb&h%Y1tukVS_Z@ut6PEPSB @u#tjhЏ&VV t E 9-th4&jZYVh) EPS&e[^_]UWVu }^_]UWVS]u 1ɉMMMMMhK#uV! tfitLat%bt0lh%/Y1txEPS~thEPStXEPS"_Z@uG1;EE}1SM}Zt xuPt9xu 9uU@܅t95-thH&jeZYuujjuSe[^_]USЋQfPfQfPQPQ P 1Ҋ\ \ Bu[]USÉIQHQH QH QH QH QH QHQHQHQ0h#RS褿]UWVSEUPUfPfUP Uf@fEExstExl]uq>1ۍujVk`&W^T uu wuA uRCu1jSk`&V#T u%u vuNA uًU EGue[^_]UWVS}]t?u 1TEPEPEPEPEPEPEPEPEPEPSh#Wj 4 uEyƒt#S`nn $ȉj1RPBu @u hb#4,$P 9uj$$RP舰Bu @u h~#,$PG 9u͋$1,,EFI APARTAA \A1q$(q y$ϋO(1҉W, q0y4σ8T󥋽,GH1ɉOL4WPGTP8,GXj\W',Aj$1RPf Bu @u h#$,, ;$uԋ,$(GWG 1x$AHQL1҉Qj\Q苜,Gj($$$RP跮Bu@uh#S[^*$,x ;$u1ɉ, _ XZe[^_]Uh-h#XZUWVS(Ɖj1FZuhL&hH#j* H1jvSv ShIi R裭@u hT#j #e[^_]U E]PUE]?UW1HfDžDžDž\ƅƅƅƅƅƅƅƅƅƅDžDž18<Dž\DžDžlDžDž DžDž Dž$(Dž, Dž0i-Dž4Dž@kiDžDe#DžHi DžLu#DžP!i DžT#DžX Pu u6 }UWVS4 Ơ@0^ jS CjjhWPS=d$thh1!#W)& Wh#jS ~11|u@ugLt;I)ӉtuߋuIu|u@u1Rh;"vXZFtY~jW ƅjjhSPWEc$thh1!#S1% Sh#_XF1RPh#hSSh#th#ѣY[jLDZJjAXu8/-h%j H1jvSv Shji RN@u$81h # jÉh#Y_ t 9ÉѺ})؉Rhw%ʢXZ h(#輢Xh.#豢_ t9ֺ})؉Rhw%脢ZY h(#vXe[^_]UWVSVus _uh@&h7#j ƍEP[t h4$jk juVzFNj] t>sVZYu+C xu"mt s sFYXj ZuXe[^_]UWVSE @80ƅ77Ph"u  t 7u[Cu X0u: ^t hE#0p jVh0(4 Ttg81ƅ9((@󥍅8Phs#jPSz0Phs#jPuVz VShy#j S[t h4$j T˅t_S zuR(,WsyZY,u1(zu%B sV辭ZYu+C xu"t s s>YXj 賙ZuBXe[^_]UWVS@J9sr[^_]UWVS]u)ZuPe8E_@u h̑&hH#u0^uh̑&h7#jB sP3s Wsh$u t.P螕 EhB$u E tZu| EYLEPh#u }Chs@Pui @qh#uu XZt V Yh#uW XZt Q XMEPh#u E Mu {hE EEEM؍CU`EPu u @Muh̑&h#fEftft5fu6t2C t Wh#j }tC(Uh#C0ut3h#jc t C0sHtS4KL9sщ}t:s@shu us@s`u @u;4ϸ81t/sl`}t$CU[s@s`uŝ @uEsd6CptSuZY@u s\h%#s8sXu荝 @u s\hV$te[^_]UWVSPux Zu1iu 虃 _tQVZ Yt=W EWu 迄 MuSM VZ [^PQS߄ uVoZ ZSC X؍e[^_]UPEPhB$u0 ƒ 1tEUWVSu\Ph#V t\Mfnj4Zu\VXtd$1jRVVhiSE@tt}f1RPh#u  1e[^_]US]uu S? @t ]]1]UWVSu u [^u 譶Pd Y9Es萶?Vn Ƌ}M)1Ze[^_]UWVSu u蘂 [^u FP Y;Er)?V Ƌ}M)1Ze[^_]UEPhe"u6 ƒ EuӵUWVS8uEPh,#V uhC%h&hh5#Ghv#VɁ _ZtPe ƹ}[E]ShiV5}ĉjS肎 Phv#u * ƃ SK Yt=EUu؅yكۉM]! EjEP+ XZuVhv#u ȁ VJ He[^_]UWVS1Rhiu4 @t|j7RPh#hSހ>tVh#oVťt j7RPh#hS;tSh#2S舥\ e[^_]UWVS]hv#S( Y^tVP蚎 Zth#h&jVh5#qV蠎 ƍUܹRhiS3@u h#j e[^_]UWh%1󫍅hPhiR3 t|}UWVS\Ph,#uo uhC%hx&h0h3#跬dShiu13 tW\`tyƉރ߉\`! ftShiu2 @؍e[^_]UVSuVvZtÍEPh:F$V uhC%h&hh3#uS1^Xu hw#jz CPSH ZYu h&h#Ph#u ~ uh&h#j4 S&1e[^]UVSSu] EPSV @uh&h#j h#V} ZYuh%h&hh3#%#EuB$PRSI~ He[^]UVSSu] EPSV @uh&h#j| Eu h#j? h#VD} ZYuh%h&hh3#蘪Ph#S} He[^]UWVS}h$W| [^u袰PU pY@vh#VIZu h#j VPh$W@u h#j} xtdPhiWp0 th #뮉`ShX`e[^_]UWVS}hB#W/| ZYuݯrP蓊 pVYXuh#DVShB#WE@u h,#j 1҉Uu]EPhiW/ @u hE#j SX1e[^_]UVSÉЉʉƃ ιC#u1!#QuRPShR#Le[^]UWVSu1jS,Vhxi P@uh^# UЉUPXۋUu hw#j! U]Vhxi W̓ @uh#ڋE9E~E1}~ WhV$裍FXZ;u} j 貌Yj 訌SjUVSPuVZt"ÍEPu V @u Sh#j @P诃UWVS$ƉUЉhX#P6z [ZtP҈ ƹY1@]Shvi V.j S PhX#uz à VC HZe[^_]UWVS0]EPh#S uhC%h&hfh3# MԋU ;@uE̋UЋM]Mĉ]ȅy+كۉM̉]Ѓ]!ىΉЋU!Љ E UȉƉ׉u}j EP XZtVhX#u y VB He[^_]UVSuV[th$Vx ZYuh%h&hh3#&PU ^fx PS+ZYu hw#j PX1e[^]US]EPh#Sm u &juS,ƒ 1Buhh&hV$XZ]Uh#1US]dPhS%S uhC%h&hh3#Cd|lPhiS+ @u h #X1]US]dPhV%S uhC%h&hh3#Τd|lPhiS>+ @u h#X1]U1EEpPhiu+ t h #j 1Uh#uv ZYuh%hГ&hh3#-Ph#u [w HɃ0 v+BwBÍBwBU5]UWU1ERhiuG* @u hE#jO 1}W|$wUWSÉЄtGjj h1!#QPj]S S6 z1!#tC#PSh%#謈 h"¸b3#Xe[_]g_UWVSr uhX&h=#j jLhr-s_Z1!#t1#jmhr-usZY¸7#u1!#WPShX#h-褋=ho-t VW?Xjmhr-/sZY¸7#u1!#SSSSSPSh#h-Z$V> j=~UEU P]UEU P]UEU P]UEU P]UE1҉To-To-1]UE1҉\o-\o-1]UE1҉do-do-1]UE1҉lo-lo-1]UE1҉Pto-to-1]US]Shr-"rYZt 踧=CЃ v؃߃Av 薧hr-Z>uy r-1]UE1҃t0]UUpo-t H9t@]UWVS81ۉ]܉]E䀖500EЉ]ԍEPjLZY@MЋ]u hx#EU׉uȉ}̋}50ɚ;EEtJ*EUʚ;EEt$ӃMЉ]ԉ11EȉẺEЉEԍEPE[@tEЋU ЉEh4$j uGEċ@C t@PYEąt݋@EtCt}tMEU9u2U9u+9u}SEZtjEP{ Y[=0u4]늋U9ыUjSZjuTj{EPjKZY@UE]9u]9u9}~ 9UȋU}hw"j_ UWVSÉHPZtP_D 1D1V9"LY@u h&hH#&RPHSƃ uh&h#j R1RPh#hWbWVh #蚃 jVWŹWhiLs@u Wh-#t Ph>#OXZjVW{Wh~iL)@tt PhI#Y_j *pHZ@uh&hQ# u =`o-j:RPh_#hW ?tWh#虂W| j:h_#hW?tWh#SW詔| tHSW?YXjVW^Dž@WhiLuh#XZjS#jVTWDžd1hlWhiL蝇 @t|h>Xu h#l@1dWhiLV @@u h2#@lhJ#.@RY =?0t%oA"w(&RhX#Y_HS XZ=?0u0=>0u'DjHSDP jV`VضV>0-{k?PL~@u$=>0t#Pj h}%h#0%X thT$b3#X thA"b3#oX thq#b3#MX tRPh|# h}%#0j_ thT$b3#^ thA"b3#Y th#b3#Zj &~5Xo-X%SV65po-tjHSVv e[^_]UWVS]S^t EPu S @u Wh#j u h Si Yh Etuh&h#jl EP+EZt h4$jz u1EVtRUWZYU}tRUuZYURhB$S tFE=0tFtj=0tFu[=0tFtL=0uE=A0u+Hu)}tj |Xh8-vZY U6"=A0tj f|XS4 u3 ujsUWVS,ÉUP(^uh;#@h$Sj ZYucU̹ Rh8i(S @u讝8t h$j jh$u uh̝&h$j Eܣ00u Vh$j e[^_]UVS։PpVSPh$ji UWVS]U h$SXi ^_uhU%h&h2h$謖‹0ށ؃E u %ERUw NjURw WP/"tDPEV̤ZYUu #9ERE ËE É0X1e[^_]UVSP]U Ch^$Sh ZYu 1WPv Sw VP!Ãt7EPS50ƣ0SF1Fu #U0e[^]UVSP]U ht$Sg ZYuhU%h&hh$EPJv Sjv VP Ãt7EPS50Vƣ0S1Fu #U0e[^]UWVSS]U h$SRg ^_uhU%h&hh$覔Ƌ0%EVu Vu WPD ƃt1PuGZYui$EM É01e[^_]US]U hEPhq$S uhC%h&hh$ 0%˃ uˁEU ى 01]Uh-h{$vXZUWVS]h$Sf ^_u3ht$Sf ZYu"h^$Se ^_uh$Se ZYtP0 00!‰0d$1󫉕tVh7iS @u h$j e[^_]US] u衟PhV$BxE tPYt Ph$xXZEPPYtPShT%x e%܋Et Ph$wXZ]UWVSuV[u h;#/VYu1P4Z@u h&hH#p 81jS8P训8Ph8i(4V}@`%1󫍅`PhiVT @uh&h$jW tWph$vX`&Ht#t8uP9u QݘXVh$vXuSh$o_XjPnY^u h 5"j \8Ph8i(4d| @uh$H\Ph$Evhz&%HH9Tt$h\$vhz&%Tj)$uj uP4Z,H%(h$uL&_1ҋ0t`&xtO(9u 09t4#HɋL b3#u1!#QPhT%\u ,딅u h2%@u^j YtYjmZti 119X~M%9u>uWPh($t h>$thG$4j sF뫃 u]e[^_]e[^_]UWVSӉϋuu^ 0^ Zt2tVWPLb u34+ 1ɉ [u1V+ ZV+ % Xe[^_]UVSu]}t ju NPڋE XZY@uEC s1C1e[^]UWVSu]Et,DžpVRpRtWjP6uuBpWm Y_u S ܋NPڋE Z@tʋEC sF C1e[^_]UWVSW]EtJs$URP6~Ɖ׉‰ 9иr E8tϓ8"uo;sC| C 9s} 蟓"WV; Y^u 腓 볋K(PUE Z@tE}G _C G1e[^_]UWSËtP') X1e[_]UWVSÉUMU1}E;E t[ztMUj8^t`NjUx4uup4x u}x xuup1ɉK(C(E81 S$uS$S(PXC$ue[^_]UWVS1@}u a-E@} uE@ } u"PRy^ [^uPRd^ ZYu덅LPhe"E 0S tu 112L 17 uu_tHhe%HP`H,ZYu Dž,Q%E@0tj/St&Y_0t @0`1DžTXDž\@PTP,S^ǃu.@xuP0 ːkTtHu@xPS葋YZHu.fDžtt0u_SXDž,uTtt,^1҃0u$SZDž,T(j DP0:,D (t8t,v ,vҏ"S X%Dž,(SX(jDž,10dr<wWr<w7 0 u0 Ј0E޹Eވ0 A$(P_,fCNj ֋$B$@tPY^(Sf S LEHVUE [@2Ex0$,S ZYu,Shl&h$js @PVAf VU uhl&h#jE SEpE0Y uS" hl&h#j S" XE}G }xG }G1e[^_]UWVSu]}t W}Zv eWv YuM #NPڋE Z@tEC sF C1e[^_]UWVSU1EX1u܉u؅Cu3}Ej1ɋUE ?E1҉Pupup Y\uu}Wu Pu4EAu! }uE$EXExtHu E؋Exu[}t1}t.E2%}ue[^_]UWVSQu}uEX$Cu S{0u3PE 0W YZun?-uGPRU|YZUu{(WR|YZuA{ Cu CuHPE 0V YZtPE 0V YZu^;CwH$T&PDj -w7a2 w72 XZ1u(7. _uCPh$j ȋK 11PE 2Z@tEF EFC4FCF1蕉 Ue[^_]Ujj$nZYt$&U PUPUP UPUPUjj6ZYt&U PUPUP UPUWVSu] FtVuVVPJX1;}t$jXt0TQ1҉FNG1 VuVVPXFue[^_]UVSuj(j}Y[t2&EC1҉SCCuu SB @u SX1C؍e[^]UVSj,j%Y[tDÉx&E CEC1҉S$C$C(uuuMU @u S>X1e[^]UWVSPu]1҉U1+Ei̋M ;}|1_t79r蛇GM 4WSuVuEsG]15t1jWSuVus]+Mi̋U; r+]i̋UU:e[^_]UWVSP]11;}tCSRuSt,Uu 3u PU҉EV EtG븍e[^_]UExu@RtE]1]UEP 1tRZ@US]C$u 1ɉK$[Ps S: @uCuu PzZ@u1]US]C u 1ɉK [$(KSs Ps @u܃C4uu P!Z@u1]UVS]u jZt$pSuCCC]e[^]e[^]UWVSh$uQ h$uQ tÅu'j`h&h$]< V` S ` Y[@8Fth$^F1󫍅Nv󤍝tJvr󤀽uCU9 t h3$j |t uhB$jP4 jS, PhJiu @t1 h^$Xe[^_]Uh-hn$XZUWVS, =@0 ƅƅF1RhKiu3 @PXujP Y_VjWhQRP!qpujP XZpVjRhVpQPt!hQ%W\u$,hQ%R;uZY, $tRVRSPh$be[^_]UjhIiup @u h$j 1US]Dt-9t@tu0@50 X ujjS^ 0 u Dt-Dt-]UWVS ]UUEt ;0uK-f|JxuEuE} tˆUPu HLZYUtC}t:=-‰EHffUtSUBf<fuh$E9r^h$ E9rh$YX1_EtE -WtU0 -fW ƒF-C+UE9~)1E؍e[^_]UWVS]u ~;0uS-f|PxtN=-119} fLOu0t ,@t@ޅtt SVh $SPhĉ"_ %h7$_Y19};Ph-"_GXZe[^_]UWVS ] uع1}t}u*U UܸM؊MMمx9s1LuÍKكt :M؍AMP裼ZtfP׋Me[^_]UWVSQUU} uj[UuhL#RZu h;#j jPV̔ u} ]e[^_]sdUWl$1E|Ru ul}UWVS,E u:[u hP&h7#j6Y@uhP&hH#j+ P載Z@u hP&h0$ݍF1jR sp^_C xyDž@Rhi3c @uhP&h?$ZYq:u]S @0PjjhVPRu+t"%t'$VPh"\ XXe[^_]UWVSu FPZuK}8+u1h%j \`%1juSqt \vSh iRb @u|81t|8/thV$tXpe[^_]UEU =A0uRP*ZYE Ef$[UVS] t4sVunZYtC P;UuPVZYft1e[^]Uh-hu$XZUWVSSÉ։M1S>_u}uJh$j# jh$P uW-DPtVh:iSf @؍e[^_]UVS]u1ɉh@uh&h$j EPh$S u^{)EfEVh9iSƒ 1Bu h$j e[^]UVS ]u1ɉ@uh&hH#jX EPh$Sd t,juV E؀8t-EPh$S uz)EfEVh9iS=ƒ 1Bu h$j e[^]UUE9@t-EMfuu $tURPh$TY ËPt< $Pt2$P!$Pt$Pt "ø$ËtI'$t?$t2 $!$t$t "ø*$UWVSljӉʋuFEE9s]19tc  ^w@v|USh7$Wk K 1UvAE9s:2UFPh-")ȉMPM UuRW u9utD7...}e[^_]Nj1e[^_]UVS ]uVhiS @u h2$j EPhB$S' uhC%hX&hhL$$rE߉EVhiS uEh$XE1e[^]UWVS$]uӹ!1j EPhF%S?uh4&h$j& EVhiS @u h$j0 1e[^_]UVS ]EPh$S uhC%h &hhL$DquVhiS @uh2$E؉EVhiS @u h$j 1e[^]UWVSxhSh $u@uh&h$j< DžDžDžDžDžSh$<_Zu?Dž1ɉDžDžDžDžjSh$9 u ؉8 -DytRx:uL҃0jWVhe%Pt;9u8tMh$j jRVjPdƒuu;t 1҉Ŕ@|Phi8uƒ 1Bu h$j e[^_]UVS0]juVh $Sо@u h&h%$V Zu Vh8$j? Uf@fEލEPhiS4 @u hL$j< 1e[^]Uh-h\$MXZUWVS] 1}EPh8i(S @t&E1r r%1ʹ|󫍕[!RhiS @[< v Ph $j8 h5 $S[P\P <fDžLVhiS @t%fNth< $=?0t hF $RXfDžLVhiS @t%fNthO $=?0t hY $uRXfDžL VhiS @t0Nf=) Phd $AR_X=?0t hl $*RYfDžLIVhiS9 @t0Nf=) Phr $QXZ=?0t h{ $QX1|󫍅|Phi8S @t}u(j P$PhiS@)_h $QEEEEĉEEEԉEEEEE|Phi8S^@uh#)QXr}uMu u uuBEH~HE-DJtx:t~&jPh$ uWh $P^_Eyh$PY111Pt՘hXZGj,ODYyh$hPXh $[PY4t8h $APXZ h#3PXj LO_PhiS= @PhiS! @jh&P u ftePh $O[^Vf"fPb Ph $O ft Ph $pOZYj NXe[^_]U81EE1҉UUUUUUUUEPhi8uF @u h$jN 1UWU1Rhiu @u hL$j 1}UVS]EPh $S謶 uhC%hh&hNhL$,iuVhiS @u h $j 1e[^]UWVSÉUPhV$PNS`Ǹ) 6 9|jLXe[^_]UWVSƍt1fDžfDžRhiV y h $j{ h' 1p)֍H(@!P }_9p}p' Džp h $hP:%h $h $h^ $hV$h $pph $L(G(\G!PO(!W Y0t 0E0tI@tc@tC@tP@ tS@@tB@yA@_GlGdw19~L9}B`fWGu uw%k pfx p@tp d#z= tt= w-g [=wOf?v'k 11?1p%1=$v-- 1p-1ƍG P h0Sld`VPPpph $KG"`G!\ƃ0`*w/wNtA2FltU0W=?0FQSPh $h! $FJQl=?0= $ $=?0$YdPhV$IXZe"d9 ʃl1!#y0$lRPh"ICe%빀=?0FPFPFPh7 $h@ $IF1d^1ɉll9d&j>gH[S=?0FFPh* $WKStRTRPhJ $IRPhT $H l대=?0FPh[ $HXZlF=Ptlbhf $hV$HY[=?0FPhk $nHFPhp $[H^ fdV\ $t5X\PQhT%H\K zm"XdˉX\lT\l $XtWl $Pt $Pt $Pt"PQhT%GlX zm"렊dزT<\t=PuEFu:h $hV$!GXZ=?0%FPFPh $F t#=?0l $h $hV$FY[=?0FPh $FXZ1D dD ҃L ll\1!#lt $dRP\Q4&h $8FCuh $hV$F[X=?0FPhk $EFPhp $E^V l\l $Xt5dlPQhT%ElK zm"dNjXfld\ Td\ $tR\ $t $t $t"PQhT% E\K zm"lXkT؃dPhw $DZYkl=?0.N=?0'$`& $} $ts $ti[ $`! $Y, $R7 $KA $DI $=Q $6Y $/c $(h $!q $z $ $  $ $F)`j B)hXh'e[^_]UWVS Eԉ։ˍUع1fuf]1ɉMRhiu uEh $XE1e[^_]UPEPh $u踦 uhC%h@&hhL$]ME\UPEPhP $up uhC%hL&hhL$m]MEUVSjjj"w y h $*\1ɺxBhPSh y h $ZuufiuSi Xe[^]UpPhiu< ulh $菼Xl$Eu h4 $j EE1UPEPh} $ux uhC%ht&hAhL$2\MIE@u h^ $j躵 1UPEPhO%u uhC%h&h4hL$[M E@u hz $ja 11 w-USE UUXt=EEEE1҃UjURP` 뺋]UE Pujū蹫 US]S艫Ph $j~ S`H0PH0~ UuUE PujfZj} UE PujD8 Ã=L0tMUEE EjjEPEPjEP/ƒEBuh $XÃUSPdh jh&Xf jS0f uSh" $6jPfZ@uSh4 $j^]UWVSd@u~Q1}=L0tC&;Et7EE jEPjjjVi@uuSh^ $O 1ۉ]]]]]E}W]Sj^VSj^kÃjh $TEZYu $ $1uuuujEPjc E!"1}jh $hgv# EPh$ h$h$j{ j]u6h*$r[jjje jWj]jVj]_1ɉ w-jEPjje u^8tihY$Z+U9uU,Rh$jWj]jVj] Xp Ѓu,t$h$BjS?d = w-k = w-tjWj*]jVj ] w-SӃ  LEEEEEP6b Xe[^_]UVS]E pt&I>v ]![^]USQjj]Sjjh w-th "uT0Zu h 5"j虰 jjSPjh w-u‹EP0]US[PhJ$h-?h-h$rSh<$h-? jo2UE E ]NUWVSE u}8@D$ 1%$1D$D$ 1 %1ۋ$T$ L$ 1 ډ9t$&(  9\$ t & &11ҍe[^_]UWVSE u}us8@D$%T$ T$ Љ$$1҉9t$&/ $ 9L$t & &11Y[[^_]UWVSSE }uJ8p0 Љ$$1҉9t ]$& $09tu & E&11Y[^_]UWVSE u}uG8@D$T$ Љ$$1҉9t$& $9L$t & &11Y[[^_]UWVSSE }uK8p% ‰$$1҉9t ]$& $9tu & E&11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]$& $9tu & E&11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]$& $9tu & E&11Y[^_]UWVS UM EuT9|$y|$T$ ʉ1щ9L$t$&9T$ &uwy|$y|$L$ ˋL$ ˉ$4$19t$&9L$tH$$9T$t\$ &11 [^_]Uhs jjh@w-u.1҅tPUWVS jEPE Eu_X1E9}2uSP JZYt!SPIZY tG1EEe[^_]UVSQË0tRVh$EP?pVERmZe[^]UWVSQ1:nuzouPmX1҉Uhe%Pl ZYt98nuxouSPРZYu}SP辠ZYuE1V\Ee[^_]UUPPPh$h-9j{,UWVSÉϋu ,PQ ZYu Wh2$1}uHt*hKw"VtZY41yG"Uu1u4hA%,P3H^_u%w"~u M}jP ZYt1ih&$Djh@$W_ uU jZP,P& t% 9|X 뭋QRS u=00u1-hG$Wj VhW$4Et#Etu#EtyG"Et6!%&u0P,P* ZY@tjj@k^_,t#jh@$S uho$V,Y[0:w"tSh{$ShML$hV10 ,Dž@he%,P"XZ9 PWkXZڄtVB L<-u.1j=VY^t$S@8#S4Q ,t1ɉL=00t>}uh$1_11=40u卅$PE Y@u@h #KX3=40u"4hk%1GXZ9j 0X}ut t6hp"X t 脗XPw=40tj}t0$X jX j(" @u h$膫_w-,W3h_'%h,R/P,R$ Q8tV,Rh#/ ;ulQ8uWVWh$ jO t 薖[P艖Y}u, Ex](W jj (N WS$OV ~)t}u2h8-,P=XZj P$V ~j,PW @u hH#X,Ѓu ƀt&mttPWPVhk"(D} =000SVR& Y_@uVh$諩XZ e[^_]UWVSj Ph$.;11to&tZ&t =00t>&F\$tb3#QPhT%D. !ǃ 끍WC#\$tb3#WPRh$-udtj\$tb3#Ph$-t t 0hV$ h#-XZ=00KtSp+F=00u=00KtSp\$tb3#QRPh$L-=00hb3#hV$--sds`sTsPh$-slshs\sXh+$-0=00~chSjjhKw"ju.t%j S^_tShJ$, h\%NY'"ts#PhV$l,XZ 1!#He[^_]US] 1t-tPu6?ZYu801=80]UWVSEt48nuxou 80PX1uhþ"gX1Y,u@B uPf_uh 5"7Sؑ[^ljxj,SZYt X1e[^_]UJPha$h-.j!UWVS]!11tE1҉p7-111ɉplh$u uZ 0r=d PVXt(t5 p70CtYDžpt -E E)ȃt+ttC|t C|ߋzu2#uWErUEtCpltFpt#uuxPW0^Z@uRWhy$jA xPWZY@tECt'xPWZY@tǃpuECtECxuE%C|e[^_]UWVSSVlPpWu u!hWlSh0!"薮 ,@uSVhx"j腜 n@t(RPh&hSlS JjUSP]jEPSU :9uySu hx"j ]US]SgiZt@ h"SZY]US]S8nZt@ h$SsZY]USP]jEPSnU 9t :uy Shx"jZ ]UVS]u VS{ YZu Sh\w"j[ ;/t"Shqw"K XZu Ew"e[^]4 e[^]U]FPhvv"h-e*jQUWVS EEu EE}]EEE1҉p7-h|x"Vu t4ouBjWh&5 p73Su hv"j茚 PRY붋-4E)Ѓt>S6EXZEE FEe[^_]UVSSPPVu ujVShi% ,@uLFtv"t"{F0qZv"tv"PShv"j聙 jUVS]u VS YZu Sh\w"j耙 ;/t"Shqw"pXZu Ew"e[^]Ye[^]UDPh$h-(jvUWVS]E1ɉ#11d111lhhb$u u HuLf$M,9tQG.C|g$&UC| C|C|C|5 p7 CpZDžlL5 p7CtXDžh.5 p7CxX5 p7Xjuh&5 p7pPu hv"jɗ PPX5 p7d`XDždC|-P;Ut0ttSxt SxߋM |u4^uWUEhtFlt#uuxPWY^@uRWhy$j xPWѵYZ@tECp'xPW践YZ@tǃluECpECtuE%CxdupVV@$XZK|ǃe[^_]UWVS SVdPhWu u hWdSh%" ,@uSVhx"j f@tKRPh&hSffSht$!0jUSP]jEPSkU :9uySu hx"jN ]US]SbZt@ h"SZY]US]SgZt@ h$SsZY]USP]jEPSמU 9t :uy Shx"jÔ ]UVS]u VS YZu Sh\w"jĔ ;/t"Shqw"XZu Ew"e[^]e[^]Uh$j\ U?h$h$h$h1$ha$Ph$h-# jUVSQÉj EPS U:uVSh$j e[^]UWVSuEE@t"@0 1VFe[^_]P_u hþ"jœ VP ZYuj]e[^_]隅UWVSQ]E10u1w-h$u u~ 2F$&=0t0뷃=0u0c뛁K뒺a p7C8K t 0hK\cPD p7jC@K@2K&g p7@P s4K I p7C(KK@KEPuh&5 p7Jƃu hv"j Et 0tctKtK@tK t=00 s=0t0c@tKt1҉,x-sc sKsC  sC sh"VH0Y_Eth=7%VHC$KXZEth$VpHC KY_Eth$VVHC$KXZEth$V9HC ƒ Jujuu s艠 ]UVSu 81҉uuuVu~C90u7VJu/^˅t)v 8080Sh&hd$e[^]UEH؋U PEf]UU otzȉEEȉEE1EjxPjEPjjhuA w/70Ph&hk"7HxUWVS]u uu uQ fMA1CCS1CC0@0ȉC1҉SCE ȉCЋEȉCԋEȉC؍~E$PWh E$@&1t<16 1Ƀ 1Ƀ 1ɅtuRh~"ju 1ɋuЋ} t1Mk"8"t$M tM9uM9t Suh"맋E9ƉU}7=0tuuWVSuh5"luuWVSuh5"?9u؋E}<=0tuuWVSuhe"+uuWVSuhe"jt e[^_]g_UVS, = 0tPh,$h-+ h`$Phm$h-h-h"iXZ= 0&ttshH#h- j=0u UPUWV=Lx-uHH׉=0t&ɉ HffJ=Lx-u f@ffB^_]UWVSƉ˃= 0t/=0t 1}mQ00Pu Pס0RPSu5(0+ 9t + 0!jPWVh%$:j"e[^_]ÅtUWRPY_}Ã=0UWVSSƉˋ 0= 0tSu 0Q S׉ș։ЉEMRPSu5$0* 9t z0piPWVh%$j$e[^_]Ã=02W|$wUWVS#Å=T0uP0BB400T0 0 ;0 0ؙ=P0;|*9T0_1)։ؙ540pؙQ Y&JtRz!9t !9t ҋ1҉ؙ=0Q 3Xe[^_]g_W|$wUWVS,EU؉M܋ P0A Id t1580)X=0t805P0PPV 80xU th&${X80H xU t@\M؋]ȋM؃=0t805P0PP P0A Id t1580P0L0JH,1X9M؋}ruuh*&$ P0\E1ҍMQRPuu lj֋EUEȉŰϋEЉUMԁ}Tt.CЉ‰!!SʉEUԋCx1RPuuD K` t1Ɖ׋Cu}ԋKd t1uЉ}ԋK0540P0_\T40@xRPuu Ã=0tKSuY^1}|(}؉ʉT(@ uE@XȉCXE@\EȉC\E@`ȉC` ߋu]%ClRPuu Ã=0t]Su,XZ1EtttpեY_DpTtF u1E譥Y_Fu @ߋu]%CPP0H0540EЋUpXe[^_]g_UWVSQEӃ=01}=Lx-tBBfCUC)f UZ[^_]USÉЃt't7uFɃu0 ='ShT&$h- ]W|$wUWVSLEUȋ P0A Id t1580yY=0t805P0PP 80xU th&$1҉U؉U܃xhr&$_1E؉EP0X`u؋}܉ tu}}zU tStX~KM< ɅP0@8EU܋80J9M؋E܃|R`뮅tGt%b 4!Ή8뗍 ?!8u{!8hvSh&$h-i Nt% tSt1\uWEah&$Í Í ? # Sh&$h- P0$~?80EE1uԋEЋUEUClM 80EHP0L0EHesE@E=Lx-nKdu؋} t1RPWV! }WTU u}WT }U P}t}}}GXE1}EEċKdu؋} t1RPWV MQuuRP EыEȉEEeƉϋMUeuuRP Eȋ}EЉEeЉƉϋRPWV }f E9C0u'=0805P0PP K4EDS8)‹}W S8)‰ }W$D4Ɖu}܋80 P09A8~zU tR`˃]1ɉMM]ʋ]؍ @뛋 P0A Id t1580$XE؋U܍e[^_]g_W|$wUWVS։ˋ@1 0=Lx-t@fxfDžAx3 ‰|fDž y-=Lx-t{-P0@40u 1ۉ,P0@DJL!ȉ!؉ pZ4JdQyt@f fDžA % ‰P(,iKL04H8C s(H10t ǃ^F=0s0Kd t1RP߭ڍ,%VV$h_)$@ P0 ؙy8PۅI4%WW$q,h)$ P0A0= @ 00,0= 0u\Tu kУ,0jjjhj5,0j£40u009,0uh)$u j& ,01=0L0 09|RPh)$0 0 0540 0&[t?t  Lș)FOu뺸2=0t?jj50S$=0STb 0uPؙVpjV uؙ=0VY40P0Xlj=0t PRXZP0x40\=0~ h*$ XDž=0~ P0A,XÉƉ׋ǁ\TtA!A1׋AId t1RPhv#jjfF-ftRhht@P DžPu ft0=0tu1'1=P01w,1P0;x, h8- P01҉牅8[9<}Ƌ\TuAЋ!AAA)uky4D1ҁTtYӃY19Ћ|h3*$ (_P01=8080CU C )C5P0$~N`Cp=Lx-u*{tFx9sCxNfKxF,H9u fSCf{CTCXȉC\OK`ȃ~:=0uCh|{lN`Cd9sh*$ %P[80P0P t+)lj1ɉ1xU u@\€ 80H xU u@\€ 80H ?xU u@`¡P0@`P0$~%80Bl580FP0=Lx-~!{8809rKd1VT~U uVT~U t PFXƋP1~FKd1111f3P0@8P!tx 80)D4)Љ809s?zU tR`ك 280B$C1ҋ9r)P0H`艅 P080BY89&zU tR`A`P0$~%80Bl580FP0=Lx-Kd1VT~U uVT~U t PFXƋP1~FKd1111f{89rNP0580$.Nh񉍸Flx1Dž1҉)D480;xsxU t@` 80@$벋!ʉt:@t@;Npr1tɋ$9~‹GDž붅t$9~‹H0BH0;D0u^=0t@0s4PP <0@<0P0Z4Jd15@0@0H0P0H41[P0Z0 } 40؋580=0t5P040P5804 P0X0540ދvxx P0\t4Tu/%Fl/%CPO붡4000𙋝ڋÉƉ߁TtAЋ!A1׋AId t1P0Y\Tt=0]s8,0){0ƉK`Cx1񉅰69s)9s40g.%Cl뀡40,09rߋ P0A01q8𙋝ڋÉƉ߁\TtAЋ!A1׋A׋1Id t1(Z~==0j.X܋ P0𙋝ڋËƉ߁\TtAЋ!A1׋A׋Id t1z&%u1!#WVRh*$Q9]=0DP0P,t,=0t h"X1j X1b~j X=0tjtx|m_u= 0th*$v5P004=Lx-0FF4+=_w h*$j< 40X󥋅`1=0tR5P0蘾[^40=0t ǃ\8 5P0x\0RP SMY=0tL0P0r4PP蔽 P0X4HdLH t15L0@0Z;H0sE=0tP0r4PP8 <0@<0P0Z4Jd15@0X5,0540YP0@4P5L0YeY[^_]aÃUWVSu]tV; _uVh"jY: `1ɉPhd@u ( tGRhedAu  @u!8tuhԅ"Z@XZ6B<1CB(CB,C B0CB4CJ8KCB@C BBC$BDC(h$芲 ƹ ߋSh"Vx+ CPh?"Vj- C Ph"VX- CPh"VI- CPh#"V:- CC,$C,Ph6"V"- C0PhK"V- tP{ X}!uhzd@u  @RhedAu { @uuhZ"j8 41}󫍅Pu_W^_@4ȋ9A9t(Ћ}1ۉ1E1ɉ [Eƀ*PHj PEPD 1e[^_]UWVS4}jhPjWh tGjPjVWV u$U ʋMQ؍e[^_]UVS]u VS; YZu Sh\w"j7 ;/t"Shqw" XZu Ew"e[^]e[^]ÅtUWRP~nY_}UWVSuuuuw É֋EU)jj`RP} Nju 1ۃ`9}.EPl@hFVk`1EUM MAhQlCˍe[^_]UWVS]MpM1}tfF^1 :^F: 1 MKMKfCCCCC s({,C8C1ɉ P2\-h8-dh-ZX22ĻXZe[^_]W|$wUWSøth`3h2$詚XZ52h2$藚52h2$臚3t Ph2$p_X2t?29} h3$Q[()(%MMEuQQ$h*3$) j @2Z133EE2ۃH~-2]PP$0 L%RR$S2QQ$SEWW$S h-PP$Sh=3$q<3d2p2!]|22Ezu%ٞzu%=2\$=2$hu3$e[_]g_1Ujj׶XZ1=2P$U=`-u =2ujhu莶2ZY92~23ueUSáT2P2xFأT2X22%w%r\-y1]Y]W|$wUWVS22ff222=29=2u ;22f2f2]f21Ej]Sjj53M yh3$[jh3jjh253Ƽ y3t h3$_EjSjj53L y h3$j2 h2js] [^22f23 s$ 2ɡ2ȉ 22s223}f2Bf2H24fpjh3jVP53ǻ Ã9t:y h4$YSVh`3h 4$Eh-VZ1`-2% 2 32@222󥸈22 2u|22󥾬2󥺬22Av.}fE fEm]mE22%52=2 2222U u}fU fUm]mU}ЉEΉ߃ɚ;~ʚ;Eހ}2 2222H%؉ 22 22E22=ɚ;~ 22-ʚ;22rW 22 22 22222=ɚ;~ 22-ʚ;23t ;3te[^_]g_UWVS<ÉUM3tUUEčs}uyMăA}9}fE؍t E;2uJ122u5}t43u+JEPuh%4$Ғ Ѝe[^_]W|$wUWVSEU܉M7C]3MQURuh84$jt hV4$YXWh\4$M3Y_t,%E L%RR$Phd4$3t"uC-e[^_]g_ގe[^_]g_US2%=3u1!#7SPh<$h->j*UWVSƉP ¡D3_tEtPh>$E X39U|} Vh>$jc tt-v 1{[ft )уȉCKEsf1}~CpMуt[}D;19Ue[^_]USӃ X31҅w =w"=w'=w?=w W=w F=v=w=w "tft ЃҀJȉCAʉPfPJ:u9r)@[]UVSÉ֊@<t<t,<uPs=P PVh>$ SSC PVh>$蛏BhPSjPVh>$sS^PCPVh>$Wh8-觃Xe[^]Ãt"¸ ?$7t>$tURZø>$USљRPQhSh8-SS ] @-yUh8-j 腕XZá8-P8- UWVSDuh8-e[^_]ÉÉh"?$聎&aXE1ɿ!t0\Љt }uCEtHP1DA u1tЅ}t2}uKU1ˉj.h`3EPj:U1ˉu.N VPhV$j.h`3?h`3hk%{XZT583VPhk%XG 0=$3UWVS @<tPh/?$Y[C`&tRh "PhZ?$^_Ph`?$XZCH<$&h1!#C Phi?$趌C& Scssh}?$舌C! &<t@&<t\&COS C #CPh?$ICZYPfwk$`&h?$h?$X1Zh?$h?$h?$hց"_3h?$^!h?$׋Y PhE$ċXZ뢍A9sh?$购 EԍsfCfhw:ffEPEPEPEPEPEPh?$ajfEPEPEPEPEPEPEPEPEPEPEPEPEPEPh@$$t/Exuxt VhA$j p}Pq ju& }CtCU/1}#Exux uxuxu xE@E< u2UĹ1jEPEP ¸U%EE耉E 1}EP1E1FXЀ w.XwWEXw7u\M}wRE$&FXЀ vRXwWȉ<E9sjFXЀ w/ˉBE9rLB1}13B7뷍Xv E`W븉EE9E)ˆu}1ۉj/VoZYÅ}=L3V%8 Z/EEPVU Y[V7 YVpYV ZqP}Wp @0u3E V2 Y{ȋMUPCUe[^_]SEEPV贞 [Zt?EXSC YuWEEPV艞 [Zt#}uσ=L3t$V7 Z@u6'V 7 XuX }u MU1Q% X3U1EDe[^_]US-tuP ZYtC]UPu*fxu#@PhE$hh3蘀3 Htu DP7 Pi5 ZU}uE ҃' hE$hqC$RRh,w%PPhE$l UEt#t#E$E$tPhF$E$E$Rh)G#"XZUVS$&E׉Íu 9stMtJ@ShF$XZe[^]UVSU%tYE uLjjEP à uU1j.0kY^ƅth3@P胓YZuUuR@ ZhPh3j 3e[^]UUE Pjjhh3PR.? thhy%h3k 3UVSE UMYt @ȅu˅t6t1R )˅t8u3jSZYt%u%hPh3 VSh,F$hh3~mVPRh)F$hh3}DσVQPRh&F$hh3}VSQPRh#F$hh3} 3e[^]UWVS$u} KE 0~y111119Bt} |t 1M LtMw tLxw tHuGC@u?6ttxtu#2 @"@Ƅ9t(Bh1u "ω9)51u- uh%h3v[^vth2F$vYEPjjhVPPM< t hy%VvXZSVhO%hh3{3e[^_]UVSMQ3Q3يۊ&BZ&XÃ@.)օ~=3uC3[^]UWVS uE Eԃ=4-tL1ɉ 4-hh3%[_u(j.h3g_Zth@Ph3Z 3uhh%h34 F<t^<t<udEԉE FEe[^_]!Uڹ1ˍ}fEu jEP [^uԍEPmZY6e[^_]VPFPhDF$hh3?z3e[^_]US]U MC<t,<t<u/MU ]]OMU ]]U؋]!S"PCPhLF$hh3y3]UWVS(uE MMԋ]U~u)ẺUЍ}عjuV _XUЅҋEtuu SVZY SPV }yE EV$e[^_]~ztEEԉE E6]#e[^_]]zEEԉEE E+"e[^_]>zUWVSXEEE EEEEEEE"1EEEE1҉UjjuVjj]S/Myh@$)EuhVF$̛ Xe[^_]PcXu jj jjVWjSLyheF$݋EEhVF$ XE9^CU!‹M9A}tSyM9,sxEt  Cy;8-t8-PuCyPP C E1ɋEtttHP1DA uЋU؋uЅ~uE'uPsRV~uEuPjjucE#CP>h`#h`#h}F$Hx@-H@-$yh8-j ~XZ8-P8- }e[^_]3UUMzuȃ'QPuu RUU} uЃRPjjuUWVS u} EE11һF$~kMUD8-u^@PZMt$Ut:u?DX,t*DX\}uCNv t4}tEEEe[^_]UjjEPEPu u-h?uuum(USPhF$h-zShF$h- zShF$h-y$ShF$h-yShG$h-ySh3G$h-y$ShFG$h-yShgG$h-yShG$h-y$j}lUVSƃ=3u%hWmEPt3t-覍WPh-I$t荍WPhH$ n CiVg Xe[^_]UWVSV1}jj}Wjh`& uTEEPfjjWPh`& t S[!hz&%S责 ZYtQhz&%je[^_]ÍL$qUWVSQpqAlA EAEAEjjj hwJ$ Y1iPEZuh 5"Suj ` E y hJ$j E9tSPhJ$e tt/u?EEpJ$)"aEEbJ$*"LE@EiJ$*"7}uEPEP _XEJ#tEE1!#9#S~YE܃}ƒ}E ˆwtRExurWR~Z9EsEhJ$hJ$h+"h+"SuhJ$uhJ$k$EX1EЉEԉEȉẺEM}ltp9CECECEEEUEŰEEEEUEUԀwbEU }E]EݝxM؉WQRP蜊 PuSuhJ$ju؉sEܵx %PP$EM)ș WVRPO PEU WVRP5 Ph K$jj h1!#RPj}W蒋 @u hG#jj h1!#EU RPjEP_ @tjj h1!#EM)ș RPjuV3 @tWuSuh"K$isEܵx %WW$VEPh,K$i,*}MЋ] }tajj h1!#SQj]S贊 @jj h1!#EȋU RPjuV臊 @VShCK$Ui MЉ]ԋu؉uEȋU WVRP PWVMЋ]SQ讈 PhUK$}"Mȋ] }jj h1!#SQj]S @Tjj h1!#EЋU RPjuV轉 @'jj h1!#EȋU+EU RPj}W芉 @WVShlK$WhM]u؉uEȋU+EU WVRP轇 PuEЋU WVRP蠇 PuWVM]SQ芇 PhK$gW}MMȋ] }m]m]jj h1!#SQj]S貈 @jj h1!#EЋU RPjuV腈 @jj h1!#EȋU+EU RPj}WR @Eu %QQ$WVSuhK$uhK$|M]u؉Eu %RR$EȋU+EU WVRPf PEЋU WVRPL PWVM]SQ9 PuhK$uhK$f$uXeY[^_]aUׅPhL$h-ij\UWVSƉUσ=3u'jh37 3ZYuh&$[3Xi 3}u)VUPxZYUub`VUPxZYUu9Rhh3Cƒ 3uPhV$j K k1e[^_]UVSƻ@-tPV9xZYt%VhtL$53h3 OC St8tPRhaL${ RhlL$ {ZYuj 3h3 C33묍e[^]Uj訷X=3t%3fPftjh"P蒉 jh@3d UWVS=83543ÉDžu¿L$RWhL$53g53{XPhPh-$y'1=T3ShL$53dg-fDHfn,f?trfauH43ShL$53g (fptfqt#1҉8353hL$ Y[C1T3Sht$53f &SShL$53fe[^_]Ã=T3tO=3tFUVS58343831ɉ 431U58343u1҉T3[^]1T3U0;3j芵Z= 3uj踆X<3t3j蝆jh3b UWVSxEUtk1ut=tu-DSt1@֋]څu$EE%@ -t -fBuӃ}tgh3*t[ƋE]tC1ۊ3t8u9s&H3 CuݍHȋ])=~ E봉EE} %Uй 1]13trtl$t\uF8PuQ@@x0~-H8tWDЉ\C8tu\:u;81ɉLЋEǸ3:[tL\t$ HWыu)@,-x$uvX-DZtep0u&E@GOu)~ˍYσ ttD9])ف~mP<,<]B<\t<$uj2-DstX0u"Et@GOu)~ɍAσ ttD9t])ف~Oȋu)=ZJ ]]\tBJuztBX5-D^tS@0uU tZBGOu)~LӍJσ t4tT9t(])ف~Wы})ׁ@E8uhuPs EE53hM$ EXZ‹Ee[^_]USEU t~Mãz&%@-3tRQhT%Pa#PhD#P 3ZY/t!h3hM$53Oa13 B]R]UVS]53u93twE 03u13@-8t 9XtShM$je @u=3th3PhaL$Ss PhlL$CsZYu353e[^]U}u蜢3]øN$]U}uw3]øS%]fU}uR3]øN$]AU}t-h3hN$53` 3U}th 3h=N$53_ 3U}tšh`3h`N$53_ 3UWVS1}uEE PPEu jHt}6hN$E PEP] uhN$E PEPB t}E pXE Pu r"3 3t! O$tVWjVjjhRSxySmHX 3e[^_]U帥+"}u#]U}u ݖh`O$hiO$htO$53T13UWVSE]uu1҅‰uTpuCE xh+"WTZYu u0Hh#W7ZYu1t/#@ u븥+"PVhO$53 Te[^_]UhO$h,3u uI3U}u3=3t3E EO$]逹 ]UhO$hL3u u3UVSE] u1=H3H3u{+"yt ash+"V(ZYtBh#VZYu 1H34V^shO$53R 맣D3H3노#PhO$53R =H3t5D3hP$53R 53h7W$s H3Y[t1҉33e[^]Uh&P$h3u u3Uh3P$h@3u u3UhIP$h3u u3=3t1H3UhVP$h83u uM3UVSE] t~ ܓ1=33u=sh+"V}ZYu3h#V]ZYu139s? 3^hsh3 333 A 33#8u-#QPRhP$53P33e[^]á3t8u53hgP$蠶 13ZYƋ 3+"UhP$h(3u u3UhP$h3u u3UVSE] u duosh+"V&ZYu03T3_h#VZYu1ɉ 03T3HVϻZy$shP$53O 1=0303T3t +" 1#T3PQhQ$53O1=033e[^]UEur3HuhQ$E PEPc tЋE phVQ$aYZu9=3uJ=3t53h+Q$Ҵ XZE phUQ$xaZYu3@31 3USUE 3u DC3Pt ]馐pYteP) Z@u Sh]Q$n@=@3t"h@3hnQ$53HN1ɉ 3 53hQ$ XZ]]Ű]UEt~3=HuhN$E PEP tӋE phQ$``ZYu 3USSEu轏3Huh O$E PEP访 tT3hKj E[Xjh@3I XYE tE ;u1ɉ T3jju 讯à uu=T3tڋtShQ$_[Zu 3E =T3u=3t83831ҋtT383tuj>XZ1ɉ T3]UEu蓎3}Ht}6hQ$E PEP uhQ$E PEPd t}E phQ$^ZYu!E phQ$^ZYu 3UWVSUU] 3E=3t583831ҋE _¡T3t@T3583ujZY1ۉT3EM9t EPͪXe[^_]UWVS}u <jj薗ÉXZSk CYujjfhb# à u$j/S _ZڅtPhRW =03t653SK 3HQPY^y Pj JY^ J }~j53h"WS4  jWS3 Sh3R$3j9~PD Z9uWj腖[^WjyZYt1 hFR$ýX3e[^_]UWVSPEEu豈3%HhmR$E PEP袸 EwɋE phvR$X^_t 53h~R$ Y[}hR$ Zu ]E XShR$XST1 t뙃}hR$̔ Xu ]E X ShR$PXST1 t-U}u"E X ShR$XSOT1 <3Ce[^_]U3}t\= 3t =@3u#׭=@3u3E ER$ h@3hR$53D13 U3}t=@3u#P=@3u3E EQ$鈪 h@3hR$53D13 UEu茆3{HuhS$E PEP耶 tӋE ph=S$VYZu9=3u<=3t53hS$ XZE phh:W$W誘ZYt.huN%W虘ZYthAW$W舘Y[t뷻v[Zt3u6hIW$R_1 tT3tT35T35T3heW$R/113e[^_]UWVSPU} uRUyZUuUE W$3Ee[^_]0Ë@t Pw1ɉKXW讧CZ=3ttP3hW$530e[^_]USEU 3t tt<]~r-t8Cu1!#PRj hW$53>0jrr 13]UVSu 3}t e[^] rvxXuvhW$53/,Ct Pn1҉SY3hW$53/13 e[^]US3}uq3<=L3u3E EW$]7 3hX$A3X]USEU 3Hv3q3P=T3u3E E X$]͔ 3Hu h6X$nAYrh;X$^AXZ3]USMU 3Avp3Y=L3u3E ECX$]O 3BuPhpX$@XZrPhxX$@ 3]UWVS @Eu} t-p3AHhXV$E PEP tЋ5T3} 19~j k`S3Pw t*Cu%whY$53-3 h@h3P 1ؿk`S3X 9Xr-DP@tC3<$t<\CFC -K߿DJtm1KԿK߿DJtk ߿DЋԿʋMQ9~mP3)PE 4V E 43߿iu6CDžؿ9}~)3)PE 4Vԩ E 4;ƃF;rT30oXu 53hT$u!53hT$ԑ 3^X~ t=<3u 53hHT$΃=3t:53h3莑 3HQPYYy Pj .YX J j 6R T3P5T3V =,3t3~t-3HQPy;P| J PjO.XZh@Ph3臨 qT3ET3E 9XCؿt G9}ce[^_]USËt PV1XCt PD1ɉKXCt P11CZ]USd0;3jyX=3t>?FPhY$jd]Si%~!3fJftPSRK jh3& USdjkyX=3t>EPhY$jd]S%~!3fJftPSRyFE8 u@EuhZ$hXZ,HEHwuE1e[^_]Å8UWVSH%Pt=-ufTwfUtePt^ftwftO0Euf]fۃW})߉0ufWӉ)Ӄ@YA]AXZ[^_]UWVSUu u h+Z$j ljjhRZ$P uW1ɉK fCPjhZZ$W虦 uWC fCjhaZ$Ws u WC _t36vCvCF C FfC (WuhiZ$ Ef: j/RUY ^ZEUu R腜8)ЉUHQM ƋMQURP { uEuLCYj@V ZYt_{ u1҉3Mq@Pj:Ep  t@PMAYE@E@tu[uvVj]RU YZEtH:UttWuVhyZ$)PERVMV蟕u WuVhZ$tEx:u-u%p/Uj:V YZUt>t3 3ׄtK3Gpj EPVn >tU:u PvWuVhZ$/fC*C tt53u53t1!#V軚CZ{uA%{ tA%P蛚CX1e[^_]USZKJy ;J| t Y RP&XZ]UWVSP1ۉDžfDž1jhZZ$PY jP]$CZY@tt8tt8uVhZ$tuDž8tj;P [_ÅthZ$PxZYtChZ$SgY_t>hZ$SV_Zuh[$[gVSh1[$Dž DžsDžVÉj@P  t1҉3@PΘYj:| ^_@P覘[H8?u1;u11ۃ/j/S ZY9u$uHsjhA%S語 cu)uR(31ۅ%pu'j(3u911ۃ=(3Džt*1;t%hQ[$SrZY11u @11ɉ>t+hQ[$V*_Z1ɉ=3=<3t jj_XZ=3;hPWc 1 t1ɉ$31҉$3QPZ$3<3YZu u*"#Hu9d uWhX[$ u Pj衾PjrY_t ;1$j/S_Zu Jx;hh%R 1ɉ 3Pj=3u/; =3h-h[$ XZt>ut>uGt>t݃t3hSSg hhA%S' hVS $hhO$S0 1 tL5831ɉ 83=3t hhO$ hhY$SҚ Wj$583F3uj/V [ZtP1ɉ=3t WjWjXZ3-1ۃcÍc؍e[^_]UWVSl<1@DžDžDžDž1048Dž1 ($ Dž1DžfDž1DžfDžE11,jh3 ZYu P]$Y[@SG^5<$!Zffu0t#;th\$SZYt h\$3t$?t?u+u =3uh\$[W苑Y,,3t <,j/P _Zt@,PEZ P2Y3 t 8uth ]$c1=3=333DžtDžx=3t0 tRPNZYu33D3K]$,h&"P+^_44u ,4Pt$PEY[u/tx3353=3 t14P_1҉$WVPuy,PhR]$=3u=T3<T3 -,Phm]$53 33 3 u53j [^RPhx]$Q\hSh3ĕ H33ƃ yW(PPhQ^$ 83(uRRh+^$ RRh?^$P듸=3u 1{PssVdyVM7 ^XPTPPPh1!#lx˃=$3t@Ptu P [Ttu PYT39}Vk`S3Ph=$H"YZu2h@h^$h3> ]YT305T3qXZ G뮋[ PtP0u1PXTtSp8-/@dj VP$ 9pd8/Pdx*u,j pPR pd83 3Gh_$`$d+tXH ׉dR%s^_Džh8HR1Ytx`$dtd襁2`$dt]N$dth,`$0Xr_`$d`ujhg`$ ^_p@9`$d't`$dƅu `$dutPlYV̀Zt<oZu&J3 3h`$# _t 8uh`$ڡ3P3~ ha$ ^}31uQu2P7ZYuc T3tjXRjhPF Y63<t <=t3=p353=03u 3hc$WÉ53_~It,=<3t#3-wQ53hd$eQ Y[=h@;3hI#53p =<33-v+p3h,d$Z=<3=l3=h353=03u 3hc$xÉ53_~It,=<3t#3-wM53hd$P [^9h@;3hI#53 =<33-vtPh3hc$Y=<3u9 =3t 5$;3P53h1d$yc$ c$uhc$Sn_Z3$ w=t53hd$,Y63<t <flpRPdPRRRP`P\Ph=e$h63謐 , \`dtk=Y633$ lpRPRRRPhFe$h63 #`631fX63 Ћ Ћ ȣ\63lp ffZ639x63YlpRPdPPPPPPPPPPPPPPPPS`P\Phe$h63 \t-53hd${M 5$;3q $;3 \u`u dt 53hHd$붺\631fX63`63@ulp ffZ63jh|63h`63Bw 53hd$F53hXe$6hc$S<[^^1ɉl3-w 53hd$ERpRRRPhre$h63词 t53h}e$3L XZ:u:u:u˿X63t63󥋅pffZ63jX63PhX635$;3Xy/$;3=3wP X$;313>=Y63%hX63j5$;3[_Zy hf$\^Y63=@3<<Y63<[63PZ63P_63P^63P]63P\63Ph2f$Ã=<3^=@3Q1҉@3X6363=@3t fZ63$;3tP _jjY63P$;3 y"hc$[^ @3=@3u#jXRjhP艖 @uhe$$X63PhX635$;3 y%he$'[Y5$;3 $;3xT3tjXPjh5$;3 DžhX631󫍅hPR5$;3d @he$x=t3,p3=l3 h3t$=l3=h3\tX63<u1ɉj j WhStPtP} 53=03u 3WS\h"f$aÉ53~5t=<3tp37h@;3hI#53 =<3u Iu<t=<3[63PZ63Pjo63Pn63Pm63Pl63Pk63Pj63Pi63Ph63Pg63Pf63Pe63Pd63Pc63Pb63Pa63P`63PjjhIf$HÃX1st @3<uBDžXjXPjj5$;3虓 5$;39 $;3X1=&53hud$e[^_]UWVSD}$;3=3tWPHjjPw ƃ HPj5$;3X @-$;3EfEjEPoM]ġ3ZZ<ډEUjEPoM+M̋EZ[+Ey@Biy1QjEPV 8t8#thf$63EEPEP5$;3  à ty5$;3 $;3VjSf @t?}uEjEPjjS W5$;3IY[Quhf$U X5$;3v $;3Z1(8\8#Nhf$eV뽍e[^_]UWVSu1ɉ ;3hj.E[_t= 3u!3+3= 3W+3!35 3<3<3H3thPBUPJ\ UBCH3 t63t63 󥍺63󥿐63,;3<<,;3(;3@@(;33DD33HH3T3LLT33PP3 3TT 33XX33\\3jh3`UP[ j`Ph3Z jh3U썂qPZ $jqPh3Z 3U쉂3hh3PZ hPh3Z $hh3UˆRrZ hÈSh3\Z ujw,;3 t1;3EEe[^_]e[^_]UWVSQ}j/W [^t#9u jhA%jWXZ/jhF%mY^y Whf$NSnhWh3Y 3ƀ3. d1.F9t@BUUjh3XZx9U0t8u-Ou53hg$A XZ10jh3YXy3F<.u1F@F0볍e[^_]UWVSu(;3u/h'g$- X=:3t 31Ee[^_]<fDžƅfPftjjWPt hIg$RXhhbg$5(;35(;3 ,;3Ã(t hIg$QX=:3t 3j3<Xt(t#fVfthWPJ j]Yu=3(ujDZj1ɉ 3Dždh&"u _Z\\uu hd#bK[^aDžd\fzt \@xRP&ZYxE%=tu h h$53 EЋUԣ33Jjh 63, ^_B53=3 hN$u ZYthN$uZY3twC\fxu \jWVPk\@jWVPyu hR]$"J_X+5353hg$  DžT O$}tEuuhR%l H3T^``u"uhV$*ZY뽡T3h h$h&h+h0h$x953s&53tP5XT353PH_53j"^l@ujj !ZYl=H3t=3t =3y D31ۡ3`fxt `P\fyt \@S53553 53- uu h-4#H_X8 33\P*XY@X t0`Xz33\J뭅t[pt9533|@3#,53^ptD3pt륋`@ @tu@o` 33<\H Xpt 3933|3 {\@ @tʸ#au h-4#FXZ`@ @tjhKh$FXhjXdtd\R^1\`P1ɉ` $b[nhPjXZDžh=T3te$;3xP, X$;3`t`P^1`j[31;33}j;Y 3h@u l@u"hPjoXZ㋅lPj ]^_$;3xP [$;3du `u)\tꋅd\RY؋`PXP31҉3333e[^_]UWVS104D3PT3t$1=3=3L333(3$hO$uZYDDu = 3uVu=3t}t}u&E 8-u}tuhg$53W 뺋E Phg$53> ɋDtE uPu 1ۉ8Dž<Dž@1=3uDHjh 63. ZYt=T3tzjXh]jNY[hj@^_<}tWE jP[^E j/P~ ZY8tN8 tDE Phf$KC[^3M E h`#P_ZE 8|uuU A%t,F%%E 9u jhA%E jP^_/ jPY[n= 3t 8 uW@8 u"E hP _ZyE Ph^h$6= 3t 뽃= 3tE PYE D3uJutYjjjXZ塄39u&ju0^_333ujPiY[=ujh 638 ,_ZDu}u-k33 tRPhg$0 ͋E8t8PuhR% Hh&"?^44uuhV$Y[ȃ}E h`#P_ZuDž08-15353E 8|uXjj _Z@E hr"@P Y[00u E @Ph3R$A15353Dž8=E uPY[00uE Phd#w@XZ#Dž80fzt 0@xRP;^_@tE%=t1ۉ33T3ha$h&h3h0h$9 53s&53tP+YT3 53PX?Z53jX=H3t=3t =3yD3,1,3Dt@33 t/0f{t 0IjRPQ53 53 530fxt 0P4ft 4@,VSu u08 u33hoh$>^ڃD43 3#0jjjP 11y=E PhR]$N>Y[Z0Jy/0PZt΃ t*;533|0H уԋ0jjjP x N33,334J4Ps_ td0@ @ul0 u4J4P'^t, VL@L Hu ,PT9ȉ*3#153菶XPTD3ډPT33띋4H 0334H PT 39533|3 {4@ @t=ʸ#aC8 u33 hoh$;Y݋0@ @tE PhS4#;XZjX8t80R^104P1ɉ4 $I[Lu33y3`LPhh$535 53hh$) XZ뾋D$ u=3uj6 _苅8=ju)[^X\Bu@j`SR^_X\lp1tE SP4D ZY@XP$J+‹E $Phh$53Q`jh 63蝿 ZYt$31;33}4jX Y*h,j^_=T34PP[벋<@u @@u" H3 53oSj j VhWss| t hh"W= j h"V= =3t6xt*3{u VRh+^$VRh?^$P4s jsad yVPhQ^$7 <=3u 1{Pss2y X[t63sKCt63V 1t63Ph63 @uGu uh&i$Y6 Bu uh^$ 3 1.63=u63u%DžjPjjq h&"j,;3hr"U(;3=,;3tuhZi$T ,;3^4=3t5H3hni$53} jQ[~",;3tP˱Y(;3tFP軱Z=jSjh]p jShhEp H3(3 Xe[^_]U53hi$# XZUE }ut3hY$WMZYEt ue[^_]Z2øb#= 3tl$Ph'l$53芻 -t$= 3t~ tPR2PS$2 SO%YE ]e[^_] QMZƒMuQWhVl$53KSu QWhrl$ދ}u#Uj PMQ_8 MMEPjUR rPj hW$53踺릍e[^_]UVS3 T33$t!uItJuB3313P3-8!- u @ u3tJt 31&33 tGtBB@"u\uXu@!@B؀"@tՈButBT33:T333tHt 31313[^]US33T3T31ɉ 3T31ۉX1T3{P5T3/XZtT3@ڋ]UVS 3=3t,SP $^Z8tPh$$53Ÿ 53腩jh@h3h-*y}uB53hl$t.=3t 3Hy Pj 莻Y[ J 33󥡰333 3XZjP>3333+33_X39}39=3 3sB3󥋵53= 31w~s9؋}gWPhdo$hSߩ3fJftPSR jjj-jh`3, =3uh jjujjj =3l%_h"P 3Y[tPhV$hP x3319߭y<%ݝ݅ (%߭ٽf f٭۝٭y1d~dVho$)P=PWNj3~-3t P׻Z)Å~:ùdh1!#)Sh&Pho$)P=Pǃ119ʉst @u4&SQho$)P=P蓧+3 3+ $3y @B8%ڽ߭ 3319ظw ȉ߭X%s9ٽf f٭߽٭=ٽf f٭߽٭É 9ǿs tA؉ݝ4&%11d PVSho$)PPá339lj33)ލ 9lj݅99Ћ}ho$VQ#à +33߭߭ٽf f٭۝٭?~~ho$rtPh "VQ}Ãhx&%VQjà <ЙRPho$)PP1Ãuh")PPà 3fPftSVP? eY[^_]aUSjX]á3@ `t1US3HyP_Yu1ZJ ƒ,uɍPv"u|@33HyPZuJ"\u%3HyPZuJCC3uh p${ Y@3A33HyP蕜Zu ZJ, „t@Pv8\u"3HyPVYu JCC3uq-=@3th@3P荶ZYuC ߸ ]UWVSQƉUh@3P [_tHj.V艎[_1ۅt6uP ZYÅu#)Wh@3V& u1ۀ@31ۉ؍e[^_]À=@?3tUWVSh&"h@?3Ӧ3^_u"8th@?3h&p$GY[1$hS@K_ZyƅEj.S[^pu Džp1!#1btH uuzG uҋpH3uSpEƅt1;4 3*%u_3uGE uh@3"} h@3P葴ZYtE thWn$Pr[_tB3fPfttRPڟZYx|?th6p$t h_p$w$xAE85h@3|}X 3fPfttRPa[_x"|?th6p$ hp$ E8h@3}z= 3t53PۘYt u 3Hy t u53hp$JɋT3u53h)V$XkaS3`S3iS33HyP^Zu@J-DB@uGG9u uT3u3lS3`C3=3HyPYuJkPkpS3BlS3klS3`S33HyP赗ZuJ< u6T3k`S39lS3u@T3 {u@T3KZCh@3hq$ _X3@tR輕[53h-q$ XZ53處Y 53hp$ۍe[^_]1US]-uhSq$SZYuP3DB@tCjh6X$S" u T3UhXq$SZYu X38h%S}ZYu \3hdq$S`ZYu `3]USZKJy ;J| t Y RPYXZ]UWVS3=03u 3h$V$萳^tIhiq$hD;3L ZYƺ9¸} C;3.uhD;3Vhnq$53訠jhq$hD;3 5 3tjh$hD;3 uSt @3 D313j hN$h3 t\h3hM$53! Bt 1@31D3t*j hq$h@;3B u53hq$ ^_L3P3T3X3\3`34;3EhX$Y1u(;3t-fPftjP 5(;3*1(;3 1ɉ <313jCPZt Shq$j  Ϻ0e[^]UWVS](3=T3t =<3u$u 1ۉ33Pu7=3uE33P3@1ɉ 3=3h5x3VL /thhA%V hhr$V VyVhr$XZ1pPU =3Xأ35H331H33} t1= 3P̼Xr"EEt!jjRPPhQ$V"ҡ3-cvt@;3} t1= 3PbX=35H33h&"V3V =3uuh6r$ ^6r$53hh3蕑 u53裎1ۉ3j h3͂ZYu3e[^_]UVSQQMq3=03u 3=\3ut953hVr$ Phr$EYZuBj h@;3K^Zuj UR@P譏 M te5-DN@tVu=3u=\3u1ɉ \3t=03u53h@;3 3 XZz3eY[^]UWVSQ4MY=3}=3}=03u 3=P3u}53hr$ fPhr$0^_j hD;32ZYtj.hD;3^_thD;3*YD;3uKjhr$VR; u7Vhr$53-fE;320hE;3hr$53E;3 1}V§ZtVh s$53ޘ EPh#s$V4 tEEP_uu 03u\]3gu=3u=P3u1ɉ P3t+=03u"53h@;3- 3 XZE3E3eY[^_]Uuh0s$j2h3<u hJs$j{ 3UWVSP}u jjhb#jWhxs$V3 ƒu&Whs$V2 ƒ uWhs$V2 ƒ USjBEe[^_]Uhh@34c ZYu@3UWVS 3533=03u 3h4v#贩_uSj h@;3~ZYtA8thUWS$]؍U1EEEEPShQ%uy ƒ1uudw Xe[_]UWVSu] }VuSτ u1N tut$tt$fN lSZHˀ; uLUJ9uD -y h-Y-H - t@u҅tt$ff t1҉e[^_]UVSQuh3萜[á3?vPht$ juht$P蓍Cƃ3 1҉UUR@)R3Ph-yht$uht$53HjrT319T3 U e[^]UWVSD]} S\j j VhRuW[H t&hh"RA j h"V4 3tzW9Vt vuvvS85 @uTΩ8jjjhSvvG thh"S 萩8Shu$6Y[4jjS褯 ƃ u(PPhG$hu$PjSf @uPPh@u$fDž=3~"jP3XZuWSD @ƨ8$}u貨8A^PPh^$D >jP*+‹Y_+y@Biy1fDžRjP趭 uY8u=3~{8#tLVjS ƒ 1BPPh "nu轧< tQDžPPhhS< @ueS e[^_]UVS]u S|<$WURP Wh$S WVS E(tP_]uhvR$跙[^t^}u-hR$ Yu]SES軕1XZuhR$kËuV處1 tts;}u-hR$ _u]SESY1[^E8uhuv$ | YPhR$ËuV!1 EtPhR$Ƙ_Zuu3 3^ux<35T39~Lk`S3Ph=$TZYu0h@h^$h3J lT305T3WC/@31 3Et P11EX]tSC_1Et P1ɉM[]tSZ1EtPXe[^_]UEu23=<3t%5H3hv$533gHh4$E PEP EPw=3t 3uE P 3U u#J3t8u hv$j RPQrZY=3t"=3t53hv$535 <3j hS%h3 33j hv$h 3o 3j hv$h3T 3$j hV/"h`36 @3j h%h3 3=$3tjjE p UWVS0u=(3uue[^_];]ȹ 1SjhV u}uVhN$x S 1E0ES XZEče[^_]UWVS,EPu EP跠 Uȃ u ỦEЋE0ufEjEP3EUXZ1ۃ=3~yjEPsE+E‹E__+Ey@Biy1RjEPk u{8tq8#tua<_Q1҉jEPVP u 5 y&8E8#7ËU9} )‰UEuIX؍e[^_]UE]UE@(]UPEx$tEjURjj03 1USjuD [Zxj0j|ZYu S Y11҉P$]UVSPuEj0jFZYt,0@$jjVb jEPhhV2 ؍e[^]US]t&S13舤 sKsCS=1]UWVS(]=3~jEPh3EU_XEE E̋C t 9EsẺEЋs})C C)E}1u)EEЃ}uW3¢ u=F888#*C( 8u5C}9{r:T}|D@^uC,8#uPZYCEЉC{uMEЉC 1{UfE؃=3~;jEP)E+E‹EY^+Ey@Biy1E1҉VjEP u (8t8#tC(9蚚53Phdo$53~<C(<1EЍe[^_]UWVSQ} ]{uhyCZC{({,CS 9Sts C)9G1s sSjjEPlu{(uS{,t{uEmKSBCEC9Cu3pVsZYu C(1E&Cs} {s}MC Ee[^_]UWVSSu] }VuS u-~,tut$tt$1ɉN(YS؋ZHˀ; u9UJ9u1VjjEPXt} utw$1ɉN(t1҉e[^_]UE Pu0 XZ=3u 3UE Pu jfoUE PuUu XZ=3u 3UWVSSƉ׉ˉʁv )…tRUWV虝 tUuk؍e[^_]W|$wUWVS|xˋ7GEGEhE_u h.w$&hEYtU 1u]EEEĉu1EEEEE11E11҉UUU}u}tp}tj}u^Wuu9 EE)PEW|ĝ u h?:Xȱ?v.X?v"?tH?uH ?uHɉ[]UWVSSƉ׉ʋCuj RPX F 5454hW|$j ؍e[^]UWVS ÉUE9C8uqBhzu0t'Phh@3M t Džh@3)ȋDPS4F hY[< u5454h~$Ph1hn))=w(SXZDžh@3Phh@3S 5454h#$1_1ss C1C1҃u\#u~nu 44@ f4454zI_1+4=4u8#uxnu 4M 1M I t44t]Ut @uKf 4-t41ɉ 4=4;G 44t1BJM pЍe[^_]U塠4@ t=4t/=4t@HyPIYuԋJ54Pj XZ1UWVS|u=4uQ48u==4t h!$j( 4-4Kw$48-4("44tQHyPJIZt@ J54Pi 54h4h4 ÃYB4=-u 1~1P^G[= 4tdh 4 h 454y t $L&494r4kP544XZ=4k 541L415H4{u54s觯 Y[ = 4uuu =L4z H4t5D4CPj VA; uL4H @))ӉH4SPV Ij5`45\4hD4;jjh"hD4j5`45\4hD4Fj5H45D4h\4\ jjh"h\4Aj5H45D4h\4) 54s菮 H4;d-r54h%%D XZ1@HЉ0,Ph$546F,B 90uH@)< F;5d-r54h%%Ϋ Y^54j$J? 54j =? 4@ @ c¸:tbPP54hk"j 4 L4u4545H4j5D4.=P4t54j > XZjhD4g^_1ɉ L4jjh"hD4rjhD4,@=L4545H4j5D4e-=P454j > XZ=L4rH4=D4BHPj W>6 ƅt*P44)H4P4H8545H4jW,=P4t54j = Y_8H44P44 L4u4545H4j5D4k,=P4t54j $= XZj6494r4kP5494^_=4k 54CFP/RYFG=4%=D4CH@u. 4t$P9Qs@4R54Ph$j蓳 5H4j1ɉ@9^Z"1ɉ 04H41҉HLC0tZ4uH 9Hu;Ptj0Wh,4CP Q4pP @9u9t)HL1LH9L}jjQh,44PHσ)HLL'Hj@$YZ"L HjHWh,49Q tUAQ )HLLHj@YZ 4QNu9AuAQ 똋 D4j)ȋ54PQh,4~CP 4P @@DjH+@P@Ph,48 tD4D4P4,4P4,4t<4,4Cxt4545H4j5D4(=P4t54j 9 XZsF uq=L4u~uhh Pc F @t"5H45D4Cpxa ;H4t Cp jh"CpPa Ht1 4=414[=L4h{uhh szb C @t5H45D4s` ;H4tshV$j jh"s` Hփ=\4ujjh1!#h\4o\D4D4P4\4P4\4\=L4H4Hw{5D4=p-t 14H4D49IFTu@1*jjTPkH<9Hs B@9u[0QPVA 0uՋ@9s3<jp$(Ph4.<jjVh4 )H*tD4D4P44P44t$4454h$"540= $4 L4u4545H4j5D4%=P4t54j N6 [^?Cv1s  4ue[^_]U 3txt1҉P x{u@jjh1!#h\4US];] ttCtE8tXX1:"u#C@؍e[^]USPryYt@Uv‹EBu Sh[$j赫 ]UWVS Ek< -Ex19~BURE@u9 2u19)VD PR?kEh4 ~1]U1҃=\k4i@f4 P1]U<du4 51]U<c4 1]U<@d4 1]U<a4 1]Ua4 1]Uu4q1]Un4e1]Un4ex1]Un4e]1]U`4 B1]Uu4 '1]Ub4 1]Ur4;r41]Udu4 1]Uc4 1]U@d4 1]Uq4 ~1]UE 1҃8i o4 Q1]UVSQ] hQ%uV& jVVjjjjh2(V*j Zx9~ʉe[^]UE]2/UEN]"/UE.]/UEg]/UEb].UWVSÉQ-W-VPhx$sbze[^_]UEU t2t Ju6@d4 'u%du4 a4  c4 ]]UEU wS$`&n4:u4.a4 "@d4 c4  du4 ]]UEU t2t Ju9@d4 'u(du4 n4 c4 ]]UEU t;t)JuB _4/u0 @t4Ƀn4 b4]q]UEU wG$x&u4 .`4 "@d4 c4  du4 ]]UVSuU E$&1i f`}4ZKh$P}=ZYt u h{+X e[^]je[^]US]E U $&1Ƀ:i o4 q4 @d4 c4 xdu4 lr4`h$hr4<ZY;r4t=;r4t h*X):s4b4@t4Ƀ؋]{]USE h$P*<ZYudhRh1!#h /1]U{4ƀxjjP#US] {4ƀxj3P{4 )t PWXjj3P ]UE 05{4US] {4)thjjXZ9ƀxj3Pyjj35{4j35{4V(]US] {4ƀx3j35{4#]Uju NUju :Uju UVSu jVZYtV"jSPe[^]UVSu jVZYtVSP e[^]USRu ÍEPjSu ugX jjS5 ]Uu 4US]E $&1Ƀ={4iv4 l4Oy4uh$hy4b9YZy4t=y4t hc'Z>z42b4&@t4Ƀ5{4aX؋]#]US]E U$&1Ƀ=\k4i@f4 >h4 w@e43k=i4_h$h=i4z8YZ[i4t=[i4t h{&Z(Zj4 d$5\k46`X؋]Q]Uh耷@t41U14jvO1U14jaOc1Uhh$h |4Υ E Uhh$h |4觥 E Uhh$h |4耥 E Uhh$h |4Y E UE.tgzEEPjjp貺 UE.tgzEEPjjo菺 UE.tgzEEPjjfl UE 0^Ph$jjcKUE.tgzEEPjjhB UE jUE jɨUE j诨UE j蕨bUJU ]U藬U ]U|U ]U`U ]Uj`U Uj_U U詾U ]U{4,P1RP(U{4,P@1RP(U{4,jh(U{4,jh@i(Ujjǰ1Ujj跰1Ujj觰1Ujj藰1%,UhÄ$\ Uhф$s\ 1Uh߄$b\ U@1]Un4jM1U許1]Uj.1UJ21]Uq01]U+1]UVSu] h6#C Zwt @t2E0f~ufFsHPhY%h"e[^]Ee[^]#UEU ttu(n4u4 `}4]]UEU ttu(u4 `4  `}4]n]UVSE 0ڸuhX$FY hX$ C9uCEe[^_],e[^_]UWVSÉU@҉׃}fEs{S_u }}tiP^UUj WZYƃUt)JMPWE@PRUsoUt >t~UCuBEs4})CuS փ9~Of{ufKf9|A)fKsfuu)K9M|9~fs)y1fssf9u|MS9~09},CPuAERuFYXMCu9}ys(unXZ1C9uf{th$uQshCujjsz uC}S)Psse[^_]UE ]UE 1҉P]UE @]UE @]UE ]UE 1҉]UE ]UE ]UE 1҉]UE ]UE ]UE ]UE ]UE ]UE ]UE 1҉]UE ]UE 1҉]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE @] "U14jB1U14jB1U@d4 G1]Uc4 ,1]Udu4 1]Ub41]Uhv@t41Ub41]UhE@t41Uc4 1]Udu4 y1]U@d4 ^1]Udu4 C1]U@d4 (1]Uc4  1]Uu4q1]U`}41]Uu4 1]U`4 1]Un4e1]UE uU]US] {4)thjj@XZ*ƀxj3Pjj35{4]UWVS ]u t/{u)P/vP< t6vWJC 1ɉMCU9~Y}C48Zt>vPZYt/{u&MVU7MQURPGE뜍e[^_]FUS]Ct>PtC ZtsPEs 8 1C s7Us 1CZY]UWVSP -1AƉE1U9}HQG t5fu.O)ljPD PRk$j'jPd車ZYths藐hs* CuWVC }P>C RC P5-7`?XZ|KʃC{@9h-j Y^sVK_~G=t~{=MC~HSB ufCf;CU 몃P$ &=RIS҉ЃfEO?tzR<sσf}׍z$\&t9tsF fCs S9D)@fC8s$uh-j 5-7v&5-7S&jjWP=Et3Qu5-7=5-7sV ƃ11Et9}} < uEF5-7lh*$jj5-7p Vjj5-7` $jj5-75-7q5-7^Y=5-DBxsqh>tadt\<-u(=tK=tB-wH=Rt/=Su8t4+=4E9s$ X>t 4|h-jT XZC?OCf.S K)y1fK)y1fCYCfEECЍP9UK fM)y1s9~fSUʋMM9EL8fKsjXxufufCVt%z `~x~Ha (aS9USB CfC> =S=VpYv1-DB'h-j Vo sjC Zt sP:_XsJYtF t!u S_Zt Cx~fF ft\uMsiC ^tsP:s B1ɉK sAJs*1C4XZu W_XF u|s@-t-t)94r!DP; Zt;4s @-`-؋]U54^144ZU54XU54SXUS]uTu PjSPjQ]US]u+u PjSPj(]UE Puj UGuPhV$ UuPhV$ US ]uuP jSuuu jPQ$]Uh1!#uuu uUWVS}5454XZun},u4u(PiWPjjy ǃE}t'E8tE$9}u4Y|EE$|9}AE6}Et)~%E8tPZU$D9EeE} u)@E }y$uw[Ej PZYtE@M}})ȻEE9~)Ήuu uWQM54)ÃMu$u uWQhm$54I11MR@S+XMtV5-7,ZYMM54~PS}54PS,jjS[$SHaE @PE@PWMQ54$)P,Sm~ P54<}SP54u#u(PgU,Ru$u uuP$t6S[XtSV+V S;WPSe[^_]Uh1!#u$u uuuuu u/$US]uuPfSuuu jP+$]Uh1!#uuu uUS]u1uPfSuuu jP$]Uh1!#uuu uUS]uu PBfSPj]Uh1!#uXZUS5454؋]Uj US]St h"݃ P臁 sl$ =_4t7S螈Ph$5_4 5_4f5_41_4=n4t8S^Ph$5n4c 5n4&5n41ɉ n4=4uh-h$b XZ]UWVS h&"Ps _Zuoh~RjP觌PhI#h- Ss^ j h-#S _Z؉Ph_#KY[&tCVhS uW< $W藋 t ;u뵋Ct{ tዅh-#R ZY€:=uZh-#S ZYh$SVw ZYWSSx ;V5Xe[^_]UEPE 4UWVS 1ɉJ P] ^`s Zp j h$V莊 uՃ{ uC W hA%W , VW, WujƋ;7Pf  yC9C u=CPW&Y_Zu Q YaCPsY_ZtۉC{ CPGC VY^e[^_]Ã=n4u UDt4t uP)w XZj$ Uh" YtP} Zt hA%} YhjhQ~YZ hZjXUWVS 1ɉM܍}1n4j1j蜇[_ ]߉jjPN =n4u:SZxEPj b_X}cjhy[^1=n4uT/[j{4PgZY~>jh6j{4PgyjhY^=`l4;SZujh_XS^u{41ɉ$HuSZ{4PhV$jXj_{4)t]SVZ4}EEjP_U^XEE119EtMԋ 1҅t9t; tB F@܋Ekl9tH41҅t9t; tB Fl19t!4EPbZYu S?YYG19tPZtG}WfX1;Us=klE@0 t.Hdt'yt!U؋ Ph q1p8p4kUB19t4UW=ZYmUBSX_S}Z^u`S[Ohj]jYju8j]SZYu'@֌SVS jj^֍EPXe[^_]UWVShPVr hh%Vs hVWr $hh'%Wss VQu1EW@Zt/SSSSSSSSSSSh"h4jj*Y[ WVVXZ뷍e[^_]UVShPV(r hh%Vr hVSr $hh'%Sr St VSXZe[^]UWVS}11u܉5n4jj._ZyjVP7J e]{4$*u u^)uYjha Y[,u>tPZt{4$PX{4$S^_EScSGZYS<^_%#%S ^5-7iUjj5-7W{5-7O5-7DUEPj }tChj_jZju,jSZYu%#%̉SXe[^_]UWVS}11Eܣn4fjj]ZYxjSPhH xpu{4*u$tPV _XEV\[u4EPj ZY}t!hj`jju VXe[^_]UWVS1HH;E E8u EH1LEL0t < tLEL8PY$}1ۉ889E SZ9$PuS O]1<%rA <%t)-< u"DB@CC8uj PPSi P 9T1ۉFADЋ(DB@ulD:AtaD\t?@@4D@P0ډ,Du,:t0@먍TFX4,!< u-DP@tC8u$C<%jKwSyPhI%j8w5n4! 0TPhb%hT%j[1]US} t=n4uj j Z=_4tj j XPSPhk"EpR7]US]S=d X=_4t=SxPh$5_4 5_45_4H1ۉ_4hV"hn%% _4ZYt$SxPh%5_4 5_4]'=m4t# 0SPh#hT%j[# 0SPh%h-E j1 1]UVSƉ5-7Hj5-75-7e#OhPjj5 hlPGhWPjjcVhV$5 h$ CPj8N5-72@jPSR)R5-7$uh-h%/Q j? jPQ4cZYt'5-7jPSi5-7 PS6jjSUsSRM؍e[^]UWVSӉVjVj(P$P@  n4hn4hpt$ =-h-hbt( ud=-u[jh%j h-hf@$=-t"1҉-h-hbt(i -_4tPXn4tPXӟt %1n4L%%ujd j] jjh%o jjm µ$6 󥁍 Pj(肇 ( _4t#u h%P 5_4b1_4n4t#u hI#P 5n461n4h%3 ^_uh%s ZYu s Xe s hb4XEt28t(P~ _tSPh%J_ S3 3h'%1_ j#Dt41ۉn481󫋍$88Dž1 EDž1ɉ z8/hv%^ _=_4t 0NPh1%5_4e jj P 9 X8󥋅 ,014,PjjXPh , 8uE 1ۉ#XhVS> hԗ#k] ^Ƅu PV$ u1t@ ?uz_4tPWK 5_4 8uE h`#P ZYt f W0:0G C 1xE% _4xt SP8 XZSjU ƒt=$ ( _4^_tP[1ɉ Dt4諻 ƒuhMu $t"=th'M Z1e[^_]UShhjhjjjjj jjh-h4y.h-hi%J _4Y[t Phi%I XZj jP!Sa ]UWVSEPuhV }uCxPVTsY[tE 1҉Sth&"V _XuA h&"V XZ1ɉtu6_4tVh&h%PW 둿tt txWT=E X1lSxO pY@ltJG9r7tuvQEE 1ɉ^dWQ%BE XZtNp1F1}uSSS Xu5_4t,Rh&h%P }tS ZSe[^_] UWVS0u 1EEEPVEP ] 1EԉE܅unVh%E܍t0SE)Phĉ"V< h%S< ƒE9E؀8'uE؋E؀x*hz&%u ^_]EԊp<'uMCj'SF^_E؃}u SUY؉E؋Eԍ4Vu@E_ZOSh%jR j 벍Jg<%u<@T)IB*E6j/V臓 ZYDžuV&D EXuVD E̍GE/X}u_HEuY M܋}ԍYtqUĀx .tx uuW赂 uˋU;2tEԋEԍRUu?EZYUWVE)Ph%E܍DP y;2tVBXu7 XoE܋M1ۉ衶]Shht@j f}ufEf}ufEPEt|e s+-7EjP5-7h5-7B6Et55-7S<j5-7}5-7B-7EڋEEEfmEPuuًU܍Edh-I tE@ Eu ڋEE]^SESXZ;-7hPjj5tS9-7ut h"BXvu4;A_E@;-7ujP4f 7hP9LAXZ륿랅whPy$A-H-ZYy h--@j 褴_蜴蕴G;-7tS [}ter+5-7<:5-7j5-7[@u@Y]܃Ct P@Zu?XtEtV4 Ne[^_]UVShV"[ZuYtPEj.VZYÅuhVh4XZ 'hVh4@Z hCSh4/Z e[^]UWVS֍y9sjʅta}t7E t/t,-DHuUQMu ZYMUtC)؃~Qh%PS[ F1E ؍e[^_]UWVSƉUMjjj>à @t5$1UVjh4VXY VuS>S؍e[^_]USPh4h%EPjh"u" [Xh"j ZYttjh%Sr} u؃h %S蝺 ZYuh*%S茺 ZYujh5%S9} t؊t t@hSh4~X u=X]UVSh4$4$h4h48X =4tR)~4.u4Ph4AZYt+hhF%h4X hh4h4X 4e[^]UWVS1ɺ!idu$xtx jPh`4W 1ɺ%idu$xtxٖ jPh 4QW jjj~à < 1jh4VW Vh8i(SScugL8P2hPh 4V G$8PXt*hVh 4W hSh 4oW e%Íe[^_]ÍL$qUWVSQ-P4T[h]%(Pj y,_4t Ph{%> ^_h-h%{> j h2Ƌ([1ۋ(?RX5YX9h$WT ZYPWVy h$WT |-LDžX-XtMQD$HDQVy uHLDAEXhViP#U C (uV0:W*:XZ0iƄV:W :^_ujrjoY[ PDž$Hjj$V(Wh%7 @u"Dž$ jjVWh%}7 @u/ ;Psh%jP|YZt,뱸 ;x|s:h%jPP_Zu(hre^t4DžT jS4XZYt5Lt4gXDžT 9tf@ @ d)htjjjjjjjjjSXjuRL411PDžhjt`hPLϿh uLX<8_X 4hiPh4R jh?%h4bwt(jh;%h4Jw ;%?%1DžPh%j@$W$ jjPpPWk5 $@t puh4&h4hT%h,jct8DžpjpPjj$V5 @tVh-%e^[^1=4s(u=4lu 4-DJuPhA% ZYt;rPhA% ^X1hYH$PxY[hYH$PV_ZÅu 1DžPkjv<$1󫍽p!󪍍pi\^@u 1ۉ$Nhh2%tVZYthh 4h 4jf= 4thh 4h 4hhV"h%r Ãt~PhK%jh\hs%S]\hw%SR\ht%SG\$h%S9\h 4h%S)\= 4th 4h%S \ h%S[^_h%S[h%S[Sh%j[h4h%h(h4h%h$SB S.h%h 4oZYh7%h 4V^_h@%h 4=Y[h$h 4$_Zh"h 4 [^hz&%h 4ZY= 4h 4h4hG%jtnh4hb%$Pj8~ $X$3_hh 4h 4j~-hC%h 4b 41ɉ 4hh%S[^h!_Zh4h%h%hDÃ3P 4h%\Pj_ ~h\h 4M \2j h 4׷ thQ %\Pj ~h\h |4nM \2j h |4脷 t= |4t 4h %\Vj ~h\h4 M \(2_=4u8h[ %Vjh ~h\h4L \1Yj h4߶_Zt=4t 4hh4tY^u =4u 4111hP$VDL hh4h4jxhh4h4jw,PV^Zt%4Pu*jh`4h`4jytjh@4h@4jzetih`4 Y= 4u=w jh %"P?w jh %-wjh %h 4mK jh 4h 4j{hh 4h 4j}4u:1llPj豷XZluhh |4h |4j|VDžH 4= 4u DžH$DžD 4= 4u DžD$@4=@4u$`4=`4u$ 4= 4uC% |4= |4u$HDVQRh4Ph4h4h"hV,= 4u DžH$ 4= 4u$`4=`4u$ 4= 4uC% |4= |4u$HVQRh4Ph4h4h"h(jjjZp M%x PX4RhV$h hZ^L,Xq.h %jktj}4Y= |4hr"h % XZu>=_4th5_4P81 hh-P 1 j0 h, %jTpWPB W WPhI %hf %VT =4th4h %VlT = |4th |4h %VPT h%jATj莻V'=`4sh@4h`4h4h %j5h %h 4U hh 4h 4jjFj jh$$h4 [^T=4th4$h4 ZY~=4th4$h4 _XPu΀= 4t&h$ %hh 4h? %hhh] %hr 4j{4TXTeY[^_]aUU1!#w&]UWVS] }Vh$ZYuu ƅ?jhw %yp:jj\f@jh~ %M7ZY9t x/t/@?/uGjh~ %MXY1iR 4$SRPh %hu e[^_]UWVSƉˍPh$ZY1!#uu %VQPSSdu4td4PVSWh %he[^_]Uv4E]ZUS]S+VZй o4؋]9USPEEPj褰EZYt=`u4sb4=b4/ub4SPh_'%hhm4s 1]US]=4ujXE]EPj (EZYtt`u4_ZExN1jSEp:4 SuVSuVt~tg`PRT^[^tEPPRZYtU68t,8u"E@t$RP]^_uhi%EPwY[tEXt p$l(h,`d04t:$VSd]_Zt'EPV4Ph%hS蜰 \EpFjh%XZY@ߛ؛h %h%S"Vh)%W"Wh5%SZ$WGhPh}DSqS'h ?PhF% t0?u'hS%5[_thf%P$ZYugXRh%P1! tjj h1!#,4,0RPj$W S- tHLDJ@tSPWVhp%hFP g 41󫍝DžƅDž4DžDžShQVmZ 4Džf=t#fyf4f=NE1f=FX!щ11Ҋ44t'w8X$'wX$$(uJ1󪍕)󪍕$R2ƅ(ƅ,J(,,f0ƅ<@DžDJDž('Dž$ƅ|0RhQ`V!Y^ ?j!jAj.jj h1!#,4,0RPj#R (PW#RVh%hS膬 Ijj h1!#,4,0RPj$W WVh1$hS; 0E@8@}~P# $uJ< uuƄ$jj h1!#,4,0RPjW" SWVh~%hFP被 4be[^_]UVSPjjuVjjh&@tbud XtSjjVSjh&@u SY2hz&%SZYt PuU ^Zu S[ hz&%j1e[^]U EEE EEhEPOZYtEU 1ɉMEUhXEP%ZYtE1UWVS`NjEA w1h%w藎 ^ZuhA%w 褾ZYth&3蒾[^G,Vuh&3lZYt\tBJ@u xt@wHt4{4$t)tVP҉[Xt{4$1ҍ1ɉ9{4PS趽YZtXP,40S|ƒt/t#VRЉXZu\RY8pu`$uVP҉XZtً$9jjjjhSQRPx jjjjhSQRPx hm,%P h{4PPb+ hՂ"V h{4PV=+ W(R諻[XT`oa9lhGPP* h_SV* Ahm,%SO hwS* hՂ"S0 hwS* (uYh%V hVd* hwS) Phe%S^ à ƅG1ɋÅthyG"S$ZYu!Phe%j^ à uh5#SZYthu#SZYth%H$SкZYthM%S迺ZYthh"S论ZYtt hh% hhe%Vc) hSVT) ƅGw PVà {whV$jj9Z؍e[^_]UE1҉UMU ]UEEMU ]UWVSQ]} E10$hlj6S*u E%4jRHDjjSRǃu E18‰uE@WZڈEV$XEe[^_]UWVS E 1ɉ1D󫍕D1҃=n45-7„ h- 5-7kn4 Iuujj_AXZ1Ҁt,DžfDžDžd)Dž=v Dž1ۉ11119tD5fDŽ5DŽ5d)H5=fDŽ=DŽ=d)BC8[ty1t1DŽYfDŽDŽd)DŽBt1DŽWfDŽDŽd)DŽBhjjjjjjjjjRPj谛Ã4uDžhuhV$jJDžPS!tuiu5hjjjjjjjjjPj$ƃ4t@DžPV趐ZY^Hy V֛XS͛_u?t6hhPh-# {4-Džc=n4yun4Dž<1ۉn49i8511ɉ9=n4t9i85Ht4t(~SWYZoڋ d4{4ƀy1҉LPTXjSP" hCP{4"P" jShn4" 5{4,, 0$4(804$ u1҉DHPWHDFP${4()l,, 0$4(804 uȉ1DH$=n4 pH DH9jj h1!#RPjV jj h1!#{4$P@ RPjP _48t${4VHDPh%R {4$pvơ{4$0`RRVP{4Pjj:5Dž1ɉ$Pj行^_u65{4h^u1Z%$P1$Xu@Pn4P5{4 P.^{4$JZDH-1ۉ,048DHƂ({448<=n45 d4T_Ht4Y d4tu Ht4hW£ d4a1X@KyuƆy$tP,40W1$͋e[^_]UMw1vB ]UWVSDž1{4*)Ph%hS] i%t+he/^Sh%h訽 juehA%{4Ph 0%hS hA%ShS% ǃ((hA%ShjlE0pT11ۉR#YZtsE;klEX{41ɉ Ctʅtƃ{,tjjjRhRs8WPx {jjjRhQs8WPx jjjRhRs8WPxƅ,CP 1҃CL_cLuӟXZ=n4CLS<SRV菍ǃSRjj\ 1jjB6u$ &v=IC`,tPh%hVɘ Vh%Pӻ C`,tPh%hV莘 CXtPh%jWp WV3C\tPh%jWK WVSTz"t$t.#VPh%P1 CH@i%M%GCX,tS\tPh%hVΗ Vh%Pغ %i%h%P赺 XZ%o%h"%P蓺 _X.%w%h6%Pq Y^B%%:%{Tu"%PPC XZF%%d1]i%\%NKPQhR%hcǃ-1ɍP4Y1e[^_]á{4*;UWVS ƅh%Qhr"h#脊資Ph%j$=_4t"{4X荇SPh%5_4 u6hx_4Zt Ph% ^_jj 3Y[h%W*${4[^1҉D)kSPJBZY;PdVD P,P1 Vh.%W#TP,PA$T\L1PL9Phl"HPRZYHuuRS褏 Vi,TXhg1TRjPZ*Pn(P V'^P1ShE%W" PAVYkDlEXC uDED;rC,u{Pu C0u tCLtċC4jjjjhVs8PRx 1҉LtL{tCH1!#DžHG%#CP w$\&=11DžP $#"DžP%u# DžPi%hA%H藧ZY҃1!#uhLPn L%PLhc%Sy؃RPh}%W8!RPh%h%讄X11DžP.%11DžP%<@hA%HզZY@%h&hhd%T}t _4{41)Ph 0%hW, U{=UBP4 jjjjhWp8RQx U9h%Ń^u){4PhV$h豏jj)_h#wYth#Pjӂǃ y0{4PhV$h]jjv)KSWS19sktFZSXe[^_]US]4 19tVklCx,u9rDBP4 jjjjhh4p8RQx tjh4j[ t4]US]47 9r ][]b[]À=4tUjh4j 4 UWVS jjj 1iPYSPj  E uxZEi]M}EjhՂ"P uuuP tAE-DPtE쀼u؍F} tjuj  ukWXe[^_]UWVS}19t2klwFLt#UFhA%P,ZYUu NPy#C19tklGx,uHPC171u0kl_%{Tw%Phb"h_'%EP蝬 Ee[^_]US]1EPu 5YXt$UtthhRPmE]UWVS\1}󫍕EHt41҅ƅ&jP[_ 1} tE pSZYtbP,40S詶t;JPq2YtJG89wtfE@ ]BujR _ZE Ht411҅t $;] t t B܉tE3ÄhjjhhjjAjjjjh@-蕀4VP>v ExtSx u^~1;s}O19t }?;tBx(u PYFËEx uVZ&1ۋ;sx(u PXC1ۉ؍e[^_]UWVSu1ۀ~ tB~9s*ًx(u1;tB9uPXC͉Me[^_]e[^_]UWVSQ8ME111ۋE;Xs-E؋MMQrPEPL tu}CˉeY[^_]UEPE P0]UWVS}EjjjjhSuPRx u1=jjjjhVu WPx tVSh%he[^_]UE8b]UE+4Ƃ+4*4fP*4fP1]UEPE ]UE E EE]-US]+4)PCC0+4R C*4C*41C1]UWVSÉM1u1sNуtX 44tJ}󫹱:0u%1Ƀs1t0uAqt⹅*J EE띃}tB 2BB1EEZY[^_]UWVS1󫍵HEPE jhjjh6,jh5T44jj jPSj|Ã8VPlrS}1e[^_]UWVS<Ɖ׉1E1;S sMQRUSPL <]UBjluNZY1҅E1EEE;C M9MMQuSPL k}lE̋UЉQE܅t8tjPQ HL >_4EG8EċUȉGh}jh%*h~Vh$V,5m43hx JjW5m4 hn&hn&hSjW5m4{(SZt PSV IVlVjh5m4M 5m45m4:jjh%פÃ(xj VPES蟥e[^_]UWVS։ϋ1׋B˃1t.0uKB1t" 44 44ȍYu1[^_]U1ҋE ]U1ɺE ]UWVS ]ju ^_jdu h"%P u h 0%W 19tNi sQWV" uΊa<w ~[BjjP|ǃ :1ɉPhd@WĂ u u WZ`RhedAW薂W`9< RFaPu h"%Wk jjW蕢ǃF s9"hh"4WY@u W Xjh-%h"4V u܁="4usjOh"4Pgƅ_ OusƄW薢u hN$%sl CRPh1$PS $1u2jau hN$%s- CPP4t CtC @C wF-1e[^_]UWVSEEuu&& &*41&ƃ 44@&u1 44@9uP44j@{h44j4{d44j({`44j{\44j{ƣX44=d44W>Ëh44$U+9s}Ë`44RUZ9s}Ë\44RUY9s}VZ9rVh1!#h%jj"x T44EEe[^_]tU|EPu` XY1uE%;E Uh@uÀ=n4tuUhn4h3%j5 t1Tu4h@d4hO%h_'%hh`t4ww hc4hO%h_'%hh`k4Yw (h`t4sZ1Uhu.UQ *4 *4u0EEE jjEPh*4jEPK*4*4USh$TzhJzjj\G h$hh$hhX%j S SXZ]UVSP]u EPVEP E u Vhl%j SSPh%jƘue[^]UPEEPjeEZYtM`u4CZghb4Ph_'%hh`t4u ;ghb4Ph_'%hh`k4u (1US 8PhA%n [X1u?9t3h0!"S‰ZY¸thS$S誉ZY]U ZE\URuhb4PVSuhU%j"¸$KEtVSc V|à E)ËE9th%h`&h h%Ee[^_]UWVS EUˋujQEY_tG UR#kuSPQÃtPES XZEEe[^_] e[^_]USj$uTZYtD1ۉ]XEPjhjjj EPS诳U Vt;M rj$S뱋]UEPM UXUEPM UXUWVS 1҉<P&jƅPh%V< t#hjh%h%j %!hjh%h%j &%Ph`}4a Wj&V  Hvw=4uj輒_1|-Dž`-Džjhh$jPj(Uu1 h`}4h`-Wݢ 1!#=|-u.h]-h$zZY1!#u={-u %WVRh1%h谈VS` =4uj̑XDžjhh$0iWj'T-=u4+=`4=`}4hJ%WB` W h`}4Wh_'%S Wh`4hu4h^%jڇ$VSh$%jWh_%j讇Wg VS_ Y^DžWj)SXZX=n4tZ=u4tQ=`}4tHhJ%Wy_ W h`}4Wh_'%SC Whn4hu4hx%2;e[^_]USڸstjSZuWU2ЉXt0t0}4haujPjP_SV t,}4uQX} tExuh%j老Y_}tuSh%heǃShH%hNǃ VB V7XZt-t4}4ShV$hajj@=`u4t=@t4tShl%j E@ 44t 8}4e[^_]UVS]u Stt uhr%OXr%A%2u|%jjPVSe[^]UWVShhO%on4_Zt Ph%h [^(}411۸ -P/t 8t 44u uA؄t (}4Dž -{54}4/z;i 44\,}4u1uSZYH0,}454}4j5-7蒆5-7=5-7=3<}48}4P5(}4h%ja_1`u4Pj wKtu 44<}4uf<}4ƅ1N1tσ0u@/u(Ht!ȿ1 44uƇ 44Bƅ뼀t/<}4'tju ^_ 44t8}4(}4u9uh_j臚 0VR5,}45<}450}4Ph%h^ jjY[}u%,44h%j}XZ/44tkh%h}^_Hu%h+^jY[th%j}XZh2%j}h^%jw},44,44hA%LRP urhz%hLxRP uT|9u;xt8h%h%1Q^_th%j|h%h%M迴\[Oth%jT|Y[ju XZ1e[^_]UWVS-{t0u1#W3+PYZtWhV$h\ ك1ujhXZe[^_]UWVS1h%'KPhV$P_| ytQP[Hh%JPhV$P)| xh%JPhV$P| y6륋tPSYuhV$h2[jjɨZxPNh O$] à t蚨XySPhr"WLYX1u|SPWuhV$h2)[jjBUh-#Ww YZuk$u t*WhV$V$ ShWR u<=uDžSOVOXZtz胁^_ulY[uNh/Zj_Zu@7[^t jh1jh2%ZY1X]RG؍e[^_]UWS]S 1E CM [_]Uu uUWVSSu] V 1EStitcklЉE1}9z4u@lM9ut@FjlPB‰FXYt*1}9{4ukl4 @lM9uܰ1e[^_]1UVS@]xu1EEEEu1EURURSЃ t1;EE}juuS:URVSPL uF;s rEtEȋỦEUEЋUԉEU؍e[^]UWVS]u 1V,ZtƍCڍe[^_]US]s es$]XZCE]LUWVS]1;3s8klCxdF@0 ttW X9sklS9zduBd@1;3s>klCx4uFtWXF 9sklS9z4uB4@s蹻XCEe[^_]馻UVSjhPjuWt)uu P2[ @uv0S|u0Z1 S}|Xe[^]UWS] 1Sh|duw t#S;S t%iSR3褷ZYt3X1e[_]Uu hzd@u)UVSujhPjV}t(ju jPVo+S{y !u01e[^]Uu hedAuUU EHJ Ju BP koEMt03t(Ŝt h1!#5T4h]%v躕tstZ~ tS4C8u%uh u hH_hPRߒY[P5T45dl4n41RPssfRP5T4%5dl4n41RPs$s fRP5T45T4hl%vҔ=Ŝ5dl4C S$CS n41SQRPfRP5T4몋P [uC( PGP5T4[u CH@L؃PGP5T4[uCH@LPGP5T4ayuCHpX5T4yuCHp\5T45T4hz%lmCHP`u&h GP5T45T4hc%v袓OEERh%jPD hFURjPà P5T45T4hc%vWSѫkfx5T45T4h%v%CH@Hth%v XZCH@Hth%vY_CH@Hth%vܒXZCH@Hth%vĒY_CH@Hth%v謒XZCH@H th%v蔒Y_CH@H@th%v|XZCH@HE %FEe[^_]Tlu%CHP5T45T4hc%v,I+{jPMQKQWsPRdk B(0]EMQP5T4hc%v0e[^_]UWVS] Ep+sk H(L9t[Iw`hWKQVsRPdhWWjjjj@(4I8WVsPRp VsRPh 1e[^_]UVSu hSP t*hSSjjjjhH SPXZ1e[^]UWVSu jFHP]S jSSjjjjj HH-E܃,11t]DS@uu@tA^Ht҈Uth`#WUZYUu CcL'/t C/jWjWSx FHHL1e[^_]UVS u vDh%j ]S@ j SSjjjjhG0SFDVHB`1e[^]UWVS jj%̣[^9hBC \hBCC\hBC C,\ E1҅tuB &tME4}GF \u/UDEjh誌MEZYU}B}$w"uuh=BF \X}$th%h@&hh%[jjjjhg\hjj jjj%SjM8ƃ4xu Pd.V9Se[^_]UWVSQE @4uE x8u-u uxXZttt =t ujj +^_x 1҉j4&U艋G T^UBXYu؍{shAh ACh@C h@ǃmjjjjh]hjjjjj SjM7ƃDxu P0-Vp8S躥1e[^_]UWVS] ;G(S119tuklKI0΃@jj h1!#GOOgRPj!W+` jj h1!# A1҉SQыcRPj'P_ 8uth?jPPV輿 E@ tP?jPPVi 1!#u h?Xp~?0m?'QWMQVRPpjjAdl4,jB:?SPh1$j -P< dl4jC?SPh1$j :P< dl40j->SPh1$j GPu< jD>h> OYÃsU4OZ£U4~ް-T1~CVƄ5T -߉TPh%jPh`U4; j.3>h`U4P5U45U4GP:P-PhC%hhT4; Dh$CXe[^_]UWVS] {4$DV%Y_TV$ C8@@8 QPVRL oB r0󥋅PHDž 1jjjjRPRPjPQ0Hug $(,Dž<Dž@jjjP84P@L PT} j jjh2eh`jj7jjjjF)ƃ4PVFV)E)PB89B4<蔓ZPufLW WPF8PP8 WRPQLP $A `dhdl4l`PjhXPVq (hSVb S赆w 0P`Tddl4hjRV!`SjP01Dx tjS)!SjPXǃ1ۃ tjT !`RjP2ÃjU `RjPƃtHt&PPSW0h%LPgA bPW0h%LPIA Dt%PPS0h%LP A P0h%LPA 0[WUSOVIn4X1\1(9,Dž} p1ۋ n41RP,(=>RPhv#jpP< t";tLSh%HP7@  LHjSjjFj jH#H 9LtPS^SpP 1ZY8:'@<`~m tҋNA4jjjjhVq8PSx 5--4@&h%hSd WVSh%j'(WlYh%jXZe[^_]UWVS|jP,_Zx-ǍxPWY^x t W-ZghVWO, =uW_-Xf}u1fIҁ󤉃EfǃU1e[^_]UShEdjjEP]Sh(%i @t2hz$SmZYu Y4h;%SSZYuY4]U E]UWVS41ɉMԉM؉Mܡ{4f([{4$u|jjjPUPÃu1{4jjHDjjPtϋ{4$KC19};DH} DH{4$}ЃEȃ=Y4uajj]Sjjh-y1uaY4Zuh-h@%m ^_jjSPjh-T1ۉ]Y4u9}MkT UWuZYÅt FuMŨup{4840h%hGEPEPEPuzCxtuuuh%h;15Y4EPEPEPu3C~Y4wL3Mh,hV CSEȉUjheRPPusss shQ%h(hMĉ Y4hY4j,C Y4u/EEԋEE؋EE܅t+EPEPEPuAPUԋPU؋@ Eܡ{4$tuuuR{4,jhP{4$tIytCf(u9PH[Ht'{4$P{41҉$Yhh^X]9_~GL Y4AEȾe1Puqqq qShO%h|EX$뱍EPj-EZYDY4DY4se[^_]酃UWVS5Y4t/uujPu Sgthj_XZe[^_]UVSE X(uNpƋ0VPsjh Sà uh}jj ؍e[^]ðUE1Ҁ=Y4t]]UE} t=Y4t[1]U h^% hj%j!EjjEPEPjh- $@tEU th%j XZøøUWVS,uEE1n4n4uFVEUFVEUURURVЃ tԋ Y4EUA {4;\`|.}t1hjn[_uCP@^N t9Ӊ}ډȉn4n4 n4 n4EEЋEE̋E E11}E,E1ɉMԊ MˀuMJ}uE9tEԋMu}t>MJ}u29Mu-*}tMJ}u 9Mu }ˀuGE }$vE0EDr%=uu r% = uuS% = t;}yhjˏYZ|tTY4t&@t 9t9Y4t@u%}*h4j蟏YZ-OOBOu5(O~% E tSE (%~ v$ t%~ v t  %% E uW%E fUu)8t$EU {4;\`|ˀ}t4U uWNE (}uƒ ҅u uuth hhXjbZuWhV$h %V膎e[^_]UWS0]}ȹ 1E1EEE =Y4ujjS@ jP4E܍EPjSm@e[_]UWVSM 1{4f(uD11uFu@uGN t Ƅ[^_]1US0]U t/MQRSPL tsuuh, %j]UWVS4}=Y4PklUVE 0]]ZYE UlVSClPW11CC,C0CLCPCT {4$F( t1;~ sJURWVPL t5E؋K,9u+C0 C0E̋UЉSEċUȉC"%h;tF@U1e[^]Uhh/"%h UWVSH]@1u -1[eu1ɉ n4h4jP3L YS`ZtItC"F;ue~D}4$-(Z4tPKXXthZ"%h(Z4j PhP"%h(Z4jk(Z48-(th"%Wj? VPh"%Wj5_4tW$Wh"%V V_[wVWL-<VpWL-7YPQZt C8C9h@e4h@f4h4, 1-Ct@t!1C F |uʃ5-7_Vjj5-7M|5-7P5-7:VhJjjhhƻj&jFjjjPjÃLPSS e[^_]UWVSQƉh#%whr"P uA=_4th#%RPh#%5_4I h#%4Ph#%2j /OuPh<#%Phn#%X _XVh#%S Sm K]th#%h#%SjXh#%Ph#%Sjh#%P=_4ZYtuVh#%P 5_4Xujh4"V脔 VUX1e[^_]U1ҋE]UE]UE@d]UWVS$E}Ѝ}1ɉM] u]u]܉uu9uu~ u >}}w1] 1ۉMԉ]M]x(Ã}t*3M 3] uM ]M]U9uU9u y;u U| 9u܋U}U;U UU|WU9U܋U]|G9u9uǀǀH vIH uԋ}p x$]C 1҉EE$[^_]á4"UWVSLEԉUȉM]E EUE}ԋwu}9UM}։lj]19؋]| E1ɉM;EE}HuuWV  t4EUuuWV );uE}u}]ԋEUCSEU1҉ŰEUEU]9]E9ƉMEEEU)EUEE1EЋM9M#} E؀x @11ӉM܉]3M 3]$M]] ]9u܋]9ƉE9ƉUE9EEM܋]Ή߸;EE#EUuuWV{ );uE}u}E9Ɖ]w)]9؉ы]}EUEЃEE9EE]|Eȉ0xEUAQ EE̋EU׸;EE3u}uuWV);uE u}E̍e[^_]UWVSEU }}u}M] M]M$](M]M,]0M ]$M]M]M]M]u} M[^_]USQMAQRPRPjjjjU} IuEU11ҍeY[]UE]US]sh#%j ]]OUWVS]} j/Wc ZYƃti)PCDPW ƒuNV`~EJ9s4t'19ty u9t@e[^_]Uju EDPUEvPEDPu i UVS]=4u 4K$9C |`549s sUjjjjRPRPU t39r,1tu{(u t @9|1e[^]UWVSU}119y u 9;] u}t uz(tt}h}[nЃu"9uǂǂ1J Z$1ɉƀJ C@]t#%1e[^_]UWVSU@11B z(tBBB B fǂ[^_]UVS@Z41ۃ<&t9jS2FFXZSF w&ӉӉƃ"ue[^]Ã=HZ4uUZ4]øZ4UWVSUu}E EE9E sX11ۀy u9t 9] tC9] r8@9E}tMa}w}uWrVg 0}t.1HR}t PRhI$%PRhN$%WVu R}t PRh"%PRh'%ԍe[^_]US]uh\E%h&hhS$% sKX]]KUWVSÃ=HZ4uj@Z4u1<@Z41@"t 9u& 4419tp4x(9uB1[^_]UWVSu =4u "4E1҉U19~\UE]FPwu"u ~tu Ex(u}t!C;4GUfˉ}FFN(1tF$1Ft 8tjPkMPd kMƄF uF }thzUXEEe[^_]UE0U U]UWVS]u=HZ4uw1E1M9bz u :D;E +}ߋE싃E苃E}t }u{(u1+FV C S$FF^N(1tF$1F,MPFtk9t jPRzc F tV"}uM9MuǃǃFt$9th$%h&hdhS$%F t'u@K 9M sM 9rE1e[^_]US]=HZ4u!w k @Z4"1;4s k44C([]US]=HZ4uS1w~&E[]UWVSSÉU=HZ4ud!v=4 41k @Z4B9tp4;u(}u1BRQCZYt룄44k44B4V 1Sh%jRUe F hr~ SPhgp%jWE F'F(UV,~0F((e[^_]UWVSu]=HZ4uw1E1M91z u :;E  1}1CC1C CkEt CЉSMS K(щS$MPS,U{}ut 9u 9UuKT9u9UutK }u~(uۃ}uՃ~(tτu˃K @N 9M sM 9r E1ZY[^_]U1ҋE ]USR] j EPu U:tt hsX1 R]UWVS0]C{Tuh$%h&h{Xuh$%h&hhS$%{\uh%%h&h߃{`uh%%h&hȃ{duh9%%h&hjCDPV_ u hS%%VX XZ{4uD1ttʋ5-DNuT4@׀{4ujhJk"C4Pi ؊LD tB:u JN Ph\%%W] hr"W< ƃiWhn%%j3jPh}%%V!jsXs\s`h%%V j,Psdh%%VisTh%%Vi19aW 4&PwP7Ph%%ViG P u"OQPW RPh%%VaiH9~h%%h"V:iZYZh%jiV PPVh%%h &%j Ã(V*Xe[^_]UWVSÃ=4u 4{s1ɸ9|,@89@|1ҁ{v@1҉[^_]UWVSE Eu}hj<[ZtAǀǀjhPju!@uS AY1RC,PhedA x0u<;|1ҋ9Ћ}S@XZ뙅~1E un CCCs {$s{ECTCd_19G t C <u:?C <yG1ɉPPPG1RP1tA8thtjjhjjjAjjjRVh踼E4URP[u虽V*}51Dž<Dž@;us<`RVSPL t$hl`d<@FjH &4A Y^s1҉8,0$(8;HD8ȋ0`WpVRLW6uVS jj@<0,EU+,0RPjPPS,PTEUjVS4Q 8 tIVPSRL$(u}u} 0,WV )׉<@8ڋE"C t @]fCEf@ DP:Xe[^_]UWVSEMt]X$[ EXUjS2$EZYtI-Ut#E@$19tD BMNju1ۋE Ee[^_]UWVS] Ep+s8k H(L9tWIw\hWKQVs4RPdhWWjjjj@(48WVs4PRp Vs4RPh 1e[^_]UWVS0] K4Uus 0RQPVL Utss ssuu3ҥC S1e[^_]UWVS0] K4Uus 0RQPVL Utss3CSuuPR|EU+CS;C {}C S1e[^_]UWVSDÉUEE1uu11;{ sGMQWSPL t2EԨt+M؃9u#F}y tEċUȉEUE̋UЉEUG봅u*}pƋ0VPjhKNtY}yS}ttURURSЃ u1pƋ0VPjhVS1RYt }WSЉXZe[^_]UWVSPu\hP1҉UU:ÍU.WVhT%jjjMQR9|ڃRjjh&%1e[^_]UWVSl}1E EEURj`-1[_|ËEPRHEU{4PLEUYE9ƋE|EEE 1}EjP4E̋MEjjuuuun41ҋ}9=n4׋u}EURPjEPQEƒ01EUEUEUEUhjjhh.hj6jjjuSj莵ƃ4u S#ZkEPV$VdS#}u#EMQ]SP @u uXUEEP tB]fCe[^_]UVSR] 1ɉMS4t&uVRP u uXfC<1e[^]UWVS] E@fHPR0_usCthpW= ƅhWWjjjjp t%RWP@ZYuX붉Ɖse[^_]UWVSLu}1E EVUEURj-CY[tUÍ}UE;P s WRPQL hjjhh.hj6jjjuSj}4uS!ZwURPE EPJS!}u*UE;P s]SWRPu uX1}t UnEx fFe[^_]UWVST]SSPHEU{4PLEUZY1}9M|EE1E}u{3jjuuuukMeRPjEPS,HEUEĉUȃ}uuujP8E؃ jURS @tQEM;M qku0}u jjuuuuuujURSЃ,Hu1~Uع1EUEĉUȋEUẺUЋz!EjR4E؋juVStVPSRLƃ txtjuuSe[^_]UWVS|]{4tf(ttuh&%h&hh&%xF5n4t\U^4hjjhhhRjFjjjuPh ]4蕰ƃ45^4Y20蜹Ep菹|7肹xwtjj h1!#jh0jURX,jj h1!#jhjMQ:MQURW|xu{4PjhN@h$${4$0E{4$pӸEEEEEU׉ u11MQMQSЃ UtEfEE?EĹf@ @ N@f@@_=4w@ f@*@,phtjjjjjjjjjQRḫǃ4t P螮@,EPW^W螯Et11!UMQWSPL UuG;{ r"E EtEuEȅtօt1h\jHY_u_4zPh'% SIZujhQ_XO:jS[^Jsjhse{4@u ǀ@>U1]1EEPVXZ}y1Q1҉u1Hùxt%| q1@ 4S .|GEE;xrB;Us E11ۃ}t E;]sP,C_PYV躭5^4XZ}e[^_]UWVS0EDž}uEk4jS9ZYt jS%^_upY15jS_ZuI>[^ƅ1;44} tE 9[uE(u)tMQRYu';s{Љ E, UHD9Ɖ}djj h1!# WVjWhoƃ 3WVPh8'%V 3 VY ƅ3³PY XZ00@ _w%tDž111=u%hmjj h1!#E,}H,DRPjVE$hn躲RjPESYƉ<$T2 ‰$SP赪 S[Xf S蘪 $zf <$Sw W<V[9r$hC'%h&hh&%luZ1hjjjjjjjjjP菨Ã4tPS+_X19s <19t4@YڅttVdZXMB tSXe[^_]UWVSljfDžv/ƅujhF%RY^yhhF%S0 y賟t&誟8t蠟WPh_'%hS. hWSw0 =Džp!j/SGe _Zt-xv9tH9s8/t@Q^7 YyߍxPWBYZ%=pu>hQW iƄ/u%語QPhT%hS2 %hQSx/ =@uW6 ZuhWPB/ =hSx} Y_1Ҁ;/u 1Ҁ{‰hSFp<$2ZlhЃpDl=w4uhhA%Ss/ =whWS]/ =v O?V _y 7VY#V ZVX1e[^_]USÍEPS+@YZx7Et.jSXZxj `PS- t S?Y1$S4`Z=vf u]UWVSEUP7 ^ƃ}t11ɉMV( Zt{fx vX jh(%SQ uSuh_'%EP @u he[#& 3Et}tESWuhV'%j>u-[zV XEEe[^_]Ujh)GjA UWVS he'%011tY+ڸn'%xuڸy'%wu#WSx>XZuWSd>Y^1yahy'%轛hPS6, WS>1u h'%藛PSh'%j?Sh'%j7hS>>ht'%ShPP+ WPQ>u'h'%SϚPPh'%jh'%hPS}+ Sh%jtPh'%h'%j}uhf'%SZhPW(+ h'%S=PWh'%j@,h'%S!hPW* h'%S PWh'%j ,hf'%SPh'%jMh%S˙Ph'%j*h'%hPW}* h'%S蒙PWh'%j(he'%ʙhPWC* hf'%SXyth'%S9 Ph'%j: h'%ohPW) h'%Sp14 -Ph_'%hWT vtpWh'%jC utjh*=DXZte[^_]UE^4fP]USE@k &t!&ShWE 0C^4 ]UWVShƍPhW@jҭ@1jh(%;_ZRhW@P艭 11!tVk &&u Dž"BVP/ZYu=^4DŽ~Gjjjjhljjjjjj!ShޞÃ4tjPSsS賟*Xe[^_]U迖^4tPPRRRh(%jUE 1҉P1]UE @1]UE @1]UE @1]UE @1]UWVS$pxЉ11)ӡn41RPSQRPhv#j]S衤 ]Сdl4EԃЃ7PURjP:jPPh ^4& S  e[^_]UWVSĀE@kl} GNjE @u FuG u G08uw0WEU1EEPj גXZ}E MQw8P uEP^G81ۉ]E ];Xwk]lE X{8tIC] su19Mtklu ^c0AO0u uu ]u]u tu9]}UEG0uW+EUu FV}t ]U]EUWE <1e[^_]UWVSd} E@9E Ek] lEpF0tjPPV& h"j*!URjP3h$dl4j-SPh1$jF^S} j.ߝ h&PShd+%hh^4X e[^_]UWVS8Ë@H1{$C$EsCM19tklD>0 tfA A  B}lj&fG G5GG G,G01G8@Ep x$+s{ 1ɉMM;H s%MQuPRL t Euu}EыK19tklSB0u+2z@s{`S(xE+C$PREpxP@EUn4n419| EU)AQ1&Wv @u1]{]4VNUMEP$@ EU]9]s#kElx8uyP@P b]9]r,1]9؋]|ZEM]+HX M]11~8u(V] ]9E]|V1]9؋]}yV9E]}jM9MsWM]+EUuuSQCUUMNk]lUMʋUeʉT EUVEM]+HX M]11ҋ]9]sV]9]s kul7T7]9]s kulD7T7 M])ӉM]19Mt1E9t$E9t8uW t G0u)EUAlʋ}9}}y{9к 9ʺsbkEl}GËSEUu}+u}uuWV蝮)9uE}u}u}EU)SE};xM] uuSQ訯ы}ϋUʉӉ]u9ދ}|}9׋u}ȋU}MOQ)EUE@EE}EpxPEU19]EUC<S@9Ɖ|]C0EU9ƉE@9Erk9EkElU‰UM]) Z19ʉ|EXH 9|1ɋEHE0xP0tqP0EH0bEUӋEU)uuSQGыU2zk]lu΋Uʋ}TE0xEPuFV e[^_]UWVS@PEU 8PpP4x_j0PpN4[^uLt4Ee[^_] PPRHHLY@@ @O9O$u;Gu1҉$(HL$(4DžD1,HLP@9,k,lPGP0Dut ,Du|0xH8t5@t@(SQPRLP@ D0u+s{ 19}2LHWV:)$(,0)9D@P$@ 0+$(P+GW kDlO,ϋ _$(19}lSPh ,%v˸e[^_]UWVSuE ]ƅo$&h khPW hh%W S0pz t7z(u1hhz&%W_ hRWM ,9u|h!pkhPWO hh%W S0pz t7z(t1hhz&%W hRW ,9uWhV$v茷 [[$h":[ h#0[h$&[h%[h&[h'[ h(jSPh/,%v/e[^_]Ã=`4UWVS11ɉ4P;ZG418t=suB89J4ƅƅs@14k8ƒ|<tcPh6,%jP4PhQ,%hhhl,%Ro h4PRV G8u4D(~&Pht,%hWf hWV 4D,~&Ph{,%hWf hWV 4D0~&Ph,%hWf hWV P4؃PVh,%h1Dž884kt1;8 8tuÃuT4B1LVI$$?c)((@6,,A 1ɉ Ph#jST jSSjjjjW=[0Sɒ ZS躒 Xe[^_]UWVS(]}h`#uVO _4XYu81ɉU`&MVPgZYU9‹M}ƒ$uӃ_4} E $&h3RV Wtjj5V_h4ku2n41RP tRPhv#jEPS h5&tjjUYh6u)tjjUZPhV$jEP*S h7t"u h#jEPR h8t"u$h#jEPR h9bt"u(h#jEPR h:0t"u,h#jEP\R h;TVP_4PhV%s=e[^_]UWVSX1ɉt @@_4Ht4t=$txuP1$Xytƃyjhl-%趬_X=`44|uÐ Dž814ktƒ8B1;8 8.T8 RPh_'%hWQ 5Ht41҅t8t%FWP5eZYu Ɔyԋą d4ƀy1LPTXƀ);4ǀ,ǀ<jWP hW d4"P =Ht4u/ d41҉Ht4h" d4aljY t_Ht4tByu/Ht49uHt4ы9u􋐀뺃G5Ht44@k<Љǹ1󫋅PB osC )t C8$tC81$u19;x sۍRPPL tO@j$xustj_CBk<y׹󫋅PB o$CsC C8RPL u;H ruكtЋSO_Wk<<󫋅PB oCsC C8b]1fD @9s=$}4t1&󥍅Pg^&󥍅P6[=`4tcDž DžDž41҉&󥍅PY= }4t1&󥍅PX1B 6cTB 3l_4yFHfGe[^_]UU J E]UWVS0EЉUĉ1ۋ9}qGE̋GE11ҋũ<tw9tMBu9uSuh(T%jEPJ 5Ht4tFURP_YZtEЉChjXZe[^_]UWVSC GPZYtcOTt[8jjjjhRQPWx 4؋QP :jjjjjPqTRPx PhI#V] 0)h-%V<_X1 4k,<PXQ0PRRB GPZYtcOTt[8jjjjhRQPWx 4؋QP :jjjjjPqTRPx PhI#Vq 0) 4p$p pph-%V=h-%V2 h%j#V? jj< 4tPh .%h+i uq 4tyVPh.%hiuK 4th4.%hh u, 4thG.%hh u 4DpC1e[^_]1US]1{u4{ t; |1C4`v"{x[]Ã=d48UWVS`1Dž11Џ4P~Y5Ht471ɉ$;H QPRL t tt߀8tPR? RX /thA%R{XZЏ4 QR( ZY9st6t-Q4XZ"XY99}tt$;H s41VWD Џ4$Vh_'%hPC 5Џ41!#t%"PPZ> XZtЏ4PtYVPh'%heЏ488  RPVh`.%he$tt;,($ PRPh.%hue$!PRPh.%hReu&Џ4@40|81e[^_]1US]1{u&{@u1Cԏ4$ {x[]UWVS_4Ht4xtt$u ƃxaPYt0$xtEjjjRt1PZu#_4tSh.%PF pÅt_4tSh.%1=$}4'04P_04p41:uJ Jt @ =u_k 4]ȋủ44BMȋu1k 94u94u94t Bu1҉444e[^]UVSMU194u4r94u;t = u1[^]UWVSGDžHt41|?1$%$;p WVPRL } t} t!} tWVS jVSSx k|<$tjjjjjtVRPx|ǹx󫋅tfDŽDŽd)| Fhtjjjjjj |}@Pjj|Ph0Ã4u1}?PS%S0 |9ṣ_4k<}Ee[^_]US<] EjP_4ZxD1k8|<u$MȉHHt4t5xt$h_Z0jY^tjjXZǃ=_4؍e[^_]UU=h4tuh0%jPO UVSuu1r$ugjjjVyÃtjjHDjjFPt${4KS;DH} DHe[^]UEx8th}#h8&hm h0%G@UWVSQ} E@E19u~aEX=ru8u?G8.=qu8u/Gx=luWsZ$tfc fK F뚍e[^_]UWVS0uA_Í}Ĺ 1S^uċ$G$zuubPrYtWWZtNjE@ u WV_XWPVD tjVSE@ t VPZYVXjjSƃx_4 e[^_]UWVS] uUYP}Ĺ 1󫃽PuPZt苅P$V_xt2jjjVǃtVYt P$VPHHLd 1Zw j4&RjP8x u0h}#hD&h h0%SER1t4Q,1t9E t @11tt:[]UVSQMp@19|hR1%h@&hh0%19ù|@89¹}@1ۉȉڍeY[^]UVS]1C49C s6SrY;C K$}%jjjjRPRPU Ɖe[^]Ã=_4uUhfXUS]=_4u1;_4s k<_4[]Ã=_4uU_4]á_4UWVSSÃ=_4ut=;t6_45_419t$USF P(ZYF<ɋUuG1ۉ؍e[^_]UWVSSÉ։M}hg1%Rw(ZYuj ju#XC,S0hn1%VO(Y_uj juWC4S8ht1%V'(_Zu0j(uWY^ƅj)PC_ZFhz1%V'ZYuEh1%V'Y_u j(uh1%V'_Zuj`u@S觕 Oh1%V'Y^u>hb3#EP~ XZt(@&>ttVPT'YZuG C<e[^_]USPQRh1%EPj3~-h"u:JEjhx&P蝹 t2u)z[1Eh-#EP XY:tjME+[h"jIEZYuuyX]UWVS1jhPjEpZÍPhd@SQ @S:EP,[1Dž Džƅ ƅ tfÃuCt=ut2Ѓ  uuЃ A떋Ex@uS@4tPh1%P ƅEpPh1%j3t1EE@@Ep0Et(pv0v,h1%jo3V]x1ɉH0X,t(Eps8s4s0s,h1%j3vE@61C,S0Vщ‹VZ*H{09L;C, P{89T;C4 PCP ^_;t' Ps0s,h2%jU2s@\PV#ZYt$Vs0s,h+2%j2q{ VSS$zuh%h(&hh0%(e[^]USEP]S2XZ1}u#]UVSu EP]SuG1 tEHwv}t1e[^]UWVSÃ=_4uet<;t5=_45_419t#UuSv ZYtރuJtjaYj jVG t*t t/j jVfGKj jVNG u7thhz&%PD hVP/   h#V ZYuDG8PW<G4&h#VZYu)+h#V}ZYu)j h&VԨ t򉕨hjd^Xۋu05iY19ȋWi[j`RC@Pك C,S0C4S8 u+t)CQ RPlYZuƅu_, G 1E u7 G1ɉOOO_O _$UWG@jhRjPHƋ_,tjP4tKRPPs0s,VFt'8t"P螨 PXZ@8u ǃC4S8)G W$q1ɉSh|dV iR^ZugYSh|dV u܋1;s̋G,tpH,9H0u0;u"H49H8u;t밉jSPD BuV'Z1e[^_]Uc@}4t 1=h4]USÉIQHQH QH QH QH QH QHQHQHQ0h#RSQ ]UWVSEUPUfPfUP Uf@fEExstExl]uq>1ۍujVk&W uu wu6 uRCu1jSk&VВ u%u vu uًU EGue[^_]UWVSu] t>u1}WEPEPEPEPEPEPEPEPEPEPEPh#V:4 u}w1M9Mt ]K1ߋH X$9} 1҉P P$ )H X$EE}Uz=tVwAtLw"Q w=RX<Á@1HøUWVS։M11ۉ9uuRjSP07Gуt `d1ɉMMu]썜SjuRVPEЃc}t09tGE}t"MM슌 MtMuʋ0tt9tGEC01e[^_]UU 1tEMh]UEUUU ]UMEPЃ< u1tE0]UE1҉UFU ]U EEEEEEEPU EXUWVS]xu,P4x1p3?J} @0P4x1p3?J} P PH1ҋuVi13k?] 319[^_]UWVS u]}1u܉]EP/U sZu tX3%PEUEԉU؋}uM9u džN,t1uuuuQt1e[^_]ÍL$qUWVSQhy}y}y }E1EEPEPEPMȋUEaE )EЙ]u)։]u]uEEEPEPEPMԋUE Eܙ]u)։]u]uẺEuE}ƉeE؉U׉֋Ue)ӉM]]ȋuԉMʋEeƉωؙMʋEE)׉ t/E Et'EPWVuuEE Eu}tE}}5E؋EؙRPuuEU{4DH~1ERPWVfuuRPVEE]ÉUӉыUe9E1EPEPEPMȉEp xKE=A}Ẻ}UeʋMЉ;U;EFuE=~]E}8E]1 9ZXeY[^_]aUE]UWVSQME܋A1҉UE؋E܃0EE1Ɋ t.}uÃt&<t" ,1ۅu9ut@u0Eu1ƒ< PWEpWMUE{11҅xE1ҍeY[^_]UWVS,U$}(E,u01ۉ]]]]]]1ɋ]9ً]| E1ɉM܋]]19U}U19E}E1EEU ẺUЋEHXE;E9ME0juQuMU]M MȉE@E1;EE }H1u}u uWV%)׉;u} M}EE)9s U)‰U1҉UM1ۋE1ҋ};}}܃}uu VN^ Eډƹ19 Ee[^_]UVSEP$9p |$1jjjjSQSQjURP>,1҉Ѝe[^]UWVSuMU ];k _(u/ȄtaB 19t Bu,1u.R E@M,9du 1dd[^_]UEUUUUUUEUUUR@U UEUUE1҉UP0UURU UEUUEUUP0UURSU ZUE1]US]MEE k B(u#1tAƒ<!Ѓ;ukE U1uQЃ<![]UEUUE1҉UUUR־U UWVSÉ΃8t2$41jVRq $Rh{dЀ3 jhPjR6@ue[^_]UEP0RPdUWVS]E EC0E1xp@u{4Lu䋀PE19uuE1tr}t[P,}u]9UuX}ts1t@u}WuSp yуtu G{0Ea;hh ZYohSLZYa }U׍e[^_]UWVSEX01҉U1Eߊt]}tttR<tNwtw A,<vy _4CFU,U9u _4@Ce[^]USE PMk K( : uBu'@ ;Et0j RkU P 1]UWVSUE}u NtGtRutG_tvpS GPh%vSx FD64t(vtvPSg e[^_]USR] =_4uj EPu ƒ =w uE8tt hJX1kD`4d4u]U U1vEEUEPU E7ZÅt*UVS14KFZuSKXe[^]UWVSQu>xp19|h/4%h&hxh3% ]9|@89@|ue[^_]UWVS0uU={4]ډ@E =~Mȉ\1ɉ`Uډ@8;FF| FP1RPz~ tjURjVPL tWEċUȉḾ1 u@dž9|Ӄ!lj! t9ȉ׃}vjhve[^_]UWVS]`t0`󫍓0 Se[^_]UWVS4E E th:3%h&hh3% hjNE^_ &ux CEUY~11ɉKKCSƉ׃s {$Cǃ?ǃjh>RP@ǃEPuO^_t!ẺEЉEԉEȉC1҉ ؍e[^_]US]=_4uF1Ҹ;_4s)=w9t kD4B1=w kD`4[]Ã=\4u ^X4UWVSƉ $41󫋅 EU RPVh,1%h4Px E jhPjV(xShydP @u VX1VjSu|b e[^_]UWVSlu] E EE$EEPSV EP ډzXE8t%E8hG4%h&h h3%w 1~,u3FuuuUM uxMQWPRL u GF,;x rËEċU9Uu;EuE̋M9Mu;EuՋF,MQMQuuuuWPRxà Y}w}t }t#1A}tPh 0%%uPu.a "}tPhc,%Ph%uu ؍e[^_]UWVS8Ɖ˹1jhPjV&1ɉDž11؉1u51 RPhS =|<ZbƋ!!ЉU u9tDXH!ƹDXfUtƒ<<„t <uh[0101ff=Ut f=u(Ћ,D1ɉNu1󫋽~wRXu[tO ttGEt%,MPP,1RW6P蚃 Px rt6t%F,dDž $t tW9,sAu1hj=^Zt1ɉF1*1҉X1u1fǃUe[^_]UVS0E E th:3%h&hh3% hj<^Xu1E u CEUY~11ɉKKCSǃ?ǃjh>RPT@ECǃ1҉K0SUE^@uS@hރ{ u_C$9S }NURjSPL t;M܅t4`4t,`41@=tD9u=uSXe[^]UWVSSMӅtY0uƀ1҉8,0)߅uU,)ƀX[^_]UWVSP}U] J3ȃ<tu&`t$[choXQ1EEJE,K1CB C 1CtqE1ƀEDtP?1҉TY}`t01`1ɉEǃ<t}tAu1ɉM1EE9`uƀ1҉vN09MuCt:Y4%29Mt΋0ukE00,09u/1O0t0uu 10M`0 e[^_]UWVS,É11@jhRPShyPhd@- @tۋf=tf=Uƀfu fǀf< 󥀼t!,;duB $u͋0u< 󥋅EE 1h1󫋅,t20t"uh}#h`&hh3%]  u/ƁƁƁƁƁƁ} }t~1É1uvB? ڈD>1É1uvB? ڈ49 fDžU1 uAWVhPx30J12XuWVz)׋1҉!!S9uE9u=H!؍S"S9ș[9-9!X؍e[^_]UWVS]Euh4%hl&h .1uEE}lj1Ʌuh%hl&hh3% s{u}Ɖ 9uE}QRuuuK0S[Puu e[^_]UWVSÉЋ{1Ҿ`4`4tBt D9u3{u}s{ u}u}u}v}t Lt4M1;})ωxMH PC u hk"kE UPn XZ܍e[^_]UWVSE }Ĺ }Put&`4u{}1ɉt`4t_`41 h4%hP&hh3%& D9t Gu]u1ۉ]]]]E1u)E4%}vuuE}t8tރtu݋M\Z]1ɉMZ1]u뼋u^0]M Mt3] ]tu$}rEdu uXM]M9M]uUMUMUMM9M]uP @x|EUx|EUE9}}}EE`ut.1EUEUE9EE}}ދ0Ή1}9}}U|s1EUEU,Mp1t1ptM9ȉЋM|/9t+E9EE|}E1hj0EZYEfǀUƀEEE1҉RPtphu9uu|H1+EUẺUЋE,ujPE}܃ t"49ttP4W|u 4Y_E0Z}w1u}RPWVb)׉E9Ɖ}ME,}ȋ})1ҋu}׉u}uĉ}ȋx|9E}}EU+EUẺUЋEujPE}܃ t"4t9tP3Wt 4XZ0}9ugucE,9EE}Ohj /Y_uEcLt4}},fǀUƀ0Ë0}00UMыE`E]}v& }v}b}X]puu;u}ʉUHX M]EEjREpRMUEEE1ҋ]9]ЋuEEM1ۉMĉ]ȉ$tuNEEE1҉UH1ډƉuuRP )׉}9ǃ}U1UĉEȋEċUȉEUEU1ҋM]M]9ȉ} +EUẺUЋEp0\EX}T>uuuE}܃ t3UŒED4Ut9tPd1W@r }UD4_XE\FhjjPX 1}?t;_uE@EuՋE1EE1ҊG9Bt<utE0E}tbExt99BEXEtكt&t!9B1ɉME}tX̋E돃E9\=,ujSE6}܃ 49P/Wp 4XZЍe[^_]UWVSL]E EEEuC,t)uC0EMċUw-:PX{,BC0EMċUHu1uĹ 1jjjj1RP1ҋ};}}EURPjEPS,tEUEĉUȋEUẺUED4jVSUE uaduVh&suuuus&C,u*E̋U19}'SjRPuus&C, X({,tˋC,tPC,e[^_]UWVSdE}Ĺ u^0]H`4`41@=D9u€t 1ۉ]1}t ߃tu‹};} uE@uǃt"9t}hR]QEEM1H1EUȉƉSQRP2)׉u9}1UĉE11҉uts;E @˃tuZ}`tMt;E ti@EMt˃tt9E tA@E}uы0Bp}t E5%E}U1ɉMEċUȉEU1u9E8ƒt<E`EUEUЉEUMEu49MEEE}tIMtƒt6<t2,AE1҉UI1M]‹E9‹EU}0n]уtt@uh}#h@&hT:u09EE}}h}[UUűEЉEuEEE,EE] E9sEjQEpuMUy}$ES5%]]1ɉM1҉]ĉUȋE19u֋M}ẺUЋEuuWME]E EE t];u ǀ]܅t'EDt9tP)Sj DXZEt uDEt ]TE9u/Eu;hjjP趦 E̋UЉEU1҉}ttBuh}#h0&hl8EM]M]։u1}9΋}})щ h3%` E}uEgEe[^_]UWVS]uh0%h&hk h3% Es0h9tSME M9u㋶0u͋EtP^C,t PY`11d4(FZus%(X]e[^_](UWVS}G,t PXjhPjwÃt7WjR`#YXtRVSV'SZWXe[^_]UWVS\E0hq_E0h#jP]SͿ jPSSj S Ǎ@^>w̋E0h#jP]S虿 jPSSj S ƍ@[=wʡ{4EHDEU}~ E1ɉMRWuu%SVRPމؙ9Uu9]tAˁ~ƉЋM\1҉`@EWVSuE E0E8e[^_]UWVS]E EEEEEܡ{404}81HDEU}~ E1E}u?9}/jh>uu=~?EEEUE܉0t}܉}UU}} ]e[^_]e[^_]UWVS ]{4480h%h}WuVEPS$xuuuh%hWVEPS>tuuuSЃS,e[^_]Ujj q j f j PUS P $1!#PShE6%h- j蕴 U=-u -4fPftPZ9-UWVEE왉U1E}ujEPjC e^_]U0E E1EԉE؉E܉EEEPEPuG ƒ xEÍL$qUWVSQ@@u5jh4O 44h4l444XZjPO h4l4x4|4+44_X49}944s74󥋅441=4uhSjjE(t!j$jjV =4u`h"P8 `4Y[tPhV$hPW xp4t419߭y<%ݝ݅ (%߭ٽf f٭۝٭y1d~dVho$)P=P襹 Nj4~-`4t P% Z)Å~:ùdh1!#)Sh&Pho$)P=P? ǃ119ʉst @u4&SQho$)P=P +44+ 4y @B8%ڽ߭ x4|419ظw ȉ߭X%s9ٽf f٭߽٭=ٽf f٭߽٭É 9ǿs tA؉ݝ4&%11d PVSho$)PP; p4t49ljx4|4)ލ 9lj݅99Ћ}ho$VQp à +h4l4߭߭ٽf f٭۝٭?~~ho$rtPh "VQʵ Ãhx&%VQ践 à <ЙRPho$)PP~ Ãuh")PPT à 4fPftSVP eY[^_]aUSE j7 X]UWVSPu ]Ett v9s 71;uuߋuE9s$;ut:GFFPh6F%jW襴 ؍e[^_]UWVSuE E1tpH-td:t_ tZUx}HM=-DWtDOt uxuZ 1!tjjEPj3  FCE덉뉉؍e[^_]UWVSujuZYt&Vu PnW9u 7؍e[^_]UVSu hurà @tuuSS6؍e[^]U|EPuG ZYtM EUQ1UWVSEE 0Vj S輩 DžuVjS誩 ƅtu)@))։NjE 0E8 uC t  Ȁ# Ȁ;uڊ t%\uB"u#u uB1ۉ؍e[^_]U <v }D&7Ep V: YƒwCljt)1E@EȉC,ub Ex txj,(Zu h&3XYǃ,f@S(P1.1;,s$k(рyus1(D@4u e[^_]UWVSSƉM׋ttU9t7{ t1 ufujuPn: t[뼃 S Vh/8%@2 e[^_]UVSÃHt1HL~t HXPx 1LXPt1PT~tM PYP> 1TZ`t1`d~t `XP 1dXt/tV9I,X 1҉Yt/tVI,X 1Xt/tVH,XY 1Xht/ltVH,lYh 1hZe[^]UVSTjjjVmD@PjVj48@t@сt t t48SVYkXZe[^]US]E ftPh&h7%/ jP2 t(@t h&l/YE u1҉U E]'Shd jP'#@uE &E8%] /]US]E ftPh&h7%. j|Pr t@ v|y 7`x |xYZt>1҉ShjV"@u;E &E8%]:.h&0.XE E]&]UVSĀptQPhhxVP@u hh&-XV ShZ8%- e[^]USË4%uXh8%S葔XZ{PtS0Ytp%tSLt|8%Ju +#PSFXZ]UWVSÉ׉΃t t%8%t1PS S)]jS@u8%tw#PSXZe[^_]UWVSÉ֋8 Ph8%,1ɺhXZu8%VS蕓Sjj$1ɉK 4%uj%XZe[^_]UWVSUM8tt^@@tR{ tGu}  t1҉CXZ[^_]USÃlt1u?hvPplPh8%E+RPdXZlu]Ãx tkUSË%u6S% Y u=uS$mZ S5.YuS&X]US]S謎Yuj#XZIpQpcvPh8%*j]#Shqjdj"]UVS]E ftPh|&h7%y* |)RxP uh|&-*X;|t xD8t|xqh8-萒 H 1tf @-yh8-j Ť Y^8-P8- Shd j@uDE |&E8%e[^]b)jXZu Ee[^]!e[^]UVSjh%ZYuh%h|#([^"VPp%ZY@u Vh8%(ZYSXe[^]UWVSPu~ % tVXtpE&%Et%`u VYE%@u$t+`u#V+Zu}V+Xt%e[^_]UWVSE48ځ` u %t8tf% tWYt ߉%@ tW+Zt 翉%` t떁1u ځ u@\e[^_]US]'%P'jj#jj#4]UVSS]4@tp%uft0t0VY%t1҃w&R Vh8%C&SvSZ%tw4&Vh8%&[^8%th9%'&j Shjp4u^%@tTS,1ɉMjEP,Z@u h&%Z,ǃ,Xe[^]UVS]hw"%48^u:t0t~ u h8%VsYXvjXZe[^] 48]e[^]5UWVSD]u Ctt,PCQPhj@EP|@uh&%EYE{ VEPW3 buVWh9%j$ {EtSj@VCxP# VWh)9%o$3.`U D@RWP_Cx3_UXZe[^_]UWVSÉMt0x11UjSZYUu 1{ K uRPQM3^UM   t*;xMu;0tQhA9%#11҉ZY^{ tHEU  Ѓ t3s Z@uhT&[#Xe[^_]UWV։ϋD@WVXZe^_]UWVS]%t S$&_u Shj9%"Y[ % ڋFEj EPju{ }PWh9%B"M1҉1;,sYk(jQMuz* Mt5j EPjQDPMAPuh9%! MQ}G럋 S2Z@uC Ph9%!Y_ t{ uS1%ZtScX{ tS肓_t>{ u8u %҃RSʠZY@uC Ph9%Z!Y_t { uS4Zt]e[^_]ze[^_]UWVS(]} uS5$ESɣẺ{Ls$S$ ({ }u }s uJS}Yt?Vh9%f SEScSj3XoE 9%]e[^_]jVh9%' h|8%ST11҉ 9C$u/S#Z@%[ 8E|&e[^_] jjS/"Sc#@u$ 8t h|&_1EE A]e[^_]!}{ tC uPh:%Ph#:%VY^{PtRStCQEЍ}ԉƉщUSVCtZU9uPEPu' t{ t811҉{ t411ɉh +#SSxDS5]e[^_]e[^_]US]C Pt*ZYts$sLP ]]/ UWVS];1{Ly)tC$tjjS 14%tutEC$u?tS!Y@u h8&9ZjjAS_ @u h8&X]e[^_]US]B][]3UWVSUMu { E9}E4W ZYtFE;E tE9{ umE;E u{ uV}tGh8:%SejjMUWVSS SSX/E9t(C jjMUXSM [ e[^_]UWVSS] 84%@tjE1҃ t6HjEP, @h&h8%_tm>hl%h~:%hT:%@t+XRD&AtxUhD:%hM:%hT:% UhD:%hd:%hT:% 1Uhl:%hv:%hT:%f 11h:%h:%hT:%At [h:%h:%hT:%<@@ulh:%5Y_jjj KPh:%)<4u544%u W4XZe[^_]USS]E uPh&h7% jEP,; uh&j*YuZ8t$h&h:%lj,,ǃ, _w$jPh&h;%j6U8tu h);%cYuvSRXZ]US]E U{ u)C щ‰B{ t][][]UWVS ]]} utSEt%XZu y w{ tC Ph>;%U;%1^_CStP }tQSS^[1pEPjEPuEuh &YASu$XZuܭ ~ WEtR$YXt3{ tC Ph^;%XZF$C$N>K>tmC**aFVtPMQV1FEtPV2VP~ u!Wht;%11ɉ/Y[ۃ} ~EPuu $ { tSZPHtJHPXEu}OuEPu ؍e[^_]UWVS]DžPPhhjA @uh &h;%1XZh;%Y^1hP萱F1׃ u Vh;%XZu 87t 8 tt Vh;%^_\XPSǃuh &h[ttlHp VW"ZYu VjS ϋFVt=PVF Pt!ZYt%Vhnjj 7u7W1FtPV2VP~ t11ɉhVh\W6tPtS!tPS e[^_]US]E ftPh&h7%W SѡZ@u:f 87u ]]P 8 tF 8VtE&]]UWVSD}U uMtNˉUMPVcZYUtOMv_ 7 }E &Ek"e[^_]G(1f9u2W>G(1f9uW>uxG(f9t& tʉUQPG Ph;%UfW(W>8uHUPVG*P0  Utn uG>j u G>T tGjt G*ˉe[^_]UWVS,}E EЋEE܋EE؋hX<%S蠚 ^ZuEE b<%+hi<%S ZYu,EЋ@0SǙ ^@E] EЉEe[^_]hy<%SB ZYEh<%S* [^u EЃHo1E9}E4_ Y\FSEZE1ҋE9}?E؋ UQM' Ɖ$MQu )KEƍ@E UB 뺋E@uh<%u1-E 1E111EEM̍EPh@&h<%uu/Mtvkt@(NtT4tW6uE븃UuM@몃ptxtnu딃M뎁M녁MyoEc-E%@4@E܉E1E11ut0tX~ tMڍN U9U~!E4UQM] ZYtUBM9]uuVju EvjEPEp ) uot0tR~ uvڍN U9U~!E4UQMۗ ZYtUBM9]uuVuuu @u414E@tf UE%  9]u%}uUMjQt8EE̅x ލW u9u~E4RU ZYt FUEЉUԋEU E Uԃ}t}t}u}tM 1҉3EЋUԉ/tP9]u>tw[E4tY[tVEX]9][(tSu؋M܉XZ9e[^_]UWVS] U1{>tNf}fC(ffGfJujZ ȋuFZK>s*S>+Ee[^_]UWVSu} lhUD%hPV蕈à t1=whlehUD%hhiD% <ޢ 8thUD%hV$ XZhh[u h$&r huPY1l>u?G PhD%( tXZ{>u[C PhD% XZ1hDPWhohnRPhnR耓 =nwHƄn ƄoPRhhUD%V@u-h$&hD%~ YXhtjWhà phthD%/ Xϋpe[^_]á4tU塴4P4U4]UE@]UWVS]u }uhE%h&hG}t}uhKE%h&hHhE%詚 tu ݠ "t 9ptIC ujYuTHtAJHt6BXCpf@up MH1҉PfxCM1 K뽉Cȍe[^_]UEM uhE%h&hhE% u " t 9Jt BH@MUWVSM Ep}y1yy9s)}_+Yy tʚ;1Ƀ}t}[^_]UWVS$Ǎ]Sj E EPGPShEUЋG uʚ;)U܃tHPU1ɉM؋]9ڋ]]s 1҉P1 ])ډPX )9s tJPMىH 봃ue[^_]UWVSU} uhE%h&huhhE%h&hhE%M }ʚ;vhyE%h&h܉É΋P t9zuM9Ju JuK$݋S(tJtHK,JjYtcUUrEB zEBEBC t&H9r 9ux 9}sHJP1C$BS$1e[^_]UWVS]U Eu}xx xʚ;v艝 [^_]É}u M[^_]USEU M]]]] 1ۉ][]nUVS]u E1MMMM i@BU[^]4UWVSUuuhE%h|&h|hE%虖 B 1ۅtI} t} 9xu5}9xu-t9pu$xtyz$x18z,xB,C볉؍e[^_]UEuhE%hp&hhE% U PH@LUEuhE%hd&hhE% @L11UEuhE%hP&hhE%輕 U P0UP4UP8UP<1UWVS(]}1E6/E@uhE%h<&hYhE%] 1҉ỦUЉUԉU1;s4s,C0 I>v }  DFu EPj @u11EEEE1;s4sjEPC04" @tF1e[^_]USjPj[ZtÍ@Pj@ ZY@u S?X1/1[1҉S C C1ɉK C C$1C(C(C,CH؋]UWVS]3tg>U t9FuV9u@uEFtB.NtH C1҉KNt RʠKXVXs@~1s@sDCMYC t6HtJKHPNڋHtJHP5ZC uK$HtJHPXC(uK,CNe[^_]US]jSXZ]]UWVS]uChE%h0&hhE% 4t,4H44C8tst Ӌ`!ft1f9thWhi6b@؍e[^_]UWS]h$1jC PhWihWh~i3 ƒBtx1e[_]UU1B$t0zLu%1t]UWVS\u~>u 賑 Vv衑 7EEEE1]Mu EMQUE UJHOuԊEEjPS PF PhE%F>PSV2}(u V*N>׉e[^_]USEtSjS[ ]UE t E]饢 ]USEtSuS[XZ]UVSEu Ʊ9tt ut1t 1@1[^]UWVS}] ?jWSj s jWVR wmj:VrZ ZYDžt?EPjhjjj jGPsp C8 }tޏ UC8jVCP- 詏 DJu <:tFu}Wjhjjj EPVo C0E t/it.u#Wjhjjj j@Po C4 }tC41e[^_]UWVSt] F1DžjZu h&_.1ɉ@Sƙ ^@u$h4$XZ1'@ txuaPp^_uD0t?F WP] ZYt"v}uTPE0; ZYt=l}~1WE4 ZYtF9uu19u&E811E9P~9jPET4 uE9P~ 1F1E9X~!jPE\4 uEXt39u/1%FjPEL4e t CE9HӋEH9u t1ɉSuz_ZHu}ShE%PoE@wC*WtE4%@u1t(StZ@uh;F%S7 SC@S+xfCDCCHSw @t CPCHC pSvCL1s@CX_XnƅRe[^_]UWVS<}u tAu}*EPV[Z1@u0tC WPJ{ ZYt[u{ 1ۉ؍e[^_]UWVSS} E{ sWkZYSs F<t<t+nKCtjRPQVsWjuBC~uN ufF UPtjURPVsWju$Se[^_]UEU tt ;Pt@ 1]UEtt @$u@]UWS]h$1jC PhWhWh~il txe[_]UWVS4] 1{ SB u%zu_vZEԃ v r u@)u;B.t/t, u'Er uu}tB }| KK9ruEtt 9st[Ȇ ؃4[^_] US]S:qZ@u:jhj @tjhj @؋]UVS t=΁u$B Ƅ Ӄt ӁtӃuӃ uӁu [^]UWVSljQ Zuh&ÉEhb3#EPOT ZYtfPU Xuh&S\[_LUj@PV  Uuh&S/UR& q7S Xe[^_]UWVSSƉϋ]jhGF%RUI UuA}H} L @ð`jhKF%R u>MP} Tð0M@} DKS0CPp}7uMU E$e[^_]UWVS EӅt΀9uE1҉1j/QM Y_DžuuV>~ _ZumVhRF%2@EEPjj jjj juc }tuhiF%Y[:t SP6[ZuuV} ZYt/1tE0^Xe[^_]UWVSÉUQM,t YM<9"u"OAIQMjͫXZMt3t 9usf 7QS薫Y[1҉U}u9tEtCE9KEp9us _Xul(E@EVgo Zu\o EBU$VɿY^UMuh&{u?8 D8NjuDpjCPu uh&8VY[41҉TMe[^_]UWVS]s {X1;s s WF,Xsx1s s{$X1;s(s WF,Ys$P1C(C$Ze[^_]UWVS`ljUċ] E1= $&E @Z t uhF%;-tPXj11Xu 1 uu1ۉh &Y VZtjى@[@t 8th%P n ZY/1ۉ^M@PJYt UuBjٺZuh &hF%t.u hF% u t$ jٺ$_u hF%1 u<hS <PT[^J>h4#Sl ZYudžEPjjjjjjS~ }ShF%ZJEPjhjjjjSZ F }ShG%8%EPEPEPEPQEPEPEPMԉډ 8%CEPEPEPEPQEPEPEPMԉډ jSuuuuuQt Sh5G%fjSuuuuutQujSuuuuuVQ볁111otq;tlj/SB Y_M̅tU@j/PB _ZDžUuًE#ًE/*O1t1ۉEEEUEPjjjjjjS }}ShHG% )‰U썄jYu heG%R9  T uhoG%oj,SA _ZDžtxu ShG%V9u:K j@Yu h" t%Ɔ EPjhjjjjS"W E, }t hG%_ )‰UčEPSSq _ZHUu-Uv 7L U䉔) jWY ]̈ T <4t{4u  ;6t{6u @C빅EPjjjjjjS貞 }!ShG% ~LHL+j,SQ? _Zt S`f P U$U衱YUShG%RPR 1ɉWY}Eu Ƈh5hL%Sf ^Zu Ƈhh H%Skf ZYu Ƈhh-$SNf Y^u ƇhSjZE^ZPlEZYuh &^lSPpY[{u Ɔ 1kh"Se _Zu Ɔ NhA%Se ZYu Ɔ  1hH%Se Y_thH%Sse _Zu Ɔ ShH%pt$ jٺ@[u h2H%1 EEEU | m^O@8%'EPEPEPEPQEPEPEPMԉډ jSuuuuuJjSuuuuu_JjSu8%EPEPEPEPQEPEPEPMԉډ jSuuuuuILjSuuuuuI*jSuuuuuIjSu,^j=S; ZYu h;H%@Ej hVH%S up}u11҃uM#EEEUIj hbH%S: u}u:1ۉjhoH%S u0}u 1ɉM1jhH%S t@jhH%S t,jhH%S tjhH%S }u'jP%XZWEEąuhH%\OE@MEM̍UE@u E "M1ҍE@tE W #XEPRU 2EPU̍BP1EPU̍B8P1WURP$$1ɉjhH%Sx }u'jPs$Y[BM1ҍE@EWY"Z61ɉMURPE@1URE̍PR01EPE̍P8R 1WEPP&$$1ɉjhH%S tjhH%S uB}EPjjjjDjju }`uhH%j hH%SD }uߋEj/u7 _ZDžtSujk{ Hu_SujX{ HuOƆEPjhjjjjGP; }t uhH%uh I%11Ƀ}^ٍUE`j/S6 Y[uEjP} JM JM ٍUEsj/S^6 _ZuEj P  J M J M \ETPT'E߉EEUEEEU  %EEEU Ɓ QR󪍖 fFPfFSfFVfF^fdžƆ Ɓ DžtG1ҍEj@P %  JM ^Åu  8%t EPEPEPEPQEPEPEPMԉډ jSƐVuuuuA" \i 8Sh"I% q $菮Sk $Y[ h &> 4%tu h}I%fF@u ShKI%  s d X @I : + uh[I% EEẺUЋ4%t%E̋UЉ1tt huI%E̋UЀPt @_t1j/S+2 _ZDžtGڍEY@uShI%q 1,E̊EE19M k(Pu*t,Uf9Pu#U8uU8PuU8Pu U8P A밁  K  @ED1HEL PETXE\EċE18E1҉uZ }tEHM Eą hI% EH$MH(MąuhI%}tdƅu ShI%r EPjjjjjjS_ }t Sh J%C FÅtMhJ%k1uLƅtFj:S.0 ZYt8URjhjjjj@PE 1}̃}t'h+J%j=S/ _ZE1ɉMt@Eh_$S ZYu)u hDJ%p0hS%SӮY_1utčph\J%S裮YZu( sPu heJ%Uphc#SjYZu(:u h~J%ph "S1YZu(u hJ%phtS%SYZu πEhS%SܭYZu @)hŅ#SYZu  hS%S褭YZu h"S舭YZt-hS%SwYZu hIS%S[YZuhPS%SBYZuhVS%S)YZuyh^S%SYZu`heS%SYZu GhmS%SެYZu@.h""SŬYZu hS%S詬YZu hS%S荬YZu h^$SqYZu @hS%SUYZu @hS%S9YZu hBS%SYZumhI%SYZuThS%SYZu;hS%SҫYZu"h #S蹫YZ t ShJ%7}tuShJ%XZ1E s!t@uhJ%qXs }u hJ%TXuShK%urBthY#S ZYtS Xu 1E}u.j,EċE@PRF uBh &VhG1EMċ 9sM9 t>{t8@,9tt(MMċJ]ĉ k,1CC C$C(S_YE{ECs Cǃ}t uR ZEủ)1 E}t5E- }t }EEHh/K%`" S肀^ud}ShIK%@dMA2Džt @hb%ScQ ZYUĉMȅt"hb%S@Q ZYth%S/Q ZYuEċU ẺUE%E̋EȉEЋE̋UЉhK%SP ZYu\u heK%30uQWjl HRhK%PQWjl Hu؉߅ h%WsP Y[thK%WbP _Z@   jٺ[u hK% nbV@JEPjjjjjjS誆 }ShK%tzEPjjjjjjSr }ShK%QtEEPjjjjjjS= }ShK%iPfYuhK%XZjE@P( i(,P,k4EfFFE̅tHEEFEFEFF}u!1}F1uFj/Wy& Y[Åt/uWj2j HtJWh I%1}_X/uWjj HtWh I%}̉XZuf~jCEPjjxjjjjSфF }CShH%VFY[-e[^_]UWVSEu} EEEE1ۉE싀@&tM܉UVPDM ZYUMtCnuFE샸D&uu u E#DEEEE} L&EEe[^_]E8%uu E5G%e[^_]e[^_]UWVS]}1-} t]%E苃%`E?EPh@&RuuLtAjj5 p7PًU E=ƒu$E8E%<%t<%뢺} t*%Ƌ䟉 u }쉳UaUЍe[^_]UWVSQEE] 1 t 8t RΞZPŞX1t 8t R裞XP蚞XEtu7jVuZ pe$Z@%8tjjV txTuxTjP僻DtVr,DX@HXLtVE,LH؝P_TtV,TP謝XY\tV,\X耝(uXZ]e[^_]de[^_]UWVS0uhdjߘZYuh&X9Áǀǀǀǀǀ@ `h&P&48Y_tt %t 4 4up4@4jjj? tPx] 4 4Xjjj tPJ] 4 4!D_ 4 4ЃhF+P P蕶 =v1 1ɉ} !8%j,j @_Zu h,&Y ǃDj,jH_Zu h,&Y ǃLj,jȖP_Zu h,&Y ǃThh&WƵ =vh,&hL%WXZPPZYh-#Pa$ Y_t u-PP1҉xW\F ZD9t t ux\tH@ߋ@D1@DHLPT1HLPTXh\l1X\hP0V9u0h,&hk"课 ut=w@ƄS0V81 1} 11PP}YZh-#Pe" ZYt u t:R|D YD9t֊ t uʀx\tH@߅tC%䟉1h7$D YZ} uj`@Pdh u>ju P虘 d`J Zuh,&迼_G`hF%C ZYu;}uPC Y_$h#C YZuA}uP{C _ZutDž}tuh7L%Et*SPSZYtbHT9KTuZ8PC8PY_tE1ɉt8SEPQSEPS9t%D h4&ޮSXZ]OV;_@uC 8Vt h|P%谮[jjW舺à  jSWrEC S9;U tSW謺SEPjuyCTt 48%u=t8ڸP%Sj1ZY@u&C 8tC 8t h &֭XSY],;E FSVSW9tB h4&葭SXZjjuVeà uUWVSSljӉMЙ1Ʌxtؙ)ѸFE)عy11X[^_]UEuhP%h&j;hP%; Ptt B /1UEuhP%ht&jQhP%; Ptt A /1UUuhP%h`&j}hP%Q; Jttt8A /1)z 1zuz uzu 1zUEuhP%hP&hhP%: Pttt-A / xjh&P 1UUuhP%h@&hhP%|: B<t<tt>@ /1z'1zuz uzu 1z1U幀U E]UWVSu] }uh|%h&h{uhP%h&h|hP%9 Fu#<u;FuFPhE$WS @u612WSPFDPhÃVWSPFP S Ã؍e[^_]UWVS}] uhP%h&huhP%h&hhP%)9 GS8t)R78s<t<t1&vvRS Q e[^_]UWVS(uuhP%h4&h$FE<t<FVU1TF1 G!)JO9t> B@t8t}19sF8}Єɹy$At}!u}@]9s 8t1s> /^1ۀ=4uV}ع1E׈E4S}W=WV&thP%h4&h'hP%m7 4؍e[^_]UVS]C<t<t= /g S؉U Y=4t154S6Z;E thQ%h$&hnhP%6 4Ǎe[^]UEU uhP%h&huhš%h&hhP%6 fPUWVEu uhP%h&huhš%h&hhP%B6 fe^_]US &tPh!Q%y XZ]UWVSD1}]S1Z@j0S21uuuu}WS431;5&s/&H>v ;  DF1;5&s/&H>v ;  DFWS2; 1҉u uSjE0EP^ƃ S1YEt W; 0e[^_]UVSuEPu V虁 uVj7 ZY@t؍e[^]Åt3UWVSƉ׉ˋtPWh)Q%Vu 1Íe[^_]UWVSU} u19s$@u9s8uh/Q%h&hC؀xthrQ%h&hhCQ%,4 u1X9s%UjKQPn t؋UGJ:N9s@u1Ѝe[^_]UWVS`։ϊB _`u1P`P~XZ- `S4 X4%@t _t^Fhgv#)YuQ%PhQ%S @4 PhQ%S @uWhQ%S @dlhhQ%W+ YZu@htDžphxDjVYZuGDžphQ%W* YZW* Z|6hQ%W* ZYuDžph8%W* ZYh +#Wk* ZYh|8%WV* ZYh9%WA* ZYhn"W,* ZYhU;%W* ZYuh8%W* ZYpDžp Džp_t@F PhQ%SY @p&tPhQ%S2 @84t pNdX}#tR%RhQ%S @VL2%t $Ju :%PhR%S @ZvHhR%S @BFPPhR%Sq @(v$h(R%SY @V裮Ph3R%S=@~Pt?vtFQPhhtR@ttRh& Y_twpulelxOpu V<Z;puh/hxDpjVY_}#R%}#PhbR%S9 @WhkR%S# @VLuZ%u6u_%u*PhvR%S @ut:u%u褞@t>(WtY%uPhR%S @ubhR%S_Z@Npubll@lq PVh'%ST@d'%h@pt!pNVh\%SV 1huvh@Lt㋍hqPPVh'%S!@urpt)ptptVSxZYpujlt l@u1d lqPVh\%SS@d\%QNppuA 8tV) _yhpHpDVh\%S @WpCPhV$S @tXd 0uSH SDY^u h&xZ#_tFP`P u,h&HX_Džp؍e[^_]UVSË2;tPSe e[^]UWVSQ} utu=GL|8%t +#Htn"}tE1@ۅt"a1ۃuZ xut@xt:HHu 1HH}tE-@uCt W踩Zt!CE}tQ%EE@t]jWC[^t WYuu"Ep}tQ%Eƃuًt 8u1W Zt^}t8EgÃuˉ؍e[^_]UVS]u tPހ~t9. :jhR%S4 uS/ S \ZY9rh8- X1e[^]UWVSEE} u |Uƃuh&ØY[jhR%W覲 uu Ee[^_]E1҉UWPE PhR%EPFƃuuh&hk"= jEPV3 @u M- 8th&hH#1ɉM^_EuƒutSP ZY} -];уM I+ѻ}hb3#EP' ZY;tjhKF%S螫 ujhGF%S臫 uu1;}1u1;} uJuk& [EPjjjjjjSO }tG,9uSv r ZYEPjjjjjjSrO }u9G,nFuak& d!u>kX1e[^_]UWVSM 1҃}twE8to1tA1]\t.u#]<uu'7t)Kt/@ t @B뼉)It tB[^_]UWVSEEEUE E܋]1ɉME9!1E؉EErE,@x $ VuQ9uu$ "E%?B ȃ}uz}E؁}E‹E9r봋E9UrE}DEt.O9Ms i$ 7뎉ߋM_.MIE)M܋E9,}v+$ M}}9]ttC }Ut;]tC } t}E[^_]UWVS u }EEE]1EE9EEEPs2`&`&Csy7Ku-y)‹ -DAt/rumr^s ‹ -DA@t# t\tFx+B -DAt/t U" Uu=k" t#w" 7f\\Ev\0C0C0SEttNCEqt(tsExu EE [^_]UWVSÉ׉U.ƍPSoYZ@WhV$SP @}uSj= _Z@u$p h"S @u@ s=Vu hV}^P~n sVu S > _ s Vu S=  u V* t.Vu PhV@VhV$S?sh.#S,ZYsE1D0t<0u FuM )tSPG Y_@u|u } 9K;} u@tPh%Sj ^Z@u3tPh#Sz @G루tffPh%t&ffPh#S? @c t Ph%@tPh#S  t%7PhV$S @sWj.VWja2 tcVhV$S @tQ?tGuUWVC*P׊ Utu[փVS0m_Zu VS_mY[tFXNR蓍ZtPte^_1VScZYtX /1 q ؍e[^_]UWVS(E̋A tӉ΀ytu9 xVx}WY@$1FCt}Љ9F tCU(fCF t#UԀzu ztK|@FtC8F t CXUF0CxFftPEtM_ZF tU tUԋECTt14~t Q h%EťCTZYuՃe[^_]UWVS8t F1Dž@jB UPPsfDž ˉhPhiUpg UJ>r*hPhip' ,؍e[^_]UVS1ƅ@ CtDžC8P^CPƋƒYu9CZu)CT@fCXPO_u tЃtЀC| t Cxt(1ɉ,uCT1fDž @fp׉މ;tHH tut󥃅 T:upV虄XZtHHt'CstHHt󥃅  t'CXsXtHH)fSP8 @؍eY[^_]aUWVSDžLDžP"1ۉTEXDž\1`1jjHVjjLP @OHuWRY1CPWiOXZ$jjVSjLP跿 @u= 8 넋H؉@D@9DDx9@s DD9@r׉F u]dETuGuVXu h('_wX?$RuSU ^_u1XZ]]@UVSË%tJC><vBD&FTttT9t0t&NT9JTuu ; 뻋@À{>v P ShU%Nc e[^]UWVSÉ։h,jE9ZYt:PǀcScufǀ,1e[^_]UWVS0ÉRo^@u PhU%hbY[.Gw*hH PhV%9b %th, Pj28XZt@dtVWv<u?(9x u1Wt cScuGhu @F @(GH>A<wO*󤋅% t&x utmtdf@ tStJSjʛjPS!V9Ѻrf‹fP@TȋG,CD7LJcSc_$tZDcScuQtu?Odt Ghu;Yt-fǀ2@$)f5XH~$tQ~DcScuHu ~<u|t2<t&)ڃ*f@6Vt4L7Pu"uJƃv9C,m@1;D9s 8 ttBxrhуuL>t4L7Pu"uJƃv9C,VP)HFGWu*)؃f9 ffC tHGY u<)9dCM A 󤋵 \ tC)9C= A󤋵 \tIt @W uD@Wt"@W uv tD)9UC< A 󤋽 \ttRC4%u+@t@Zu)؃fPhP<ƃ tt)߅tPjV2PYY9qQS  C{fCWVY^g0Q COt/t+V Z@)9 CKt tRG%t4@^u()؃ftC uO t>P)9rNC A 󤋵 \C))=+w/D@ PhHV%UX2 e[^_]UVS~\jhOPF\ uF( 8u!5 -haV%WY[ Sh@'hk"W 1ShjpK@uh@'h8%WXZ1e[^]UWVSE}uhnV%h$'hh|V%= Ӊ΋S IuN EEE싐%tZt Cts mjSu@ u3@C CXJP S@p@P'& Z J(H J>r*󤋅uK%t9 t/hQQ@PPB PhV%8B>u1DhQPB*PjP RhV%Rh'>SXe[^_]UWVS$Ɖ1iu1hV%Rf-Xfth$SPà 1GiPV RhV%QRh$SP6Ãu 8t8iW Vhk"R!w h' VhW%xR 1`64%@u"j5S,Y^@uƅS#$Zu h'RX뢍lj󤋅e[^_]UWVSS]Sj8^_t]u1ƀ8tCP#Ztlje[^_]UWVS$ϋEE EhW%R ZYu}]ƅP $!#Xۋuh'PYuQVhRSKVp+<@t-P袅P.l XZuE'e[^_]P1j6j4a@uƅw x,"j@,Ph@hWmuքWPh"迄WPh"SVh-W%N$v"t$u)kPWVh@W%pN(BPWSVhW%FN ]e[^_])UWVS] P'tPh0#p XZE1E;s31;Et k, 9t@v 6hMW%0 PV踹G,1;uts 3hMW% PS蒹F,܍e[^_]UWVSEvpE E] P1}tEuDSPhO%u= @tBE^P!Phk%u @t E9sT;] us< v!I Juj M ZY@u؍CT9Ub "uj ZY@te[^_]UWVS]u }~EHt t4PWhV]@uxVhV$SF Ut" QSj 膾 ZY@tǃ7PhV$S @tE)uSjQ [^@u, 1e[^_]USS]uEtBSuHPEPjZYu1}ufffDsD]UWVS4E 1҉U@hpuԋ@E܋E E@_tE@o^'EPjyMԋU܋E 5^XtE1!#,EPhMԋU܋E Y[EUW%EU1҉Uw|MUu 蚕X1E}UċM1uGEEPS解EPCP蚣EPC8P荣Su tEE99w< v i YЍBEȉD9EMA "1E )уȉEU@t~TCtE@Tt 1ɉMEPj!MԋU܋E XZt؋Euэ<1E9ECEtu UXu EEU9t M;At;A u1EEIʸy,%=tс1utȉE@uFtEPVEPFPEPF8PVuE ]E@PEPjMԋU܋E Y^u1҉UU9u 9XEEPWaEPGPTEPG8PGWu螔 ]뤋E؋E%u3E @hu$uЋE PhYW%`HE؁ Ee[^_]UWVS(}ƅj4uM{Y[@uƅEXuX uExlS(}Pu h}W%u#@ujuMH^Z@t'^1Pu hW%uܡ@u-S1P|Pu hW%u象@ujuMZY@t,E#pVq|Pu hW%ul@@ ؉P?|Pu hW%u:@ut Ex,u@GhElPhhSrSu hW%u$@ut 1;j@E,Ph@hS"Su hW%u蘠$@up;s VC,X鋇@1ۋ;Ds VpC,Xh1ۋ;ls VOC,X鋀1@D;Ή⋍T1P1ҋ9tk,;BፕRPMU[XtxG SVhPu u7ռ 8}u@v;WPZYt*SVRhPu u7芼 ,1;Dsp⋍TPuARPMUZYt&PhG Pu u7 F,낸e[^_]USEtE.1CL[]UWVSujh0jR t)Ej}WjhP%n@u SX\jWjjSn@tjWh@hSm@tȍU1EfEDtEjRS=d @t؍e[^_]UWVSQÉU0!4%u|Gt OI9HtjEt` GdPG`_uh'CY؍e[^_]ShjP6@uh'h8%BXZe[^_]W|$wUWVS?E苷EF$E1FH~ t)v FFFF F FFF1ۉ^ ^XNvUE䋀_ ƒYt=Ep+Ev$wURPShX%AF0FHX%%t$v$vPSh&X%AF0FHCX%7~@tFHJX%F0u*F8F4v$vPShRX%cAdwjShmX%uAF0 V8F0u0E1Em \%}fE fEm}mE؉F8A9r=E1Em \%}fE fEm}mE؉F8PShX%@ V4F0u0E1Em $%}fE fEm}mE؉F4B9V8s=E1Em $%}fE fEm}mE؉F4PShX%w@ F0E؃>u,Vdt%F$;BuFhuPEuuPSh Y%?v$,uuPSh Y%?E苀4E%t*FHQ%hQ%WjE8~HuJFt.Fhu(VJ9Hu~<t>t FHp_%FH*Y%>u FH1Y%FH8Y%~0uF8F4bWhv4jEJ7WhMv8jE17(Whv0jE7v8v4Sh>Y%>$E䋀~@uH%u>ViRUShlY%>vvhUR7R @Uu RhY%>Y[^hE䋀t=W[2Zu[E苀8E%t]h9%Y>jE?7 >vHWs7jjuWt(tFdFhӉe[^_]g_e[^_]g_UWVSPuE EtuVjj36(tl%ub  CiP6hV@ t;{t5{<t/s$rPF PhY%V=1ɺVjj51s 1C CsCCCC 1CCECHt V0Y1ɉKdChuVXZs1CC C$Zue[^_]ae[^_]W|$wUWVStEUM]EEu\P?_EPT%Y%u'Ht :tRQE PhY%;1ۉ]EPLt @v@}GLih^ Eu?ZYEE1}m5L%EPT%Y%u'Ht :tSS$RQE PhY%%;MUEE@iEEE@ht 1ɉMExdtj$PuP% t؋E@$EtˋE@EPWS u{4%t Sh/[%5[^jWS t jP&ZYF MpFuWS uhV[%h'h h|V%b  FdH PF ,Ft'N V$vX]e[^_]e[^_]ËJh1ɺBUWVSËN t9At E9F$E;2UiPC Pha[%4FiP3MEUu~@u kUjRS EtjPn%XZESjj,E%tBFH8%h8%S.48%Y^ u-j,XZShjj+Ee[^_]UWVS(Ë4%Sjj+V BuB EjEPS u2N }vuu܍EPEPWS%BPt3t P)#uhP Shu[%2SAXe[^_]UVSËu<wPh*PBP3 uhx  X\`\u TT1ҋTX#DT9 tj`9r7_Ph Ph]% \X`#D`9  `T9`rj5dohYZ@u ƅo4\`%th Phh\%)XZn o`< uBHvWdVh\%WdVh\%c  uWdVh\%uWdVh\%1CLDžXXX\Dpt;jXdhZYtWdVh\%.XXuDžX`m\@6@t:j6dth0ZY@uWdVh\%WdVhW%$dhƃ tPh Ph\%x(V; h4%u$h\%hCiPh0hhsPjhCPu CP+WdVh}]%;C@FC$CD1C<wPC*PEP%( u%C PF Ph8^%xuMU[뚍e[^_]UWVS8EE] }uPYt99s&}E EE 'E[^%e[^_])WPSU nЃ<@_{ UfCfEf9>Eȃ(9E؉EċEEċPЉUfffM9f}DC E1ɋUȉjfuwEċEԋEċ@Ef}tuC E܋CEEfEfEfE}uܹ1҉UЍMк EUfҋEftuSPE Phz^%6(fEfu)T3EPE Xe[^_]UWVS$}E ^\ftPh0'h7% cCubh$RS u#>t=G Ph0'hk"rWsPRWt^\ue[^_]UWVSE 0xjPu* uE'e[^_] ËOwvQPw Sh^%<uu؍e[^_]hx\uu؍e[^_]e[^_]UWVS`(É։ʍDž( 11DžDžDž,ftRh'h7% t @`jVP" u h'YVSzXZe[^_]UEM ‹]UM 1ҋE]UVSuVXt,sss Stttt:uj@苃t$Pöǃ tP襶ǃYZ1Ze[^]W|$wUWVS tu}P.YUK>vuu{(Ofu  tu%ue[^_]g_h ƉE1Em5L%RR$C Ph^%Sh9 Vja(e[^_]g_UVS]Sh9 jit~ht j3gXZe[^]UWVS E} wLBuB9{d4G PuF Ph^%VU1Cdh8%V|V GunC t{@;GusP]MPF Ph^%%t VXCX{F$E}uEUҊMM섄tLGECЀ8t HD)у@v * M@MH@E}{CHX%j6esHV}e[^_]UE1҅tB]UWUBv豫 0E 1ɉJI} ډу¸)Ј1_]UEt9ʸy,сt1H%]USU MEttt9Xut9X []UEttPf1ҁ]USEttju S u[1]USEtt$ttP] 3#P uI1[]USEtt$ttP] 3#P uI1[]UE1tzhu 1zd]UVSEE t u ~qZt unueAhBhu&FAhRhu tBu 6,cScu=cSc =cSc[^]UWVS\EtE}?Ex 'Eu1E@$ h&EPjju Ã{E8uǀxhtxduhv_%h'h*h_%r h&uVfE@dZYx tWuC]Xu1EK|EPdB#B E}WS]kE@d@ EWCPGkC9SV^jjEEP jjEPE }E8P4f_uqE0[^D$NjuuP+\C| SEP]juEPDEuEPZY@E@$tvtgu\X1uuVS/jVCP%jE@dEPC8PjE@dEPCXPi SEPL]_Xu[jj}Wà SWsxC|ZY uC|E@dEPCXPiSu 9tS[SXX떀{tjSu !à uhSd_tߍC8EPd^ujju ƃ t9tEuVyfZYtF ~$1ɊT <2P@A"Puu9tjV븋E@EE\E@$tLu>E@hu5jVPhO%jC P| }t EC1CECcHwnEE] Ee[^_]CtNt;C uCECKtHJSHwuSjà ]e[^_]e[^_]UWVSut=t7;Ct+$ PjCPC PSF PtjR$ōe[^_]USEt6t,ttHJHP X]]]UWU@Euu( Y_}UWVSQƉ uXӸ'ljU'9r 9EsҸ'ljU'~9M9 uZ[^_]UWVShPLufJ}xv͜ #htAEH@‹EEhЍHdfhdZh`%hPh΁Ëh 8 8th'h`%XZh?w8j@h_uh'^Lhǀ@hO @uhShmS =wPƄ ƄPPhh`%h苀@u$h'h`%h1҉Y[hCjydwZXETE`\fu `\\@)ЉD譚 7RP*RuM UuU]UWSU v{ 11}}u1'M[_]UWVSUt΀yv  u1y tËATr@t$tt @$u@h`%X؋U-ÅtF PSYFP}WWCPYFT@t Kth( u} WC8PY_XC9@VCXPYZY؍e[^_]UWVSSƉMtGu[x|tGT} u@t1҉t H|PVYLXZ?1e[^_]UWVSQEp1҃t<t 19sDB]۹yAt}u1ۅ}u@9s 8t1щZ[^_]UWVSE Eu}EEEHfw EHfvP Ef9EEEM) u k@w ¸ w w w ?w xK9~%諔 "}u1EEf}tdf}@~9f}? t1҉EUE) t1$t@E) t1u}11ErEUEa ׋UM U MEREC1[^_]UWVS}E uuGT((*1ۃ t%jPG@P ut #wTۉ؍e[^_]UWVSu }WVu(WVuottSHIH9JHs؍e[^_]UVS]CtP蛙V SjjVA]e[^]0UWVSuFXPF Pha%?Vj@u3襒 81t)蛒 8t葒 8t臒 8t h'AXF@t>jVC@PH ‹u#StPWS]e[^_]뾍e[^_]UEttIt:t4x@u HAtx@uxDuxHu xLt@PuR1]US]jjS&ƒ ujjSm ]UWVS} uEtMtGu{@uCAEPVTZYt$@u NtHUJNV^C‰؍e[^_]UWVSu 1ۉ]]]EdߋGTEuu;tGu}묋WtSWuJMQ1ɉ uHJt6GuCu;W_IuWYUOuUJOUjW@R06 t)G9Au!%uFEPQXZ8MWG E1҉UE܃YtMuW Xe[^_]UWVS} Et0t[uvtCPEP_ZY@t/C@3#Eu%CD3G#EuCH3G#EuCL3G #Eu붉e[^_]UWVSu ]ENj@t9pu9X t5jLZuhH'5YpX 1҉W PG 1e[^_]UExuP u U ffP 1҉P]UU1zuJ u fB f]UWVS4UUuhj_ZfECCTUSǃt_{ u Pu ueƍS@ C t@sTKQPuR<@u{ s{ u @t{ u j.EPC G{@u RUR^Y^@s@t~{ 1UĊ  L @uj.EPC@Pj tJSRPhO%j.CXPqf jC@Pu t @PCPKTKPCPuKT h8''SXZ1ۉ؍e[^_]UWVSEEE EEU}uM MM$M܅uE苀t RPEY[rEuZE؋Et?jWC@P u(ECP}}StP뽃} }WSgjVWunP:}@u 1C$C {4s(ECP1E@CEXCTEt CTtSP ttSX{@t4E胠4uSuq!uSuu}uLSYMCAuhQ%S=VXZЍe[^]UWVS]C$t1jjS u苃%uuS^u묉%u^f{(uGC>Pu<{*Vh'W tVh'W u 較 謃 VEuU1Ejj@VStƃ@$@ 1ɉMH P@%t<u,C*FHC+FIC,FJfFKC-FMC.FNC/FO%<uC*FHC.FLV葂 V8FHtVw FHE88VW 1ZMjG@PRU( U܋Mt?uRGPt%tEGXPG Pha%V? sj.FXPRj 1E@F0EpjV@e[^_]UWVS]} FtHtJN HPZڅt0jjjVtEE Ee[^_]:jjjVOV`1Sjj$e[^_]US])XE]UWVSQEv襀 E 81ۅEjG@PE@P[ tGT(1E@PGP}u!GTtGXPuG Phb%GP ttGT uCtWZOT }u/GTOTt OtHU JOWX}3u1ۉ؍e[^_]UWVSQu E@EhE@PE PuǀR@4uUr4{(s41ҋEGCEH$Q+B9sȉC$}O : v: K vu9F s~ SAZ11BCZ؍e[^_]UVSÉփXPC Ph:b%VSt VPZY ht'QXe[^]US ]Sj$ڋEXZ]UWVS Et_IuVj#XZ؅t_t @ FUMvj±ZYUt0Mt&@}wFH r*NjM;jC 1CUe[^_]W|$wUWVS %ue[^_]g_hE ƉE1Em5L%RR$C Phc%[Sh?_Vj(e[^_]g_UU t,t9PuƀRhejj9UUу1t3wt-tRh'hc%= UWVS 1ۉ]]] stqpCuCN@H9AHrot t]t tK{du~du?u~hu0C`PEF`PZY9E~FC3^R6t1EC7UtHJUPe[^_]UWVS<1ۉ]]]E1u1EEE9CEׄCdKTMЅtYURQPk t t0u5CPE Phc%r1ɉKd EEt9sEsxF URV4RP t tlVTtRNXQ%t$QPF Phd%Vja@u+m 81t!m 8t hl'Z1F$F fTEt9sE6NEtXMPF$PvI t t1F0PC Ph$d%Y NtHVujuPECPEЋCL }ffMM9Ms>l KMɉMM̃щu2@uj}t}u^}vXU؋PU}vEUPUt6ut#9Usu)t9s M EEu)u%}uƃEă}v1ɺ1]/tuhFbWjE}t?E Ph9d%EESjE0$hQ%u<e[^_]UUt&t9PutƀU]\]UWVS}u1-0t9~t6^xtuu S u؍e[^_]UVSEu1(0t^xtuu Si u6ډ؍e[^]UWVSu}t9suCxU u1[^_]UWVSSu10EEP 1ZYtU9pu 1ɺPGEttu4@t$Poǃ e[^_]US]t9XuPxtJT8t 1[]UMU t t9Huut xdt1]USMU t3t-9Huu쀸uX`u @tײy1҉[]UWVS@EPj E _X1EE 9CEuhdd%j uVE CPVhjd%u, @ursXsTVhud%u,@tuuVhd%uj,@tCtPVhd%uQ,@tC`PC`^E'+"uE1!#fC"t 1!#AuA6$" u1!##@u1!#1!#y(]#uRWVQuVhd%u+ @&sdVhd%u+@ C1C;s WKF,Z拀H1C;Ls W{KF,XCPECLE}EfE9Esjf SM@ukHL1}9t 98t(A, 1M9t39tF,}čOQ}OQhdWPB PEPu2 H UU)U-sx1t8FT%u'~ t!GFXPWEPhd%u@*@6ċ<e[^_]UVSu Ft%tF9CuuVCxPuwݍe[^]UVS]Sjj1҅t#09XuƀلtKj3H%Y^u=t hQ%S:6XZe[^]UWVS] 31<t0h%f%xNj 󥊅zp 0hSg%11Ҁ+u8B,CTtG{$tA1ɉڋ8u.ڋ8CXP0hxg%1s$ )t1ɉEP8Q )xdu+81҉EP8V2H4818EP8V2p*v>xdu"t0hg%f *?)t49$8xdt⋅4t48^u0hg%Y[+(뗋4t=4O8xP4j40t8Y4jj4護8jj4萷 Z8@`y *t[j@t/*tJj4>^_@u80hg%Y[$*0hg%聾XZ4e[^_]UWVSp]U Dž 11DžDžDž0ftRh'h7%F jWVdX u h' YWSXZe[^_]US]jjS u"C PhAh%^Sh6`SJ]É]]xUWVSPu} UUjWC P Utۀ8vh%u%UPCPC Phh%߼CjV UuDt&9tH9Kut倸u܃xdtCEe[^_]e[^_]US]Sh6`jǴSh?_j貴 ShR]j蚴]ú'Jt f9tUWVSEU MftEv0f9sHQ 1&f9u}tMf9) Q [^_]UWVSEu} tRU w P 'fɋ] ] +39sP "1?fҋu1҉]19tu692uA,t[^_]UWVS8EċEȸ uѸ@URj uQЉƃuEfǀ<+P GfEfwEă Phh%Y[f>ff}fuEfǀ<O 1҉1ЉЃEu.Ef}w p'Phh%j ]Sx- 1:BUP_XۋUuh'CXߋMDڸuf}f9<t >Mčq RVhh%PS联Ef]f<O 18f}uVhh%V}ȃl((Y[Eċ4%tjBXZE΍e[^_]UWVSSƋ1;,k(f{u{u4{u.{ t&{u&{ u {u{ue{u{tYCUhPCPV4Ut1ǀ5 Kf1ɉHGEe[^_]UWVShEwM EdEEEE@|tXTÀuXTBEAE1ɉMM}qEf9UrZ9]s#IM E Phh%XZ0u<}])Ӎ{}ff}ftftfu f9s#L E Phi%訷_XLʍ]ĉu)fEE,19t.kM(Mf9HuUjSPl UtGF΅uE4%@u+j EPjEPuPE Phi%菶f}tHuΉuȋ]ˉ]̅t<9s8j EPjEPtuSVPE Ph;i%蘶(g1ủuEEPM1ҋEJE[tE2Eƀ>#f}uEȅWeEEEPjuWƃUЍ M))Ufw#VuMUZYuC;u}tG Phi%r[^덋SDtKHtƃ>VuZYtȍe[^_]USUE M]v]ɉME BE[]+H 1[]UWVS ÉUM苰EPjRQRtBf}u;8ύK G=DQwWF(1RPQhj%%~(WQh"j%蕲 EPjSuuAtBf}u;8σ G=DQwWF,1RPSh}t8sLCDCLCHCPCFT rFV t#tFXPF Phxg% 1F$upFXPF Ph k%! VT s"1F$F VjjFi-NtHN rVqXVYHE؍p C`;u PVh%k%MuVh?k%,KdSh tRQPVhWk%u迫)uVhk%u訫 RVhZ%u蔫jE0QXZ}uA}t;WVhlY%sHsDhWE0& @u WhY%?_XE؋_|tACTƒ t ujC@Ps輯 tKT CT uVhk%耫h8uE0Ȅ E؋4u$}؋t%uj98tB9rIpr@uHtHu f$8,nt104tj 0\ZYHu" t\10fDž$H8% t#j@wPϓ(| @p|1(Hx@1NjDC buy(u4tƅ,18$|Dp<@D&v P PhU%蠞 DP4Boe[^_]UWVSuVhjS1ɉKC C X1{{~ ;u Whl%ו Whl%螕XZ@uWh'hk"辕 e[^_]Éue[^_]UWVSu{Du ?~ Whl%Pc1CCCC(C 1҉SC| tPT sPTA@uWh'hk" e[^_]Éue[^_]XUWVSPuU~ Whm%?P輓1҉SCCC,C 1ɉKU @uWh'hk"r VVhj j e[^_]UVSË%t S[/jSZYutSjS{ZYue[^]UVSËƆ?twjhjF|P8j3vL>nFDFLVHVP1ɉNDNHt h8%S}XZP3Sjj荋Mw0%t11҉SY2~Dt hpj%SXZu Sh>m%ݒ1ZYe[^]US]?S Rhhm%P躑 ؋]US]C Phm%詒XZ؋]US]?S Rhm%PU ؋][US]ShjVC Phm%/؋]US]?S Rhn%PڐShmj1҉؋]UWVSƋu5hV%f-XfthWP, 8PV RhV%ՐhWP6| Z4%@"PPR` @ {TWjj u +)CTSXWjKZY@KhtD1+9}F Ph[%衏Y_DsDjbCD_Zu hT'Y#Nj󤋅CH_1҉tjhj|PP62 sDj1CDCH e[^_]UWVS] E1E;s31;Et k,9 t@v 6h,n%r PVG,1;uts 3h,n%L PSF,܍e[^_]UE@|tPT(t1]USEu1X|tuu S u؋]UVSEt0t-uvX|tuu S襏 u1ۉ؍e[^]1UWVS} 7G@4j.DSFPjw6 4wSh4n%)}tE@<"jWuY< u h('iG8@Pj48PNj<% tj[^88 ttu< Ph$o%jj48><01ɉ,0,;(⋍(tx}HlaDP< Pho%裈<;8BPj48ƅ0tfBu0S@tWC<8uOBQjRPDt8fBu.08r$PDP< Pho%Ƈ48sunu StHuZ%uGjSƬY^u9ϋt# w~tn0ueeu1t1%thDjVYZ@(@,1҉P|P|10fǀ<fǀ?SjhP'jjS"u"C Php%~ShSىFSX:Ѝe[^]UEtQw]UM E]UWVS É։M苐t 48UMtSjjPv u EU S腁Zt~8 1pp@1x xx$3@u Sh,'hk"}:SY(h q%SXZP3XYXt jjV|Pt j3YXZwLXGDGLWHWP1҉WDWHYt=t8E%Uu=t}uEq%uS&ZYwLWw4WwPhq% YX؃t w t u F17tA9MuuUM7Ph%` XZUM΃`Ѝe[^_]Uh-hq%Uj t4h4t9W|$wUWVS41Bh41-% 6f6 s f4.s f4P s1f4f 4f 446 1s44 ut/4x4 |44 4f41=0-Of44ff4f4=@4tjVd} Eȣ4Eȣ4ZY0-X464U1E4]544jh456ƃ x9u h%l%d XVS54hr%@ 6Hujh,-j0 P4\4D4H4 D4u\4\4D45-= -u؉}mrq$-E؉ D4H4 D4H4EL4L4=ɚ;~ D4H4-ʚ;L4\4D4%we[^_]g_UWVS4ƉU)'hr%% Y>^ hr% FfVRVRPWSPhr% j.]SFPj uj.h"Si Shs% j.SFPj uj.h"Si Sw F^(ZU)ڃ<,wJ<w1tR<CSPSPhSs%<+h+s%"<:tI<zXZERR$5<4584QQ$5-5-ht% $h8-E _h8-: X}ɍg_W|$wUWVSTt44u t4h\4j4_Xv,-\4H%=d4ݝ(1@DP%ݝ@1ۉ(,h\4j质4ZYt"jj$ Ɖ jPj} 4t1=4݅(zt -\4H%=d4ܭ(ݝ@t49h4݅@؞vw\4D4?%r 6t=-t#6t*\4D4vܕ@݅@z84k - %-ʉHL߭HvݝHP4\4݅Hܕ@v݅@6`fDžd L%ٽZfZ fX٭X۝H٭ZHPj`P L%ݝ y 8h4"Džt|1󫋅TtxDžDžjP56ǃ y&h 8Nht%Z j[^6Ӄ w1…{)uj{,ud,u_jh6CPr uS$t*6t!9t6C Pht%CC(=L 9m6qPht% $1\jhP q PZYtuxt6Qhu%,65PPWh-u%] ރ w1Ét7t1z)uz/uuB 0@u1L 9rhQu%Z~)tD 9rA΋u7~.ƒ  ˆtыTHT<&hsu% T@f8f;4 TfHfp48@p4-=@4T@ȉ1T@ ʋp)Љpyhl@Bphl+hl݅ ڽp߭܍  4vٞv؋8p450404(4(4-v-84v 84 6Ѓtl48p4 Ј66 tjh--jݝ8P PWhu%[ 0hu%K 6݅8tS؍1fDžF 󥍅Phu% [^݅8=@4tQQ$hu% ؃t hu% ZT\1NjH9s:4@8t!t\SQRhu%i  B뺉 \ <jhz4T Pm 8iT@f0fp4Cp46sl4p4 ڈ66 P9PWh%4$ T@‰ffP ft2ftGfTffRPh9v%TfPhv% TfPh&v%o h_v% ^6^ TXGTWhj.VSj VT@4'h|y% T@f0fftf_fehVv%Txhdv%3 X6tET@th~v%hv% X%818ߋ0fPH9?H)T@uC=wtvh $i f9ff0P=v 101P 9 7ȋ8 8ԋTp_6t3t uhv%h5% XT@t hi% X 3 hv%Y1H1ۃHu ˃j.RVj uj.h"RJW Phj%* XZHuu hv% Y Shv% XZ eTp\G뉅PT@O9u~TX\H9s&$ -DQt%RP CYXDž8\P9H0sZPh1!#hT%G H9\saTHSH\Zuh $ [.8utSK YƄ0\x61h\$ T@Z<t"<t%T@02h5%hv%} X~^T@0j,~ XT@uFShv%E [_8uD\9Huj,F hw% _X)syShv%Shv%j, hv% T@ZY9Ptj, PT@Ph w% 6P(PWh%4$ T <x2<w><tG<T@8Phw%P $@'<uT@<w*$t'h w%Bh8w%;haw%4hb9$-h9$&Phw%,T@t <uh;$hw%^ Phw% Y[THLhw% T@Z<t%w uh x%<uhHx%hx%R _h3x%Phmx%= [^T@8Ph{x% THmhx%hx%hx%hx%hx%hYc%hx%hx%vhx%lhy%j.STPj uj.h"SR Shy%f j.STPj~ uj.h"SJR Sh-y%h=y%& hb3# T@f8fZYfw2$'hTy%hey%hsy%hny%hv%hy%}9Huhy%nhy%hy% S1ɋHU t Sh{1$hy%&uj.VSj| hy%; [hy%+ hb3#! T@fHfZYfw-$'h_v%!hTy%hey%hsy% hny%hv% X6t-T@<m4t'h"Ph<$ ^_6 6uh8- [g v狝t݃{)!C2t!#t1 hy%3thy% C Yhz% C HC SRRPC Phz% HIǃxPh7z% XZ hEz% XCPhXz% Y^19~gVH!JYZuVhaz%s XZCj.RPj uj.h"RPO PVhpz%/ F땋L 9؋t4p4t9~6 4t49p4 =p4P$ UWVS]u#6tP3^1ۉ66S 6@$ +6Yu, U1҉ 65-t:C@;:uS tD~@tB\u JDN@uǀ:u‰1e[^_]UWVSUtWB<:u1<2E 028uFut<@t*}:u<:t"u}:t;EuݍG1ɀ@t1ɉ[^_]UE@-]USE] u:À|u%u@C8t9EsHt:t @|u1[]UWVS4}!}u[=6tQu Wn[^u<56Pi)YtHWPD3XZh5)^1u?D Dž)Etw}xjjju% !jh@PE xDž1ɉ1ދ9rqhQuƒ ?tuZF 0S09 0HЀ u%V1It 1:u4:ut75Dž\t&Dž t t11҉V9r)ډ)ށVSj,ZYu"S/^u[Ɖ‰,1i<#au SZYNFS;/XDž@-K1j=ht%S Ɗt F:uFHX)ىMQRPu[Ë tK}t uXWt.^tCu F:^DžBDžtB<:uЋ))ˍ x:t:C؋)ȉ)9))))QWU*ZYu:W-Xt uXx- _<ljljƉlj )PVQو SRƈ ,Ymt u^)؍P9s&PS:)ZYuS,( XË Dže[^_]UPjujM UEU6tP 1҉6Y16 661UWVS1=6uE 6=6uYh$60 6^_u=`P56Y[t?Duz1=66t= 6u 66u@ @uP 166P6@Zu 1Uh$PAڋ -f\Yf:u#t =6t|0\L6E|0\u 6N1ɍt:uf:Y\tAߍP56sY^u'6tB @R 16ZD돁NJ|Äu :t@PFjWjM EÍ@ wCe[^_]UVS]u uu ][^]UWVSj=u uj Pjd ^Edu! l4uEdUz}<:<^uFC<:{Mu])CdPV%ZYuV([{<\ůCt}<:tyHЀw1GOD9t0v뛍{1e[^_]UPEPhh`7h7uƒ1uEUWVS} uHu7uuW1ɋUà =d7u u1Ɖ>1e[^_]UPEPhh`7h7uƒ1uEÍP Љ ‰ Љ ‰ @UWVSQBJ Mؙ\&#߉1I wEZ[^_]UE @ U+B ]UM UA+Bu)]UE +E]UWVS(ƉыXB1x}É)M1ENjEE׍9rס<7EС7E=vEiẺMԋEA1PUÉ)‰UM1E‹EЉE܋E؉E]؋U܍9r9Mr(}v k=9s}E܉EEE놋EԉFEFEF ~$Eԃ([^_]UWVSPU} u]RU? $URjW+ $WjV $Vj$S ZE] Ee[^_]UVS@ÉjjjQjRPw tN9tLtHVPI ZY@u:' j@]S09 h"Sh%PD-=7tk 1e[^]UWVSSÃ=7tO1t 7<!j转ơ 7!7)Y9sRU蜬7Z9Uu)@uÅu,87!1ɉ1ƅtÉ5771e[^_]USX?797r7É7 4t1[]À=7UVSh1!#h1!#h1!#h%D-h1!#h"hZm"h%D-D- fC"=7t"%=7t%V"=7tL"QRPh#%Ӌ5D-Gs$=7t%u#=7t%e"=7tXs"%=7t5%SQRP֋D-U@7h1!#h"Ph<%ӋD- Uh1!#h"PhC%ӋD-U7ih1!#h"PhR%ӋD- U7Ah1!#h"Pha%ӋD-U7h1!#h1!#Phr%ӋD- UH-h1!#hs#Ph%h1!#h1!#h1!#h%D- e[^]UWVSQË@xtt*BEB$؉‹E¸1DD@J 9s:tt/Ήz}z$߉}1|C@1҉Z[^_]UWVSS(7,7$7k(0h '@P G1ۉ^,<7~0XY1;,7s6U1h 'GPFKGU C(XYk(|0(7,79subC[^]á7uÀ=D7>UWVS 0DžDžDžjjPh@7jS @u @7j <7P871 @H47hShȀ% tƄ181ƅGhـ%:Xt uʊt͍B<9;$ '7R7F7:7.7"7H-47B9HH-@H-77P-HP-47J9@P-L-HL-47J9~}@L-u7l7c7Z7Q7H7?767-ƅ h"Rh%PD-C7n3D 0=7t h& YP-9L-}L-=L-‰7 <7 07s5,7(747)I $77H 7tH 7 H-7X 7 7Ɖ5757#87tA 757)7=7t*1҉j Ph 5"* h 'h7Aj777h 'h7A117@7}ã7u&@7 1tD71e[^_]1À=D7u1á7u 7UWVS@É;7;7j,¡7_9u739u0PY;7u;7)77jVS0 19Z;P 7PPh7A=7XZVS> Y_@u: j@}W0. h"Wh%PD-=7t֞ 957u"tX 7PPh7WAXZe[^_]UWVSEЉʋ 7!Ë 47)){ MA L>D=7tMjRP/ M957sxu@)lj|| >;7Fs"J| u| | DT>| T 9Ss$EExSWwBED CSWr@;sss{uISC PHBXZ=7uE@,t 7EX,7؍e[^_]e[^_]UWVSƉȋ} 1ۃ9t yYC 47‰ى[^_]UWVS¡ 7!9t> 47)su܋tu 9t)D @!u܋D UEPh7*>@ZYe[^_]UWVSQӋ 7!‹ 47)tu)ߍ41Ƀ9t ^NAt#\| DuD0| DJX[^_]UWVS$E܋ 7!9_C E؋ 47E)puЋ|7Uׅu9u)Ӌs V}t Z}܉E)+F$Iu*w  'w) 'w '1;SsS |C@C;Fu ;u1ɉHt SFP?XZN]H9t9sxt PFP=Y_SV=XZ{EЋT }t Z}܉ыU܋E؍e[^_](E܉EEPh7<Ph7H?=7t KZ{ SC 77e[^_]UWVS97t79kjjh7|>ǃ t؋_ jWh7c>EWh7>7=7;7r;7rw1ɉ Åuj}먋 71ÅuP=7@u1j=Nj 7!‰)[9tP7Y9uō37t]EPh71;XZt>G 9r7 39s0jWh7=EWh7=7=7}뾉؍e[^_]UWVSÉU 47EC1t}9xts@Ƌuzơ7EF}}1U9s;à t PW;Y_YVEÅt@p F E SFƒt )у}T1҉SC11LK87!‰UEO…tͰ=7u =7t 1׋MЍe[^_]UWVS 7!t%:Džtƅu7=71/G _Wh78XZ=7u =7t1e[^_]US97r][][]fUVS uuu=7uÅu6=7t h1!#h1!#h%PD-L 1ۀ=7t1Eu]j EPh 5" ؍e[^]UWVS0u ^uw-1=7! h1!#h1!#hK%}u=7E]!;]<79s 9r97r87։!U!ʉU;UX]ɉMD9r )M?)‰U؋E97=Eԋ 47EE܋U؋Eƅ 7!E_ 47!uX})9]t }܉|C]؋U؋})RUE-Y=7=7)؉EƉ})UEЃEU9UtE܋UЉBẺBEE)PUEE؋M)ZtMϋ 47PUE[=7t=71M79rE 7u!9r)?)ЉEEE ƅu7u57wG!uU)')ȉM؉E܉‰rEƍU)‹Mt3VEp XPh74ZY=7t ?1=7uu01 =7t+ h1!#h1!#h%PD- E011ۀ=7t!1EEEuj EPh 5"$ ؍e[^_]UWVS ]} n҉ƅu=7umttc t tS957r8Åu(2Åt%=7u;7rJ;7sB1߉81=7t h1!#h1!#h%PD-趐 8 1ۀ=7t1Eu]j EPh 5" ؍e[^_]UWVS} u'=7t}EE }EEܡ7;E  79U s=9UE 1 AE1 @9O7;E r.9UrBu9r;7Ӌ P-U !!9u9s87U !9t&U Å=7tE9E r]=7E;E M )U1 7ҋu9sNE ؍ 31ȅu@=7t9u s+M UU Z빀=7E;E }M E돋E!9E79Er79Eu !։UEEEPh7/Ph737PVjEËU!SuÃ$uWh70Y[WwG Wh70XZE9E s=7t+u U ڰZE;E =7tyM )1iE Åt9 7EuE܉ߋu9E s M ߋuMEaTt=7u 13E Åu%蓹 h1!#h1!#h%PD-W ]=7t"EEE E]j EPh 5" ؍e[^_]US ]=7t]1EEj EPh 5" t ؋]]UE]ø`-ø`-UU-fDP]UU-fDP]UU-fDP%]UU-fDP]UU-fDP]UU-fDP]UU-fDP]UU-fDP%]UU-fDP ]UU-fDP@]UU-fDP%]UU-fDP%]UME 1҅tt1Ҁ8‰]UEU ]UEU ]UE]UE]UE]UE]UMU 19t <t@]1UWVSuE 81ۍujPVXt C9]s؍e[^_]USUE 1 t @B9Es[]ڡp-TUEE]JUVSME ًpVPy;P| uE ][^]ݝ r0 [^]nUS4@ 'u ZYuC u1]UUE H w UD ']1]UU1t <t@]UU1t tE ]UEt-fDBf%f]UEM tt 9t1]UWVEu U ^_]UU-DP]UU-DP]UVS]t%;u1!#1!#贶 0PVSh3%h-M e[^]UU 1}w-t:t1]U1!#}3u"]UWVS1ҋE] ypw v w 8t 8u tB18H[^_]UUQ%;<_(s-]UUf%;@)(s-]øUS] uSh- h?"Swt蕵 0Phz1$h-0 h-j 舑XZE-]݈ UEPu u UEPuus UEUUE ]YUEPuuG UEUUE ]-øUEPuu UEEEE ]UEPuu UEEEE ]UEPuu UEEEE ]11UEuE ]USPEtPt 1 +wu PEP}à uE 1]UWVS ‹@E-E11 =E}9s%9]D{t}tk Y DFɅt}uzuB H7BH7 [^_]Ã-UWVSQэX011`xwG0w(XtVWh.t0tyw HutY9}1OM‰"tZM3t`t t$@t39}ǍÃZ[^_]UQEEUEEPEPPÃxuUSˋ@ ى[]ÃxuPH7@H79Ps=UVSÉjRp8 u 1 Cse[^]øÃxu;UWVSÉ׉΋P9PsSCHK 4BRu[^_]US]E xtK1ɺ C H @([]US];Cs 8^u@1ɺlC H @$[]UWVSuxu^ËxFS<L$9rAL$LL9rALL@ u CP PD PQ C< e[^_]UWVSÉ։M1E!ЈECE1EEt URS_XS9s\Ku{tt/t$H9rEPSS|EEр8\u!x|u+8|u$u9H9s9u@}9ut URSZY{ u"E9Cu{uCH7CH7{tK1Ҁ{ut'9s'x9s38\u.x|u(B8|u@B9rJu}u#Ju }t9r'm}u$Eܹ)KPxE܉EEXK+MHKAEU)щCE1ɺEY}~!UK)щK+Me[^_]UWVSË@E)щMt2֋Sʉzt SC} 4ECEZY[^_]UWVSÉ։M}K{}~2}u}D~7v}E}~}t}\$'s`A)VxVu>K)K)21ɺCPY^y)VxK)]K)1ɺACPV*MKZ{uoEA)VHXK)P؍e[^_]}O}M&؍e[^_]5e[^_]UWVSSlj1=p-H9s?MjB,@Pr(2 Mu e[^_]C(S,z{,f P{<t[F-01=p-H9s -29se[^_]UWVSfU0P9s'H9r f8f;}ux]u)E-HuVQM/ t uMQJ ZU9ufG}uf 1e[^_]UVSË@9r{uCH7CH7KP9s+9s'8[u"x.u. K9r !f3r9s:.u z]u{uCH7CH7[^]èu'B -fAf'f` ЃðUS1u4'؛ ZYuCC u1]UUE ft҉U']1]UWVS É1=p-H9s33C8C,E-E-E1E9t*C(p{<t@}f;t5}f;t,Ff9{419ts04f;|f;V~ @1 1{8C pPWZYuF;s$rC8e[^_]UWVS Ë0F;CsGjh|%V>- u 1ɺjh%V!- u1ɺmS j@B@Pr T/ u ؍e[^_](K A QrqЉE1}C @t E@<S9s8^u @E@89]u @]-@-9H:9<]<-3K-9)BC9S9{uCH7CH7S9]p9rD-tN[@3K9ȉu,M؋U먀=Vʀ-ux]Z {uCH7CH7{uCH7CH78Dz@U׉DRO^fE11=p-H9}"uQMBZYMt UGjE@$E@PEp , u j}G W$JO$f4PY{uCH7CH7EH9G8:>x]49r{uCH7CH7<]t<-u{uCH7CH7=ȋUC9r{uCH7CH7S9sH9s8=ux]u {C~8-P9x]x-t  -f9=p-f9~0{uC H7CH7f9UG1=p-H9|f9jE@4E@PEp0* u MA0Q4f8fpBQ4EV~{uC H7CH71E, U%Gu48-u@-U;Cr{uC P8]u H7CH7{ Ex8tC @tEHp-E11}tf~)f=t#M9tFfE@fNt/Ex,x4uzx$utx<un@(ffEf=t^U܉zC P U܋pEp(Ep0Ep t1}U܍D2 9Eu'C HC M+H 0؍e[^_]Fe[^_]UWVS$@ @tbF -f tNt - t< -ff9t-;sEщUfE]EӉC;s$[^_]É؃$[^_]UWVS]CE q39\t[p;sr{uCH7CH7Bׁ)>t~+90y<1ɺE {*.MC @+1ɺ(1ɺ4~t6BЉE8NdBM@a C @Dz({PUCxMu*@uC H7CH7{ G7щ3S9ryn3S9Y>*ubF3CHE)PHAKE)PCHE)PXKE)``[^F9>\~{3ƋK9sI:,uDz;9s6J-DJt%9~{uC H7CH7PU:SY9s"H9s8\ux}uDH9r 9r 8\ux}u{uC H7CH7 1($S B@pr@ wML(h/S9s#H9s 8\ux)t)\ wCDLpS9s(H9s!8\ux)up39Zx*{uCH7CH72SUEECE^ ]k3US9֋My*CU z5{NGe[^_]UWVS]x;s?SB< $'^[m\p{|;{r{uCH7CH7S B@xz@ wt(hw;Cs8)t~)p wCDLp@;Cr{uC P8)uH7CH7 1E1ɺC H @$E1ɺ C H @(븺 몋C @t,SUEECE^ ]};US|1ɺ(N`g;{r{uCH7CH7Pu1ɺ1ɺ!Cxu{'{9Jր?u#@}{C {P9sx -Dyu@<,t<{uC CH7I7}{uC H7}~{u9C 0@}t{tEH7CH7+uN+ueH7CH7-H7CH7C H7CH7+tv *t?{CH)VH$K)PrCH)VXK)`L_X5CH)VHK)P^CH)VxK)K)o1ɺCPO^MNj;SsE:,u@BJ-DJt%9~{uC H7CH7PSY9s8}u @48}t#@9r{uC H7CH7 {9s9r։v!?t{u#P9sP-DPt o1e[^_]UWVS} U0E tEp9) W菈 [jLYt3SUUw$@@EjP|1҉UYZuS'X ]lp1tEEU1}Eu_/DžhQ1311h1xEEMU싅hE1C CE$C1C C$C(C,C01҉S4S8S qAG9r 9Y-EUEfTPffUu}_uc9wu G 9w sFˆEEDPu }_} uAu&}_f}G9G9wNȋ-DJ<_-9wuDJu _lFfDBfE9wu_t fGDB‰Ѐ>_ €_f} 8;w,-DJu _9wu G9w NDJ_9< u AЋ -DQ<_KED%EukKM2KM=Xw=H=P =8tK!=p =x2=h%NC0Y(9u710E%EGPx utڋ)Mu MA}dʼnM)ыU9ruG PV1 uE @MC9uEƉ]]uuu uMrE%EEG]4뺋G]90t10uuu UE)PM7MtE%\uuSuM@ SUT\%=uK똋]G؋HUM+W Puuu uMQƃusGUMLa]G؋PH UM+W PP uuu uMƃuGUMTL Ɖe[^_]UWVSEUM} MƋ]U9UE@EEM %=p=8pwL= 3w$==Sf=|=(4=05*=Xw =H =P<=@=`=h=wE=w=xE=D==fzk=tlw=t#=t1z=ofwWf98f=|TEsf>E]fy%Nf<f%fUB ;E!! ؉ʁU! ˅EHU)ЉEM~! d!EtkEȋUt %AE8! ؁UUÁt!! E=؃[^_]UWVS4ljUMȋEEЊEЈE׋G(E؋G0EܸMjPh{PM UE}tEfEE9G t9GuGt E@fEM E1uE9GtfEE fE1ۉ]̋M9Mu }tEEf} u@uIf}t6f} up`@(E}Qf}tP-1Gu@$E~1ɉM1f} u @uDf}t*f}tr1w@(E}{Gt f}tByf~u"| f}G1҉U}@(E1f}u1GuEf}t}u?f~gGuE1}uf~@}u f~u7tÉEVuuuM UEMuf~u;11ۡ-f}UfMQPf_tIf}tAf}uf})E@-Buf}_uڻzf}-EDBu#f}_uff}thf}u4fzXf}tLf}ufztBf}E@Buf}_ufztf}u;rfzu"yVuSuM UEf}tAf}tY -E@Af}_ fE@Af}_ 8uY8E-DBuf}_f}u7E-DBu&f}_tVuhwuM UEUąUt }udU܋E9UtxM9MtpEU9UtNM9MtFЀ}tEVPEPuM UEuuEfEEGE@}t)EG1EEf} -1Ee[^_]UWVSljMuU;u HE%=Xt+=xtM=Ht3VU=Xvd=p*CEMCEӁt @EM=0t8wUBU==(t=Htw =h}EE@EjuVUEju uM‰9EtMIFjSVMU YSVMjuVUEju uM‰9EtMIFEEjSVMU tUU9tESVMUjuVULEju uM‰59EtMIˍ^@U%tjVSMU 9Et(V^@4֋%=uNVSMUXZ?_E+G Cd_E+G CC DEEuTEe[^_]UWVSljM];] AEE%= wF=(w"== =tf2=0t=`T=w"=k=tr===9uFf;EZ9uF9uFEA 9wG9wt39wu G9w ;w~ G9u G9z> qAG9r 9Y-EUEfTPffUu}_uc9wu G 9w sFˆEEDPu }_} uAu&}_f}G9G9wNȋ-DJ<_-9wuDJu _lFfDBfE9wu_t fGDB‰Ѐ>_ €_f} 8;w,-DJu _9wu G9w NDJ_9< u AЋ -DQ<_KED%EukKM2KM=Xw=H=P =8tK!=p =x2=h%NC5Y-9u710E%EGPx utڋ)Mu MA}dʼnM)ыU9ruG PVt uE @MC9uEƉ]]uuu uMwE%EEG]4뺋G]90t10uuu UE)PM7MtE%\uuSuM@ SUT\%=uK똋]G؋HUM+W Puuu uMVƃusGUMLa]G؋PH UM+W PP uuu uMƃuGUMTL Ɖe[^_]UWVSEUM܋}uE fEӋU9UE@EME%=p=8wN= Bw&==fEf=|*=(F=0He=XSw =H=PM=@=`=h=wF=w=xU=o==f}zw=txw=t(=t8=f}wdUf9U?fEf=|E~fEfflEffEff}yPTfEff<@-/f}$(f}UEMA k MM)ʍ M ыEEHM)ȉETMڊEtwMMсt ڍDU7DE%EMȋMI tE؊DEC[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹ƒ}t H}܉E9C t9CuCtEx1EE9CtffEE fE1uԀ}t!puRU UuEEf u@EuLft:f} upucp(fE}Rf}tT-1ɉMCu p$fE~1fEf} u @uFf}t-ftt1ECEp(fE}{Ct ftAyf}~u fE|f}C1fE}p(1Efu1ECuFEf}tu@f}~kCuMF1Euf}~t}EEHQMuRU tYU9UtQ}̋U֋M}HtuuuREPűM U‹}}f}}t4EC1E>t$E@Ef} -fEEe[^_]UWVSljMuU;u HE%=Xt+=xtM=Ht3VU=Xvd=p*CEMCEӁt @EM=0t8wUBU==(t=Htw =h}EE@EjuVUEju uM‰9EtMIFjSVMU YSVMjuVUwEju uM‰`9EtMIFEEjSVMU: tUU9tESVMUjuVUEju uM‰9EtMIˍ^@U%tjVSMU 9Et(V^@4֋%=uNVSMUXZ?_E+G Cd_E+G CC DEEuTEe[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹ƒ}t H}܉E9C t9CuCtEx1EE9CtfEE fE1uԀ}t!puRU UuEEf u@EuLft:f} upucp(fE}Rf}tT-1ɉMCu p$fE~1fEf} u @uFf}t-ftt1ECEp(fE}{Ct ftAyf}~u fE|f}C1fE}p(1Efu1ECuFEf}tu@f}~kCuMF1Euf}~t}EEHQMuRU tYU9UtQ}̋U֋M}HtuuuREPűM U?‹uuf}}t4EC1E>t$E@Ef} -fEEe[^_]UWVSljMuU;u HE%=Xt+=xtM=Ht3VU=Xvd=p*CEMCEӁt @EM=0t8wUBU==(t=Htw =h}EE@EjuVUEju uM‰9EtMIFjSVMU YSVMjuVU|Eju uM‰e9EtMIFEEjSVMU? tUU9tESVMUjuVU Eju uM‰9EtMIˍ^@U%tjVSMU 9Et(V^@4֋%=uNVSMUXZ?_E+G Cd_E+G CC DEEuTEe[^_]UWVSljM];] AEE%= wF=(w"== =tf2=0t=`T=w"=k=tr===9uFf;EZ9uF9uFEA 9wG9wt39wu G9w ;w~ G9u G9z> qAG9r 9Y-EUEfTPffUu}_uc9wu G 9w sFˆEEDPu }_} uAu&}_f}G9G9wNȋ-DJ<_-9wuDJu _lFfDBfE9wu_t fGDB‰Ѐ>_ €_f} 8;w,-DJu _9wu G9w NDJ_9< u AЋ -DQ<_KED%EukKM2KM=Xw=H=P =8tK!=p =x2=h%NC5Y-9u710E%EGPx utڋ)Mu MA}dʼnM)ыU9ruG PV_ uE @MC9uEƉ]]uuu uMwE%EEG]4뺋G]90t10uuu UE)PM7MtE%\uuSuM@ SUT\%=uK똋]G؋HUM+W Puuu uMVƃusGUMLa]G؋PH UM+W PP uuu uMƃuGUMTL Ɖe[^_]UWVSlE} UE8e p >E F E ЃEF@EFEF=p-lt1ۉ]tMEAEWsO YE}M9M) N,F4EF8EtwF}׉ƍWOt%%"F9rى׉ƍWOuۋ})9U ĸ [^_]ËE@fEEDžDžUD$ D$D$D$ D$D$E$U6DžDžDžDžDžUE@fE@fMIL$D$ |D$D$$" t$ D$D$ 4$! EDžDžDžUE@MIMI Ɖ ȉ } Dž UE$8D$D$Ɖ$|D$:4$ Ut p9EDžDžDžDžZ DžE@fEEDžDžkzR%KwҋD9V9s%u9sF?V?4 r9i_oJseNN9sVu鋽D$ }D$D$$t V9sNu鋽E@D$ D$D$$ ^V9sNu鋽*N9sVu鋽seNN9sVuseNN9sVu=Ex @t:ዕt9seNN9sVuseNN9sVu yseNV9sFu鋽Dž6pSseNV9sFu1fTA D$(A D$$AD$ AD$AD$AD$AD$D$ D$D$ $ ȄLN9sVu鋽AD$AD$AD$D$ D$D$ $g lBD$D$hBD$D$ |멋AD$\AD$XAD$TAD$PAD$LAD$HAD$DAD$@AD$<AD$8AD$4A D$0A D$,A D$(A D$$A D$ AD$AD$AD$AD$D$ D$D$ $_ dAD$TAD$PAD$LAD$HAD$DAD$@A D$<A D$8A D$4A D$0A D$,AD$(AD$$AD$ AD$AD$AD$AD$D$ D$D$ $ N9sVu鋽N9sVu鋽}nȉN9sVu(@D$ D$D$ $ N9sVuA D$A D$AD$ eD$D$$# {V9sNu7@D$ D$D$ $ N9sVuD$ D$D$ $F N9sVuZD$D$D$D$ D$T$U$"N9sVuEDžDžDžD$D$ D$D$ D$L$U$mtN9sVu*})mUE@D$ weD$D$$ EDžDžDžDž DžUyzUWVSt.y óU11 rEEEEEEEEEH>U DEED$ED$$`;U}ĉ|$T$E$5 ƃtdE$ 5 ƃt'D$ED$$ ;1҃ډj6 MD$|$E$M5 I6 M?6 8D$ED$$:6 8t[^_] 6 UWVSP w ADž/devDž/XtyDžyXXD$e$c;t-ƍD$D$FtH4$ 4$<D$D$ D$D$u$UV@Džep40ƅpD$D$<$:ƅt踗L$D$<$>uD$<$>tg$;nCN4 P [^_]34 8u)΃wΉ<$;uD$D$<$9`c:EE ut|$E$+ Ut#ED$D$ $聴EtED$D$gt $m 1P [^_]KDžUVSt mED$ED$ E D$ED$E$tK ƃt?uE$\9E$c8[^]ËEUE$59[^]þ[^]UVS Pt ՁI ; D$D$$ t@ $ ` ǃ $8ǃƃ 1 [^]1 0ǃ $k8ǃƃ t1 0ǃ $08ǃƃ 1 UWVS<4s ùuD$/4$ D$@4$6ƃ%D$T$$q60 4$z7Ƅ=D$D$D$D$ D$D$ D$$ tVuw: ul<[^_]À uM. Ɖt$ XD$ eD$D$4$ =0 ? 0 UVSq 9u 3D$/4$ "t$ $! c D$D$$( BD$ D$D$$p !Ѓ D$D$$~1[^]YRD$D$%@4$r4D$t$ $Ɏ *- Ɖt$ XD$ eD$D$4$5 =P. ?)1$1 tƃ Y$. 8#t. 0z. 04$ƃt- UE$]fffUWVS o }E@ E։υEE y ]]U ] }ED$D$ $D$'ЉM;MM }$UM T$L$ U$D$N'ЉM9ureMϋE eƉϋ]ڋMщeʃ}u؃ڋ} } ]YpAhQl [^_]1 [^_]ރEE9EE }E2MϋE evUWVSPn É{D$T$|$$|$D$$D$,H*)R)L$L$|$}<$teEU +D$T$D$T$ \$,K)v)D$T$)iD$T$ e[^_]øUWVS8m Ǡz}܉E؉Uȋ-8}tGC@%-Z+]E[t_E@Y‹}DG11]a 5 ‰EtvEЙ׃ЃE؉0xE܃Hʋ]DKEܸ9 }KtO0)Ӊʸ9иbv-t9+E]܃}thEȉE̅um 8[^_]E@ta(uk1f)uAÃPt((uރEPXEȉ 8[^_]18[^_]Éc}ȉk}ȉ^}}Љ}9s]tSÃPuހ.tEȉEt,}-UЋuԍLDFt uf}am}a.m.f}pmR}p.m.1EЉ$] 1E܍,e'D$D$EЉ$]ݬ t#tWuՉD$EЉ$] u݋FV }؉WF2}S1}؉}+E܍L}̉eD$EЉ$] tu}܍"D$EЉ$ KLeD$EЉ$]f Hu݋E܍l}ȉeD$EЉ$]/ u݋}Љ<$]p |?sE܍lD$EЉ$] uE}u8}DGt.E܍D$EЉ$] u1ۋEЉ t.u}.E}Q} auD$EЉ$] usu̅u#D$EЉ$] uݸUWVSdg tƋ'<'wwEVN)щȉMEED$$Bgt_FMȉFD$F$gt:F]؉F>FDF 1[^_]ÿ'E {UWVSf tD$\D$`D$dD$hL$tL$D11rD$DD$xD$|$$1D$TD$PGD$LD$T>,I\$XD$Xtt$T=qw 9;D$Lt$Xtt$T=qw 9;tD|$P\$XL$HD$TD$dU ID$Tb\$XL$HrAKT$X)Ћ$‹RD$\T$`F3W:D$|t$xt$X$1;\$H\$PD$Ptqwt$H<g9D$XrD$TD$X$ h$$hD$Te[^_]D$\D$`CE@$@@(L$XD$|)ЉD$|$)щ$L0lPT$|@A$D$\T$`AQ T$TeD$T!,I\$XL$XD$|)ЉD$|$)ى$LiGtсqw 9;lJ;$rD$DD$|PT$|X$A$D$\T$`AQ JD$T\$XL$HƉL$HD$|;$rD$DaD$|APT$|X$P$T$dL$hPH JD$PtD$PD$T$L$HYЋAԉD$81\$(9ډËT$8QˋIL$0;T$@9щ‹L$0ً[I<9qUD$(B$L$HAQD$ D$<Y $\$щ‹EL$XD$|)ЉD$|L$H)ى$LE@ $T$HJZ@U@pHhXl둋$L$HAQD$ D$KA^D$xD$XD$T݉D$xD$XD$TD$dU DD$TD$xD$XD$Tt$P\$Xt $D$|;$rL$PD$DL$PYD$XAD$|PT$|t$Xp$B$\$dt$hZr D$XJD$Pa,ID$H&E@ $D$H$D$HD$\ E@$D$HE@$D$HvE@($D$H_E@$@($D$HDE@$$D$H-E@ D$8_$D$HX4""""9ȸ"""3ȉ)L$8 I] ApAhQl5$D$H@MQ m$($,$u@yރ1D9$($,DŽ$\$P $D$$0$$L$$\$($ \$$D$,$$L$D$DŽ$DŽ$DŽ$DŽ$DŽ$$\$,$à $  .D$ t$$|$(5 D$ t DŽ$L$$$$\$PD$TT$XL$$D$L;$o ;$b D$D;$Q D$<9$@ D$,;$/ D$;$ t$T|$X! $D$DD$D a$4D$P;D$L%w\$Tt$XD$\D$\ t$D9%Gtԋt$Pv WL$T\$XL$l\$pӉD$DŽ$DŽ$DŽ$D$T@D$<t ] 1uUT$$]AtFuɿ [^_]UWVS9 Gt:>t M1uU T$$-AtFu̿[^_]UWVS,9 ñFt: >t M1uU T$$@tFu̿[^_]UWVS 8 JFE $"} ƋE%EEqeUuUT$$ … U>t M1uUT$$ @t1FűuUEEu54$;E [^_]ËUt }1]uЋu9t!$U D$UT$4$ E0E렃}tE1҉UWVS7 Eu Ex}u 4t+D$4$4?uE)E@ [^_]Ë t 1[^_]Ét$MD$$zHUWVS7 ÈDE D$E$P D$ED$4$RNjE8tB 8"tn# uOt$ E D$upD$$҉[^_] 8"u썇v$뱋 t[^_]ÍvҋE D$apD$$|GUVS6 ËCuF$~9F $s94$k9[^]UWVS5 OCE 1t 8u$0E]M $y NjExlD$4$4MA XEU PMqeEED$<$Dž?nED$=<$螽 HE u M D$<$d~kD$E D$ ED$D$4$tWD$D$zd@ $I  $D$$ |$$/ƅOD$E D$ ED$D$$$+} D$E$膱PtD$$}$4$4M 8[^_]À>/uEt$D$<$ t'D$<$^ 8E D$t$E$O}8[^_]ËE D$bD$E$NE D$D$D$ ED$D$M$ՠ BE D$t$E$COg: E D$pD$E$ENDž1D$ pD$E D$E$Dž1` E D$pD$E$M10$% t$ 'D$E D$E$7<$1pD$E$=D$/4$H E D$tD$E$!MDžDžk E D$:W E D$:WUS(]. ;EEED$D$ED$ ED$D$E$貞 x E([]øUS(- v;EE>ED$D$ED$ ED$D$E$F x E([]øUS(- ;D$ D$$?D$D$D$D$D$ D$D$D$D$ $ԝ x D$([]øUS - Ñ:ED$D$ ED$ED$p$9.x E[]øUS, 8:E$yU, :Ut ]Í]UWVS`, 9}|$E D$E$J9s [^_]^ ?|$ t$D$$[^_]UWVS+ t9}|$E D$E$K9s [^_] ?|$ t$D$$[^_]US + 9E$o t []ÉEpT$$EUS :+ ÿ8E D$E$n t []ÉEpT$$EUVS* q8u4$%t[^]ÅtEt$pT$$EUWVS* 8u} |$4$)t[^_]ÅttE|$ t$T$$EUVS;* 7u t$E$V*t[^]ÅtEt$qT$$EUWVS) h7}|$E D$E$L u[^_]É 0|$ E D$(D$$[^_]UVSx) 6uE D$4$t[^]ÉEt$"qT$$E[^]US!) æ6ED$E D$E$uE3qT$$E[]US( S6ED$E D$E$tuE3qT$$E[]UWVS$y( 5D$ D$EUD$T$EUD$ T$E D$D$E$ Ɖ׋D$ u $[^_]J L$ EUD$T$EUD$T$E D$ ED$LD$$$[^_]UWVS$' <5D$ D$EUD$T$EUD$ T$E D$D$E$Ɖ׋D$ u $[^_] L$ EUD$T$EUD$T$E D$ ED$D$$$[^_]U& 4U!MፀL]ÍK]Í]Í]ÍO]Í!]Í]Í]Íg]Í]Í:]Í_]Í]Í]Í]ÍS]ÍǮ]ÍS]ÍR]ÍV]Í]ÍQ]ÍF]Í<]Í]Í]Í]Í(]Íu]Í]Í]Í]Í]Íc]Í=]ffffUWVSP X$Hp)9s L H 9r,P 9s P P P$@(@,[^_]Ë #p VpUWVSL% 2ƉUx HEU D$ T$ED$9s)L$><$~F [^_]D$$ۋP Hx,tP(9s ,P P 9s 

S S KC S$T$ʉs[^]UWVST8$ 1E}>11L܃r׋EEċE EȋEUEЉUԋEE؍WỦ< <<] E;EriEE؅eEU9s UEUȃE9sv ED#UȅtEDgET[^_]ËU#EE%ju}ču܋EU$T$?uẼƉE wt ~ 1ҋM!E! tE̍PUP v)E;Es MĈEEU̍JMR wډuuUtE;Es U>EE1ۋE؅EyUE9U9v UD#Eȃv UDEȅUDwMaEEEE}ωu΀FE:j=*}_]̋MEU$T$ڋ}i]EE߉]̃{u]bO?_]̋EЋU t1҃EE̍PUt'E;Es MĈEEU̍JMu܉E}ESfO?~w<@p]fEЋU t1҉EU<@t$ t1!E!UGE̋EFE̍PUE]Ȅt&9s MĈE]ȃEU̍JMu9s U=EEEU$T$U]}EEf@E%#jxE%#joEUE_]̀}FGG9U}1 CEt'E;Es MĈEEU̍JMu܉E }EEEv_]̀}fGU}1 HE;Es U=E]̃EQpEЋU t1҉EU<@GE̋E"0]̉EUD$EUD$ T$ED$E D$E$p]fffUVS '+uED$ ED$E D$4$ED$ED$4$U[^]UWVS4R *UEzlj(aED$/<$螥 t<|$7D$ED$ ED$ED$4$/4[^_]ËE =E|$ED$bED$jD$ED$ ED$ED$4$u 8upED$ |$ED$ED$HqD$ED$ ED$ED$4$|MO 8u 2EL2 8t ED$|$ZD$ED$ ED$ED$4$  US )EU MP]]] ]][] USEU M]]]] ]][]fffUWVSt. ó(D$L$<$c9t$!D$<$n1 Dt$D$$ynũED$ QqD$D$$irt UWVS F&D$ED$$#t{NjE88/tbD$/4$k…tL)JBU=wsG|wdD$}|$M$w Es(uuE[^_]É[^_]äftUuu%1[^_]MyfUWVS ;%}UtlƍxD$4$G tD%=`u'2$U tĄ[^_]v O1Ą[^_]\ 1UWVS Ô$}U)tlƍxD$4$QG tD%= u'=$U tĄ[^_] O1Ą[^_] 1US(m #EEED$D$ED$ ED$D$E$† x E([]øUEM tP8u ߉P81]à ]UWVS  Z#}tc$vUT$U T$$, ƅt/tV$/ uDt$D$<$MƉ [^_]ÍD$$u [^_]U  "U T$UT$-7$]U EtUT$U T$$]ø]US  ="E D$E$`=u$ED$ED$-7$ []øUVS d !uED$E D$4$x=uED$ED$4$H [^]øUWVSL Ô!E uUŰPUЋPUԋH M؋HM܋HMHMHMH M@$EЅ$vEPU@E)99}W~E}ủuĉMEU1NjEĉD$ t$EȉD$E$qE9}u֋UȋED$T$E$J<E$e1L[^_] 7Eԋ U2bL[^_]UVS4 I uЉt$E $^ED$t$E$y4[^]U   U T$UT$-7$D]UWVSO uEE}ED$E D$4$Z;t}EE u[^_][^_]UWVS4 t-78ủt$E$聣E D$t$<$4[^_]UWVS +EE}-70E D$ED$4$:t}EE u[^_]?[^_]UWVS4A uED$E D$4$U:t%}̉|$E$轢ED$|$4$4[^_]UWVS4 g-70E D$ED$4$9t%}̉|$E$YED$|$4$w4[^_]UWVSH~ MU }Aq)9y}ȋ:}̋z}Ћz}ĉ}ԋz }؋z}܋z}z}z}z }R$UUątj~;ƍỦUĉEuƉϋEĉD$ EȉD$t$<$!nE9u܋EUȉT$D$ $M8M $1H[^_] 7}ԋ Uy'H[^_]UVS4d uЉt$E $ED$t$E$4[^]U  U T$UT$-7$u]UWVS tuEE}ED$E D$4$7t}EE u[^_][^_]UWVS4 -78ủt$E$!E D$t$<$4[^_]UWVSF EE}-70E D$ED$4$L7t}EE u[^_]p[^_]UWVS4 fuED$E D$4$6t%}̉|$E$]ED$|$4$ 4[^_]UWVS4 -70E D$ED$4$6t%}̉|$E$ED$|$4$4[^_]UVS  äEM thP8t P8Ɛ-7@:t1 [^]ÁP89D$D$@37@<$GH8붸 [^]UEt @:]ø]UVS t d-7t^--T$XT$$3Ƅ-7tE$\1-7$S$-7 [^]Ís$3u뎍vq$7$譟fffUWVS0 FuzE$z~}UU}} M߉ME؉4$#aƒ  UFD$ D$FD$4$蟉U9UX9UF?M- DQEmML$D$4$34$W`ƒ4S;} E8E}E;} tu}MMD$ FD$FD$4$fD$ FD$FD$4$fMAE9N~D$FD$4$!3mFM9ED$FD$4$2EE9;} tɀ}TUD$ ED$FD$4$fEHU9ЋUE9F M10[^_];} D$ uTED$FD$4$eED$FD$4$12xD$ D$FD$4$eeFD$FD$4$GeD$ FD$FD$4$&eFD$FD$4$1}tE9} uD$ FD$FD$4$dFD$FD$4$j1D$ ML$D$4$dFE[^_]UWVS0 qE}GDEE-798GH%EW,_]ԋG1ɋ];_]]؋R_]܍49;EM}u5W,M؋ +JMIʉʉʋMUMfF%] ؉Ft$G|$] fFuE9sMF^U9jbځM9OV Df~9E9rMutPG,]؋ˉM+XÍ@‰ЉЍD$ t$EԉD$<$]虁MEE9G~0W,10[^_]Ã]1^E:<$]?}1U \-7$]UVS 6-7p t4$u N8@[^]ø[^]UVSl ut4$nu N8@[^]ø[^]US$0 õE UD$ D$D$D$T$T$ D$D$E$$[]US$ \E UD$ D$D$D$T$T$ D$D$E$$[]fffffUWVSn } uUE%tUG$ Ul 7tUF$rU/ 7tBU$U 7,048<@DHLPEtE@$9 7  $(EtE@$ 7TX\`dhlptxE tE @$w 7|UUUUUUUUE}$tE$@$X 7U UUUUU U$U(Uċ,Eȋu(tE(@$9 7ŰUЋUԋU؋U܋UU䋐U苐U싀EE@@t ʋ}wHt ʉt ʉt ʉ,t ʉt ʉ,t ʉt ʉTt ʉt ʉ`T|t ʉt ʉ\|Mt ʉt ʉXUUt%  TŰE@|E@hDž$&' E@,8@1fN9 4>ff~~ tωv$uE@,8@4F uf~n$O HG 9u͋940f|0yW}$G,@fD00f|0y.GDfJT$G|$uĴ[^_]Ë$#E@,8R|)4xLlx9kf+fdG9R)fL29R4 ʋ fbJr tv$uE@,RD 9YUR, rfVAtωp$HN HF 9u͋tp9dl9h0\d$xy DžxEP$ty DžtEL$~y DžEԉH$Yy Dž4$1y Džx|Ƌ)΋)ȉlp9`l9E@,H1҉tvf~94>ff~~ t‰ljv$ u}O, I4F uf~0r$"4O HG 9u͋9 Ƌ9p9pDžAlxE@,8@xM8MA,@ƋQHVfF94QDfHD$A|M$uDžGGG GGGGG G$FFF FFFFF F$,B0B4B 8Bff~~ t‰׉v$u}O, 9I4F uf~k$b O HG 9uϋ9 p|9|)ȉ9xE@,@u0F,@‹NHJfB91ЉNDfHD$F|$YuXx-7}9Gx E@,@1fF9x4dff`FF tƉv$|uE@,@4F vxfFXl)\N HF 9<$gu,9|?EH,|f+f49@)fT094‰PЋLf`\Pp tv$/uEH,@D gE@,pfFE^*LN HF 9-$ utE@,8@1fF9t4PffXFF tƉv$uE@,@4F otfFMh&LN HF 9;$u9|EH,|f+fD9@f+f|094xH8f`Txx tljv$uEH,@D8 KE@,pfFEЉM,LԉN HF 9Nj$nu3|-7}9GG800D$E$/f1UWVS| ÓUu}}  7M  M 7  7  $( Q 7,048<@DHLP ,,} 7TX\`dhlptxE% TT} V 7|UUUUUUUUEE % ||}$ 7M MMMMM M$M(Mċ,UȋU$ UU}( 7]̋]Ћ]ԋ]؋]܋]]䋙]苙]싉MM( M̍M̉L$ T$D$|$t$D$ D$D$E$|[^_]ÍD$E $tUD$$t1D$4$t,t$<$ct}-T|$E$Dt} |D$E $t}$UT$E$$s}(EM̉L$E($syU$ hU$T$ U T$UT$UT$UT$UT$ U T$UT$-7$w]U$  U$T$ U T$UT$UT$UT$UT$ U T$UT$-7$]US9 EŒ-7t0ÁtZD.7tu-7 %BH[]US aUE t0ÁtZD.7tu-7 %BH[]UWVS Eu] %tFDU.7^HFE~TFU1~_V,@M}@t~D8x ߉xf@9uڋ}9}uD$4$]]1[^_]Ã9}uf-7 Y[^_]U UT$-7$]UVSy Et=PHӁ.76u @D [^]Éց-7;1uڸ[^]UWVS< ÑU Etzu<[^_]ËB$E@DE̋E@HEfEE@LfEEẺED$E@|$dEx|U B$SU BMADBEȃvgDE9tKuU M$88@MąɋU  AxDE9uU <$U %.71t MAHALQDUEfEfEE}}ȉ|$A|$[|$E$1ҋEH~]E@,<1E@~=U E9p~*W DtL$Eȉ$E9p֋UăE9PD$E$ [<[^_]ËMA|tBf-7 U $@EH|U U UT$-7$_]UWVSg }-70t=Gt6G$ &|$4$D$4$(Z1[^_]ø[^_]UWVS u} t=Gt6G$&|$4$D$4$Y1[^_]ø[^_]UVS EM tlPHց1.76u7PDQAP|tA\Rtu1[^]Éց-7;3u뭸[^]U UT$-7$J] fǀ UWVS8 Hu-7E8-…2-7E̋2-7E؋2-7EЋ2|-7EG x-7EG$t-7E܋GTp-7EȋGXl-7EԋG\h-7EG`b-7Gla-7EGm`-7EGnE0Ћ2E̋2E؋2EЋ2EV EV$E܋VTEȋVXEԋV\EV`FlNmEĈVnE4$"F-71ҋ2‰T$$V -7V-74$4$ 8[^_]-7E-7E-7E|-7Ex-7Et-7Ep-7El-7Eh-7Eb-7a-7E`-7EUWVS }D$4$ƅEdž3E Fdž2dž2dž2dž2dž2 3ǃ džh2džl2F`fFddž2dž3F FFFdž3dž3dž3 $3dž34$6t$<$}o2PJpdž2D$D$D$D$ D$D$4$TFD$D$D$D$ D$D$4$F4$a4$譏D$D$D$D$ D$D$4$謡F tjD$$4$$4$t4$4$6HH-7t 3t4$#4$A[^_]Ë2t$fd2$g29tDžu拆3$,4$$1[^_]ËRhD맍s$RDžUWVSW }2t$c2$ig29tƅu拇2$g"<$a3$3$t-798t<$b[^_]<$L[^_]UWVS /u, +9uǃ >ǃ <ǃ ^ǃ vǃ #ǃ :ǃ 'ǃ #ǃ #ǃ #ǃ -ǃ -ǃ _ǃ  |ǃ$ oǃ -ǃ -ǃ <ǃ >ǃ *ǃ !ǃ  f2E@tgt.Ex tAu[^_]ËE싀t(VT$V:T$ D$D$E$ 1, Tp=u[^_]US ÎM1Tp, =u[]UWVS, ], EƍME$+FF(9u݋uD$$ 8Cuxu=D$$$3T$$ǃ !ǃ +ǃ !ǃ ,ǃ< !ǃ -ǃd !ǃ .ǃ %ǃ 0ǃ4 %ǃ `ǃ\ %ǃ aǃ$ ǃ fǃL ǃ gǃt %ǃ hǃ &ǃ iǃ %ǃ jǃ %ǃ kǃ %ǃ lǃ< %ǃ mǃd <%ǃ nǃ %ǃ qǃ #ǃ oǃ, #ǃ sǃT %ǃ tǃ| $%ǃ uǃ 4%ǃ vǃ ,%ǃ wǃ %ǃ  xǃ ǃ$ ~ǃ #ǃ pǃ #ǃ rǃ d"ǃ yǃD e"ǃ zǃl ǃ {ǃ `"ǃ |ǃ ǃ  }E2xU, U}tPE}Uu(x<uD>E tAuЃ,[^_]ËE}܋u苗t(MIL$V:L$ D$T$$Ep, }Wp}^X^X^ X ^X^X^X^X^ X ^$X$((9u,[^_]$> $< $^< $vd $# $:\ $'|$ $#jL $#Xt $#F $-4 $-" $_, $| $o $p $r $y $zD ${l $| $}n UUS , ]p JHJHJ H JHJHJHJHJ H J$H$((9u[]ffUWVS0 EU܉MDŽ-772EE4E, fEE$ƒ=4M4%y 4 44fǃ, EDPf~M䋑f8>@E, fWfcftf.MlU܅t-7Q)ʉ$1E$ƒE@ @M M4 /UfB 49}} 4% 44;4yf, @"7f1҉Ѓ0[^_]ËE44%y 4EDPf, y4D$ D$D$$- 4449)‹4L$ T$U؋MȉD$E$4;4U}dž4…f, 4xp4fǃ, +E$/t3E$=Ec0U$)4fǃ, E܅U 0tE@ U؋4 E44B%y 44D$ D$E‰T$E$y4%y 4 494114M%y 4;4$fǃ, Mԋ4D$ T$U؋ED$E$U؋M ~4y 4 49411x 4Wy 4 494@"7ff, @}AEE܅U$D-E$ƒUE@ @MM MtU-oE@ U؋4  UfB 9 4)fǃ, &E܅{t-7Q)NUj 4}} 4Hx6 44m4%x4|뿃ߋ 4}} 4%y  44;E@ }fG Ef` -D$ D$!D$$N $XdU ›Efǂ, ǀ4ǀ4ǀ4ǀ4ǀ 4]UWVSX GuDŽ-7MV8у$33-EEt-7E(V8t@N<)tE11iE}uDX[^_]ËFv3@|-7D$x-7$#ǀ3E AX[^_]EE] (.t&KEEED$D$ F@D$EĉD$Ủ$UuQUT$4$ M)v4$ 33} -!EED$D$ F@D$EĉD$}̉<$P|$4$& E1EE$E%V88uF @tG 8t!F }fG %E g3t&|-7D$x-7$M1҉3E@ U .UT$-7$]UWVS { u}ED$E D$4$t} u [^_]r [^_]UWVS ' ìu-78E D$ED$<$3tu } [^_] [^_]USп UE$ []fffffUWVS 衿 &Ɖ$Bo $艺…t"ׄtN<$tȃuЃ [^_]ÀF$G Ut p@뮃$<UVS ÑƍD$4$Co ~qD$4$)o 4$yn vlte110B<1ɀ;Pt0tD~ȃu9mt(B< v-1ɀ;Pu1[^]ø[^]É묀;tD01ɀ ɉ떀>uF[uVmtÃt0ZcWKUWVS0Ͻ TUu :uH2tU$9LUF@fu2ML$ MD$T$<$S2MEPJ(N$JN 3\q$ JD$D$$hFTq$D$D$$7FXV ~$x-79|-7NTt-7 p-72P3B0ozpdH12džp2E苂E싂TEtU܉Udžp2ELɉME*EEUwD$Eԉ$U;E܋U؉$'Mԉ $E܅t2džx2EtEJdžx2dž|2UtE.dž|2E؃0[^_]ËHt1@@Dǀ@l@hǀǀǀ<HHpF$B(KE`U܋ED$<$j U|E>U܋ED$<$j Uu p2EU܋ED$<$bj Up22@@ ,F@f`L$ D$_D$<$2E41E$D$E$i u džx2EED$E$i u x2|$E$ji x2Et ED$E$:i u dž|2EtD$E$i u |2|$E$h r|2c~ LSMt|$E$h u x2dž|2EEdžt2džx2dž|2džp2MzEdžt2džx2dž|2EbtW|$E$g uDx2dž|2džt2džx2$Ⱥdž|2EEdžt2džx2dž|2E&U軶 D-7D$E$]US蓶 Ex-7H$ |-7H t-7HT p-7HX b-7Hl ˜-72 p2< t28 x24 |20 2$QC[]U }M„-7tJXp-71]ø]fffffffUWVSLjMEE_9tBfxft0fu9PuԀ}tMHE 9u[^_]M@EE D$E$UElUUWVS  ǝ}ƉDHfx 4 [^_]Ëf=tnfDN4f>tM$]辯QPf9uǀFF [^_]ËEFf\Nu]ED$$]耴MME$ ]*UMtbf@f@@ f@@f@@]\]X ]]UU9uU]0$$uG]-D$ D$D$$< $9G]\$覺$GUWVS 7 üƉ׉M$b ttLMt5$LVp9uϋ}E$TF [^_]É}UWVS蓲 Eu^9t)fxf8u@$9u׋~1$]9> $]詵4$衵[^_]UWVS X9t0fx4ftfu9VuF9uЃ [^_]ÉMFUFҋUMuUM$MUUWVSt }fǃL $YPf9uǀ2ǃP ǃT ǃX lN2@tL$x` =w4D$T$$N2D9u[^_]Í\$躷$0DUS U ҽE E„-7t+2UT$$UPE []ø []U xUM ~*-7t2t 1]É1]UWVS 襯 *DŽ-7te3339}}<31 [^_]à D$$胯‹t!3333뱸빋33D$BD$$V 33]\33o'U ˮ TE-7t%2UT$$1ɋUE]ø]U} M„-7tJTt-71]ø]UWVSI λ}<$}ƃuOG @tIXl 8u?DŽ-73t-|-7D$x-7$yqǀ3[^_]UWVS ʭ OEU-72El EE$3=X %y P T fǃL LNfu f9qL fmffjMUU$ E$mE@ @ME@ M P %y P T LNfL X T yt鋓P X 9fL y [^_]ËE$At3E$8=DEMR [^_]ÃUfB X T 9|l <X P 9fL [^_]ËP %y P ;T fǃL Eu-E$E@ @aσufF t-7Q)=X T Ef` [^_]ÿ-D$ D$ D$$3 $->UWVS$H ͷuDŽ-7M~V8у$?p33-M MEt-7BEF8V<F11‹FUS 袇 'E U@37RtI|t79T$D$$x-7ǀ3@$ 1 []Ëxt9T$D$$/-7ǀ3@$ 뵸 []UWVS ن ^EƄ-72tt_ [^_]@37@tǂ29T$D$$@$  [^_]@37@@ttǂ2@37@jǂ2U -72$]ffUS]E  }t J;}R ;~1[]ÃUWVS虅 }tG8 uZ@u[^_]ËtG~W,EO(G\p;}@ ;~E9uՋu뭉<$VG8UEU t9P| @,]1]ø]UWVSu] UtSx]F9}VxR)9H t7~,}߉ˋF(D$NQT$$U91[^_]É봸UWVSu] UtTx^F9}WҐxR)9H t7~,}߉ˋF(D$NQT$$U191[^_]É봸USEt"H~X,19t t[]1[]UWVSu~~?F,E1ۋF(D$NQT$$ًU9u1[^_]øUWVSu~~?F,E1ۋF(D$NQT$$ًUI9u1[^_]øUWVS}] UuG9)9UtYW,G(tX] UG(uU r9|_9}G(r 9 _9}"E E9E |1[^_]D$OL$$bE9oƉ\UED$ PT$D$$]UWVS}G~CW,EH;}@ ;0~09Ut_(Gt} u̓1[^_]USEP(]U@,M H;}@ ;~1[]UWVS}t@G~2W,EO(G\p;}@ ;~9Uu׋u[^_]UWVS]t]{tVO~Ww,19tItC~2S,EK(Ctx;}@ ;0~09Uu׃[^_]Ëu[^_]UWVSĀx R433x,}396F8 ,4};~E<E1uuuuủuƉMD>EED$D$ M3@@D$ED$E$OV,UD>UЉ$IUЋM;4ED$ EF,D$D$3$bED>$EENjE94~WD>D$E$CE!эP$U. D$UT$ ED$D$4$;EE[^_]F,D$D$E3$EV2MD$ T$FD$4$D$M2$ҸEE[^_]ErUWVS8-~ òƉU̍R4EԉuЋ4M8<$- ƀ?tqE4EEEEE'E$荄M9ErIUU)ր?Et7E܉D$ t$|$E؉$舂Ey8[^_]EEEԋ@tCuҋEԍPMulEEЀ4uŨ8[^_]}E)9ǃEԍPtt$D$ $U> U)uMtMȉ׋uԋ6sRtftE‹u)uEmut$D$ $U UIuE)muuzEfUWVS,3| øEօE93}ʅD-?@tDG@uM$Ur+ MɋUM4M׍MMu܉ƉUE$Ut7)ր?t.ED$ t$|$E$[Eyĸ,[^_]Ëu܋U)׉|$$…tٍNDvu4]Xʉ1,[^_]ø1ɍ=1USz fEw"D$$=3[]øUSz #-7t3tUT$$\[]øUS Zz ߇-7t&3tU T$UT$$( []øUSz Ô-7t3tUT$$[]øUS y P-7t&3tU T$UT$$ []øUSy -7t3tUT$$\[]øUSxƅt,)‹M tEt|Etuu)1 [^_]ËE tmEtYutREM.7 u)1MfT$|$E $wE 01f%и [^_]øzUWVSp ~EEuE $wƒw]}E(1M149rEtfEt1[^_]ÉEE $v,} E9tl$vtEHE 103EE1MM9rMEtfEtЪW‹EHE 1uu1U7U9rUEtfEtE%}.7t]ft  ؉EP1u 9r[^_]ÉE'[EGfmHfmBЪEfmEH>UVSTn {UE ӁttH@[^]Í 7ʋ JHJHJ H JHJHJHJHJ H R$P$ [^]UWVSm 8{utv4$}uVȉ‹9u F0$qF,$p-79pt]9p tJ9pt2t$ $p4$p1[^_]@u@ 9pu@9p uUF4$up>9UtU?$9Uu~X24H90t…#ȋH90utJ$p2UWVSul ylj֋@X2BTttO@ ttO@ ttO@@t tO@@ttO@ttO@ttO@t4tO@ ttO@ @ttO@@ttO@t@tO@t"(ttU<$UtB8tt<$u 1[^_]ËGX2G@%G@RR8t Ɖw@Ѹ[^_]UWVSj xƉ׋@X2@Ttf@ tf@tf@@tf@tf@tf@tf@tf@ tf@@tf@tf@u=uAuIu 1[^_]@37@@8tf@ۃf@t4$t4$뭸[^_]USEi vMU -7t%t X@t @@f%f1[]ø[]Uh vU-7M u]]]Uh VvU-7M u]]UVSh (vE Œ-72Uu0ÁE% úډ1[^]ø[^]USEh uU-7M u8tHX2H@H@[[8u1[] ʉP@[]Ug ou-7U]QUg Qu-7U]UVSg .u-70tFFX2@Ttf@4$4$@37@@8tf@U1[^]USEM Ut%t X@t @@f%f1[]ø[]UEU Mu]g]UEU Mu]3]USEUu2U Á ӺEڋE1[]ø[]USEU Mu8tHX2H@H@[[8u1[] ʉP@[]UEt@@]ø]UU E]UU E]_UVSe qsutFFX2@Ttf@4$4$@37@@8tf@U 1[^]}e s@37PT1 t t t@t̀t(t t8t ttLt 1d Fr@37PT1 t t t@t̀tt4tt t@t@t(t t8t ttLt 1ffffUVS c 'qu4$B D$t$-7$) [^]UVS ec pu 4$ D$t$E$ [^]UWVS ,c ñpuE Œ-7:x1u 9t <uЉD$t$<$ [^_]É4$ UWVS b Pp}-70E D$ED$4$׋t<$H D$|$4$7 [^_]UWVS qb ou}ED$E D$4$肋t<$ D$|$4$ [^_]UWVSb áo}u-7E D$ED$$U"t/Ux0u 9t<uƉt$|$$k [^_]ÉU<$Y ƋUt$|$$C UWVS a o}uED$E D$E$葊t1x5u 9t <fuƉt$|$E$ [^_]É<$ UVS a Înu Ex2u 9t<uЉD$t$E$~ [^]É4$p fffffffUWVSD` &n}EUċEG,4@4E@U }` jE EG@E̋GXpXș)։uȋE;GTEȅ~E1ẺE9ut3EĉD$<$譾uD[^_]à E1D[^_]É$f&EEFEȅZE@$YfEyEGM+M9E O(U @9~F t$fF E@ffO@E % ЩOH ȉFEfFE@EȃvA}$YMLO HG E9uЉ}FMăU U~g։}NjUG tUMȉ$fG UMȋE@A%GGfGfwu}G9uOT9 pO(LE @ 9}Gpt$ EĉD$ED$<$9EEGT9tBuW,u P GG(<$FEP1Ʌt=Uȉ}$bXkMTO HG E9uЋ}E  G(MJ9~R 9}ED$ D$ED$<$a&A!E$cBE u E;GTuO,u u6uč @4E;GTQG8 |<$w<$ EE uUčJ‰Uĉy19zuĉ)UBHFBLfFMEy19@E0B,4v4BDfFt$B|U$bu 4M+EOT9E M MO(ʋH93OU9U+GHFGLfFfFUO9UGDt$G|$au3  GHhUMʉUȋu6O, 4I49~X}uEFDfG|$F|$aFHGFLfGEȃ9FEfxmMO(E @ 9}EȉD$ EĉD$ED$<$M MG8 E 8W9)ʍBE G8  a-78u E<$\GG8 <$BEuĉ׉EċE MO(@9E w(t@ 90}0OL$ EĉD$ED$<$EEGT9tAuO,pM E<$0EG8 <$}YmUWVSX df8uE0E,EP@,Dt@ 1H470RM܋E9M܋E׋W~iU1E9w~MG,U[_DUPXfXf@D$G|$]Qu`E9EuM܉r9M׋GD$ D$t$<$]9uuE7fP 1fU=J WUT$-7$j]UWVSE89tZ@EOE)w~>EP,G(UW,΋M4}y߉:O9u}?9}u[^_]UEtPt@+B]ø]UEtPt@ +B ]ø]UEt@]ø]UEt@]ø]UEt@]ø]UEt@ ]ø]UEt@]ø]UEt@]ø]UWVS(H `V}GDE-798 GH%EWUOMG,E܍40UunыpG9UfFE9svffEF%M ȉFt$G|$Nu¸([^_]ËOU9~VUEEGGE܋D01E_GD$ ED$ED$<$%<$ 1([^_]EUG U-7$]USyG TE]  *t&t  A  1[]øUWVSu} ^(1Ʌ~&1 ~у9tT,y)у9u[^_]UWVS0F ^TE,Ex-7E   E1|-7EED$D$D$D$ D$T$UE$t!UB UUB(ɋU~CUMT$$Vt=9 ~#tyڅlE)e)Uǃ 10[^_]UWVSE TS}W$G(E~w1U9w(~hD,tO L$y؉D$D0$tuED,yD$UЉD$D0$ tD,E9w(E[^_]EyUWVSE ÞR}G(~"1D0$9D0$=#9w([^_]UWVSD YRu 1~019t% 9 uDŽ  9uۉ[^_]ffffUWVS qD Q]ƉE׉UM$2L]EPt MA +B A(EEuFF]^]^FT4$]j 1ۋNv]uF,MzF.1ɉU܉fGU9VUGfGFD$]HG |$F|$3Ju [^_]ËEED$E@,$]nCtыuF,U)D$F0$]CCtF0V]K +J K( <K,[+ZR,UʉUrprpP 9MuԋEU܋zUED$<$]KUBEE9FEP1 [^_]ËVE}ǍD$uF4$]PBÅF4F0V, M܉ً]Ӊ]u܉HXXXX @x9UuҋE];9NG EOsC9~ HOCU4 9C~FO$w CC 9~ pw C Ѝ197~5U?9u1E)EEE1)ùUWVS@ NE]SCJr9~ FCr΋M 9~B1)΅K zB 9~ HK B U9 }B}M :u 1)ȍ<?E C EC$E-791[^_]C:}x-7-79ˆ-79Œ-79S9M 9u M S E|-789E9EE)Dž#EÈ-7tS} x }x$}u UM su 9+E|-78;}~}낸[^_]É1)ƅ.$1NC E1'CM 1U> 7LE~M ~„-79B$t ]1]ËE 9B ]UWVS m> KUE -7Ex$9}h-7P H4 9unfH$p <19} JBzo-7P H4 9u80H$p <19}  0%D$E$hu)-7P H< 9H$p <19} E}x$} x x-7}:|-7} :2u #vt@:u$wvuE$؃ [^_]Ë@ 9E 1 [^_]ËM )U)M )U)M )9)UWVSl< IEƄ-7ǁ3~^U ~W;A$t^U T$$D$-7$t [^_]ËE D$$t$1[^_]ËQ 9U u1UWVSMU ]tgAt`q;pVq<;xKI8YxQtX ~0@,41z9~R y9:}:9A1[^_]ø[^_]UWVSE; H}M wuGX;P$UWUU;P G)‰UW u)։uwtb9NEU;FvE9F nEU;FaOEG <$|$4${D$<$茸1[^_]ÉFV MȉFE‰V 4$69u뼸[^_]UEM tP8u ⿉P81]Ã@]UWVS : GE} O E+H O(w0G~_1U J(B,4B]+C[,H NX^F BU D$ $]7BFU 9z [^_]UWVSEPX2uH8ˁX8p x;z t[^_]ÁuكH8HR$x9tC9uՋMQ ztɋQuut duH8 uX8UWVS(8 RFEUMQI$3ƅ1ǀǀǀE܉$i3EF,D$E$o7ljF0MF4EFXFF]^EF^ F$EFE F F8FUE D$ HL$HL$D$D$H +J L$ H+JL$D$$$[]UWVSL1 >Eȋ}M]u$EE y)}1y)1ɋUy +}Ey)1ۋE @9pE@)9Q9?E @;E E E@U +U9.E 9EE)؍EE-EE]H, uq}MMUE M̉L$E $]諎9uriE(tEDP@u|$ED$E $]XEԋFEEF tM̋\@Ӄu]zUEE} 9}9D$E $]U1L[^_])ȍpE)E UWVSL/ ǖ<}ljUM@XEpO8G}GW][u9|;E}Eu)x 9Cu9|;U}E )x 9Cj@tfFȃ࿉G8C8C8 G8C8G:EfEMf93э4u)fEfEEfEA]tG(uȋ^W9} V ;~fEEEf;EEXEfE;CMQ,Mċ4 uUO,Uȋ6u؃utS,EM̋AE܋UR(w8uu9Oq 69BMfMM fMM9~)MfMfE fEEfE)փ9~EȋP f+G(ffEҘSu)E9~ f+E)fE]f9]E̋@EfEEEԋM܍EE@4 CE؉FCfFSfVf~HfP$f@fuG:GD9CCfEfEfEuf;ulE̋]؋@E܋EEM]̋ttEEHW(]܋E )9~W(EX E̋p E )9}G8tKW(UEȋ@U ЋU)9~EG(EEȋ@ M ȋM)9}EG8t EYW(E9|UW(M9}ЋM܋9O(]9Ẽ 1L[^_]ÉE*79 M69txF:uFE~F,E11҉uʋ] tËu^+_w, t]C+G_,!‹]9|u69uMEEȋ@U؉PSfPSfPfHfP$f@fuGD9GLfFfFt$G|$]0E̋@E܋]G:{EEȋ@WDWLfPSfPD$G|$]_0tEE̋@E܋]-EfEE fEEfEfEyBEL[^_]9;K8@O8CxCUWVS ) Î6@ǐ-7#B@@37~tD@Tt5MU9L$D$$c,"7!A@U!‹MtD@t5MU9L$D$$c("7!A@U!‹MtD@t5MU9L$D$$8c$"7!A@U!‹Mtc@LtTM9T$D$$b`@M.7t-QMT$$LM.7uӋP@#Q@tA(t7t.U9D$D$ $hbH@@UtA8t7t.U9D$D$ $"bH@@UTt3t)U9L$D$$aH@U t8@t)U9L$D$$aH@ Ut8@t)U9L$D$$]aH@U@t8@ t)U9L$D$$ aH@@Uƀt8@t)U9L$D$$`H@Ut8@t)U9L$D$$`H@Ut5@4t&U9L$D$$i`H@Ut5@t&U9L$D$$/`H@U t5@t&U9L$D$$_H@ U@t5@t&U9L$D$$_H@@Ut5@t&U9L$D$$_H@UuLt<@t-Lt#9D$D$$8_H@[^_]Ë@@tU9L$D$$^H@UzUVS # H1@37Rt @u [^]$K9D$D$@$^ [^]UWVSR# 0Eօ}„-7@U}GFGfFt$G $)OfNfUFɋ>8~xfHf@uEfx~SE@uJUR#h2u.78}}$J t$JutE1[^_]f~E@t܉-7fy~ӋUBvuGfd묅t}$:J {뎁T$-7$G}$J G_UEPT$ PT$P T$P$11f]UWVSEu ]MU}}} }uyE]yE˅y1ۉׅy1pu؋M)ًP)utu9nP Uu)H)ыUt29OM)ىʋM) xHMUщMUMʉUuu܉uUU UMU[^_]뭉U델[^_]UWVS} .ǐ-7@@Mt@37J y9ED$D$@37@$6[B@$"7#B@t2ED$D$@$ZB@("7#B@~.7t $hD[^_]uW~udt@379Et9D$D$BL$jZ`@@379E*@379EED$D$@T$ZB@,"7#B@&ED$D$@L$Y`@.7[^_]UWVS ,}ƉӉ$N,4;]u;} t;E"D$E D$ ED$|$$]6[^_]uUWVS +E-7Eԋ3 ]Ð-7]ZJx< XHUE@8@u B8@B B@ ]9t$D$@37E@@D$XEԋ@@HT D$u4$]Hf8E@PhtfEԋsEHȅuvϋE-7EP,11M~9z_{}~r}41҉9} L$M4$]MuՋE̋K,SB9E}E@@%ƋE}9})EU*Ct}EU9/EEPB%9uUEuE}ċE)DžyE9U)E9EEE}ӉʋuEEȋEMȉEЉ]u]9]1MEȉE܋ZE@,}܋xB,p1҉]M؉M9}L$M4$]TuՋM؋E̋]9]EEEȃE]9\]EE90}уAy9Ex$EaE̋K,E؋mEăpSBE܋]؋}̋7N,"XV9EM$^E@8MEԋP]CD$CE$]CD$C$ESPSPU܉EE$]t,M؋E̋E}Љ9}9}r}h}ӋBM E]ȉ]ȋ}MӋBy9nE܋U9~EċEBDM9l tSl BDt$B|$]gFfFEBLfF9uE̋sE;` _C1ɍl UL$D$ <$]U€w֍V)‰։L$D$<$]S‰EЋE̋@` d EȉE]9~]E])؉E؋UĉЋ])؃EEH,E9p]]]E])؋UЋUЉ֙Ӊ]1uu܉1M9| M9]9]9]E؅& 9]܋KȋŰrU9Sf E䍐l E̋@=vuEEE܋Hىωָ   tftEE =wEဃ)ȋ]܋Kωփ~ tftE܋]ЉXE̋BD$ D$ED$$]蚇EIeWdIt$D$$]D-d]9t$D$$CMčGED$D$ E؉D$|$$]M U܉ MDD$)ȉD$ ]؉\$EȉD$$] EE@T]9L$MD$$CU܉E܋ML$D$E@$BE܉؉}܃}EUqd^]̋R, ]9]uE]E@,E]EE9E|EH,EE}؅EX]@E܋}ȋE)NjE@X0ppuCpM}UčJŰ;JSHFEĉD$ML$$](d9t$D$$AD$D$ D$M܉L$U$t$D$U@@p$6AD$D$ EĉD$D$$U@|$$xct$1|$$@E̋@D$D$}@@0$]9ct$D$$@D$D$ D$D$Eĉ$&t$D$@@p$O@D$E܉D$ ED$D$$t uD$1D$ ED$E܉D$E$]19U؉t$D$E@$]?U؃9uHvtHT1҉Ut$D$E@H$];?U9uUD$1ۉ\$ EĉD$E܉D$E$]|$E@$wa9t$D$$>E)ED$D$ D$D$E$]TE@|$$at$D$$c>D$E܉D$ ED$D$E؉$] HÒ } D$1D$ EĉD$E܉D$E$]19U؉t$D$E@H$]=U؃9uB 1E@Ut$D$$]}=U9u ppu;t#t}učNŰ;JXLJEĉD$ED$$]_9t$D$$<D$D$ D$M܉L$M $tt$D$U@@p$<D$D$ ED$D$$*U@]؉\$$]^t$1|$$5<E̋@D$D$}@@0$]^t$D$$;D$D$ D$D$EYučD>ED$D$ D$E܉D$E$]TE@t ]̋ ;qtE؉D$$]]9t$D$$C;D$D$ ED$D$EЉ$]E@E؉D$$]9T$D$$:D$E܉D$ ED$D$E$]SE9Ủt$D$E@$]c:Ũut$D$E@L$]):u 3E9t$D$E@$]9uL^ E̋];XM iE9Ủt$D$E@L$]y9Ũu)D$D$ ED$E܉D$E$]|$E@9E؋]9Efuucfr 1t`u 9}tQpt$$]uE䍐l E܋HcfwZ]䍓l T$Uu܋F$NU 1ɋE䍸l E䋀d EE܉E9EBEEUWVS A ]Ƅ-719X‰PtAC:uf11ɋCD$ CD$C D$C$KtB[^_]5C9u-7 Q+SxSQ+S x SċKxSt1҉S1҉SQ+S y[^_]U y -7$]UWVS R u] EM ^\UV`UVdUVhFlNpL$D$T$ED$ ED$\$4$t[^_]FF9u-7 Y+]^y1ۉ^IM+MNy1ɉN[^_]ø[^_]UVS Óut$;#vu[^]UWVS `}GDE-798GH%E1ɋwG,pGE9M}DMfFE ‰Vt$E@|$tAfFE9s>FVM9utс}9uN uf~xŸ[^_]ËM}9OGD$<$wD$D$<$"1EU '-7$]UEU 9u5J9Hu-Hf3Ju @ R u 9u@Rtu1]1]UWVS* ïU} w to1t6~RutF$qu1[^_]ÉU$t8U F@RuDžtÉv$#uG 멃UEU  HJHfJHfJU @ E]UVSF utv$u[^]UWVS  ØMq~X1Q,zQ~>1҉EM׋q tMv$ZuME9xԋEM9A [^_]US] t.UӋE ȉt %1ȃ9u[]ËE[]UWVS]} 111 ȉt %1ȃu1Lȉt %1ȃuڋK t4u14Ɓt %1uۋIuҋu9h[^_]1[^_]US E t$D$ $fx) 1[]É$1[]øUWVS07 üU  E싃 E@37HApEЅb-7EE䋳 utayFEԋE%Ey E܋EԋuƋUE99ЅyBU)u܋UE)‰U.E9EEEƋEU)ЉE9gFEԉu܋ u)y ‹u)֋Uu9Guԅ+^x-7uu܍t9B~ Eԅ3D$D$ $/ǃ EЋ EE1ҋ EMM܀}EEa-7> ; ЋM)ȉEԋHAEЅzEEE9E| E9AT$D$EЉ$$/@P# ǃ ; ^J U -7UfT$D$$. >u Eu@@l8  ; J Alu (D$ E$#…y )Љ p t}쉻 }艻 0[^_]Ë=b-7EEU싃 EMM܀})y uyFȉEa-7> -7ЋM)ȉEԋHAEЅ ; }xM9M M9M D$ $) ǃ ; t E܋E9 E"t$D$$, ; ~a p @@xu XD$E$<y)  ;  < t$D$@$,  ;  u؀> u)ʃ|-7E䍃 EԍEfșƍry )ƋE9@M؉L$D$$V+ EE0u9~1$  ]$uXE܉E ;  Ɛ-7u܋R,r@E؍ E0   u R9 E܋EP, 4v4F‰EEu@M؉L$D$$* yu9D$D$EЉ$)ǃ ǃ UNE;H@uRFuLf~-$ D$ D$F $?V f= @$  tD$ Eԉ$…y )Љ 덋@lT$D$$(  E9 EЉEԉu($ \] t'D$ Eԉ$4y) $ ǃ D$ $װy)  E)ȃ9u@D$D$$' 9  E"t$D$$^' ; ~b @@xuɋ t5D$E$y) $ f0$U됉Ƌ t*D$ $蚯y) $ 1ҋ EUWVS _ E苃 |-7M19|  9 x-7E@379 9-7E9E)$ JEu ǃ E98.@@ltˋM t‹UT$D$$%뵉 PBh9}d T$t$$GƅtDE; t4$ؙ U 9D$D$4$%uU1  [^_]Ë -7Eu@@h9ME4M䉋 E;0 GE  @37p >u~x -7U9t$D$$I$mtGUt @@tut$D$$$@@lu$ gmu ǃ x-7E 9P))Ή $ 둋 xǃ UX U U U  U 11]U U U U  U E1]ffffffUWVS V%-72-7E-7]19u9uV~sF,E1҉MEF~PCH1U 9F~59uuS9~S 9}͉9FˋU9VMIg[^_]Ë]S~Cs,~DUMڋXCӉu΁9u9uu9utɃ9u @37BH8~NHD~GBlthtËuu拐tt 1 @37@ xUWVS( uƉEY@37EBH8ˁ:ul-7u@D*= }h-7LJ DŽ-7Y\A`fAdBt%]9D$D$ $N EBt8]9D$D$ $ -7p2!P@EBlhzǁl2ǁh2BxT2@@Tƒth2t h2t h2t h2 t h2 @t h2@t h2t h2EHA\$fǁrǁt"fǁ~ǁfǁǁfǁǁfǁǁfǁǁtmfǁǁtLtfǁǁ~/Rrff@f@@ 9uǁp"ǁt"~&p"p"ff@@9u}苇 %ȋp"t"LJ  LJ 2-7E-7E E9tE9tE苘 ZHB~UJr,EEU܉}؉ϋ~HQE% ؉9u9uuҋU܋}D$$]_j1([^_]øEh-7ȋtǁl2wl-7Ћtǁl2Ntttǁl2)UWVS EU MfUfMf]h-7;7Lftvl-7949)-7l2tot"уt>]f9p"t"]fp"]fr" 1[^_]Ét"ufp"ufr"fMfvt]fufEftwft8fXfEMfCfE8fufEfEfE}f9r"*t"BfEfE'UVS ŠEM ]f„-7;B`N4f1Dfl2t1[^]ftf/ftTfufft9#ft*fuffuffufffff릸yUWVS$' ìU} uEEEƉEljEf„-7;B\ @ frftufv@37 I ytX2RtE}|$}|$ ut$D$$-;9T$D$$1$[^_]øUV Efx?„-7;B\}1@rU f tUf vEf1]ø] z„-7ǀǀh-7 t% ǂp"ǂt"  u1U勀 %1]UWVSm }M „-7l2t^ffǀh-7 t) fp"fr"ǂt"  ug1[^_]f3fthfufto'ftVfmcfuؾfLB %1[^_]þ뜻닻N -7h2UVS 1 öƄ-7l2tu?@37Rt*9D$D$$0"7M!A@f@d [^]UWVS > tǐ-7} 3x@tOu f„-7f9pdt6l2t*ǐ-7fpdQ@E % ЉA@[^_]΍N} f_f|Sǐ-7UL$2@$79L$D$$UUULf`L$2@t΍N} ff|ǐ-7UL$2@l$ 79L$D$$bUUULfL$2@h$69L$D$$UUǐ-7$UM fxGUǐ-7$sUM f -7f@dUWVSp U-7pFFy ;F|# tH4$i [^_]Ét$$.|UWVS ÐUu FFy ;F|# tH4$i [^_]Ét$${UWVS 3-7x|$E$Ɖ<$6i [^_]UWVSl } |$E$EƉ<$h [^_]UWVS1 U-7tJ } xCH9M ;X9}4xp,9"49M uM HP1[^_]Ë#ָ[^_]UWVSEM UtK xEpu9|;p9~4Xx,9"<79Uu7PH1[^_]Ë4&ָ[^_]UWVS Uztzr BEuNjEBw u)]ZڋOM)ʉ x=_]93O9},_w,9~ ! ΋M9u3GWGu [^_]fUWVS@ 6E}E E EE E @$]8ÅxyGEGE؋E @ G]% upEp-7E_E))9@L$ED$<$]؃@[^_]û놃 uG1뼸@[^_]ËG,U؋E̋pU ʉMDEEЋGU)9|M̃ W(I9~Gt)A$fE9r)UԋAFAFA F AF9sڋMA E @EȉE E%AfYE HvJM܉]ĉ}}$]M \_ XG E9u͋]ċ}EԃUt1Mٍr}}ȉ8)fX@ fH9u}WBO(T M̋I 9}GD$ EЉD$E؉D$<$]Q<$vM1 EGy1G1 <$] E9GT G8  <$]T1E D$<$]v1 UԋUЉE  E9:]ȉMĉ:BD|$B|U$]-UBHGfG9}s*w tUv$]uUG 뜉]ȋMĉU UT$-7$&]UWVS Xu}ED$E D$4$t} u [^_] [^_]UWVS  u-78E D$ED$<$tu } [^_] [^_]ffUWVS| E}}M E $]EQw$]E1EHMGEȋGEEċE @M qMMMp-7M t[E2 $ ]ÅyEEę)EEĉEċt& uE9GTu G8 )EȋuڋwGEM)ȃM9EEċGEȋE ]EMp-7MU rUUEM  / m$ ],DžyE]ĉؙ)Mˉ]ME Et MuM} EĉEY,]Eȋ}4{U]tyu4Ur }y([9;~;EȋY}U9ZU@t)G$fE9r)UGFGFG F GF9sڋEȋUUċu}ỦUUĉU]ȉ]UUuEȋ^,EEEF@ED$ED$ED$ ED$ED$4$]&mmuE]4EȋQT$ UT$D$ $M]LE 8 MQA(TE@ 9}E <U1UĉU uKEEEEE E E$]yVMmEEMmEąy1EămyEF$]my)EE9EbEWMFE EĉE_$]+ymEHU8mEąy1EċF$]y)E<9e}U&FHGGfGfG9}FD|$F|$]luE$]|[^_]ËyQUEĉAEȉA $]{MyUQE9ATtNEȃE u{}ω4$]<$qE1|[^_]E $]xyMEu붋E$]_=U HU T$UT$-7$q]UWVS uEE}ED$E D$4$t}EE u[^_][^_]U D$E D$E$]U D$UT$-7$]UWVS \u}ED$E D$4$tE} u [^_]h [^_]UWVS| EE}-70E D$ED$4$t}EE u[^_][^_]UWVS  Üu-78E D$ED$<$#tEu } [^_] [^_]fffUWVS 6ÉUM-ljEDWp1҉]]3 VTJ>v]D{u܋]4.tH<*t*Ѓ}‰ DOu냉1sUWVS( <EUM؋ufUވM݋U 1ɋU EEԋ}-Et$$UEx}P$u܀G$O Ut}EMU E1‹E Et~MލAf qC$SЙDžNE݉Et$E$Uu0Eu1([^_]À}. G}ԅ~Mȃf wC$SDž~]؉t$$UuUWVSuE ]UUMt{~9G tU9tMV z$uYVRp҉U싿t:?v(MMM] EE[^_]Eu1E1[^_]UVS UE tzJ;A t[;tSZ {$u]Z[pۋtA R(D$ t$D$$E[^]ûu111[^]U ]  D$ ED$E D$E$]U   D$ D$D$E$]UWVSM Nj2FEF<\<^t{Ѝ\-r7%Ӎru<: <&~Hپ!J'JP'EE[^_]ÍFFZ%P- QuJ{E< v^]v.F<-]1DsD]}MMލ[{D~Dyuu}M؍\u2<\u7{ESȍэf  ΍ f )ʃ0Qfv)f )ڍ)Ѓ0P}E[^_]ÍJ{P]1TQu<.tt]<*yMl1nVU}uf%p}O0J%}d J]܈ZQUdEVU}f%p}O0JJMf%ctEF =8}Ef%pPU}W0PUEtEHM%+%c֋EE&VU%p0%Bp0%{B2}%*fB %-}O0JJUECVU%p0%B{10}B%/%{B 16}%B*%p0B%{10B}%m%B+}O0JJUE'UB\E%p0%@p0%?}W0PPEUMU܉ȉMbËE%>%tEU܋EFt E%+%;E֋EEL1<1JfKMC|D7<\F=]EPU\EUVS Ê@37t t~9t $sK EED$D$E $`uI tG@t  .7  @x [^]É댋E[^]É @uUWVS(: ÿUEtBEE@37E}<$k UT$ D$D$<$u蹵N)) [U܉e)‹M) [UѸg4 )3hD$<$k EtTH tCp$1҉}܉ 9t-~fuUE܉D$$}k UuF([^_]1([^_]ËP 3h([^_]UWVS( pUEtBEE@37E܋u4$`j UT$ D$D$4$赑}kLЍB)ZUeЍBM)ZUѸ>Љ)<;gD$4$jj E܋tRH t>x$1҉u܉ 9t(nuME܉D$$*j MuՋGy([^_]Ë;g@x([^_]UWVS(藹 UEtBEE@37E܋pu4$ i UT$ D$D$4$a}-?L) RЍ)ЍlTGEeE)  IȍE) GE*SRЍ)<;l[D$4$h E܋;p[AQ tJy$E܉u9t(~suED$$h uދF E܃9u؋E܅tЉ)EgD$<$d -VUE}<$=c UĉT$ D$D$<$蒊Mĸ-?L) @)ЍlTAE-?LeȋE) @E)AM*SRЍ)l[UD$<$&c Ute}tu}cu }uFEE3h$z<EEg$J=p[$0>렃}u E$ѵ1҉UffffffUWVS! æE1ҍpNt-%upHptKst!ltpNuӉЃ[^_]Å~;}~;E tىUo Uƍp@Hπw09}맋E D똉Uo UUWVSZ ۾48,.օR@08G4<11$rD$ \$4$01󫋅0t=1(}J90t <u 90u狵(P)1~u,H]Y8^4~!%u~V%8H4X0@,q9r0t$$408C,s0K40u4  8$4诪8  @0@4$4{8G,_G0Gƅ`%4- Dž,Dž$Dž(Dža`0:~LJwDɋ4jXKJw! .ʋ DNt{,4ʍ\qЉ,'~>aDž,>~`B<=w^4jW0)?(t9,> z$t-.(M,Dž,Dž(hDž$YilP[J߸ V8uo'dwEOI PDEG/8W,G4G,[^_]É,] CEP0 ]P,&Vҋ4xkE EP(, B08H4X0@,T9BtD(\$ `T$0\$ȉ$4%Ht8C412<'urR1҉,,0O0PD]PEEP08P4H0@,Z9PJ8K40U{UJP,0$4Z 0,OPDŽPUw}7D$$>D$t$$-‰E$20UtYEE[^_]Ís$7ƅSE1ҋEEut$@D$$uM$-@ x Utb}ut$qD$$9EJD$$$'< Ex t;MEt$qD$$ͱD$$跱ED$D$ht@E$C tEftUft IA(QuEt E1x$t!D$D$$%RB($tD$D$$RB끃}D$$ӰqD$$轰UVSG ̬EtD$ E D$ED$E$ƋEt$Q,[^]fffffffUWVS fƉEωD$$O tB4$eN ƀ?u1)9tXzzt"D$|<$' …uۉ<$/N 9t 1[^_]Ét$ED$<$~[^_]ÉUt$ED$<$XUu[^_]UWVS % ƚuEUt E<t]\  [^_]É΋Ex %1ji˃1҉9rExtftEx(1}fWVu~9Vt"VT$<$]ljFVEptft]CPSD  Ћ]XgËuVf;h{CftMWҍTRӉEf}]}^ Qu F 8vE9uڋE}f8Pf]s} H u yf}uHD$$%]š]C ExD$$!]菚‹EPn!f8t;Pft2]{u0 ftXHt݉f8pxE;x T@$`|$D$$] - Ex E@$E11MȍV HnsffvrRPMu v@@1҉P 9rjD$$]L]C(11ɍ&mC}G G$t$]bG$uyf fE@$$]Ex D$<$]芘]C$f$ffs@sU@@Jru9U@}t*JrHUznnJrfM6fy'bUWVS,u E׉MT$ qD$D$L E$G4=v(fV [V 8,[^_]D$E$kƅtʋE$G UU܉T$}|$ D$ED$4$VmtJUMt@:tOE$Eǃu(EPEǃu E䉃, 14$Gn,[^_]ËE܉D$ |$BD$4$:lu΋MUD$|$E$臵E=D$E$jƅUWVS։Dž)t Pv9s:ut<:t׃u)u͋[^_]ËrtftƄE$txDžiDžUWVS  Áǃ, q$豽8/u$%… ${ r$tt!4$‹ [^_]Í$At,D$ rD$D$<$?14$(r [^_]Ír$޼TI/@$Glj($<$?uDžD$$Nj$OmtQ<$)4$‹4$|$$)t4$$Q<$tr, 눍q, wUWVSy EEE EUUD$$rtƋM‹E1lj4$tKMUEt81ED$E$QC t' uMȃ[^_]ùȃ[^_]ÍHPEEE[^_]US裒 (P Eu[]ÍED$E $I,[]UWVS֋N ufS[^_]Ë~Of JN fJy8VӋ6s!uu [^_]äftuutYyZfUVS贑 9Ƌ$.F$#F$F@$ F$F $F0$4$[^]UWVSC Ȟ}wu G9r [^_]Ått$$Dtw[^_]É4$UWVS pU MuR u+ftO؃tXf;0t&nt(suXDuN 1ۉ[^_]ËEx DC볃UWVS h E 0@ Eu C x}UxMnPsfJHϋBD9 U<$EUt|B@zDJH]fBHxzHz@tftEBHJ@XZHun.sWf6BL[^_]ËB@u1t$B@D$$2uE(UE tщt$ D$crD$E($1럍xJHϋBD9sE$|JHϋBD9s|$B@U$bU1z |GJHϋBD9Dt$ D$~rD$E($1BHB@z tzu0BHJ@BHXZH]J@BHu$f4BHxzHE$z@u stftE$BHwuhuOыM~fBHBE ffE$UWVS轋 BE 04$[; EE @E$<; EE @E܅$; EE @(} GW8DGH}MȋMȉ$t8t\tɀ^tăt8uH[^_]ùx1[^_]ÉdUWVS% êuNE|F9sXtd|$$,tH~NU fFF}t<]fFFF [^_]Ëu1[^_]É<$螂렋}<FUWVS<} E@ EE@ 0t$$sM4$ɊE@E܋uFX1tftE$萊u}D$|<$ HM|$E@ $E$q6 xDMED$E@$҆M;UBNju`P0@|$E@ $k$E5 Ǎ@ED>D$E@$TUu$螉EE<[^_]ËMAOMփEtfEtǤ$VE܉$KEP p,@ @(@$@,׃ EtU?Wx0My ɍL L$ T$D$E$$t8}uWfUE$茈Ep@@LEMA@AHADALudfxB 111D$ T$L$t$D$ED$ ED$D$E$tam7GED7Mnts{HP|1뉃}t>px111rx@11buE4$腇E<[^_]px1113u܉4$]֨u8uDMUUr$臛EU r}fm몍r$HE0GU7UWVSC ȐUJEtB9swt$U$CUt]rJ] fBB ]fBxzE:us:u.u'EBB [^_]Ëu1[^_]äftu%u0tۉ4$u}U]EfUWVS8 ýuVzF9sHtT|$$Ct8~VM f FHNMLF [^_]Ëu1[^_]É<$|UWVSX讁 7ED$,E$} D$|$]_xD$|4$] PU4$]0 = t<$0 = E$]0 = D$$P]ÉE܅F@ t$$<Et E 2t E D$,E$qEN EEE-E̋EE u<.tjDy@u붋}]: D$ED$4$]ŗËE8g E E܃x f_EĉUED$ EԉD$E썈sL$E $@EċUڍwEJЀv)ύ)ȍLD$4$$ u [^_]ÿU*t §E=w l]1]UWVS s yu4$# UT$ D$D$4$J}-?L) RЍ)ЍlGEeE)  IȍE) GE*S)ύɍlD$4$~# u [^_]ÿUWVS4 s ÏufF(}ȉ|$$ t4[^_]É<$D1t9,ufV(4[^_]UWVSr ,uL L .7fV E.7 4$@V(EfD$FD$L $U菐=UwDE |)ʉM싆t7T$UD$E$NU9sUJM|M))‹FtIT$UD$u4$U9r4[^_]1$.7[^_]ËUыU|UVS]q ~utgF$tF$tF$tF $tF$$tF,$t4$t9L t 1[^]ǃL p b~L @p N~L @tÍ=fffffffUWVSp ~lj$U/ D$$ + Et$UT$,0U$29UuED$$ + 1[^_]ÉUED$$ r+ L$4UD$4UD. UWVSdo ;}8EE1EEƍLEE> tqE9D$t$U$2Utˋ$40$3UDŽ0O- 5Euu ;t1< tHv0FIU$30$3UDŽ0UWVS<n Ø{8U11ɍLt6u, E+<ȁ<[^_]Ã0u@W@0ƃ:uVƅ/lFu,$9L$’  Ή${1D$i1D$D$ D$D$o4${{qD$@|$/$t:tRP:uVpƅz빉1$\0Ή$k3Ή$:0D$(0$0D$*3ω$/D$/R$*U$0s$ߒƅD$/4$5/tY1ɉL$T$/T$LT$ L$D$4$Tt$sD$$|R1҉T$T$ L$D$4$빉osvFUWVS ,j ñwu}D$:4$t!D$bT$$t|$E D$4$- [^_]ËU t考 [^_]UVS i .wuD$:4$!t!D$bT$$`tE D$4$M  [^]UUi vEw0t ]1]ÃL]UWVSh i ÎvEu 8MU1ҍx,U0ED$ sD$D$@U$UUƒE9~ЉLEΉ )t$|$ʉUM$+MUӉϋʉU$,uD$,UD'& !L}|$t$$h+uU+u h[^_]ËE膪UWVS`g "uEM 8U1ҍp,U0MED$ sD$D$@U$U>UD$$ z" EED$ML$ED$Q);EUT$$ u@B" f!L^ut$L$$ )U+uW`[^_]" LU$E+ED$6+UED$ $UWVS`;f sEU8L$\1ɍpwb0tNT$E UD$ T$sD$D$@T$$T$T$1t>$LuT$ U MT$L$$ L$\+u`[^_]øWUWVS ne rExw|,M0t_ ƃtAkƍLU$)ED$)UED [^_]ÃLu$)Ɖ [^_]UWVSpd Dr}EU 8uM1ɋ]p3,M0mQm8@E~Eߺ81xEM}EL )|$t$ʉUM$]]'MUЉ΋ʉU$]`(}D$Q(UD! !L\$T$$] ]U+p[^_]ê0f%.t&CD$D$ ]D$D$@}<$Gj뉉f>~$E~LSC9u1Uf~7g] ]KUSdb oEPw*0tv -[]ÃLu$*[]USb ÔoEPw*0t! -[]ÃLuU T$$[]UVS a 7ouD$:4$*t!D$bT$$itE D$4$֑ [^] - [^]UVS :a ÿnuD$:4$t!D$bT$$tE D$D$4$$ [^]ËE D$D$4$ [^]US ` 9nEMPw*0t - []ÃLuL$U T$$$ []USQ` mUBw0t1[]ÃLu$[]UVS ` ÎmuD$:4$t!D$bT$$tE D$4$譐 [^] - [^]fffffffUWVS_ m}E1E xt=1}t ƒu@u[^_]UWVSĀ _ Njl}E|8xƋE 1@ E0 E|1E]EH Eƒx  EB A ǁE9uʋE%u   EpxEPMHx }1E]uJ˃4x MN K u9uʋ]uE%BzBE9yxE+?1[^_]ËU 1ۍU @t?ELt鸓$I )9uu1믋}@ E1ۍLE0 EEEu1}}}8KtDAuEƃ@E}t,ى%I$))9D E9u }u _]uE^@],1҃DD [ u̓E9uE, a:!@t$EDu۸@u܋} Ƈ ,E}8L8 0u} ]l ]E M }~Et M  ЋU 1ҋMDŽl  r1ɉ]] u]U1 L ȉу9uMՉʉ EMU1 L ȃ9uMՉʉ MEE@ttM Љʃ Љ Ѝ Љ ЋU‹ELt 1itEUEEt @FEǀ ]@UWVSX_Y fuE EM8ENjE1ȉ܉ %Ev㪪UUUUUUUU ]% ȉE1EE, EEEƃ4x  EF A Eu1E1EE܉}ԉEEƃ4x  NjF A E؃uĉ}EEHE EEˉuEE܋E؋uu؉EEuuEE]EË}1u!u܋11ًF11}݉]Љۉ]Mɉ]ċEԋ ]3 ]3 ]3 3 3! 3" ]3# 1EEԋ$ ]3% ]3& ]3' 3( 3) 3* ]3+ 1E؋M؋}1ȋ]!؋u܋]3<1Ë}3L>1}u u3 u1E䋼$ u3% E1ljE3 3& 3 3' 3 3( 3! 3) 3" 3* 3# E3+ }m1]E%MɁ ȉEE%MɁ ȉE1E1 EEE0Ãx  NjC A EuċE8upuE+u!1X[^_]ËMEd 4UWVSP$U bE̋uM M8EЉNjE19$}܍]]ȉ9u<$…E<_t:t< t<:tMAE̍s}ЋU+ZP[^_]ÉUĉ}؋}1D$ D$E؉D$$u+EҀ09uE؉$tEԀ8*sx0iE̍sdEEEEEyD$ D$$<$]g9tD$ )D$|$E؉$Cf}2ae}sha1f}1 }argo}argo}argo}n2d}M̈l _ȍp l MEE Ȁ`QŃ?}<9E ЉEE9uËUċEEԃEM̍q MEM̍M/^Ń?}t}<9U}Ĉ  ڃM4`À@~^뿍^҃?뷀@~Q>Q҃?3}EԉD$4$p< .t&U<:MMEM̍l MME&}n2idN}DEԉD$4$대}EԉD$4$ nEËED$ T$EȉD$}̍ $,EfM ȃ?9K?9K ?9K8EfM ȃ?9K?9K ?9K8CEf?9K ?9K 8CC EEԉD$4$I2}n2i]UWVSP ]E8EEXUэuuUS1r 9uZ9MuߋU$U+u[^_]Ë]莒UWVS,O *]E؋U8ENjE1Z}uU܍S1MJ 9uMZ9uڋU܉U} D$ D$|$<$uEUZ8uECу9uF9t܋E}U+u,[^_]ø]譑UWVSDN F\U uU8‹E1DžDžDžvJ88E+1D[^_]D$D$D$ D$D$$x @D$$ T@D $9sÁ t׉D$@BD$ <$L$ $?293?!~9.?J9)1?߲9%?+59#?x}9#DžTDžJD$$MD$$M(D$$(P489ȉ )ڋ09<} D$0ED$,D$(D$$D$ D$D$D$D$D$ D$D$<$n$D$$!tD(,481։ 1 <90Dž|Dž@mDž ^DžODž@Dž1bUWVSzJ WEu 8‹E1D$D$H $4{DžDž4$u8$u tt$4$Ɖ$dDžD$$8vu[x=uUT$$ D$$ DžDžDž DžDžqe|$4$"3ptjtmt2$ L1U+LĬ[^_]ÍT$$x*tT$$y6OT$$xۋ%t$s$%uDž!t$s$DžID$$ƉDžDž|Dž[<Hv2BIڍ{Kz) ЍK!ȹZ) ! ȍ{й9) у! у+у>Ӄ/Ӄ? ЃA! = ЅiD$$Ot*D$ 7D$D$p$$7I 4$@|$0|$,D$(|$$D$ T$|$||$D$t$ D$D$$@D$ D$$uD$D$4$uD$D$|4$uD$D$p$u$%D$sD$-$UVSD âQuv$SF‰)Ѓ[^]øh`UWVS4C `QÉED$sut$u 4$袆u3D$ ED$$EE8$E $]Eh`)‰UE E h`9tt$u+E E܋E$]NjED$ut$u t$u܉t$ sD$D$bJ E$J t$|$ ML$D$E$_}v/lj|$t$ ED$D$<$/9]uىE D$E܉D$ED$ED$ ]荃tD$D$b}<$MU^D$O O ȉD$$9EPU9uD$]J J  J ȉD$$EPU@D$D$4$rE4[^_]14[^_]EWfffUWVSˉU23]333 13Ή 3 13 43 1343 1343 1343 1343 13 43 13$43 13(43 13,43 13043 13443 13843 1΋<1щ3 13@ 3 13DE] [^_]UWVSƉEfM䍾}܁H1۹1҉}f;]ǃ? u}19uEE}EE]܉UEEEC9uE荈Eu䍙uΉUEEEC9uu9Muƃ[^_]ÉǻLUWVS = ~J9ɍL  dH USHlf`TEPƋ@D1\f;`6 uދ\19u111ۍhXdLD1` Ѐtfu Ѐu拕`1Љd1f< Ȁu1hXLTdPhxP9GTP0`DP1\f? uዽ\1Љd1fH Ȁuዕ`1ЉhXLTdh`GP9SP09->1ۋT@D98uԋX1ɉ`T1f|=؃ u9uѻ@TXO9uu⋽`E؉`]BbJ9uߋHfǂLK $2?ƂNK aHLK ƄLK $,T$ tT$D$$7D4${`D$HD$T$e14U+u{[^_]Íxƅ??tOlEȉDRHvUWVS3 uAu(} 8E14$l$?$u 1H$9u勅)ȉx  @4$;$D$(|$4$D$tD$4${T$|$4$_}<$$D$(L$<$8T$T$<$$D$(L$<$|$0, $$lj~T$,D$4$Dž0Dž4Dž8Dž<$,D$4$gt&D$uڋ(D$4$AuڋfǃK $1ƃK $ D$D$K $ OD$xtD$ B$Pt$,$1s$D$(D$<$ ɋ D$,D$<$t|$,$B<$ʉ)Ѹ%I$))Љ)‰ :D$,D$<$ ɋuo$D$(D$<$9$D$(D$<$ D$D$<$j $D$(D$<$Cp D$D$<$ ?K K D$06 < ȉD$$K K D$17 = ȉD$$=K K D$28 > ȉD$$K K D$39 ? ȉD$$K K D$4: 5 ȉD$$wK K D$;T$$MK PK @D$D$,$_E+[^_]À$')MDž0Dž4Dž8Dž<Dž Dž Dž8pUWVSH- :MMUu8ƋE1@Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\E[1ۍT009u$>D$@|$<$衤E D$D$<$舤|$$貦<$D$@t$<$ZD$t$<$@|$4$pE+[^_]Éu4$~UT$L$4$t$4$ Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\T-lfUWVSA) 6utJD$ED$4$7NjE9t.8u)<8"tE 81[^_]Ãu1UVS( T6EU ]~Í у? H9u[^]UVS( 6EU ]~Íу? H9u[^]ffffffUWVS8A( 5ƉUċH0<@,9s1V8UEV(U}ԉEE܉MF4}ĉ}9sMt$}ȉ<$t8[^_]É<$5uEĉ|$4$Eă8[^_]U' 5Et t&t1]ËM t6 t]ËE t(t]ËE tt]Ís]Ís]Ís]UWVS*' ï4u} 4$9uw[^_][^_]UWVSd& g4u}$}(E($!EEE(EEEEEEEE EEEEEEEԋE E؉u܉uEEEE8Euu4$a…u?}4U4…u%tE(usKu?u8M,tE0uVUE(D$}<$ <$h)UЃd[^_]äftumt׉UE4D$ ED$E0D$E,$)8UtE(D$}<$} E0D$E,$k <$(jfvE(d9%U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$9]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$`]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$]UVSf" /u4$xu1҉[^][^]UVS." ó/u4$@u[^][^]UVS! x/u4$u[^]}[^]UWVS! …u+t"11U2 у9uUɃy Ѓ[^_]úUWVSX6! û.M $ƉEE$ljE4$ƉEE EEEED$ML$}<$1t.1EM $>$M $3$4$+$EX[^_]ËuE$EtED$t$<$몸Ǹ1UD$ ED$E D$E$]UD$ ED$E D$E$]UD$ ED$E D$E$]UWVS I-}u <$ …u8T…u+t"11U2 у9uUɃy Ѓ[^_]úUWVSS ,}u <$b …u=…u+t"11U2 у9uUɃy Ѓ[^_]úUWVS b,}u <$ …u=h…u+t"11U2 у9uUɃy Ѓ[^_]úUu +E##+Pፂ0t]Í"]Í]Í,]ÍGt]Íu]Íu]Íu]Íu]Í]Í]Í,]Íu]Íd]Í]Í]Í]Í[t]Ínt]Ít]Ít]Ít]Ít]Ít]Ít]Í u]Íu]Í3u]ÍJu]Ícu]Í|u]Íu]Í]Íu]Ív]Ív]Í1v]UWVS  Ü*EwrE$c5NjE $V5ƋE$I5E|7E$ 5EU׋E$4ƋE$ 5 [^_]Ãu$0tffffUS _ )U T$D$U$SM []UWS] }Èĉ Ⱥu$u*t 19r[_]êtfUWV}u uu.tft^_]tfUVS]u 1ɋ΋T11Tu[^]UVSG (u Ee…t5҅u.UR؍uXUWVS$ #E]M Usy AEU u}O1ۍG1)A[]EuW])؃H1e1)E<t}1Ӊt$D$ $\$]3$[^_]ÍF)؍8]D1ۋEe1)MKUuȃH1e1)둍D9L9UWVS0{ "}wt1ҋGtl1ɉE܅tDM1M؉EEE܉D$|$ML$ D$4$j;~rϋM؉tw뫋E܃;Gsw10[^_]øUSEoox P X:PHUPX4P$H P,JH09P(P4P@@у+?҃/ [^]UWVS É։ϋMER)Ѓt$9uuE [^_]ÃEE9sDE11փE? كCwʋE9EuljUt)?UZsEE9rEE [^_]UWVSEUEEEEM4u}Ov(}W];;}}UM0~^z) ҍ^!ڻZ) ! ڍ~л9) Ӄ! ˃+Ӄ>΃/փ? ҃A! ځ}w ҅Uu}M[^_]1[^_]UWVSE0 wG׉1w7  r-у0 v9t}0t ؃[^_]Ã9t1ۉ؃[^_]UWVS  ßu} FEFED$E$O?$ug$E腞D$EUT$<$1u?MF8?$u#vu=uGUDžtEF8?$umt [^_]À=uG}t܋UV,8,uрxtuˀx=uŃtUV(8,uxpux=u}tUV0V48$uHEEFiUV8$ZHEEDž>EFFFF F$F<F@FD4$? [^_]øUWVSXI }EE8UE1D$E$wƋẺ$-E+} f$OME Eĉ4$肜U9PMMȃ/MU)ƒ$v=yM}BEŰB8D$(WUĉT$ D$D$u҉uȉ4$K4$‹E9\BPBMыE)Ѓ+$m=yM}x}E̋@,D$EĉD$ D$D$uȉ4$J4$g9M@}uȃoMыE)Ѓ,t=yM}EŰB(D$UĉT$ D$D$uȉ4$J4$ܚ‹E9JBacMыE)Ѓ,p=yM}EŰB0D$UĉT$ D$D$uȉ4$}I4$U‹E9BEЋM)уf$xqE̋H@$i)ƉZf$E̋0QG}̋O $N1}E+/EX[^_]Ë}ȤA}f}ȃ0f0ft&"ffvE}}qM^rEM)M(W}ȃ}f}ȃE҈AyuӉfE҈AyuӉfE҈AyuӉ fE҈AyuӉ$fE*UMR)уtu]UVSU ṽщcw[^]ffffUWVSO |$`Ѝ$$X03ps$X$\2z9uً$XA$\A$`A $dA$hA$lA$pA$tA $xA$$|A($A,$A0$A4$A8$A<$A@QD5т歁RQ$$AHQL5l>+h$$APQT5kAكD$ T$$AXQ\5y!~[D$pT$t$X$\D$PT$T$x$|$`$dD$@T$D$$$$$h$lD$(T$,$$D$xT$|$p$tD$T$$$D$hT$lD$`T$D$06_D$4:OD$8+D$ $D$PT$T$X$\D$pT$t$$D$8T$<$$$$$$D$@T$D$`$d$$$$D$0T$4$$D$xT$|$$D$(T$,$h$l$$$$D$HT$L$$D$hT$l$$D$T$$p$tD$ T$$$$D$XT$\$$$x$|ȍ$$X3J3Z3 3ZX9ue[^_]UWVS]u {@1ɼCg jC;ʄC gC+Crn+C,hC0kAC4كC8y!~C<[ڍ~@M]u 01pq]u11r9u]u 1[^_]êCf8fUWVSLC uE 8U1҅P?EEEEEEEEEEfEEEEEEEEED$4$U+uDL[^_]D$4$tFXF\FPFTUWVS]Es8U -ST SP!<}J`)ЉE< u zeSC@SDC@SD1EU19EsH{LS`#ǃE}} =%M ȉEC@SDEUC@SD1U9иEs11sH{LʉMM逋E)=w}U `< u s,uu1[^_]äftuauit11t&fuUu<oҹ`^PffE pE땸+UWVS Tlj(UE u8, M1ɅH?fM?W0E1Dž2Dž6Dž:Dž>0DžBDžFDžJfDžNDžPDžTDžXDž\Dž`DždDžhDžlD$$$&$p 1߃}rMEuQEuHD$\$$$D$$(e1,U+[^_]äfEtD$$$($tBXB\BPBTD$$D$$$Ǽ$t맋(pUWVS\ ML$} 8D$‹D$X1D$D$D$ D$$D$(D$,D$0D$4D$8D$<D$@D$DD$HD$LD$PD$T΋9EAT AP1F@VDF@VD1FHVL%t$FPFT)ȍT`D$D$$eV`T$ D$FD$FD$ F D$$FD$(FD$,FD$0FD$4F D$8F$D${"D$0Iv\$0{!D$0vv_ك|v ww~s!D$0 s"D$0 s!D$06 ys"D$0[s!D$0f =s!D$0Hs!D$0* s!D$0 6r!D$06@ r!D$0Ir!D$0 r"D$0qkr!D$0v, Mr!D$0Xa/r"D$0:br!D$0q!D$0|q!D$0gq!D$0Nq"D$0{q!D$0]q!D$0h6?q!D$0J!q!D$0,q!D$0p!D$0p!D$0,p!D$0mp!D$0mp"D$0x Op!D$0Z1p!D$0?EEEpD$D$$]}}GU܉B0G??E VEX}E؉mE؋E@N?EX څ}wOE ]UԋuM؉]]BƃvUԋU]uM؋]EȋM)ȋuFMA :E@O?EЉEEE_ E}M̍}WPGX WTG\GG?} mmEԋE@H?}uЁxE܋UĉP pUԉxuUVyU܉BAQ?EPDE@C?J}9} U9k v‹]ĉߋuԃ   )EE)EEċu)FDF EPD둋}EP  EX }wIMUUԋ]uMBƃvUԋU]uM؃4 ]E9C % E̍2zu܉FCQ?q}uȋE)EiExlEPdph։u9] pPHXӋE؉]؉uUU}}M!u4^v]9sZ]ԉ։BCǃE!UBRfU9rɉ]ԉˉUuffMf9s3&]ԉ s9r]ԉȋ] M)؃1M]9MMYl]Y]]Mˉ]MYMfqt9uM]YlEXlp`9Eԉuu]]M؃whxx}ÃUEBlE̋}x߃f}UfTGt}GU9#EEԃvE뮋EP ~ E@@?}w@E5Uԋ]uMBƃvUԉ]uE@$tUPE@t @ E@7?EE}w@EUԋ]uMBƃvUԉ]uE@$t]ӉPX }Wt3G t-EfED$ED$G$]kGWЋ}G8?EEZE]ԋu}M"Cǃv]ԉu}E}xD@$txt E@ ЁEEE@UJD}9@t{}_$tKstD{})ϋ[9s5:9  M)ȍ>ߋuԃItftE@t E@ \ )UUԋEHDM)щHDE@uFDF:?9EP UR$tB1ҋ}G9?E@;}W$tB}GDG;?}wCE@Uԋ]uMBƃvUԉ]uM؋}EG< }E̍WU܉BE@Q?UBD?mmEԃ} wCEUԋ]uMBƃ vUԉ]uM؋}]SdCh s`}mw ) }E̍U܉BE@Q?Uԉ]uM؋}uȋE)} 老B??or]ԉu}벋Et1] 9uE|0C$tH$MtKD;H(s ACDEuEP)uuԉ E@??E21] 9uEE|0C$tHMtKD;H s ACDEuEP )uuԉiUԉ]uMUԉ]uM؋}uȋE)}ԉ]u}W4])Ëw89)W,ƋEPD9sȋ}9s)E)‹]SD}9u}ċEPD @E@R?E&А{9UsBE]ԋu}MCǃ9r]ԉu}MظЋ}!]CDCD})U:f*EEE@P?uȋE)EJ c M)ȋ]]]MYl]ftYt]9]U}E؋UMyQ?x ft }E̍U܉BAQ?EE1UċuЅ2 E}GDuGH?Uu ЉEE!ȉp@U9Us|E5]ԋuU؉}}xCǃE!MMȋMMHfM@M9r]]؉uu}U؋Um})}؋M}v]ԉu}EǀXPHX׋E!Hp9Es_UԋM؉}؉]]ZBE}E!u4E~v9rĉUU]M؉]m)E؋]艃sD 3Eǀ@??Mu)ƋE@D9E@#E@ u}UU1Ez@ t$EԉD$UB$]#cUB)uuԅ=REǀXPHX׋E!Hp9EMUԉ]E@`E@ 9t$EԉD$UB$]ybUB)uuԅR"EpHXL@K?9]sB}^Uԋu}MBǃ9rUԉu}MظЋU!Ћ}GHU)]m)E؋U艂rDE@M?U4}wC}]ԋu}MCǃv]ԉu}M؋Et }@$t@0NEB))9E}E̍WU܉BE@Q?}/]ԉU-}E̍xEPD@B?} EEUԉu@}E̍y]܉CE@Q?QqItDUЋ])ڋ]ډD$T$ $]̅`EHU܉J0X xEpEu99E̍zU܉BE@Q?EЉEE}U̍RyM܉QUBQ?mmE9s55]ԉƉȉs9r]ԉȋ]M)؃1u]M؃w-E̍Y&]fDSt9uE@lu荆4FpFPFXD$FXD$FpD$ D$FtD$$]n}y]܉CFQ?]ԉu}UT$UEԉD$}G$]F^GUzU}E؋}uȋE)BEԉu]?EED$ED$}G$]]G7}E̍y]܉CE@Q?} ։uU! yf}q<9}swU}]]؉EEIPUuU!Muu4NfMvM9rEԉ}ω]؋E]M)ȉ])E؋M艹EAD<"E@l@E?1EPL@I?]K9s5\]ԉƉȉs9r]ԉȋ])؋MF]tKrM}uMEE@G?} }uȋE)EEP$t EEt E@ E@6?EEfvPjEfED$ED$}G$]c[GGEE}UUԋuȋE)EE>Eԉ}]>@ WlaE@l@F?1E܋UĉP UЉPUԉUPEUPuuEtB0M[^_]äft.t&ft.t&u-uYu5urf } f떻UUWVS 諁 0}u|wFV u*=>?t*U UMu[F [^_]=>?u>D$D$$q\ML$M L$$[\9Ft본FR?UEM t:P t3P$t,Pt%;u!B-4?wB tJ$A01]ø]UWVS$覀 /Eԋuu8E܉NjEEFE~@@}S?}GS?wH t7P$t0Pt);u%B-4?wB M ttB 1]ø]ÃUEtKH tDP$t=Pt6;u2Jw$C?tL?u +BD]ø]BD]UEt6H t/P$t(Pt!;uB-4?w4Bp)]ø]fffUWVSx E}Mx11 rtE xfDU9uEExfG0UofxZUWVS4i Fw}̉ÉEЋ@,E܋{t-Ek@^S,sP ]u4$Džt [^_]ËvF,F@ J BBF|FlF\FtdžFxF`FhFH [^_]US]t+S t$C$tuSzu M J[]ø[]UWVS]} ut:S t3C$t,u!tSRt S[^_]ø[^_]UWVSN N\E]S C$fu{{} G9rrU )9~։U #Ef 󉟼<$]?}U )uU E [^_]E E [^_]E US]tDS t=C$t6…u)CM MMMH|[]ú[]UWVS}] DЉ ЉECEtƉ ƉugWBteJ0zPt9r[^_]Ãu߉ MʉЃ[^_]ËE9rX[^_]ËztfGtiGOt )|uO$t )|uO,]U뤃zl =uR+UWVS4LL YE܋EE؅Y} OE@EEP &PE@=u~uN(] ^(v=* EPA@qE@ EM$  @M L$M $MPct'} fN}  E;EXu E@(E؃4[^_]ËE-@MAEЃ} n] ۍ ~ 9=EHE@Extu nx} WEPEH0uFXFu ^EH0VFX^,EH2VFX^ EH3VFX^ EHVFX^ EHVFX^,EH VFX^ EH VFX^ EMA~؉AE@Ee]C0E _E@lt B))ЃuNVZ^$NVZ^Fl6D$D$$] $MA0]CqCE@9ZD$D$$]MA0uVFHNVFHNVFHNVGB,JA:Zȋr$}_OqwЈ GHWGX_ GHWGX_,GHWGX_ GHWGX_    uNFX^FH VFX^ Vzt*JVFX^ FHVFX^,VZ, E@ @E=}  VFHNVFHNVFHNVFHNVFHN   uNFX^VFHNFqE|~@FEtsIk[M gE@@, E7EXۋE@I} ?E-@MAEEPJ]{}s B)E[ ]9kUotftB BJI,t 9E EB UEUBGMu)M]z }JIr 9EE])ZE߉΃tSEi uE@0NVZ^NVZ^EP0NFX^4NFX^tM)ȉD$BȉUԉD$E@0$]MA0UE]ڋE}x΃Ntft]MKKSB,E@ E@IBuN&ZV z~ ^x~t4FV9F uՋz,t9EFnV1묋EPZ,t @9E@ E@[J$ uN*Z$V z~ ^x~FV9F uыR,t9ruEFV1묋MAhE D$E$0Pb)ȉD$NL$E@0$]MA0)ȉD$NL$E@0$]MA0b W]C@,C9CgB,MAgtsE@P]9S sECMI0uVX^ EH0VFX^,D$D$$]+MA0uFqEFjfmEK1ϋGtG`W8GlZZZfGtGtOlQWl9p_t^M }Eǀ} (M7A\Yl])…A8D$ T$D$u4$]3FlF\M@G\)…x9G8t$ T$D$<$]O3GlG\ P1ƋEPu^VFX^ EP0NFX^4NFX^E(E}E(G`GlO8MtMLU:QMZZZfotGl9_tS_t=E qG`GlO8M;9MhE)L$CD$E@0$]MA0V7D$ D$D$E$]U.} HEEP~@B)ȉD$uNL$E@0$]2MA0V<)ȉD$uNL$E@0$]MA0F@,L:Q1:Q(U썔UЉ}]]׋UI:Y:Y:Y:Y:Y:Y:9~:Yt}]ԉUU)сO`9_`ٍAZZZMff G`)GtGlG`9xG\Wl)…G8D$ T$D$<$]]/GlG\@E<EuFD$FD$E@0$]MA0VK1FEǀ} `MA\qlu)…A8D$ T$D$u4$]`.FlF\pEPE$],5'uFDVLfDPTT$D$$]Nt[FlF\dž>ɀ @\Yl])…A8D$ T$D$u4$]x-FlF\4@u FE@@\Yl])…x?A8D$ T$D$u4$]-FlF\1n1N1w1fEP}]ԉU}]ԉUt}]ԉUc}]ԉUR}]ԉUA}]ԉU0}]ԉUUWVS8 oF} EJEqEp3 Y}OE@ M苔M9~(uaE9tF}L DDF|EE[^_]D$E$E@FtFl9F\EXYtYVDFLfDBDD$D$$dž    9TE,E UWVS]ƋCxPtT$C($S$CPDtT$C($S$CP@tT$C($S$CP8tT$C($S$CD$C($S$Cqt[^_]þUWVS 6  DEuE EM}EEEEE U$o81f8]vEFF ^$}uEEG} }UD$D$F($V ÅUF0@*P@x0ljC,@C4UJKPCLCT SXD$|$F($V C8D$C,D$F($V C@D$CLD$F($V CDǃUJD$D$F($V C K K8{@KDЉDRE쉃E艃C$u [^_]A|A13u3 eEF$EF F( [^_]øCE-@F4$}U ED$ED$D$D$D$ D$E D$E$]UWVS] EUCECBCBC B CBCBCBCBC B K$J$K(J(s,r,s0r0[4Z4D$D$ $ЉÅUBNjuD$C,D$B($UR C8D$C,D$UB($R C@D$CLD$UB($R CDD$D$UB($R C{8Us@KDC,uv8C,{@uv@ CL{DMqD-{uvuju^CMQ+QS $ | 0 E[^_]älfb.t&ft.t&`fV&ft&fu5AfY{8f3f+0f(-f%*$ E1E%./ <UWVS8/ <EȋM }׃}TuĉU 2A3؃u߉߉UθEEEE]ȍỦuEʋ1E؋u3ruԋM3JMЋ}3z }}3z}܃<EEEEE܋EU U҉3tRET  }9`U릋}>X8Xr‰]f9]s‹EƋE܉D [^_]ËEX8Xrf}U냉E܉D [^_]UWVSLÉ֋EЋJ9}A EǃPǃT=1E1M̉ыU"P\ ƄXE9tf<ufD9uM̃YẺMM}ȉuK}11҃P\ fƄXU)‹}}t T7)t4}뤉MMuEFM̉uȋuЉuM̋uȋPM}̉uu9B3XEfpfq~` UЉv}` UămẺP` ` }Љ6` MȋTMEUĉX MTMȉT Ѝ UȍUffXEX8*%MuET` Eȋ}P FE̋AEAEAEč< 1mu1 9r EЋ}fD}<ET PEE]<)ދ]4 ]EtD9}7]Ѝ DD]9}EfA9u|‹]fC< ]9{11uK: fNuExBuЍ|9t2VtLUԍAfDU1ۉȃ uf9u΃L[^_]Ë]ȋ}tEčPUȍ4C: fEȉC< ftfC< fK< f< Uą$=uS< }ȅt>uă\ 9M|uЍ<L9t)fWmuȋuĉ뤋MċEcȪf1E*ȪfUWVS ERfDHDE1E69t*9}tuf| 1]9Mt>9|9}6}f| tK9U19Muƒ [^_]Åt49]t Ef| Ef u1]z E$f u$1ENf t1E*]1UWVS BE%Z]\ ]1һ}܉fMMc9t|~ | Uf UU)9fGHOOGPWW )UUDu  ډU ʹ)9fGHOOGPWW )ڍL0~E fOWZ_WGX_ )fEu99E1EM9MUUUUVU9t8[^_]UWVS  }GtSD$U^ƋGD$U$3t)4$a=yarauE 0 [^_]É4$JWY1 [^_]UWVS  Î}GtSD$U@^ƋGD$U$d3t)4$2a=tciduE 0 [^_]É4$V1 [^_]UWVS  uFt>D$U]NjFD$U$2tE 8q [^_]1 [^_]UWVS  â}GtUD$UT]ƋGD$U$x2t+4$F`=yarauE 0 [^_]É4$U1 [^_]UWVS  %}GtUD$U\ƋGD$U$1t+4$_=tciduE 0 [^_]É4$YU1 [^_]UWVS# èED$E D$E$UtSEt4}D<$A\ƋED$<$h1tE01[^_][^_]پ[^_]UVS ut$E D$E$£t.yaraUFƅu [^]{0[^]k0[^]UVS! æ ut$E D$E$St.tcidUƅu [^] 0[^]0[^]UEU E MMM] UEU E tcidMMM]UVSt E D$E$ՉƉ$]=tciduE0[^]1[^]UVS$ é E D$E$腉Ɖ$m]=loobt 1[^]É4$U[^]UWVS P E$t,ƉD$E D$E$ʼnlj4$R [^_]1 [^_]USq E D$E$҈UT$$Dg[]US8 ý E D$E$虈UT$$g[]US Ä E D$E$`UT$$g[]US K E D$E$'UT$$ h[]US  E D$E$UT$$7h[]UST E D$E$赇UT$$@h[]US à E D$E$|UT$$nh[]US g E D$E$CUT$$h[]US . E D$E$ UT$$i[]USp E D$E$цUT$$3i[]US7 ü E D$E$蘆UT$$6=atadt 1[^]É4$ptUEt 4$pM[^]UWVS ED$E$nt,ƉD$E D$E$lj4$d+ [^_]1 [^_]UWVS " çED$E$7ot,ƉD$E D$E$葆lj4$+ [^_]1 [^_]UWVS EED$E $nt%ƉD$E$>lj4$*[^_]1[^_]UWVSe ED$E $znt%ƉD$E$lj4$L*[^_]1[^_]UWVS ÏE D$E$Ɖ$S4=gntst 1[^_]É4$ P$UDžtڋUT$D$4$ t U:[^_]É<$UVS E D$E$zƉ$3=gntst 1[^]É4$N tU[^]UWVS # èE$ct,ƉD$E D$E$虄lj4$ ) [^_]1 [^_]UWVS ME $t%ƉD$E$Mlj4$([^_]1[^_]UWVS t E$t,ƉD$E D$E$lj4$[( [^_]1 [^_]UWVS ÞE $t%ƉD$E$螄lj4$([^_]1[^_]UWVS Ju t#t$E$Tlj4$'[^_]1[^_]UWVS { ut*t$E D$E$lj4$l' [^_]1 [^_]ffffUWVS! æE 0Ft%uFt$4$1[^_]ÍdL <$1Ft<$"1[^_]Ét$L $<$FUS D$dL $藜 D$L $R1[]USP EU 9t8J 9H u(Rt<@t-T$$o[]1[]ø[]Í=ˍ=US fE @tUT$$[]ÍD$ D$D$t$~US E @tURtUt]NjMs"EtfEtBEB Ѓ[^_]׍zD$ D$D$0$Å$!1UVS Cut4$Z}[^]"zD$ |D$D$~$WUWVS] Etw} |$ ED$D$$hƅxEH $M…t1|$ ED$ML$$UhU1x[^_]1[^_]ÍzD$ D$D$V$蛄U )UT$7$]UVSy ut4$|[^]zD$ |D$D$~$UWVS  Ýutb,9uXFt@~ G$…t>FtAD$$UbU [^_]H4$} [^_]1 [^_]Í=UWVS utJ,9u@~ G$g…t,Ft/D$$U bU [^_]1 [^_]Í=U Et ,9t1]Ë@ ]U uEt,9uP@tt ]1҉]Í=]US 1Et ,9t1[]ËU tH Q9Ur@tD$E $&a[]Í=UR Et ,9t1]Ë@]UWVS Ü}t;,9u1G $ƅtGt"D$4$`[^_]1[^_]Í=U 8Et,9u @t]1]Í=]UWVSx ut ,9t 1[^_]ËU tM 9uFtA F EP$U/DžtŋE HɋUtOFt@L$D$ `D$T$<$dF~}~ t$hs=븍=UWVS 9ut ,9t 1[^_]ËE FtE $(xF EH $Mf…tFMtI} |$D$ `D$L$$U6dFUV}~ t$o=믍zD$ `D$D$<$US QEt ,9t1[]ËM tM 9uL$$(US Et ,9t1[]Ë@tU T$$w[]Í=US1 öEt ,9t1[]Ë@tU T$$Mw[]Í=US bEU tG,9u=t99 u5Rt@tT$$v[]Í=@uፃ=ٸfUSs Et.,9u$@tU T$$v[]Í=fUWVS # èu~(Ft  [^_]D$ED$ D$D$4$tȋUBU$DžtFD$ED$ UT$|$4$t}M9Muu>uyF8"udF1M Z$ Zƅt',D$4$XFF FE 0 [^_]É<$D$eD$4$tՋMofffUWVSP S<$;xvH@Ή9w u)D$D$ D$t$<$D$D$ D$t$<$jxuP[^_]Ét$D$$_DžD$D$<$R?D$D$ D$t$<$D$D$ D$t$<$wuP[^_]UWVS Jƀ8$CrD9t- P9/t9rq/u9t9t8/t)ȃ=%׋ƄfDž.$zqP /.pl@istX@XXXXf@ X $ƃtb|$D$4$΃984$$Y1s8[^_]_?1[^_]äƄ3f P4$c$mlj$cׁ|$4$?0D$$螆~84$&UWVS։ʻ1ɍ<0ufPw 7 uuf F[^_]ÍPw W ӍPЀ w 0 1UEU @]UWVSȿ IuM ^t^F9tX^ [^_]ÉMD$$衿…FFM빍{D$ D$D$p$w{D$ D$D$p$vD$ D$D$p$v1űE荘={& t̉D$4$u1 [^_]<\\D$\4$ltӉT$4$Ytƒ][^_]UVSM ]u {u3vut&D$$Ot,u[^]D$<$%u 1[^]D$/$t6u Ht>D$$u뼍T$ lT$D$p$oqE >][^]UWVS\ ]} u{w{u4wut&D$$_t-u[^_]D$<$4u 1[^_]Ë?u Ht>D$$uύT$ T$D$p$pt][^_]}UWVS Q ]Ct  [^_]Í < tD$$/u1 [^_]ÍO{D$\D$$itD$ $ [^_]UVS辷 3]D$ $tCu3\D$$u 1[^]D$ $tD$$u[^]UVS3 ø$$t@$t$FFF EF[^]É4$i1USͶ RE$H[]UWVS訶 -u@ } $wDžto$etUGGG E G<$tt$<$P u2$觹1<$蝹[^_]É<$苹1[^_]É<$0t‹7UWVSյ Z]u}E E $ae‹FUJv<F H!uix-x-PVHtzB-ttjB-u<-uz>tBFv1RU/}u(}~,Fǀ  (u1[^_]À/t>t t  uΉ)N] t9uʉT$D$E $]u?/F(<>t uHvb~ t{ lqC u\*x E]]{D$ D$D$p$k t=u)Vx"xPV HЀ"u c"tXuEF(>FFF F$GFR1q)щN$x>8UWVS0 nEEu }8Xtj1t9s[tN<<}<&uKatClt.gt}qfu({uu"{ou{tu{;u"룀{tt;10[^_]Kmpu{ouހ{su؀{;u҃'b{;u<O{tu{;u>6EMMt<"+E<\tdMt&ȋM)]9t 9rD]6U멀{p'{;CEt6<>t)uE$EE[^_]Ípq Ɖ$r\E jU4$-jU [^_]1 [^_]UD$E$]U D$E D$E$J]AUS* ïE$'t[]Í{D$ hD$D$p$cUWVS0ѫ V$>_}_HtыpG$|_tBtD$D$ D$ED$$_u0[^_]ËUT$$PDžtօt$ Lu}DžPtҋ@w4$)T$$PtЉ4$ktaNjPu냍{D$ TD$D$Up$b{D$ TD$D$_p$a{D$ 4D$D$p$a{D$ 4D$D$$p$a{D$ 4D$D$,p$gatыt$P{D$ 4D$D$:p$aUWVS< Ü4$\B BBB$BBB(B8O&Bf[+t{vBADžT$T$4$ЄY?D$D$ D$|$4$D$D$ D$|$4$N\ut#B8OqB8|<[^_]ÿ"[upB(VxauZxluTxsuNxeuHxBJB(zxru"xuuxeux̃+)D$D$ |$D$4$D$D$ D$D$4$ [u1<[^_]ÍHJx"t%>LlBB(>Li4$1UWVS iEuKvuE1҉Ѓ[^_]D$$ Džtމf‰U<$ UЃ[^_]1Ҁ<‰T$$DžtfUE 9E]UWVS谍 5ƅtBD$$跌Et E$@zDžMu% $1\$@YDžtE D$<$PD$G$YEG,w0G4G8G<[^_]US uL $1W[]USʌ OeD$̲$ZL $V[]US茌 D$L $VD$L $F1[]USD əED$E $z<[]US ÜED$E $J<[]US lE$WE $W[]UWVS(豋 6UM܋p4@,EEGEt@E<E t{D$ LD$D$$=UWVS谅 5uFt0 9u&x<$QƉ<$Q[^_]ÍD$ D$D$$2=UWVS8 ýƄt1fƅtptC[^_]ÉUx<$%Q1ɋU5ƅtpt<$Q[^_]ÍD$ 0D$D$$<US蟄 $E xt"D$,D$E$[]Í|D$ `D$D$ $0<US8 ýUB4tB4R,…t8$.[]Í|D$ D$D$$;{D$ D$D$$;UWVS4訃 -UM@8t 14[^_]ÉƉ׍@E$OMt9pE}<$!Ex4$gE$^O4[^_]ÍeD$̲$PL ljE؉$YMUT$L Mԉ $E܅$<$&MV09V4E$N4F,E؋U<}Nj2UЉMԃD$E$2MԋU|A)D$|$E؍D$EF,}܉8MHF4F<E؉$jLE$1E܃,}<}ܜ$|EMD$ $}|$MA$dEU܉PU؉$K|$}ԉ<$萳E܅$7U؉$KE@,v}><<E]E tE $[^_]Ãt}E9E)>E1}E9E)><<Nkr<[u1R}GEt"E9E7E)ȉ >}> |D$ ,D$D$e`$"=2]D$ ,D$D$,`$!UWVS i >w$dLD$$U衩UBB BE u Ѓ [^_]ËE $WdUtJNju} s5E u%E uBE B Ѓ [^_]äBE B fE tM $1UWVS h nvu} tEt=$ct%LT$$EɨE@px [^_]11UWVSh vuE u@1$_cDžtLD$<$]GwE G [^_]ËE $"ctDǃ} s E uE u뛤ƐfE tM E tE o1UWVS g Juu} tEt=$bt%LT$$E襧E@px [^_]11UVS_g tutGL9u=Fu!F D$F$tH[^]É4$޺[^]1Ug „tEt L9t1]Ë@ ]Uf \tEtL9u@]1]UWVf 2tEt L9t1^_]ËU tP 9Urptt} suuɤfuufUWVS f ÒsEtHL9u>P pt0t{$U`t!NjUs*ut[^_]Åu!1[^_]ftt鍃D$ dD$D$`$YD$ dD$D$`$/UCe rEtL9u@]1]USe ÔrEt L9t1[]ËM tM 9uL$$bUS d MrEt L9t1 []ËM9H uU tL$M L$@$襕 []UWVS kd qu>t=~(u7Ft=D$ @T$VT$$Zt F$ [^_]ËFD$U$11tՋ}O $M^EtFVT$U$MUK9}D$)D$4$购$~^ƅLD$4$xFEF~ E 0%r!D$ED$F $:ljEt\UF$F 9:" |D$ LD$D$`$E$Sf [^_] 8"uE$+f$]ƅtEE$f1 1Ulb oEt 9t1]ËM tM 9u9]UVS$b éot$L $ƃL t$L $ƃL 1[^]USa VoE xtD$E$[]ÍUVSa ouJD$$.tL 4$'[^]ÍL UVS?a nut9u4$[^]1[^]Ua ‹nEt 9t1]@]U` bnEt 9t1]@]US` 5nEt 9t1[]ËM tM 9uL$$UVSh` muFt [^]À~(tD$ D$FD$F$Mu_D$ D$FD$F$%tWJD$$F-L 4$蚳E 0[^]ÍJD$$-L Ǎ(D$ D$D$$afffUWVSa_ lƅtBD$$h^Et E$@+ZDžMu% $b1d$@ ZDžtED$E<$ED$G$*EG,w0G4G8G<[^_]US^ lE$*E $*[]UVSd^ kPt@9 u6p 9r(}D$ D$D$|$tD$ D$D$l$UWVSZ uhƉEx,}UD$$YtQUtBMI0M s!MA,Q0E$^[^_]NjuӉF,V01UWVS^Z gƉ׋P4@09rJF8u:9t(<$V,F4HN4U Ɖ<$*[^_]UWVSN r\ut 9t[^_]ÍN $MF4E9E MF8V,E EE }9sA<|E }9s*MuUJ,4t9uM}u}~4F< $RE$@[^_]É $77}D$ pD$D$$(}D$ pD$D$$USM 2[Et 9t1[]ËM tM 9uL$$USfM ZD$E$藖[]UWVSu} ]Ct [^_]1t{(uى[^_]/USL ~ZD$E$[]US L QZD$E D$E$跟 []USL ZD$E$[]UEǀǀ]UVSPL YutFwyM MJ]ZMJ [^]$Ft|] X]XMH ]X뼍:}D$ D$D$A$D$ D$D$B$V1fUWVSUK XUu }t`t`tAtA}tA uutA} $uN[^_]1[^_]Ãt  t L ]tL ] MtD ]뙍DD$ D$D$Z$DUWVSED$] u}څu59D$}t }GȋT$[^_]9sut E|$8XD$1σL$uT9r9ڋD$)]t}W뗉u 11҉ËD$\$Z D$)‰$ L$t$ ؉։L$T$ ދT$L$T$ÉӉd$ D$T$9rFt>Et(D$+D$\$ $|$ }_D$9D$sq+D$ T$D$1UWVSu] }Eڅu9sL1҃[^_]Ét$9s [^_]ȃL$ u;9r9r )‰t$D$[^_]Éu 11뛺 L$ )D$T$‹D$ ‰T$D$ L$L$ L$ 4$t$Ɖ9r-t&$)ˉL$|$ ڃ[^_]9$s)T$щUWVS }|$u ]Eu9sA1 [^_]9s11 [^_]u@9r 9\$ىمu 11҉ƋD$ [^_]ú )D$؉D$ L$$\$ ؉t$щ$$9rt 1RT$9sC1<15UWVS M]}  D$\$ۋD$D$ˋuD$u 9ƉD$1MD$9sFȉD$1\$|$tكۋt$t؃ڋuVȉڃ [^_]ËT$ƒD$uy9r9,)|$ȉ뙅u 1t$1҉ljƉ|$PЉD$كۉ\$]U ] } D$ T$)ЉD$ ыT$L$ ЉD$T$\$\$ L$4$Ét$Ӊd$ƉT$9r èKu D$E$(@t[^]fffffff$̀ffff'̀ffffỳrS[4K[̀rS[K[̀rS[J[&̀rS[J[%̀rS[ôJ[ḅ̀rS[ÔJ[̀rS[tJ[ḡ̀rS[TJ[̀rS[4J[̀rS[J[:̀rS[I[̀rS[I[̀rS[ôI[̀rS[ÔI[Ḯ̀rS[tI[%̀rS[TI[_̀rS[4I[\̀rS[I[;̀rS[H[b̀rS[H[̀rS[ôH[̀rS[ÔH[ḛ̀rS[tH[c̀rS[TH[2̀rS[4H[̀rS[H[̀rS[G[9̀rS[G[Ḇ̀rS[ôG[ḵ̀rS[ÔG[8̀rS[tG[Ḁ̀rS[TG[̀rS[4G[Ḅ̀rS[G[̀rS[F[ ̀rS[F[̀rS[ôF[̀rS[ÔF[0̀rS[tF[Q̀rS[TF[̀rS[4F[)̀rS[F[{̀rS[E[|̀rS[E[#̀rS[ôE[)̀rS[ÔE[=̀rS[tE[̀rS[TE[̀rS[4E["̀rS[E[USs7 DE UD$T$ D$E$ X[]US:7 ÿDEUD$T$D$ ED$E D$E$W[]US6 xDEUD$T$D$ ED$E D$E$W[]ffffYXZQ̀QQrUS6 DED$ ED$E D$E$[]US [6 CED$E D$E$MX []fffUS&6 ëC9E[]US5 ÄC9E@[]US5 ^Cp7u1[]$S1[]US5 $Cp7u1[]$1[]USe5 Bp7u1[]$1[]US+5 ðBp7u1[]$1[]US4 vBp7u1[]$k1[]US4 ut$E EED$D$vt4$[^]ÍD$ D$D$;$UVS0 y>ut/ED$D$wt@4$ x@Eu[^]ÍD$ D$D$;$E른ffUWVSq0 =}u tKt$ttf|[^_]ÉuED$D$t<$n[^_]ÍD$ D$D$: $UVS/ a=utD$D$^t 4$[^]ÍD$ D$D$8D $=UWVSu/ <u} t~(~$1[^_]ÍD$ ,D$D$7h $~(~$1[^_]UVS/ Ó<utE F(1[^]ÍD$ 8D$D$7 $E F(1[^]UVS. 1<utE F$1[^]ÍD$ HD$D$7 $E F$1[^]UVSJ. ;ut$&ff gFF[^]ÍD$ XD$D$; $UVS- e;ut F([^]ÍD$ dD$D$7 $WF([^]UVS- ;ut F$[^]ÍD$ tD$D$70 $F$[^]fffffffSL$D$ t9tEA.&f€tuuuu˃t@Au<.t&€tAt9AtAt9Au΋D$[US v, 9P D$E D$E$5 []fffffffUWVS1, ö9u} j%=9~=@U=`b%ໃrGO%ඃwG%@=wK@vu xOG ໃrQඃwA%=0u xQAໃrඃwB\BBxf [^_]=us=@'s=t:= uoc=t@=u w=uFlzpp--sRdHS?4SBBTf [^_]ÍBB-f [^_]ÍBBtf [^_]uF%̃aD$ D$D$9X $AgABfUWVS a) 6E(D$E$TE= YAD$ED$E${Uǃ8uE$TOEtMEMED$UT$4$kMu E<=tX4E8E4uϋM9|>) ‰L$D$$蟺iX1 [^_]ÉM4$fSM랹čD$ D$D$>| $넍UWVS' Q5Eh'l{ptDžxAEEEEEE|(D$ut$$k]E$D$t$$EDž<Dž@DžDDž8H|$8D$$Dž\Dž`Džd1|X}t Xuĉ4$_XD$4$|$4$D$04$5U8D$hD$t$ D$ D$0$"G,V4$G,48D$t$0$tD$(D$$D$$D$$D$|$$4[^_]D$ $![^_]Dž4c;,Dž4GD$(D$$yD$(D$$D$$D$$UWVS@$ 2t$0D$T$L$4D$4t "|$GD$8UT$$\$0uL$8ǀ-;+=D$D$4C0ND$D$$D$ D$( D$,D$4 11҉D$8T$<~09L$4xfD$$|$89T$ |$<O|$<1\$81؉ -D$(T$,Ë|$<ߋD$8d$(ډډD$8T$<NyЉ< uA< W9L$4jߋD$8T$e[^_]D$rD$4D$4FL$8D$(T$,D$T$ $D$\$0D$$T$ D$(T$,D$T$ $D$D$L$8D$9\$0V"D$8D$e[^_]D$rD$4D$4FL$8D$(T$,D$T$ $D$\$0D$$T$ D$(T$,D$T$ $D$D$L$8D$9\$0}"D$8D$D$=u4$臒7)EE8EE1҉MԉU*}D9FEE>tHED$|$M $nLuى<$"}9EuEEE>uMԋU܅{UWENjp,-t$E8:tED$ED$$xGxp70E<-<+<::gB9FB 9F <;uEz8;E=-0tE8:tD$WL$žp7WE<-QEx:T?Fw E؉Gw t01]E8[^_]ËMԋUEE$XEM~t$ lT$UD$_| <$'EUMt$ \D$D$<$>u42~L$ Mlt$D$`| <$諿EM:\L$ t$D$<$3-~D$ lD$D$a| $P <:z5E*E!w ]ẼuE MЋM؉<-t(E8:t ED$ $菜EEЋG21p7Eu-t$E8:tED$ED$$&p7zEEzU؉:=P}EЋuAE $MЋzuE-8tE8:tt$${p70-08E8:,ED$|$=y:6}9E} }؉2~L$ MT$UD$`<$ UҋUM-~D$ T$D$a<$޼t$ \t$D$<$Mn2~=-E8:t$L$LG M-~D$ t$D$a<$B\Mu 4Mt$ \t$D$<$McUWVS4 ù} uP u$ǃP E ;M8-p$x P -=$D$-E$#ǃ P --|$E$tAx:ǃP >u[^_]Ír$ P :u>u t E8:?부xt=$됋>uTx:tL9M=$E8: tZ|$ D$ 1P =$[^_]Í~D$ pD$D$R $uB~D$ pD$D$S $譹跽|$ D$O~D$-$誡E 4=:dUVS $utD$ D$4$[^]ÍD$ xD$D$/ $UVS7 ü utD$4$e[^]Íi~D$ D$D$/$ $衸ffffUSX E$N1[]UWVS1 Etut4E@D$Ex E@t$9r0E@ 1҃[^_]ÉuU 9E׋EP @D$E@t$9s뿋E@D$M);u ED$1E U9Nj]C E@t$9ANE E ~D$ D$D$D $e׋EP @D$0E Udew~D$ D$D$D $6TUWVSs UB EEEu1u}u}9}EE}B269rz])9ErEË}u sHu(u J J ZR9r [^_]ÉftEË}u rucuk량UGD$4$?ƅt[UB)ǍD|$D$$7U0MJB E4Xf넃BUWVS u} D$$$R…0x@@ D$D$D$ D$D$$UDžt)D$$[^_]18U$>$4Ϲ81Ĺ8US  E D$ED$-X$ []USJED$ E D$ED$-X$[]UWVS Ïu} t(ED$ 1D$|$4$gC[^_]Í.D$ D$D$4p $`UVSut'D$ D$D$4$B[^]Í.D$ D$D$Ap $UWVS+ðu} t)D$ 1D$|$4$B[^_]Í.D$ D$D$6 $耲UVS>ut>D$D$ D$D$4$Et [^]1[^]Í~D$ D$D$0 $US6ûED$ D$ E D$E$X[]UWVSÀuttE D$4$~7蒓F0u D$4$蓓[^_]tYF0uҿ@F0뻍.D$ D$D$/ $]UUM E=vEM EB]UWVS u] Et?})t6vD$\$$Vu9}tE) [^_]ËE [^_]UEU@ ]UWVS(E0x$tu[^_]1[^_]UWVSf} tE}1tGfp f@UPx$MH,UP(UPDUP [^_]þEu51UWVS p}u$‹EE Bzr EBttpE tZ0E YEU,1UtnMfH f@PM H$x,p(@DP [^_]ÍYE뭋M t0E E딉UEU$1 [^_]UWVSoUE trB0~4r,txM q J$tE D$ E 0xt$|$$q[^_]ÉU~D$ D$D$< $UY.D$ D$D$; $蹭U US rED$E D$E$ []USAED$ ED$E D$E$Z[]UVSuf~ D$4$F0tN@9t $F0ǀǀ FFF t1FD$4$ߎ1[^]ËFߍ.D$ D$D$< ${L UWVS#EU tdP0~4p,t} r H$t} Lj $>M Q!Ѓ[^_]ÉE~T$ T$D$9D $譫Eg.T$ T$D$8D ${E.UWVS2utFD$4$Knx$P8D$4$T[^_]É4$/ڍ.D$ D$D$7h $US "çED$E D$E$9 []USvED$ ED$E D$E$7[]UWVS,<Et8uj}ԉF;(~$&FFF )t$|$$脳,[^_]ÉEԉ$E؍EEu}w~끋,uUqEx9(~]Ë,]Í~]UWVST5UE }}8}M1ɉցE-  tM9utID$2@D$u4$4$ߟPEu2}E+ЃT[^_]Àu3p4$譟PEtΉUED$t$E$:U밉t$ (D$D$2u4$躋4$\PxU@E 7t"ED$G$賟ut$ 눺]}U D$ D$D$ $§UE T$ T$D$ $荧uE7M,E T$ T$D$ $GE]1fUEPt/t]P uE tP f҉Pf@ ]P t uE u]E u]fUEPt.t]P uE tPffP @]P t uE u]E u]ffffffffUEuE w E ]1]UVS~ut;F)F3E uF F[^]1[^]ÍD$ D$D$Y'$ĥUWVSÁu} Uts~F<FF DWPWPW P F F 1[^_]ÍED$ D$D$v'$U`UсD$ D$D$w'$̤U+UVS}ut~u@~w:E [^]ÍED$ D$D$'$_뺸UVSut~uAF u9<.w5[^]ÍED$ D$D$'$빸UWVS(í}u t5u%G u<.w~9|D7[^_]1[^_]ÍED$ D$D$'$qUWVS.u} t*~uPF uH<.wDx>9؃[^_]ÍED$ D$D$'$몸UEu E D]1]UWVSÙ}utQEu@D69E r4E D$D$<$+|6GfGG[^_]1[^_]ÍD$ D$D$.'$AUWVSyu} t;~uaVL\WQWQW Q F1[^_]ÍD$ D$D$M'$輡뙸UWVS4rƉEԋE} 8uЋU1҅x'PރT$D$<$]GGt_T7<}؋x}p uX]HM܉M HJH JHJ H:rZ}܉z ]9u1}ЋU+4[^_]ÉE܋]ԍRT$ lT$D$h'$臠E܅E܋]ԍ]T$ lT$D$i'$LEm]U*UVSmut~uEFu=:Fr6[^]ÍD$ XD$D$'$ϟ뵸UWVSÅu} t9~u)Fu!:Frx9sD>[^_]1[^_]ÍD$ DD$D$'$EffffffUWVSqƉׅt18u9s1[^_]ÍF9rFލiD$ PD$D$$=uUWVSot ljփu [^_]Rw%FGT$D$<$w[^_]ÉUuD$ D$D$$$UUS[E x[]ÉET$ T$D$T$̝E[]UWVSÂu} Et,tYPσF)F 71[^_]ÍT$ T$D$b$LEuET$ T$D$c$ErUWVS?Eu}UxE ;Eà EME9؋M)1L!ȉ)1׉E8E 8t@‰ߋu s}tftËM؋})p)ƉnE0)F=^EX E[^_]EE[^_]ø‰ߋu rbEX]荃D$ D$D$$oÍED$ D$D$$>W]荃D$ D$D$$ f;{PUWVSEuM}~ 9)1UD!ЉEUE)‹E1UU ˉM] E )P)‰U|U)G=Mw]_^ ȃ[^_]1ɉȃ[^_]Í^^ÍED$ pD$D$$輙MM]荃D$ pD$D$$脙MkUWVS;u} tt~)F1V J 9\ t+9sw[^_]ÍFፃD$ \D$D$$踘]ED$ \D$D$$艘*UWVS6E} ux)ubHQσwWvPH Y 9r>\ tHډt'9s89t9t!P9r P9sݸ[^_]ú߉1[^_]ÉET$ uPp<+<-iq<@pHLDD$ D$LD$r$lf؉DžH<+tj<--t$X$llPH;v31@U+%[^_]ÉFg<@qs<@PHLDL$ D$D$r$lqDžHhUTd [4$lL uCF)<@t$X$lj DD$ XD$D$4$l覚tthKqUTqUT؉DD$ XD$D$4$lADžHDžL1bUT%LUT Lƅpl4D$ D$D$ށ$q0lD$ D$D$ށ$lqPl&D$ D$D$ށ$.qlAUWVSUM(E<}88ƋE1`<ǃ,P U@D$D$ D$DD$<$`@D$@ D$4$D$D$4$74H0@@ $@P T$$,t@@$9D$4$cX,t$D$4$,|%=B,P $K4$0$8E+[^_]þ뿍D$$W…tE@u_]Ѕu K[tA|$t$ E D$CD$C$uԉEȋUЉ$]=Eȃ@[^_]Ë]Љ$]l=@[^_]Ë]̍&D$ D$D$^ށ$Jl"ÍD$ D$D$\ށ$l]̍4D$ D$D$]ށ$kUVS(*Ɵ8E1EEEEfEfEUUUT$UT$ U T$D$$RU+u([^]É~UVS(覲8E1EEEEfEfEU UUT$UT$ D$D$E$U+u([^]ÉUWVS,ÖuE EE E ȉEbQE x1wtftE @~uE1EWJЀ JJɉM`EE @})șMU9ȸEjE H)ƃ v] ,[^_]EEEU9sWJЀ ?ɉMNEE뽍Jv u(JɉMEUЉE뉅uЃ߃A<wb j@=eD$ D$D$$hE)șM؉Uܸ9ȸEE H9`D$ D$D$}$ThE @}lj)WсD$ D$D$C$hE iE9KM؍8D$ D$D$`$gM4QfUWVS vEp@}\G؉EƂV OE9ÍlV EV uKʀvFu9s\ H9sOpPE9s2E9s7F.Kʀwu9spE9rΉu9sE [^_]À?wglV }w]uCu.}Myt O?9s:}9+V 뢤}Mytft&?뒉tUWVS苭ǘ-<$w7D$ D$E D$E$ZƉ<$w[^_]UWVS 2÷Ǵ-<$sw 7D$D$E$Ɖ<$Mw [^_]fffffffUVS$ҬWutXFD$ FD$FD$FD$FD$D$  D$D$V 4$}H$[^]Í?D$ D$D$3$dyUVS81öuEUT$UT$UT$UT$UT$ D$܃D$4$t 18[^]ËEV E䈃V E舃V E숃V EV E􈃱V V 8[^]ÍND$ D$D$B$!dDUWVS|[^_]1䍃aD$ D$D$ND$[ UWVStÖEUU8M1ɅtBE}<$WM L$ED$<$?XED$<$U+u:t[^_]ÉEoL$ L$D$hD $:[ESUSlE D$E$[]USBǯE D$E$[]UVSÜD$yD$V 4$RD$ t$ED$$Ss[^]UEȅyt ]%]]UWVS0芡E؋}u 8EԉËE1tstX|$}܉<$]1< F TFuF(}ԋE+uS0[^_]$)]ƅuՋ]؍;D$ PD$D$F$Y[]UWVS謠1EE EEu}8U1ҍ $D$@$ d \19ȋ})׉ 9}PD$T$$cc~3D$T$ $19|vH]0$+d]0t 14]0$dm]0D$ $U+uw[^_]D$ D$L$$VB$c1몍D$$:tыptvsUD$D$D$D$ E D$E$]UWVSxNӫEUU8M1ɅtBE}<$M L$ED$<$/ED$<$_U+u:x[^_]ÉEoL$ 0L$D$ $wVEfffUWVS蚝# ]4u 8$ËE14ENMVU^ ]]~}}^]]ċ~}}ȋ^]]̋^ |]Ћ~$x}ԋ^(p]؋~,l}܋^0`]^4\]~8X}vh}l1u1u1lj]11ωtdn߉Љp}1U1׋|1ljh11ljpu2n׉l}1u1x1Ɖω`11߉lhnlj}u1u1t1lj`11׉hnωU}u1U1׋p1ljߋu11ljd`2n}U1׋U1׋l1lj}11ω`n߉M}U1׋|1ϋh1ljNjU11\Un׉u}M1ϋx1ϋd1lj}uM11ߋMXnlj}M1ϋt1ϋ`1lj}11׉T1nω֋}U1׋p1׋\1lj߉u11ljPu2nE}U1׋l1NjX1lj}U11ωLn߉M}U1׋h1NjT1ljMϋU11HUn׉u|1Ƌd1ƋP1Ɖu11މDnƉًux1މ`1L1ÉމM11Ӊ@Mnى|t1ً\1ًH1M щˋM!ˉ! ً];ܼىxp1X1D1M !׉! M}MܼMωutl1T1@1Ɖuu !! }ܼ։׋ph1ڋP1ڋ]1‰U ӋU!Ӊ! ڋ]ܼЉˋld1ȋL1ȋM1E !! ȉEEMܼEuh`1H1u1MM !! u>ܼΉ׋d\1D1u1‰U ֋U!։! uܼӉƋ`X1؋@1؋]1E !! ؉EE]ܼEÉM\T1ً]1ً]1MM !! ً];ܼˉىXP1ڋ]1ڋ]1‰U ӋU!Ӊ! ڋ]3ܼӉƋTL1؋]1؋]1E !! ؉|E]ܼ|ÉtPH1ً]1ً]1Mt !! ً];ܼˉىLD1ڋ]1ڋ]1‰| Ӌt!Ӊ! ڋ|3ܼӉƋH@1؋]1؋]1x !! ؉pxtܼpÉlD]1ً]1ً]1tl !! ًt;ܼˉى@]1ڋ]1ڋ|1‰p Ӌl!Ӊ! ڋp3ܼӉƋE]1؋]1؋x1E !! ؉hElܼhÉlM]1ً]1ًt1Ml !! ً];ܼˉ]}1}1p1lj} ׋l!߉! }7ܼމu}1}1}1Ɖu Ɖ!׉! hul>ܼhhl}u1|1u1Ɖ11߉ubhUu1x1u1‰֋l11ʉub‰Uu1t1u1‰։ډh11ulbщMu1p1u1΋h11ubˉlEu1M1ȋM1l11ЉMh1bƉ֋UM1ʋM1ʋM1‰ыl11ډM9bU|1ʋM1ʋM1‰щd11‰hlbӉEEx1ȋM1ȋM1ld؋M11lM1b|t1ȋM1ȋM1E11Љ|bӋxp1ʋM1ʋh1‰щl11x]bډtM1ʋM1ʋM1‰ыl11‰t9b׉ :dpM1ȋU1Ћ|1‰11؉pl bȋd]EU1ЋU1Ћx1‰1؋d1؉l2bƉuU1֋U1֋t1Ɖu11ΉU:bM}U1׋h1׋p1ljىߋ]11ljU]b߉EU1ЋU1Ћl1‹E11U bЉEu1|1u1ƉM11؉uMbȉEu1x1u1bʋE11UEu1t1Ћu1ubʉ؋U11EU1Ћp1ЋU1<bËE11؉Ћ402މC(lj{8 F ,EF$E+u~[^_]Ë D$ D$D$$^@4< D$ D$D$$ @ 3UVSKДut7#EgFFܺF vT2FFF[^]ÍD$ xD$D$$?UWVS͆RE[U Pu щHs H?J]Ӄ?@)Ӊ]<u EEu|UHL$$EU);MEƋ} T$4$dڃ@;Ur)]] U<u sRtft[^_]äfEuMEC] }|:}hT$ lT$D$$=EU xEoT$ lT$D$$=ECfm2u KM &fUWVS(荄E}u 8EËE11U1ۃÉу\u݉UD$]䍃D$4$>F%=Ut,\D$\$4$F%=u݋UD$T$4$t!1уu}E+uo([^_]Ë]䍃D$ `D$D$$<]䍃D$ `D$D$$;]UWVS0E؋}u 8EԉËE1tstX|$}܉<$]1 F TFuF(}ԋE+uS0[^_]$)]}ƅuՋ]؍;D$ D$D$F $;[]UWVS1öEE EEu}8U1ҍ $D$@$E \19ȋ})׉ 9}PD$T$$D~3D$T$ $k19|v1?0$E?0t 14?0$E>0D$ $U+uw[^_]D$ D$L$$#$E1몍D$$tыptvUD$D$D$D$ E D$E$]UWVSxXEUU8M1ɅtBE}<$vM L$ED$<$ED$<$_U+u:x[^_]ÉEoL$ L$D$  $7EfffffUE@@#Eg@@ܺ@ vT2@]UWVSE 8puX]H MPUHMX]HMX ]P$UH(Mp,uX0]H4MP8|@yZ<3 h Ӊ 1Ή\uh3n\  1Ӊh]nh  h׉ ؋h1|9n ׉ 1}:nh \ 1ڋ}h;n ҉ 1Njxn \ P҉։h 1΋}\;n <P hӉ\ 1Ӌu0nˋh Nj\ 1u1nЋ\ \1u2n 1ڋt7n \ h҉׉ 1Nju\0n ҉ 1΋Unhމ \1ӋUhn  h ҉Ћh 1Un\ h 1Unh 1!1‰hUܼh  ωh1!1ω}>ܼ<2  h1!΋h1֋UܼƋh 1\!1Uܼ h1!1tܼ\ 1!1ًUܼh 1!1‰\Uܼ\  1׉h!1ω}>ܼ<0 1!1֋Eܼ h 1!1h]ܼh 1!1hEܼh 1!1ىhx ܼh h1ˉڋh!1‹|ܼ 1Ӊ!1ȉËEܼ3h 1É!1։\uh3ܼ\ 1!1Éh]ܼh  1߉h}9NSh  h։ 1t2NS ։ 1ʋu0NSh4h ։ ʋh1u0NS  ֋h ։\1ƋUNS>h Ћ\ 1؋UNSȋ\ \׉ 1‹}9NS 2 h׉ 1ʋ}>NS \ډ ׉ 1Ћ|;NShlj ׉ Љ\1؋}h;NS  Ӌ\ 1Ë}>NS ˋ\ Ɖh1u1NS4  Ӊًh 1]NS h PӉ 1ʋ]NS< @։ ʉL1x0NSPӉH pm h T։\ 1׋]h>pmNjT \Ӊ 1]>pmы\ 1؉hE>pmh‰ 0 1hE>pmh 1Ήh|3>pmhh ։h 1Ӌu7>pm h 1Nju1>pm׋h 1hM >pmh  1ډhU>pmh  1hE>pmh 1Ήhu3>pmh \҉ \1ӋU>pm  h 1Njt>pm \ ׉ 1U>pmh \׉ 1ڋ}8>pm\ 1!1hEvmzh 1!1Ήhu3vmzh 1!1Ӊh]vmzh 1ljh!1Nj]vmz  h1!1]vmzh h1߉!1ڋ}8vmzh h1!1xvmz؋h Ήщ\1!Ƌ\1΋t vmz 1щ!1ӋMvmz\ h1!1NjM\vmz  1!1M vmz  h \1!1ڋ}h8vmz \ 1!1hEvmzh  1!1Ήhu3vmzh 1!1Ӊh]vmzh 1!1ljh|9vmzh 11hMʋh 1ډM1ʋx M1ωx1׋U ߋM x1ʉ1U Ƌx ]11]؍  E 1Ћ]1؋U] U11U] 11ʉUU׋U ljȉ}11׋E M1ȉ1E M 11EE 11؉E|ME 1M1ȋt U11‹M UM 1ʉ׋U1׋U U L ׋XUzp4 <UrU1ЋU1Ћu l@؋uF ЋL ȋH1P]NSdыUȋUBU `HEĸ[^_]UWVSE}O_M]ʃ?@)Ӎ41u}Mqy9rdun?v91۾@ω؋]E D$<$Ov@9s]ËE19s-)] }|u s~tft[^_]19rӃ[^_]Ë}}]}|u skEu[EuREUED$E$U)֋E9r{}؋]HuVu=ffEtuVuƆUUD$ D$D$<$fffffUWVS^Ók} 8E1}D$D$HtHE$"t=ED$D$<$|;Es1U+[^_]ø"㍅D$E${tt@D$E$Au[ED$bD$<${;EsED$|$ H%D$`d$T$U.ID$ D$D$B8$蜟UWVS \8jD$V \$E$qƉ؅u [^_]É01UWVSpe\iUZ ut$$Z @B1E}E1uNjU:ME1uEHt$$xxZ @B1Ƌ}E1NjExME1EH D$E$qu(Z ]ٸ@B1E1؃p[^_]øp[^_]$'蜤Z }6D$ D$D$Hۄ$UWVS[ÈhD$rD$E$|uE-@t&tD$E$u܉[^_]D$D$E${t 1[^_]ËEpD$@D$4$u{E@<-u?EP-DPtEPD$ ED$$UWuMU9p9g^My+th)ƍF߃1BD$~)D$4$zE@t<+ !M?!UeYfE?w-t u]Ë u@u1]U&YfEP>w -]1]UWVS(Xofu}܉|$D$4$xINE uG>wlH8EظE! EED$|$4$([^_]Ã>w2H8EظE ExkUWVS"XçeuD$ toD$D$,[ <$y) [ -t@ [ [^_]ÍU T$ t$)‰T$$h뵍7D$D$,[ <$ffffffUWVSaWdƉЉυV=vlot ufus  E ] ^}+}-}=uFЃ[^_]Ã+t-uuXE #EFЃ[^_]ÃXtguy-t~F+։} RF F+֍R먉} 룉UT$ T$D$tX$EFlFaUWVS VÒcu ] EEEE}|$EԉD$$/$v$EvD$|$$EeD$D$Ẻ$wAMẺE0EU-DPuHщMEE1EF$381rUWVS VIVƉU,c tG$ ?uE8rt;F$ u [^_]D$$pn$ [^_]Ë$ FuEx+uD$$/nD$$nF$b Ex+uUWVSH Vlj֋E8rMD$t@G$EGF$ MUVN ,c ,c [^_]Ë$EFG$ UMUVS(GUEu] WU EUE"Ep7uT]LwmƃtK]wEU $Up7E@([^]Ë]썃D$뙍EU D$ED$]썃{D$ 'D$D$ $$](0wp7t]썃D$'E$]PJE$z E$o 01([^]Ë]썃D$]썃D$ D$D$$w]썃3D$ D$D$$:UVS FSEu2]YUEoEEp7]ktht1EU$UEp7E@ [^]ÍEUED$E D$E$] $:]0p7t]썃D$E$]HE$ E$ ;01 [^]Ë]썃D$B]썃D$,9]썃3D$ D$D$$]]썃D$ D$D$$+uUWVS`DQ} p71,c 19~uMU<$]UҋM}8D$|$F $t։4$EGE[^_]ÉM썃D$ ,c M[tD$ 밍D$ c,c L4D$ D$D$$4$FUWVS\BÄPEE}|$ ut$E D$E$"t$t$E$eƒЃ\[^_]ÉEEED$$AUt։|$ D$EE D$E$"MtZEEL$ME$2eƒMtU $EUЃ\[^_]ÉMG8MtE9uWEE뤍@D$ D$D$>$M$ M~9E~L$$d‹MfffffUWVSP}AOEu}b]DE E AEEEE{~ 0jM_U tEExGz;EGEkMddeEUMEEE EE܋E$]6 8MԍD9E 0>EUM]L$\$ $T$],9tu׉EUM]ىeщٸ9и| E AED$ExD$E܉D$ˉу2΁ȉ%ƉƸQ)1ʉ)i)\i(\ø)\ƋE؉E]ʋUʉD$ T$]YD$E D$E$19} |P[^_]Í.EEEE EE=E18[^_]Ãf~*t{uE9sfu!f=?tf=[t]]uuf=?uS`EuLCEFfEf=!E؍FEf}!&f}]AE܉EFE1]ԉ}ЋE܋}]f9uxf]t(fx-uf9r f9Prxf]u؋]ԉ}}ЋE9Su]D$ dD$D$q$eAD$ dD$D$q$3ED$ dD$D$q$FEvfuf]SƋ]UWVS9ÇFu} ttFD$$K4[^_]ÍD$ D$D$Dq$duD$ D$D$Eq$6UWSo8Eׅtkt/tPWu 1[_]Ãu[_]ÉME􍓈}T$ T$D$qq$ME뙉MET$ T$D$pq$MEZUWVS71E8U1҅tWF @D$$tV$U+[^_]!h㉅T$ T$D$Eq$nT$ T$D$Cq${/cyUWVS$6 D]E։M5_VЍEF t =F}|$$]n6DžF\~MfyuE)E $M]0ÅM‹EiFJ‰F u $[^_]Ë}E=v]ԉUE$]0DžUt߅FT$D$<$]'~D$ XD$D$q$]썃D$ XD$D$q$o$]j8FVNUWVS46BljdhlE`E XuEpEP8<E1h`Xphf?X9r9f>*uf~*u1f~*@DFH9`PD$pD$ HD$XD$`$lhdDž|hfDžDdf8$pD$&D$<$sQp@ @<$P TTp@ @I,Lt4l8\T$LЅpQ tPNy~ x .5 h\9lHfOfuት\9lD@u5p4d*4|%=H`h#W89sfG/fPD$pD$\$ld=hfDžHDž@DžDdf8tpdHu|%=@1P(X|%=@B9pp/%`2Y븋`D$ D$D$Sq$GM`Zk`1҉p/!UWVSDO(58ƋE1Hf~uQ@ *΍f}f/sP9uݸz0fd"f*ffʃft@f?f[uZx!#qf92f[ʉfuffP u:!N f?ʃDW Ӏ_ Y9t fx*f*ʉك |$|$<$U+D[^_]ÍJfzuf[Qr f2f]u답f[!Vf]tI։ύOf%ff-uFf]fG-Of%fG^Vf]uH Af]N9D$D$ D$D$$P f 9 9sVfPfu9t.P9fx*P9fx*ʉW 9B kT$ D$)L$pP$覤f[!ʃoV- 0!$xK…DD$D$ D$D$$xY@xf@!EfH9'?|$ D$D$q4$|$ D$D$4$djmeUWVS" 0Ɖ׉MG tMA PQ f>{tBEEft>f{uED$E$quۋE[^_]f~}uf~uM[^_]D$ D$D$q$yMUWVS0!/)9YË)ډσˉHPftDΉ1ۉff}tYFftf[tWf{uFfuM `E10[^_]ÅtGF랍~Ff]fu뀍rZf]tFrc9r1=f[uSf]fً9CS{f{f,uvu91ҋLf fuM }1uLfAf}=s-%qQf]tyىC)D‹΃tfFY}T$ |$D$q4$=ɋT$ |$D$4$ T$ T$D$q$u=$SًfvSdfPUWVS(++u} UDžDžDžDžuBB EBB]uR} UfP9~ʅ\uVtM@ɃfH9Nuft ([^_]É\@x'([^_]B&} U맍D$ D$D$q$U} UhUWVSÜ)EtXEPtF@x~x~61g HT$$At&HUVSRg tftKg [^]ǃg D$4$Ҧg ut$"q$N1[^]UWVSRuǃg g t0$t$g $btHu1v>D$<$2g uΉ|$"q$1g [^_]ÍD$ D$D$$EGUWVSzuǃg g t-$t$g $芴tEu1>D$<$]g uщ|$"q$1g [^_]ÍD$ D$D$$pJUVS+ǃg g t$H[^]ÍD$4$譤g u҉t$"q$)1US4ùg t$mǃg []ffffffUWVSLv]ԉljUĉM؅uą]1E-EEu؃EĉEGET]DCtE- ?*WЍL]DS<*E-}<* tЍ\]]DStڋEЀ*Ҁ[i\U؃B] ȍ{}}\\ ]]DKtE-M9L[^_]À?*vG[\U؃]]Oh}눋}].@렋]у]}ы]]}L[^_]Ë] ȃ]_]_]|}܋}D_]}E-M‹u}[}]ԍچD$ D$D$|P$螵D$ D$D${P$o}-};EӋ}E//E/(EEE-EE؃E}}tÍLUDBt EE$ME/uEtveu؉D$/E$]NgEEÄTD$4$補$h 4$D$:D$Ẻ$Zt$h EԉEȉD$"D$Ẻ$sZEԉg EȉD$TD$Ẻ$st Eԉg EȉD$rD$Ẻ$st Eԉg EȉD$YD$Ẻ$Wst Eԉh ED${ft$Ẻ$mEfg EЉ$EȉD$D$Ẻ$rXEԉh EȉD$MgD$Ẻ$rEԉh EȉD$)D$Ẻ$rVEfh EȉD$cD$Ẻ$]rEfh EȉD$/D$Ẻ$-rEfh EȉD$~cD$Ẻ$qEfh EȉD$DED$Ẻ$qsEԉh EȉD$D$Ẻ$q>Eԉ h EȉD$qD$Ẻ$qqEԉXh EȉD$PD$Ẻ$CqEԉ\h fEpxEfEbxEfEfxEfEoxEfEtxEE`a`h E؉EEEčEEEt}4$TT9u f9t]:/t9r 9֍vtJ:/u9u .t&8:/u9r)vli 9u(Ƅli [^_]Éր>/t>&li ǃstftƄli [^_]Éڍ!ffffUWVSVE$q}|L-DB-fkfbfg@菢D$ ED$E$JzEUE8E9t8u|L8"tQ]ڋEƍ EʋM Q1[^_]fmuAxn1bM]9ȸs С[^_]þUSuD$ E$轧[]fffUWVSA}tz?tu<$ؒD9u p9ti8/t9t`sc~/t9u)=vlm ׃rtftƄlm Ѓ[^_]ø&€8/t Ƹ봸!US< EEEEEEEED$ẺD$$tEMt<[]ø<[]fffffUWVS Æ8ƅt $輞UtE t [^_]Í!$8E uD$D$$cǃtD$$D$<$D$<$~<$zpUS#èEt=tU T$؉$[]$UVS]utE D$D$4$蕤[^]Í~D$ D$D$1$;fT$D$Ít&T$D$.&&T$D$!Ít&T$#L$ u.&T$ .&T$HÐT$.&T$@ÐT$D$ Ít&T$ L$ u.&T$D$.t&T$D$L$  .&&T$D$L$  .&&.&&D$ffff̀rS[ô[Ḯ̀rS[Ô[ḭ̀rS[t[̀ffff̀ffff/̀ffff^̀rS[$[̀rS[[Ḥ̀rS[[<̀rS[[̀rS[ä[ḇ̀rS[Ä[̀rS[d[ḓ̀rS[D[̀rS[$[`̀rS[[R̀rS[[2̀rS[[ḩ̀rS[ä[P̀rS[Ä[ḷ̀rS[d[Ḷ̀rS[D[ḉ̀rS[$[̀rS[[Ḛ̀rS[[̀rS[[Ḩ̀rS[ä[1̀rS[Ä[Ḍ̀rS[d[òrS[D[ìrS[$[l̀rS[[t̀rS[[s̀rS[[r̀rS[ä[p̀rS[Ä[j̀rS[d[m̀rS[D[̀rS[$[Z̀rS[[ ̀rS[[S[[.&f*̀r׋L$Q1fffffỲrJ!Q UWVSqlq pq D$$pq xq +tq |q s$uu[^_]ä[^_]ft뻋tq Ppq D$D$D$D$ D$ D$$7lq 31lq D$$ D$$-$衕Gf?USpq E)9lq t$[]à T$$[]USED$$Cq u !$k[]fffffffUSúQ)‰э)y )ȍ BЅyBut*$I )Ѝ)‰)[]i)\P ףwƒUWVS ÉUB< we΋EE11u v4B< w-ύLzЋuU<9EsNju9r9MrE؃ [^_]1 [^_]UWVSQEU1U9} t?E $MOƉD$ED$M $uˋE8E[^_]ËUt E1UWVS$OƉ8E16-ʄt/}9tBt DK@t⋍t0DCu1U+u]$[^_]É $\`Džtҋ0F D$<$'_F$F(<$`떋UWVSX$E؋}E }x EEEE]-]wu8EX]E]܋DJ@u.<%uEUMYC}Ѝ~}E@}GEЅ>MUЅM E؍E-D$ ED$T$<$ƉEMEU$c1ɉpƉEE M]ȅt)ExQ)؍)MEH}eMEoMMЅGEP$1ɉƉEM =MEU$nƉEE}GEЅMMU$5xƉEMwu?%}ЅMEU$ ,ƉEE}GEtYMUЅKEP$ ƉEEx @uMEЅM E؍ uЅETMEЅE؍M$=1ɋU[ƉEEMEP$1ɉ.ƉEE gMU$ƉEM踓$I )؍))ыEHEMPЀ E MEEЅMU$c1ɉoƉEEȅmEHQ)ȍEE}GMEP$;1MEP$ EEЃ} uG' MEP$1ɉƉEEUMuDBuMU$c1ɉwƉEMEMpMElU$'1ɉ5ƉEE-l}G}eMvMEMEЅ7E؍0=%]ЅE ,}tz]ԋEpE@El‹}̉)ЍH$I )Ѝ))ыUčD)֍D)}G؃Eԃك}}}Gw}Dy@&V؃DY@u] utU܋DB@UЃ@)FUDBb3v%ME)EERUЃAD$1$E؍ډ[t"UB M)i]D$1<$ED-ډM]K U7cUE-D$ ED$E D$E$b]UWVSD Eu q 9P\MP ,M܋HP UPUPUElS *T$$ML$ ML$ML$ML$M܉L$ML$ D$|$4$^9D[^_]Í$MP M$MIH??? F??? F?? ?F ?:??F:?? F????fF m늍9gfff))L$(¾T$$ED$ ED$ED$ED$E܉D$ED$ D$|$4$]9T1D[^_]Uq D$E$]US8pEЉD$E D$E$LtUT$$8[]US4,ñEЉD$E$ MtU T$$m4[]UStE$cLtq T$$4[]fUWVS@6UE u8M1ɃtHMċNMȋNM̋N MЋNMԋNM؋NM܋NMN MN$MN(MMuăt,tSt9T~U+@[^_]Ét$D$t,$Ac׉t$D$t,$+ct$D$t,$c뫉E UL$ xL$D$;  $JxE UL$ xL$D$:  $xE U(fffffffUWVS1öu} tQt!1t  9t)ʉЃ[^_]ÍED$ D$D$8H$w볍:D$ D$D$7H$^wUWVS薾MU Etx $MnxMMEpEt';Uu"|$t$F$V9UtމuE tH9uMtFE]ȃ[^_]E千`D$ D$D$Il$tv=PD$ D$D$Hl$EvUWVS ~uU Mt;A t+ ÃutF\$D$$}O [^_]fUWVS ÖMtU D$E$ED$}|$E$ ƃE $KlEL80t6Eu1 [^_]ÉL$M$UTUM $…tU $VUMȉ׋usYtftE|=Eu stf`Z뉋E|떍D$ D$D$C$tU bnD$ D$D$D$sD$E$Gyf5Ef,zE UVS 蠺%E UtuD$E$謺 [^]ÉT$D$E$hƅu E [^]ÃTt wx01lx 1UWVSäuE 0E,E(84‹E1wD$D$4$~jhDžDžD$$膃D$h8$ShǀPǀTǀX8<$/8Dž@fDžDfFHDžLTDž\dDž`DžX(D$ ,D$0D$<$苽ƅx <$6JuT4E+u[[^_]ÍD$ D$D$D$pfdvRvUUT$ U T$-D$E$]US зUED$E D$E$N []US蟷$ED$ ED$E D$E$L[]UWVS,euq}t}ED$4$Q4$HF0tN@9t $蕺F0ǀǀ FF~ :\}EED$ED$4$J NjEtiUM E9Ut}uf~ E FUxSMN7FE؉FyEE$-E UEπ끉E䍋|L$ M܍T$UD$E؉$nEFEF 8\KD$4$PE,[^_]ËF$\}Ef~ FFCFFD$4$+PE,[^_]ÃUML$ T$D$E؉$mEFHUE$E UtGE.D$ D$D$?$qm`E9Ut!$螯E UtUEmEUVSfuD$4$OV(4$,EF u|D$ D$D$F$V(D$T$!ЃF tRF)D$T$F0t F<)D$T$D$4$ND$T$e[^]ËVPNTT$L$utˋt+FD$T$D$4$_NqD$D$D$4$2NUVS?uD$4$MV(4$DF D$ D$D$F$V(EU!ЃF tZF)EUF0t F<)EUD$4$MEUw0E[^]ËVPNTUMutt+FEUpTD$4$MgpD$4$MUWVS Ò}?euw t>EtB[^_]ÍD$ D$D$M$kj?et[^_]Ft$V tQFtB1ɉωMT:0$V T:($V D: $ҴM;NV r$輴F,t$譴F4t -$虴F8t$芴4$肴[^_]ÍD$ D$D$K$|iUVS貰74$zq D$E$s4$z[^]UVSm4$zq $s4$z[^]UWVS.ó<$ozq D$$jxƉ<$Pz[^_]UWVShuED$@$iED$E $aj…t?t$U$_Ut'zu Ńtt$$_uUEHutU$CEUЃ[^_]ÍD$ D$D$< $g7UVSÁ4$=y,r D$E$h4$ y[^]UVS跮<4$x,r $h4$x[^]UWVSx<$x,r D$$iƉ<$x[^_]ffffffUWVS0!æUz-E܍uu<0 1E1M؋MLYtyu 8<|EuȋM؋uԍE99)11 ؃9ruu\M؋uu9tzwr<.uUy<0BÃ߀Xt\E f)Ǎ|uԄAEDX@30[^_]BD$ D$D$FL$$eUTuԍE9t11UWVS AƹiD$D$-<$LE tED$E D$<$荰D$$ ,FE$?USʫOiUT$ U T$D$E$oUWVS 葫UEtaEEt88 [^_]à "EE 獃D$ D$D$Ç$cpD$ D$D$Ç$wc:}}43+} ;c,uuEU}#Ћu0u9dtt4}t>}9tȋEE T-EE } =U n}E vU -DPum}E 0} Ј3E T-&E 0uE E}E } ;U -DPEE DЍPE}} #}}E1EEu } \Et } %Et } &Et } =uE E 0<EuЈEE} ?U  Ћ}E} } U -DPE K0}E IEE 0<}Ј@E nwt,EE T-ME 0u Ј} -} ^E-u DpuE EE 0uE[EMEEXE+E E6E E"E EE EE EE EEEEEE\EEEcEUdu_31cduY7E 7P-WEUE-WE EE1NEEtE fUWVS,趤3u }EEqE/O]}}؍}}܉MEމU)ߋED$ E؉D$ED$E܉$Uw{GAM ǃEE@uUD$ E؉D$D$E܉$7U+E,[^_]Í]D$ D$D$Ç$ӉU;\Ua9EC4D$ D$D$Ç$ӉU[U4D$ D$D$Ç$ӉU[UXEE؍EEaQFtM ƃUED$ E D$D$E$]UD$ E D$D$E$]UD$ ED$E D$E$s]UWVSâulr />3)Ѝ)Ѝ:~ 9w$&tr um"U$Ѓtr U4$Ѕt?w$WD$ D$$UοUЃ[^_]É4$uw$Wt$ (WD$D$ $U-=E Ut1҉Ѓ[^_]Ëtr t;U$(NjU4$CЃ[^_]Ëǃtr 뫋U tuW3ǃtr \r ^D$$=芟lr Jǃ\r 1+1UWVS"çuhr ))Љ):~ 9w$&pr um"U$Ѓpr U4$Ѕt?w$WD$ D$$UҽUЃ[^_]É4$uw$Wt$ (WD$D$ $U1;E Ut1҉Ѓ[^_]Ëpr t;U$(NjU4$CЃ[^_]Ëǃpr 뫋U tuW3ǃpr Xr ^D$$莝hr IǃXr 1+1UWVS&ë}E$MDždr fE|81ɃP9u/>3)Ѝ)<7ɉM~=~}|$E$MMAF$U 1[^_]Ëtr VD$ ED$$襻E$@F$맋tr u$Ѓtr $(ƉuE$@Otr at $Ѓtr @~u㋳Tr uED$$=蘛Ɖdr lǃTr ǃtr IUWVS'ì}E$KDž`r gE|81ɃP9u𸿿)))<7ɉM~=~}|$E$KMAF$U 1[^_]Ëpr VD$ ED$$襹E$@F$맋pr u$Ѓpr $(ƉuE$@Opr at $Ѓpr @~u㋳Pr uED$$蘙Ɖ`r kǃPr ǃpr IUWVS'ìUEtЋlr t'Ǎt$k9uǃlr ǃ\r dr t'Ǎt$09uǃdr ǃTr ǃtr EE EE1[^_]øUWVS<UEtЋhr t'Ǎt$耜9uǃhr ǃXr `r t'Ǎt$E9uǃ`r ǃPr ǃpr EE EE1[^_]øUWVSJӥpUE DžXE/tBD$E $p,E $Guv E t E tDž`Dždxhً]/]=Ut Ѓ/u.t+M L +Mkt/l+]utftl+EthD$E $p)%=l /=@_Ot/t?+Mu~.׉ڋt9E щ`p\`d 5lD$D$E $p]YDž`&$`pcED=`=A߉փsetftdl /tf\`Ut9E etE Ĩ[^_]Étzu \`l5p S?t9E tX$p51nىf t~uf.륃8/utщ$pQ1UWVSBǠ}E ttrD$<$3'xX[^_]Et$<$}*DžMtAt$$&ymt Q8"tƉ<$R1[^_]P1fffffUWVS葒}<$)Br $jr ǃr 7ty-E1<:uPyAu-<\u.JDK@ttDK@tBuE<:u1<:tEuE1[^_]Ër t$:ǃr ǃr O yEUWVSru} u <:tu1[^_]8ut$8tu<@t΃}:t& u}:t;UuF~@t[^_]Ät<:u[^_]ÍID$ D$D$t$cIY}D$ D$D$t$4IUkU]UWVSQ֝u} tb 8u$ u|:9ƍt&s :t|tu[^_]ÍD$ X D$D$t$eHo}D$ X D$D$t$4H:1UWVSlfƉE 8E10}!H Mu0r t |$$p$貉Dž DžUD$ fD$D$4$?*D$D$ D$D$@4$&D$D$@$QE8DžDž1ҋ9slxȀ %:Dž\1҃ t t DžN9 ΋9rD$D$E$P5xȀ Mp@<#D$$2ߍFkDžD$=D$<$… <:Duz)ED$T$E$EƋt'p<:tu))|:t:Ћ)ȉ)9 )؉D$\$ $MT$t$<$7$Xy?@E<$Dž:΍N9))t$$80r1eN1nCȋ)Љ)Ћ))ӉL$$舉ÉNjÉC:{DžtE$M)P9rg8E+~l[^_]D$ D$D$E$+DžD$<$yxr $ Njhr D$<$D77lNj4E0<$$E0Dž$ID$ l D$D$t$?UD$ l D$D$ t$?D$ l D$D$ t$Z?E$MKE$7KƉ<$߉6$5D$ \$|$4$V tBt(PuADž4$VDžDž$>5H $yDžL$T$$4$V18XD$ d D$D$t$=<$RtE$lIB <$B 4$VB $Ӈu!$趇냋E$HUVSÂEM ut.t^UD$t$$P[^]Í}T$ t T$D$t$J<M EuM EUT$ t T$D$t$<M ElM ET$ t T$D$t$;M E1USÈr t$<ǃr ǃxr ǃr ǃ|r 1[]UWVS0誂/ME 8ƋE1Dž]xr r -r tr uD$r $;D0Dq@:#|r ux|\u ǃ|r ׍:\tWut$r $:lDҀ|\tǃ|r ǃ|r r $l#Ƌr u$(ǃr xr Pxr @&L$$!r dǃxr ǃr ǃ|r f:wu<:tAt<|uD$t$$ƍ@E+0[^_]Ër $2"uhr $ǃr +xr r 0D$xr $ r 5r t$~ǃr ǃxr ǃr ǃ|r UD$ @ D$D$t$7tD$ @ D$D$t$_77ǃr ǃxr ǃr ǃ|r $ǃr !UWVS8~ýu} tPtzr t$cǃr ǃxr ǃr ǃ|r } u[^_]}D$ L D$D$t$f6uUD$ L D$D$t$86WUWVS$i}Eu} (TED$=|$4$ƅl$d]xDž<:9}d]V<\ֈmt>}<:tkOML<^uF<:mu‹M])ىύAdD$$]|ljEEd<:u]WF<:XЀvP2MҋMP FE1]MVD9ut 0v]M :]U})rtT$<$]{EEM$[^_]Ë]뽸 y]䍃D$ 4 D$D$t$3Í}D$ 4 D$D$t$3]䍃ID$ 4 D$D$t$3z1*E$].~<$]~]8 UWVSizEu} uE0D$=|$4$Dž$d]uƅ<:d <:tCZtsu)Cd]D$4$]yUn‰ƹd<:uЉƍX)Ӎst4\$$U]yU@Љ)ӍsűE[^_]Ë]썃ID$ ( D$D$#t$1E]썃D$ ( D$D$$t$1Í}D$ ( D$D$"t$n1Z]썃lD$ ( D$D$`t$<1)D$4$]xt-M14$]{։4$]{]U6 UWVS xÒ}E uD$#D$<$R80tN 1G<w/G9~ƒ9G< w91[^_]ÍG<wG@tftƄ/DžDž)S$O9>:hfL2 81Ƀ4uA )čD$ pxr󥋵t$D$$%8D$D$$5|$t$$5D$D$$5D$ D$D$E$+udurP&1&rBvBDžqfzOU er8D$E D$E$]UWVS4rù}U 8E1EtqMyu )čD$UPtMP}y:u}8T$D$<$36U+ue[^_]ørffffUSqD$$+Ev D$ $uLv []UWVSH1qö~u} }ԋEE8EЉE1D$ $Z>v u}MfMUT$U܉T$ D$ UT$$AFuM vU܋9Eo} uv t%9v t1uЋE+H[^_]Á} u v uD$D$,$\E؅t EċE؉$`KfxHuPPM3J$z 1 uԋM3JʀuNjPD$EĉD$$U裲DžuED$UȃT$Ẻ$;EsE؉$^ % ЉD$D$ 44D$ED$Ẻ$G ;E1B9EBf9EwB U؍yM|$D$Eȉ$EċMQUUȍD 9E89}r5M̉ωփs1tft1HE؉$]3")UuuB r Ef&US;n{D$r \$ ED$EU $T$u؃[]1[]ffffffUVSeLuEqVt M>$ I}|$T$UD$ D$D$@$ыU'$ tLtF@Ht?|$T$UT$UT$ U T$ML$4$ЉƅuGE([^_]Í}몉U썃D$ D$D$$@HU0E([^_]Ë$ 1ҍ}QUE썋L$ L$D$J $EIUT$ T$D$}p$E]D$ D$D$[p$UU<iJ-D$ED$ED$ ED$E D$E$]UVS<"JE$ t:t4@8t-UT$ U T$UT$V$Љƅu;E[^]ÍD$ lD$D$$@8F0E[^]U ;I-D$E D$E$2]UWVS;OID$D$-<$Et8ED$ED$<$@|$ D$D$$E $CD$UxD$$E$US ;åHD$ ED$E D$E$z[]ffUWVS8:fHÉEċ}u t$E$5Eȅuu}EEEE̍Eԉ t1 E U]M!ىˋuM! u t뷋]u!M܉!щME܋UM t1҉EԉU؉ƋM̅t_Mx+Mw&ELEԍHwq{E@N4$]>tEԃ0<Eȅu tEtJM\Eԉ0҉Q0A0q AEЃEЃ8[^_]E@uU\UƀtUMƍBEЉ4$]B=tU@^GE@uQ4$]C=uT tOFvGE Fv5 *-UЉrBEBE-DptGEЉ7EЃ8[^_]ËEԍPE-PUȅE\@sEU\B0E0<UE\@aEE\@nEpE\@vEUE\@fE:E\@rEE\@bEE\@tEE@0@ 0E^?iE\pEUWVS6}D}U EEuEE tu$U;UtT t! tT$U$1Ut==,GG W[^_]ÍB߃]wʃ=uËEEuEEU }[^_]SUWVS46ùC}u EEEEEE4$9uI.h v.%pGG  O[^_]ÍN߸?tċEEEEEEu }[^_]_uUWVS5 CƉʋEE8E1x}} EuD$$4^ D$<$3e xDžE %@  1)ttu䋅D$ v D$T$<$8x9 tvu1ɸ)u)lj9usu$D$$y2p 1󫋅Et# 9uE t *H uE t 'H uE t E t E t E t "E @u \E HE 2 !L$ L$ U T$KL$$ׅu͋$25$$5$5$5E+DĔ[^_]Dž:VD$ D$D$*$D$<$$0UDžpD$ D$D$*$FLEj1UFD$ D$D$*$uXD$ D$D$*$$X6X 1󫋝8Džp-t0)؋t9D$t$$49.9Ëϋtft6tt$1$1$19&!Ɖx!։|x| t1ҋ9iD$ D$D$*$J$l2…t01DžDž1 t1 !! u e눋 09Ћ!ȋ!ȉ t1ҋ19D$ D$D$$,1<$#2t 01s^8D$ D$D$*$FD$ D$D$*$L" fEqX#111҉mldUVS*Ɖ7EE8EE EEEMED$ UT$UT$$1!xEU+u [^]1rlUWVS)7EE8EEEEEMU ED$ }|$}|$$xEU+u [^_]1kUVS )Ò6u t44$D$ UT$UT$$1ҍE=[^]1UVS(@6ut54$WU D$ ML$ML$$E[^]1UD$ ED$ED$E$M 1ҍE]UU D$ ED$ED$E$ME|]UU E D$ ED$ED$E$MEI]UVS'S5EE8EE EEEMED$ =T$UT$$1xEU+u [^]1;jUWVSR'4EE8EEEEEMU ED$ =|$}|$$kxEU+u [^_]1iUVS&Z4u t74$qD$ =T$UT$$1ҍE[^]1UVS&4ut84$U D$ =L$ML$$E[^]1UWVS)&î3}u t74$D$ =T$UT$$1҉N[^_]1U%R3D$ =D$ED$E$M 1ҍE]U%3U D$ =D$ED$E$ME]UH%2U ML$ =D$ED$E$ME]US %Ð2EEEEED$E$E []UWVS$$J2DžE = tIƍD$D$ t$|$$%tyDž 9AD$E$>uƋI} t9rcJ8 uv9t<$-'$Dž9t4$&Ё$[^_]ÉUE D$E$K]ffffffUWVS#Æ0ƉЅtK Љ Љ Љ Љ Ѝx|$F$"tBF~1[^_]ÉUT$ T$D$y$3E냸UWVSa"/ƅ9N rn~PRuF$D$ D$L$M<$Ģ^M΃ډE:BGuETB[^_]ÉUy(MED$|$F$DMҋMUu~ LЃ[^_]ÉMUD$ D$D$$MUMD$ D$D$$M9N r~y(M+ED$|$F$CUMu~ 1UWVS 4.ƉυZF(JJrPf~Jtt$ $ uKLQthF%=@=\=DĔ[^_]Ptt38t$tB$Pt9z |1tft Ĕ[^_]fx t~B8z<~ ^z0Z4FB@zT.IBpDp@PDH41ًP01 uH<1t3P8 uҋpx9t<|1tftFĔ[^_] nĔ[^_]ÉtD$ D$D$$ttD$ D$D$$tkzUtBT%=.8t f{f{UWVS+E։ʅE@(tvBXU$`U@PxTZrtftP,}WP@ @J@ @@[^_]ÍU$txTULYHP놉M썃D$ D$D$$YU"U썃D$ D$D$$!U1]UWVSI)ljօxlxD$$ tE3G4U3W0 u|3G}4F)uGHf fű~t$Z u} EHDu@8/tF(t`F[^_]ÉUD$D$@&$NǃUtq#F<$b<$ufF몋E@[^_]ÁN(iD$ D$D$1$F11UWVSOutpp7u4E4$u(4$ E$F[^_]ËF$$뿋F$$F$$F$$ 뵍D$ @D$D$B$ۿaUS Ô-D$ D$D$E D$E$l$]]US PED$ D$D$E D$E$l$]]UWVS8Ɖ׉t,M=U= =dT$E؉D$E܉D$ L$|$4$KS=ƒLu܍M؁ ʨtUEԃ8[^_]1EEkEhEEMdҺ뱺몋U른"كx8[^_]1U]-U E]UMU E]ffff̀rS[ä[̀rS[Ä[ ̀rS[d[USHEM u 酔t9u[]1[]UWVS u} ttB|$4$趴[^_]Í:D$ D$D$B$uED$ D$D$C$轼UWVSzu} ttB|$4$&[^_]Í:D$ D$D$B$[uED$ D$D$C$-UWVS@rt$0D$T$L$4D$4t "|$GD$8UT$$\$0xuL$8ǀ-;+=D$D$4C0ND$D$$D$ D$( D$,D$4 11҉D$8T$<~09L$4xfD$$|$89T$ |$<O|$<1\$81؉ -D$(T$,Ë|$<ߋD$8d$(ډډD$8T$<NyЉ< uA< W9L$4jߋD$8T$e[^_]D$rD$4D$4FL$8D$(T$,D$T$ $D$\$0ȹD$$T$ D$(T$,D$T$ $D$zD$L$8D$9\$0="D$8D$E $]OD$@E$\E EUP ]萵]썃lD$ D$D$ $uu1]=uUWVSs}G $fwt6$SuG[^_]UWVS+u} t"tL D$ $ͦ[^_]ÍȎD$ D$D$:,$uӎD$ D$D$;,$ԮUVS8 Òut&== =ED$E܉D$E؉D$ T$E D$E$B=t3w Ef>@fFE܋UVtfNȃ8[^]FfF1E@EÿE?EEURҸFfFFfFs1]fffffff̀rS[D[UE]UWVS$E։ME}E؉Eut[E9UsH߉։]EƋE D$\$4$U~" HS9uE)9ur‹]ڃmu$[^_]Íc;D$ D$D$rP$苬EQ0D$ D$D$sP$V"UWVSXEu U E } XE EE̋EƉE$]8Eȅ EE MȍANjEȉEԃ)֋]ދuމu؋ED$E$M#EȍDMԉED$EED$E$U1ɅM9uREEEȉEEEE؉E܉}ЋEM4u}؉9_u E9s#ED$ED$4$U9Etщuă9UM]+uED$T$U4$U}9NjUt +EMC1ˉUE‹E9rU]}M9MrED$ED$+E$UEEE‹E+EMȉEuM9M}ЋE9 EEE]ԋ}čGU9Eщ}U܉EA‹M)ʋ}č M9xȋU)Ћ}lj}ԋE9E9EM]ED$}|$]$U}]UEE؅:U!ED$\$<$UU9~ ]E9rՋE9M̅pU܋E 9r}G9D)EE܋M܋E}89uM܉E}9}M9M M]E̅uU܋E}Ћ029r}GU9CЃ)E܋}EԉE9DEԉEGED$E$MEEԉEȉEċEEȋE9EEĉ$]1X[^_]Éˋ}M 9sWEƉ}Q+ME }uڋEE‰]MĉEE HZ9Eu]M9r}M8E}ljMĉ]XJM9uˉM]9sMˋUMUuދM9U]3]M9ËED$\$<$UM9Ӊދ]19ME9Ms?}u}9us'<3ED$|$E$UU9~؉9urً}uE9Zu̅U܋E 9rUB9)ӍCEE܋M܋EU‹9uM܉E}9}[M]U9UU̅U܋E}ԋ029rUB}9G)XUE:}܋u9rUB9)]E؉ËuEߤ9uu]]Uމ+]9UED$\$<$UU9ЋUlM9se}؉ߋ]M ֍E9}s8)1ÍED$T$UE؉$UM9ȋU‰9}rȉ}EE%}܋u9r}G9r))]E؉ËuEߤ9uu]]Ҹ}܋uEԤ9r}GU9s/}܋uEФ9r}GU9rщ)EMċU9EȋMĉMȉEU9UrEЉE}ЋEMԉE؋MuuEU)ЉEĉڋE]XJ9u]uE}9EŃ}tuED$}ȉ|$Eĉ$]I}!]0D$ D$D$&P$躢]ގD$ D$D$'P$舢ÍHE@$$X0tlEM 1 [^_]D$E$ƅt[P } uuuFĢu蹢}8눋E@$$Ǯ蟢uJ蔢}8E Y}If뱤&fvftJ [^_]E xDE xfffffff̀rS[$[ḃ̀rS[[UWVS$autoEEE Em8D$D$ED$ t$D$E$Sƃt 1$[^_]%8 u8ፃD$ 0D$D$<$sbfffUWVS0&ƉE̋]E 8U1xu2  t8u)؋U+0[^_]Í}1 r}̍@]ȉT=Ѓu]t; t\="t]y$]uk1d]̍$fffffUWVS}U utrt<Ѕt .t&HOtuxu)Ѓ[^_]ÉU 4D$ HD$D$=$əU 뒍4D$ HD$D$<$蚙U \fffffUWVSFM} UthtN49t8u)Ή)t3ttu)[^_]1<$Ɖ[^_]ÉUM4D$ TD$D$A$ƘUM]4D$ TD$D$@$葘UM$USGEy <_(9~)ML$-D$E $1[]ÉD$ D$ED$E $֜1[]UVSMEy <_(;}.D$@-D$v 4$r[^]ÉD$ D$D$@v 4$X[^]UWVSRu} taEtH-EEt/E9t(TSOLKf9t)ȃ[^_]1[^_]Í:D$ `D$D$?4$uED$ `D$D$@4$踖FffffffK̀rS[d[UVSJTu imNA90%[^]Ë9r [^]9r싋 UWVSI} P^Uu}E_ N)BЍ4))Ѝ<)Ǎ)ʉȍA )) E9uu}E]싓L419|[^_]Ë]싃Lu޾ UVS0õ4$qTu U4$T[^]ËE4$=[^]UWVSX} EqE$T @}j}wMǃTǃPǃLG EG1E$荥E[^_]Ã}?vB}<6 )ȉЉA[TPLW ЉU艃EPU)ЉB}҃?}Ƀ}Ɓ}tD$ |D$D$Yt$Ӓ`E$`EUWVS v EEẺEыE)ȉE䍃E$TɋU @TPLEH t)̋Eʉ1E$lE [^_]Ë )ȉGfD$ pD$D$t$xUWVS2<$Ɖ<$ߢ[^_]US tED$E D$E$t []USCE$[]ffffffUWVSÖ}tHD$<$ƅt&tt$<$[^_]1[^_]ÍD$ D$D$A$JUWVSuD$4$9Dž|$4$ t>UT$D$E $;Es17[^_]:"(썃D$ D$D$V$|NUE U9r 9]ø]UU E9r 9]ø]UWVS` w  w u w 8E1ɍPt-ωD$4$&t  w PEu׉MD$D$4$ MtMljMuD$|$E$  w 8Ftt$E$ 4$uMEw 9t$$ǃw ǃw [^_]Éw TD$D$$g[^_]UWVSßu} t%:D$4$Itt=t1[^_]À=t[^_]UWVSEut4t$P<$ƅtD$<$ 4$[^_]ÍD$ D$D$$ UWVSE}G$4ƅtx @D$P$f[^_]UVS}ut/t$P$tU 9P [^]1[^]ÍD$ D$D$$JUWVS U8E8s7i1}ƉUE D$ED$<$+u E <=,E19MƃU;\tkCEZE [^_]UE [^_]L돋 u{Etu>E닉Lt9ur 눋}bM υtIMyED1uLC yvyEE)fffffffUWVSÖƍt$<$ru[^_]D$ FD$t$<$|[^_]ÍJD$ `D$D$X<$Ok떍+D$ `D$D$W<$#kcUWVSXݿ}u tt$<$u 1[^_]ÍF D$<$薡tF t6u$FD$<$軚tăt$<$訚뵸[^_]ËFE }F[^_]~D$ <D$D$x<$OjR+D$ <D$D$w<$ jUWVSUھu} t tJD$|$4$菡[^_]Í+D$ PD$D$g<$iuD$ PD$D$h<$iUWVS轰B}u tet$<$\u 1[^_]ÍFD$<$t~uD$D$ F D$t$<$W뵍+D$ D$D$<$hqD$ D$D$<$hBUWVSٯ^}u FFt 1[^_]Ét$<$VtFD$<$tӍFD$<$0tF D$<$tt$<$ 랍+D$ D$D$<$gVED$ D$D$<$g'UWVS֮[}u  GtNu$G tWt)FF[^_]F[^_]GF[^_]ËGuS[^_]GFGF[^_]ËGtщEL$ L$D$$fE GFG F[^_]ÍFD$ D$D$$<$mfL$ M썃D$D$%<$U5fGUM6G EL$ L$D$ $eE   FFufffìrS[d[v̀rS[D[VWST$L$1t8uЄt`B͉ .t&ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUWVSÖu} Mt}t]MF9tDJuMtL} XU tz9ut@[^_]É11fu1[^_]1MD$ tD$D$;`$dMN`D$ tD$D$:`$cMfUWVS(ÃƉЉ8U1҅D$ |$D$$$|z<$DZ@9EED$|$$Fu1U+6([^_]E @NteulN u`L$$ $|YHN tD$ ̏D$D$ $E4t9u΃tft%D0 T$ T$D$$a0T$ T$D$$daFD$ ̏D$D$ $nDu-uFfUWVSyƉЉU 8M1Ʌt=~t3 E+ȁĈ[^_]ù۹Dž9FftvEtoEfD$ ̏D$D$<$C<$V9E]ED$|$$-Vu5F~uN uF=tu ~tMEEhED$ t$|$$w4$U9E}ED$t$$M1@FȉC:9DžM9FF ftV ffuu҉T$D$ D$ȉM)D$4$=Mx 9=EtEȃiviD$t$E$ڿ1T D8D$ ̏D$L$M܋E$G=M܅x9E4FD$ Ϗ뻋EYQEE@DEԋ}1=E؍׏E܍txEЋE؉M؉u E8EЉT$D$ E܉D$t$ $M<MH9@)ƃu1q҉Ű}UT1=E؍׏E܍txEЋE؉M؉u ET8EЉT$D$ E܉D$t$ $M;9M)ƃ9}u1MFD$ ̏D$D$}<$;<$EOM9L$|$E܉$ԽMUU܉D$ D$ȉM)D$$I;M}9nD$T$ |D$L$M܋E$ ;MUWVS@klj΋E8EG uY$Mato|$$Mbt9wuҋtD$G $Nu1ffh$M@=v1U+|@[^_]ÉЍJƅffЍtftD$D$ |$D$@$sO9Aff9't0G9T$D$G$5t$ |$D$$wbu8u Dž11fBfUVS ~ut$F $_E $MUYF t [^]ÉE4$^E [^]fffffff̀rS[Ô[UWVSv}E$exkUtD֐6t;F txu@9uD$FD$E $Uu 11$kY8[^_]1[^_]UWVST٨ut7D$4$5FftID$4$5[^_]Í.D$ <D$D$@$S띿fffffffUE.߃At..t!.t+vPЃ v-u2-.u…uҸ]ÀvPЃ v_u_1]UWVS UE Hzu;9]苰uυ0qD9sDw]Y}D9~D$υt'v@9w@|uxb9wxT9}P [^_]Ät^};tm9tЋ'밋II[:K [^_]Ë9u9tЋ}ND9OD<]][D9^DυYDM9YDM}B4^D9_D(뮅f"f 9DupR?UWVS$E@dtfɍ<ʉ}ЍMԉu7APWЅt#xuPR#l;htՉNj@u݋F9]uAEF$[^_]ÍMUSOԤPt@uQPtuHuX uHuxu t1[]PtCu[]U/[]@ tOETD$ ED$4$'TuEt8u x[^]ø[^]ÍD$ D$D$$NqUWVS({ƅt Ftt 1([^_]ËFy ([^_]Ãu ӉM܉ЉUUMxy=fuVfǃؔ ؔ f|M܉UߏD$ D$D$$MM܋U0u?FtTtG1M}|$ }|$D$$VB0@MQVd:볍3UWVS蟔$Ɖׅt4tdvu 1[^_]É $GuMޏT$ T$D$$LMuMߏT$ T$D$$LMlMT$ T$D$$|LM7UWVST諓0։8E1tDžDžF F`FD$$D$ D$D$D$F D$FD$ D$D$<$u G @u}D$D$ L$D$<$gO @,1ƒ $QD$D$ D$L$<$赕~QG KD$D$D$D$D$ T$L$<$肖KE+ȁT[^_]ËQu7Iffft#fFPЃ6t?rD$ D$D$ $I]tt1t dQD7UWVS(sƉЉ}8U1҅t\D$t$ D$D$4$ ,=?U+([^_]É4$?PwstP|.ut$T$ hD$D$4$+댉T$ T$D$ $"HO UWVS4;Ǽ}8EЉNjE1A<<EԋAE؋AE܋A EAEAEAEEE}YQ,A<9u1҉M 9t5Kt-!8tyՃw9uˋMȋE9~UĉM̋ uEuЋE+u^Ẽ4[^_]Í}1f1҉9r׾tffEfEAE띋M1|]UWVSčIlj։MEND$A M$赌…tKX MH GBG B GBGBZJBB!F^ ߋus%uu Ѓ[^_]äЃ[^_]ftugсD$ D$D$$E0D$ D$D$$bEf mUWVS&p@<ϋE E(8ƋE1  ( @/ 11 r} !8} t } 0<Hf@fPffL< 8Px HD$ |$ T$L$$‡…L?@@ u+DL<$0ЅLDHDL} t!} t} tDDž6H<$~:=HD ɅLP9yHDžLDžu4 =81HP9H4D)ȉ,D$L$ t$PD$<$HDž@@ uD$0Ѕ[<$.f&G$ƍG$W 8f &} } l} 9U qf&!M8$覈f8G $蔈f,G$肈f&wD$|$ t$PD$<$+…c@@ ։<$O8=>$芃…(88,,D$|$B$触8 ,&Lt!9 ft LL1.Bvq'tlLH$i}NjE $\}$~|$t$D$ D$ D$D$$%h81H L)Pd8pT4ؔ DH8@@11HrLXDž\Dž`HTtDžxDž|$@(4)L$跉P#LP3谅1.} 1-D$|$ 8D$PD$<$ƅ@@ u<$0Ѕ8Ɖ<$5P9,| rGL"fǃؔ DfGljfWtuˋW҉N{E+&[^_]ÍW0DD$$Z(FF FFFFl 9u8΍ Gt‹@u iDD$$!LH󥋅DD$D$ LD$D$$%V81Lx $蝆跂15M(18<pfaf14DD$$W 8FNN uuD4$1DD8D$ D$D$$b:D$ D$D$$3: ND$ D$D$$9($ޏD$ D$D$$9D4$0DD8,D$|$D<$"8ЉD1_ <$}w1#Lu .8t189 u拽,t t҉11UWVSpÌƉ8NjE1>$zB$z11 rFFtGGFUFq=~1ɀ.уu9`d9@ HDPDDžDžDžDž<$<8=}3G u$1ҋ~`{}$V$H1xƋND$F D$F$Ƌ@ut2OD$G D$G$tF$褀$薀U+p[^_]Ë넅tJPd9\.$1ҋD$ D$D$$uu~d,@}뎃1@<tE12Dž$1ҋ. P{u@ {81.늍D$ D$D$ $3$1ҋgz@u6mwzHDPDE$ ~&z1jDUWVSXz݇EhpPt%={8DžthE11҉ rMd11҉`d r`VtA<$8iy^yt[^_]ËhMEEdUMEE$1u`11 rU؅tkhd<$7hE[^_]ËhMEE뀋hMEEd<$7ЉddiX07\P}`1}dX  rOTdDpPHXLƋX9H`D$ PD$D$L$@%hL$P T$ D$HD$l$6xWE11҉ rlUEE!$\X;l$z9T#X\dwc\$5U`U؉h<$5h(‹d뎋DA‹@uDn> t1҃me9Gh9wGw9uhtQl$|dl 9u`q@D$%l$h[l$w…hl)D$L$4$|XdX`phHP HLT v~u~hxv G<FEu11 rE@t`EEEE<$ ML$ML$D$ |$D$E$NtwEЅUp[^_]É<$X MML$UUT$D$ |$D$E$t?E$^_p[^_]ËUEtFE$^gMEԋAE܋A EAEAEAEAEEUԋEg{EЉƋ@ujZUWVS\ Z;h8NjE1 D$ D$ D$ $nƅ8#3D$4$D$4$xDž< < D$4$Wxt$$}t띋AAA AAAADžD$ D$D$4$~#|$$u@D$M$1ҋE+Ё\ [^_]Ët։։vt.t_tދ$닉ޏD$ |D$D$ $u3D$ |D$D$ $:MUWVS4`WdEȋE0xU11  rŰ]ȍD$M$qEЋ]̍EЉẺEEtCË@uE)uEЅt $]+EU4[^_]UVSV7duD$F $UtP PH p[^]UWVS@fVcljE8EG ut$t$$tӋD$$-tD$F $ ue$R@=wI$*‰@=wЋЉ==1U+@[^_]Ë~D$<$Xtu狵1DžЍtftȍtftD$D$ GD$D$@$)9OtD9AD$D$G$t<0L9_YB 9@3t9'9uۉD$D$ $kut$ D$D$$+u9u [u3fvfvBjUWVSR`}utHt$F $E $UF t[^_]ÉE4$~E[^_]ÍD$ D$D$l$ fffffffUVSÉ1   lLLLL9r[^]UWVSTNjEGEGEG EM]Br 2 r 9u֋]Exj׋]؋M1ȋu!1U V1!1 ‹Mp $1!1ы]3ν1!1 ˋuč|1!1؋uȍ*ƇG1!1 ‹u̍F01!1ыuЍF1!1 ˋuԍؘi1!1؋u؍D1!1 ‹u܍[1!1ыu\1!1 ˋu䍴"k1!1؋u荴q1!1 ‹u썴Cy1!1ыu!I1!1 ˋub%1!1؋u̍@@1!1 ‹uQZ^&1!1ыuǶ1!1 ˋuȍ]/։1!1؋u܍SD1!1 ‹u؉1!1ыuč1!1 ˋu؍!1!1؋u썴7É1!1 ‹u 1!1ыuԍZE1!1 ΋]荜㩉1!1]1!1 ‹]Ѝ og1!1Ӊ]ӉыU1ыU䍔2L*!1 U֋UȍB91UԍqU11 ‹M]"am11ы]썴3 811 ˋuD꾤11؋učK11 ƋUЍ `K11U܍p11 ʋ]荄~(11ӋE0'11 ދE0ԉ11M̍11 U؍9ى11ˋU䍴211 ڋu|11֋EeVĉ11 ED") 1ȋ]Ѝ*C 1 ËU썔2# 1ދUȍ 9 1 M䍄Y[e 1ыE 1 ˋE܍0} 1؋u] 1 ƋUԍ O~o 1U, 1 ʋ]̍C 1ӋE荄0N 1 ދEč~S 1M5: 1 ‹M* 1ы]؍3ӆ 1u uÉ_] GMG T[^_]UVSJ|Xut0FF#EgFFܺF vT2[^]ÍD$ D$D$$HUWVSJXEWU P?ωM] 1ÉPHUʉP@)O9]rlڍ<u u|utPE=E);UEމE} ]7E@9rE)uu U<u sPtft[^_]äft.t&N] u]tugT$ T$D$$EU |E_T$ T$D$$kEGf2u S'fUWVS$LHUEE} 8E1WEEG?78)‰T$ D$<$ND$ED$<$7EX1tftE+$[^_]úx)rD$ D$D$$D$ D$D$$WZfP轉UWVS$FYT}Ћ]E E8EƋE13-8}DGt`EE؉<01E 1҉M܉MLAt;}t^}׍T3y1]E+$[^_]Ã}u-t( fɃa) 3믍NȀw볋M܉<.u9twQ3ЋEDP{<0#s߀XtXEE1҉3)AtstEt)Eԅʉ s1EE EM M 뗁EM tEF]Ds@9o]xU ED$E$u ]ËE]f ̀rS[Q[UWVS0EDQuE 8M̋U1xu1 t8t)űU+u0[^_]ÍMЉM11ɉEċEȉ rEčLۃTЃut( tۃ\"u|1w@UWVSTCP}E 4UE08E1;q,hEED$E$ D$h8$ hǀPǀTǀXDžDB$=8H"Dž@DžL0D$ ,T$4D$8$ƒ8B4D$H$AB4E+Ё[^_]É,D$ TD$D$<$n,,D$ TD$D$=$0,THt$D BU,ANUT$ U T$-D$E$]UED$ ED$E D$E$y]U@TNUT$ U T$-D$E$B]UWVS$@Nu4$5uE荓UEEEEED$-xX<$E؉D$<$D$<$ $[^_]UWVS?ÂMEX8TE1D$D$$ބƍ`$1D$XD$$P]PT$D$i4$4$t'pTU+İ[^_]\$V\t~։P6tN~ tu틅XD$F$2uԋPGX$XcP$1A$]UVSu>KuF tF 1[^]ËF0$AF0F($AF(F,F$AFFN D$j$FtF 뇍D$$t F ^YUVS=.KuF uu,F [^]ËF$WFF F tԋ$F F [^]UVS9=þJuF uetaF0$@F0F u9D$D$ D$D$$gF0[^]Ë$f 뷸US] $)1U C []UVS<Ju4$F$?FFF0$?F0F($?F(F,[^]UWVS!<æIE@0}  ML$$IJop< t< t򍃏D$4$蔲?x4$fM Ay EpE pED$<$KtbP1tJ< t`< t\E@H9tTE xFE7ED$$tgPuuE @4E [^_]Ã됉U }OD$G$;DžUtBExE xzt7@ D$$ 9ƋEp0E$01jUWVS$c:GEuUE@ u*x(9P,ӃCtftEp(ff} GуbF9SNO F|>L)/9!A)‰UtEHE HU1EE.E HFD)ЍtEx9EEPB9uҋEPU@E]OED$UT$E܉$ \M(uTMEHE Hb@ ]D$D$ E$[]0E$E@$D$D$$茹9ԋD$ D$D$<$1-D>DBu.L$$u9ċ;$. D$=D$$ǸZUWVSM%EĉED$ED$E $b&D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,yaD$0 Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,aẺEEfEEEfEEEfEEEfEEE`t2 u&FUopQU x;uED$|$ -D$\D$E$E`t jED$$;E`FED$ D$D$n$(D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,_(D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,"_D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,^D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,R^rD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,]D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,]ND$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,]D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,\*E`Yl‹w puED$ t$D$E$l‹w p8uED$ t$t$E$訲kWZ PH8uED$ T$t$E$ekWu Wz?uED$ T$t$E$'E`t tED$$ ED$$1ɋuEED$$ EED$$@EbED$$EEEf Ef Ef EĈ[^_]Í T$D$ D$D$<$.o D$D$ D$D$$UnU D$D$ D$D$4$n D$D$ D$D$$UnUP D$D$ D$D$4$NnK$D$YD$E$4Ĉ[^_]ËED$ D$D$$虘ED$ D$D$$oED$ D$D$$EED$ D$D$$ED$ D$D$$dED$ D$D$$ǗED$ D$D${$蝗@ED$ D$D$w$sED$$ IUWVS$ QuE }8U1D$L$ t$U‰T$$ xVD$t# $U+u#$[^_]$."1OUED$ D$E D$E$]UWVS f}ED$|$ ED$ED$E $ x8Ɖ<$WuH;M}"f.E[^_]À|.tH;M|1[^_]UWVS$] E8E1D$|$ D$E D$E$&…tD$<$E+u Ё$[^_]NUWVS O}u Gu 4 Gt*D$4$趞uUt E[^_]ËEtE[^_]UWVSY uZe~M u ( ~t9uUt E[^_]Í L$D$ D$D$<$iEtËE[^_]UWVS Hu} dVu + Vt!9>uMt Ev[^_]Í|$D$ D$D$4$#iEtËE[^_]UVS+ ðu,dX Bt ;2u[^]Ét$D$ D$D$ $hv [^]Ét$D$ D$D$X 4$\h[^]UWVSt U} tdUfc~U ~t;u[^_]Í T$D$ D$D$<$g[^_]ÍUVSqub) Bt ;2u[^]Ét$D$ D$D$ $^gv [^]Ét$D$ D$D$D 4$g[^]UWVS5úu6bw$ wWvK Bd v|@vF>[^_]Ávf[^_]Á 3[^_]Á v,%낃@t9u~jtucO D9*.# ̫11t$ID$ D$(D$<$ceϒߒɒUWVS=}>`YD$t$<$`x [^_]É|$̏D$ D$(D$4$d[^_]UWVSN}_Q rt;:u[^_]Í |$D$ D$D$4$:d[^_]UWVSLQ8E1E <tmD$QD$ D$.D$M‰ $McMt#PT$UL$<$U0E+u4L[^_]D$ .M‰L$ME D$$MoGUWVS4 EEEE$E܍U}}؉EUEEU t 14[^_]Ã?uuU<-E<+u JMB-DK~r1ɍ LH>vD{uU 4u<.}DCuuŰMэMܨ@uM1ҋMDK@u49rMԄMDC@&E DS@tc9rEu ]Ԉ^^FEȉFEȉFEȉF EuuEE9sEiEԋ}DC@u>1ɋUDS@u%9rUȄQUDC@NE9>DS@uE9&ENjUDC@ub1ɉUЋUDS@uF9rUċUЄEĉEDC@Eu9sEDS@t|9rz}BDCz}4BDCu;uJMBEcEE]z}DEBDC1.t&FUWVS~EM HMHMHMXˁHɁ@ =+-E=E-ENMb֍)É]؉л))Ɖuԉމػ))ƉuЉ]̅EEMbӍ)Mȹ))Ɖ))MUĺQEM)U)MEJ$CEE4$CEE $CEUM^]EaE}d\$DD$@ED$<]\$8T$4]\$0]\$,]ȉ\$(t$$L$ uĉt$ut$u؉t$uԉt$uЉt$ ủt$D$u 4$\E$0Et $Et $E Ĉ[^_]ú)‰UliEESEW) u RE ; er@ror:@ unk@ nown@ LOC@ RR @vers@ionE Ĉ[^_]ÍsEs}\$DD$@sD$*tQ<.tAx[^_]ÉȅyEXT$ T$D$$nE[^_]Åt<.1[^_]UWVS0 VE荰EEEE$PlPHH8|$ x|$x|$@ D$L$T$ oD$D$4$ ~ Eƀ0[^_]UWVS` u ) Gt-D$4$Ŏu?E tE [^_]Ë?D$D$4$ukV-DPtM肹D$ ED$4$J[ҋMyE8m1Ɂ]1VUWVSpuX Gt-D$4$Սu?E tE [^_]Ë?D$D$4$ukV-DPtM蒸D$ ED$4$ZkҋMyE8m1Ɂ]1VUWVSÀu D$4$蝔FFy ;F|/} t)P}D$4$葔[^_]Ét$E$襝US EM QQy ;Q|< tZ[]ÉL$$W[]UWVS2÷Eu E$̨EEEEED$4$賓F0u ǀED$4$"D$4$褓[^_]UWVS-mRP`8uWV@tWufFuFuFf~@tJD$4$plj4$$R[^_]ÉV@ut"Fu먉F룉4$xfF@먋FuxUVSk`8Fu t$-XD$ D$ED$4$[^]UVS`8Fu tE D$ D$ED$4$[^]UVSD`8Fu wtED$ E D$ED$4$2[^]UVS,|`8Fu *tNE(D$$E$D$ E D$ED$ED$ED$ED$ E D$ED$4$,[^]ÉED$4$;EUVSh`8Fu t2ED$ED$ED$ E D$ED$4$[^]ÉED$4$EU`8U]Ua`8U]US?ED$`8$[]UVS`8Fu t$ED$ED$ E D$ED$4$[^]US9þ`8$-[]UVS×`8Fu Et2ED$ED$ED$ E D$ED$4$[^]ÉED$4$rEUVS $`8Fu t9ED$ED$ED$ED$ E D$ED$4$ [^]ÉED$4$EUS&ëED$ED$ E D$ED$`8$[]UVSh`8Fu t4$,[^]ZD$$dUSD$ l D$ED$`8$[]fffffffUWVS AE8tj׉ƅt|$4$2Qt@u(<.tqAtN<\u~u~t(뺉U)Ѓ [^_]ËU9Ѓ [^_]1ȋU)UWVS3}};ƉӉȋ9uwufu9rى)ڋE1[^_]ÉED$EəT$ D$D$$-EE룤u9sftuu_SfӋ]KUWVS0&E׉΋UU܋U؋U$EM9L9MyؙE荃EEuuE9D$E$yt4$ME+x4$MyuE$EخE؉Eu܉00[^_]ËuE$Exu)y9uωET$ @!T$D$$E1UWVS$Þ]Uϋu M MUL$T$ L$U‰T$$EEdËUv‹9EuC9@@EJ}B$[^_]Ë]t*]t .]{<|.B]9Z.EM9s;D$U썂əD$ D$D$$-Eډ)؋ux$[^_]ÿ뛉댋]썃ܙD$ 8!D$D$$'뷋]藬EE}8UWVS(=]Ӌ}u UUS9)ÃEM-U썉əM u2D$ED$ D$D$E$EJBs1([^_]É4$Ex%([^_]Ë]臫EEUWVS+-òEuE(M,} M0t8xU1҉}$tt$$JNNƀ?E4$l6DžU4T$|$E$Fƅ9s9D$əD$ D$D$$-7)U4E$NjE$|$D$2D$ D$dD$$VJNj $‹>|$ $}Mtq}whML򋽤;qt#t<.)z<7|0.M$U$=D$T$L$ٚD$ D$dD$<$/I‹$9"h|-f @)ȉ~ DžƋȉD$D$<$<9u׋)$$|o|$ $1ɺ0yf; F01x JDNu.9uҋ‹)‹<$9VƋt)xE+1Ġ+[^_]Á}e}$# M$U$[&D$D$$U `9wF09\Gt1Gt`$D$D$ D$dD$$/‹ $LuP~F$B=  $u|$t$$U <$Q4$~$XD$0D$ D$dD$$.‹ $<$|~$D$T$ D$dD$$.‹ $s<$fF $F $D$|$D$uD$ D$dD$<$-<$G$|RT$D$t$D$ D$(D$4$"-‹$}U$r VUUU)ʉЃ=p $-^E$XD$=D$D$ٚD$ D$dD$<$^,$}$fR<$0G$"D$t$xD$ D$2D$@4$+‹$']4$9lj4$$lj$k$T}lj<$L|$D$$U xt9HD$ H!D$D$E$<x}$9Gt1Gt`$D$D$ D$dD$$'‹ $4juP5G GGG GG GGƅ=G GGG GfDž==ƅ=W GGW GW GGW G$,Dž====fDž==e)RD$ @t$E$D$$ y 1E)0~0 $309 4$Ku‹$yD$D$ D$dD$4$$‹$p?2‹9@Dž@DžDDžHDžL@)‰t(19rE4D$ T$t$$˕$s9s3D$əD$ D$D$$-)U49V<$ |$t$b|$D$ D$dD$<$"‹$s7D9D$|$ D$dD$$! $yD$ @t$L$<$8  P1E)0~0 $K09f4$q‹$yI) 4$lj$|$(WD$ D$dD$<$ Nj$‹\T$ $1ɺi$ ? B4$Nj$u4t$D$<$Dž9s3D$əD$ D$D$$-)u4t$$1ɺ`4$ I ?$裿Nj 4$u4t$D$<$Dž9s3D$əD$ D$D$$-)u4t$$1ɺ]4$T<$蠾Nj4$u4t$D$<$Dž9s3D$əD$ D$D$$-)u4t$$1ɺZ4$ ]5$虽<$u4t$|$$9s3D$əD$ D$D$$-lj)Ɖu44$gUt$$1ɺm24$ j $g_<D$D$$U i}$M$fҋ]PV,Pf҉N,ukǃ ǃǃF(F(V 9~F$F(DF,1 [^_]É~$F(DF,1P 9UHɋ] HN,@fV,9ErgMF,F(F(T~ 9~GF$hF(F,cmN]m]m(ffUWVS]Eu)M} OV~^m M0ȈE<ƒ?ك}Ou荶!ULWm ]0وM<O ]O?9E]U\]\U]TT} uU u ;E}[^_]} Oσ|$ˉM_MrUWVS)î}u 'MYf0x}~E~p1M ɃT 7  ҃{T 7SƒuM9}{C.봋]9|Mȃ[^_]ÍH rȃ[^_]ÉET$ 0"T$D$g|$^ME#' UWVu o^_]ø1qL ÐUWVS\ѥVϋMM8uM1t$D$ED$ D$2D$M $MQƃM9r,ML$$$<7M)11}U+u\[^_]øUWVS *EE E컉e)})ljӉ))эR)É]%I$)‰))ˁ}: EE >u}: w( ]u#M EÉ$Sr?E}~=Ut3}--w\DAtu܋E Ƌ})x [^_]9u]䍃D$ P"D$D$e$s\ÍM U$WEM E$DxgEEM E$HEmx>EM EÉ$MMCxEM UWVSvu4$RH9MX} slu^uVt}} Tр:.utgz\t,р:.tU ƒ.} 1[^_]Ãt=z\tפftu?u&xU 몋E Pf} /`(qUWVSܡaE 8E1D$|$E$xFD$T$$zxT$<$z4U+u [^_]fffffffUVS"çEuUMx#L$ T$t$$<x9s[^]ÉL$T$$%[^]fffffffUWVS 豠6utcEt\E $F&ljD$4$'u?|$4$#u%džt$|$E$D [^_]É4$#fl^UWVS äutcEt\E $%ljD$4$V'u?|$4$"u%džt$|$E$ [^_]É4$"]UWVS 菟u t\E$+%ljD$4$&u?|$4$f"u%džt$|$E$  [^_]É4$!S]UVS ÌuD$4$tD$E D$4$5 [^]D$E D$4$ [^]UWVS蟞$u} tAv-u3D$4$$tD$4$`%F1[^_]{\US3øEU tttu P1[]6\UWVSn}u t' t:@trt0 wvONuI[[^_]D$<$ $tD$<$y$wFw71[^_]D$<$#tD$<$<$71UWVS%ê}u tPD$<$#tD$$D$,\ZЃL$|P/~ȃ9~D$$)D$,ND$(\$,eED$8D$< D$P!L$8iDI4N\$tD$t$|4$bD$|8(D$tـ\$`D$XD$XD$XD$(D$0D$8D$< D$P݄$\$`.D$(FT$H)‹D$<ЉD$PD$X~T$D D$XD$P/bD$P؉ƒtL$tS(݄$4ݜ$D$P-otj݄$D$tL#1ҋ\$Ptut ݜ$؅ D$P݄$ݜ$|$Xu DŽ$\$tNQ"݄$\$`$n݄$\$`t$TFD$`ƒߍFXj‰D$|@H0tT$TD$</[|$PT$8T$H 8t|$PT$8}D$hD$|D$,$x D$D$5$<$\$t$$]t$ $D$|$$$\$t݄$\$`t$ptD$|L$DD$`\$`D$`e[^_]Ë|$PȉD$|t^t$HD$PD$0JЃ w(D$PL$8\$| CD$|SJЃ vD$8D$H-0t ˃L$|0t)ÍCD$PBσ\$|BЉD$8D$PD$0\$TD$H|$8\$,Nq$$\$t D$`$ D$h$ D$8$ D$T$s \$P0D$tـ܌$T$`ݜ$D$d\$tD"݄$\$`\$HuD$P$%k)~&U1҉$4DŽ$pD$Pj؋D$tـ\$HL$H\$Lـ0OD$,D$H$%u=D$0[D$H#$$T$P=܄$ݜ$m1ҋD$tàT(C$D$\$t$#D$4$x$ $$$1D$XD$\𿃼$us$ue|$Pt%=/D$D$T$\$tD$T4D$hD$D$T$\$t1D$XD$\࿋|$P$$\$tL$X܄$ݜ$$C $/$%= D$Txu xD$D$T$\$tD$T|$h|$$$ځ$|$P3'p$\$t.D$`$"D$h$D$8$ D$T$$v|$0$T$Pܬ$ٞwq؋$ݜ$!$1D$XD$\?6$%=+|$\)‰T$\K)!؉$^$DŽ$M9D$0tS$$|$PtN%=w@k)9t:D$0ut$HSD$H#$u΁tz%$1ۉ$$D$Hqݜ$$DŽ$DŽ$$hD$,LDŽ$1ɉ$t'4$)D9t t u 9u[^]UE]UE%]UEt ;E ]ø]UE%t 9E ]ø]USMy҆EM t.9t*֛D$ $$D$D$p $0[]USxvM E%t.9t*֛D$ $$D$D$p $0[]UEt t]ËE ]1} ]USTxمUE ~;u;t5֛D$ $$D$D$p $/[]ǂ[]Ãwǂ[]USwPEU tt 1[]5UWVSw$ {rEtc@@5D$D$4$Eg5u E[^_]Q584$zB58EE[^_]UWVSvsuthF~O9tHNM 1[^_]ÉU4ED$|$E$蠙U4u=FUF맍D$ @$D$D$Z $/i|UWVS2v÷}t;t-M tWt1$y;wr$~y<$vy[^_]UWVSuY}tJWt7E1U9}t#E4E D$4$%u߉[^_]1[^_]ÍD$ 4$D$D$ $ .UWVSCuȂE@EEE19ut|Ef-uix. fLD$:$w(1flmUWVS\]k׉u UuU8E1Dn} t>M1U+y \[^_]Y$(W 9ƉyfQffQ 9>f4ED$D$ T$t$ $X@ u1$ЅD 9MPPHDžPGO9=uDž Dž)D$t$ D$D$$XWDž@ u4$Ѕw8L8 9v<$ZfG$ZNj$YЋ9f}}$} )Q t$$D$t$ L$D$$VDž@  99uQ 04$ =$\C{GvT'tO<$NNjE$N$O|$t$D$ D$D$$%ha1t9s;)d}dDž1 019tl!9hu狍Ƌf4JuZtJ9}A9p@ ‰))9~V׋2$JZ<))9zrtft1mDt$$*x9P ]u,04$rtx99v8Љ΃tft4$=ȉB9}D$ %D$D$!$r D$ %D$D$!$: cD$|$ L$D$$P…s@ 899EP04$=+Ɖ<$uP)9| t$ D$%D$$%6\4$p)9T$T$<$tq8f<$Ѕ%WDž$V1q΋9 GƋȉfpfJ2r 9t H0f9ًF9}랉t$ FD$|$ L$D$$M…@ 9-<$P9D$|$4$o1r@ yyy )ʉ (D$ $P‰p<$%O\/D$|$4$an01911)fR9s<04$L2)׃ (D$$fOljUWVS$ OÒ\u}5EGBt $[^_]øEB $IE!M DžD$ED$ED$ D$ED$<$wI…xkF D$FD$FD$ D$|$E$MEEE$Q<$ Et;$[^_]øE9E$Q<$ F tD$ %D$D$!$RE$QF UWVS@jMZMu8‹E1kFB FBPƋ<}ۉ\$D$ D$)D$4$~HƋ9s < tW< tS< 9sz~D$ $)H< u땸1$H@ 2m)փ (D$$EtƉKD004$A@9]‹tft‰)‰ODžNtftR :)944$S@9o‹fBf 8mDž1 }D$ $D$D$^!$3P$HF9%f)փ (D$$B%Ɖt$Edf\UWVS`ArOE‰Eu8E1FE D$ .u‰t$L$E$}YEE4$ML$ML$D$ t$ED$ $輬t`E$DE@ U+`[^_]ÉM $M>ʍLEbMUEƋE$KDu녍D$ $D$D$!$B[UWVS(r@MuE>FE苳 }teUE<$ML$ML$D$ |$UT$4$胫t,E$CE@ ([^_]Í뙋MUEƋE$FCt([^_]Í $訪t: DD$ $D$D$ !$nUWVSE?LƋEtvF u>ED$ ED$ED$E $E1lj4$[^_]ËED$ ED$ED$E $EDžt뼍D$ |%D$D$!$A[E1UWVSm>Kt@ËED$ ED$ED$E$ًU EfƉ$[^_]ËE1[^_]UWVS0=zKE}u  t/10[^_]Ã} uyMMUUUUu|$M L$D$lD$hD$ RD$ D$E$&iuE0[^_]Ã} tba8t{bPWPtD@ 7 E #сT$ ,%T$D$!$_Ex{UWVSX|<J}E EЋEEEE8EƋE1$(>71 E؍EEȉMԉ}܉<$?D$D$ D$D$E܉$iDžE؉D$<$蝲ƅtEȉD$|$$ MЋIt9pMЋI t9^Mԉ}UEă< t< tM܋E؉D$4$MPE tJ< < E}9yE؉D$$tPuϋEЋUĉP MH}MHAMQM)ω}9}ЉG)ʋ}9nt1ɉU؋}U9rU؋}ЋO E)׉UA4$@9‹}؃UЋu؉2Ɖuԋu)ƉűEEE6tftuЋVuȋMԉ 2M)ẼEE؋}9SE؍UȋU܋4u4$C@9Ern‹}ԃrjwt%ỦϋU)׃E (D$$h9t 8E܋U Mԉ}M܋E$fuE̋E_M#Mԉ $=;EEfbD:z1E܉E8USF7D6D$D$@l D$l D$ ED$E D$E$[]US6uD6D$D$ @l D$l D$E$g[]UWVS6+DD69tDÉt$ D$@l D$l $ًU EƉ$B[^_]1[^_]UVS+6ðCL tpǃl ǃp ǃt ǃx ǃ| 5D$D$ @l D$l D$L $,Ɖ[^]ÍL $u]L t55fUWVS0q5Bƅ-8DGty]]ԉ]]]܉U؀0tv\G0 1 4H\Gu6.E]9tEprBDGu10[^_]Ã0 vNȃD$ ,&D$D$"$E@0PSfffffUWVS"Æ/Ɖ׉ʅt5UWVSsu} tdt0tCt 1[^_]ËEFUT$4$P[^_]ËFUT$4$tƋE[^_]Í+D$ 'D$D$|"$rD$ 'D$D$ |"$[CUWVSuE }t )щʋUt7uzN|$D$4$Q tuUtQFU'U u@ 1N|$D$4$QUt?tFU U u@[^_][^_]1[^_]1[^_]ÉE+T$ &T$D$*|"$BE ET$ &T$D$0|"$ EUWVS?u}U 8E E|$4$_tz9Ur0tpt+uc1T$ED$4$6>t,[^_]Ãu[^_]É<$Y E [^_]ÉЃtE륍+D$ &D$D$|"$)E D$ &D$D$|"$R}!<$ E 10UD$$$NjE 8Ut E?&D$c$ 1UWVS8u} t tJD$(#|$4$ [^_]Í+D$ &D$D$?|"$uD$ &D$D$@|"$UWVSà}u tNt 1[^_]ËVUEGUT$<$Pt׋GUT$<$P[^_]ËGUT$<$tGUT$<$tE1҉¸M1 ډV[^_]Í+D$ &D$D$W|"$,YD$ &D$D$X|"$蹿UWVSs}u tNt 1[^_]ËVUEGUT$<$Pt׋GUT$<$P[^_]ËGUT$<$tGUT$<$tE1҉¸M1 ډV[^_]Í+D$ &D$D${|"$达,XD$ &D$D$||"$茾UWVSFu} tt@} u[^_]r+D$ &D$D$|"$)uYD$ &D$D$|"$UWVS3øu} tt@} u[^_]+D$ |&D$D$|"$蛽uXD$ |&D$D$|"$mUWVS*u} tt@} u[^_]V+D$ l&D$D$|"$ uYD$ l&D$D$|"$߼UWVSÜu} tt@} u[^_]+D$ X&D$D$|"$uXD$ X&D$D$|"$QUVSuED$t$ ED$E D$E$~>.t[^][^]US7üED$ED$ ED$E D$E$B[]UWVS{uE D$E$t })x[^_]9u􍃰"D$ 'D$D$"$OE)UVSEPtY.J.tQ.t&.tPÃ߃Aubv-0 [^]ÉÃ߃AvXЃ wrÉȅu[^]û.HvHw@B.̃v XЃ v-u(rÉȉdJ[0 v1nUE8*u P.tt E]]ÃE]USUtA1.tF1Ƀ\BÅtX߃]w"t1ɃBÅu[]û[]1ۉ[]ÉU[]UU!]wBu]1]USiE D$E$[]US?E D$E$[]USE$r[]USl E$@[]L `8U?¼ E Mp7]UEf]UE]UEfU f]UEȋU ]fffffffUWVS(F u}E EEGE؋U )uу<9M E9syQ.tf@t|E E9sT@AuwuFcO} o9](([^_]"E E1ɍ )EM[<U|$M $蹃Ut~UM)ȍ<FD$ $艃UUM)ȍE(\.uЋM)ȃE%E}9}EM؈vM؅<.U܃uwUD$]E$yUEE})C~x9F-}ȋ?DG~ruE9E9EEEE1ȉU}f]tEE:UD$ED$ED$ ED$E D$E$y]UWVSDFE܋EEpu؋EmE@u8uEU1Ã@;؍sL`uʋE EEEEȋ} EEEċEQuE;EM}ԉ‹EỦ]}?wxEËu)?fpхt@}E]Љˁ?@ ‹EЍpхuEEuEuŨ;U]M}ԈM]lMEFFEE]肬o+E d9] [fEp}1EpBf9utBt&M]܍D$ 'D$D$"$:MUWVS$xE8E1D$D$|$ ED$E D$E$t>ED$D$<$&tE+uЁ$[^_]ú/UWVS$<E MU8E1D$ D$|$E$t-T$L$ ED$D$<$cU+u $[^_]É.US]E M9r 9s9su[][]UWVS`EU} E9slUP0ك@t$tNt<]ĩ([^_]9sAAu@u;!E!29rUUX9r1[^_]ËE؃EȉӋUUWVSǖuE t*X?w#9r6 )ЍXt9Aхu)[^_]É[^_]É()[^_]UWVSEEUu Ɖu]Ӊ]8]}Y ?w` 0}9sq }9sg9u>zPt$|$$U]C uU270:ۅt9u1[^_]Ë][^_]Ë](1[^_]UWVS /u}E9E |2&6D$D$$ umtF;Gt1 [^_]ø [^_]UWVSCU2E uuW1[^_]É?wZ9rBZML$ ML$)D$D2$x(9E~9}ljr[^_]É(뗉֦?UWVSEU t_Z1?w%9r8D)ӍV[t9хuލF[^_]É{[^_]Éd(F[^_]øUSÔE D$E$k []UVSiuD$D$$tD$T$ tV[^]øUVSuU ]t*>t8u9t Ju[^]UWVS,^uE܉U؅Ot A"}܉MGEML$$]ou]NjM-+E0 EEډU1709~Kt$EU9)ߋE^SЀ vSW9U؅ttFE܋E؋u܉0,[^_]ErEJ0AkL$X\$\1ҹ1)ӉL$H\$LD$@L+D$ D$Pi)\iT$P(\ЉD$P)\L$(QӺ\D$8\$<9¸(\D$<D$P)\L$(щQ֣p=D$PT$T9 ףD$T\$ ׋D$XT$\19|ID$XT$\D$HT$LD$XT$\m1뷸n1뮁lL$X\$\n9>|$0L$X\$\L$X\$\1҃D$HT$LD$Pi)\iT$P(\ЉD$P)\L$(QӺ\D$8\$<9¸(\D$<D$P)\L$(щQ֣p=D$PT$T9 ףD$T\$@L+)׋D$XT$\n9}8D$XT$\D$HT$LD$XT$\ m1미n1릉$D$PD$@l+D$8t$X|$\؃!|$\֋T$\ƸQ)ƃt$X|$\)i)\i(\ø)\ykddڋt$X|$\)׋T$\i)\iD$X(\ø)\d$XQ֣p=T$L9ø ףD$LD$H\$XD$0 |$8-9R9~&)уD$P t1ҍR9ڀ|$Pt$$D$XT$\D$XT$\ƋD$XT$\9L$X$uD$t;ÉD$(t$,EaŃ\$(t$,D$t;D$PD$T1$D$HD$dD$8D$tD$0t$X|$\9}Éщ\$dL$hD$HD$ ED$D$8D$D$D$D$`Љ/T$0D$H]D$dT$h\$\1Ӊߋ\$X1 t$P|$T11 7D$PT$T|$X9Ɖ׉ӋD$\D$dT$h D$XT$\D$PT$Tt$X|$\1Ӌt$P|$T1ڋ\$X9؉ӋL$\D$XT$\T$HD$XT$\D$0D$(D$,bT$4L$8\$Kd\$T$4L$8\$$@+7Љʍe[^_]D$D$$D$E$T$(щ€|$?uG D$4xF~T$@D$D$$\$71ۋF|$0>|@u$hFdN-00tD@<@sȉ|$0>$@L$ @D$ D$49t$ G  ӉL$,iF9uڋL$ t$Ή\$4L$4щ\$0iF9dF\$,+dFG D$D$$D$E$T$(Lщ€|$?ED$D$$D$E$L$4T$(щ€|$?D$0dF\$,+dF)1W G D$ 9tG +t$\$49t$ \$bT\$a\$UWVS 讣/}썙]| uu [^_]Ë}|:dNu쉼PuMTډ ?-00tċu! [^_]UWVSt'ì\$XT$T˅. 0xt$\|$`IXPL$d\$<É s {9 l$dyD$<D$dD$<D$ t$lt$D$QD$ D$\T$`$T$\$X[D$\T$`E.‹D$T|$T:)؍))׉|$d)À\$l|$<ljύ))É\$$t$D$:D$ D$\T$`$T$\$XQ[D$dT$ht$lt7k9)ʍJ)Љ)))șD$dT$hi"D$dT$ht$l7_u)Љ))щL$\D$XL+D$(iT$h)\iD$d(\ )\d$dQ\D$dFEVED$ ED$ED$<$HƅL@U܋M;WW+EỦ9‰FA1EdF1Xn]؉PE܋؉ }<$11ƅE؍+F(EỦ9sUWVSPÓH\$|ljD$xT$pL$P8D$TƋ$L1fBZ<:\$t\$X4\$x0>D$DD$\$|$ljt$ȃ|$dw|$H1 ڃ9t$xuD$hT$l|$HyD$hT$l\$tCL$\qY؋T$p\D$HTT$8D$h9ËD$l!΋D$HD$\L$pD$hT$lDT\$d߃D$tD$t\$x9D$D#|$t$D$p>11ۉD$x":tt$p>t$x9Kp9|ѿBG|$xkfat&Dߍ$D$xD$|D$xD$P{D$D$x$\$|1[\$|L8T$4<L$@kD$0. \$X))D$Ft>8t$|$pG$D$\t$pD$`k XPD$H1$$D$P\$xD$X($\$HL$`t$t ;C suyt$tD$tT$hFP~L\$t9\\$h}4=}H\$t\\$h\\$PL$x ;>VD$\9]\$x|$dD$d|$pdF$ tftD$dËD$pXT$`D$x$\$|~6ËT$`<|$`1>|$t @ϋt$xs&tftt$`D$x D$hu+uċ\$|8f1D$ht$t IlPӉȉnu6u\$xD$p@f$ $ f |$pdNeND$@1ɉL$8~$D$xUWVSPՒ\$dD$tT$pω<<FD$tp@u1e[^_]Ãt>u)D$lJD$ht$t|$hwǍT$xD$`tD$lD$XGtt$TDD$Pt$p@dPdP`tftߤ1eD@t$p`Pp@D$HD$pf@D$`<9PHЅu>u)Ӊ\$LT$`.u<*t <-~0< wȋt$t)D$lD$hD$TD$P\$pCCD$x؉dFǃhFǃlFǃpFD$XC dN\$lډNjt$ttftt$l0e[^_]~~1D$HD$`*t -~0 wËL$`)ˉ\$LL$LY\$4\$X\D$x-D$|"D$d$|$$58,,$|$8|$pGD$xD$؉dFLJhFD$|D$؉lFD$lpFƇqFfLJrFD$XD$\D$dL+D$D\$@t$8ti)\‰(\= ף|$D4)D$XT$\9D$Tt$PtD$XL$\t뺨1ɋt$pD$dtlD$TD$P11D$Hy,;T$|| ,;_D$pD$TD$P|$pwt$dD$xD$T>7> 9iFuD$pD؉D$X1\$Pt$p>iF>kFuL$T\$X)ىL\dFuډT$X|$d9u\$PD$T؋|$pdFLJhFD$|؉lFD$lpFƇqFfLJrFGD$pX dN\$lډNjt$tsctftt$l 0D0\$LډNjt$`stftt$L0ɨ뀋|$xT$|1{2D$Xf ndPt$pdPePeP@f2|$pdNeNT$hfM|$pdNeNT$h"fQyT$4\$\$@t$8D$XL$\D$DD$dL+D$8L$\$0t$,ri)\P(\wf= ףt$8)D$XT$\p:σ|$@p/|$T9׋t$P}D$X\$\L$@t3빉L$\$0t$,D$,|$,9|$|$D$(D$dL+$\$t$i)\P(\= ף$)D$0\$@D$d9)؋L$09ȋL$d؋\$(T$DЙD$XT$\D$8T$<D$ D$8T$CD$(D$DșD$XT$\D$8T$<‹t$FD$(șt$9Ћt$H}D$,D$Dt$0D$XT$\D$XT$\puD$DD$,9}bL$T$$D$@L$T$D$dD$03UL$@D$drD$0;L$dJ\$t$pD$(Fu=|$plFpFdFhFG\$\$@t$Dt$8t$)=D$pf@D$,:D$,D$p1҉PyUWVSy~}ƅӀ:tyɉ‰Džt;:1ɉUF E荈M1= ||9}~z>dN$]-)=v޿T[^_]@@@ f@ǀdFǀhFǀdNUTC1[^_]ËE~퍖dNE荄dNNjE#9tUD$4$]lUu_ɉ1DžuUWVSx/Nj U$8(=EU~|$, $( 5}# +TPdž _y>u E [^_]ÅxE P$RrÉ 2+TPdž 1뒋WZytىugb1ɍ=+dN}D$|$, $UVSv^,4$B uƃ 4$B[^]UWVSvEuM V~6hFhF1P9u dN9ut [^_]Ë]w41[^_]UWVS,vǭUM Z~/dFdFP9u09ut[^_]É4[^_]UVSuE,4$A8$4$A[^]UVS}u,4$A14$A[^]USGû8$[]qUWVS+uƠ$R pt6ÉǹUu [^_]ÉE$cx3U1UStBE$8x[]UED$ D$E D$E$1]UWVSmt,<$~@8$, D$ D$ED$ $Ɖ<$:@[^_]UWVSsÂ,<$@ u8$貛E D$ D$ED$ $ZƉ<$?[^_]USs E $11ҋE3t +P([]USLsр[ $11ҋEt +P([]UVS sÑu  $1ɉEt t+P([^]Í+UVSrA] E$1ɉڋEdt t+P([^]Í+UWVSnr,D$${>8$) t1$-[EgƉ׋D$$9>[^_]$1ɍZE/ƉUSq_ME tE-[[]$E1ɍZ$[]USqME t@ tE-[[]$cE1ɍZ$[]pUEt@ E]UWVSqƍ~]} tC }1ɍZ[^_]UVS0pN~]D$CD$CD$ C D$CD$CD$C$D$(D$D$$D$$1ɍZL$xLL$ L$KL$ KL$K L$KL$KL$KL$ KL$$K L$(K$L$,K(0[^]UWVS]u } IXP ;r B}y[^_]ÍIlP)׉[^_]UWVS o/}u} ,D$$; t[ t$RXPL$ ;p H}yD$$m; [^_]ËL$RlP)Ӎ8$\UWVSET$RuXP$M ] ;H pDyE U $\$ ;A yyƉ;u ]|o9u ] $\$ ;A qyƉ9u ]|͋M ]11 1ڃ[^_]ÉƉ;u ]}# $\$ ;A y}'yϋM ]11 1)ڃ[^_]Í [ulPƉ)뗍 [ulPƉ)J [ulPƉ)RUlPE UUWVSlmz,D$ $y9 t< tOUM T$L$$Ɖ׋D$ $?9[^_]Í8$C uu} UWVSl`z}u tstC-t(TSNLKf9t)ȃ[^_]1[^_]ÍED$ +D$D$B#$%둍:D$ +D$D$A#$$^USlây0 u#$, tЋE$(UWVSk[ye=t:F$V FtD$$g,4$ouƃ[^_]UWVSokx}ƃ0 $VftCƉxtD$<$,E FEF e1[^_]ÃUWVSj~xuE} t\Et1UӋ} ׉|$E$Ut!~}} u1ۉ؃[^_]É뻉؃[^_]ÅMuՍ~D$ +D$D$H$$#멍D$ +D$D$F$$"3~D$ +D$D$H$$"D$ +D$ED$G$ $Mq"UҋME~T$ D$D$H $B"UWVSwivƉUML <$3EtC$CdpupMH l l <$h31[^_]Í 1 #txu8u맍ƞD$ ,D$D$,$$m!O<$2UVShvEU Mt [^]MUEӞt$ ,t$D$,$4$ MUE[^]UWVS1hƦu}L E$Z2h l 1ɍ E0EMt"l Ct\9S t~ߋuMMh E$1h uMtω?$ ku[^_]Åt+l { uSUMCЋUMl 9uYh uE9rHE9sAZtҋl UMCK $ЋMUl 9tE]U11ҋE]BffffUWVSf3tUE0}E,8E1M zhEED$E$^0D$h8$+1hǀPǀTǀX71DžD8H@L,D$ |$0D$8$B%8U+d[^_]ÅE ((hEED$E$a/D$h8$.0hǀPǀTǀXE (D$ ,,D$D$QP$$W(ߞD$ ,,D$D$PP$$O((D$ ,,D$D$QP$$(~"TU(dqUT$UT$ -D$E D$E$>]UcsqUT$UT$ -D$E D$E$]UED$ED$ ED$E D$E$]UWVS|cqD$-FX$F`F`y ;Fp|4} t.FXPVX}D$FX$[^_]ÍFXD$E$USb|pE-Q`Q`y ;Qp|< tQXZYX[]ÍQXT$$[]US b$pE D$ED$-X$g []UShboED$ E D$ED$-X$5g[]fffUWVS!bæoM } }E EEED$E$E@ E@U~5M19E}EtfEtME)‰UE$5UE@몋U tE eMpTEfH @1[^_]ËUu G)77wWU<$UtًE)1u EEPCP@@D$$E[^_]ÉЋ}tftE@9y6U$D$ <,D$D$t$$E@U)ЋMAD$ $%E[^_]Í}D$ <,D$D$Qt$$..D$ <,D$D$=t$$EurMuMu4UD$E$aEU)1u =fBfmyMyHMXUS _ÕlED$E D$E$c []US^dlED$ ED$E D$E$c[]UWVS^*lEED$E $ƅ DžD$ED$E$0"=ifGfw G$G,FG('G Eu [^_]D$ D$D$<$[^_]É$"fG 1[^_]ÍD$ D,D$D$>$$@UWVSu]j}t5D$<$w fD$<$![^_]Í.D$ L,D$D$;$$ffffUWVS\vju 4$ 9EU9s 9ru׃s$u8u:Ѓ[^_]Í 9rU9tՉ׃ru$u,tftƤЃ[^_] zfUS @\iE9ErD$E D$E$m []Ԟf!̀rS[Äi[UWVS[fiu F0u ǀFFF tHNtA})xT9VnHM9VtnF t tc[^_]É4$N})y9u%D$ T,D$D$W$$+Vr4$t늉4$uS.D$ T,D$D$<$$o fffUWVSZhӉʋ} MM tau!ƒuމ[^_]Ãu1ރƒ0uEtԀ0tσC0[^_]R{} x|1utv҉)Ѓ0CUtʋE9ut OsECExtE1뙸)0KыEÿEX0C[^_]UWVS8Yýfljօt:Fu1F[^_]Ét$<$VFF[^_]Í.D$ /D$D$@%$~UWVS X;fUM9 ?p9s΃ttUUED$t$E$y{MU)UD$D$$E}E01 [^_]ÉUEDED$t$E${M uUEU JHJHJ H JHJHJHRPVU0U$&[0`UWVSLxWdljT$ L$L$,11 rL$$D$(D$ D$D$L$uct_GЃ%uD$wPZw0l,1ҍTPЃFHЃ v$uЉT$…L$t$$|$9|$  |$bD$D$tZFT$| |$t$L$8w%0-L$1L$ 9<΃t$  9D$uʋt$L$9t4$Y1e[^_]Ët$6뼋L$1L$ 9<qt$ 붋L$1L$ 9<IL$ 랋L$ t$ ~64|t$ t$ xL$1L$ 9<y|$ ]t$뽋L$1|$ ?<L$ y|$ 6t$ t$6t$ t$ t$ .t$6<t$ t$ L$D$D@$*PL$L$-~D$|$UUUED$;D$(i D$9D$sD$D$$L$D$ AD$L$D$|$UUUD$;D$(_D$9D$sD$D$$L$D$ AD$'L$D$K|$UUU D$;D$(D$9D$D$$L$D$ AD$L$D$|$UUUT D$;D$(BL$(T$$D$(OHЃ  1t$|PЃpЃ vt$L$<$|$UUUD$;D$(rL$(T$$D$~D$9D$sD$D$$L$D$ AD$L$~*K PЉ FPЃ vD$|$UUU D$;D$(D$9D$ D$$L$D$ AD$ED$fD$|$UUUD$;D$(rL$(T$$D$iD$9D$sD$D$$L$ D$ AD$D$ D$L$L$D$tL|$UUU{ D$;D$(D$9D$ D$$L$D$ AD$9|$UUU D$;D$(D$9D$D$$L$D$ AD$L$ |$UUU D$;D$(ID$9D$TD$$L$D$ AD$D$@࿀ D$|$UUU D$;D$(D$9D$eD$$L$D$ AD$,L$FD$D$i|$UUU D$;D$(L$(T$$D$@D$L|$UUUKD$;D$(qD$9D$sD$D$$L$ D$ AD$oD$D$f|$UUUP D$;D$(D$9D$sD$D$$L$ D$ AD$|$UUU! D$;D$(cD$9D$sD$D$$L$D$ AD$|$UUU D$;D$(D$9D$sD$D$$L$D$ AD$oD$|$UUU D$;D$(L$(T$$D$*|$UUU D$;D$(fL$(T$$D$]L뾉D$vL$|$UUU D$;D$(rL$(T$$D$tD$9D$sD$D$$L$D$ AD$oL$@D$D$D$D$0D$LL$(T$$D$L$(T$$D$oL$(T$$D$PL$(T$$D$1cL$(T$$D$+pL$(T$$D$QL$(T$$D$2UUU? ;|$(rL$(T$$9|$s|$D$$D$ t$1D$|$UUU D$;D$(rL$(T$$D$=D$9D$sD$D$$L$D$ AD$D$ |$UUUD$;D$(D$9D$sD$D$$L$ D$ AD$DD$ |$UUUD$;D$(HD$9D$sD$D$$L$D$ AD$D$ |$UUU{D$;D$(RL$(T$$D$8|L$(T$$D$]L$(T$$D$>9.t&14$ Nf"L$(T$$D$}L$(T$$D$uD$  |$UUUD$;D$(rL$(T$$D$DD$9D$sD$D$$L$ D$ AD$D$a|$UUUD$;D$(D$9D$sD$D$$L$D$ AD$KD$|$UUUD$;D$(nD$9D$sD$D$$L$D$ AD$D$[|$UUU"D$;D$(rL$(T$$D$)u<$fnt$1PL$(T$$D$PW|$UUUD$;D$(`D$9D$sD$D$$L$D$ AD$6|$UUURD$;D$(L$(T$$D$rD$|$UUUD$;D$(rL$(T$$D$0D$9D$sD$D$$L$D$ AD$|$UUUD$;D$( L$(T$$D$(L$D$$9$J L$D$$9$JL$D$$9$JL$D$$9$JD$@tb|$UUUD$;D$(rL$(T$$D${D$9D$sD$D$$L$D$ AD$vD$ |$UUUD$;D$(rL$(T$$D$ D$9D$sD$D$$L$D$ AD$L$(T$$D$^L$D$$9$IL$D$$9$kIL$D$$9r$NIeL$D$$9U$1IHVJЃ |$1tBЃD$D$JЃ v$q|$UUUD$;D$(rL$(T$$D$yD$9D$sD$D$$L$D$ AD$L$(T$$D$-L$(T$$D$xlL$(T$$D$ ML$(T$$D$.L$D$$9$GL$D$$9$GL$D$$9$GL$D$$9$GL$D$$9$GUUUwF;t$(rL$(T$$w9t$st$D$$D$ t$L$D$$9?$G2$|$1댋L$D$$9$FL$D$$9$FL$D$$9$FL$D$$9$FL$D$$9$yF4$lFL$D$$9r$NFeL$D$$9U$1FHL$D$$98$F+L$D$$9$EL$D$$9$EL$D$$9$EL$D$$9$EL$D$$9$EL$D$$9$fE}L$D$$9m$IE`L$D$$9P$,EC|$UUUwTD$;D$(rL$(T$$D$D$9D$sD$D$$L$D$ AD$L$D$$9$DL$D$$9$DL$D$$9$wDL$D$$9~$ZDqL$D$$9a$=DTL$D$$9D$ D7L$D$$9'$DUWVSPZ@M$]$} |$Dut$L}|$P8D$4Nj$L1'D$L'$@0u ǀƄ$D$D$$CD$0$G wf DŽ$D$PD$$$$$DŽ$DŽ$|$L$D$lDŽ$$D$HD$,D$xDŽ$$D$<$D$8$8-$%t >u$)؅$*$$A$$$j$$~Ƅ$Ƅ$FDŽ$DŽ$DŽ$FZ $@.ዴ$4$$:+@F f B$fx0\$L<$$DŽ$DŽ$D$$$$D$$8$g$ǁPǁTǁXy 1B<,<tft$F f$f$Ff$F$F,$FD$$L$$DŽ$DŽ$DŽ$D$PD$ D$LD$D$DD$$$$Z5$@$fH @1ۍFЍPwFЃ v$>$FZ$/$Ƅ$$$DŽ$1ҍ$$D$|D$`D$TD$XD$h$t$$؋$9}$D$\s'$$u$$)tB$\$8F$$S$f$$tJƄ$0$t$<3C$$V$O$ǀ'|$|)υ$$$;Kȉ$$W$$$$t$$)-t$\$ZDŽ$$$$8$2\$ltD$l$$%=$$@ @ft DŽ$t$(9t$$<\$4$L+=$e[^_]9.t&S$$K$$r$D$h$_)D$\$${$$j*[,ۼ$D$h$T$$T$$T$ |$\|$D$$$$CDžl6$)D$HD$lt$$;<$$p|D$lv6<$w$$$tƄ$-$D$X=$$߃Gm|$h-($t$X\$\ É$r$D$xt D$Xf)$y DŽ$D$l$D$|D$`D$TD$h$k$D$h$D*D$\$FD$h$D$\$a}/X$X0D$hP$$=$$$_$$"a. ,ۼ$$D$$D$$D$$D$T$ <$$>"$$$~|$\$ C#-vL$$$$$1۾ $$$$$$st$\$ 5$+[R$$Ƅ$1ۋ$?D$`$$ D$`$|$\$D$`$D$|$$$$$st$\$ !+[R$$ $$$y$$.,$[$$$$$DŽ$$Ƅ$1҉$$Ƅ$ $t$D4$$6@$4$6@D$x$H@87$|Ѓ01 Z0 4Jу0 vꋔ$$9+$N-v$$$ މ$$Ƅ$+ލW7*a4FЉ1҃ /PwFЃ v뉔$$$$$W$ 0!) $H$p$$$_\$\w*1҉$$$ǁ$Ƅ$x% ǁ$h0D$`Ƅ$$p$/$ $$B%$$t A+$D$|$PD$|$y DŽ$D$\$D$|$$$1D$`D$TD$XD$h $ $$$$D$|$+$)$@$D$|$$$$$t$D$$<$$')$9~$Ƅ$$1p$$$$$$$D$|D$lt$$Q2$($@$$$^*$$$$$$W)‰D$l*$$$L/ t$Dt$$LD$ $D$$D$$3/L$lD$|$$E$@⿀ $n$[$$$4$$$$$K$$L$/ $'$ I|$D|$ T$D$$4$$2.$y DŽ$$$W$ $N$$$5$$$#$$X0$$$$ʃT$\  &#ʍRR$$$$$ D$` $$h0RƄ$D$x@|$h$h|$lt$H|$|$)t$X9~~@$$7_؉$$V$$y1ۋ|$X)߅|$X$|$x$ $\$0$$$3C$$Q$$$\$|$)$9~~@$$7_؉$$V$$y1ۋ$)߅$*$X$$ A$$vω$4$$$륋$$)߅$&$X$L$@$ ~UA$$vӉ$$$$$L$@$~$$$|$|)υ$$X~$L$|$ ~UA$$vӉ$A$$$$L$|$~$$$ $$;$S$N$*$^$$\$0$$$7Gp$$X $D$HA$$^ $\$H)ޅ$|$,y$$Y$S$t$($h$T$@L$ $T$( ~W1A$$vӋT$@$@$$$$L$ T$($2։Z؉$T$($I $$^L$@$$&$$$L$@gL$@$$s$$$L$@~$$:$$$$T!$h$$ ~U1A$$vӉڋ$&$$$$$3{$$$$I$$X$F$$W$$$ $tB$t$07G$$Q$$$$\$l|$H߉|$|$$$3C$$8$$$$$$ݔ$D$h$T$$T$$T$|$\|$ D$$$/ǁ$'DŽ$$|$X L$\9l)L$\D$\L$zL$|$$ $$$L$|,$$~$$B$$$$$$$T$ x0T$D$^@%$$'D$l8N$$`rVv$$$$D$\$DŽ$D$|D$`D$TD$Xc$$|$||$\$$PT$xT$$T$ $T$\$$D$`e$)~Td.$$D$|9}$D$|$D$`D$TD$XD$h$9$u$$1۾ $$ $‹$ǁ|$X$DŽ$DŽ$$PD$xD$T$ D$XD$\$$$$K$)$D$|D$\$$X$ `~UA$$vӉ$($$$q$$?o$ $@$  $RD$`$ D$`DŽ$DŽ$ $ $ M$[D$`y \$`Ƅ$-$$$1۾ $b $ID$`,$? $[D$` Ƅ$$11DŽ$DŽ$$$G$$$s$$$$$p$\$h$X$t$`l$`t$h2B$$K$dt$xt$|$)9~΅~9$r$$K$Q\$x y1)E$\$TCL$`C$|$|$9h$\$$$ ~U:B$$vӉ$ $$$$2Z؉$$t$x$$$$ql$xl$T.$$`D$x$$ȃ$|$||$\$$1h$$$g$qD$|$$-/$$$-$$\$x L$@$$~$$$$L$@$h$X$$A$$vω$Z$$$륅 |$hD$h$$΍D$ x0D$D$4@%$$.D$ x0D$D$3@%$D$\$$$D$@$ǁ|$X$$ :$Pu`$3$$$$ $u$)ȉ$D$|:$$|$|0 u䉴$|$|$` )$D$|$$$Ƅ$-$ $D$@$%D$X$$R$D$\$$$$$ DŽ$$P|$|D$xD$T|$($\$`t$d$$ T$|$$ʁы$)уș׉L$`T$d$$)ii̍D$hȿƉ׋D$hljD$p%D$tD$pT$tyD$pT$tT$pD$`1L$`\$d|$|W0G$$D$XD$T<9 $$9~D$|PD$@GD$TxtD$T\$`t$d$$DŽ$V$|$()ы$D$|;$RD$`$BDŽ$DŽ$$$DŽ$$$~$$$L$@$$3$$$L$@ $ [ݔ$$D$$D$$D$$D$ T$$$/Dž%$)D$H$yD$HD$\$uƄ$D$lt$$.<$$WD$l<$$R$$$Q$$[$$$J$$I$$ $@R$ z$ID$`$@h$ $ID$`$$ $R$$$ D$`$@$$$ $I$$$$\ $ $0$$$ƶP$$$$$葶$$$$@|$ 8  $ID$` $D$\D$h$+L$X$ $R׉$4)0ȉуcڋ$s0O9$T)ډщ$$ǃ> tft$$)ЉD$,D$\\$, $$y DŽ$D$l$D$\$D$|D$`D$TD$X(D$P( D$PD$PD$Pn$`8$Ƅ$1%t$x<1\$X$1<9)FuދD$\$03$@0)ً$D$|$^ $$$v$$$\$Xt$xȉL$T|$`$$D$l$D$|D$h$؃|$||$\$$1۾ UD$\$$3$$$̉)1ҋ$$$)iiщƉσ$0$O$$DŽ$$OD$|$P|$h'D$HD$\D$HD$\D$h$1\$P\$PUWVS\}D$<$ED$ E D$-D$<$豺D$<$[^_]UWVS~}D$<$蛕ED$ ED$E D$<$QD$<$蕕[^_]ffffUWVSƉ׉M0itt[t@[^_]ËUuD>ttuf9uE[^_]À<>XuD>t6EtD>t&u9u9tt[^_]ÍD>UWVS=}ED$E D$EE$ԉ0E܋\$D$D$D$D$%-uMAU$T$ 7ƅXT$ DV 9‰T$ s )HFL$D$$>D$ NT$99sH\$T$9rڃ9uT$9Ѓ9uU@]} ;tL$E$UE tE C9rwN9ue[^_]ËD$%-uMEED$E D$1$6Ɖe[^_]ËED$E D$($6Ɖe[^_]ËED$E D$]$~6Ɖe[^_]úT$U~ t^E|tEXrUWVS,n}m|$D$%U <$p 0m܋|$D$$%-BuM7U$T$=5ƅNT$DV9‰T$s )HFL$D$$D$VL$ 99sB\$L$9nك9uL$9ȃ9uUB]} ;tL$%ɋE$UE$tE$C9ruN9ue[^_]D$$%-@uMEED$E$D$1$-4Ɖe[^_]ËED$E$D$($3Ɖe[^_]ËED$E$D$]$3Ɖe[^_]ú$L$U~t^E|tE\pUWVS`4ùE(|$PD$YUt$X|$0D$0D$H|$ D$$D$L<$6¿0፾ÿD$DED$ED$ED$E D$D$DD$ D$HD$|$0$.U:ue[^_]ø랸뗸1ffffffUWVSx.ót&=E= =D$TEU D$HT$Lu 1ҋE%=D$HT$XzD$T~D$TD$pD$ D$tD$D$X$ʁD$DD$pD$PD$\% ?D$X\$`t$`D$$t$`D$dD$`أ܋$܃,݃4T$`L$`|$nD$n fD$ll$lT$hl$n؋|$P)׉T$h<ƠS(\$X,D$(D$4D$hljD$@D$,} <$00D$`D$tD$ D$PEExD$0|$@t$0L$$ 3t$4$wD$8xD$0L$4ȅt~9 ))D$4)NjD$,tXT$0D$D$8$:yD$8"T$DT$$wD$XT$D$tD$XD$D$.wD$XD$h }~D$0t |$TD$,D$h   )ƒ& <)t$LE'E D$E D$1$.D$`D$`e[^_]D$( D$4L$hD$h)D$4މt$,D$@D$h} }~1|$Tƃ}B }}}D$0UD$@‰T$ MDD$P$-D$`O}F|$T;|$PwHL$t |$@ ƠS(D$@ƋE D$HD$`P|$P|$nD$n fD$l9 ؋`Ƀl$l\$hl$nL$h‰L$XL$Xv ɃL$hɉD$hH0Jڞzu؋D$D$rD$`9D$@}U E 0D$`e[^_]ËD$,D$D$D$vD$DD$`D$`e[^_]Ë|$P|$t2} x )D$`D$dl$`\$`t$`D$d-D$$D$TD$T1|$TD$TDD$T@)捊 ym1}} }t=ED$0T$hD$()ȉD$41D$0EED$ D$P_D$hzIl$h?ED$E D$]$*D$`D$`e[^_]úT$4ׅMt$(vT$PD$0t$`L$D%D$D$ $pD$XD$ $L$h+0FL$hQu y 9|$P‰L$D1ɉT$hD$Tt@L$TD$D$D$uD$D|$X|$$vL$T6|$`94 vP9t|$8L$8=D$`0D$E D$($)D$`|$PwuD$t(.D$0L$@ƠS(ȃƉDD$XD$t"T(T$t Ƀ ɃuT$\$8D$8T$ D$PD$4D$,T|$8D$`D$4t$PD0D$(t$DD$XD$4$a'D$,0L$hT$8T$4$PsD$P|$D$X$s…@ fT$T$04$sD$DT$0$tkD$Dy}T$HL$T T$PN~}~L$TT$ht$D~HD$4$UqD$D1t$Xt$$^rT$hV9zT$,1t$4FD$hD$X$jD$h L$8tt$89tD$h4$njD$hƉ|$8D$8$XjF(MZD$PD$D$D$X$$kD$XD$D$D$qD$`p1D$@D$X$iD$8lD$hD$D$X$nD$X86+D$p[T$XBD$k¸ )6D$XD$D$D$pnl$@D$D$ D$D$KjD$DL$0D$ D$P8D$0~)T$4D$HD$`DD$8|$nD$n fD$lt$0l$lT$Hl$nd$HT$H0qٞىt$Ht$0T$Hك0ڞ.D$XT$\D$HT$LD$tx |$@t$4D$0D$8 T(D$Xr D$D$D$8$ZnD$81fu T$hvx0t|$8L$8 t$8F$f…Fz tftD$$mDžYD$PD$4HL$PD$h9L$("D$D$ 4$ hƅ`D$8D$D$ 9D$8$gD$8,D$D$ <$gDž D$PD$4D$8L$؃\$HD$HT$LD$-@D$D$8أD$|؋t$`D$XD$8EЉD$@A$&fD$Px}ND$H D$P=N)ȉD$41D$(D$HiD$LZOD$,DD$@ƠS(ƒD$X T$T$L$T$HL$L?T(\$81tD$8 \$8uT$D$8T$m|$@|$0t$4|$Hfu|$ t$ e[^_]Åy1fu|$1 t$e[^_]ظe[^_]}d%D$ 0D$D$4%$RmUE fu%U ]fu%U ]ø]ÐUWVS;EЃϋ}Ѓ׃|$d)hED$t1Ƀ ~ |$t9|$tT$l $]ljD$hzD$tD$`M4OE|$tQ9sT$l|$tE9~D$`4D$h|$th|tT$`|$tD$hHL$lD$`L$l)Ɖt$PT$`T$lD$h$\$T$le E D$HD$hHCT$`$D$D$h$g\$lD$lT$pD$T|$HL$P4t$0t}D$`D$D$D$t$PD$tD$D$h$TW|D$lP1D$DD$d T$`D$t$OD$HT$`L$`A|$49g)lj|$t|$8D$`)DŽ$D$\D$D$t$SD$t}t$tFD$:QƋD$dD$\rD$0=P}ST$LD$4D$tD$8ЉD$8|$PE@9E  D$8D$LD$\D$0D$`u؋\$TKD$tD$HEЉD$DT$lD$d)D$8D$LD$,‹|$4)T$\t$`$t$LD$tL$8Ήt$8D$4t$tt$D$H$RD$H#L$hL$$`PD$tL$h $MD$tD$h)t$4t$D$H$SD$H+L$l95vB<9tD$< |$PE@9E D$8D$LD$d|$HG$KKWx q tftD$$ SD$d~D$<؋t$lL$dD$D$h$RD$hL$tL$$SuL$dfD$hx,D$<D$DD$l1D$< ezfu D$tSD$dƒ80tND$<؃\$TD$TT$XD$$-@D$(D$<أD$$wi؋D$8XVH؄tJuU tu ؃[^_]11USXEHP$D[]UWVSDEċ] CE}9G{}ELM܋uűUDE0EH1EЉE9uEEEEEgEU؉Ӊ1ۉMԉ]؋1ۉEE+M]+M]؃EEN9}s] }uAG9Es0uV+E)‰؍M9tGz q s7u/u(UE$]UBEUE다fuuJ z Mq ffUWVS<E8Ex0E }Uxx}؉EԋE@EA…uA…t v0uAE)Ɖ9ME܉pE)E؉p$] )ƋE 9m1E ]9XE pE9)9E @ E؉$]S ]3E"P0[^_]Ë](EbNF10[^_]ʋu< ǀ0^0tʋu<ɉMEJE?$]j E@@E}؉8E @}]?D"b?)։Ut$E؉$]DžUt(N}#bUt$E؉$]puU3]K 8 t 9u~2U)49t$W0T$D$ $Du1[^_]Í~ u u 9}t$O0L$D$ $u뺋}}z1HUWVS0聀}u D$(D$<$\$ D$ T$$D$T$D$,D$4$c\$D$T$D$T$ G+FD$(+D$,~%T$$ЉD$D$\$ D$ t$e[^_]T$)‰T$ D$\$D$ t$e[^_]UWVS}M 2A<w 9uYu߉[^_]1[^_]UWVSxEM]E TsCD9sϥ9r)؃L9s&)D$D$ $]g[^_]UVSEPXM 9} u#9r1[^]Í~M t09tݸ[^]UVS~7h0)ˉލ u썊5a)ˉލ u썊A)ˉލ u[^]UWVSU} EZ]9BB[^_]ÍBEuLMuttb )E^M9uUM ЉFCU9rߋUM})}Lt% 9bE9rE})} E)B>[^_]ÉB$MUVS!}æUBJT19r & 9st9sEE$Ɖ[^]ffffUWVS |Fp7} w+ M4tetB-$F2E$iwƋEFEFuFF [^_]úMUE )ȉE w|-$'F"t-$F|UWVS{-ut"F w"p7u& 4[^_]É4$~[^_]€-$UEN? 4tU$E[^_]UMtuQtZ]ft11҄uuuut]1҉]ú ]UWVS]CEEƉE EE1ɉu}u܋EDEd}EUƉ׉1u}D9Mlj t"E9C~$E}|C؃[^_]É؃[^_]ËC$2tKSx s stftE$]u2uʉE$Efx s UE=w5=w=w=?v=]1x@u ]Ã]Ã]U$7t UP@]UWVSM CFM9r}ыU܋]9rB+M uUEPE$E$[^_]å9sܥ9rչUWVS}u F_)u)ODT9s290tۃ[^_]UWVS0u] C~)u:NDT9x9t] sމÿx1F$E؅3x F~}ЍUȍtu܍suStuquԉu}11Ẻ] E]EEK1ۋ@1))ڃ1EEʉHM9MrÉu}E̋] {}̉)ك9 }ω}uΉuu9]Mu}EA1)EU1USE9r׋EM܃})}ωuʋ}) t}؉GE؃0[^_]$UE؅t@@E؃0[^_]ù9u9ur }ω1UWVSEx|$Pt~^$2 )‹M  P9|$s`F )׉\$ Éً\$ D$ ?\$V9T$sZV ЉD$ D$ e[^_]à t(D$ ?\$1D$ D$ e[^_]1D$ ?\$D$ D$ e[^_]ù )D$ ?T$9|$r1ҍH ЉD$ D$ e[^_]ËVUWVS $ƅtc] %t D$ED$uDD$$&T$V ~tbM5)NjE8e[^_]ÍD$$T$tI ) |$T$~V~u-2MD$=)딋|$UEM Q tJu]UWVSyo|utD$E $wDžD$D$4$3ptt ʃ9t*xD$4$ t|E%=qt`fx ttpu ffx fp@P$P,FP('P Ĕ[^_],1Ĕ[^_]ÍD$ 4D$D$E&$&Q,1B,O1USm{E UD$T$ D$E$[]UWVSmD{utFD$4$]nx$P8D$4$f[^_]É4$Aڍ.D$ 4D$D$=&$%UVS3møzut&nxP[^]É4$[^]Í.D$ 4D$D$I&$%ffUWVSlFzu&$n$fUWVSk&yuf~ D$4$0F0ǀǀ F 1F t V$ЅxF F0tN@9t $nF0$nF0ǀǀD$4$FFF [^_]ÿF tF$6np4$D.D$ 5D$D$8&$$#( fff̀rS[w[UVS"jçwut8F0u ǀ4$uAnP[^]Í.D$ 5D$D$;'$k"뜸fffffUVSiwut%V 1f t[^]É4$Y[^]Í.D$ 5D$D$;4'$!UWVS&iëvu' 7FF <ufJ.t&fF FF uwFVT$D$F$V$FV fV 1[^_]ËF0tN@9t $kF0FωVʉNɉ~ ωVʉNɉ~ωVʉ N ɉ~$ωV(ʉN,ɉ~0ω V4ʉ$N8ɉ(~<ω,0123FG4VF5NE6FD7UMFK8VJ9NI:FH;UM<\GLFJ\EZLDJFGFGXLGJLFJLEJLDJ^_^_XLGJLFJ LEJ LDJ ^_^_XLGJ LFJ LEJLDJ^_^_XLGJLFJLEJLDJ^_^_ D$ D$D$T$$s+e=<1ɋ8tBD$D$ N|$\$4$ y8t6D$D$ ~D$L$4$OW8t6D$D$ VL$\$4$ W8t6D$D$ V\$D$4$?O8t6D$D$ NT$D$4$_8t6D$D$ ^D$L$4$?W8t2D$D$ VL$\$4$uwW8t2D$D$ V\$D$4$u7O1$[^_]ËO8,UVS 7`ümEU uMtTp4u 1 [^]D$D$4$f-u"udž0UWVS_?mƋ4D$D$4$ -EtE$bGu͋$btMtf~ 18t$b9⋎t $#4$sbuu&E[^_]U98}]EUWVS^l]tCƉ$b[^_]þUWVSY^kljUD$@$e]:ƋUu 1[^_]ËOD$M$&]…1]~˃Mt|tatOt=t+tt9EGX<tE[^],[^]UWVST b} D$$zSƅǀM]:8bL$ ED$|$]$"mF8FF F FFFF4- ~D1 󫍾󫍕xT$E$]~^ $]F]Um]StV4EHt }Gu]Stt LV1v4s$≕@DDDHN F$D$ D$ IL$4$BF0F(LN,NV<~$Q9~s~]WEP IT$4$0}M1Q\$E$KT$ ML$|$}<$$ ÉX TUMQ D$t$$ËVnNNFVnNNFV n N N F V nNNFVnNNFVnNNFVnNNFVnNN F V!n"N#N$F$V%n&N'N(F(V)n*N+N,F,V-n.N/N0F0V1n2N3N4F4V5n6N7N8F8V9n:N;N<F<V=n>N?N@F@VAnBNCFDXhH *JHXXhHJjJHXX h H JjJH X X hHJjJ9Z1=x>alV]D$ I<$ ;F@7NF(șdž‰Dž=N V DDTNꉖD$ T$D$8$]EP D$4$0}4dž$$$FH>pԓXuPx %H XP7p[^_]ÿO$4$GP 81Ë-f T$ ML$|$}<$ 8녋u 8"\ 8F8FF F FFFF4Ǹ- ~D1 󫍾 1$F~ j  811q [ 8ED$4$Bdž0$ 8! 81UWVS$JRXuF(x~(V0!UN9F9MUD$N $IMUF($N 9} TDTDF F,9sF0 F,|$}|$4$$[^_]ÉUUE$DEEtlE܋UT$ML$E$ME)UЉL$D$$M $&MEUVU(_US]ED$U $ #C,9C(}#C0[]fffUVS 2I÷VEpFtD$D$$F u  [^]UWVSHNVE0LHPH THxP@X~t=i`TIX=DHD$$$7GƅǀXHdž$$BljFXDt dž wG7G}ED$E @D$E$t7ƅt|$$t [^_]!84$8UWVSD0K>uE 8‹E1lt$D$ D$D$<$k=5DžDžDžDžD$D$$<$4ƃtI<$D$D$4$4tntD$4$tSD$D$$VE+uqD[^_]Í؆$NW8D$D$$4$_8Q?qUWVSl/É<E EċEE8EEEpFtD$D$$聶F }&Et&}U+nl[^_]ËEċP}O9E!D$D$$茳DžFfN @EW)‰UEċ@UB 9EGf~FED$EĉD$4$ׇ]fdž~ f}EF(<EċP}O9E}9rY|$ED$4$ʉEEEEȉEE@EME؉EEċ@E9s]|$EĉD$4$q?EEEEȉEEċ@EME@Eă9EЉEJ}3D$FD$$бDžFfEEGdžD$|$$ẺD$EĉD$4$:UljEoEf}}?} EEEċPMQ GO)MJ9MsLED$T$UT$ML$ EĉD$|$4$<}  1=f9Ms(UɋU)ɉL$DWD$DW$tUfGG)fGUfDWMċAE@BEB AD$D$$U"UBD$D$MċUQ$F( <u4WGu"f}udžfdžD$|$$  aEED$ |$EĉD$4$A1D$|$$±n9FOFf;EAfF5D$|$$z&E!}GD$D$4$`RE=&҃9 FED$EĉD$4$y~ f}t f}f~ }fdžG=w|҃9UdžEfdMUrD$ |5D$D$b'$OMU>UčrD$ |5D$D$b'$UOUMrD$ |5D$D$b'$UMjffffUWVS0'v5EUE@( EpLB< _Gx ZU)ىL$D$$]҆f}Ufz|rrEXft)ۍLZ]f9sf]f9u]t^J_f+Eft" F]Ff9sf9ufjE@(E <t 10[^_]ËE9PuEP9UsރUfBҋ} 9OO;MG(  UEfEUED$D$D$D$ D$ED$E$]~U_HMUG D$E$]Ƀt_MUFMUD D$E$]蓃tUMUE]䍋rL$ 5L$D$b' $HUEc} 1ut8UUEfEED$E D$E$]wUB=wbF9EEu!BB=bƃ9EUEfEXEH(U]䍃rD$ 5D$D$b'$Mƃ9EUzUUEfEED$E D$E$]~U],2BLU1ɉL$D$E$]{ƅEfEED$E D$E$~UE@(EUUB(D$t$$]oUE}GEfGUUEfEEE D$D$D$D$ D$ED$E$]{UUD$D$E$]zƅE@U=UUEfEED$E D$E$]|Ut_UD$t$E$][UU]䍃rD$ 5D$D$b'$UfE@(ExEH(EH(U1҉T$t$E$]ԩU&]䍃rD$ 5D$D$b'$UUWVS !L/}u FuIFu 1 [^_]D$D$$tYVPD$D$$/D$D$$车t!VPD$D$$|{UWVS0!Ý.ljU܃,E싗E9BD$BUD$$9ƅUBfEHMTFEDtU D$<$P~UF=w?uj>t$<$ut$<$ ;0[^_]ÉU썃rD$ 5D$D$b'$UE EF )‰T$L$Eȉ$*EfEfFEDFfENUBft?ЍDVEȉMU؉uuMf9sfUf9uMU؋uԍLQF=f+Eft2Auu}}Af9sf9uu}fnD$t$$ǦE܃8tRE܉D$<$t#fFfFF 묋E܉D$<${nD$D$$W1QD$t$$:1UM䍃rD$ 5D$D$b'$UMUWVS@*ï+}EpFtD$D$$F rt@tf ȃ@[^_]F(tܨȃ@[^_]1EE䍃rE؍5EԉuED$E D$E$FƅEM}$f9t$E D$<$hwFD$ ED$E D$<$E@  V=vE܉UE؉D$ EԉD$D$b' $qE܋Uf9b~E@M=HfNfTf}܉u |$t$E$v,GD$ ED$t$E$7GHfuIfGE@=UEOfO`D$FD$$Dž@=FD$ |$D$4$rG=@MD$|$$MYD$ED$$Ϣ4=jU 1ɉȃ@[^_]ÉM썃rD$ 5D$D$b'$YMKD$|$$B띍rD$ 5D$D$b'$ D$ED$E$NuG}1f;}uD$|$$踡FEčMML$D$4$ CN9|fEr}Ѝ5}̉ωщ>9RAEȅ,D$L$M<$8F,EE9NjM@9ED$L$M$EE9ƋMTFD$FD$$VFEQvMԉE؋EЉD$ ẺD$D$b'$TMԋEArD$ 5D$D$b'$D$ED$$hD$T$$D$FD$$耝Dž5rD$ 5D$D$b'$F8@xf}܋98}fxXDy|8f@D$L$$"D$|$$貜1jmЃ}uf}D$L$$ڞD$EȉD$$g!VFrD$ 5D$D$b'$y/}suuD$D$$H5D$L$<$ED$EĉD$4$h?[F,E׉J9OMUD$|$$賝U싲1M91D$T$U4$肝EM9΋U;EFD$FD$$…F7ft։EfM܋61ufqpuU+MfPmEDGDED$|$$蛜D$ED$$(Dž@=wU܍rD$ 5D$D$b'$+UBU`fU܉1D$|$U$1҉T$ED$U$菙DžUA։ffffff1̀ffff ̀rS[d![UVSG!ut5D$D$ D$ED$4$Ot6E[^]Í~D$ 5D$D$5'$럸fffffffUWVS.ó UE pu8lE1ptEuAx=EGu4Ѐ:U)hx9׉drD$/$?t)1lU+Ĭ[^_]Ëdr5d`%$>F 9dgƀ>Xt։`dD$ h)D$|$`$Jpd9r9>/utD$$d"B/|%=@dt~8u)с?h~D$ 5D$D$?($hM+X\pD$E  D$\$8Xh9Ƌ`5d)@u08p9hD$d$ޘuvEt)D$\$@JltD$\$@.89d`RfffffffUWVS)Eu U9Urz9s 9roǃs"u5u7[^_]Í 9rQ9t׉ǃrިu!u)tftɤ[^_]xfQfUVS Ç̿4$CD$$D$F $? [^]UWVS C}$W$W#1$WD$$D$<$x?t$<$> [^_]USG̿$[]US,!æEEVEEED$D$ED$ ED$D$E$h~t}u E,[]ø,[]US !̿$[]UWVSxÉUʋ1y}IMB EBEBEBERUEEE@EE@EE@ EU܉EEE̋UUUUĉM؋EEȋMMЉ}MUE te kE2-byEnd 3Eexpau֋Uĉ|]11 É]1uM1EMEu1]1 M1ΉMˉ]1uԋM1]1 Ήu1U1ىu؋uU1M1 }11Ήu11 Ɖu1UډU1ЉUE]؍E11 4u11E1]؋Eԍ8M1щM1 :]1؉]1ωE̋E}NjU1]1 1Ӊ]1m}uuUċ|UexpaUnd 3SUԁ2-bySte kS CE}CE}CE}CEȉC E}C$E}C(E}C,E}C0E}C4E}C8E}CffffffUWVS }lj։ʋM fFfFP@F uzYˉM V)fVfVD$\$$U]eZMUBfFF F D$t$$]蠂1[^_]Ã<Qʋ]C ^)fFfF] H@ L$J UL$ $]YUBeD$B D$$]tH D$D$$&KUWVS$Ǟ}E΋xfzfz:E~ F=/M9AfZfZۍ E@ EƋE@tT=$1EAfBB B D$T$E$]1$[^_]=ft1MM\A4f9rM=w(f21f]\F<f9r]UM]rD$ 6D$D$b'$VUZM뢉U]rD$ 6D$D$b'$UZUM]rD$ 6D$D$b'$۰UMUM]rD$ 6D$D$b'$蝰MUU]֟D$ 6D$D$|($bUUWVSL}܉E׉MM  fMꋀEE=EffEGEfE=f}EfE1fE1EEЉ}׉MEuTF2 Z]f;}]9fEA)fAfDYt$T$UȉM؉$]UUԋM؃fuEf;ErEEȃEȃ]f9]xf;}E@ Eƃ=w/.t&E]TCڋ2rEuTF2Ef;}E\E9s|E]9tqf;}MԉU؋]܍YD$ 7D$D$|($MԋUuEE\E9r}D=gU]܍YD$ 7D$D$|($衭UEfpE@(4f;UE Mf)EEEMf9GE1fuuZEH fEV)fV]fT^D$L$$]SfEEUf;U Mf9Mu fEfEG sEHA bE]TCE}D=EfpE@(9H@f;ErfAf;E1EMAGEHMIuMA}f9}u}fGEL[^_]fEEMf981뽋]܍YD$ 7D$D$||($fJ]܍rD$ 6D$D$b'$4I]܍YD$ 7D$D$|($'M uNf+EfF[1fEi鏂銂f郂.&vsUWVSq ƉUMED$4$gǍED$4$gÅtxEEGCCGfCfGfCfGUB EC G ED$E D$$M9U[^_]1[^_]UWVS( å ƉUMED$4$gEljEfGE}fyUzyAB A u.E B=f9PEU܋ED$$EUMEABAfAEfAB A BtHUD$D$$uU.U}HD$D$$wUED$E D$E$MU܉-E䋆U܉׋usOuCu1u9ut2U܋E$'EU܉E]E([^_]äu9uuΉUftt֋uBfF] fu]E떉UM썃rD$ 6D$D$b'$詧UMEE$g1EF z]fU1҉T$ED$$UvUWVSt Eԋ}uE fEڋE M܃8MED$EډED$EE$U N …%}t Bf+EfBMfDJ MQVP]XP AD$D$$UЋ]MFD$D$uEF$LuE܉EЋE 8G,E9HEEEEԍr]6EэAD$AMȉD$$]r…MAfEfEڋN g+8 FE EXJB)9&E:D$ED$E$MUȉqEUȋMU EF 4?jEP])ډfPEfTAʉ\$ED$$Uȋ]~KUȉBE܉EȋEEEE 8u*E $MȋU u[D$EЉD$$]sD$t$$ls9MZuEȉE9E܉EȋEED$EЉD$$]'sD$t$$suEȉED$EЉD$$]rD$t$$rG$pt[^_]ËV]XVT$T$$]&J'G{ EJB)9^Mf9s()D$DJD$DJUȉ$]IUfBUEF ]ډ]U܉UfMDYȉEE@=`fP11ҋ]ЉutC3f9ruMEЋA]CfEf+EfCMfDK Vgf11҉MLFf9rMAEEEOD$ED$$]quEȉED$EЉD$$]pD$t$$p1t[^_]Ã(]CfEf+EfCUfDSЍL U]ċP[]ȉڃP]ċD$Eă D$ $]GM܉MȋE@WD$@ D$$]mH D$D$$]oaMڋU܉UfUDJЋUZ}]ЋPUBfEf+EfBfDJVJP{FEċA EE]CZ]u f}YEXEU]E\XËE ]MEčH MML$M $EЉE M9ȋUs XEEXE(EU]PURPEEPvMDAȉE@EPUDB(EUED$ ED$D$b]ԍ' $轞EUjEX 4$MU '$m171MED$ ED$D$b]ԍ'$3MwMUEED$ ED$D$bEԍ'$MUECEMED$ ED$D$b]ԍ'$辝EËMjUEED$ ED$D$b]ԍ' $脝UE‰UЋ]ԍD$ 7D$D$q|($5UTUED$ ED$D$b]ԍ'$EċEUMEED$ ED$D$b]ԍ'$MEEED$ ED$D$b]ԍ'$苜EXLt&@t.&v0tfffffUWVS, ]ƉUM܋ED$T$4$ NjE  &ЉUUD$L$$]jEGfEf}UB ](9tD$T$$]jUBD$D$$] h`XMfG|$ED$4$]<M9$GfEf}BEGIf9trWu܉V1,[^_]ÉE؉MEr\$ D7\$D$b'$菚E؋M7UE:98uDE܉ufp뛋PUD$D$$]RiUuQ,[^_]D$D$$]%iUE܉ufp8UE:98to$D$T$$ftfGUE]rL$ D7L$D$b' $薙UED$T$$]|hsUWVS<, }EpFtD$D$$=hF w8t<Jut(F(x 7Gv\Ѓ<[^_]F(6ǀ~F,}P/G DGDE䋆fHD$|$$_gD$ED$$dDžVPvrED$ D7E܉D$D$b'E؉$G WEED$ M܉L$D$bU؉$裗WUԉEDGDE䋆}MԋED$ M܉L$D$bU؉$HMF,OG .GTU䋆f@D$|$$eUD$T$$ucDž@={rD$ D7D$D$b'${TEfEEM8FtM$(F FMF(~UfVF(D$D$ED$D$ E D$L$4$5!@EFЃ<[^_]ËE @ME$MU Q‹MEfEE#tQMVE$MƒMɋMtEVUfVD$D$$@dD$FD$$a9TfC V(VfxD$D$ $ctTD$|$$FaPXOfM2D$|$$bcwSfEEMfMMED$ED$$cU.V(ENfMfMM}fEfEMgωEOfMfMMMV(uNfMHU7Uf9U=ǀSxD$D$ $abD$|$$_PJfMWE5ED$ E܉D$D$bE؉$ܒE EfEV,UMWD$D$ $aD$GD$$=_WfU9uD$D$ $_aE܍rL$ D7L$D$b' $#EEUfUV,UcWD$D$ $`D$GD$$^Hwf9U9u*E܉UrL$ D7L$D$b' $cE܋U뫃fU@  G OfPDWTUD$|$$`D$UT$$]Dž@=vU䍃rD$ D7D$D$b'$蛐UMT9fQTP|D$D$$d_D$|$$\1҅^8@ tfUEfUME䍓rT$ D7T$D$b'$EsfUUVSß uFt$F FF(U VUfVF([^]ffUWVS4F }G,EЉrE؍P7ED$t$$[…?G@=fGEfEU܉GfEfft?fE<Ufy ED$E D$ $M50MUt(fuU܉B EftgU܉}B E苇20fHEDBtD$T$$A]B E1뭉UE؉D$ EԉD$D$b'$Uȃ4[^_]ËEMȃ4[^_]É  u8f}u RA=f9uu AM܅uEEfG MD$D$$ ZEtfEED$E D$<$.EMD$L$M܋$\EUGW E9uЋM?E؃9E܉MSD$t$$[EM9}GD$GD$M$2YƅM^GEFU=oMrD$ P7D$D$b'$(M:эwu  Ru fE^MD$T$$XEMr@= MfuED$E D$<$-EMD$L$M$}ZEUGW E9uЋMu7D$L$M܉$>ZE9uЋM EFD$FD$$WuFfEftfm10ufpEpxЉM荃rD$ P7D$D$b'$zMED$$kYMfEED$$LYfED$L$$&Yuf3EfE苇0ufpB‹Uutqt1D$L$$XD$t$$HV@U=UmM܍rD$ P7D$D$b'$EM܋U5D$L$$.Xω1mЃ}Dqt0f@D$L$$WD$t$$mU1u'rD$ P7D$D$b'$膈M}Fpfu܋10ufp5ff̀rS[ [ÌrS[ [Ḉ̀rS[ [̀rS[ä [ḹ̀rS[Ä [o 4UWVSEU Mwv9tt*<9t!Xr8t)[^_]1[^_]ÐUWSUtmg jBgBrn(8w68)|>)1ɃtfTȪLB@t@L>))t 19r\$4$)ߺ81tfff녪gf uhuW6ЃE1U U9rU6DfFf\7Ef렉ȪUWVSӉMp x$?tn@)։u|(9uzuރEEM41p x$ut2uˍP(T$$EEutM?Qt@lj\$<$G W$@9ue?Mt)ʍx(5tftM1H X$[^_]Ã}?$x(MQt@uƋSWSWS W SWSWSWSWS W S$W$S(W(S,W,S0W0S4W4S8W8S+B,hB0kAB4كB8y!~B<[zP1uUuFu-u%BHBLB@BD[_]êftэt&f볪UWVS" \uFPEVẺUЋFV EԉU؋FVEUFVTXF V$N(^,M]N0^4x|N8^<`d^PPl7}܃L}쉽HEĉUH]ux|]ċuȉ]u]u]ĉuȋ]ԋu؉]u]̋uЉ]ԉu؉ẺUЋE HE @GEU$T$\ Ɖ׋PSE EċUȉEUMċ]ȉEU11ډEUMċ]ȉEU11ڋ]3{Mыx|!ω}M!Ήuu}]!ىMu!MM]3M3]`dEUű}Љ11ڋM̋]Љ11ډ`dEԋU3E3UM̋]Љ!Ɖp!։tEԋU؉ƋM]!Ήh!ډlpt3h3l`dTXu}M]PE}܋M]TXx|`d9LE܉UEPpp)|>Q1tft:7~Qo1uDuQ1s^tft\$4$;ߺp1uwuh"t䪃ުn.f0uGu8rуM1ɉUU9rUif둪ofUWVS ÉT$ʋp@xD)L$|P9L$t$KD$-D$/|$41s@{Ds@{DsCHSLTT$T$T$CPD$$T$D$,CPD$B|$D$؃D$T$ |$ָL$F&tftT$D$D$$is@{Ds@{D9T$rCHSLꀋD$9wT$ ovjBL$D$1T$L$L$$C@SDC@SD9ƉыL$rCHSL逋D$9uT$t<Ѝ{Pt$tft1C@SDC@SDsCHSLe[^_]frЋt$ru^zfD$u[u@L$D$tCP{QBffl$L$L$BKUMt U E]UWVS} } Et.1T$T$MTuۺ1u)u/tft[^_]êtfUWSU؞B]B|6B *)bBp0BZYB9YB/B 1 B$g&3gB(XhB,JB0dB4 . B8OB<HGzP1uQuBu-u%BHBLB@BD[_]êftf뷪UMt U E"]UWVSW } Et.1T$T$_MTuۺ1u)u/tft[^_]êtfUUʋE ]fffffffUVS蟶$ EDžDž<|<s:z DE5N;=' ==D$D$D$D$ D$t$$&D$D$D$ 0D$T$4$6&tp0[^]=t*=uy늸۸ [^]ÍHúSu,t돃DuD$b$o&s̸ XNDd :0&iDžDžDž D$D$D$ 0D$D$$$ D$D$ 04$T$lz1vpDžDžDžD$D$D$ 0D$D$$C$yPD$D$D$ 0D$T$4$#0[^]ødj낺FsGdD$D$D$D$ D$t$'$"`&C0D$$0D$$h ~ m ^O@E3D$+*)(&%DžDžRDžDžm G6D$D$D$D$ D$t$E$ /D$D$D$D$ D$t$6$O D$D$D$D$ D$t$$ D$D$D$D$ D$t$$BB DžDž DžD$D$D$ 0D$D$$t0 ><S,BD$D$D$D$ D$t$u$1D$D$D$D$ D$t$]$Qup3``fED$D$EЉD$ D$D$<$u}u tTE E E dt dUWVS È 8<$Dsdt V6u贬g$Et+蜬\t V6u<$rE [^_]rTt V6uD$<$rE [^_]US$Y޵ L t$[]EEED$D$ED$ L D$D$E$tL uɠD$  BD$4$$)D$ |$t$$5Ƅ=DiYD$D$$wCƉ׉4Yg 8X9;-D$BD$d$诹D$D$$菹 {tD$D$$Ot X"U+ <[^_]Á}@ Džh1Dždd <$D$`D$D$ t$D$$ ~ 9WǸ։LRD$ D$`T$ $A9_Q((1ɋx9zz11ɋ)Y99vЋu@8RщT9PuQ(9P(\n$tD$D$$訵t`UR etD$dD$ $>tUt=6tftt\1Džp8H41`9t9F@FD$$Fu9;dt9FD$FD$$覴F D$ t$D$訳 tD$t$ $o9eu d3D$BD$d$ٳD$D$$@p8/tD$D$$蘲tPRBDž.D$BD$d4$ 89:y``9_$1}d$/C4$9Q8 t릃O4H4W0P0W8׉P8|tP ILP`9uM$B|tD$DD$$tP?I‹uB8`9r勅9s$4`9u닅$]'$gAgtOtD$D$ $误D$@$`Nj@8@P1f^$M@FU$-@=D$?,tLtD$D$ $m+_t΋${?UWVS谏5 l<$YE D$ ED$ED$E$MU EƉ<$Y[^_]UWVSJӜ lj(UuE]8,ϋM1Ƀ:uTtD8} Jtqu(M04Dž븋}|$\$D$ t$E D$$(P,U+F[^_]Åv }`ptu}`u܋(  $ ` 9tTt$_v߉ָ`tft`$`` 9uDž t 1U(1`; uR( Yt Z0$J@p9sˉ$btftr@ K0 97(J (Dž 0$ D$D$<4$(菪4$;HX 8t1؉ϋtft $`901$t $9Cuˉ0B$4BTG{r_lfdf91C$ Yu=a13Z0$ -1uufӋ(US 1ö EU BJ  D$T$$ []UVS ݉b utEىM)E}|$t$lj$UED$}|$4$UE<ML$|$E$UED$\$<$UED$\$E$UmED$|$E$UM܉]ZGu]E؋} 8MED$ED$ ED$E1uD$E$uMED$ED$ ED$1uD$E)ȉ$@ƋE]XQu]E)ًU)+U9xNuUT$ML$E$UUT$ED$E$UEEML$ED$4$Uut$ED$<$UuML$\$<$UML$\$}<$UU܉u 0sHuuʅ#ML$ED$E$U(EEED$|$E$UDu:}"MT/T$ }~}uC1([^_]É؁vD$|$$х~~)ËM IM)‹E PtEH,Pu>^E$]AE@ 9E\$ED$E@$EP,…EfH @HE1E‹]9sڋE@][}9Os9~‰ÉϋutftU]$]Uq)UU)UE @E)Ћ] CE[UJЃtUMEED$D$ }<$]e)EE9xsNMʋE9sBȋutftUE}8$])}UEHE9m1)yD$ED$E@$EP,…K)EMu9EPp)׋E 86p9rD$$]q]+SSUSCslj;C ЉϋutftE)P)UKUE$]1ɋU-[;Q]؋usStft]E)C=EE\D1$. *Í.D$ tI1Fu-)t'\$|$F$V,fN @[^_]ËFDu1[^_]ËF봋VU[^_].D$ |D$ =D$D$,0$ 2$螏X脪UWVSg u Ɖ׋@0$1F0PER59EED$$5F0Pt$T$8$2F0PuD$E$V5V0U4U쉂PF0ǀTu Xt$(1[^_]ǀX\D$$4F0NjF0TXtXU|ft Mp7u]1҉]UWVSRfs up78u [^_]ËF0$x0F0P3V09t'Pt($F0[^_]ÃT1݉U3UPV0ǂT1UVSe2s up7u[^]ËF0$/F0Tt$/[^]ǀP8$0F0U9er MU p7u]É]sUVSeÔr up7u[^]ËF0$8/F0U t XtTt/$/[^]D$\$2F0ǀP8$20F0UVS8odq 8E1EȉD$E$KU+u 8[^] fffffff̀rS[Ôq [UVScwq u tt$D$t,@E$[^]ÍD$ =D$D$9P0$UUWVS4cq D$(׉΋ED$M L$ UT$ML$9‰ȋL$ L$(GU0Et F"H!D$=!ED$ t$|$D$($v D$$!8!L$EuKD$(9t:D$$T$9ЉL$ 9D$D$=8tyEVnEW\$$D$9ÉL$ |}E9\$L$tD$$4[^_]i MUED$(D$$1D$$4[^_]ÍD$0E|$,E"D$D$$t$ D$$4[^_]ÅtsD$D$$t$먍e}D$ =D$D$K $HL$(=X}D$ =D$D$M $E"UWVS=aǾn EU uM] $\$M] -}}$}M] $\$M] e[^_]LUWVSEU ]\$ u}M] $\$](]M$M $\$M]u} L$ e[^_]UWVS~`n u} 9vtGFfuUT$|$$#xFP^T[^_]ff [^_]Í}D$ >D$D$Cx0$덍D$ >D$D$Ax0$x9vVD$ >D$D$Bx0$E'UWVSz_l u} 9vV Ft5ft\D$ D$D$$!Ѓt<V FfV fuUT$|$$O![^_]ø 8V F뱍}D$ >D$D$Vx0$R@D$ >D$D$Tx0$#9vD$ >D$D$Ux0$;UVS^ák u9vu`FftAȋED$ E UD$T$ $M!уN tFPVTfN [^]ù뻀fN [^]ÍD$ =D$D$jx0$4qD$ =D$D$ix0$=UVS;]j utO9vuFfu$![^]ÍD$ =D$D$|x0$붍D$ =D$D${x0$mff6̀rS[$j [US\j ED$E UD$T$ D$E$ []UWVSHB\i |$4D$ T$L$@u9D$@t "=D$ uƉFD$8ML$$\$4L u܉t$DL$8D$-+|D$0|$@0D$8 D$<D$@ \$0ۈL$D$8T$D$D$?$!$pD$@D$8D$<0UWe E-UMU ]%UEUUMU ] UVSLWd 81u1T$D$ 0D$D$t4$4$D$t$$VUVmd UB=w-B]Í@?]UV6d UB=wU B]Í4?UVc UB=w-B]Í,?UHVc UB=wU B]Í ?U Vc UB=w-B%]Í?qUUJc UB=wU B%]Í ?1UU c UB=w-B]Í?UZUb UB=wU B]Í>UUb UB=w-B]Í>UT^b UB=wU B]Í>GUT b UB=w-B]Í>UpTa UB=wU B]Í>U2Ta UB=w-B]Í>USta UB=wU B]Í>]US6a UB=w-B%]Í>$US` UB=wU B%]Í>UDS` UB=w-B ]Í>U S` UB=wU B ]Í>oURH` UB=w-B@]Í>8UR` UB=wU B@]Í>UZR_ UB=w-B%]Íx>U!R_ UB=wU B%]Íl>UQZ_ UB=w-B%]Í`>HUQ!_ UB=wU B%]ÍT>UhQ^ UB=w-B]ÍL>U4Q^ UB=wU B]Í@>UPr^ UB=w-B]Í8>eUP>^ UB=wU B]Í,>*UE ]UE ]Ð̀rS[] [D$t8t9@€tuuuuH+D$USO}] D$E $.t []ËU []ffffffVS\$ t$tCFtU8tOu9vCV9u !€t.&CFt8t)[^fffUE1]øUE tUt1ɀ81U ]11U ]ùUU ]UE t&Ut1Ҁ8‹E1]úE1]1ҋE1]UE1]UWVSU ]E8tOt(G1Ht*t-Gu߉E8E1[^_]Ät1ݻ뮉E1[^_]UWVSU MuEEtxtAE1}EXt?:tWEt uԋutE}8E 01[^_]Ät)Etփ뢾u1ЋuE뼋u1UU Et$Mt!tȉ U1]1U]UU E=wMt1]ËEU]UWVSU ]Etttw1=w%tQzt.t&=vۋEUU2[^_]1ɅtE1U2[^_]Åt1뷻1UWVSU }uEt^tgtc1tt+9t#t=vٹUU [^_]1ۅtE1U [^_]þ1Ʌu1UE Utw1U ]11U ]ùUU ]UE =vU1]UE@E@1]1UEt2Ut/u }wE UM 1]øU]1E ]UU E=wMt#Mt1]ËEU]ËE]UE1]UEu E1]ø-]UVS~JX utWtAMt'U tЋM 1҄‹E1[^]úE1[^]1ҋE1[^]ÍND$ FD$D$2$zUWVSIbW u }tKtGEt,EJҋE 1[^_]úE 1[^_]ÍӨT$ FT$D$2$UEt7Mt#U tЋM M1]ËE1]ËE1]UE =vU1]UWVSU }]tbtC1ɋ=w#tArt)t"=vݹUU [^_]11U [^_]Åt1ǻUWVSE ]tEt)uV1Jt%8tuE1[^_]ÄtǻUWVS(HÈU MEU8>}1th|$ D$t$E D$L$T$ $3D$D$4$5D$t$$ &=ljUED$ D$E D$E$4UWVS87GüT Eu}8E1>'T$ t$D$E D$D$|$ $3D$D$$u(u~5E+8[^_]:|$D$ D$D$4$D$t$$tFH󥋅D$ 7D$D$$N:=ǃ$m…1A<+w HuىD9u˃u뷃z럃b뇃Jl蜇UED$ D$E D$E$R]UVSwN#T t$ED$EȉD$4$UxE<[^]EӸ<[^].UVSw@ D̍ED$EȉD$4$x E<[^]ø<[^]USTCP :UT$$K[]+CP -f̀ffff7̀rS[ÄP [>̀rS[dP [USBHP D$0D$ ED$E D$E$[]USBP ED$ ED$E D$E$+[]ff.&&$D$4̀D$̀fffffffT̀rS[ÄO [PS[mO [USAJO p7u P8[]&[]f̀rS[O [USsAN $1[]UVSLAN l t t [^]É4$ ^u@1f1ø11@N 1øUWVS<@]N ` tsQa}1f1҉9r׃uFh E̋d Eb fE؋l EЋE D$D$(Ẻ$U<[^_]f…u"uB=fb t4t$wuыBd =uًBl ΋Bh Ëd t2b 9s"8u +x 9rth K`ƃ` Uȍ|3D$ HD$D$X3$)UȋB7 D$ HD$D$X3$ UWVS?L D$,]\$`u }|$<]\$08D$Ë$1  D$`D$HD$ D$(D$,PJD$D$<<%t2/D$(\$`|$H9s CD$`D$<D$<<%u΋D$ EtK-E1ۋEx@Eƃxf t<$U ÃXsEEuʉ؃[^_]Í;D$ pJD$D$:3$xfffffffH:JuUStu Zf9Xt 1[]1Zf9XuZ9XXJR9Pt ʋA9CuA9CuA 9C u1UWVSX)0î= ƉE8E1,Fu#E+X[^_]D$ D$ D$D$ t$E D$$uL$7D$D$t$ D$LD$-$FD$sD$4$3EDž?DžDžDžDžDžDžDžƅ:qUWVS E @<<EX E EEP1E E逃9Ѐzuȋ}38w؋xux uxuxt4x}}?9xuE@}9GuE@9GuE@ 9G u [^_]ËEp ~NE 8E1ɉ€xu]tڋ1wRt] ;St9u1 [^_]UWVS8d-: EME8‹E1Affy  D$D$ |$D$ $1)xu4~9rg4$,fV$,;u u;EuD$$胊dU+u8[^_]ø1oUWVS<.,ó9 EM uU8U1ҍx Pf9 9px(qff9t1f҉m4~94$N+fV$<+L$L$ D$t$$t}tmD$D$ |$D$ $Q']E+u0Ё<[^_]Ëqx(ljtmL$qUWVSQ}*8 h9q dqA8LƋE1D$<$-Gw ^P $Pu atZ-pXt$ D$D$h$:t$ h@D$D$<$Ww hx\f9w1~t bTtjDžL$L$$~ut Љ9x CPf@@Px Wf Nj@GGG1Džt<Ǎ L LL$LL(LL,Lzfz9t&ǹ BHHH fWDž\E<$3fLJWp ~p1fDŽBDŽ|:t&t:1t:qt:q|:y 9uf@@ODž@<Dž`DžH-XXW GlDžtlDxtЉ@<< DžP$t ЉoGah@p|l@\ t4F<<SDžtGD$ pt$|D$$i9r0Ga0<$-1ttl9G eHH9G1$0\m`<Dž*hL$L$dL$ L$L$4$ЃBw<$90fLU+eY[^_]aËlF<.Dž1l@<cDžPf7H担tt ƍx$D$ t$t$$T$T$T$T$T$T$ $-XTdDžD$L$D$ D$|$$P |7f90ua tVXt$ D$D$Q$~t$ ȋ9~D$|$$Dž`x$D$D$D$D$D$D$ $/XC)ʍ‹fDž@D$D$$-*8" 0Gw0<$,u&L$$vOD$ |$|pD$4$ N@u a QTt$ D$D$uD$ D$D$$Ct@Gk <$+Dž`qD$t$D$ pD$|T$$?p9wD$$<$#+ua '-PXT$ D$D$a$FT$ D$ D$D$D$ t$PD$$yUt$ tD$3D$-X$,$pk8d0@ M0$*tߋjD$D$$atG-XD$ D$D$$tDžDžPG-BXD$ D$ D$1$胥Dž\Dž`D$t$$vGt0GR$#D$ >Dǃ<$a(Dž@(Dž`$a#D$ GCD$D$-$GGGG+t .n0G0b4R u6d@t* <$R'Dž\Dž`Dž`N`!!4 t5-BXD$ 9~D$dD$<$G\<$&tDž*L$t$dL$ hNL$L$ $Ѓ.&<$&`VWd@WO-BXD$ D$D$$G`D$=D$-BX$=$u D$ D$D$-$Ji\OHuttЉDD@<.<mDžDžpxW<$$D$D$PD@$x\vD$DD$$\D$ $D$D$4$&pD$|L$4$D$D$$‹p9DžfDžd)ff҉T$t$$%@ 0G0<$"@6xk<$"Džd$d9Gf\dfx‰)fftg҉T$|$$̉#@ 0G$D$ rx|df9Gu a &-pXt$ D$D$$躝t$ 9~ȉD$dD$<$:-PXT$ D$D$$VT$ 9~D$dD$<$$D$ D$D$-$Tff -$5 \L=$0D$ D$D$-$躳D$$j<$rdHf+f)fffv҉T$t$$DžT$t$$5xDDu<$Y?-XD$ D$D$$Dž@<@8MDž-XT$ D$"D$ 4$葚T$ 9~ȉD$dD$<$ + -XD$ D$D$$MDž]WS@0G$jD$ Y+t .A40G]$D$ wGG<$Dž@(@t$D $J<$Rv80@1<$xD$ wD$D$-$Q<$f9D$ 뿋D$ϩD$-BX$软ff̀rS[D [UEU UP]UEU MHUP]UWVMu}u }E E=ɚ;~ -ʚ;1yA^_]UVSUEu M ]+M]9|) ZB[^])ʚ; ZB[^]UEU +EU uE+Ex]ø]É]UVS 6 uED$$vquEEFEF [^]D$E$C=x(E EUVN [^]FF [^]UVS Ï uED$$puEEFEF [^]D$E$KUWVS,R }U ME8E1GED$ED$ L$T$`4$@L$T$ D$D$$踣=E D$D$ED$ ED$T$<$fU+,[^_]Åx$=wttH|.uT$L$ hD$D$$UD$T$`4$(qD$<$y9IUWVS( E E8‹EE@ I\<$&.&T$$xE-D$ D$D$4$0 DA@tD$4$cuDJ@utSFNu tDJ@tEpt$|$<$V7$z$h1U+u ([^_]GUWVSLl }u E8E1D$<$]11Ҁ.փu9rMd9G GDGDDžDž\x.uED$D$ED$ED$ D$D$<$zU+L[^_]DžD$ D$D$<$dt9^G#GDGD}1DžED$D$ED$ED$ D$D$<$+GGDGD1DžDžDžDž.UT$T$UT$ML$ D$D$<$t~8=^G1҃‹Otth uAED$D$ED$ED$ D$D$<$RtD$<$9ED$D$ED$ED$ D$D$<$PG tD$<$낀xbV1@<t 1ut$t$ut$ ut$D$<$moGDGDDž0ED$D$ED$ED$ D$D$<$)Dž;D$<$eDžDžDžBfffUWVSl& u} U(Ft}}, ~wBBU(4$ fF@fU(fN  Jf fBUEt[l[^_]ËE$EE$ML$D$ ED$-D$4$ U($},~r EEML$D$ E,D$t$E$6jƉt$E$_EEFD$ $GU(fBMЉU(E,) }|$}|$ D$t$E$Ɖt$$ FD$E$FD$$FD$$ U(fB )Ѕ9}E*T$ JT$D$4$ EHE H E, 9/B B U(D$E$U(BD$E$U(BD$$U(BD$E $E U(t5BEE ϋus3tftuu )fB fBl[^_]ÃuuBzE fUWVS ? U }E@4E)Ѓ FD$$)FD$E=h$VfFE@ uN1T$$F D$$ G fffG )~ [^_]ø둨u+9u1 [^_]ÍD$赺U *UR$蜺U뿸UWVS%ê M uU E@}ω}EE‰EPE)96UB9E'9}}|$4$GD$u4$W׋u$sxuXuQ}׉+u9ED$4$N+E~[^_]äft.t&9}u1[^_]uvkUo$MUM 9}y4D$ xJD$D$=4$jJ^MAyEpfhfffUWVS(a ljUM܋EGlE8u䍃EE썃E< t< tD$ED$4$;D$ED$4$;D$ ED$4$;/D$̫D$4$;Gɫ$̷u< tt < u>:([^_]ÍF$~~d ʈdGtD$$Q닍F$5~GjD$$SD$ ҫD$4$:tD$ 1D$4${:uEO F $~GGD$$蛔D$D$4$:tjD$߫D$4$9uXO@E܉D$ED$5$2OWL$T$4$yO >D$D$4$9t*D$ D$4$f9ugOD$D$4$09u O@D$3D$4$9u OD$D$4$8uZUm D$4$ƒ?v?T$U؉t$E$~EUƄD$D$4$d8uZE D$4$ƒ?v?T$U؉t$E($C~EUƄ(D$ D$4$7 D$D$4$7u OWD$(D$4$75g)UVST $@Xt}9|xEEE%EEEEJD$D$D$ D$ED$t$=}tT[^]UVSg Et4D$E$#EEFEF8fF [^]Íp UWVSx  8EEtbUD$E$2#Ef3EfF}<$7D$t$<$虨|$4$FUM+ ux[^_]Íp 5UWVSo }x$萷LJft/1t$_DŽ9Ӄ[^_]UWVSo u4$`t&tuOxu:<$džt$džf[^_]É$迶뼋|E69Eut$蜶UV Et]ÍC]U, Et(]Í]UWVSu] }4$sfdž1҅~1u{t뀃9uuV [^_]ËMt31sqsqs q M31sqsqs q 뀃9tuUWVSQ uD8 E1D$4$YF u uD@@$dD4$^4$fF@@1ƅfDž5B dLdǂ`ǂǂǂǂfǂD$$ WWPWPWP ǀip6.ǀarpaƀǀ(ip6.ǀ,intDžDdD$t$<$ $w`D$D$4$xƇ_WHwDG` \Dž01'< t/t 201Ƀt&9n< [< uuDž(D$$贏8Dž4DžHT,8D$ D$D$H$Pj<;t<#tH8domaH8searH8nameH8sortH8optigxionsZ< t< G`D+<< ~< ufxinM< t< L( t t Dw`D$D$4$uƇ_9D$4$zctDž0ft DF 4DdLʃ Јd8$PD$D$ $苰x8$g,D$x$هDt6hlp Dx`0DpHH`HD@H@`t_<.ǃu~DD$. $sDFH.D$.$sDqPALD@X$t‹DgDH U+![^_]Áxservfxer< t< 9< t< t7D$4$< X11rDž\DžTD$5̏D$ D$ D$<$HPD$ ,D$|$4$uPB=kDt/RωփtftPB@D<ЉT$L@$oLt׋$ˆL,D$ $L)&D$M7D$4$, D$.4$(oD$D`$8}DǀtǀxDž0Dž(<5$胥D@Dt$D~DQD$4$Su덃F$D< tt< uDž0<4,LTDD|$@$n<NFVe9xDw@ut;u㈕$<,t$$3<$t]TDLD 44 $4,LTDDDLD<ȅy_%=tdwL$,D$ $rL{;$1!$tDž0pvLusL@DDu|uc'j&D$D$:1ɉfLu LVfqUD$E$#]UWVSXs }u hl3 3 t;D$<$t  F FX[^_]Ë 9puttl|Eq'9EttIJD$D$ED$ D$D$t$OkBt  F F1X[^_]UWVSU E@ E~tE~mEX1&<1|1t_Bꀃ9E~E9Et=}ù{u֋ KJKJK J uv uꀃ9EE[^_]Ë OJOJO J uv uf̀rS[Ô [UWVSds TD$$]@$DžDžDžDžDžx@ N L$T$ VT$D$$y\T$$r@ 9@ωփsUtfth@ lj)#Pd덋ptŋ t|$$ruf떋P04$o@9‹(tft‰)@0DžuY tftlj)@4#tF4$貍@9r1‹rf$r@ $$ś1d[^_]‹);Wh@ 1ffi$p00P@~~ <9V) 9kVʉ)ȉQ1ҋ?tftH<@ lj)99h΃r뀍D$ JD$D$d5$}x@ $oo4$赊@9>‹ytft‰)‰DžHtftR<lj)944$׉@9`‹yUff^f# PD$umuTk@ $f+ f넋$(m@ 6UVS; @7t$`s[^]ÍD$$y[^]UVSg @7t$l[^]U4 U]UVSà ut$r[^]ÍD$$2y[^]UVST ut$ l[^]UWVS" u}t5W¸t[^_]ËF [^_]ÍD$ JD$D$|d5$UWVSã }uENH NHD$$,xƅu!yH L$UT$@$tEG D$GD$ GD$D$4$ u4$jG [^_]É4$j[^_]ËG [^_]ÍD$ JD$D$d5$֎UWVS Ð EC88 -:)lj}싓 u2E D$ $  [^_]ÍXt$E$ht$ $ht{ t1= ;txED$D$KhuًED$qD$ED$ SD$5D$$ [^_]Í5D$ED$ SD$5D$$ [^_]ÍdD$ 0KD$D$5$EED$SUWVS h ''w} )ƉT$U$Mtn  UT$ $&tG  D 1 [^_]ÿ'y qUWVS( LJ LJ LJ  11ҍREE5 )Ћ  ڍAw JD>ЉD>]T>ӉT>,SMHL>@CD> C kQ QE֋ xzt =w ;LKEt =w ;LK tH~k LJ yM !؉ MeM썇/v$  MLJ  M싗 1ɍLK]MEUtwM<9ErMtu艷 Ѓ([^_]LJ 5 LJ D>ED>ЉD>]]Ӊ\>,SP R;D> rU7UsD>HL>PD>HL> HLR7Ë ; e NH P H HLJ LR MULJ D>UMD>ЉD>]T>,SP]ف9LK NLJ 롋 LJ LJ D>ЉD>]T>,SoMU-E8E䍇 $UMD$1ۀ} ËE)؉D$ SD$5D$$UMLJ D>ELJ D>ELJ D>ELJ D>EqMUD>@6UM^D>E싟 ]X] É %LJ  N f gUUxz Mt ; r tX N H P H HLR Ћ]!LJ $$ffUWVS0 EЋ u䋸 }9EWuԍ V Tu썰Tu؍Vu̍VEE]]Ef t1P}艗 P  5R}苗 D$ $ 돋 uЋ Eԋu؋  À8 u }胇9u}U - E苐 -X U苂 }]苃 D$ D$ D$ $RN  >E苀 P[^_]ø]苃 $$E+t…MtO1E-}-E7LEDXtE7<$]sƒ9r̉E8R1KU} MԈ }ԋ EU}ԉ+ E Ћ U }Uċ:O, OŰU苂 U9E2\9ËU)Ӊ]W(EUȉ XND]荃D$$!_E艘 G,+UU]ȋU̍<Q9uUċ:,^MO uquF_ u؉G D$ $]Gt/U艂 Uċ:MO u#O)ȉƋ_uGE荀61uȉMȁ vE W18 M苹 MċKщˋMD9UUċ]苃 $SUuUȋ]苃 $cUE苸 } M< ЋAE̅+}苇 $  <EU‰ŰY9Q MỦ @D@Eȉ EăU2ŰEȋUЉEu艆 EȋU}̋UUu艾 fEЋ }ԋUM‰T$Uȉ$]{MAYۋUBA ,Eǀ GEU<A,E苀 E]~C]苃 $Hb]}8B} $}苇 D$ EȉD$D$ UP$/] tU苚 <AEE苐 U }< Mč[^]ݺf ̺U 軺D 誺3 虺" U腺 U]Um U ]UU U ]@ U, U ]UWVSǗ u"$ uމ4$`LJ LJLJ LJ LJ LJ LJ LJ LJ 1[^_]USd E$V[]USA E D$E$\[]USÜ E$蒼[]øUSs D$ED$D$ SD$7D$$[]UVS蚸 ut,D$4$8Sff D$4$LS[^]Í.D$ $XD$D$57$pfffUVS "ç EpFtD$D$$?F!u  [^] vUWVS蹷> uM.D$ ED$E D$E$5Te>EDžXF\Dž`DždFhDžlDžpF tED$XD$ D$D$F$nDžH V€ʀ UTPtD$ D$D$T$YыU !ȃP{vltat0<$T|T$zDt01[^_]À Vt t0<${  PxD$T$QP^E E DžTED$D$ D$D$$`lDžt HƁ ZLsAs0E/s0 Vm Gj GL:G 0a G - G0_ Gj GD$D$L$9PLPP LЃHtfD$PD$L$;H  D$ $PP D$돉Lq8PLen  P2D$T$CP@ ƒ@ uc bbb fffUWVS1ö }EpFtD$D$$:F 0X  D$4$u_  t$ur  T$U4$Džu=U9B0E pp[^_]1UD$D$4$Mt̀N(UV$ED$E D$ T$L$M4$ !@MukF[^_]ËX[^_]F(V$tߋ9F(F$PD$D$$ 9[^_]UWVS5Ƕ EpFtD$D$$8FEE 9s  uy\$4$…u\D$\$4$ ED$D$ D$L$M4$C !@MuFЃ[^_]úЃ[^_]ÉED$D$$7UЃ[^_]ÉLnUWVS$Ä }9EUEEEE;E MmG$Au݋M…tUL$D$<$AUUD$ ED$}|$4$8u7}UcE;E sQ $[^_]Ɉ뤸$[^_]ÉT$$t㉇1UWVS(迮D uE䋆EMM܉;E E苷EHMU$@ƃUtY9Euȋ})lj}苊U|$$OU}낉֋E})lj}unE;E s\ ([^_]É׋Eu)ƉuD$ E܉D$ED$$6u@EE9E 1([^_]D$ ED$ED$4$6l([^_]UWVS(1 EU9}] E苊;M 9EE܋E9t<)t29ut&M\$U\$$]>MUD$ E܉D$L$M$U]5M9M Ut%E9s.E9hw1([^_]Á ([^_]É\$<$4DžUt([^_]UWVS(«K EE] ;M sf]]9suE19r 9t[:u)ÈU]D$ E܉D$L$ME$]4uEFM9M Uu]1([^_]É)맋E ([^_]ø([^_]UWVSk EU EpLB< D ?ZU )ىL$D$$] f}U fz|rrE Xft)ۍLZu0f9sfuf09uut^JLB)wmft" F]Ff9sf9ufjE1[^_]ÉMU GD$E$]uU M̉EU ]썋L$ dXL$D$7 $+bEU UEU ]썋L$ dXL$D$7 $aEU U E]썋rL$ XXL$D$b 8 $aU EUWVSިc D$T$$tb@D$T$U4$DžUu D$T$$H0[^_]D$T$$(0[^_]ÿUWVS G̵ }EpFtD$D$$/Ftt88f [^_]ËE t9sF [^_]F(t‹tF$Pun$ 1 [^_]Ãtރ [^_]UWVSDv }wFtD$D$$/F}   8CuD$4$D$ D$D$$NJ F$EEEЉE܋G!D$ MԉM̉L$M܉MȉL$<$Ѕt"ND$ ẺD$EȉD$<$Wu.E؉D$EԉD$$h;EtD[^_]ËMN$tD$ D$D$$}I!уtD$T$$7u 1D[^_]ÍUED$ MԉM̉L$M܉MȉL$<$Ѕ_EE$D$ ẺD$EȉD$<$W3EԉEE؉ED$EĉD$$g‹E؃9tD$<$+jD[^_]UWVS Ð u~GtD$D$$,GD$4$G uUEu@t*$8u*4$jtME[^_]Ë$0itE͋D$$E EUWVS$é uM Ut'}8BEtbQLPD!@tHx9D$BUD$ $U]C1[^_]Ë]CD$$荣M Udž9D$D$ ED$T$4$u>]uU|$ $tUx?UWVS 謢5 EE,E}1EED$ED$$]'ƅ@ @=fU1 9M rTVÃf;EuUMUfY]][]]}tH}t8MNDF,D$t$$]u)E!D$DFD$ljU]荃rD$ pXD$D$b 8$ZU ]{_E}E9}twu})D$D$$](9utAFD$FD$$]<&tVTP‹}u뙋u]^}8 [^_]ËEpE )}fG w [^_]fffffffUWVS$q uƉЉfMy} ~ϋX9U)ω\$D$M$]bEfC 1U~U 93;DD"=. fLD$ E D$ƉD$$]]ËE XKMǍDUfTTQf[MfTftEff9؃0[^_]Ã9u}ԋGDC$GDM_=ƋC 9Ex}؍Oȅy¸} E PS$u}+D@=D$1]܍8D$$VOR1ۉ؃0[^_]ËC #C$yP}ffw$C4=nE1҉S4UEE܍d\$ X\$D$88$*LE XUE_E+w@Euus DDoDuED$ D$} D$$txDOHDVtRE눃E}i}{ HHhD1%UWVS4膒 E} wFf~ˉM Ef8LM fMMEHE@D9EmD$ |$EDFD$E$]@ZDžpft6f~wuftLÉEf>fEEԉEf}eMfyvDTQ9.ED$E$E@EMU EHfEEf;E}f]fD M)lj}]U)؉EE|$L$E$]@9E U5]f{vDTS9szED$E$E@EMUEEHfEEf;9]tED$E$1MUEUԋMf9MsFfED$E D$uF D$t$ ED$ED$E$]ruOEEtE@EEEt5@EEESpEE@ =ufufČ[^_]fEEEE]D$ XD$D$88$ AMt !EEfEE:M]D$ XD$D$S88$@MgUWVS$ʇO Ɖ׉MBEF =uMQ)ЉEW UfyMȉE苆t$ED$$舆Eu>E9G ED$E@GD$E$gE$[^_]dž(Efuhdž $D$ |$UDBD$4$O…t EME$EPEwD$ |$UDBD$4$N tʋ@f8 $dž mDUWVS,%ê uE xEFEEEE@ETGփ>VMM ‹u9sfU܋u9M ELf+M܉ΉT$U؋ED$$UU)UEftfDuf)tGfLGM yITGփVuJҋu9sM DG)fET$U܋UT$7$1U)UUPMf WfЍL)΁M wdftGuftGfWL$E$E*DEfEfDU܍D$ YD$D$y8$<M UaM D$ YD$D$8$<M VuM DGƃ=Fu!u䍳YuDG)fET$UUT$7$U)UUPMf WfЍL)΁ftGMfLGWMfE HDGƃ=FUt[u9s‰9E8Eu;p)E9pEfDN,[^_]1,[^_]fE D$E$E tˋxLUED$ E܉D$D$8$:UED$ E܉D$D$8$:D$ YD$D$8$:ҭD$ YD$D$e8$Y:E@ED$ YD$D$k8$!:D$ YD$D$b8$9FE)UWVS EE @u E1Oft{DPND$ t$D$E$]Iƅt|$E$FfUH]uYfwfuf|Pu E]M IM1M AKEfE@ =\)ځɋ]fTKMfDQE Ht$E$]t9t|$E$Eh81[^_]DPfAfAF^[^_]ÍD)wMfTAhU]썃D$ XD$D$8$8E@ ] UfTK=UWVS3ø U EzMq uf+4GMM9U t$ED$DM$u)uD$ U T$MDD$E$F…t|xEp uf+w;udLf|Go‹E9u-t$ED$WU$bUu Ѓ[^_]úЃ[^_]úЃ[^_]úUWVS} Eu} 'D$ D$DJD$4$] FtDPfzuft,ˍ< fD$ t$MDD$<$D aLJ(@f8u$LJ 1;D$ t$DHD$<$pD…@ fEB@fE1fEE$#MAE9F ED$EFD$$M1U)fUN fMD$ t$MDD$<$C…ZM_LJ $LJ(14r9UWVS('{ì E։Mz@ =uW)ЉEN MMȉEGfEt$V~ED$$yUE D$ED$ D$t$$E9F ED$GFD$}E$E([^_]D$ t$DGD$E$\B…t#M L$M $MEEvE8UVSu]ED$E$1ɋU Ct1[^]øUWVS(y uD$E$1ɉE/D$ED$E$/EED$E$M fA fJE @EEE@E;EEHppfEHuj/VZYtp %t0MPVZYMu}] EEAe[^_]Vh "hU "h-+AUWVS]u 6_h$"VSj tfu p7-ۋ=-)u=-u h$"ŕZt- -$"hj5-1- @u5-h$"j3hXu4'h$"jMUW6ZYMtUBk %u6h$"j~VKSW%P UWVS] 3h1!#jth1!#Sui@t h("-DP-Zu-Kw$1--%5-%jjP0- y 5--- =0 -v-u h("j}d-u#h-d-("t-%t-%-%H%hPR/h- yTt-P-%H%hP5d-ңh- `- y5d-hV$j<}@-@--u-X-u-H-uj@-D--9ӡ--sE-táX-0@-t--@-D-- -twp- l-t_-%h=`u; p- X-\-l-X-%l-RP5h-t-P -t h("jh -Ph۫j%hj%1=-=-=--hX0 -P0 -V5--- t -- --9щss -- u15-5-5--P$ u15-5-Z- rPPhV$GY[-u5j5-5-5--P  t5-hV$XZ-------K-]-]-] --9Uu/9Eu*--ڣ----6esEUӣ-- -----t1--H-L-j1=-=-XsE--EUMt- -EU-uRR ----=u=u=ۣu-t=H- X-9ȋL-\-s")1=D-X-\-H-L-L- H-t j[Z-5- tH X-1=@-X-\-H-L- @- D-)։-5- ut-=h-ujPY@u$8th("5h-t-PZ@u h #j,xjhUWVSX ] 3Jh1!#jn h,"Suc G-$,%-1 ----1 --@-z- -1=-Y-J15 --3-$-1ɉ -------=-th?,"= p7tu hd,"j\v1nuou-j,P[YZFt@jVc-^Zu ht,"W8pj,W'ZYt x>1>A!Ph,"h-Ij5--=-t t9h,"Buu/ -t'h-"&=-thG-"--jWNT-ZYu hn-"y;O-=-t11X=-uمtՋ=-jWSY[^t' 9=-tЃ=-t ]tlj\ti ȉ=-\t 1Z01C P4jZP0P蹓t 1B"-~h u)Va_Zu h-"js15-DRP藒ZYyƅu(3%=`uƅu3i- PVPY_=-i =-t9PVYZt=-Vh-" }=-t%" r=-ugh$3h-" Qu =-u7h$V3h-" G=-=-u3hV$xXZ=-t4011Dž8hhP'%P -5-8i- 192t;t SY PZ9}D1PL@DXTHL`\PThdX\lp`dtxhl|ptx| t =-u1&--=-t50(";-si C1e[^_]USEEE EE0][1҃vU|r҉-UEh1"RP:[ tvpt.Et?SuF-Ƀstxu0-볡 p7X---Ph%h- jE-EE)ЉEEt9E8-u/-EH~-)EEEHEjp!1ۉ$ZuYhxjXZjjY[hjXZh-Yt1h-h1" dXZh1"HYh?j[X/ -Et^E8tTE04YtEEj0YZyjdZ,E8!tYEh0h-{ @Et9h-h1"^cYXE8tjZuh1"HXx*X-tPhV$Y[h8-Xy"=-th@-hI#h- uY=-=-h-h1"bZYh1"G1ۉ$gZ&f%-1-냋-| thr/"XGXf%-^1-O$x(5xd-PRR tt 1j1ɉ -h-h1"a[Xh1"F1$d=-ujpjZuh@-5\-h2"h-h@-hI#h- h-h1"aY[jAZn=-ujrh@-5\-h2"h-nUWVSXu} 7>hǢ"FYZu2" fu p7h2"WVV utt -)Nv(WE8}W ZE1`% tAB9EsEUPQMWҜ UuMt6QWh2"j)kփ빅u Wh2"AE@t1j URPtE ;F|E8tEph2"jjE1~PSYXF=mw2=m=m@w=m@m=m8@=mF dUuFfEERhmW UWEffEERhm+fEEERhmW 1!EPhm8@W x E@%6Shk"jif9tfuPh2"EPsh3"KU-"UK U83"U 4Uuuuuuh<3"E$uuuuuh\3")uhz3" uh3" XZQURPW x%uSh3" ,URPW yShV$jiPh3"jj2UWVShu E1E1ۃ}~F8-tEh4"_th4"PbZYu -h4"~_th4"P8ZYu h4"kXjh4"h4"覙wEP8;uh5"d0E_t<1ɉMMMMMMJh 5"w p7PuZYh+5"jgEhQ5"WE)PRE @}w}c}6to)}4E뷋Ed$%}8tEKwn뎡 p7Eh'5"5 p7VEXZj p7E]EQEE--}uC-EuS-4>tj@uY[t8P}t Uxu)NjMMU9rxtEE xt}t1ۋtPZ\tSOXIEt'U)RPS sSWÃ~t C}u"h'5"h$EZYu ha5""}uEEuh-WuuEpEP\uW yj=-y h|5"}tLjuVjhS y h5"kXjVjh5-y h5"kXh'5"vjuVjpS账jVjw5-衦,uu1ɉM̉MЉMԉM_18%H>v  DGu΍EPEPj =-t}t.D1}tE܈jEP48%/ GuݩEy hp"jodVh~f5-Vh~fSSMUEQ}u j uXZjjUE 0UjQXmUVSEU J -uc1E1ۋ4H%Vh*G#uU@-H@-Y^yh8-j XZ8-P8- Cu 1e[^]ÍL$qUWVSQxq1$.$.$.$.$.$.$.$.$.$.DžDžDž1|h ]"V N @I&/0$`%S'$%1!-!-!-s!-d$.jP5 p7 :uy5 p7hw\"!-$. $.$.$.$.$.$.14݄%4݀%h\"HC u$.w$.l$. p7j/SAY_Džu ;C3@;tGt@:t%t@tj/[ZÅt8@tYt@t3te@tij/IZYDžt+{tQt@tUt/{t@t)tG|h\"O$.Ph$.h$.h$.h\"5 p7+u p7<t h\"jJ_=$.u$.fPh%.Ph%.h\"5 p7ĕ~! p7<u%.%.9sh\"뉅 %. p7j/SY_t6PS}_Zu# p7%=@u !- p7o.$.!-!- p7$.}5 p7'!-[=~ PZPh]"j^-)ѡ$.=$.t $. $. $. $.tWN=$.t t$h@]"4t=$.t=$.uhr]"=$.t=!-uh]"I$.u !-iDžtDžxjjVjjtSr@t,FYtjjVPjSL@t=!-!-=$.u/RP{_Zu%=u $.$. $. $.1 $.t1=$.!-=$.uRjhh-PRr/!-y'3 8uh-h]"'.wދN1ۉ d).h).F 1ڣl).p).&.5x).11ht).@Ph`). f Nt). `).Éd).h).@u"hZ"X|).1ɉ t).[Ѓ<tπtʊt ȃ<uuutW119l).p).7t).t19ƃƉDžDžf=&.&.&.t P1#DžDžPŃw 1҃.1҉'.t. Ҁ&.t"Hu'.1҉sBu t).`).19}Et3t*pu!K1ӉBDžDž$.=$.t u$!-9t).Ph^"$. $.tO$.5!-=$.|1RP1RP|h^"\Zt=..;8u h_"EX.Ƌ@V=!-RPSQPvvv Wh!_"G [j X%.1jhjjjщ¸c_"%.%.1jhjjjщ¸}_"%.(%.1jj?jjjщ¸_"%.9h_"qO=!-Ijjjjj1ɉJ=!-$tj !-_h(.ƀ(.$-#h(.ZY(.t(.1tFh(.h_"&[^h_"h_"h-jdh(.6hR"ۋuw1ۉ$. $.u!-=$.=$.!-uvÃ=$.uMh#`"jYtpjhO`"gXZؙjjjjjщڸ{`"h_"0tt Sh`"%^_1&.@u &.$. $. $.1=$..Džt~ Džh`"&.Y=tk jhjjjщ¸`"ƒti¶ f&.jt).DP:XZh`"Fjh$a"&. 11'.tJ?tEWh2"'.1ҋΉT 9u9u @u&.1;=t). `).؀tet\Ph2"-+ `).1Ӌ Ɖ\ 9u9uGtDžDž19~JCWShDa"މD 9u9uG뮋y1RPjjjʉٸUa"TƉVa=f=&.?&.h%tk%u ù19rGD8&.G&.@%.11ۀt,&.t#u;u u@ $ut&.u돋5t).`).19}{.tK;tFȉ C219u9t&.A뢡$. $. $. $.=$.uYhia"^=$.tl$.  $.t ha"[h b"gYtM`$.c$.Y2`$.M~ hEb"Z$.4~ hdb"hXj񋅀Ɖ1ƃu h^"ϡ|'.11;|'.ÍPPZYx+=w;)uv%.=%.5%.jStPLU 1eY[^_]aUWVS}] 1ɉ1Dž1hr"SWS3 rfq1stwz1҉j P5 p7J p7 8t :tPh|r"&78"[N5 p7hr"jFGDž-Dž-)OtjhP6P2Ãy2 h).hedAP y hr"= *.9 @f *.1ɋ>Xu uXhr"jh).h8-k{  tȸor"u1!#Phr" ZYDžf*.h).~f*.h).-k~PSyhs";j7u"PhwdS h$s"XS1e[^_]US] 3SuUS] 3Su~US] 3SuNUWVS}1ɉ@j/E 0[^d+.t@E d+.7~ Ph"60XZ1 $11<8,(Dž4h["u W 0à A6$%Dž,jhjjh p7y"/8jhjjj p7с"//.jhjjj p7܁"//./.Ajhjjj p7t%d/ $jhjjj p7"6//.`jhjjj p7"$/ƃt @5 p7h".Y[ p7/.jhjjh p7#$./.jhjjh p7$./.jhjjh p7"a./.jjjcjj p7$$=.!-jjjjjj p7"./.I@Phjjj p7$-/. jjjjj p7$"-4 p71҉j PSL< 8u 8t Sh8"h~"< )Sh8"hB"jADž8Dž(-)Ov.< t5<@t<t#Yu Dž2"h̦"u>Zu`."h@.W:-Pi^t.R$A[u jj'XG1ɉHwvtj9uPhÜ"X2Wd$Zp- HWPF_Xu-FFDžBUt Y@Cu担)s @.h"WV P5vB$`%@.j P5 p70@. :t5 p7h"h"Y5 p7f.Zu5 p7h"@.Q@.B p721ۉ!-%@.tRPh<"ji%@.1ɉ !-@.hV"5 p7`@.[Z5 p7he"j=%j P5 p7.!- :t5 p7hs"j$th"A@.^@.O@.@-@.u hȝ"j$=@.uj.f" ,;..| (5. .9Ȼ@%} VG9ƉS}M)Mt1jjs sM9ȃM} N&uXS;&t,;C|*(s^C t"=.u!!>"=.t"=p.t"h`.5`.Sh"j7jDh"=.th"j'=.t3hhh"ƃ xjh"PbVSh"jQh..h""2j)h.j hD" [=.u=."" ""EE=d.t Ed"E=l.t g"=h.t j"=x.t w"=|.t #=p.t #@6$ T.PtPH1ɉ hw"jEPS^ 0Shm"j0Sh"$ jjXZj%UWVS@u} E@h"WV7 tTHth wT$&ЁȀπÀ5 p7~+-X뫡 p7|+-1ɉM똋-)Ht,&4jVhՂ"H tVhՂ"hT%j h..jVXZy VhV$jL ]1uȉuԉufE5+-]SSjWDyh"^jhyt W迨 y8th"95|+-hCt W薨 yh"}tjj#Y[t h"j1҉UUUUčEPXUWVS8]u 1E6谬Xh?"VS x`At$Mԉ.ăa$&.܉.؉.+-. #덡 p7.!Љ.v̉.kȉ.`ĉ.U.J-)Ӄ=.t=ȉ.t&. ܉.t&=̉.utu@=.u7܉.+=ԉ.u =؉.t#u=.u܉. +-8-U1..hXUu hM"j=܉.tEPWjj11ҍE?1.tjh&"P胤[Xu5.hV$j1ɉ .jjh.jVÃt;tMvLSoZV+X"4~FMELK1=.e[^_]UWVSE p$.EX1=.h"JPZYu .'h "P衲ZYu .j轝@.X.KfM@h/ ޠK m5$.h "PBu h._"=h.tQ #P_tP^DX~5+u!zt~Khy%WZYt W]CuTCt XC.h"/._t8u%h".PSZYt .#h".P.Y_t ."1=.tjh"_Z~PvjK =@.u&jDPYujj=h.t@. .ujh"UXZGjbj^_=.uh`#5S-蜰Y[uZ ~jh"Uj>]5.I薊Ztj"]肈,.0.Bu@t.4.6u΃=8.t$H~ 18.=.u .=.~jh#"9STj DO jOkij\UWVS]u 62 ,.5C(.{ 4.~0.h'#P| u.VS[^~CjY1uhb(#j9~!vu0P.h(#VS u%/~k |Љ=.vhv(#5XZš-)Kutm-DPu^S(_=vhh(#hSh. ;tC0..5.h(#j ]S)hj}hjqhjehjY S藩^u h&#j>@uh&#jh8-h(#% u W-$.谽h"薴[= .t"5\W-Yt5\W-h(#jCt Ph(#j= .u5\W-贲Zu€=.t8jj5D. y h(#*Pj5D.d xh.j.. .% .%.%.f .. f..衯hX.Y"hP.O"hH.E"hӣjҷU(#=.tI(#PhV$蜙1S8.^_C6f=\X-t js[覮E8W-utxEڃ=.u*t{8,X-u1f=X-X-< t< uG< t< uMjEP5D.貱 f=Y-{1!#} u"Pպ_8W-uEE5W-PmZYf=X-tCۡ-t -fEjEP5D.( f=Y-uEPmX?ha#jw UWVS E 0蜢.W1..h'-#"Y[t &-#/-#hE-#V"ZtTMBug p78tpjRP_ :uS1ҋ .buV.. .hp.#u uà uC$ H&5 p7h]-#..먃 .륃 .뜃 .듺w-# p7낃 .v p7u#hz-#hH&h0W .h-#S^_À;1h-#SZYƿH&t&VRS@* u <2t&he%SM^_SPh-#肏 . G.O3u8=eRh-# 8=tRh-#BY[\3he%S^ZƋtt ug(SYSvBeR0G.f"$lK&H $K&a.t..G.1..a.1. h.?.1.1."..1|.|.1=.x.t.p.l.-)Ӄ.=p.t*thB#. . .tbhC#jt3=.||=.t=||)=.||| Dž|40.jd.PCx<hSh]-+=v ShIC#<h]-\Y]-]-X/tK]-]-1hjXZ=.t.Ph]-S,x/uP]-@]-= ]-wPh]-Y_@u\8Uxt)o%=@xtbK=p.u=.t. .t P62P6_Z@u6hV$j8%=@t /t 1ɉt4h]-h[C#j. p.tDžt Džtt$PZPvЀ8/uj|Vx 1lpupCpQh]-^Zh]-CHfuFs Pshk"7zpDžlpx-Xu$wfushqC#yY[ftf tt)]-C,-]-=~TSh]-hC#y o{DsC(huTttCpj/V66YZpt)xph">PYZphp>h)8/t z/t/Bс]-vPh]-hC#x VPRpp]- ]-= ]-vx/uP]-@ߋp=.xt Ph]- Ph]-\^ZSP@xJ9|uD;u@EJ9Mu5;B u0sh]-hC#j/W[2YZtxh%WG_Zu^h1!#VS @ui-)Ãu]p0fZY@u jjKje;LtEPtIFu'/hG#VSD w~fw$K&1///1////1//t/e/V-4)Ã=/t/-=/t,/=1=/=/u/1ɉ /ttu#F%V1ɋP|=/xt)SW=YZuE%=u dSW XZt WhV$jE%=@9tQ ÃSp/UWVSu 6萄h1!#jVj_ЉÁp1thk%VuC tVmtDžtptc5 p7蘇Xu5 p7hB#jhWpW 딡-7hV$qߋ^Xt!DžtpS ZY_yɾߋuڋtVnUWVS}] 3h1!#j hI#SW tUit)ft5huP/σvu?/1//15//뗡-)ǃ4ju/hO# j =/tuϋVPFTtP2l pY[uNj|%=@luh2lQtà =lv2hI#jVltx/tlƄ/CGh>WkZD>8/u 9tH@j/W+ZYtPRd5Y dvWhI#nXZ"@PRl7 t DžphfpkUWVS@] 30-SuN]Sj6uEUEUSj"^_Sjh6ZYuEUEUSj^_SjD6ZYuEUEUSj_XSj 6Y^uEUEUSjXZh?i#:001=0=0=00P]1E؍}ȹE uVSj=xVSj- x"}ujVj y}tVSj xjVj y}tVSj˓ xjVj踓 y{}tVSj蠓 xjVj荓 yP}tEVSj n y1jVj[ yVSjI x^y y0hGi#0j– ^=e-tUjhF%贙e-[^y hgi#0j臖0 #=e-u=xe-t @h̦"aYt8u`."VZÅt @|/tCPR0_uhi#j0ZYtlj؍P0/h/h: jie- t! ttBGuB@9=/t hi#jP=e-ue-X t 00e[^_]UWVS]u 63|h1!#j 1hS$VS tLtPt9-t萕h4v#_8/u|hs#P#TY^ukhh#ST_ZuZPS?Y^@tHxPhF%)_Z@t2|9u;xuM9 u;Etjj(@Y^uj SÒh8-eXZD-@t h("jjgUWVS}] 3zh1!#j100 1hFt#SW ft]/WPtwR)d0벃vtbit6rtxu{0010p100Z0K0<0--9=0豓zu8QuthPt#hXt0؋Ht ʉA?jl0[0 0u t1=0t =0t@jPWѼǃ uhpt#C =0t.u)WlXCHHf $PR&PDs Pshk"j=0tC ?ƒuts ~Pshk"f0k=0^KPSCʑHjSWC 1ɉK +C  Cu>S=0tCHSftYwifu`KPCeusZ=0u&shV$d0Y[R蓍8XC=0usYZuH1Ntm=0tU8VG8?H98r50 0$10s6X8t hB#jQW[hxVSZYu8=0tCjPShk"e0_u=0EE%=@uB=0uSht#d0Y[묃=0t'E%=u,S脓B=0u=tىډ蜏uh=@uS!=0u SйZtXÐt1=0uShV$w^躋8 謋8?螋8u=0S謌X50a1e[^_]UVS@jj荈^X1EĉEȉEEjEPjÏ +4L¸9u 9E0j j!Y[ȫ0H ȫ0jī0$1!#j3ZYh#gVg-1ۉ]$h0i^Z0tt3Hu:0.O001<0E 000t.U=f-v=0i`=0tEPDX100tA:g-HyP/Xg-H J hg-ŨXjEHm00j00nīEPCXu utVXZu u蝵Y[}um=g-t,Eh#p@^E=0u PEuE=f-u}rEj?^=f-'7=0u趴h" [uW&jh#Pj1EÃP?$yBY|=Vg-uL=0uCEPB$#豶Zu EP CX8tEP$?XE$01ۀ=ng-t$=<0uEP[BX<0ng-u'j4V&^XC̈́RP ZY=ng-=<04f-$050该h""$g-襦XUWVSpE 0qh1!#j1ۉ]- 1-] ;E9hN#W躄ZYEWx_9EuphT#Su tZftatDeuI렃gu=j5 p7蒌EZYz5 p7hV$j&^-E ]SurdZYy hZ#yEPhBt @uk y hd#$X}Whht@u~k y ho#XEPht@u[k y hz#Xt$FvE 8uVEPuWSSz^1ɉMME 8URu V$YZURVYZuURV^ZuoE 0-DPt"V詡PS?VS蚘E9jh#V+ uVSEEZYVh|#]E E}tSju5 y h"ju}t Whgtuj y h#XjZUWVSu 6mnh1!#j3Y0 xo011ɉhdt`p11ۉljhh-h1#VuqlRtf(LtntMH1һ뮃PthtPdtXfuyDž`뇃vuhDžds= p7hDžpYMDžt@Džh1 -E)t 4Hubunpt uY00t00pt$t*tt h:#jP t)00>=0tzj:W4MYZt@0j.WYZlt!h0WD&_Z@lu B>t0<#u$0h0W&ZY@u ۉ8xPWZY@u WhB#j=0tE0E0jSVͯǃ 1uhB#>pu jSWɹ WbX CHHf wg$m&s Pshk"ZDžl=s Pshk"YttDžl0 Džl0ht)KPt;Qu0t;Au A<50RslЃ t"`ushV$Y[dsZ̀8t hB#jV[VUWVSu ߔf00` 0 ʈ00$0 ʈ00谓0%ij0f00h'-#[tjh#Yo&t7GtPSrYZu Sh#Wh#j1hU#VuD A6$`n&,0%ȳ00 (0$00= p7h"WQqYZuh#W9qYZ;= p7L.j j5 p7Qǃ u~8"u 5 p7h#D=0j j5 p7Qǃ t =0~8"u5 p7h!#jj j5 p7PQǃ uY~8"t=ij05 p7h:#뺸Y5 p7cZ@u^PA0I0=104 0(0 9ttk؉ ij0v jhs#uh# 0tt hş#j00ǃ;=0u/;0u"0;0u09rt1= h-$0(0  h--=0tP U)4uE=0t=0?04=0tt  1Ljhh0PQoPLy h0t=(0uJLxPPYZYLu&%=u$0(0w($ZIP3WrLUWVSjj]Sjjhw&)@u h$#jueYtjjSPjhw&(@t͋EE11һ9}~T >tItt9Ӆu5U1ۃ jj@QMQMQhV$AUU1G맅u) @-yh8-j [XZ8-P8- 1e[^_]UWVS ƅ]-ƅ_1ۉ000150001=0001hѫ#u u ycPtJTtgxPl$w& 0뫃 0q 0 e 0Y 0M5 p70Ye5 p7>Vj:V1?[Zuh#SH0t)XV3fZYXu C[Ӊ0=0t h?,"j p7tuhd,"1Ҁnuxouh-he%PGC^_t1!#0֋= p7u 0i1!# p70Ohrh@x&Ph#h-kVjWI^]00t00t 0-M Tu)tP1ۉXh3m hk 50R XRrRhu#RL*eZYTLS jjLRPVm9X}XTPT0VhP|à uj/SZYuShՂ"hT%hS=PV襯Xu"VXu9S諮^ty2LhVà LVhV$juhyG"LRdZYh5#LRcZYSh#jjhVjS˗ǃu Vh#jh0hzd@PV uWwX0`PhedAWkV @uVh#WwVbH__9~Vh2#(NE X0?0@0}u n-xk-1ƅhr-u u諥ǃ zI`Ntu&At/CcG6$&WBh$ ?_00w0kA0p-Z@0N0p- 60*?00Pjhjjj j5 p7F0 6Pjhjjj j5 p7qF0 5 p7hc%>0_Yt9ƀ0xAt!ƀ0l\m uƀ0Ct_L1n-%m-n-`k-p-ƅn-p-p-=-=A0uu =0Wjmi^G=?0:=>0-=A0uu =0tEjL$Y=A0t=0=0t Dž PPtVSE PE)P=O-Džuh`&h=#PV @u h.$6t*HkttWP`XZuh`&h;$GSS薭YXuVZ@u h`&hH#S蟫Yuh`&h7#j賶VZuh`&hW$jl@ uhk$h`&h*WSй%1󫍅Ph$SէuhX#S*/_Xuzkh$S/ZYuh%hD&hqP=ƍH_v󤍅PhiS @uh$$YSpj8V"=Z th$h4&hih3#[V%=ƹ󥍅Phui S]@uh$hUjm&Zt h&jLh6 h0mh0¹ Uhs-h0"h0PhqL h0%h[L h0$h0^ h0lXUh`t-h0θh0h-V h0ѸhfT h0иh0 h0XUh`v-h 0zhv-h(0kh 0虸h(0菸h[ h@0d huV h00Dh[ h80Qh@0苸h00fh80蒸UVS8y h$4Yh9"%Zy h$Xjh $F[^]u[jjqh$ u=jh$EXY$u$jh=$h$Ph!"h$s/j 7jSPyf @t-Et Ph$r^Xjh $pEZYtj S^h4$Mj B^ w-Xp jj hJo jjjj j jjjh%o o0jjjjhn Zjjhn LEEEE jjjjjjjj j j jjjuV@8jVj~c1EEEEEEjSj]jSj]$jHejAej:eEE EjjEPEPjEPƒ$Bum^8L0 w-te[^]UWVS]} DžhDžT1L11PXDžDs h$WS~ u~fFt/RkDžPgS$&5 p7KDYu5 p7hW$Xu p78#t5 p7)~Zu[ j dR@Pr d:uYZu0Xh{%W]>_Zu 1ɉ 0:h$h$hR%Q= p7h$W%>YZu 0h"W>YZu 0Wh$Djj5 p7 5 p7h$Phjhj p7$(0 0= p7W qZu-DPuWh$@=W=0qh]$5r@0jxlP50ph$G@uph$0@th$( jr HM1󫍝`4󫋅 =0u 0tJ 0 0Ph[^@=00 0s=0u;0 0}hRN @uh$PQ&ZY@uh$=0h0V7Và uVhk"j螛Ph0P1r ujhh0jP;nyh0h$!P%^_@tڋ%=`uh0h$1=0jjh0MM yh0h$jPyY[uh0h"$jh0hՂ" 0t#0VRWJ9^ZtN xRjVhՂ" u ƃrVW8YZuSh0h1$j=0u@0`PP50h02_@uh0h`&1=00=0u0 hE$Ytc uh0h\$ht#S$8ZYu&0uht#S8^_t t Dž0?=0thk"hi%S7Y[thps"h0hL&Džt'0RP5 050!D0 050= 019|Y<@ t 0SQRPC  50= 019| hx$t5 0 09sSQRPh$jtd0 0ˋ 0%0RP) @u+5 050h$j蟗'0P_Z@uh$话[^ |tjbPhV$j,l}tVS h"j>l}?LDžu{P ?_ $t8=3tj jh"bWhB=$=3t j jh"bWhO=$jc8j jh"b tVWha=$jbWht=$jb h1!#h!>"h=$cjjh1!#h!>"h=$c }ujj%jjjjjj  jjjj jj@u h=$jkjjZY@u8th=$=j34X}u_j 4_j jIZY@uP8t+h=$pY2 u h=$Z W3XVS(h=$p 0`jjƒ 1!#Bu"=$SPhT%j jUWVSDu]  '3h&SV5U v~j cStITtbLu<3뼃dw$&H38343,3z3k(3\03M$3>-)ƍÜ\3=03tjjh%wT3 >Ejjj"蛜T3jURh@hPp @u hT%4oY=T3y h%jh;u=H33 @ W4rZ) (    mt /  =H3t1ɉڸi1ɉMhjUE؉EhjUE܉EhjUEȉEhjUEĉE hjUEEhjwUljEhjfUEMU ʃ} ʃ} у} хuu h="E1҉D38gtj5T3_X1ɉME1!#E1!#FEȅ"CEċS:-0BRUpZH3U$&D3"0-D30-D30-D30- @3uj3[3LP3A91&@uCEċSEP1ɸ uCEċSEP1ɸuCEċSEP1ɸduCEċSEP1ucCEċSEPM̸iECEu/CEċSEP1ɸNiXL3uCEċCU _EuKMċs t^3hw$&]1R3F3:3 .3@"33 3 3 3 3t# 3 333t13jjV1C RX3u#EPM̉UhEXUUuEPM̉URe,^uChQ%s^ZY=43uhB$hB$h]:%z @3CHw)=43uh0B$hKB$h]:%H 1@3SEP1ɸ^gX]ċuX3MuhgB$5u>au uhB$"P3EġL3}tuȉuthB$jbMu}t }EEă=@3uMEȉE310E$18 31atctguIE#3E(3"33@343X3,3H33󥡠3@3U9sHxt)ЈX3t]E؊Hw uF:T80D019r)19r)1ELE؃9sIJ 3X3tMutHXSVh3 =$3t =3tØ3B$\X3tE}tHpVWS謮 =$3t =3tB$\X3tE}tHpVWS^ =$3t =3tB$a\X3tE}tHpVWS =$3t =3tB$\X3tE}tHpVWS­ =$3t =3tB$[X3 tE}tHpVWSt =$3t =3tC$w[ 3f 3=$3t!=3u=X3tD\ 3]=3Sh 35T3 u( 87t [Ph;A$XZ9~kPhYA$Y[] 83u =D3tH{ 8t<3 83 (3 $3PSVtr 11ɉډe[^_]_Wlae[^_]UWVS } hYI$PZY…Uh~"WuVH Ut.at"t=3 p73뽺붡-])Åt>um3t&h#S^_th{H$SxZYCt/=3u&43 sujRKuEVh`I$h-Vh}I$h-j=3u.3hI$WuVG t@,qA3w$&z=3u3먃=3u3듃=3u3{=3u3c=3z3 G383)33 =3"3@33335 p7#3X=33=33j=3 p73h%P?Y[>3/=3F33)-E)tH:Eu5=3=3t =3=3]=3t =3=3txt4h#W^YZ!h{H$WIYZu/ h#W3YZ7h{H$WYZ"h%W _Z,@JK EGpÀ53jj535353vt53jj535353v;E53Sjh 0ShV$jRX3En =3mEInjEPj?h @u hI$C^EUuuhI$[Jh`RPhI$yt StYyE  1SQ%1RPhI$<G1=3t5u5oXhM%S_Zt#h%H$SZYt?ujkVhI$j Vh7J$jJUWVS u] 1h/L$SVB tRtfu23ֿϡ-9td1ɉ`{lPV薬[ZjxPPIuZY%=`=@uxh{uxPh2L$[^Dž`ddPhVb ttF{1:{j5 3趖h8- t h("jC54UWVSP}1ɉMM1hn$u W. t3gt!utGu. p7E p7;u p7E85-9襖t3SZt@E%U裖MM@uShu$jB1}1ɉM}t EܖE1}t6he%EP裾YZt"8tu h$jBG衖DʋE 46VZ@u6hV$jBhF%Y@ttEPWS_Z@uh$}tuY@u h$jNBtuRZ@uh4$FtVRPvhV$jBhb#ZXXu$jh$SSP@ShV$jAUWVSĀu] n41@t4u4_4%1Ht4h+£ d4a1X&?t2Gt&W =n4uRhn4 YX RwP,N {4\k4XZtu(xF%B}u)x%,xt}tjUxY~jRt+XZlN t0P +t'%@t0PhQj]7V0P{0[_~ tVhjj 7vՋd%@u hA%>Xu u0S [h B%>dh@_dhShjj6@Sh j 2@P?:$ZYy)h&h D%j>[_ 1ɉ$ 1Dž$d%0uSZ@uh&hD%!>Y_PSoBXZt;t HxtyzP PJ?XRf1ɉ_VSOy _ZtP ^8-S聆SC?_ SQ;-tP[hƒ@tRt \tBh-D%lwh8-蓥bh$tPRh&hB%7h&h$B%(%Ѝe[^_]ÍL$qUWVSQ@Y1ɉP4141,0<48hW|%S@ ,H01$'6%65 p7f41Ɋtrat<GtD AtBCt.@Lt,Slt" ctgt#su,'" @f4F누0f4%P1҉Lj LP5 p7ƉP% 8u! p78tL8u ;Ph{z%pj LP5 p7 - ~ p7:t L:t5 p7hz%t4z 6@n2thz%j" 6jh8-1ɉ - -$-^_ p7< 6j LP5 p7D,(- p7 :t L9t Rhz%j%"@=Rhz% p74 6 0LP5 p7 p7_Z8tL:t Pv)ݝ p1݅ tj[Ph{%!%v5 p7h@{%AٽFfF fD٭D߽ ٭F $- -߭ H%٭D۝ ٭F $-xy5 p7h{% uhV{%$-^ 6S}0tuhy{%j LP5 p7|*8 x p78tL85 p7h{%&,%6 6 6 6 p75-tDFu h{%1B卅(R$R RRRRR RRRRRRRRPh6$Q*VƃH1Ʌ~ )16h7$0Y14@9u919~4Ph-"GXZj 6t1DžtDžxDž|Dž:h6Vj5 p7CtP蠖Ph{%66rJB6R虖 6@Yj LP5 p72(0- x p7:t L:t5 p7h{%=hh|%6% - 6k6%6% 6CLP5 p7蛋 4XZL8u5 p7h5$8LP5 p7U4_XL8u5 p7h9|%-@)Ht赼6j.SY^u S,Z)؉@?wPSPx@Ƅ t@ -t -fBۍ1V @KjKPVe@SVXVdP$TVh~|%j# Hd`hSVjSNX6t=0- h|%Xt1DžtDžxDž|Dž:h6VjS"tPPhV$jb6BtÉ4ru h|%6Jr rrN6 y h%<6@t"56h6PS t hVL%<1DžDžDž:PtPj<0tP荒P ..., where is one of: %s: %s not compiled in chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodlnmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6usage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s %s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOIELEMinvalid unit number `%s'%s: too few arguments%s: too many arguments%s: CHIOSPICKER%s: CDIOCLOADUNLOADinvalid modifier `%s'invalid element type `%s'%s: inappropriate modifier `%s'%s: CHIOPOSITION%s: CHIOEXCHANGE%s: CHIOMOVE%s: CHIOGPICKERINEABEXENABACCESSEXCEPTIMPEXPFULL%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: status not available Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu f:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %sunloadinvinv1inv2voltags [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortslotportaloflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizeoutput block sizeinput block sizeblock countfile countunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiAvailiUsed %*s %*s %%iCap Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklMmNnPqt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %scannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp filedes_cipherbad hex digit in keybad binary digit in keydecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileEnter key: des_setkeyunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input filecannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionp:sxES ? interruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-f device] command [count] %s=%o%s=%x/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d %s: block location %u internal error: unknown request %ldWriteProtectMounted76543210asfbsfbsreomfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache [-u locuser]usage: %s [-46dn] [-l login] [-p port]%s [login@]host command pollRCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloctcponly super user can use the -u option468KLdel:np:u:wshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrport must be between 1 and %dbytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dusage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: needs_cleaning returned %d%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progress%s: clean_fs returned %d%s: shutdownnfss == 0/usr/src/libexec/lfs_cleanerd/lfs_cleanerd.cLFCNSEGWAITALLincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blockscoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost taildepth <= nbufs/usr/src/sbin/fsck_lfs/bufcache.c!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)bp->b_flags & B_BUSYSuperblock magic number (0x%lx) does not match expected 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) ix < ULFS_NIADDR/usr/include/ufs/lfs/lfs_accessors.hix < ULFS_NDADDRbc >= 0/usr/src/sbin/fsck_lfs/lfs.cNot enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x pseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%x/%d bc > 0sb0 %ju, sb1 %juAttempting to verify newer checkpoint...done.** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data No -b flag given, not attempting to verify checkpointPrimary superblock is no good, using first alternateFirst alternate superblock is no good, using primarylfs: ifile ino %d read %dlfs_balloc: bread bno %lldlfs: ifile read: cleanerinfo: error %d lfs_valloc: inuse inode %d on the free listUsage: %s device %s device command [arg [...]] Available commands: rw%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. successfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringdecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionreallocarrSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT header%s: bootcode too large%s: bootcode too small%s: invalid magicInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?PBR is not bootableNot bootable%s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedbootmenu%s: [%.*s] (space to clear)'%s' is longer than %d characters. Explicitly specify beg/end address?The bootselect code is not installed, do you want to install it now?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: Bootselector , infinite timeout, timeout %d secondsNo active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdB0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks? Geometries of known disks:Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. Boot selector configuration:Timeout value (0 to 3600 seconds, -1 => never)Select the default boot option. Options are: %d: The first active partition %d: Harddisk %d Default boot option We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tableusage: %s [-fqrw] [-s sector] device Invalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. and on-disk sector number (%s) incorrectly specifiedsector number (%s) out of rangefqrs:wget labelNo change; not updating disk label.Updating in-core %sdisk label. set labelNot updating disk label.Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS# %s: type: %u disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdusage: %s [-o options] special node getmntoptsmount table fullincorrect super blockspecified device does not match mounted device%s on %s: %suserquotagroupquotardonlyunionhiddensympermrumpautomountedgetargsrelatimerealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-bdins] [-N nsegs] [-o options] special node bdiN:no:s/libexec/lfs_cleanerd-b-d/var/run/%slfs_cleanerd:m:%s.pid%slfs_cleanerd:s:%s.pidusage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%xWARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too bigfs->lfs_hasolddirfmt == 0reclen > LFS_DIRHEADERSIZE(fs)spacelen > namlenspaceleft == 0/usr/src/sbin/newfs_lfs/make_lfs.csuper-block backups (for fsck -b #) at:%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version preadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld insane maxpartitions value %dinterleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit width%s `%s' is out of range.AB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:bit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume/dev/%sr%s%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -An < LFS_MAXNUMSBnblocks = %d, not %d %s: fragment is not last block%s: ulfs_bmaparray returned %d looking up lbn %lld%s: bread bno %lld%s: no clean segmentslfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_number/usr/src/sbin/fsck_lfs/segwrite.cfs->lfs_is64 == 0devvp is NULL!(bp->b_flags & B_INVAL)idx < lfs_fi_getnblocks(fs, fip)bp->b_flags & B_DELWRICould not allocate %zu bytesdaddr > 0unlock to 0 with no summarySeglock not heldunknown disk type `%s'DIOCGDINFO on %s failedsectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sCan't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytesabsentCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'%s: Unable to allocate table%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingBad number `%s'usage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev ioctl (%s) failedRAIDFRAME_GET_INFO%s is not a component of this deviceYesNohardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_GET_COMPONENT_LABELComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d RAIDFRAME_INIT_LABELSgettimeofday failed!?!?%02d: %3d%% |%s| ETA: %s %cRAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. RAIDFRAME_CHECK_PARITYREWRITE_STATUSParity Re-write is %d%% complete. Reconstruction status:Parity Re-write status:UNKNOWNdisremainstat failure on: %sinvalid device: %smirrorRAIDFRAME_CONFIGURERAIDFRAME_REWRITEPARITYBad last unit %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vUnable to open device file: %sRAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTUnable to create RAIDframe configuration structureRAIDFRAME_FAIL_DISKRAIDFRAME_SET_COMPONENT_LABELInitiating re-write of parity# raidctl config file for %s START array# numCol numSpareSTART disksSTART spare# WARNING: no optimal components; using %s START layout# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c START queuefifo %d Components:%20s: %s Spares:No spares.%s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYParity status: cleanParity status: DIRTYraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure RAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure RAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity %s: Parity Re-write complete RAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANoptimalreconstructingdist_sparedused_spare|/-\ForceSoft*invalid*usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list extract directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseto an alternate location with more disk space.or set environment variable TMPDIRTry making space in %s, %s %s bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer /dev/ttycannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? towards the first. with the last volume and work file(s) are on you should start Unless you know which volume yourYou have not read any tapes yet. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump coresymbolicwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). strdupwho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctl%13u usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable %s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. unable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- : noneinvalid target: %sinvalid lun: %sSCBUSIODETACHSCBUSIOSCAN%8u %4u entire track defective%10u SCIOCDEBUGSCIOCRESETSCBUSIORESETvpd%s: scsibus%d target %d lun %d <%s, %s, %s> VPD Serial:VPD Device IDs: proto%uunable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu unable to allocate defect descriptorinvalid block number: %sbusunknown %s command: %st10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISASresetscantarget lun[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcachesetspeed[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#Diagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xParametersError in %s, Offset %d, bit %dError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:%s: Check Condition on CDB: %02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedWrite ProtectedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This TrackNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare Error%s: SCSI command timed out %s: device is busy %s: device had unknown status %x Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time format/usr/bin/wall%s -n%s: Can't find `%s' (%m)FINAL *** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at poweroff/sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-zCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:tcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s %s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]%x:%llu(%d/%d/%d),%x %s: size mismatch %c%x0x%0*x0x%0*llx -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2xunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorLESSLESSSECUREVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDticmso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYts=tabstop=pcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%c-clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifttildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdvcudiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x), Valid options are:=number=word=stringSupported machines are:usage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap paths != NULL/usr/src/usr.sbin/installboot/installboot.cmach != NULLInvalid machine `%s' from %s (directory)(none)(to be cleared)EditClear$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSInvalid block number `%s'-moption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'fstype != NULL-tInvalid file system type `%s' from %sb:B:cefm:no:t:u:vDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown typeparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s Secondary bootstrap: %s Please specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'params != NULL%s: bootstrap installation is not supported%s: bootstrap removal is not supported%s: bootstrap editing is not supportedalphasumioaddrkeymapresetvideosunsumbootconfboarddtbbb16 != NULL/usr/src/usr.sbin/installboot/sum.cOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x invalid console name, valid names are:Boot options: timeout %d, flags %x, speed %d, ioaddr %x, console %s console %d keymap %s Patch area in stage1 bootstrap is too small/usr/src/usr.sbin/installboot/arch/i386.cparams->fsfd != -1params->filesystem != NULLReading `%s'Reading `%s': short readWriting `%s'Writing `%s': short write, %zd bytes (should be %zu)Invalid magic in existing bootstrapparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)Cannot enable writes to the label sectorWriting `%s': short write, %u bytesamd64i386com0kbdcom1kbdcom2kbdcom3kbdusage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCSWAVELAN[ %s ]SIOCGWAVELAN(wreq %04x)Transmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCSIFFLAGSmust specify interface nameSIOCGIFFLAGSscanning ... AP Information No APs availableap[%d]: ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] string too longUnknown[ Unknown ][ On ][ Off ][ %s ID: %d version: %d.%d ][ 0x%s is already specified to %sa:d:g:hi:m:or:s:A:M:R:DSIOCG80211NWIDbadly formatted addressLucentgeneric PRISM IISamsungD-LinkHost initiatedFirmware initiatedInquiry request from hostWEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: NIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: %s: not a regular filemalloc, using %zu bufferUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv%6d %6s Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx ls: %s: %s total %'llu total %llu humanize_numbertotal %s %'*llu %*llu ????????????????????????%s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too long-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%lu secs (%llu %s/sec)%llu bytesunknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryAlias count botchalias %s=alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDPeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sCannot determine current working directoryunexpected argumentUnable to find current directorystdout: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifiernull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode nul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes[%d] %c %ld RunningDone(%d) (core dumped)No current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d [%d] %ld lpZmore than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${LINENO${#LINENO${#${(((...)$(...)">|>>>&<&<> && || ! | if else fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvb%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) internal error (%c)kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %s+-Unknown option %c%carg for %co missingNETBSD_SHELLNetBSD shell: %s Bad -c optionOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionUsage: shift [n]Usage: rotate [n]can't rotate that manycan't shift that manyallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntil";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %sBad flag `%s'%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error '...'<<nonblockfsyncdsyncrsyncaltionosigpipecloexecEXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLequnknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'evalbgchdirletfalsefdflagsgetoptsfcinputrcprintfsetvarulimitumaskunaliaswordexpPPID20220122 BUILD:20250510185853Z SMALL REJECT_NULSincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s [-L] format [arg ...] Arg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: not completely convertedArg %d: %s: %sArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: %sArg %d: '%s' numeric value requiredformat "%s" too complex#-+ 0'%s: missing format character%s: invalid directiveprint failedoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeol2lnextreprintgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d illegal gfmt1 optionillegal gfmt1 option -- %s%lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqcs5cs6cs7cs8-parity-evenp-oddp-pass8-extproc-parmrk-onlret-cread-parenb-cdtrctsispeed %d baud; ospeed %d baud;lflags %d rows; %d columns; queue = %d; line = %s;-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfoiflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignparoflags-opost-onlcr-ocrnl-oxtabs-onocrcflags-parodd-hupcl-clocal-cstopb-crtscts-mdmbufcchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... %s: invalid %s nameHLPRdfhvthe -L and -h options may not be specified together.DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %dusage:%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/vi%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipszaurus%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraAutomatically adjust partitions [%s]? Invalid answer# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition tablecan't get msgbufrq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %duntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDwrong type to dirscan %dNAME=%s NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** Alternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s can't take snapshot of %sEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) ADD '.' ENTRYREPLACE WITH '.'ADD '..' ENTRYREPLACE WITH '..'DUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKSINFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATE-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %d%.*s/%s%s/XXXXXXXXXX/dev/rfss%dDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %da:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBR[-r]Read failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %juPri%s GPT at sector %juSecGPT partition: type=%s, start=%ju, size=%juMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qpartition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableCreating new secondary GPT headerMoving secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]%s: %lluType: %s (%s) NoneCould not find index %dDetails for index %d: Start (active)UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?]GPT part %lsUnknown %#x %*s index contents %*jx %*ju%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaxGPT not found, displaying data from MBR. %5dshow[-aglux] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changedab:i:L:s:t:U:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]gpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.csector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile] [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] %s: getsockSIOCGIFAFLAG_IN6SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6 inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime %s: getifnameeui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressinet6 address lifetime not allowed for the AFpltimeia6flaginet6IPv6 keywordsia6flagsanycastSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEnetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflag/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTR%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sifcapclonecmdNote: trailers are no longer sent, but always receivedSIOCSIFMETRICSIOCSIFMTU, %s byte%s[-L] [-m] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimeSIOCZIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s input: queue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecatedexec_matches%s: prop_dictionary_augment%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types? media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkmasterno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsCAPSS:NRATE%-*.*s %-17.17s %4s %4s %-7s %3s %4s %-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s> DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): dlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal Error%s: address resolved to multiple valuesassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dFlags%-*.*s %-*.*s %-6.6s Internet6InternetAppleTalkEncap Protocol Family %d: %-6.6s %u.%u.%u.%u/%dillegal prefixlen(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 swaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab MBytesGBytesKBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)PriorityCapacityDevice%-*s %*s %8s %8s %8s %s %-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20241129NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandLPSVEPSVCan't create socket for data connectionwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cWriting to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Usage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpBad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVncan't stat: %s%s is a directory%s is not a regular file.gz%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()works for regular filesin-place editing only%s: %s %s%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtvUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages%-35s %.50s2001:4860:4860::88442001:4860:4860::88888.8.4.48.8.8.8.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page downCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exit9600192003840057600115200BIOSrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/i386 10.99.14 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.99.14 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.99.14 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.99.14 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.99.14 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-10.99.14 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.99.14 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog10.99.14xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/10.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02X/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:ipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.statsnet.inet6.ip6.stats/sbin/route get -inet default/sbin/route get -inet6 defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/i386/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,nosuid,noexec,nodevmtime,nodev,noatime,async,noauto,log/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/i386/../../disks.cbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%sxbdmcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%s/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/i386/../../util.c/tmp/entr.%06xrndctl -S /tmp/entropy-file %s dd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/certctl rehash/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/i386/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd %s cd to %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /EFI/boot/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootablemachdep.bootmethodUEFIOut of memory %d%d%d%d%d%u%uwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_bootsel/usr/mdec/mbr/usr/mdec/mbr_extCan't find %sgpt biosboot -b %llu %s/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu ntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstypeparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ---- %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/i386/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/i386/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errorparts->geo_sec != 0info->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: IAID conflicts with one assigned to %s%s: connected to Access Point: %sNOCARRIERPREINITEXPIRE6EXPIRESTOPPED%s: removing interfaceDUID %spid %d failed to exitdup2 %d%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leases%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.2--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z: [ip6] [ip4][manager]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.2 %s Compiled in features: INET INET6 DHCPv6/etc/dhcpcd.confInterface options: DHCPv4 options: ND options: DHCPv6 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.2 starting%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initnd_dhcp6_invalid IP address: %sinvalid CIDR: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6vsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLnrt != NULLchangingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.clen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefix - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sSTATIC6ROUTERADVERTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIAS%s: if_addrflags6%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_send%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/var/db/dhcpcd/secret%s: cannot read secret%s: cannot write secret%s: IPv6 static DAD completedcannot find a loopback interface to reject via%s: deleting address %stemporary %s: adding %saddress %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u seconds%s_ip6_address=%s%s: waiting for %s to complete%s: pid %d deleted address %s%s: regen temp addr %s%s: too many duplicate temporary addresses%s: waiting for Router Advertisement DAD to complete%s: unable to obtain a stable private addressipv6_makestableprivate%s: Router Advertisement DAD completed%s: delaying Router Solicitation for LL address%s: sending Router Solicitation%s: no IPv6 Routers available%s: soliciting an IPv6 router%s: delaying IPv6 router solicitation for %0.1f seconds%s: impossible RA flag %x%s: %s: router expired%s: expired %s %s%s: expired route %s%s: part of a Router Advertisement expirednd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%sIPv6 ICMP packet too short from %sIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %s%s: delaying IPv6 Router Solicitation for LL addressreachable again%s: %s is %s%s: status truncatedUnknown Status (%d)%s: DHCPv6 REPLY: %s%s: server sent USEMULTICAST%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: %s: DHCPv6 REPLY missing IA Address%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %uTIMEOUT6%s: %s received from %sINFORM6BOUND6RENEW6REBIND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: %s: no valid lifetime%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: waiting for DHCPv6 DAD to completedelayingmulticastingunicasting%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f seconds%s: %s: sendmsg%s: sent %d times with no reply%s: ignoring unicast option as not manager%s: declining failed DHCPv6 addresses%s: DHCPv6 DAD completed%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: soliciting a DHCPv6 lease%s: requesting DHCPv6 information%s: no advertising IPv6 router wants DHCP%s: failed to request DHCPv6 information%s: failed to decline duplicated DHCPv6 addresses%s: failed to request DHCPv6 address%s: DHCPv6 lease expired%s: failed to confirm prior DHCPv6 address%05d %sDHCPv6 packet too short from %s%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: discarding ADVERTISEMENT from %s (%u)%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: ADV (no address) from %s (%u)%s: ADV %s from %s (%u)%s: redirecting DHCP6 message to %s%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 lease%s: delaying DHCPv6 for LL addressSTOP6RELEASE6%s_dhcp6SuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix AvailableSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RECONFIGURE6-%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host ping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmapunknown qtype no address(TTL=infty)(TTL=%u)TTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> RefusedIPv6 address/etc/group/etc/master.passwd: (malloc) Error in munmap(): Z Pu___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumcntrlgraphpunctxdigit%s%s%s 646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d snaparchivedsappendschangesimmutableuappenduchangeuimmutable ,N/Alink#%hu%d:[%d,%d]pqrstuwxyzPQRST/dev/ptm%s%s.pidjanuarygmtmidnightyeara.m.p.m.noonmiddayutcwetbstwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdttomorrowyesterdaytodaylastthiseleventwelveagomonthfortnightweekfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdayfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshautoselect10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTEthernetTokenRingFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT.sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy stringCannot allocate %zu bytesCannot re-allocate %zu bytesCannot open `%s'Cannot format string%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sinitscrESCDELAYTABSIZEcsp != &blank^Gkbskcub1kcud1^M^Junknown error%s: generic terminal%s: hardcopy terminal%s.cdb$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number/usr/bin/rshRCMD_CMDCannot exec %sR%zu W%zu L%lld %d *0*12aargon2idargon2iargon2dargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$$1$Argon2idArgon2iArgon2dOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesMemory allocation errorOutput pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureUnknown error codeacosacosfasinasinfatan2atan2fhypothypotfexpfy0y0fy1y1fynynflgammalgammaflogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error log2: SING error log2: DOMAIN error unknown header flags setincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthsinvalid code lengths setinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeatneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible versionstr != ((void *)0)fmt != ((void *)0)src != ((void *)0)ctx->poec_capacity != 0ctx->poec_buf != ((void *)0)<>&\u%04Xversion="1.0"!((*cp) == '\0')?xml !DOCTYPE plist