ELF(@4J4 (@@<<``PM!"\\@0 6QQ O@@@( @0 fH!@P@Q?H3tР -L~G&/PM]main() returned_   ! X(@@T @@ 0/aaT (/// P-Lxv@-@PL00S @0080 0 0 0 b&Ѝv``S^P/00S 000/v2@-@iMpP @iߍ0s PP 00 0`V  h#@    0R)0R OoBrk_edAT^\ 4S/0!8 00 (   !/Hzhzlz@-P|}%0 !!X0T0P0H000, !  !Z^7T^HzhzlzG-aM0SJpP  @T   pP9  P@1 6P 2P hfP5 DP@ -!P%   P PP 00 B4R 0 @a0C0 P E&ЍG @+P|&Pl!PP P 8"$ 0@ @Frk_8FHT^T^ 7_RT^d^UT^@-<@P$P@ ,V^T^TK_T^@-l00: ST 88S!~0Y?@_ 00 僋]@B@-0@0PS@!@.H 4Sʀ0! 0    !B? SSPj0 !! H{"Dy"<v"80q"̀2-HzhzlzT^T^T^@B U^ P00  /$@$0P  000/dPd<0 P0/S/0CQ/]s@-@0S7`P`HP) CP' >P P0000 8PЍp@芃d'PX0` P0RЍp@a @P8P0ЍpU^"U^)U^p@40U^]` @ @O-M0$pPt崄 ?W|L"媄!7GR  EyP00l'0d'd7!`' \7PX7+RJL7尤ᴴḔἄ e U `P& 6  ::Sf0Tއ6P X "01%6PQ P!! *!& 1儆 !&f0|6#6$1  1" @P *L\#H&H6HfUTS$1)0C$10!10C0PU0S 9#9S  @P :$1I)0C*$1,1,!p1c001 1 @P :|5*$10C$1 1 @P :$1Du*0C$1u0! 10C01 @ P:$1t*0C$1b0! 10C01 @ P:$1t*0C$1O0! 10C01 @ P:$1lt*0C$1<0! 10C01 @ Pl:$1*0C$1*1! 10C11 @ PZ:$1)0C$1P#Gq㰃 uGW#G#Gx#xGp#pG$p`3`` \3!XT3 0C 0p 0G! 0I 0I ~G": vG": nGt: gG\: `G0p09 XG 0p0 :NGXp!#H!p0 G<J$1Q 1!0!>0>00!1 ! B"&$! 03/03/03/ 03/x [+ 1XH0SHOH010! ,1,! (1(!h$'o! 1" E Ѝ6U^@[@0 DSBO]2ﾭU^0`AiP0U^??,,li`?JU^)i` aU^@ihaaTaa^^ _ _@4_H_\i@``__ _o @ @P@@- @0 PЍO-`p㨱LM P 1 0LЍ001!4 S6AT1S1S1S* o@ ,TTW    ,00< @0p08 @P\  0<0 0^*0 00 \S 0 $ ``06/Tp0$ 0P5/`P?>$ 5/0$ 0P5/ 08`$ p@#8/]` p@-dPTU@ $ ``06/Tp0`$ p@//p@-0 P T@``06/0 ``6/`0p@ /p@-P@@0 T000S 0d00h00p0x0h0x0p@ S0d0i0h0^0 S0d0i0h0^0p0j0l0]0t0` ]p)@A-0PST@ Sq  Bu 00 `0*b6/`P   0@  0`p7/< `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0`pS0   0 7/0 `p 7/ `pt0 7/`` 0 6/ ``D0 6/0S000 0 00$0Ѝ@V^V^p@-P0 ` T@003/U U ,  p 003/V^P~@-00 ~ Ѝ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzA-0`@TP Vp V h300 3/P0T00 T0 `@4/A0T0 `@3W^|A-0@PT` Tp @DT0S $ 003/@08$ `@#84/A~;W^ 0o/x_/0@-0M P@ 0VP 000 ^Ѝ0T.@p@-0@Tp@ttYz$0dP 5/0 dP5/0U~0R~ 0p@N~x_`[qW^A-(MP@D1P<4J0100: S# 0A㫀p` 0000 (`0w?C$004  p,00 `0@ 6/0P (ЍA}05p`WV ||t aPdk 0 0@0 0(Ѝx_T^]W^pA1@W^\.@ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz@-@:A-1@TA0P`dp 7/U }} 0dP5/}㩀0dP 5/0 4P5/}U} A} }U A}x_j[qW^p@-0@TxxPpPP0 4P5/ 0 4P5/P} }}x_x[qW^C-1M@TЍp_0` dP5/ 0dP5/P b}`}h}8pPP p d09/0 49/ #0 49/ 0 49/PU 3}1}/}0 dP5/0?<#x_qW^[A-1@T  &PP0` dp7/ 0dp7/ |||0dp 7/0 4P5/ 0 4P5/ 0 4P5/P|x_[W^O-,1P@`({,{0{4{0p,m|(j|0g|4d||| | @P0 | x(| t(| p[P0| | (C| ,@|0=|4:|OO|x_0S@- S S@@WW^00@o/]` @-`@PЍG-@Ђp2PRp`0CR`P2R 3C7CR0 0 $ G~2RS 3C7CR008#8S800 0H &D1414$00L00P0$  Q  !%!b$ R!X $ %$ h0l0& d  ' !0 !  011<P008#8S308#8S0x`0 p h(`8p<151``5008#8Sy308#8SsSW HdHdW^r_ X^@-@`P@h `0 0X 0P0 P0H000,04 4I^P$Ѝp[J[L;@;@W^@-y@-@m0 0R/  \]` [lp@-@ 0R * R< RU !0 1dPa05/x1x!dP 5/d1dP\! 5/<dP D!5/ {0d,!p@/ !0 1dPa05/0 dP 5/0dP !0 1dP!05/0 dP 5/0dPp 5/=dP !0 1dP!05/H0 dP 5/5dP[~ _f-/0/-/-/-/-/-/-/A-PpO`0@ 2/ p 0S0@0 @0000@A-P M@`S0 0 0  p7/0P * * p7/0P  "( p7/ Pt 000 00@0H1 R `   P v Ѝ@0X@p0$0:0d0 00!S   1 0 0S0h006Qd  |0000100 0000 8/0$@0\0` v,0X^T^QX^tX^X^|_X^ Vu^ 0 /|_/$ R/P//C-p0MS @*`  5@P" Pd@ 001Q0000!T0    Q40 00 a6/00P@@Ѝ0S   00C0/$ R xR R  /X R P0R/ ! !  _W@@W@AW@EW$o  R0" //@- oX^@-@(00 S@@][X^A-QP@ 0S @T`V pl`V @@DT@S 0S T@ |` 00 p@-@|P@0`000```0P0 ^P70| ^Pd-0X {^P<#04 q^Ppp@T^[_E@Y^E@@F@F@@-6@A@-0@~@-*@y u0 0@-0 0@k0 0@e0P/__@-<0@TP T0 0 @L_0P/QC_p@-0@T/ 0S S* S& P 0 0 P PU% Pp 0D0P0000C00 0P  pp_RW SW 0o/_///<0Q 1CQ/ 0Q0 /00 W@W@p@-PP2S6x@P@2xP,@ @T,@ tpG-M`z@P2`0p븂XP/ 冹0* Rq "Sl ph2h P00 000!h<" p-PZP00$P(0SIP㴑ġ0SKP 1@'wP 1@wP l1@wP L1@wD10S h 0c00h0 01@0`0!CdЍ0!p P_ a` P0p 0NwP0qw Ew0* R 0 @vP S T0@_T^] L@` [L@W^O@H@L@`H@  |JH[O@@-//G- s@dVʀ 0! $"0""   !P 0x EwLwP0S zP0SP0SDP0SK( ]0T Q0S001R0 P "00 S^0 ?0y w w y0S w yP0p vP ,0S -0S (05#0x vvP0p vP Q 0R(0l0S$00SPXX0S`P\ d個$0Y0 0 0?cٷ 0!D d08 0   !ͷHzhzlz_X?gfffA-X0P@0`0\00`P @  @jЍ P@- R NN_0/_p@-`PpPDTʀ 0! $ 0    !0 2/P 0!H D0< 4  , !p:_Hzhzlzp@-HP0PSp P@ `6/:0  0p@/_p@-p`0SpdPP@0 S 000p0CS0p0 `6/Tp@_G-pP`̐P@ P% P# PV `FPE @P P #P P00Z0S P P`4  `@ T^OZ^SZ^^/@-0,\ @T 4/Ѝ_00S/ R//_00S/ R//_p@-@P4`z/ Qt/0p@80/_ 0 S)p@-@0@` !P0 R  P RP V0S0@@ P@@00 , !p/A-@0@p !`P0S#P ) R00 @T tt@PA0P !!P  0S R00 i@i@ 0  )?)/ 0  )?)/^/@-@q dL Q0P0CD q 8?  q (: q 5 UZ^`Z^fZ^nZ^zZ^0@-LP$M@ &  C000 0I$Ѝ0T^j@0@- 0@ ,MPr           0 040$0*P 000 2,Ѝ0i@/0/!//A-pQ`.0  P@ x0E#P Hpp`@tT:80[+0 'J x>@\@-k Z^@-g Z^///1/8#81/1/ W  R/ R/ d 0s S40@o//0@3S0/m/B sZ^p@-@0PT3/.p`R0p@8/4! $$#  p@/Z^Z^h\Z^Z^Q0 Q Q // ^Z^Z^O._O-P`M 0 3/Ѝ03/@zQ [0$  3/0 0Sp "R 3/ 0A0CS000l 3/u0d 0Q 0H 3/, $.!4 3/!0AYS}p@dy@w@dy@dy@8y@dy@dy@dy@dy@dy@dy@dy@dy@dy@dy@dy@q@dy@dy@dy@dy@dy@dy@dy@dy@dy@dy@dy@dy@dy@dy@dy@w@w@r@dy@0w@dy@dy@Lv@dy@dy@w@dy@,v@dy@w@r@w@w@dy@8v@dy@x@lv@v@v@dy@dy@dy@dy@dy@dy@ s@u@v@Tr@s@du@xu@u@u@u@v@t@r@r@r@v@r@u@r@v@hr@x@r@x@x@x@0c0C S+q@q@q@q@q@q@q@q@q@q@q@x   0\3/ 0L3/@ 0<3/W  0$3/ 03/W07 1p 2/0 30 r#03/0A CR@S> 000 0R8L3/4$$(0". (:$ 03/$&0$0$3/0 0 &6z R'zppF0$0x3/p60S `6`&0S T&ZP0H3/083/ jZ0 03/$r0p0pO8OS $03/50S 5Z 2/%5 0|| 3/Zc 0L3/0X3/p0! 'R0,3/0 nK RS 0 3/  BR03/Z  03/R$0Y$0 t$tO0J$80 0C2/ $0!?3?3 2/!;?#00@q 0s0 0$* "0  : 0#$90"? :$#: \0LH#0$"<0,,7S0 S003/ 03/ 03/ 03/0000$3 0$2 p0$0`$40S$HH 2/$03/!t03/0t3/0h3/W_ 0~0$03/$($0p 7/0z0l3/200p\$($0 7/6$8$&$p(0 0[Z^x\\Z^^^Z^T^Z^`^._l_:^Z^h\Z^[^I[^|^Z^[^/[^i^On_,Y__[^@"[^,[^2[^<[^>[^4[^@[^\D[^H[^X\h\N[^sZ^:^X[^][^Z^^l_[^k}^_^`^[^\\b[^f[^l[^+_m[^r[^[^[^[^[^ \//`!//` `! /0/c 80/c#c4 4#0/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ 0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/ R/c 8 R/ R/c#c4 4# R/ R/  R/ P r00 / R00/bs_notimpl_%s: args at %p$O- mmap- r_1- r_2- r_4- r_8- w_1- w_2- w_4- w_8- rm_1- rm_2- rm_4- rm_8- wm_1- wm_2- wm_4- wm_8- rr_1- rr_2- rr_4- rr_8- wr_1- }wr_2- wwr_4- qwr_8- ksm_1- esm_2- _sm_4- Ysm_8- Ssr_1- Msr_2- Gsr_4- Asr_8- ;c_1- 6c_2- 1c_4- ,c_8P0 PQ 0@o//- /0/-/-/-/- /$0/@-`@P (pW @/ ,pW0  `//p@-@$0P`P !0"8`<` H @ , H H L  H  0  (0pwwwwp@-@$0( S 0p@4 ,00,0/0 R,00,0/p@-(0c:0@ T:PUpp@-2@02 P<0#0P20C22S ㊈Upp@B; p@-\0!C !2 Q02(0$!  (0$!p@R/L-, 0((((S l R B|R/xRi-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R  /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L-ȩ 0((((S l R B|R/R}-0 B RE@P`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p R@P / R@P`p@P@P`p R@P /@Pd R@P@P@P@P@P@P/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L- 0((((S l R B|R/wRh-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/ # ($0(000(/ # ($0(000(/< # ($0(000(/ -L R l\000Х000 R 0 4 8 <0 R  /R000Х000 -L R l\000Ѥ000 R 00#40#40#40 R  R000Ѥ000R/ 0 R0#40/0#8 80 R/R/ 0 R 480/0 R## 8##,0/R/0@-0#88@$HHP%XX,ȠȌ8 R0R/0@-0P8$#H$8#0@8%#X%8#0P 8,#, 8#08.#.8#0 R0R/C-R :08PHpX hx R R:x08PH R R:080 R R:0 R0#40R/}A-R:#H#8##H$%h%X%%h&''x''(,,,,.Q R R :#h#X#%h&$$x$'( R R:0 R#X#H#$X%0 R:0@ R480C-pPM`0SZ 0 S S SQ !SV 0 @0 R =R DP 0=S@V6ꄙ@@ș@ܙ@@@V 0  SR0T=S0(0 yP@Ѝ m  P    ]NP 7@- 0@P P0P R S @ Ѝ0@-@0 }P  嶺oЍx-2`? @C @P(PP`5P6(5?3`x/x-2`? X@C @(0000]ߍ`@P X @P0`(0 0?PN@ @0 4/@?T>P @> 4/@?G8H1 !0R$04$0/o/s@-`P@P!0P0sJX03/03/0?00?Ѝp 0P 0S00S 0@ S 0@PQ __p@-A0S! 0S\X l\0_03/UA 00<000S: #: " ! 3\ #30 00C 300%& %6 " ! \ #30 00C 300000C0Y$00pBB_Ai!i ^^1?/ //?0 0!0S 0@o/ //0/////?  22//-P/6  N?  "2/!N80 Q @-*O@P O /65/ N N N5 N:6 N: N 1,   P QOO/l  0 Q!N:O56!N:O6!N Q* : QO N Q* :65 QO N Q* :6 QO N Q* :5 QO N 6 Q N N//$04s@-0@S  ❘(00(0/O- R\bY I* b$\" bin_cksum: out of mbufs p 0 A2$$pgQ/pWq'2'/QRppA@Q@`  `  @  `  @  `  @  `  @Q@  @/ Q@`  @  `    Q/0@cQ@0  0  0  Q@Q /0a131 /!# 0(0000(0 # 0(000000(0 # 0(0000(0 # l0(00(0\ # D0(0!0(0, # 0(00(00(0H00S/@-@0  "!$0p03/0 !!h`_03 /0@-$@4 >< 4 @ 8 L < @ 0 < /p@-P$@4 '40 <080" @0<0 L0@0200< @  00p/$ 0L 0 00/-1$ 400 001!00<p@-$0` @ P         $  ( , $ 0 ( 4 , 8 0 < 4 @ 8 L<0@0Xp<0001X1070 0 0\1pO-81MpC0 40$P刢!.!n@L0` 1017800qm=` !.p!=W q0000 0 00 `L<`划0@0 0S101ߍ@00S/A-P@`q& @00S8$0            $ ( $ , ( 0 , 4 0 8 4 < 8 @ < L @  X0<101101= 0\! 6 SSO-0p@`0M 46CSЍO+t 000 0$00 L04`0C0C00nЍp!```Q 0 Z0cQ 0 J<!PP81\Z 0  PP  P0 0  3/ ZPu U  u L0 0C0CL00" 0 0 0P0P20@-0t 0@@$!0   80$ &08@1011@2/L00C 02/ᔬ@ $0 " 00000 0 0$00(00,0000040 080$0D0(0 L0/S$!6  P 0@-ZCU0 lPC^ 1 0 L00L06&0 6&0/0pP 0@- @ |M l Q \\ QQSH0t S0  !0 @m|Ѝ00!R 10/`p@-@P Pp `0 S   0@-4 0S$ @ ` G-82p&xM &  , ! L   PALPRcF0@!104C T*0FPALPRc0^S t 10  !0 PImxЍH03!0%@ 0 :/P> 0t  0 !0 P$@$mxЍG|0@ T03:0 H@      "RD$  H0XY ,rS@ Y `_^^@<@@l@@@BO-`P|T&o /@- 00@P 0S$020 0 P 0S 0 P 0S 0 P 0S 0 P 0S p0 P 0S 00|P 0S#020 0oP 0S"020 0bP 0S"010 0UP 0S|"010 0H Pd 0Sh d0> Pf 0Sj @04 Ph 0Sl 0* Pj 0SnЍ0Ppr!000m0 Pn0 Phj`!0@00e0Pfh0!000c\0Pdf!0:0a00Pbd 000_0P 0800Pp 0800P@ 0700P 070uk^2`^`^`^`^`^k^-l^6l^`^ ^_^`^`^`^`^`^`^`^`^`^`^`^@-H00S<00S0 00000Ѝ^^00/G-Sp@` @ S( S11P0 @D`Fp@03/ L03/X(@`pGP@@0P3/ L0G/RdP@03/L0 D03/ P03/ZPH03/T0``_d`O- 0@4`lTD r0P\qX pX>  R7: R3* P N Y  L\!TWX# D p(p W*Y ) p 0S p    0@[ ЍpWr P@@- ^ 0P \0 B^0 \`^A-Pp4`@P 0Pp 0<0`@P00 (@0 0,0 r4G-P(p0,P0PS!@!`!*Ѝ V1Z 0 00 0:P  `FP@VU0,00,0000,000000/O-0 `0  P2d0 ЍO/@08"p0 S )4S 04PSz@@d@@@V @D P T*S0IY!80 0 @ `FV @DP T*0Z*IY! 0CY!-0 0 A3A3C?o20 0g @ `FJ0V @DP T*0Z*IY! 0CY!08 0 0> @ `FJ$$   Ѝ_\\a^7a^C-@Pp T ϶ Ѝb2"0S@&0j0O-M 0S0>W:W: 0(% "S  R 0 [0!> zJD x>\[a^p@-PN@N@M 0> p@0ׅ\x>@-0 PS@0S 0#G-p`@00hTЍ PZe 0 YUP! 000 P`@D@-P0,00000`S3 :RP00p 0p0@80$0p00P0,Pp`0 ЍrO-p , 0  (0MP @0800T0R0S R(0p,0001000ЍPU @0A#AR ODD P P P;/ \H0H00HP0` B0 0 0 H`P0``>0 BB6*a"*UbY 崨0 0  0 P PE\ 0 H0P0 B$0 00007 rO-@P0,08p`00 SP Ѝ0W0P0S` 0 W10 0  pG0P,00000O-M Sp@`Q:LD0  0P0 T P%@> P @[H0@@ 0:S P%0:0PD0@S д Ѝ2 O-@MLT) Pp` 㸰@0SЍ0S   0 00H0  0D0 0@00 0P `@H@ D@xP@-@P`U^p^0.b Q  0 0 ^ *4 0L0\!>00P@-//G-)0PS@XqM` $ R  (0+0  PVV0P00 0 Ѝ R  *0PVV0P00  0 | $ R s (0+0 PVV0P0 0 0\wa^a^a^//@-M`@PT#T<,'H80'<4UH/, 2?0Rr pB```@Q```CPPP T@%PP `1l p 000T0  @Ѝ@Ѝb^$b^1b^``$a(a,aaa>b^wb^b^A-HCM`P᭹TYЍARI  !pŸ *Q   0"D3Sȳ0P 0Sl ⳳX!\1- L < ,  WT3W0pW0! 1   G R#T3}T3@xT3  tspql1l!0S `1*B0S P1F@T,,ZT3   !1@TT 0 0 0 0  |W P01GT Ѝ 6b^ _\i^b^^^Q_c^c^c^c^-c^b^\}^lc^yc^c^c^c^T^AXV:c^Gc^Sc^`c^`A`A4`l`S^c^c^c^C-pPἸ@P03/bTD03/0L30HP30?,7?07@sѸ2C 002  00d2  00H2  00,2  002  001  001  001  001J 001N 00h1R 00zL1V 00r01Z 00j1^ 00b0b 00Z0f 00R0  00J0j 00B04S ЍC+d` ЍC<_-d^:d^Gd^Vd^sd^d^d^d^d^e^&e^:e^Pe^fe^we^e^e^e^e^e^e^ P-`@P p!c pЗ!P  R $LIpL 4DO 4/!`@S`!W , ,`! !oDЍReset vector called, LR = 0x%08x-DMO-pBS `!W , ,`! T!oDЍN  0O   ! "`"Рo+ T R2 RLDLOoB@   P 4(S0" [04UW  P P P  P A@!T@@@0 (0 w0P(W 孼W [ 0(0L0Ѝ 0 0t  0] 0 S{ S S 0, (0A`pPzO0@ 0 x 0(0 8< 0\ '_\n^_x>$o^Ro^qo^O-PM1s0100S , !QL@5xxxT6 T*h10S0 1  00 `P6 0  wP/ t 0 [0 0a`Pzo`0 p0  0 0 0t ̸0 0 0$  00@4@@0  P0 @TL@0* R @+Ѝ_qo^O-p1pd0P@3/tXXaWTʀ 0! $ 0    !U U+ U5 t?oT20S00 0!t!0   , ! Ѝ h?oT20S00 l?oT20S00 _Hzhzlz/\o^00P (031000Co// !:!P/ 0  P/@0. 04S/Q0 /0  @-C.@-G-08M@pl00 00,(p$@ @@ @`PGw0,0L0 0D000000(p$@@ @`3w8Ѝ1_a2q^0S;0;0 / 0 R/<0P/0*4S/0S0 0 /000/_*4S/@-0@03/0BN0_Q(QP0\0 /)Q/R0 S 0@0D0/S/0H0_Q@-@ (4S80BNX03/00)4S0<03/0)4_p@-@0Do A("(RP p$$Ph$! ,$" \%R 8Aq00CS0p0 p@ f bd@-@|0T0S$D 0SX* 0S@@P*<0QD$   D$ @@DD @a0 04Ē Q884/0H4S/ aT H$R t@-@@8P 084 $ 00|4a x>@0P/-    B B  P^^ $ B$ ( Q !! B B!! 0S@0P//O-PP4LpQTX4Q9 @䀟䠟fU*%*1QP \ : 0010?0@03/@X0Ph%!1XLP L0뚟@03/@Za_ :q^p@-0PXdT4S N@l $60L0V L0?4`003/03/+6pa _p@-D@[P\y_0``003/03/`p\4P_pa_0O-P` @P\Q pQ00؁U00SG R㼑= Ѝ ^^p Q@` WW0p0U0 WU0 `` 0!&Q0 !SL   0-  @T00 ЍO/QᤠT ``  U [  R`` `s!& 1!T0L  @ _aA-P @`pTQ 0 "A9P 0`PR  V`p@V0A3100A-`P+@pL(<@([dP_\[_P`h003/`003/03/`hMd4P\4P__耮a_G-1pS@0!R00R0P  \  \ 1!aV0`0ó?0`PQ 0 ^ ` 0S 0PR! S YY S 0h0hS 1S 0h  PU0S0`000<\ P/0S0S/A-@P Pp/ 0`00 00  0 $  B$p 0V !SA  B!! SA  B   /O-P64M@0$0p o6`H4S 0 E 000 \L0(0X0勱gS' 6T&0P0 '6000 0 01,0 0Z P 0P P P0S  0S<`,'X00 000(0S X00 000X05`5T4 0 0S0U0S 0 00C)4S ( `00 4H03/-'Pd$0ST Z 0 X000404. 0 皯,-0?T 4x4ST$0S  $4,'$ 0020P 10? 0S & 0 <&&JiU hE@.''PU LPP P 0 0000Q@  0P 0R  X0  & @iYU Q 张 U(06 <&  (0  00 ` 0  P0 0000 0000 1T!R110011 0404<Y|g&e&X0 |   @h4ЍR 0000 00(0$ S000T0R0SX0 0T4U ᾛ<`% P  *&` 0 QX0 @0`5 X+ 0 1?  _a0f _db^q^q^O-@4M` Mf% TU2T 2x4ST B>0PS0 4pp0V :%AhRW @:p&: :6S1!f0P ` 0 &5?00 V:U 000 Uc0SP0P 4  4 0C4Z% 8P <00W%  (T%[ 000 U00 1  Pj 4p pS  U0 0?$ 0?, 0?0?0 4P00? 4Sf0(4S   0t S4Ѝ 0fO-@p@7P`e4$ ( *60Q000  谟 @03/00 3/03/%  0X4% 0?UW 0<0OZgᒪPP <`T00  S  S80d5 ,0T42 S0`5 _a`0@-0@D0PSM@PЍ00 08P G40 U0*0~!@O-@pdj$T:$003/Og$ZZVUP!2`$5ᔠ?`T:0 0C0#P @0  <@0H咑 00?@03/003/J` _aA-p@`Pd$$$4$*$00S[$f(DF0@00V@U($<01S  2# R>$f$606$fX 0S(H$HJ$J@L W000  00 p@- 0$@0P000Sp`H4S d0)$4$$H P4^h5hE000D40@@DDpa q^O-`MlP@2d#0I 0000 T : 0 S:0SM#ЍO*f$jjf V `!ZP@ p$5?pT*. , 0 E ᚯ뚯R0 <#[#0    )d#0  R!* Jp +4S 0,03/0+4Ѝ耮_O-^PPE@p+#댐匠ZT:Oc# `fV`!P@ $5?0CV0 GQ!803/@Z_O-@p$M`!c"'<01S 01 0  000Y' ^'v00100PqW X [  G EP D" <P 0 #P"_e$Ѝ @00@0 00 0"0皿  뚿$,$$0 !R3 0?  PXcP " <P 0 @00@0 00 0"0皏   뚏P R0lœ\l% 0S 00 H 0 <  0p 0 ꀮaq^q^#r^0 #!R/080/_s@-@Pb$" %60`P 8"0 00<TM"K"Ѝp@dꀮO-q3S$100@-4S0,4T封勰U !0 PU ,$$#2$$0 SQ 0T(4 xDTE|D ЍU0000xdV B.TxX 2/ 0! 0R  2/ 2/  / 2/TT$$` 6/03/00  !!000T(4xDT U 0-40-4|0 3/VBn __10 P0  044-4/@- 4@S 0 4;P $0T E0(4 0@0/ _@-(a  k @Q! 0 4$(4Q!@T 0R0D4 p000 00S 000D40P0D4w!$TPp,tq0000'0$4$0!*10,$020 0 Ѝa@_@-@a0 4cp@-@Pp 4S d0 46?P Pp 1T 0(4p%1q*$g$T  0S0Q D$,$ ,$ B  B  Q@@TQD$h0 0T X0x$R x$ p@ 4DPD$ _@af@g@-@P{@קO-0P 0UM0 0@p 0 00   P@!P ~  qx PUЍ 0    D+600 001000 SZ `B 0&`  1` T4 00#Y0 皟  0뚟y  0 Z 0 Z  0d V! B!! !  B     0 ꀮa p@-PΕ, @@@ <a@= p耮p@-Pὕ,@@@ <P@, p耮O-`x`|Ph O~b@@@ @Q8pW0S    XQ @T0,03/03/XP? P   p0 0 v$ B$ +60$ B$ @ 2'ꀮ _0fp@-@0>00' 7vD h@t1q $4!*$010D,$020 0@01 0(1C0 0@@ @@@U1 0000 @@0 0000@@ @@@<+000@0@0 @@@. $<0,ЍO/ aqr^r^r^r^_s^^s^@0!S@0L4 S00P4 S$0;00;010?/ap@-0`S0@TT!* Sp0XT S`0dUP0SHVP, $EO0?pas^s^@-@ !:0? 00$ 0D O-n0PP04 `nR@` R Rph1ě{`1dX Ѝ@18!L{T(1 !P{X X[#0$  M /FVH0Q   P  |($"(XR#  UB뚿HXH :/JZHt^a|\0>0PT0?0?0000?$:=P($5?[J |t^O-@ᨐ娀zT:00ЍO/ 06Sx`1`! P$5?PT:0?L0 HS @03/003/ qJ_ 0$4 / 0  ")//0 !Р!/0 ! !/p@-PMP# @,`~0t00 \ 1(Q$  ,0(&#,0 <@0?6/ߍpʈ^P002'0 S#3/^ 0P/^d0qp/@-fP P8@ 0BS B 00PO-`2`BM<03/ sr DR0S0,,"S  & P:ЍO?4g`Pp 0Sm #@(tЍO"jP;0Q@1į0 00S|F0p00 I06SP<14A 0 @1:0 0 0 0u^Iu^s@-P `0R18AL8Ad8AX8A z@P1 00 @Ѝpt0d03/00 `40P0  ^@P0000400040@@_/0 G-p `P /Ni~M0@:0$@P $U 00<0 0@0$000 0 00@D@$@//C-H0M00p000LP@0` 0%&kx00@`@TЍ p0 00 Z_u^H \A- t0P0>0\ @X0`@Dp@ f00 CkL0000L0gu^\ O-p1MpR00P `PH0 P@  0S1 S9% DF Fd˂0 01/1/ Y 1! IE@TSP S0  003/03/Y 803/`J$JQJd$}Ѝ00?\_qu^0/\0/x0/xT0@-@0 @RS ,0 Ѝ0000x\l0P/0 S/@- ^@LS:0 0CS(0 Sxl0P/0 S/@- ^@LS:0 0CS(0 Sx@- @ F00@0p@-`!P 㽻@P$P`900n@p@r@A-餀`@+0PU |p R0P R 0L  ᖅL0$A ℻@u^u^7@-Pd000@T T 0PE0%VE$ @ Ѝ00S 0ES:@@0-  0@P  0@@P  0@@P  0@@P  0@@P  0@@P  0@@P  0@@P \ 0@0/ 0 Q/0@-3@PdM *QLTdЍ0  00R( 0 ⦄  0v^\(v^p@-P!@0PS ?!60#Q0P(?0` ; S00,0|0YZ2Xl0%XS40T10P3/P14 X3P S9@A WT00 00p Ѝ\p@-L(0H@P#04ۊX3 @t3$0S$@p@T\@-`MtPpc@`T 10'*"*0*00(00,00 $0$00Ѝ\A-PP@X00$00u0P1> 0P$P G0P17 0009SaSh" 0C023 0tǩQP0S 030 30303:303:33030400,0.04 ,$0 00$00202120080$0<00T!P 2/0P1c0m' #p  *  P1 00AraS_S<00SS #l     P1 p `p , * " # -  "$.* P1 `0P1 0\v^v^11@@p@-l0( h@"6 0TډX300$00p@qP劜P p@\G-@ኜt2PY P1ЍG` D0T`R0L0SqRARA0RAQARAtRA8RAQA r0 00000㢢 R!HFY 0S<00L0S,3d00!C=wЍGhq 0 P1 LP *0G P1D qP R  qqpx3 d00xC000 2@0S *"*E0S 0S$00P1 &p40Cp4aЍG`>w^RT^Tw^T^JAv^/w^v^"w^Fw^LJAX?iw^p@-PT1P @0`3/P P P2pT1 0P3/T1 0P3/P` PpPP10S( L6k@00;000000 e66P1 jw^w^0@-M@ PP *p0B8#8S 00ߍ0:@ <000l$RP!     8@-M` PpP`-*0B8#8S) ' Q#P1. 0,00@400300r2T10P3/P1/4 P1` ߍ-`0u$\@-@8  ]6> "t3Y/(0 , W/ 0 X#@V/ 4 /  Q  2L0?0 Q29#9P0t$@*p@-T1@0P3/PPX3VP DT1PP03/pX30X3X3;X3w^O-MpPӚ`@ HQ 0pdT10VP1 P1% P1  xcc~u={uxu, PE  p`p%axl ⡑P1  ) $5$P] PF~D00,(P$  `^0P 0$?ЍcH0 p moQ Q P\  <8 ti(Q7L1S /0T t#~t WL1 0P!00P16 j?0 X3<X3n?0 X3@0X3X3l tN"> 1sp3t @mP0L1@j $9"1S0!p3`3`?0p * R -/ * Rt0s?`9 Si&i ``Y!<#ĠhlÄ t4X3@W?<0 0?᎜ !t3,t 000W?000W tV  0t#_y^w^x^^y^fy^y^y^C-@P@@0$M,Rc 0`xЍ\X p@-`P0 & P<;@P P  0p@p\0@-P$0M 0 0 }Ѝ0LAPA@-(0 0600nЍLAPAO-hhS@ 0M`L8<X3 03Z p 1CZ 1Z  0 g`~2Z] 2Z0 0 0 BLPq k0pS   Sz*0Sw 1<0 00000 00,0 :601 00:60 00X0P0S`  D` glBQ ,@՜ X00X0 `@帔0YP P!!0S`ЍJ80 ,,ĠჁ ~R`0ЍOЍOЍO 0000100000` 080,041 P0`` `\vdndQLALAA-`0MX@p `P\ $0HP 40 000p0`0Ѝ`\R/00S  00s  @o///p@-P`P10@,0`02X0!40T10P3/P1  /P1p@ny^@@0u|\O-pᅗ@ 0 l`P[x͙pPI1 !)0   0 PUR T1߿P 03/  Tr =(r  Nr 鿄"r  Hr r ʎ @OtTU ɗ۱0t4FV] O0P!0P!0 ЍBA\\@-T1@0P3/P WT1P03/p@-PT1@0P3/P00>p^0   " ""   00H00D000h0\p@-2RP0@`2 R0 RL00P0L00P0<0, 6#p@ /0 z^!{^p@-P@`Pp0D02( 02<06# 2/p@ , 0    , /  A, 0/ @  /O-@pDMT(h0P00 `<0 $0z [H 0 \0p 0+ t0S 3/0 $ _02\ 0:/ 2@ a`8@7匐P 2@ @P7~P80!0d R2  R00p + 2\ h0<(,0040 000$0$ 6哂" 010000S 2< 2p`(`X002 p  2( t x@0'x 00 S0!< 80 S( 2@ ŠĠt0S $3/,0( 4_0 $2\ 0 0,! ,1Q 0 @DX?Mb-  2 05S=00 a`09#80 8802 0<<0A-@`Pp<`3  A᛹G-`@ PP@  㙧,p 0S S8 @ጧ@ D1. 尓 ,/ 408p<003/3 3@ J0#S0RR00R0S @ 00R80KS 40\ $$\ 0& $$ S ,@ "44Q0y NEFXPi'TDG-p`P叴@PP 0,00202?Sb40003/S3 PP;yO-P0M M @0NpP00SV000S/=,Po E000B0岧bS00x2Z4 2  R+00\ [^d R  POW Obd R  Q@000 0# = R8*X0 @00R X@000S0S00ą娋p 0p0p00S ۍ ЍOp[*Wۍ ЍS`S'pW*p W W| Wt W h0#  8 `@Wzi^0~^#^T^~^K~^Z~^o~^{~^~^~^O-|@4MPp80S<0:l=S8>08(QD`V< #" R=/kD`08 R){80 S-d0S 3/ `80SOhpd 0pR00 峸D եw< #"0^0<` `00SQ  00  `090 00 00Gz< `V 7<0 0` <0 0Q Q<0` 0 x~^~^ytA~^p@-P@` PU6p0S \P0 P/ 0 /p@-@P@pp@-@`P0 @Tp0S \@ Pp@-P1 P#UDP3=0 P0 0 00(005@$ ,00$4<p~^~^~^^@-@ 4<@D@-@ ,Ae0S ^p@-@P 00P`p>eecAp@ӶA- a@TpUʀ 0! $ 0    !fe 0  @ 0! T0t l   ! 00 0h0 03/@T \p P HzhzlzV/0S0!?S,0/8#8S00  R 0 0 000C00, 3,0/?Q0, 0,0/00 ( 0 ( /0( 0 ( 0 / 00(/0/O-@ZU0` P ^pp Ǎ=,0帢,<zpsL!DH1003/b#-  Ѝ_?0Q R 0h图100100100 0兾-/@@@^?^G-@p`Nz"d1 0 : 0h0 0$3/UP0V/R $0Sh0 03/P@ h0  03/0V0 ЍG@-MP`Ĉ@@ؿ89`0000 0 00000000 $ 0S882     㹸 P Ѝ@pP04P800@PD00P0t2 X0l2t0G\@`PdPP H p(LL"p0  နB!0  w9!0 F n0!0 N e'!0 V \t!0 ^ ST!0 f J 4!0 n A!0 v 8 0 ~ / 0  &$0 Pb0 b0 qPpӾ 00 0sTЍ@sT^^AA^^^^^^^^^^^^X?`AW^HAO-`00@0Q0z P_ PppJ R/U? T岻2L SARD 420r,, pWp Sp0SpU  QD pW? 哻 Q!C0S 剻击U 偻 PR  PxU p2T SR@PR( 4bQ ЍPR S0Q 0W  IFP@0|`tpJO PRS \4St<. PR @&0T @@Z^:^^i^_ ^$^G^>_m^8^u^^@-"o@-Pd0`@ P0@@d0<0 000`P Ѝp@ڽЍp]^^,A^p@-@PH`$ 0S 000 P0D0L0@@D@mp@RA-@pH`P  0S Q D 0 0 00@:U 4LT0S U,VmP @G-`PᨆHp@0L0!<0S7?yP,$0 ö᫶$0 PaYa t Xp~o┒ᒒP P⎒U⊒ @-^ 0X@[A-@pp0 03/` PYV 0A'aX?0   Q @-0 03/P0S/A-P(Ms@P@(Ѝ0`P0$0(0 `0 03/ 0 $0 0008q/  0P: p 0 `p*08/0P*0=0 888/P< 8!P r? 8 P (<03/ 403/ݵꢀ^p@-P@ 0 $0 ˵޵(<03/400 43/庵p@("-d}P0.X X%,à1 0")!0 <"#1o\Q "<MbX?C̀ʀ^@-XM@X  ᧉ 010 H0XЍ6$p@-P0@$0 3/L`V 1SSpp@-XM@P`X ႉ701H0T@9C>H0 @H0P  0$ 0 0 XЍp@-XM@X  _< H0XЍ0@-P$@\M hV\Ѝ0X H 0 010408020H0P 020Հ^2p@-$0PXM 1`XЍp,0@S Q S 0R,@`X 010 H0nTP`  H X  0108020P,@^-^@-$@00 3/ 40S 3/00 3/00 2/p@- 0@ `4P4P0480(0p P s `PU 09 0PA-@p`0 03/ 0PY4 9 0U 09 00<0S 3/ P0p03/7/PP 0 4pW  7/PP P$0 0c9 0U} ЍA03/$0  PP$0 0 4PUPP$0 0 0 $ 0  ^P ź 0 P 庺PU4P0S ppU 0 9 0 0 9 0ЍA50 0S $0p p00 00 Ps PЍI^d^{^^^^́^Ё^LAA-@`)HoLp@PU  0R0D0 0 TP03/T 0S 0P  P+ 2@PX @˅5020X00,@LpST0TTP@P@lЍD00 04嵶,0X0 @P 02^^r|_A-`MpP`c@P*U@x 0PN0X TBPᆅ402|0PSd020P0$P@P(00 <T 8 U400`0 0 q`Ѝ2@2^|_'^@- 00 00 00  0@P =P 00 0PЍp P 00 0%>0S(0 0TP P0 3/ `PP, PP ꠆J^u^A-@00PP 宷0000P80P0800 03/pP` H喷`0p`0808(0S茄^^@-000 00<Ѝ@-1 0 /ЍA-@00pP0 3/$`Q\@    0 03/P tH(`P X@0001q  1\1\1 R004`V 6/P`  `@T :Ἄ0  I03/tAyPp`P$꾄^ք^P^^Mb^^A-00P0S@S 0# YPP`Pp0S 00B0P30PU*< J7X?xk_0S/p@-0@0P) 0# p@.@-0 03 0Ѝ@-!à0 0  Ѝ@-0 03  0 Ѝ@-!à0 0 ЍC-Pp`@X T 0  Ѝ0 P`@DC-Pp`@X T 1@0 0 Ѝ0 P`@DC-P`p@X T 3@0 0 Ѝ0 P`p@DC-P`p@!X T !3@0 0y Ѝ0 qP`p@D@-0000  0Ѝp@-0@0PT 0# p@Yp@-0@0PE 0# p@JG-p~0(0S P@P qP`@c `OP 0S00(0 3/0000@00p@-P0(0Sp@` 0R000 Q0 (03/0p@@-~0(0St@p@-@`PU0 p@,0/0 3/Pp@-0@Q0Pp ` 2/P D$ @p 0`( "4`#/ 0 /\!\R TR /\@ Q/ 8 R //᠆,@ G-`0$ MP0K p  pp0@*4/@PD00p8@0 4/@PF<1@ 00@P8p0 ,X ()0 Xd000p0$00(h`X0l`射z@P$0 00 0  `P@P $0  <03/ 403/Ѝ rZp@- P@@@4X`TQpC-@$0\MPp`x( X  ʁ< YD00010<@1`1d`H0$0 00p0 0 P 2"0 2"oP \Ѝ@ 0b0?o0cS2   $ $0` 1011SX z 010 80t0H0P X  i 01$0 080H`P 0  rr2 6$G-@$0XMPp`x+ 0/X  B X00,10D <11@`H0$0d`0 0p0 0 P% 2"0 2"P XЍ?0 SX  ᣤ* 0 0141 H0uP @ 0b0?o0cS2   $ $0` 1011SX ڀ 01|0 H05P X  ̀ 01$0 080H`#P 0  2222 6$21BP31 a1/G-0M01S`P`1  V~$0] p00 pp0@0*@4/@P PUЍ00p8@@0 4/@PQp1@ 0@0W@PCp@0 fX (c0od0@0h0l0041(0D00p0$00X0@P$0 00 @0C`@ ᖀV $0@PG@$0 %@ <03/ 403/T@ rG-`0$ M@p0c   0P*5/PP@008P< 5/PPB,1P 0<ҫPP4< X (0$d01S\1 R0 Q0Sj 04PUX  5/PPZ %`1  00PP VU  0o 0$0  p  00lPP 0 8宮YPP  08 0$0        ppp Go57#0娂\1AX0 3/P t5堀7# 000$ 0T p  pp0P*@5/PP/00p8P@0 5/PP14P 0@0㝧PP#p@0 ᬧX p{00@000t40 08$0p 00 PP{ P $0 ዧ@ <03/ 403/U  @4P0 0 n0 pc0 0 0 R0WPX# شґXpX XL W014Q0{  Z Y 0S W  U 2UתժPP+ $0 00 @0p@ 0c{W $0vW01(孪W㴁$1S  p0P p Y#t帱ZW W:1S 1S !p0pPt1<1p!A?pP0  <ë 0Np00p  0 !020'> !RR p0,  z0 S01"90 1!(pp00p  0 !0r哫000V^ņ^ r߆^^7^^\n^^^^^^ć^ʇ^^Ԣ^^҇^T^^^^1^"^p@-P`@v  0 DS P: PJ0 0(0L  rPH TXX `[1ap P0!?A1c L\1q`0P!2 SOp 6e `'``` HLaX嫬pP  rK 6HF `'A`` HLa9P5 T0XX, `['<0ap P0( ?A1c\1L!4L1\gfffH^o^p@- `P`@0  p `l XpPtHu@v8w`0xya | pH!R0BS2l)p ` XlPtHu@v8w0x(y z{a |  p `l XpPtHu@v8w0x yzazꗈ^C-lM@d p$X "y02X~P*00 0`40 ` 0 0 `h0&hS `PbSy$0P 4呫$0 p4P0`UlЍ00S00P080P$0P8PX0 0 3/$X xr08,00X0$P  NP 000P0 M bP C^@-0000000LЍň^C-@`Pdpܐ܀\MX  x$0H010 0 )0 1P$  U   `\Ѝ0 1?o2?pW<UG'p@-XMP`@X LxL0 H001`?oT20S $0$0 00XЍp2W@- 0@8 0 0$0dM 0 03/$0P$ P 0 R0 0a PPPE_oR_0]dЍ$0 X w:020U0?$0;P0QP,000 03/ `iP0`$0 0Q pm zP0SQ0 03/T +P 00 X w20P0 02PP 08 00@-\M@PX w010 PH0\Ѝ02p@-$0P@ ,Pp 0 5P000pDP pO-@`pMP0 0]$0 p0  0 wP`\Y ~Ѝ2 0 (P00SF$00C 08 S"00 Zf 281 000 0P00 00 6P ’+0 00 0d P00 00  P00  0ݢ00 0բ0 P00  0Ƣ wO-P0M@ 0p` 0 0 03/P 咩 Ѝ$0 P0 ?0 7Ppl W 2 0 gP00SF$00C 08 S"00 Zf 281 000 0GP00 0T0 P ’+0@> 00 072t `00 0*0 P00  0 ov00 00 P00 0^C-P@$\M@>R`>:pX  u 0@ #0 01020D@H0=@P X u 0` $0!01020d`H0(@P X u&0160 H0@\Ѝ@A-@M@! `Pp 0 1pA?!0@P !0@P 1 4唦ߍ0 ~@^!0RP/TX QX !X T T !X T !//T X0RX01X0T 0T0!X T !0P0//@-q O-Pq@l9P)m_701naV!n1SKjk9U~o p\`KV ፝v}~} }A}qᏋ$pLP KpPW =$009[ HLPK1 P MC-MPpppQ@101Uo0|1 0p!]?l孧 0t 0p1l!L\p!0 v|Sp|!0 ~|Jp\!0 | m4n010ȁ1ԁ @K01$ F40 00\` V10㨁 t10 4P5/0 4P 5/YP 0 4 ;/U ^ 0 !0  8/` PE(_CSeMk(/C#b?0E,XBkPᲢ1  P !  w0P00 P(00 000 000ZP 000 P (00 000p000ZP  mo0 0l0 0sV4Ѝ@\@-嬟딍^@-娟뻍^p@-@PPpH0. `@@@Dြ$0q p@0 3\x>00! $0 /Hz 0(0S 0@o/Hz@0 !!/@-0 !@@-0 !@p@-Px@x(P嘠 $0dP$0 ,0KO R0(m,04S00!pHz^<B@-@DH0DS 0 ! 0$ 040^Hz0$/HzG-`0p$0PUGU !03 0#(1R$10C2r"0Cr!0CR@C@C1,Pk10, TP2/Hz @- 0 ! 0^ Q    D $ 10@X@@@HzQ@-0DPTp@-$0D0P !@8pA-@@TT堞@pP!@@aQ00, ,$041 0, ^Hz` @-,00@10CS@}0@!,1!,0,@Hz1^<B $0 0!0 00 /Hzhzlz,0P 0 Qp00//{@p@-@0dPH 5/,0p@ /p@-@0dPH 5/00p@ /P @- 040@/00S {X^P0@-  d@/  R 0{{^@-P`+h@`00@<00  p 07/PP70q 2/U/,Fl 0 4 8 < @ D H L P0 L P< Ѝ@赞,P P@ Ѝ@꟎^^{%BȎ^^0@- !3 0 !0@- !& 0 !O-rP`Q@U@Tp  q[0p@ 01@U0 0000TX Ѝ  0 @[T \≐<0  Pڸ 2/p[ ^p@-P @@@p0/{A-`0@P0c  p   021   0 0Q000S$ SAʁ{-^`^A-p0p` R0P0Q0C 0@ E@s @{G-x1TP@Php L廜X 0HS4,0S 宜㄁ 0 p0@,0T`0,0 BX!0q10 X X@ T0 t  @AL ]@AB S @D{^^^^ B!BG-0@pPp0  R( & 0 b ` a.`%RP  Q! 0`@&F @{@-(0@0@{ 0#0{ 0#0 {A-P@0B@`Ap0S  A{ 0#0{G-0Pp0XI@0RPQC E` Z *B<+B +B<+B<+B(+B4+B @ G  @ 尛{P^p@-@@0SpP:0 PpA-`Pe8` `p00p 81@ Y0P   8/P tЍ0t M x0Q  6CQ@ 6AoV0,  0Ao4z^p@@}C`A@-@ 0@!S &BS &S; `Ѝp !S0SP 0SP0SP`p' 0P0  X0P` ` 6/P@0 \` 6/ M0` 3/0S8P 0P  p@`A4/!/!`!//` `! /!!'!/!:!B1/c 8!0/c#c4 4#1/!@!H!P!Y!a@-`Pd@P0@00 p0 7/0P dP塚 d`6/0d` 6/ Ѝ@ߛT^^^@-go 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzA-1p@ 0dP5/0 L ` P0d8/0 48/V *V``U`3V  PZV010!SV0`4P 5/ P0d 8/X?A-0p@ 0dP5/`P Pd08/0 48/V *V``U`3V PlV010!SVk0`4P 5/ P0d 8/Ap@-D00@ !0 4P5/0 , !pp@-T0 @%L04P 5/0 00dp@/@-@ (1(a(q <@Q0 ̚ L KP0 00P 0 00P0dp 7/0dp 7/ dp 07/0dp 7/0dp 7/ Ѝ@-@3X?D3Đ^0B1B7@-Po *x0Àp0F0FS0 iPg0@T :PE@d0 0S B @DT Ѝ0'YA-0P@`0!0 4p7/9dp 7/0 dp7/0 !!@B-0 4 0/-0d /40P 0S/0S<0//|0O-@<0`ZP R \ R *R!SF  R < &    q D @ D<0  D!'LpT P\LX` ,^^N\^ Q  R QX<0SL Ѝ0::0C: 0S ,0S \ 1 !1R !0YH <<  Z TL TYPpLpITP,Z`N `Y  \ X B`\  ::0:0 & SA-@Pqbp`::S!QL2ML8PpD01 .O-P P4 pჟ0  A ` !@T ژ`pW㊠   Ѝ0' 0R S 2/< RJSQ LMLrD q @00P `RA \ R> SJ @  f r > R"4AQ43 Q!, 8\, ,0@8 @8   ** * 0P0 z @  f rS 2/ma0S8080001@bq^C-M`pZa@p0000i 00 P0 5/PP `ЍCpL2傟@   p@W ("(000 00 $(0,0 0S?3 Ke0Un0" nU]]PLRPLP*00 PPp008/P  1 000:88/P 屖)>0:! P!: P<: R? p@ P 0j=0:* 00 Ѝ^^|1^\^^^:B0A-SPp @ሀW@0000W0Sbv000S00 0@H 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzhzhzA-1P 0(0C*s`Ѝ0 d0@ L`P pWQ lQ ,Xs`P,XQ lQ0<00D00 87 H0R0 R1 WH01H0XH01H0 0ps8 4\001  @ 08 0@@0 0s S#4  4 Z2H02,00@008000@@0 0S%40040|A-@P2PXD`q@pWA60@008SQp 0sK 80SQ88   x븁DjXDU< :R!D01 "0D20LML q @T0@0 0s S#4AQ48 ** * S#4 BR4 0R", W S#,@ 0S#,8Q, 0 ,0000001  @ 08 08 @@0 0R", W|ۑ^/-0*T00/-0 T00///- $00/$00/@-@$00 3/$0@0//@-@$0 03/zs@->0`@ P  B` 0ŒQΌ Q @垔0T00 P05/P  0 Ѝp^p@-0P L冔00T0@4`X 6/TX0d` 6/p@2^O-,M^x0@ d0SS0 p(а d0S ,ЍS CS 0C$0PJ(0``03/PE^ 0PP0  (0`\P  3pU^0KB[^p@-@$0 03/$003/0$00) 3/ $003/$0 03/ x$0 03/\XP$003/Pp}PUp3/$0 0 N'p@-0P`@ `d!:/0 0 0 40 3/?d` 6/00 40 3/0040 3/dP <0l 5/ 00dP=  < <T000( 0"(J \ޒ^^p@-@ 04P5/0 0p@-0 d@4/s@-`PMW@`00^00 ` 0 6/P WЍp@$ j[@0`<SWH?8008080(040,0Ѝp@ 4 0 00$0^%^A^thBgBeBLeB@-@ ZP0S00 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzA-P 0 3&*?=0 `p?x0@xp? x0@J4 F@".PpP0d 8/0 dP5/A-@`0p4P 5/0P4 8/`{?0 0%3?0 00 02000%VP4 P0d/// QX0S/X0@0/-0d$ /&g^ Q/0ꙓ^D0S <//L0S <//H0S <//@0S <//A-0@ 4P5/ 0`( Pdp403/0( 7/0dP 5/P\`\p0 48/  U 0PE U AɌX?˓^ѓ^ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzp@-P@`U 0p U ό0S Xz@x0tdP 5/0dP 5/@p^p@-@PT@h@@pp@-@P0d` 6/0d` 6/( d`\06/T00T0spp@-@P`\00\0dP( 5/p@`@-@$X H00H00X0@ ep@-@`gP\00\0d`( 6/p@AQ G-@PQ10 d`?06/4 d`16/18 d`6/H0` ``` `@h0@`SlPZDpPp&5Q  Nj0L0GP彋0 d:/ 0dp 7/1 dp7/P0<0#!H 00`@00  00004040P  <压0L0H00H00X0( $00040(0(@ P T0`^T0XP0T0@`0dp 7/ d`x06/0d` 6/@``p`X0V0C?o20SX0S<0 0m `F ^+^:^X?_^O-0@4P, 5/0P( 4`6/P  PX0S   P0_ X0@0S X0<0X0H0@(x X0L U l X` H04p+ <0p 0< 4:/04< ;/ 0 'W0L00 4p7/H0  <0! 0L0+ < 8/04< 9/04< :/H2$p 4 < (p,pLpL0S@0SP0<0aP [PX0S  `  X0L P0 X0<0X0H0@(S?V\n \8PhV C/P` XpP X` `0HP0H0@% V P0S+9`P I YE0T,0@ T09/`F0`F\T0 T 0D 9/VX0d`$ 6/@C-4MPDS@PW帉 0P 0 P05/`P  `4Ѝ0p"GP `0P P5/N02p0ltNP000DXQ01 01ہ Ѝi^Z^:^^p@- 0PQ@ `M ` 8˄U < 0 ܍p^^ח^G-`@ pX@ 0sP<WP@ @H S0s  SPW/QP {PP P Q rPPP Q iPPP Q `PP W U QPP 7/P@-@HM0@00/X0 @-(/^@-7M<1 S  x [V [ [C Y fY @Y 0$000000[   ,03/   ,03/   ,03/0    ,03/P   ,03/P   ,03/   ,03/PY   ,03/   ,03/   ,03/0    ,03/Pi   ,03/P\   ,03/   ,03/PC0 01P000P:00 0 00,p7/ 0p 00,8/0P000} 0Sz 0 00,p7/ 0,, +  P1+ _ 0 00,`6/P00 0 00,p7/ 0p 00,8/p 0 00,8/ 0 00,p7/Pꠂ  10 01>  0P 00 R0So  ,0   \73/0PP1>  X  X,0   L3/P0S  ,0   \c3/0P 0,0 0\ 3/   ,03/3/   ,03/   ,03/  00X 3/   ,03/3/   ,03/   ,03/  \ 3/   ,03/3/   ,03/   ,03/  pO-M$( yE8@@  03/ P400\00@; P5/P  03/Pߍ80`0<0d00X000 0 P%6R0P0$0(P3/0P 04 043/P 083/`d,03/P\0P0 P X \`,,0 d3/P0T CRhBزBزBزBزBزBزBزBزBزBBP0[[n <1QU! !,@p!;!  9/U\0 0\00 00^@-@M. G 010K/0  $!(! 111 1014!, p1>  ލ|BO-P5CLFw  Q&R4 R(;w@$C5wQ0wC(1$!)w0aVKO0S C OwŴww`s圃0S  w` wVB `w0 S3괶BBBBBB$B,B4B 0800P 5/P Mw @ 8$D0<4>`P2帢42 4HV8wG 0 P Q CPP`P$0- PP ,2 ,4$2<0424242$42(484,;/P00@4$0 0S( R !0R "0R 00  1, 04|1<4t14p1$4l1(484,;/P00@4U@$R0\`6/2 ,`6/PP2 ,`6/pP0,4004040$4$0Pv DPv0 :Pv0X4ЍT^`Bœ^ޜ^ BChB^CCCCC|CCCCClC`vL0P0P PbP@u0H102p@4Bœ^ HBB^^C CАCW^ 0R  BR//0P Rʬ  R: //C-P @hp\ 0s'T Ѝ@0 T`1k#XD  &T09/P@D P 0C-P @hp\ 0s'T Ѝ@0 T`1k#XD  &儐09/P@D 倐 0p@-P`r>|4S @a8Pptp@- 0 R\0S 0 000P00 Ѝ:\p@-PJ>00S PpU@t 0  tOPP xQ tt0x4< 0IPxxQ tcxTPY0CO-M`p>@t` tpP  k P ЍOt 0A(P0000h0 00S0404РE>L00 8/P ЍOY04 04 0S E> L00 8/PB4X 00 0| \6/P p `$ (, d  0hl 0W*0p4W Q0CpT=X \S3: 8t `#8;/T=X \S< x `0;/X=opT=``S> 0| \8/~0@-01 0P Ѝ`<\p@-@T=X PS0@  ``\6/0  VT-X=\RB  0`6/T-00X 8RB  `P\#85/L 0 ;T=X \S`PA0@  5/p@0  +ꐡ^G-BMPp%<U@a 0h#8P$  +PP $R0$=1S 0 # PP r PԢԒb0 T-X=\R ( 08/ PX͔\T=' S  ` 08/T=X \S  `08/T=X \S  `(28/T=X \S ( `98/PUS  `P05/T=X \S  `P05/T=X \S  `P05/X 00`P \5/dQT-X=\R0 ` 0`6/PUT=X \S4 h `P05/T=X \S: t `Pb05/T=X \S< x `P05/X=\@PT=S0> | 005/0 SW0l l 0.POBߍ$Q $]0C:]^^#E@\G-`@1;Phq@ X P G@q 0( 0X= \ R R! R pWT-0R@  9/APqpP0,=T}:n 0\ R`0P xq G^ TP 01qT^Bœ^Bc^^W^G-p@ `APCQR  U010! A-P@` 0$ pE\:n X0 A\ ^G- P$`(p,00 N\:n AY Y@0 G V @ AT/C-@P@@0$M,'c 0`幈Ѝ\P p@-PH0 & @4|' P t1  0p@p\@-@xPt`$0M\p`'P t1 0040 000p`00Ѝ\G-p0P 6 0`0;'x0@U  Z40 0 0誉Ѝ0 00:/p \vd@-@( $0$$"6 0'@\@-@`Pp<<0$M(&(0 00<Ѝ\@-@dP`p$0MH`&P t1 (0 00Ѝ\0@-P$0M 0 0 "Ѝ0B4B@-(0 0600ЍB4B@-@w9 1R0@-80( 4@"6 0 &$p@\A-pP`@X9^ T 0pA/@-F9@ݑs@-P@?9aV 0@ (6/@P@Ѝpnnvd^@-o/@-p@-9@R_Dt1_T^BPBBW^B>`>p@-P@RoԮQpt! @-0@( >P/f>ᾄó cGpX?^L]L]p@-@R_jT1!0CST1Sdᠮp@!p@虮0S$00: 0S 0S/0 d=;d=/0S0 d=;Ód=//Q9 )R4 -09/00@-DM000,00(0\0 0T0@00P0<$  0A<0| P jDЍ0躣^\^$M]ޣ^A-@PT=X `S8 0 `p\#87/T=X \S8`p 8 #87/pT-X=\R 8 08/  pW0 tm9<l=D=S3  u60 ,j9l=hml]衆^ ^O-@0P `phPh=Sl=SX=pT=\S6 0l ;/l=0l=d=   P Ѝ T=X \S6 l ` 0;/T=X \S6 l `0;/l-k9T-l=X=R6 l 0\;/ P D mT-X=\R6 l 0;/ 0P4xV@^@- PU `h=@Sl=SX=PP@pT=P\Sl 06 7/l=0l=*P ЍG-@`pPT-X=\R0 ` 09/D=S+yXT-X=\R0P  5/x0PX0 `l<T=X \S4 h `08/ 0 l蠆f^^000 ͓0\S㛢p@-Ph@W1 01  hp@WG-@}`J1吀011S #S3P11011S )bPP 10CS1bެPp@-@mPᓬ 10CS11bp@Ǭ=  -0=X T=\`S4 0h /D A-@P`}X= 0\8/  D=S1pWl<T=X \S8  `p#87/T=X \S  ``06/T=X \S  ``06/X 8 ``\#86/豤^p@-]p@1-P Xk= S-<<h=0=0>03p Ф^.M]ݤ^ 0!< 04 0 (   !/HzhzlzO-P@`0ȐpW # 0 Lh` V 80000@@ T Ѝ^\ P/0 !8 00 (  , !/Hzhzlzp@-@P T⹖9S 9S 404 0@a 0 (9p@BX?gfffBD=S/p@-@=P0C==0CS=>3;3p@hBA-=PS`p @PVD=S@ 0 &=@S蠆A-@p !P`P  0P Q- 0T  \jЍ0A S  ,j 0  -^S^@-@00PPЍ7@-P@@=S 0 7 00009Sd=000 PH=SQ  OZ09SXB`B`BTB`B`BhB`BpBQ Q   Ѝ0  DG-0Q@pPxh0MQ w0ЍQ o 4=3/|7S (^h70?0?h70?|7S 0 0@a 0 ( |7S H/ox""0 \  R # 70~Yq 7B^X?gfffBAp@-PMM@x#cP00C0S0ۍЍp S;0#0Q0e  Q  QH @=SA a"Q{  Q: @-RX"QN ["Q[  Q* BQ@-\ RE"Q 2Q*2Q-0S00?600 {@2QQ 0CQ0Q 5>8#8So \|T`  70SS`  /  ("(  Ud@=S d= 0 CP6M0000@=S d= NR d= 6M0@=S d=N0@=S d= N09S >S$Q:0SKL  S* 0C#1L 00 6@=SH0QN0 N P%F*+:iA-όp` 0P@aP 0 `YP Ѝ!@-0  ЍA-`P0@p8=3/h7 T 5h72A9#9'@s@-HMPT0 S( S S@@n R 3 0tte h@Ѝp@S@ S S@ S@@S@@Ѝp=M]^O-@lM@=S D=Sd?`< ,05=0>0$0=S >S3;3lЍ9S9 YU 0S990090C9Z0 `06 p 0 P 4 0 03/039Sb.030@]  \P303TW ?9SOP匨U HPU 0S000000C0z_ Z0(P 0 S30 03/ApPG2 0 ɠ#t PP\"(0傿)R d- 03\ʔ#G   0 妦D9Sㆍ P0S ` P 0!:> *00! 420a08/ᠾ(0"0D100 0$00KC195 S) 10170< :0(0 501=0,0P(  0\!X6g3.d=  P 0 H0 0YXZ Z!0  b 0  A 0 PD10=   =0C== S-0B>0>pꨌMM]^A-0=@S 3/`pD]U  PP `V|fPT=X \Sd 2 0``6/T=X \S4 h `` 06/  NЁ^A-S@\`M 3` <3 3`0 `ЍP bVpP :0E?o2P0S P   -4W00`pPVP3<30A-MM@p$S`PPq`l$A0Vn  V7* V  V @-R ,zx $VG ? V Vr  V@=S0 S0N0D Sg*$AS0N0; S06M05 AS0N0/|#VP+  V* BV X RVd=B @#V  ;0#VV  BVd= 1A 30 0 ۍЍ \ R\P@-R 6  -3 P Pd= 4S0N0 S0N0 VAS06M00 PrP 0C. P 0SP@-:R .0?T0:@=S >P@=S 9S H=S S S!Y0>0P30 00PPz0 00@=S2Po 9S#Pk 0P Pd P9S9  09Z gPP S9i*F%-? S/@-@pP`,M 2 @2"0 @,ЍC-3@@DM > H=S  CR)N <G a3@ > d=;d=9)"" 2PP 3@. >DЍC> P@ 12[0 l U C2@PV0@0 TP3@ > U DЍSP- 1R >  =H=  S9S `P^ PP0 S 30| Q ;S3 #d`P{0 PP` V@p * !(#u]$ 0d- /p7/@=S/D=S/=G-@@=S`떟p  43/=S-D]UT=X \S2 0d `:/> P=0 .:^^XW3XR=3 ,=3/@]G`O-@P@MY,=3/`P0@= ,a*H=S989d=0d=9SCCCCCCCCC`P  ?< ?989H-R9  ;S ږo #}> p ;gQ("( ;px0} 0U10 @9  )%$ ~  d=   d=  d=6   d=  :S0?ӥ=t /9S H=S)> L <H=S $> CN0\ ; ~9S 3   s9 : 00 x0======H=Sp3iYh3f 0>>0.>0R 3;@030)9R3S2T=X \S2 d `P05/Y 9S HQ  9S9tR:k@+R0 0m`Ѝ  H=S ?  00C0S0020ӕ fڮ۾=-  P  b `bT-X \R0 ` 003/ AT1XHb<`T-X \R" D 003/T=X \S4 0h `8/= [0=S0- 00@Q PH=S 0 y&^  -%3$M]2D 1r]8 ӥ^ ^^p@-P`S4P@@MT @:˺p0p@-@2@=Sp>PS 0CS>02l_p@>S 0CS>H=S >S02p@OA^C-PpM*P@ n`h@P $Ѝ1Y0CYD1Ye 1Y 9 - 09 fx94P@4 =#@=S M\1Y7 1Y. ϩ@P#@= S7 9S    @N S 6 4P@3@ @yR0 @0 0VT@P4P@3@ WH=S@2iii9iO-@=@SdM  i*P #X=\@T͔ \4 h ` <dЍO/0 000T-X=\R0 ` 0P5/P  . T-X=\R @ 0`6/<00p  0P 0t+ta2 9S2"ἴ'804;[:9S { T-X=`R" D 0p\7/=-0C==0=1 < .& nT-X R$ H 00\3/00` (0P㖯! 0@*4`= 0.#3 ;3& ET-X R$ H 00\3/<0 0` 0 P▯4 0)`= 0.3 ;3 T-X=\R  0P5/` 0p`1)S q S  BS T=X \S=4 8h `P#85/= /3  d=0S P 0=00 S0( 0=T=X \S`02 d B`P#  .-0< 01(320@@00` P! (ǟ:|"!(.$΃$ *00! " ( (.@70 p07/0)0RSЪ 3P 3 5*8S00C8uq' ᝇ*Յ0 0 0iX"tt\2 `P [ 0_ 8⠻P 0/+)` V0%.F'K+~Qp  ➟0H(མ=[)0@%\_= -JZ %,w_=0= ؆0F&>=~)0 S$bRP \_X l\ h\ d\ Tt [\VtV\pT\ )pXG&n` K+Q 0 /؞w0H(མ=[)0#_= -JZx#_=0= r0G'>=np S0 0 02_0CS񟗃`"C#C"C"C"C#Cd=0d=9S9Stv `43/+jd=0d=fH=S >Sl"PZ 0>W9STd=0S9`S 4Q`PEUP#D뎄 U >^pP>PI 0$ 0 0$ pI-00 02` S02́"0000H-Q0R RJ RD2G  0> hP``:g>  +L0>YP 1>#F&U   0e1  ?& ,22?2 ?"LP0C.>2>2?5?# R #.+t>^oDkM]U^M]M]̨vM]l^z^^^48|æ^ͦ^^^^?^T^M^O- @ $MP( ([ $Ѝ] Y 'ST=`X S2 d `P0\5/T=X \S4 h `Pp85/0D= P0D=U_}0 4"P  1PXB  +zZ0p 00 pp&ZH}0wQ R*Z0H=H=S10S"tZ0H=0 000X0 0d1!42# 0L= Z( <0(=v pZ0H=0dp0 0 1!ᬆ2# 0H-P=R0&SS+ 000 j P0@S0.S0-S0 S0H=0 00C 0 B2# 0 B2# 0 B2# 0 B0P=<&H=S% S% EZH=帥帕S L}dd|:9"a0@gt/ZPdo k:9ȏ"a@h 00Z& * )+5),|04p@04\r0404043099!= 0 &P *]:0㠠 0I10S S2 ԊJ베YH0D PG0  SBQQ Q"< 1=0:H=S0 d=  0 P0 d0מ0d= d-H-R' R R;P d-Qb?)d= lQژ0d=\3Q8<9 9<9< !S:St\/d-P-R2R9;998<9 9<9<  : (0 P0S909 0 0x 0 RPl 0SiڴyX )>02 t=$2(x=6=⾀ᰀ?Kṙn44=4!8=141:1:141=1=1=1 =vM@p1X 0>9/  ^)>pp1a  8U)>p0T8<;Kj>0d=$1R| xH0P-d= 1R9 <9 p@-@j$P3 3@0 X-0\`PT-R2 d 5/T=X \S`P4 h 05/pR2 d 05/T-X=\R0 ` 0P5/ T=X \S`P02 d 5/p( /,4S //0l#R" /04S//G-@0Rbi?0ഐ(0 :/03\"0:/(0 :/0/ 00\"0:/\#0 :/#)4\:/(0 8/03"\08/0/ 08#8R0003ЍA-B肐P`,0 3/,0 3/,0 3/p,0 3/tpO-P8s@0S䢐Mhx&h'x0G`+0 L`F HH2$43/02002嘝K`ᛥp!: zb0@0005C\3CDC3C4C6C\GC?Cݪ^@-@4S@/G-3PA@,p0 <300Y SH bVHF3<3> - 2X>00`V  ,P 3<300 UHG#O-pPBbM?spHs 0(:/03"0\:/ 0(9/23H0\p$#7/0\p#7/0\p#7/13\p# 07/0\p #7/,3S 0\p#7/\p^3"׿7/\p0"7/6>\p" 0`37/0\p(#7/0\p#7/pp0 (9/03"A0\:/p(p0 7/p0 0\00 p:/W +pŸ0 \p/0 S ꇫ^`ICKCKCJC8C^CHC P 1?A3c0}\\t]t@{t H1@Xt@jt@mt1(@1(Mb31S/ !t       000 `0/p@-@^` 10 1@1  ``0d 0 `0d 08!@0 0-10BRS-10-1R-1@0-10-!t3/&D1Sp3/0H1pp@- ?`P0@ @003/H1S P 0@0Sp\G-P0`#0?H1S@_P 8!(pR' pP⨏YȀ6$0( S S00@ 0990`1S @1S bpP,@ b,0B 00351 p"  4!  *!?   *! +m R*!4 1!4!0)1(0S`1kS*12!0k8!0GtpR/1v00q R0 00 (0KS0ږ S~0A0R.1.10.1(0\1`10@1&10!!RF !10!&108A00 1 10 10%1] 1 10 1-81S'000003/08m#!Rj #1fR*!1!4 *!*!*!  }S*12!0*1 0 0 0\8O-t0 vpTM`? @PpTЍ0  1S \P P0 pxP 0*=P0@0S`̐@1S 3/P ,Jpq0H1`0d 0h0S ܂0` dQShP0 h00&0-1@1 -10-181S-1P0 0CS-10-1t-!03/03/'(3> 8 !i g0$@=L0K<1h t0L L ,0H 9,0,08,0,06,00`1V1810<1t1D1寏ᜐ  111@1 01 10 1 , 6 0 pP0  03/pP3 0@00S-*ЉaSt Rh00SZ=9 R =?A3c2#d S 0"#!0 "#1R 0 34@J\%^MbHH|+8X?]p@-0 `"6 0?H1Sp@OP 31S ^ᇉV 1  10 ᾉp 10 10%1 1 10 1<\O-H!R !P %!PR %! A(0q 01pBR0  R<" 0"  @W`0@S @DWc AN.!  BR!V: !K !  !-! -!8!R:-! -!90@`FS AV    R<1! 0 03/p !  !  !0@`S @D` BR-!`t6/ ! !  !$!R ~$ƈ'a(A(5!@ 0 2/4!  #! #! , 2/"!R "! $  h0Ar0,0 ЍO/ Ѝ8X?_CO-H1S~ @GPy  tP⁈03/81` SP4f03/\,!03/03/`81 S 0S @0P 3/10u03/ 5 R $ Q Px |  Q $R0x0 x 8!R0 !e `V03/03/`h0Sd`VG K Ѝ3/0>  3/,!0 3//!03/0!03/,!03/ 03/t03/ pW03/0p3/ 0xG0 3/0k,! 3//!03/0!03/,!03/W0 03/  &1S 0!&11!aV 0V`!p0!7/10C110103/`1 ‡%1$"!0 o 2/<20S  $0 R Q x0| 00 P04S x00IS 0x003/ Y 10%1 10 S 10 1 Y 10 181S3 0CS-100-1-!03/03/'at!`&`'  L)! (! (!)! 0110$1-1-1 -10-1-!03/!1S0!10"1^Nj'H|_^*^H@-@M<4@A-p@ `0S @S0C0\0@3/\03/\0P$3/l00S "SRH x0|00Q4Sx00x08H|_ H|A-`0@P0 p0 7/pP pzVB `0H3/ cpPKP 8 `8/ `0<3/V `0(  (3/V`0MC <3/ `043// `0,3/ `0<3/ U `0H3/ `0 3 %pP V8 `#88/0FS `083/ `003/`08 3/`0 3/E$`0 3/V@  3/ЍC-`ph@(h R0 `PP 404 x ?(Glpph`t ЍH|_Hg^C-@0`pMtP0 0``E     4pOL  ⦅081@0f-10-!3/t|>P0 | Q S*  S  h LH60S t0h,0P ?B81 0CSt,0Sت 0S0@00000810C S񟗽`CЌCCCC̋CCCЌCЌCHC000|e00 㸪0K  X7E0  0D0:E뗏454eAl1,5Pp1$5t1 z 0 1W *10*1@ d 6d#::d` 0l$  $00Et @1S0H1T0< 0Q0 Ѝ000d00@000d00000c00000 0003/c000 0003/ct Pt0 4`x6/  `R006/(cZ0 006/ cR0 003/d03/Pb03/Pb`0`0081 S= b81 Sx03/0` 3/ 03/03/ 03/,,0 3/ 03/03/ 03/ > < @000;0a>03/ 03/ 03/03/P0,, 03/03/0P 0     0 03/0S` S`0 3/0@S` 03/CT^N^Y^g^CH|_y^'Ҭ^^^^C8pCxCPO]Vu^yCެ^^^^^^1^^^^j^^s^^ʬ^}^0@-@PtM0 0 00tЍ0p@-HP0S p`@<P 0ST00pH|@- 0 0 t3/p@-z @tP 03/03/pp@-k @^ᕃуp@-A-4@@000c"`\p0P7/2",p7/$  #002#,p7/ @&& 0\"A/p@-4@@000S"P\`06/"\`06/2#,`6/l"?0 \` Q- ( "(R0#6/2#,`6/l2#0@000\`6/"\`06/0\"p@/A-@0B03 \P05/2 ,P5/2P,` 6/ `? 0@S! ? P03\` &N6/0 娙`xp0 `⻙VAڙH?$P@ 4?0P,|?#Pɭ^^^1C1CO]^^#$^O-P \h ( ` ,@,4/ R@ Wd0 0 ,P5/0D(0@0O-P\h@RpC$Mx102c000`0 00Y PP 00$10 0S[Ѝt0S 3/0 \$8/ 㪧 ,0,3/[ t0S 3/0 \`$6/ 㒧 ,0,3/ 0`S  d0 }0X?-^\0O-@M0Q05php  P@/ Pt0S  3/0 \P$5/ T0 ,P,5/t0PS  3/0 $\:/ > ,0,3/I YʠUUPPPPPePS UXt0S  3/0\ $9/0\ 9/0 ,9/P0\ P9/0 ,9/P0\ P9/0 ,9/P0\ P9/0 ,9/0P ,P9/PPZU00ЍPt0S  3/0\ $9/0\ 9/0 ,9/P0\ P9/0 ,9/P0\ P9/0 ,9/P0\ P9/0 ,9/0P ,P9/PPRU |0 3/}s0 ,9/p +40\89/  {0 00 l0P U0 $0\P 5/0 ,P,5/rPt 0S54 t0S  3/_0 2 \$0:/ . ,03/ ,03/ ,03/ ,0 3/<0S ZP 2"0   X?$0$P 0#! !0 1/X?MbG-P\ `@0h0p@$S T @@p@0 4/Ѝ  \`8V@0\t$1D 00:/P@\' S"PT0E 0 0`` 0 6/@D @ d 0D9/`FVH0P@`S"PT0E 0 0`` 0 6/@D @ d 0D9/`FVH0P@`G-P\ `@0h0p@OST 00@0 9/0P@T 0 ,@ 4/Ѝ  Q`4VIX0P@PT`E0 0 8/ 40@DQ T$1@00DD9/0P@T@$10 0DQ& S `VI0P@PT`E0 0 8/ 40@D@0 4D:/  `FS `@0 4D:/  `F@-@pP}`P0 , Ѝ@ ?0P ? Ѝ4^?^R0 R R#+ H@-<@=#+## #/#+## #TwM^x^O-\0@@hpzwP3P p@K O 㐤  P |0 ,,;/,0 ,;/*0 ,;/0 ,;/$ 0 ,;/"$ <"0 , ;/"( 8"0 ,$;/3- R p  34 8\ 0 08/0 ,8/2 420,8/", 4"0 ,8/$0 0$00 ,`6/$04$0p  34 8\`  0 06/-00-03 03 v3 p0  Ou 0 0 0@40 \`86/ TG-@`hpe}|03/<08 PPUPR40S0P U`  l= XC> D=>@;>p +\0x!40\8G/Ꮾ^^^T^ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzp@-@`$ 0p@|P]vP\v 0T L0D: 0 0 0 00 0h0 03/Ǯ^^l^^^O-\0`pQh@P t0S 3/ 0\$;/ p +40\8;/}0 ,8/p +4 0\88/ Wx0S 3/ OT(0,0000/@-@0\LshA-`p!P @{X0VP`|`hpY|\`U|{  C0 RD   R8  | R, |  R  X R X s,C CC\C@-@0Q !@\0@00A-`P@0S P 0q@P :PpsPp@-P@#tp@p@-0`@hPP 0 \00 ,@,4/p{P 0 0 0 0h0 03/P 00 0pp@-@P{p@0,uO-Pp@004{Y 0 S0 0 ЍO0  `P` Ѝs@P`  T0 P  0ؼ@@$^O-@MphPx{lGs`P ߍOq{rP! \0W%p  P@<0 R80S@p<0$RtQ{ˡ80SOʅߍr80S<0Qt0S 3/0 \p$7/ 㮡 ,0,3/p<00St0S 3/0 \$9/ 㔡 ,0,3/<0 R@ 8 R4S@0 w0|r0Sz<00  z<0S( 0 wP z0"vwz < wP z<00 Rp    z`mt0S 3/_02 \$0:/ (X0\ :/0 \:/ ,03/XP<00 ,03/P@ 0p<00 \0(0 2 \$C\#<;/. 0040p1 P3 3 p +4 0\89/3,   $r -0P00 pP* 00 0400Ba 03<3$Ѝ 4à@  P ^8pP pP#8 㷞MbX?LCA-P\ 0@ph`t0S 3/_02$\p 07/(0\ A/p@-@`x 00 07wPP 0S  0  0` t08 tU P 0,q p@q;^\ A-@P0hp`T T0  ,0A/0 0 8/@D@4S/-2 \#90/@-2 ,@4/p@-P@2 ,`6/”0P\0p@ /@-P`p@~(@Đ0A\ py ЍO]@-P`p@k(@Đ0A\ pXy ЍO]p@-@P0 \`6/ 0 \`6/ڝU0\ p@/PG-p@d尐PV㬀ʀ 0! $ 0    !&x 0!d!0    !0GHzhzlzX?7@-@ &^0202020 DR2|0@4S0000 |v2S " " Ѝ0@нCCCC1C1C@-@ &@w@-&wPp@-@P&w2020p@-@4@SS&tw 0@X?@-@&@w/@-00 x ЍO]@-@8Đ<0\ @/@-84< ,@4/@-00  x ЍO]G-p@d尐PV㬀ʀ 0! $ 0    !&@w 0!d!0    !0G0HzhzlzX?7@-@&^ ]0202x02p0p DR2h0.0000 u2S " 9" Ѝ0@YCC8C4C1C1C@-@ &@bv@-&vPp@-@P&v2020p@-@&v 0@X?@-@&@vP/ 0\R/@-@ 0^   \R@-@0U. V? z4 Ѝ@13B^w^A-PQ+ t@pT'P P U`0d 3\0 @P 0t000 3@Ѝ@ꦯ^^^^^^ 0`( "4`#/0@-PϠ ,@ / 00@-P@M0 00000 0 0 0 0R 0R 0R  0RPU @Ѝ0P]@-  Ѝ@-  ЍO-M@p0 (P $   `0 S p  .( ߍ      0 (p @0p@-@MP `y  @ @@ @@ K }zw t. a  ]܍p@- / Ѝ@-@ "ЍO-MHR@`L @, B?<00p (008 <040,0$01 @L +!0$ 00,0 0400<0 0 (00 000 8 @0 $ 0 "$ , ", 4  "4 <  "< 0 0T p (08 L @ `  @L $, 4<\.@ ߍO-MHR@` L@ 0(0 0008 00!p000 (S08  } zw.@a ]ߍ_00! X ( S 0 N 0 p$008,0040< H @L B8$`!;00,!4 *4!. $<! (@p@-@MP `  @ @@ @@  x  .   ܍pO-M`@l `hh2 00h2$p00h2(P 00,L  @ H P 0 X@\0T0L0D0@ `lx @@!H!P!X !,0( $ OZ`@ h$(,.`u @qߍP$0 (040,08 40<00<008%d @`0 H[ P W0 XR00 D 0L40 L0F8 TA

$;(8,5.`" @ߍP$0 (040,08 40<00<008 @ 0 H P 0 X00 D 040 L08 T

*P0&4#000#0PeU1! 0< <0  P `F@0HV@0 00o`V 0  @02 4 i0<0 Ѝb+v 0P0000#000&<#00&8#00&4#0 00# 0C-P`80<@0CQp80 aX!0 P<$0 I<00S<0,@0 0`pPE<0U @00 0 `pPU 0  %$- @00 

0  >2  >2  >2   `  ލ0 0 000 00pG0  |0000000 00@A S " /@ 1"à ?; 0 0  0"  0à "! 0?$0P0/O-0`hT ctPfTPnT' P%#lT% P%n'.* *nDjX%(P *hT$h*P%*bT%b*lT% P%jX%P.hT..aT%a.P%b.bT%l.lT% P% nX%!P. P".@$iD$a.@$i.lD$). @$ @$ .d. (i.f.f*. *b.*l.b*@& .**.j.# 0#i4#0#&iT%a.b4#bT%f.l4# `&lT%0#P%e8#00 !.a'b4#b.b!0# l!l.l$" !l4# ".!0# "a.b8#0 ЍG-` 0 ,Pp.p p!!!#0# "0# 0@( ,,(.  0!p0 P`,``!!#!0# "0# 0p' p',p  0p@-P`@PEUp@#! 00#0 00#0 00#0 00# 0 00#0 00#0 00#0 00#0/@ "1à ?< 0 0"  0  0"à ! 0?#0P0/O-p@`X:[OTPa!e%a*ek!l,l., ,a, i)i!l!b"b$.0 " "a(" c$#c4.0#0#b8#0`4 `$"c("  b$"a4#.b8#j.0~000/L00 0/LG-@`pP0@M 0a800,($@ @@ @堶008 <0a,($@ @@ @呶T00L00000S !&.LOPP &> 0S !&> &>ş 0S " &> P0p0 58/5 0S !%tP p5 0S !P5<< ݳ$ş45 0S " 5 γP0p04 8/؄0 X " $P P0 PU " 0\\ ⥳0@ğ 0S " (  △P0p04 :/0 Z "  P P0 P U " 0xx l0\ß 0S " D< ]P0p0 $3?:/ 0 ?R !rP 0 0?S ! 6"0?X0#00tl )P0`B0&.088/&.FP &>0 &>/P&.00!08/!(P 1 1!P&.p00l!0p8/T!8 P <1@$ ײ(1 ! ҲP&.R00 08/ P 0 ⹲0 崲P&.400? 0@4/? HP ?0P4 ⛲?0 $喲P'ލ^]$a]~^tT#^^]_^^] 0@-ALM0 P0`5/(@ @P @0 p@ 0P00 (p7/@ 8P @0 [@0xP0 (P0 p7/8 yPP 0@, FPLЍ|c]\^]^tTc]^Ld]^p@-`@pMPj l h`a R `@T᫺h pЍp07@-7P|@~ Q@00#47 b0 P Q0 Ѝ0r00#4p@-@P`\08M 00 00 P  8Ѝp@-t @0p0p@-0M 0@0 $0D0 (0H0@,00070P` P `@0p`0Ѝp@-@P7`ptM000 (, 8 40PЍP$` 8p0 p0 P@`pPtЍC-pp0MMPSrX@`P `Ⲹ0 (`(0岹7 `⮹ `⪹` N a7 (6pWIKp ⌸7 (⎹ܹ ! D7 (@h <`r0 `0r7 `n`⼹p 0b"!4b4# 0(0 7  (p0h 0p0` MߍB7 (Dᒹ ( pG 0O-MP$0?0AP (0p00l  07 00010D \n D0Q`l7D\` R 婰@hR 0T ``Z0  ( l7 ? 0 , l)0l P0Y R ``Z0   l7 v0 , l Y  07\S0lpS WPUZO*ЍQe]o]p@-l@P  A ,ap0@-,M@P"4\0  O A 000Z?,Ѝ0<ĵ^ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzG-pPd`4A4"T ڔ, LaT@! PU,QP N  0 0  0< 00M  ,QЍG>\@-$M!`||p0 ,@P D0!4a000l  $Ѝ<\0@- $Nx@ #4D\l6D@- Ѝ@- { Ѝ@- Q@05/cw^ Y0do00`0S PX 0p  0벰p W` 0S2001n8^0 Sd0001c00fN8Q0S00d0Q00@Sg/1!t115+J`!01\A  1ES  0310@0/1S01 ЍO16&!6&0- R    R    R   "-" R   .R 0  S0@008Sh0 S,\01 ꨌ^r]} RDȹ^0.R  "-" R   wP/P/////R]D`]D]D]D]D`]D]D0X 4\ !8/P x7S0S/r]O-`@0u_0Pw>0S4 0!0p눐到0S|@TP Ѝ P @  0 0W   p_ڹ^i^׹^T^^p@-`@PPp@0!0/00007wnS000q 20|7S S S0< 00CS_D_D_D_D`D `D|7Sx8D!0 0<00;080p0808070B;0;t]^O-@`p0TM^ 0=0 f  qw>pWzp{ 3 a0 fp7  0 fp7  0 fp7  0 fp7 0 |fZK0   0P> 0p efp7  0 \fp7  0 Sfp7  0 Ifp7 0 @f0 0RP 70A \ 0Y0 SZpp0S (D5V   0EP0D00`0 0(0 0 00000 0d0HЍV 0 0>0?P0A-<0P 0S`MD 04@0S00Qh0000@04@0  # 3  4  4 "$  <@ p! !(``F@#j0 p  +P`Ѝu]i^@-0<S !  4 0 \ Ѝ0ս^u]<@-@ P0@00u]/O-P0 @$N$aA$P 0[ CpG  = pGW `3 |- v0 G$@$N$aA$0PK 0Z  KS%P%G$P$@!@d!@!@0!>#`1# $ ( #$0  #(#< 0$Ѝp0R@-P@0  <0`101(0 0C` &ЍpG-R@P<M0 % `1 01(ppG0G  0-l P 80R %Ѝ\l$"P//O-<`@ P1IM 01p 0  0 0u 000 S0 0]>1Q X 0 0>0SC Dd(0HL@@00C pTS0!@D0\pW)T* `1  *Q0 :Y  ZIJY ^ ..!.0@P^ ΂ a\aNL^Q !^UIߍ|]q^A-0@`1Q X 0 0>0SC0 (@ B@D0R !@D ^P+T, P1  mP0 &IߍP(PQ !%^QY00 ZIQJY PP^PQU(   PU@T00q^qENQUQ!$q^|]p@-Ѝ0@Ѝ/8^ѿ^T^Կ^0-0@-MP@ NP 4$,!($(Ѝ0@Ѝ/^ܿ^T^0@- R 1 0 Ѝ4)R  0R @/ R0 R1 R 2 RR3 4^^0@-M@P RN ; Ѝ0 ^T^P/ 0 0 0/ᨌp@-@0PP`  R 77Pp p@O-@-@M0 0 ~!Ѝ@ Ѝ/^^G-P@p  M`  a)W P0S1`fP  M0 0 0@@00@0  1PQ ЍGQ=2^0@-,0@SMPY7P, 18   M  ,PЍ0@@o^O-S@p`PM 50SE SB 00 1S ?/`000D@S{ PSh7|7S42S3 0J S51 l?l/Fb0?!L00L0#SB S S'0 BR400400CSZ 1 >.0( 4?L00L0S 40040Ѝ, T!0d0252 5n$YX0Zp0S1 <>4.Fb0|>!\D00D00J S*1 =-Fb0(>!GL00L00S S개DĜDԜD\DXDDD̜D2St *Sp 0S ! 0D=D-HP00P0S0Pk xl00phQ1 <,Fb0 =!L00L0yx7S 0450!0P0C2X00Z0Q1 <<<,Fb0<!L00L0Wx7S0X0Q1 ;+Fb0(<!L00L0@0`0H5Q0[0 1 ;+H00H0Q  04 8 <0,S0S P |0S! *0Fb:!H00H0l0S1 :*Fb0:!wD00D0 R1 T*Fbd:!eH00H0X VY1  )Fb:!OT00T0YQ xQ 1  )Fb9!:X00X0A=P:1  `)Fbx9!'d10d1xW !/ 9&V101<00<0101|7hwSpm2Sj W   IPd d7![0R 1  @K[ 71pw. h7R7!66h7[071?%0#  1  @K ?qw>0S㺟)  ;5?|Q 2  Pi<`0S ;!0:1h7 0 000T0)08W l7 M#l78l70 000T0(5   P! T $P 0P`00 0P  `x8Xh'* 13/?S pT0<$ dF|g V 7S 40040 0 RY-1 6\%05 'D00D0BP*1 5 %0X5 L00L0P 2P P00S ! $0L5 H00H0pZ1 5X$04 D00D0_0 S ! $04 H00H0NS x RP 1 3  6`00`07h7 1 3p#03 `00`0%x8W` V , "`pW 1  TfJ, ;0 00 00E 1 2"02 yV !% P   A#p0P Q5/1 HR  2"0, T2SL00L0㸑aἡ  @J 0 `:S  0 3/P1  101"-000|7S0 Q85/h7 1A T10T1!l00l0|7S0 Q5/Y 1 000! 0 C c ! 00 000 0|Qy`h0` U^*^^^^^^^^^(^@^S^f^|^^^*^?^W^^^^^^^^^9^ޛ^i^F^z^^^f^^^^^^#^^^@@=^`^^s^^^^^^^^^^^^O^^^Pf^P^^^^^^%^0S20HQ! 00C000  10000FP Q1 d10h18!Q S ! 010FS|7SD@DDDDDDDD! 01!7S !P 0$28V V㐁C  $2$"`0000 0>  C  !``$VH,> X> `0N 4P 8P < Sጾ0 0C?o20^3baE0`0>_ >!0>U i V1.N ?`/`0 4S !$0L00000h 0 0[ DDDDDDD 㠅  P 1 4SB$> >000c $P$Z 1 =  0 =  0SG Q1Sx=X 00 0 0S8x 0 $0P 0 P 1 $ 4B0P HA< <P0[0Z0S  bP   PPj 0000I|7S0C00S0S !R 0;0X909!5# ȫ" ##Z#\Q ^ Rʐ 0  0 Ph;h+j000101%0S S S;`4pl!0 l! 1*  :*00 0~4p00p 00(00`P _P 000 04 00|7S.D0DDDDD 0  lz0@ X 1 2"02(!.40040h7 1 202"$00$0{04 \Pq 40 0@00p10p180080|7SA00S<2S1# 30#3D10D10 a6/% S   03#H10H1HaV1 H=, q◸ L10L11S 3/0SL1H100PHPX1  Hx= M1S 3/   Hg=0 ;09000000 0S``0` 0001S 0 0x5q -0@-@PM0 0 P3= 0Ѝ0@Ѝ/<^0000S0004 R 0 000u/@-0@|7S2S 000ЍA-`|7@S2Sg 0!1Rc 0pS\:P020100010020 0083/ ? 071 0!GR # D1"022222221 " 8," ZN292S988-#87 0C2c70r0Q   ̽0   04Q   0PP0C0Ѝ3254r]A-P L0R8pL `@P|'R"⡽(R# #0 83/G?G/ @0?@D00Q0000L00 }00 R  u001H0G-PpaFđMT> 0 Xi (  00 4S! Q0 000Q0 S0#+   "0 000083/? 0? 071 03!GR # +0S/S10C1ߍ (0( 0" R 0Q   0   0" R 4Q    WP0p`F@r]p@-1BMS@BߍpP` '@P  `P 0,Ⴜ0Q  R ,Ѽ!0 R1Ł!!@p@-2@SP 0aS 0 6/p@03A0AS@-@e ⧼/C-@p Ax8TMBRUDDDDDDDDDDDDpDDD@DDDD|DDD$D0DDD D\DdDDlDtDDDDD(D0DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDh'0 01PTЍ"}07p7 ~0P00 ! U BP Q 0009h75S0 S0 S00!e R #TЍCe7h7#20h70#8S >!0R1ā!!@RPPa|4V@  PP` 8. 0000000Q<<0 0 0000 P'""#"0 䬻0S00 ࣻ000U L@ PFVQxc n⍻ 0 ""0 -xW #_o`/R χ166S1 000P U0!01S 1P# TЍC`TЍC1S  PP  `P 1ZS01ā! BP2괁X mPP  `P 2 01 SP0} p l01 R0PUQ h# `,0PE("(!p7 0/A0S 0(( %=>000QDDDDD00000r"N90r":9?o2|N8z?xh728s"}0p:S| (0TЍC/]DDDA- MPp#%@`P0%`Sb BS` BSJ? S#* S~  S< `02010?0x8D!0100"]00 k"]0h78h75^0x8?00h7#2^0n^0`P V C Va@`U0"0u"]0h7=$`C000i;0X 0 EL 000Y*-O|G,DG- M@H`!<(Pi`P 0R&!S (Sp1=: S  Sp&!`'S p, BSp'S?;C0CSOD,DHDDpB!Spk GdS:dS^ S P'SW0S p7 h70J ? S* S}  S|7S pG  wx'W/o"  6R| PX?;CS񟗨DDD DDDDDDDDDPDDDHST *,AS@S#R @0SC00P0S Q>⪎0pⲐWC嶠C / ჸ@0Xp8%S BS6 BS  S / BS[|7SU cPB 13/<0%S r SF`A0W SQ`8#=0   (E03A0AS)7S4`%W&0S#!V&R! 1?0|8|7S3A0AS13/4P` W 3   R<   ЍR <3W0SD DD$DDD h7 L iRL0Sx( 0•Fh7@ 0R?0S.0‘U9W7 W?B0CS1"= IW1u00S0 ‘V1PP6P 00 S C  RW0-% EOO-?@Q`|M? p3C>6CQ m3>6Q  ?QK 70Q4  |ЍO7h?Q30 00 0p0PPx0@FS DPDPDPDDPDPDPDPD,DXDDPDDDDDDPEEEPD$ELE`EEEEEDEdEEE4EHETEPDPDpEPDPD,EPDpEpEpEpEpEpEx E EEE EPDPDPDPDPDPDPDPDPDPDPDPDPDPDPD E E=Q  =Q F0Q0 0CS04PP=Q7S|'R h7   h=Q \ Qa T=P=QL=|ЍOWa0.|ЍOD@=0SVSSX E E(D(D(D(D(D(D(D(D(D(DtEtE(D(DEE1S S Sh740 03A0AS]7SZ4PYh740h7h740@S+"P( 10CS DDD DDh70h701!x8 h750h7h750h75!0B8#8S"= Ñ P1Sʄ7w>0S3A0AS13/p7  1 CbR.0‘!1R7P|Ѝ!h7R00h7!h7R44!@R8PP<0 SP:XK=0S|7S xxx >P H1P > _ pP[ :3/ 0= 8(PP < `R # $"0 # < XrW >  PP 3S>ñ:3/W Xop᚞!Rh8PP8Q|7SxH 9ⒻPpo 9  @PPhQD`!*R<8fPPi80SS*1|7S.9 iR B0<yPP# P?0CS|7S < @P 80S$ < |'R R0<:0 S < @P 81#3/ 88  |7S P*pP P !PP <x!> 4U !h7R 331Sh75h7!R R R5p|4z5x1S p7h7:ph7:l!h7R33f!h7R22p'P 502 10h7EP!0B8#8S ȕzpt1S7 Wp7 WP pP W [ pUPY1SU$ "0pN!0B8#8S ȕhF!18p7b1019q W8 aPPd 8óx7 ?o2x`QQ 6P  x@Q @A0 S |Q80 Q_P|X x0@`P|V` e 803A0AS7SP U x01@0S S2|7S cPP  13/P!zR8PPW pP 03/P z186S003/1ZS$ 8#8SU $03/SU 0:03/U PP 03/P Z0U 03/!R8PP 8 5 0Pz > "&p7t  d1/@0SX1X  &%-  PhEE4 EL Ed E.  PXEE$ EL Ed E B"P9 919"d B"0i9790000 9100000 910iiii9ii:ii87ii8i(o?) D]]^* *]r]ɀE^hzlziHz0000 9100 910?o200|7SS!0B8#8SN(ĕ|7SS1 C=R.201:!h7R 0 0h7w>0S108p'10!S"-08H#8,C("(R! 8PP8` V#=0 C h9▲o! 8:7S (#8 9⇲! 8Px 8  0BS !R r39S0S0 p Q ARQs0W@ 88 R>Wp:3/Pᚾ0S 0H pH0P,PpW@:3/Ug0S @ X0 0CR00h'4PS4400Rh7K SPP E0 0H80-HP h7~N#2000@000S@@W`"4 0PP0T0 T9PP  > 0S p7  h7 ;h7h7 ; h7N50000> 0 ⺱ $h7P:: x⮱1T%SX58 S!V&R! 1?08|87Sq|'R8%S x(0!Sf|8R8a x(0!R7S|7S|y|ЍO0 00 0p0PP |ЍO,tx!:"P   03/PB"|ЍO^Yʀ 0! $&0    ! @aRa/#07PPWa/ΰ 0!`'0 !    !I0C-DM,00 `p\(00 00a00$  P<0@pP0(0`0$  0T00<0 a ,oP<  <DЍO^r|_r^^^$]@- ,@0xQ S,@0AZn Xx( Ri x(Ri. Q - Q UTX P$0/$0 3?>4L} Dy01"S o`% 0CC1%50 V00XW0d71G y027=02c|000UD1 9?9M3 :5<:M?0:610<10Pb00000C0zJ0 R@40c@,04@T \FP,0I iRF9 RxH5 V' \P,0 0! 0     ! 0S 0ЍP4@ ,00 1S\,40G  P4@,00 p0QpHzhzlzr]0S/EO-@TMP8 <1#;0p`0c_80$   ,p(`mP0$02 0200,p0(` @408 mP'> 0H2$,p(`0/0,2  0408 {mPv 0 00졟!18 $ 0,p(`40emP`0 00!18 $ 0,p(`40QmPL 0!X18 $ 0,p(` 40>mP9> 0 00!18 $ 0,p(`40)mP$w> 00$ 0,p(`408 mP0N@$ 0,p(` @408 mP  <<QTЍ^EW__^E^^^^^^^T]co@-@PᲧp@-@`PUp0S00`00C0 v `K-@-0 0 Ѝ Ѝ/&^p@-PP UlU`F@P G0000 ( H@P@p+^J^/A-1P@`p x(0Qᔀp, 0)x8 S rVed0 Z"Ѝ cV0 lgZi^^^c^@-1@P` x(0Q|pp<, 0lx8S 0 fY Ѝ@" 40 hY Ѝi^^^s^@-1@  0@ iY^^^O-1g_g^b^^E^^^i^+_a^p@-@PPLL 000AT   P␣p@]d^A-pP1@` (0  0Q ❩0 `00! 0>020`003/0900*= 20T100 0!` 0@0 00aS0@`PpЍAG ]M^r]u] ) @0) 8408008,08089!= 01/4%E$EJEX#E`#E2 029 0/202/@-8 040#Q0l78l7 0.  ( ( #- x Ѝ1@-@ h70 0 ,00( h7=h7l78l7^^ś^]p@-@P83/p@@-PP @Q6U2xw w> G" !`  Br 0 0# Ѝ B7SD10 1  f`0< <`mGG?0L Q^^^5]^A-`P8p3/@P\00\0  s@-`8 P3/@P\00\0- 1 ~'0 6 ₨x }00x822x80!L0003/090020T100`ЍpH] ^u]A-P`8p3/@P\00\0  x8 0 0x822x822x@x80!x8 99p@-@P`X@pp@-P@P xG G1S 3/pA-P@p`000   0?0?x80101 M? 061071 N? (Q 4{$Q 0v 0 1SA/@-P ` pk@P 00 0s ЍA-|7PSS` h7M @ iN@pI0 R0S P@xHqvA-|7`SSp@ h7] P i^P"0S TAT10 R0S P@xHA0S i V1Sp1 K&0D D0 0P&A*Ѝ[]^A-@y}`|7 pS 0 xX U |7SS@P PLP1 &0 000y]?^C-P@@@`pAT ݐ  IP01SʠP1 %0, , 0 Ѝ@ꏂ]a^G-`X  pR 0S R@OoB@bPU@ P 0R01 S  R 0S RP0 P0T@`C-p`@P. ۬P@Tc Ѝ0S ʬPN1 c%0t t 0    AT  ⯬P0S ⦬P @갂]]a^A-P@U+ pbP ЍA0S0S i V1S1 %0D @ 0!:P ЍAЍԂ]v^@-@xP 0x8i  <P 0<8HPz0H8p@-|7@SP yn<089,8xxXP 0 022220000990w>018|7 S13/p^A-1@` !fy~R|7]S11 P8889,8PPp ᛥ(# ┥x8 """" 99>0?h7?0?x'RM?6!|7Sh7!QGtQ 'AR]^u^^@-@xQ `P ⌫P P 1  <10<1Ѝp*P 1 $h\ \0   D@  ,h7 @Z 5Ѝ^i^^T^^^^C-@Py`Pa⾙08pSV Ѝ4(Y V A !T U  DP1 !0$ $0C 0CA^:] ^A-2@P !m00C02021 m!0 &`2Pq 02HQWP,RP ,PP?P?P?PA0SH1L1`P10CP1?1S 3/U^G-Pp```0V t pG  @T 0V ` 9/@K^U] l'EA-l2!@0SP` 2 @9|QI0S1 82Sr :0S 3/"<2< "!0!-200C0w>0SU? #~Q A1 0 `t0Sp7  |7S 1 $!$d2+~Q A1 0 M0S1  Ch76h7p7  1 l |6h767h7vV @ASA!@`^^^^m]^^6^a^^O-P`|7MSS00 0ppp31 p0"0W  ЍO @T 00Ѝ0W p|7S2  0S 64"|0 0Pe>00x8S| 0 0C8C80Q Rn P1S: 00! 00 00HP 0SH1L100P10CP14>H1S 0 R B0 Y 1  0 1P 0Q113/0Sʐ1  0 R 2S 0 ᬑ9/000a)Sʐ1\  T0T 4w |NS@]ꆃ]^K^X?^^^^^^C-2@SPpM !Ⰰ8#8X 0 a6/ЍCa< ` 92<2<! !000w>0SB !T20S` C` 42hǔ00 㲒 Ÿ  @1S 3/9-8C800ᬁ0 8/: 0S 3/ ЍC? n0001 0 0GP+n0001 0 7S 1  h76h7?!   h776h7v202r1 ``V ` 00r@i^^^^^^D^q^]^^ޛ^A-|W`U U) U@w xP 83/@ ? 83/P@pWU!3@PwW 83/Pp@@PwW 29S 83/P@pp@-@1 0, ,P00:p@>깃]^p@-PiN@ @P`xh"VxHp 0^ 022220000990?p@+^s@-!]1 @R0Ł<>HP1 00|!|1| yG 07D180$881m`Ug,884X YP10X 00 0in  F} y 0(' 0' 8' j^6D'@7<7Vtx8 p  p'    L ( @ ) x8 Ѝpԃ]u^L^dOEc^&E A-pʀjPFzQ` 0ES  B2U U U ,U UPPH$H@DWpx@'x@@@p*0000>0h'0S0000@/p@-P@ cs000 0t u"    @v w 0  " @x 0S @@p]A-0 0SP@0p `.|'R\EH\E\E\E\E\E\E0 0'  # 003213030 0    0   t0/C-@`MC7PP000} Ѝp0 `ݐ0=0 H02 |7S0000(001011 `Ž X0P   D j00L7SPP7HWLW0P7h^_l^@-205 2S 101 , ʠ,ʠ\ 101 S&0#*R0 BR00 \   0R!  R  (R  B/o"S0|'Rt@ R R  R R  1 0S "N)R]O-0LM SP@` 8Ch7 |7S 808 8Rp>0pS s39S~p$H8R.p㲢 $$8Rh7 4@W80 & #RH L0S0P !0 >0'S s3)7R1 8>0 0\7\0000H  0C IRO*6@P000S Yڸ 460W 000040  B    04@ 014@T7 x6U 0      $D"$  (0 0' #RH L0S0P " 9@P$000 W 0 049P 49@9@q 0H   CX0C00000(00(00000|'RdEcEcEdEcEcEeEcEcE0 0O > K 8G0 0 00ZT 060S  S  S#:9S00w0 00#"!# #"0( R:W $4RN 0@0080 Rm1 !0110/1!LЍ 08 > x 0 08   >32130300W7? o#嫲Qh' |'R8"Q S* h7 |7S8 2 R 0@0080 R (03/P1 8h X81081%[ 80S 000徠S (Z !%*0$@00 00 0J(0(0 0C 00 0J00 00  Y ! Y: $pY  k6PpPG4 I~50 0V 0 010 1 00 00 I0, 04, 00(0080$0p0 C0000 000 000((0C40 8000000C00 Ppd8^u] ]:^^^^^ ^O-0S h7 #  000   0  8H(#8CQ,[SSSx Jo᪢R  0 0PP 0< [㰠岀  T%0 @, ї0S 1 4 t0:0(101R(101 |7S  #RH L0S0P  4PP 0 TCPP 0ᰀ00(0101@8S>HHPP |7h'S000 (  0/  p' ; W00  . x S000G h7  40S  Q 40 00 00C0(0x3rPP h'00  0  ;X00  岀0  " 101Gs~h7  40S0 0C0(0o 1010H   CRB0C00000 `(0 0(00000=000  , R :01 1 m0@001 PW|'R  0Grpq禶 0 1 0100L7SPP7HWX0P7080LW2@$Ѝp^]^^^39^Z^Ą]^^A-`p/@P 00(0K0P 000pe  ap@-`P/@P 0; 0(0 `  JpG-!=⼐p7# 50`Gp@- PP 1S 0(#(000Ѝ ȕ0/ |'hR    0  + h  000 fw0S 00000   00  00|'RI00 0 ! h7   Vh72h7h7 M0S5 ) 00@10 @( #RH LQP  2PP    N  0 00H   CR0C00(0 0(00㲐0j  f b붑9ڄ] ^*^O-@fMP|7h'S000 0 0  ;0h7  9)* S09h7  h72h7|7Sxhgpe\ !PUP00!  ! 90 9O9S!  d!h 90 9?PSH(Q PU$9Q0CS*e!0 R` `!  0\ ``` 0 Ⱑ PH!֔h75h71 0l xz08 S0R 0C00 S 0S00Ѝ0`]F^o^^^@-`T1P!pR@MX1\!^0 X1\!1S 200 @E@>1 0 6Ѝ@1. ?1S_PP00L1EUS0 `HaPE0PLaPa`Pa1 X0 4`V1Ѝ@/Ѝ^^-0 /2S/p@-@Pa0 6/p@/ 06 08880 8077090(10101/* * EtDpE@-:@0S 3/ D:S@0/p@-`@0SP0P    00T ,P1S 01Bpp} ]P0/}P 0!/}@-@ C0@2^0 R  6R^p@-<@P0S,@T ;P@pt^ QA-0@P PS t`lp0FUAT  B^R D`0d!!p740!h  i j9k9 0 g901!\01|7S!=0S* 9'w>0 01 9i9 00\0 |7S 93/1  |7X `S499Ѝ@x829009h72h7Ѝ ]]^^^p7/p@-@f_qp@p7/G-P`q夁夑Mw>@VAM VQ V!I|10@|'RJ 5) 6) 7) 8)099!  089 079 069 059000N9 O)PQ R   0 0`VPpx8S   19ЍGd 0: 0@P 0590690790890Ѝ<]^@]*]i^`]І]@-h7"1 @ [|Q7S8(00S8. x (0   Ѝ 1(Ѝ@/@^a^O-pM`0`  Pw0@0 00P 000 0_o`@fJRPPU!R:"R :"R:0ЍC-MP 0`p` @;0 0 00  00P 0 0@.J?o2P0S R0 Ѝ0G-@M,00 p@P(0|10A0p$  <0` NPJ<1$ 0<0  A,p(MP91$ 0<0  A,p(MP)0'00弐$00 00A,p( < MP0$00 0l0 0`0A00,p0(0< MP  ,, @Ѝr|_^^ܗE_^E^ޣ^ˇ]G-SP Lo `0@4p8à St# 00000SW u 0` 01`P1 0j`0 d`˽Ѝ@0@T@AJ0^0P0᳐0Y:0$^@-  0 @!  Q3  4Ǖ000 P1#9P00T0iX耖C@BC-P`尀p0@ A0 ਕ0S HVP ` 0` 00l Ѝ}M^O-P@0TM00p1W:[I (0PC 1 0CЍOH0S`0 S00qp0少  A$0 Y[! P p 0PQ`1P  0 ]iPP0p 0 0Ѝ}n^^O-@0P00MP@pP 0S S S 0  RG*101aQ> P P 0 ⊠001*  0i 0  d弼000! PA0 Ӕ0S2 P 0``᝼0S# rP `& ` G勼㤰@J ჼGo`!0R py X@Ѝp0 p 0h 0 (f}^^^^T^"^@-@@]@- ,4 4 8 #8s Ѝ;^p@-@0M SЍp@P` 00 0ZЍpD^-$M840, (  0 $Ѝİ@-`plM&@P@ !0 0  ( 0  P0000C0 p0!02F0 0C0000 0d@S2 001 00@0C(H0L 0 H0L lЍ~,İ2M0P D@PЍ/00S H00O-0@!DM 0 0 (AP㪪@`p\ 0  a0,@($  P6K 0  a 40@,@($  %K 4 l 0 d    a 80@,@($ PK 0DЍL^İS^X^Eq_O-XF,MPp w0 0 0 傩0#ddh&hV *e0 0 0 p,ЍO)0 0S 0S*=)PP I0 0 0 ,ЍOR00C0FREP 20 0 0 00C0000`P' 0S S SB 0$ 0 0$ "350ZT$S (0, 0 (0, (%8 P!P 0 01`S0300 000 l P@t  R1,Ѝ0V 0S0S 04S ɣ2( @ 4 0SʠF < @T 0S 4S 0 SR00CSШEܨEܨEEܨE0 S噣 "@  @00|004 0 004 凨30 R S h80< 0 80< c 0S& i0P`0 0C Pv 00J@0D 0 @0D U0S 0CSd00a0 0S0/004 0 004 :3 J0 R S 80< 0 80< #  0SP`0 0  IP$ 00@0D 0 @0D 0SS Sİ0p@-00@4S 3P1 00'R0 0S0StǭP 000 01S0H00`p`形2@ap p耯  BR/ $R/ #/0 0S/Q@-P@1S `p! 0 @1 @T  Ѝ0S 0CS0@q 0S0 0S(00 @ꀯ~@- 801S@ R  R 0ꀯ@-@ D0Q  0TS   @ ꀯ03!"/03" /0M0P@Ѝ/0M0P@Ѝ/L@o/!4! #4! B#4!0 P/60S/p@-@P !>000pp@-@PᶼD`P@Ҽp00S DP/p@-@PP #p@-@P #}@-v@ 0Bp@-@P$#p@cQeO-$M`@Pj >pP j0$ЍT@ @ ` X0@00S @T : P00S 000S00 0T 00@0P` ` @Z 0 [0 T@0P0T @0P ` 0 0`0/G-pP@$`P A#T 4 06 S H0S 4 R30 ߎPP @P8 0x00PPH0#^Zv 05 0s6 06 #`SH0Y 0S 0C @\  " qPE]^!>00000 0/6 0@-MP@ 0 Ѝ0/,0/@- 0MP3p0ppp`h~P@ጻ 03  !(,0 , @ 0  Ѝ@) 0#000W2 0,0-EpVb 03  !(,00,0 03  (P,00,0,0 0 0)z"Ѝ-}ĮE0A#$#"$#"4#/l0Sp p l p0 0S  0 00/A-@噏|`pP1hSl l0p 厏AD劏0P1p00`0101S0@@]gq}@-@Td$,d,lH,l $. O-@pHRH2DM p00 @@R0A10bA Sv>  K EF? A`pP!1 00a0,P($@ @@ @,F000D1 0<1 00a4,P($@ @ @F1  00a40@,P($@ @@ @F0'40张0  00a80@,P($@@ @PE040p0 00a80@,P($@ @ @PEDЍ}^S^xE^^^^@-@0 0S P@\0X0S@$ P d0`0S }p@-P@0 0DS P@ 00S \0X0S@pDP 00Sd0`0S D0S 00P0#///0  S /0C\ B /p@-闹 @dPPRL0$!p@讹 0S  Q@D0R0 1}p@-P@ ̅0!S <S21pp@-@Pfp@ p@-@ PJ00p @-@ .@E0@s3p@-3@ P6D Dd@PQp00S0S 0S h0S 0S d0S `0S X0S4pD$/80S/@-3`A0ASM=pDPP@Ѝ@00S%0 00 P0 R0020 0003/ƸPDЍp@-M@`ᵸDPP@ѸЍp@00Sĸ0S 3/00001됸PD@-@$1@l Qvp@-@P 4001Pp0S 0Sp}B# p@- @P8@P@p@P@A-`@QpP000y@PЍ0 000 ` P tPp ࿌1S0 d ෌1@0Hp ௌA0, ੌ(10(1}1i0@-@M:00CS0 pЍ0@x J L g0@PS   (10C(1sЍ02i}C-0@SM 3/C 0`# P 0$P 00ЍC;ꪷp PPXU%ἷ% 0 \  PS U R X ᙷU U % }p@-@,0P `0,0ETt x0Rx0t 1x0 0S  0 00  000p@} O-@,MR||`SpPp踰 0S YP R R0 00R0P0 008Y ;PK80SC00004Zʀ !  , ! p !|3x3 t3l300  !ḠW㸠 00踰,ЍY 30S00ø0Ŭ 0SP0 0 00Y00帰X `P帠3 00 0S|24d\0Q\d00\00X0d00`0H04038 $d0S00 0` 00\0X 00h0` 0# 0 /P0PPh vP,ᅶ 03 6 #pPR,00,0,P0S  ` 0S{0S  S +$ 000 0U$ ",0 Jpr3S0S00lYL 0I ;PE 03/AWHzhzlzd} O-<>PQtM 7 .0S@ >Q Y= @Q==X"26XG0SW`T 0.͵p n=0P@8Vp=X @`\=Q 3C5CQYK RC4 圳YE U -Q60S=`V:7p4@ T1<X0 0CX#0X 1CX0`0 0iA  00R 0`uDpP@8ᑵ1`Q -`0 @ T` Pⲁ 0 @[  P!>d6 00 H`;X 0 00 RV  00 S D@ }@:S00S P0 @k 0⾁| @⺁3 P 峁P 寁! 0`0 Y 0  tЍO0 0000 `5@P 6060X`\00` tF``x`nY @ 09@X9X&Tp 90S񟗛dEEEEEEPE90 S񟗤HEEhEEEEEEEEpEEEE0S`9X6C 0CX0S T80Spi8X0S 0 S0Z T`0`V``Y T` YY P8((XX T8800L W0 0 02pP T"`@P7`9 0| 000?8p93 p!>8߈000000s`7Xn /1CX @70 S`^47`00 0 `0pPJT1`p` SlEEEEEEE@EEEEEE\E60S1| W `93! \ 3 D 00  03  P  `P p'TppWp`,0,Wp / <<E0t01ؠx0@pt01Wؐp pW0 ؐ 0`V w ! !3 PW`W0  &`WZ V[ 44 PP0Wd00 P`00S 000d00  !QR ` `R` `W00 0 `3 !0S P 0SM  U000Tq2 (hjW+ ` @0p0S 0S000S 0 ]_ܠ>pspYp/` p`p`0"X00p003 P R00ͲV 1X0S00}0S`V|00S1X"0SY$Tr0|`Xk| .S  ' 0QN R0`10`匲tЍi iii i}'i i^ii@i%iߖo?oi@oi!i#i"i Ki^P08 P R/ !  /} !  }t|O-MP@Dp .`0@0@@PWP@%*1003f 0 G`P H03HDP@L0S( D 03 0  110@0 Ѝ80S 3/@P ܱ0Z00C?o20S 0S 맱P @P}0Q(@- 0@R0S 0 R S  `Pᥱ 03 0Qᙱ/}p@-`4P 0@0L0`0D00@0 0<0(080,040D00040,000@pȯE$EEEE E0EE@-@K@ 0O-,00pS@(,MU@P 0 0 0"d1d00hS&h@@P  00 ")a! 1 00 $a$" 1040  0PP  0 !H 0 (",0 $  2 .(,(  P! ! 0"8S00 000080Ѝ8@- <0b",4b4#  #$  #(  #< ϥЍ^p@-@0M SЍp@P` "448 #800ⱥЍp^R=dadQ 0S0C0CS0#0/Q 0S0C0CS0#0/p@-@PT 1 !RR # BL|PpEp@-40 R@  000  A Ѝ@-40@ R  000  * ЍX0 0&-$M840, (  0b$Ѝ0C-M 0P`` @uxp0 P 00 00 0 0@0?o2P0S B~Q Ѝ`C-PMp@ 0` tu`0 P  00 000 0@g0?o2P0SP @TP@P T$@P0+ЍT `O-@`Pp3DM ,@0P 0 0p(`$  -43ᄃ 0P,@0P 0 4p(`$  4 0 0 0'!,3 4P0P,@0@ 0 8p(`$ 40 400!2 02 0P,@0@ 0 8p(`$ 30 0 0!2 0P,@0@ 0 8p4`(`$ 30400 0 0!(2 0P,@0@ 0 8p(`$ 30 0 0!1 0140P ,@0@ 0 8p(`$ 30 400!1 0x1 000P,@0 08p(`$ 30400 0 0! 1 0P,@0@ 0 8p(`$ x3 0400 0 0!00PP ,@0 0  8p(`$ _3 )1㬒T@T1DЍS^^`^@E ^0^<^EH^Eq_U^`^0 F p@-P @@lh 0S Q 0P @@@040p@Pp@ &0`0 D20O-PMv0@0100C0#21 2 P  0S -# 2!12Ѝ 00$`{010[аK <X XJ 000S аC[  R R  H0$0$0SS DC[O[ P P= !>800( p<0@D\=s40 0p084pX 0 0Ϧq{01(0([аK-20000S DC[$ۦV H밦`0408080S ذC[ɦo 0S VL 0,0,0S аC[  R? H04040 # 0p0p0 \ᣦS Y]  YZ#YDSS  S R 0  q0 00 IY AC0s0 cR0 R0006  coVT H7P \X d|H-  \R0S`3a `P ) `P 0 "00 0S0  "44 0C(",400 000 0 B0  B(00C(00&q1 0P,0,00  !B P0#$$("(B4,0 0C00 000PPM# V2!12   \  \H/oP" R` 3 2 0 [DK ʥ~},@- 804 p,0?A`"b8"#b ЍQMbO-p`PLM @ q *p`q0(p)`#ttx'xpGW V堏 0$ 0 0$ 嫏[$W$0S 0 3SH0L0Sr@P xE~ 0$ 0 0$ 剏LЍ00C0+P Uf(0, 0 (0, 00000C00(SqdS090! ![00CS]HFFFFFFFFFF8FFFFFP@4Ѐ -0 0 0 8?P#W 00S00 R0S 004 0 004 pPP0S@P`   0Q ,DD(00830#0S  $3/ ch20S 0  ֎H0L 0 H0L 00ˎ80< 0 80< 00! !͎5@W峎004 0 004 ,20S 0  壎P0T 0 P0T t00 1 0S W0 Cr 00SpQQP  lZh e   R # 0 0RP10S #W  R1  0S R 0$,00 00(000(000XP 0S  l `P  8Q0H8 ʠ4P $<0ȉ]`0]Eo^p@-0P@1 01  p@0C-ᶐ`,Mf @P 400   0 BP V Ѝ PP XXbp J  @1 [ p1W ЍC9 )T TX%XU d"44` 8#8R** 1S0!PU:pWPX0\p JU:H @D P *0X0\T  0 @TЍCS0RH0@0`0d 0S S :\凍@0D 0 @0D 咍`Pdp03/@xE؉]`00 h\ 0SQ HP/P %/QS  1 //؉]ȉ]@- 4o`8O-QpP00P B70 0 0 B02"0`0S 0XA0C?o20S  0R:!R\2S2 HB0 0 0  ЍO   `P "44!8 #80CS@@0SV:V`!P U[èaűPU@0 P(P2(X2 h哠 0` P(QɌ1 01  Ҍ0U XP00 0 X0 XZ[ 8#< 410 0 000!"440000 0 0 000 PP u n v0`^-$M840, (  0)$ЍDC-MP@p 0` n`0 00  00P 0 0@ )?o2P@@TPQPP ЍG-M 0P` @pn`0 00  P 0 0 p@)?o2P0S  0000 0嬓P00Ѝ0O-,M@S ,0 X0\ 0 X0\  ,ЍO P 0S݋(1,!0 (1,!0  ,Ѝ!>00 $02ċ0 00 pP2ˋ嶋0 0 0 0 p0#$$ (0"(DRD `P  `0$"0C0H0 S=40:0Z @ 0 0#P00S1 L 0d` 0S*@00p; ! 0S0!0 pp P `X0\ 0 X0\ kV+ 1f@ @ JH0L 0 [H0L  `0d 0 `0d MV 0 BV  (Y 7Y@  0P H0@ 0 0 0 "@D@!>@-M00pP `00p 0 @PЍL L@@O-=Mm @P=ЍO0hwP Њ 1$!0 1$!ۊ T=<@0@0@0S S  1$!0 1$!Ŋ<u  ꮊ0 0 0 幊<0 <   <<P喊0 0 0 0Sy P@0@S 傊0 0 0 @ATu 0$ 0 0$ 0TX PP< 0S_0 0 0 ;`( "$`$"",R a(!"4a4##<S3 <1, @000@S S;0 0 0 3 ;0S G&P "448#8T (0, 0 (0, d<(S0 0 0 W Q0(0 CB< <0;00 ,000P 0<P 0<01!0 1!30S P<G <0 0001S0_0 R P0< 0T 00000S <0 @p0(P0$400010C00STx 90S@q 0|KPPk  |Z0<0Z ZZ 0S@100 0SRQDZ Z 0 0C0PZ Z Zk0X00Y080Sx $0S @E0S [@@D 0\0#$X0P0$0?Z.@0 hG0E0 0 0 P) 0R* +Z 4 0P $0k$0J* 0$0@K@ \kZ| X_P \0 0k \P \0 0xk |000@@@T@ @ Zk0X00Y0(0S|0SN Z~ 0R: \Rk|Xi0PJ0\|P   Bk |0000(0<0  4k@gYI00C $RYIY0 #"  02R0> 0IS  S< SUD @Di000 ~j0|00}00 0S400B@0?P ]0S X|0 j L000 ~yj0|00}00 0S  j|0P0 .@E@S@T 30S@CA@$@ 0pr201H0H0S 0CS # 2 P0P0SD0CS/  00SI gPkX0\ 0 X0\ F W T  Q     L #I0L0L0Q  R W7 hW4 `W1 XW. Q+ H0T0T0S D0C@p#@10S 0<S 0 0i孇X0\ 0 X0\ 帇h],00 S ᆝ 000S < P<0S 0 00010儇p0t 0 p0t 叇, 0 @0<01# 0<3/~D}~~0]O- LM @P`pp8 eh8 (p000`,P$@ @@ @(' 8 (p0@04`0@,P$@ @@ @(4 0 07(p008`0@,P$@@ @P( 0 07 (p008`4P0@,P$@@ @P(0 0@7 4(p008`0@,P$@@ @Pw(0 064 06(p008`0@,P$@ @Pa(0400 06 (p008`0@,P$@@ @PL(0400 0L6 (p008`0@,P$@@ @P7( 040 0 05 (p008`0@,P$@@ @P"( 0405 05(p008`0@,P$@ @P ( 040h5\ 0\5(p008`0@,P$@ @P' 0405 05(p008`0@,P$@ @P'44 04 (p008`0@,P$@ @P'040|4X 0p4(p008`0@,P$@ @P'040 0 04(p008`0@,P$@@ @P'0@ T040$0 03 (p008`0@,P$@@ @P'040p3 0h3(p008`0@,P$@@ @Po'040$303 0<(p008`0@,P$@ @ @X'0402 02(p008`0@,P$@@ @PC' (p||24  0pD08`0@,P$@ @@ @-',2($0 200pD ,` @ @'p1$01D 00,`(p @ @'1010D 0,`(p$@ @ @& 2\!\\0@S50@ T08!0@T , 1d@R.0LLЍ RPP CB! ,0|FDS^^^^^LF^^^^MG^^|F^.^9^D^S^]^(Fq_do^y^G^\G^G^0].H@@-@" @^~ A-p@PP0S PP 0 0100a10 `0 0 0e 0V *0HHQ0C00 00@-@0S 00H 0 /H@-P(0dp`LM @ @ 0 P@  0 P@9PP"   0 (02,0(0P@ `"0  ````(V0 ((,LЍp@-0P@j1 01  p@sD03!"/03" /P/30P7@- Ѝ0P @R R00P0S0l00S @-9 P3D8#8 ("(P "00 /H!> 000-f2M0P D@PЍ/00S H00p@-@`ộP@P יpA-p0PS@0S0 tP0S 0\ Q Ef0 0!0;0ꋙ`Pᩙ1P 00堙e 0!@-`Q00pPg8'#TgT%%< j@P@ ЍVPlnh00100S 0CS W @#RP 000~A-@M`p  X@PP"0 RP00S)T@$ ( }eD<@P@P 00%@ЍHP PPTP1PP P00 A-PS@` PpPl0 A/4@8!< 8!<DhP/A-p`0PPQPEU `f @ T T@ @T@  Oe0PEpO-,0,M00@010 44PQ : 01 $000pBpWS岂0 0 0 彂m(,Ѝ0000 000000#![ 0C 0 (08#<400 00000@U`C`Pbt0 0 0 U7`PT70`0000x20 00 0$() 000S O000 0-0"> 00$ 000K1 08#80!$$ ("(Q:0ɱ pB "4400  8#< 400*P 0( 000@ &$a0 0 0 000], ,0@ 0,0 00800,0@0,0e*0C SV 5ql`؁0 0 0 0 0 0 VF Z`P@UD~O-QM 00а 0 p@ `G"448#80SP:0P0 P 0 0000MC10@00品x0| 0 x0| 垁X( c뀀$nY 0S 0R S>@Pk5@Pf$OPP$` lp`0 0 0 k@ 0S003 3SH0L RP0. PP 0 0C00 0000(<@0c(0@ 0(0c 00"440(",40wH0 00@V0g0 0 0aP0010w 0K XJpP@[p0 0 0 3Pp `@0000l0P0T@w0 R s 0, 0S80S X|80$3/pP X0 0 00S<LZ廀0 0 0 0 sR 0 J [H PE DH`P @0X00p sR PP3 P`hPTJ@P H0S TY}0 0 0 刀AP`@0D `0@040 D 0PWX0000T"@PHpW0 AP0 0 a@pLP LX d`04PD S0@00@00 0@000D W00P, 0 [   V W0 0 0 #3P0  #R  3 0S#lPP @W014!0 014!1P80S l80$3/PP l0 0l 9P* [ 0S%  PP 00SPP ,0 ,00,0000$ ]0S 3` U0 0 0  ]PXD]0Xj0S DA,ЍU6 3 DUy@1D!0 @1D! 0  Ul@1D!0 @1D!w P @"44D 8#8Q %0%<#*TR@1D!0 @1D!](P 0<0 0  0(DQ ,   40#0 @0A*iW X0  "50 @000PP R cp1 !0 1 !p04 0  00X 4pP 0P  R 0/`-3 20S ,0@0,0 !!448,P#8S7 5g04x 0R0  ~0 0 0 p`T" R  l8230"01`00l0I~0 0 0 ~V1PD00,0P @  ,0@0,0 3  10S x10S D ,00,0 0 $ 0  PL3  10S 00S " ,00,0 }PP  Q Ul`C~0 0 0 N~U  0  0$ PD~H`d]^ C-Pp@p0M00S0TЍ0S  S` BS0S 0 00000 000B00SQ QR [`0 P R 000*A-PpU@(M \vPP7@4 000,30P0 0CSHTFUF(UF4UFDVF  @P0S@ q`0P #Rዓ1@0S  2R`V\v`(Ѝ20u0S0@0 0@ 0 00S"00 0 P@* Q& 3S#`0VV;@ aP 0007@00 0 ⼝ ^ R `1@ 0@ 0S 0 P@`0  V1@ 1 0 `aR0C000 0zS S Q ` -@Vs@-0@ SP% S( S- T 0S000 mЍp0S`P 0P0@000嵒P00P 0  0,0O-,M00P`Sd@ l&S `6Rh *5P Pa00CS YFtXFPZFPZFPZFPZFPZFtXFT\FT\FT\FT\FT\FtXFtXFtXFtXF\Fl\FPZFtXFtXFPZFPZF[FPZFPZFhP 0h0[8 <"pP7,Ѝ`  ^[`#0Z)[# `V [ZZV0 ^ `F` ,R 0 ^`hpd@(VS` ^pP00CSZFZF[F$[F8[FZFZFZFZFZFZFZFZFZFZFZFZFL[FZFZF`[FZFZF[Ft[F00000 CR0ŕ0S@@0S@@0S@@0S@@0SKKꩁ0 00+0 0p0㄃Pk0SJJ:P0SJJ  #PV$0S 00 `$Pᨑ1GP 00埑opP:i P40SSf @]S @Z `P$P0 CRP]FtXF]F]F]F]F]FP]F^F^F^F^F^FtXFtXFtXFtXF^F^F]F]FtXF]F]F`^F]F]FhP- 0 }P 0CS]F ^F$^F8^F@^F]F]F]F]F]F]F]F]F]F]F]F]FH^F^F]FP^F^F]F,^FX^F000000D600D1356 R R D0$00  0np&j  0$ p@-@PP`p0Sp@\vsPp@-@0x`S   !00C000C0PUp@ R0 0  4PO- P\`pG@T`@V <00CS @p S0Sĕ0C0S0 z@0D 0 @0D z @1!  \PDP 0O-@pDMP!0l 0 00,@(p$   0!0 0 040,@(p$  0 400!X0_ 0'> 0 080,@(p$ P @DЍPS^^^p@-@`M0P0@@ @0 㼅dP E <@@T 0200 R00C1 2"Ѝp@^0?P,?@- P98@kXA-@&.0"0R S  B! "2 2R2S0p`P"0#Q00S qPP@UP#00C?o2PA4P,?XO-Mp "44 8"#8!`ǟ C\4LGy0 0 0 6CS 0C:W 0  0!"  "? !AT,fT< 0pR4 y0 0 0 y Q :lFy0 0 0 y; 0C S   !R  Q \  \ @ Q 0Xy0 4崥 0 4by rpP 0Fy0 0 0 Qy\ Ѝ   1T! 0 !A  Y"RR$0@P       !<  0 00! 0 0 !000 11S0@0AH4000S0p0 pp0 pWa   R^  !Rbx0 0 0 x'0p101X 0 !1R!AQ ڴ! Q Ƞ,Ƞ B! R00i Q   ! B!  B XY 0R p pp! R p0 0!p DR  B   B  `  p嵅W+ p 1(",400 000H 0 10 0 1C00S,00V(p`o :x0 0 0 Exd0  0倅 7 p 0p00Y !!AQڴ!Q K!! !! B! Rn10C100C0w80< 0 80< x(H A fDPXP-//-/-/@-@-@-p00d0@ ` P d0 (00  0 ( 0P(rp Ѝ1M  @-Z^@-V^Kp@-@P0S 0S 0Pp0Pp*P pd!>C-@pPM0 0@@ 0 !44 1C 0"440X1`V T, 0p Ѝ0S0S S0S  S0S ST@`@P 0 ^, 0  02# |0R0@l@ wh0l 0 h0p0l t 0Sp0 t #wd0]$mFD-/ 0!< 04 0 (   !/HzhzlzT0M000S ~S 0S/0S001Ѝ/\ P/0 !8 0 0 (  , !/Hzhzlz0@-S@ @p0`000S ~S 0S/@jP0P d0  0S ႌ1@ Ѝ0w0@0A-@pP`@P oA-@P@`@pY~dp@-P`@ Kpp@-P`v@?pp@-@`jP 0001p,p@-P\@ &pO-@`p\!DM 0 ( a0,$  @P0 00( 0 a4,$  @P 4 p 0 h (d  00 0 a8,$ Ph DЍOTS^k_G^dG-`pP$@T0S0S S 0S0S 9/P@@-0S0SP`0!0@PS R \ 808 0  Ѝ0 ]Ed@-p`( PSQMp $ @W0P ^P@Ud (0C0S* .0H   CR00C0000To 0(00(00 !$$    h 00` 08 PЍ#RH L0S0P  @SASC 0 #RH L R    #@P+ 0 (Q((",$ !$$ 0S(0DS 00 0 0`P0 0t0 0 0 u7P(P PP~DO-`@P(Vq p8@ @P  0 7@T000 P 9@ 0 !@,s@-aPU0@ QPd B% / P  P d0R0;;d0ЍpU   Ѝp@P P\P d0R00\d      0`( "4`#/@- "44!0"441@- V Ѝ 0<P   /  , G1S0C 0!0ղ/0M/ X 1M/  p@-P`8P@Pp0Sp@ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz@-@0:0@@-@0 :0@@-0 00   00)xЍ^p@-Py@p萂p@-P@ Y{p@ꐂO- MQ( P '    pWS   RK 000   0R010 0! R010q0;Sx@Tu 1 Rq00 1`@ 0`R00 0R010 00C 0 01 = i Ѝ HR@T  R 00 000 0R010 p RJ C\aC^L&\ds! ! !$ !$ s ' T G`^Lu\CQ B C0 00000 SE0 000T 0R00 0R010 T@ 00C 0 2 b0R`r1 !0 1 !r a  "0 0H  000CSp`V 000 R a 00 000 R00 0R010 T@ 00C 0 p`@0p0 @p0T@P 202=r8!< 8!@!<D @![D (!, (!0!,4 0!402r0W0 p0S0@@@p 00 00S0@@@ 0Z G- P@$p`0P= Y YH ڇ,  Q. Q Q 3 ,10S  0 PR00P 0P ,(#(P0 8#<48#80#Q0P @ះq0 0 0 q,0 Q Q 0@ 00S  0EiO-@PDMhppUXDЍ`0V V X `XV0CStFFF4FFFtFV  0 ;S0000 "440HPV 0 ;S0@000Sg1 0#2S S . ( . Wg!0΃g. At V0 0S S 0 ;S0<00h1d00l1V 0 ;S800S0 <00 0^^ą@-00SJ@ R  a``  B BQ00C0@0CT剄E^p@-@a@Pp80< 0 < 80pP!R< 11c TR S0cA1C0S0T10P!0S 00S 00S0`1S *06PaPT1P 1XC1H!UP1S01S0#+0N p2P11T1d\lX?O-CM0M00hp0 0 0 sp XR0 <<0f0`0SP%0%* h0kP h0 QP%*p PU =p1!0 1!HpCߍ  7PP0P 0#2S S1 00S) P"0#dd0h&h`F0L00,0000 0#21V$000$ R0S& o1!0 1!p0S 0S0S0S 0S 0(``Fr 0L00,0(0$ R`F 00 RP0 $ 0P 0$  QwPPUx $00C<0040<0 S  0SX :P  0@0X0N\K4@` 0 T0$00,0`0P(0(@,0 SȰ0 00 P&0Kyyo1!0 1!o $ #P07h ff 0h00RoP  R0Q]:@(pT@400Bo1!0 1!Mo 0 HqP0V 0 0@0 @DT 0 0  @D0V R/H00 o! ! !$ !$o@000 `FV GnX1\!0 X1\!n0# 000 0  n1!0 1!n60S T00SZhp"   p"44!$$8(<"( #8 KG6 XP  d `00000000 0nP00Uun1!0 1!n 0  HApP0@on1!0 1!zn50S T00SZhp . pq .lq p"44!$$8("( #8 . . R  0Rpt2n(!, (!0!,4 0!47n'-0 p0pGW/0DnH1L!0 H1L!"n nn0 0 0CS0S& 0R"m`1d!`g0 `1d!n+0 000  0R-7Y 0000 0000092 sP000`00;S T0d1R0 d 420S hf0  h0 0ቀ0 00 S.+0P20  hO O,0SG!>6 l 9&0009T0 Re _  h *B+P 00000 T0 3SH L0SP0\ 0 <  0CS00S0 0000Olp0060W^ n^^^^X?H?ą Rb ` 0 hpPX w6 @TR  d130p00D1;Sڤ0`1%40SI0  0$ T 70L00SE S0701lP2T"0P2 1 T"lT0@ 0!0CS103/XP  `0S 0 1 000Cp!0C 0 1R ^T00SP h!\00CS 18008 0S0Q0S 1 S01\P t AQ\l\hVLQy0LSv41 Sr:;So 0SC H!R L10LS2A0``FMl1x!0| x!!| 1!Ll1!0CS0X110C10    BR901!Va0 BR1011 01R$0S ,0S@P40S0#ǁP T0  000 0 =]P 0 ́@ Ɂ 0R* $4RkX00<0 04000hP] [ 0R 0@oP XEk1!0 1!kD rToEk1!0 1!kX0000< 04P$kX2\"0 X2\"8$Pll60E$c0 Q 0zQwSu* Qq0B AS0Vk80 !$!01Uk1!0 10! 00 0 00/ Tk%\0S `0S ! 1 2 0 @)T00T080;(0S0  ; S1 ,0S1100S 0S ,1 0 0;U0101h0hh P>00000`0VsąX?@-0  0'S(P L@e1!0 1!f$0 ?Mq 0`( "4`#/ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz@-@0:0@p@-P!T1PB1AP \NyX1+8T@1D01@ xSx0 S 0P; S0Ҳ;p^]X?O-0pMS@(0I S/`;W= P%P98!P5|60S`P0  0 !!R: !B\: \~*  B Rx X0S1 P0;0l0800000S P8P ! 1`P0H&  0z$ &!$$&  @ f1hd40S?0bd 0P `(VA00 00t4p1Hh@1SI  [) 1(00` RA(  `(VA0|   ,0wt,0K |ሁ[%( 6 )X/5`0S 0 00C00 0#Ѝ1 @0 40K, =,  5 4000:g<0U0402 b00S0U0S- 0 0 0 T2b`P 4 00S<07ba024"0 024"a `)X00/0CS202000000 000000 0 Z00400 1S 1! Z!0 01 01 POu0S0A101QQ0" 3SH L0SP0\ 004] G^~^NJ] ^ąX?x]<  0CU4 00 O0000Zp 0 ST S,(S0( ,0(N0 MPP5a0 0 0 0 0`S9f(00, 00S:f,0 ,0, 000 0S0P 0≄1 XSq5[_0 0 0 0 @0D 0 @0D ]_0 S,!0 CR,10t00 0080S: !8RP L00SL0L1`(`@-1D @0C100C0 0R100  fA-@0p0!R蔀0 0RP`|dP 1T010`00 0 R 01 @ @! 1@-0 00   00CcЍ^0 /|10|1/O-4M I F SPPQPU>Q: Q6 @ Q1J0 A\-Pap A  A0 c(#"$ c$"a8! #4 a4# CQ 0 CQBQPE`FPVpQ[4Ѝ Q A0 B^0"Ap10GS1qS BPP q*0 GR IQ PUIPGQP0p CR00 0AS0 PP 10CSQ0 CR 00 P 0CS0BS0P 0 BQ000 CR 00p@-0@P CR@Qp00CS00CSp0@0CS@p@-@Q0  00/ 0 0C0 P 0 C\ C\ 0 0C0/1S/ AR/- 0 S ARR A^ 0  /|1 0/P/ 0`( "4`#/@-0(@+R@ A3QR> R+R. R h1M  j0MX @bp@-PUp@`c0P 4 tW0Pp` d H Q1Q44![010p@p@-PUp@`\0P 4 ]X\0Pp` d H Q1Q44!]010p@@-0  4< 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz@-@0  :0p@-T0@00SDP@kp sT$3Sp0p@2Y~~#^TF@- @FA-0pS@ S P0S S0S0S0s0S0S0sT( PU  0R )00)PP 00(0 y> 0R` R: 6P 06 00001 @  00(100p 0;00S0 0001  (,!( 0"8S > ` 0p0;000 00D10S 8100Wc0 0000`000(S-00S 8 80000000 R R )0) ,    0("(#8S00SR  RO-,M0P0PP` 0T0p0X0P0 00  ( Q!R A0BQ00WV 00#2S S( /zA@P Q07j40 =`Z0`p(p0 00 00 0#21Ue1 R30 4R0(",40 00P0 00 Z(  岱  M=ẠᰱA3ᲀ0 U 00 0S S 8 1P0S05TPP,ЍOJ@,Ѝ0 ""R R2 v` ,    ""!R!3 Q@0Q @@Z0 ; 0p0 0 0 0 j`( @P 1  Q  1om80 00 0O 0J[`0(p갱( 8RUq崠 0S;a000 R)0Q8  Q8 U P0X0TPP0,ЍO0000000S U P 0S8  S8  UU0 00~p@-A3???H2S L2P"0S0R201T2!211C1S03S0#00Q 0P0S$2$p00S(2(`0`\0P0`1PP1P!UP3,b0RCP!<0824pX?0@-0PMX"@]0 0`0 80@0@O^ 0&Z(& Ѝ0,^G-pP<_@P1 /(9<0 0  1! `p1!1尠[ (`Z`PW W \8Z`XVThJa@`0@00T0P01H0,1@0Cp1=`@0PЄ8]0p@-P@T @p R00 0R010 G-`0! 1(pP0C 82BJ@{[0:0>YV;P K000B:000(#Y(0, a0 (0, (-Y@p(@W@|`@P 00S X@ 0<1P0 PY 0 00T0 PY 0 8P 0 0x0| 0?P0 0y* BP03 ( 00j 0 0? 0 bꘄ~Є =zA-0(pW% ;@SP`0;(X0 0 0 (X<U>0SPTA/(X 0$ 0 0$ 蘄 00!/ᘄA-p`冭PUA@T P P (ZX0 0 0 (eXm0:0PP~@-@01S001蘄0SrC-0`S,M(P@%0@P S FFFFFFFFFFFFFF\10S UL 0 SpH ( 0R*T ,Ѝ ): 0T0!  00WP@ 00SP00S h00@ C3SR L0Lp 00 S00/ސ]F:H]0S,4! x!/@-@0M 9<01,0 00 0S0Ѝ@F]@-( (0 尾OЍF0P \P 80P1/Q Q \P0 @\2S 0@\2S (00S@0Q,00P1Q00P1G-@0SP`(`XqP`2Sa 0!QQd2S01qw1S10S(`V`P`2SP ̐ P?P>d2S01ppU1S10;`U pt00{W *0G@0 W1Gh"R l2S0垲Pp2S<0h2S l2S0FHPp2S<0X?]p@-@PPpP1S" R X0o@ 8fS0S03X1CffPa 0 08 d7X!F1T1S01S00p@Cz@-@tM0t2p S% `0PS !S & "   8=2tЍ~QF@-0S6& ЍS6&j4^0b? S /A-P(pL1X`8@@ TL3K@D0S;@D0S<@DV$ '0 R0@1:D@0 P1XVL0S*@L0   @T8A%8150S<1*A0S0 S(00 b/ R /0SA-0`S0MYPW2PqS 0@S0@?oR20S@^ P0@S WB <2 PaQ:M 7M0000 0 P 0 0 0UP! Q 0`0@S010@Sʲ0T#TT1X%XS !0P90D0Ѝ  10CSa0Tw00000090P W R0( @Q 0p0Q0 0 ;P|00S @0G3WS "v7!>20 2 0 $0(0 \/]FEp@-0P@(6U1 01  (p@?UꘄA-8pP(`@$U1!01@@(A-Uꘄ 0`( "4`#/@-0l@ S \0C# 000S  , \0C#  B =0C=Ѕ@-@P 0;@0:P@ @ 0 \3\#   ]X?FO-m0@SM S( /`P@$00#.0#A0@.H>@$00#|7= 0 00 PU `0S l;P  |;PPЅ%@-0@ 0@00 00@@W$$00S@ Ѝs^Ѕ%O-4b@=PSMMm0S S8 > t00#.0#8.> p00#`< p\V 1  xQ6UR1!0 1!`R 6 T00;c1S 0 0A0 0g!P00@0@00=0=,R1!0 1!7R ЍO-0R:R1 01$R 0SH 0 A SS0!\ 0 Ѕ%A-P`ATAAp@O-Q<NP0T 0 P0T NPT1X! 1C1S01S01S0# 031S ;S ZN0 0 0 eN01;SP!T11T10P1000110H1;S0;0103/^~F]X?p@-@Q@0  p@z82P +PT1 RX` D B R*1C1S014cR :Nx0| 0 x0| N<TMX0\ 0 X0\ NO00q00~ą@-@aM0  Ѝ@.`pP HQM`0d 0 `0d M;S6S00 ( 1( 1S D  B0R#*Mh0l 0 h0l M00  B !  x01cT01Mp0t 0 p0t M<~ąX?p@-@P卢0  p@Ǣ`~P 01; S !R D0D00CR:001"~ąX?@-T@_SHH 04004 000咢@0~|ąX?x0 R   R-  R   R   R-  R/  / b /X?gfff@- @@0 ꈔGp@-@TP0==09#9S p@GP 000m~@-@8`@0S-//A-`@Q61`pP!P+0B8#8S1~; SQ0A?0qR  0?!0X?C-MP00`0p0 0` @. P  0`  00 000 0@?o2P0S R0 ЍO-M04@3`rXVP 0 S0DS0 0000p20@4Z@`T0V2|p3厡5@DT00`0 S0 00(0 0000SP -(9.0[@D0 [e 0 S030#X0S -([P 3W ߍ(0 @ D  H d L 1P0 0T00S0+0X \00U  (@,0#( #(0 0&(  t& T0 p Qq0y1x!&^? 0|10 (B0 0 00$P(0 8 00$Px(0 @ D  H d L 1P0 0T00S0+0X \00U,  (@,0#( #(0dx0 `0(0lq0h00p0670t00T0S_0yx1&^? 0|10Q0 (B)0 0 00$P!(0 8 00$P0 =00 =C00Hs }@=~-$M840, (  0L$Ѝ7@-PQ@ PP O R #ZP Ѝ000@-MBc0 e0P (P W PU 00 00!0 0R@P5BЍ Ѝ@@ꨄO-GM`!XP@D1LqR @Gߍ RP@ S @  R!HoQ 婒Z X 00ɟ 0@Y ,`(p 008P40$@@ @O 0!>4 ,`(p 008P0$@@ @9d> 00!T> 0L>4p,`(p008P0$@ @#> 00!> ,`(p008P40$@@ @ "040= 00!= ,`(p008P0$@@ @x= 00!d= 4,`(p008P0$@@ @(= 00!= ,`(p008P40$@@ @040< 00!< ,`(p008P0$@ @ 040< 00!t< ,`(p008P0$@@ @ 0!0< 0<4 ,`(p0@08P0$@ @@ @ 0!;0< ,`(p0L08P40$@ @@ @p; 00!x;0<0L 0,P($@@ @[ 0 !(;B0 ;L$ 00,P( @ @F 040: 00l!: ,`(p008P0$@ @/: 00 !:4 ,`(p008P0$@ @040@: 00!0: ,`(p008P0$@@ @0409 00!9 ,`(p008P0$@@ @0409 00!9 ,`(p008P0$@@ @040P9 00D!@9 ,`(p008P0$@ @0409 00!8 ,`(p008P0$@ @0408 00!8 ,`(p008P0$@ @0 400!L8 0 <,`(p008P0$@ @@ @z0408 00!7 ,`(p008P0$@@ @d0407 00!7 ,`(p008P0$@@ @N040`7 00!P7 ,`(p008P0$@@ @80407 00x!6 ,`(p008P0$@ @!0 40D0!6 ,`(p$p008P0 @ @ 040`6 00!P6 ,`(p008P0$@@ @6 00!606 0<,`(p008P40$@ @5 00\!5 ,`(p008P40$@ @p5 00!`5 ,`(p008P40$@@ @$5 00!5 ,`(p008P40$@@ @4 00!4 ,`(p008P40$@@ @4 00!|4 ,`(p008P40$@@ @p@4 00!04 ,`(p008P40$@@ @[3 00!3 ,`(p008P40$@@ @F 0!30^J^V^c^r_]^G^r^{^^^^^^^^^^^,Gq_d^G53_p^^ ^^\`-^hl^l^ ^1^}GH_^x0 0<,`(p008P0$@ @ @!0 00!0 ,`(p008P40$@@ @ !0 400!1 ,`(p008P0$@ @ @\1 00!l1 ,`(p$p008P40@ @ 0!100T 0a,P($@ @4 0400`SC0Sb=pp0S p@-P%@5p/A-0`SP%#@p0S9@@+0S ;2XR* 0R 001000@07@A-`@pP9000S S/@X=1DA>4Yᄝ 庨@]~G-p0M0@`0S6@ЍZP V V @{  "@  aY`v YHXHG0HGlHGpKGHGIG\IG(@P 0R000@P0S@+S; @P@T 2TA @P@T 2TA @P@T <2TA @P@T 1TAHXmIGIGPKGpKGXKG`KGhKGpKGIG00 0S;  e" ; 0= S00 000`0`S0e00d10200q0 000HD1P!@@2T!#3=P022|=T0814X0 *\*1 l0 1pp|00t00 p x02000020201111*@X?T?@-;@SS8#8S TS0 T @0;x@0;;S0(P @; S Q 00?0 S0P 0PD00 K P $00 B P X?p@-0(P;Sp@60@ Qp@q@P p0S p@-P#@p/0S/p@-P@p@p@-0S@ `@Ph@P @pO-QMp 0S SG Ѝ1`11@1P 0` !0 0 00  00P 00 0 00?o2P0S0S* BRpOGOG0NG0NG0NG0NGOGOG0NG0NG0NG0NG0NG0NG0NG0NG0NG0NGpOGOGOGOG0`00@0 S  S R| V`S0 0SPP/CjRP#US@@Ӗ/CjR@#Txltp@- @ i_S^5^:^p@-@\41P!(P301108480pp@-@\41P!(00P300x104Q88Q0pp@-@04Q8!0 S 0U0C:x!0S30C x15x1%d!d02S414pL R 0!QP!U:0P(;S/0p@-HPH`0D0@Tpw 0S w @갔_A-p@`{P0Hq < \  41+ !  41,812#4100FS`p@-@PUp@  BR +/A-;@S0;)`! AR80;p4Q0H 0 C'PPP 00!0C,2#41000PЍA04H04Q0GS0pP0PE<P4Q0!81 BR<10041,000x10   10BS!;S0;/814!R41,000x10 / 10BS!/O-4!81PR$Mu;SrP1200m Q0!aq?A3c 2#!0C01' A_'t14X6' $A$A! T@T(#3#  p0p [(1!20  0 Z@ @0`FB`#'d1 #<S01R4!41$Ѝ 0 0  0 0$ЍOMb̫gfff0@-M@ 0 \?A3c 2#!114S10!p 101010UQ%151S0!1 &P301108480Ѝ0Mb@-@<41000x1080p@-0!@0CSPp@}0;pA-`p@᐀PUT Vt0x0S 0S R00 劇DwP@`PO-pP10?o@2`@1PU8 V W6 VP@X3 }T 00C 001 00 0岑@ P 1R W 7P `0 @PW )P @T PP< xP`Pp@ P,A-`pPU@ P00@@0TPPp@-D@DP <4( p@dx]@^,C^H^(00S/!Q  B /( 0P/ R/0 S%7!3C" 3/0Q0@@/-P, , " " " " "    /@-@Q  088700 @0000C0%0 / P/%0$0 0Q: QA@/ 0Q: QA0//ᣋ. -%0  0$0s,P^ Q 0S3 X#Q R!0$  @XR5/p@-@`P@ LVU2 %0%00( c&$00$0D0403$ 238P<`2%0 00$0%0$ 0 00$0%0$ 0 00$0 0400,0000(0(0$pA-l@Pp`$  $0S 0 p0V00$0000 0 @0p@-P@@ UT0* % %  (R%$   $ 8 $ 4  #"#8@  R78 0S34 0S/#0R+#0R'0 0 0 004 \1@0545\1@55p P PP50305 <,ЍOL   @P]ĖO-,MBP $X 0 C0 0qW `2`P1!0 1!N0000$0VZ0 S: p0*b 0`& 0 0$0  d1d ! 0!!WPPL ,PB  R;#0R7#0R3 Dl P- 4f P'0 0 0 004 \1@0545\1@55p P PP50305 <,ЍO@   @P]dO-$M@ZPP $ЍO!10 R0 01"0 p Wy 0 b0880000 R V R  Qd:^"p 0&O 6"0VIt 0 0 00 H1 !0!!PP4 vP3 = R$#0R  `  b0 C P 1 90C P 190 Q 35 5Uzw   `    4 P000@`]PO-%0 @ x#000`0$PQ 34 8Pp0'r0sGs 0 S*06 $ 0"!" ! "  R' :#'(0( 00 0   QQ$Q-S$  (( 08800000$0 PP 34 D}0 P:v qPPp匡'r0sGs 0 S)05 $ !0!@ ! Q&#7880000 0   PQQ+QS+  (( 0880S000%0 0%00S0 0C00000 00 Ѝ0 P:@]\< C-M@pP `؀0S  S*Ѝ% %0 0R q\UP RQ 0RW0 0 0 P0 /@p@-PP@p`0@`TV@@Q> @%0% P 0 0%0P!0%0C0000}>*0`0"#0 0 \/01#`00S 0S@@hV=9C =C00 0 0 Mb@BA-P` 5@|pG L @H(PU@T D0D 0?8c[Ѝ 0@0$@~ĖX?gfffO- S @Pp0$DM0aV[: R7 0K 00p`00! 0  "  p 0pW:S' '078!800$0#1S<0P%1P%PDЍ00a]p@-@Pt `0D0034 0 0 %0 0%0p@p@-@Pt `080034 W0 n0 f%0 0%0p@p@-@`VPPpP 0V 0 10 V& [p0% 8 4 &#&#( #  % ( %    % (0 @10(0D`04`06% 36 3(00300%0(0% 0 000%0d0% 5 00%0(0@10(0QO-@PlM8 $05 8p%P %!  !  ( 尃Დ P& 4`8p FPP 8<% 0 !0 ! % 0 8p4`岓ᰃ(0:$00$0lЍX %%`p&bPP` 8<DT0 4D0%0 01 0102%00岓ᰃ(0C-MP 0`p` @0 0 00  00P 0 0@?o2P0S 00P PSS00 ЍSP @-@ C101H00H0101p00p0101000 20 2000@0040@][P @vG40!( ( "P @@ /-//-/-/@-$0$@ dH3(ԗ-$M840, (  0( ヨ$Ѝԗ@-FN^@-FX^@-@ዲቲ-@t1M/ A-P0p`0嶵@P& d0 0  0 ݮ 0PP@ZX(2004 0 004 (2Ѝԗ@-@(0((0M @Xq@-@0S 0S <P0 0  0 fP ԗ-/ 0!< 04 0 (   !/HzhzlzQA A-@,pP`10 00S S S ,00S PP(0",$( "(0P x@(20 0 0 (2ϊ3 40 0S 0 P/ԗ\ P/0 !8 0 0 (  , !/HzhzlzA-@P@`@p@vl~ԗA-@pP` ᭜@PWA-@`pP o@Hp@-P@!>pp@-P`@T2pp@-P`@:&pp@-@`P101` 000`p,1S/-@G 0O-@P`DM!2 0 0 0`,@(P$   0p!t2 0 0 4`0p,@(P$  40 0 00'!2 0 08`0p,@(P$ @0 0 0!1 0 08`4@0p,@(P$ @0400 0 0!l1 0 08`0p,@(P$ @h 0!$1  0 08`4P0p,@(P$ @R0400 00!0 00 0 08`0p,@(P$ 9 0!x0 0p0 0 08`40p,@(P$ #DЍO9S^c^g^^^]^ԗG^xGq_\ 0 \ /IzC-DlM (`{00 0 0 (0 0Sp * 00⇲P  00 Qp%p *TDW (Y00 0 0 (d0lЍ  SP p 0S$ "44 8"TT#8X%XU (300 0 0 (>0 S Aa0  PP ߯!> 12! P0 P $00S "(P,PHpWh P 0Xp  L0P L0 Qp%p :W 00USx 28 ⰃP'0 N3T⼄F'04` 0L 00yp 0(P\j /(0, 0 (0, ᇈ$@P2!0$0PP4(/80< 0 80< (/"$TTPP$P0S&2R0S $ S0S  S &1R (0  (0P0u pqtpW x00( 0 7/p P 0 0R: (0 PX Y/ 0$ 0 0$ (d/ 0 P P,ԗW^@-0S0SP0!0@SP R \\0 00 00Ѝ 060]GԗEA-0p0`@XP X/@0S  O0S  ?@ЍW0dS*@`O@P0S S @d0)V |1 000 0  TЍ.~6 6RQ*@@0000l6T$00 X00T0 H0 ST (Q~V |1 000E( 0$ 0 0$ (ᦨ 0R  P (P 8@5 0RS*0L0*!@P L5<0@080<@@@ @@00x000(00@00D00H0Z$ @0S0 0 00S%$ P 0[00000000P#40 000000B 0T(0I@0 S0  0S} 00 0(0$0T  @00 0S0$000 0 0 0 0 0$00 0C  R0T Q   R$ 5T   R 0 0  "000D00D00T 0 0Sp 0PP 0 0TP$x 0 E RE": P R (Q} 0 0 0 0 00S#$R  P8#<400(00UI  00000C00 SE ( ; 0R0% * 00ͩPP 00 Q:P @'h0l 0 h0l 'V |1 000hVh|0p 0h PP{ 㹣0 W^؁hفp؁x؁@-) @0PЍA-`Po|m|@@Tp!p@ 0RD0S|A|00C08@<00S 7'(0, 0 (0, B'<LT('004 0 004 3'D=~p؁hف 0 /p؁p@-`|PpT@TP`@0Sp@4^|' 0$ 0 0$ '@ꀱp؁hفp@-,@,P |0S 00p@@|~p؁ 0`( "4`#/P/p@-@P<@P<p@-40 R@  000  咥# Ѝ@-40@ R  000  {  ӤЍX0 0&C-PMp@{ 0`  `0 P 00 000 0@?o2P0SP QPX@P QP,{Ѝ譥Q ^8-$M840, (  0 $Ѝ؁1M/ :G-PQp`{PW@ 0 0U0 p` Pݥ@0P 3SH L0SP0\ 00< 0CVh!` V UD0V SA  .QP VPpX.XBppSI>X p AL\ AL\0A QPV .RP AL\0A-Q \AA\  S^0 B |G@-`P@M 8p.( .h`( .( `p07Ѝ^0@-ASS0CSG@GGSh v%B -QdGGGеGGk%A 0 0 0 Bb%A 0 0 0"Y%A 0 0 0 0P%A 0$ 0 0G%A (0, 0 (0, >%A 004 00 00 Q Q0%B 0 0 0 '%B 0 0 0 @0%Q Q Q%B %B %B %B ؁P/:O-PM'U@|50S p50h5h%h0(0007Ფ(Uv p0( (E"0/S0ͤ@Po ( pR((0K0:00`P\(p)j 2PW 0c`00:0p0PP|1d4p000( :0,PR[0 <040 P0#1 PIP0 S$ |!  S |!  W SW pG|!W^G G@G0/S0]@PЍH3xtp0+:pzP* I:340,0( HDr  PH0,(PH! U 20 SM .pQ'p"Pp06B0` :k G  RpG|1W2ꀻGGGGG G@G`GG  [ |1 000 000 000 000 000x 000p 000h1!0 1!`0!  ! X 000P 000H 000@ 0008 0000 ^]^8^O-M P0(`@P*}pPP 060S $60S 0F00V <␥P 1  Q"7YE`# 8$(0 8$(k#Puߍ0`0@@0 i P{iP 0S!00S 50S  .I&$050S 40S  .8&00$05DP5#C 0$ 0 0$ #`40eP2 0 R 0S 40S 0  G#05 N  P! 30S  .%0  *t#0j5T30S 0  4#0D "@0S  30S 0  "0| @0q 00S P 20S 0  "0fP 100S0 ((CTUP820S 0  "045P< R 50 00Sၡ  10SH  .v%0  5J!0450+000 0VPd[=dqdWw庡T10SS8w fP L  G0086lBύ00d0 ⶤP 刡mx]wH0Bύ1@0ٚW^؁ ]7^y^^^[^^^"^G^8دGO-(PWM@PE}{P |1 00U0! 8$(0 8$(!|1 0 00  0'S(㠡@P! 8$(0 8$(!|1 0 00 @0000 0 0S0% %` * D0⩣P D0 Q`%` *<5@V   @P 0 0`0: 0P,0 8>0S 0P. `t$,00.0P3R!(8,(0 (8,(H!0尝B?! !O!X:0HS,l=0S 0p. B$0J. <$200- 30SW0H S񟗖GGG0GG$GGG\GG|GG|1H X1GGG800S 000 R0  0P 0 Q`:Y 0<0fPPn 000[ 2GPGGGxG/Up  8$(0 8$( w|1 000 0040004 0$0[ 0$C [C 8(0 8( (0,0[(0, |1 80<0[80<uPPP @ 0 R 0 3SH0L0S 0 q`P`@P0 R0  H0fP H 0Q:00S U  6 88<(0 88 4<($$0 4 $$; T(|1 @0D0@0D[ U%|1X0p t p tP Mdx | x |M|1 000U084(0 084(ZD80S U9 UP 0P0 S0%0 * L0P L0 QD: 000S 70P5`vP+0S00S$ 5`~0S[ hPP 0  3S H0L RPp\0p0pG4pGW᠜q500$0$ #44 8#80(00C(0C0S0CS"`p0<000SX SX  0W {`P  eP( B00S S5PP `V0S0`Jw 6$0 SXp\5```P Ppt$0 S 00CS50i 0S񟗞GGGGtG 0Rp% p *  P0P P0 QtppW 0 X0 PI YXé(00C 00R0 RQ0I400 \ ?^R# \' R0\4P< 80P{< 80 00 CR H4 Rk(00CS \eIYb`|^0H40Spep}p8`TPPN  X((  (0S0  R R)02)024 80s0 (0'b_88<(0 88x4<(|$0x4 |$d(GR0嶐 <(0?o2R0S (P`&p4100T0T`Vk 009 ~oF40V04`P2X00PX$0XDHX$0S8 Jz0408 Xp00S(0`S 8P$008$0pcP P P  0 40S PH0\0\X DH  0001`0``V ~oF؁W^ ӌ]^^xG|Glف|]Hhف`p<`5យ08)0 280p0xPw 0S(0 0q(0B8 )0 (  00E0 #R HL R\0P  0800B00V0080(00 Y O38100d0dY~I0 $0)8 Y "h hpWDpG0073000S 0$0 S0S 00H0l0lpW DpGWV0`1p0p0S~?C0S`040bP P P0  0 80S 0S2<203Ju,0800z0 0 0 400 < a40< P0040X40CP10! (|(0 0`vc(00(000C0,00,0$  "S  R  0$ ppEpW3( 0WpS (O 0 4G04pp(p2a|1 H0L0H0L0S|1 P0T0[P0T0US ᮟP 06[4[|1 X0\0[X0\UᕟP nXlX|1 `0d0[`0dU}P TTs|1 h0l0[h0l'UreP\[Ub00`0S0% % *0 t0`P t 00Q:00S4 8$(0 8$(? IWߍPp00,W0{ AWC +W_ p0V`0 0 0/P 00 Q:``V %PK H帰 00   +bP 0  bP W (3W <W R00  x0P x 0QF:00S  3W Q  Qp R00  |0НPx | 0Q(:00So  [00  0⹝Pa 0Q:00SX ,R P ,00l{0@`:0000 00000PpS00,9  92#0Sl  3/g9`V!U d 90S(00  0 <.列( 0EP(gs0S80:S50S0S0S0S  P#0S0S0S0S  P R 0!0# U pPP`d D;0S(00  0 -*( 0P(ᥚ壚00K噚P0T 0S P0T [ 2 0O-@P`DM!$7 ,@0 0 0`(P$  / 0:p!6 ,@0 04`0p(P$   0!6 06 004,@0 0 8`0p(P$ H6 00'!06 ,@0 08`40p(P$ 0405 00!5 05 ,@0 08`0p(P$ Ի0405 00!5 ,@0 08`0p(P$ 彻0 4008!45 ,@ 0 08`0p(P$ 妻 0400 0 0!4 ,@0 08`0p(P$ 叻 0400 0 0!4 ,@0 08`0p(P$ x0400 0 0!(4 ,@0 08`0p(P$ a3 4@,@ 0 08`0p(P$ K 0403 00!3 ,@0 08`0p(P$ 4 040<3 00!,3 ,@0 08`0p(P$ 0402 00!2 ,@0 08`0p(P$ 0㘢40 0 00!2 ,@0 08`0p(P$ 040 0 0 0!(2 ,@0 08`0p(P$ ׺0401 00!1 ,@0 08`0p(P$ 0400 0 0!|1 00 ,@0 08`0p(P$ 娺0400 0 0! 1,@A00 0 08`0p(P$ 叺F nn0T0Sn@%DЍ:^^Gq_<^GH^ ^ ^^^ ^^ &^6^0^8?^M^ [^e^`^؁Gp@-P ^@lmh 0S Q0P@@@040p@nP np@ D08PG-S@`p0 0 0  0  0 0 0 JX 'R 3SH0L0S(d@PG  0  RV WV R R R R 0S 00) 0,P,0:S) 0R% * 0aP 0 Q% *D+Q 3 8$(0 8$(>Ѝ0 #0C?o231 ψP (MQMaR  #RH L0S0P  0З@0 0 0 o0H   C/R00C00000T 10S q?!*0( 0 (  /R 3SH0L0S0㼗@P  V^ T^(`)p0, 0`1 01  ({؁W^Tف ]r^O-0p'S(,`(プ@P  P ] P ]P  0 ЍO@ЍO;Ѝ@-0  .؁C-0@p4M|d2`PP Q7P1HqlD2DRҖ420( glʖV 0SS*4ЍCll ^1`1 V@P  f]P  4Ѝ∔@Ph 400   0 cP w 'l@T> blpP XX}ԕe@l wpMlWT 40 Xpp` dU0030# 0S H0$U0*`B 004 0 004 `Pdp03/@84G؁O-pV P>1`U F/pMY  @d<P $0S(Pe8ApWqcd3S P81 0 00 >pPX00S . 0` `0000"[ QI ]^^O^فY!I8] ]o^X?xG|Gف@-p@`]0P p@3 Ѝ@-@Yd @dp@-dP@Od0SA?C p@@d!R1S A?CSP فف@-@D P0QQ  00S 0R  4Q DA-@p`$P@P c$A-Pp$A``P@  `P Uc$p0S Aفp@-`DP@Tp0S  PUP $4RPD@A-@p`k$P@P zc$p@-0PS0S0S 0S, 0S00S% I$A JP@e$p`00#d00#h00# l 00#I$pA,فp@-P$A`h@PT5$p ` P0 ($pA @ف 0 S 0#/00P/Qp@-@p@ L P 70 SRp00k01p^]SRG-M!p4QP@ $Q !BQ -Pg  `VP_ R R RRQQ`V\$U9  BUU 84U 09  ` $2$0 0$0 (0$0(0 ,00,0 000 00nPi#DjP`o1P#R0P9` $ PL1PЍ`0@V$( R, R $V7p H 8H X0  SX \  d 0t0 0x0 $3S d  00 00008 900 P!U   $0S DZ  S0 $00 000 000 00 0P1XU p H 8q X Hm/ d fd b00"08 0 X URPP?#0  JRP P2 ]00' d^iiikii G-9PQ@`Ma V9Q] ; 6C0CQX 5CjuPio iJi( i i Vi?Pi ߖ>Ni0iKiǯ> ~$ni i ixji >Ki Ii %i Qi >!i O-pODP@`UT D P5TX@@0S0 00SDPSO PT v ` Z` `$4R@@00S0 800S DT@ 4Q@80S/A-3`A0ASHM^pgDPh@$TXHЍ00S1i^u0 000S)thP% 00000S .`   0 0 00sd0NG'PA^D-@0J `]^X?@-@9@A-HM`pDP@T  |1S  00 0HЍ00S!^ G00S .` + P P00000P]D@ o] ^@-@|1@qQCp@-@P P oppp@-`SPSS;1N q0@0L0`0D00@0 0<0(080,040D00040,000/q@pGGGhG,GGGGp@-P@vq0@`0];]SS Np@S~0008C00 0/p@- @P!>00000pp@-@P 00000000p@-@ M Ѝp@-@-SPESPp@-@0Q$MG 'R`l P'RX("($( 0t0  0 \ *P- R00S"!10!0!0!0!0 0$Ѝ@+\@P R000CS1"^N^A-`pP@200SD0CSX 40GS* S( #S_ KS% Ѝ o\Q\ X ^ QPQ `P H000S D0CV`#0F0 eP  _P V 00#S0  Lo`%S000 00 00 00 00 00000V0S  0000X`QRI p@-`@M 0 C.^^ P?R1  000 C0PU'X ZX X XX I`0 0<000 QMP`ЍpA ER PPC/C-40@SOM S $ R0#*50S %0OߍC R |1 0 0 0|1 00 0Oߍ@D  Q :S S #3R t40S h$l0|1 0 0; HT, `P2 p ₴4Bύa`a`001411 0``1@P t30S 0t#t*|10 0(0 ST#2q12L PP ` =2P<2034P09}P 20S 0"XT lPOX20S 0h"l,20S 0008"@000000 00000000 _LP1B110 0141P /P d10S 0!3"p'qr\10$0$PU ~_EUX ``x1` `<<0@ 0000 0S 0 |T P0 L00S P0\ P_y1(0(PLZ ]x^^]]]^/]^D^^]8] ^J^xG|G^n^@-@ 1Y4X @8lH0O-,00( S@(M r@P 0<Sj@P 0b 0 0bx"#2't1040bt' 0܃PP 0 K0( 0",$ h((Q"dhd& @ Q         R/ R !! ,P 2 0!&Ȍ 00 #8S r;Q R r[ Q R Y  R% ZA[ RY Z R Q R R R R rd   PR R R rd   PR R [m ;/000$ R  2/P [Y P"0R R; R8 R5 ppWp Q0Q-Q*Q'R R R R p W Y  "Z  R W  pR R r $  VP R RG-(@Pp,`PM00pxxp'p0S.0S0く RF 0S 0S 0s 0 iP' (00 0 P" (00%0PЍ#  ! Q#3 P 0P 40 X 40 X 0S2 P0S   &"44 8#8 !R   0 1 &"44 8#80 A&"44 8#80 1 06i0SA-6PS0M0S  0Ѝ0S0Ss0SQ@p) 0S0S/1hFP}0S@ 0S=0s  RE`0 P1(0@00Ld-0S  !> 000S VPd0_10S d0VP 0 S0SI / ]0SE0@-@8P<$MP 0S$ 0R   PP0S0S0s!.0  P $Ѝ0 PS0S ,0 @@/8O-p$MPhX$ P $ 0 00帤&h00 00000 0 #0 " "0# !! * ! &!   ATX $ R  0 8/$Ѝ R9&R6& R3 R R R R'  sP! R R R R  aP0  {R 0  0sRd   @0O-M000S `Ѝ0PS0S/`0S. 0@Sp(00S% 4EP`0SK 0SH0sEd0 0S0S0S0S090sP3#21208S, 00P0<0 P 0 PPQXD XJEP W*0S0S0s0S0sPU n!>6d0刐 p0(0l 000bP0S100 0 8,P0PS3M S,PQ <W |0,%S 0S0S0S0 0XPm0j0S0S 0sS0SQP 56l0S (0l00L0t0 l6P5kg 00000S w0`( "4`4# :000QX  W 0S100`P6Uy ~ aP `1`0` O-hp&h &TT$M 0X ' "%X " A  TpzWpp) PAQTI$Ѝ R R d  &R&R Rzd   0P 0C @  018E 0AT 0S0S d0 6S 6Sd0  P @0S0S d0 6S 6S W d0  wP @0S 0S   0S0@@P]0S/ 0@-S0S   Q Q> (0# ,0# 0#.$$ ("(0  !R   0 1(0# ,0# 0#.$$("(0 0 (0# ,0# 0#.$$("(0 0 10)0# F0# ,0#.$$$("(. 0  " " "0  !R   0 1)0# F0# ,0#.$$$("(. 0  " " "0 0 )0# F0# ,0#.$$$("(. 0  " " "A-0@SPM0S0s  0 0h!0ЍP0:taUP1\ Q: 0 CT0C2T* S 5 A%CPU^\Q:ࠃÅ0S:3P50\Q0ࠃÅQ:0CPRQp Å0P0RS5W0P0R^#05W0P0RS5W0^P05p^ ]p@-@08M S8Ѝp@vP`.q "448 #800P8Ѝpz^ 0 /ؚ@@- s@(ㅟ,F=aED{>A-P0H RP' @0D 0 @0D `p\ Q00P0SP 0S @@XS  00فG-@Q MPp@`I YF 0S A`0d 0 `0d /@ Ѝ  0{P 4@@ V { {pA0 0 0 A@ H/PH0S |1 X0\0X0\0S/ 0S,0s)  0 {P T @T  R H0C@Q S``V |1 X0\0X0\J{00@hفO-x8M#2尀崰1(20[H`00p00DlpSX00Z 0S P T@PA [@pPUXHT0\00C?o20S, T@P' [@ZXp00 [ApP00$0,7 0@00000@P0 0UA_E0UY 1p@ @l0D pP [BZWX* @0S0S0S 0S pplPHvH0T40@p 3pApDz[(ZXTSL0 T TNPySL0 @KWZ@pX5(#2!12ЍZ@aXTzPU @X0S0S0S 0SM  n4t`T6 LlPP j1p @pP [pp`[@Q `< H@PA<0$ R=`0l3t 00x0S/ 8 l~@P)4 lx@P#8 40R030S `0 H,0P` 0s f0@0P1D0DPU A_EY `?`X0H` 0 00SHq?`n? 0`S  SVX`b?` 0P0P 0  0S0s 0s 0@0P S0@0P0s 0@0P0s 0@0P 0R)T0Ss0<0s0 Xk 0<< R<RZ | r%! !Q$ RnTR  V` 0>` 0SX>0 Rg0 `T R QRM  #  RC H`,0&0P,0;R ف| P P/Q|1 00/p@-@PL0@ 8Py P H@xpp@p@-d0,`P( 0 0@M 0  0"` `P P!PP d0!3d0"44 6cЍp(0 @-HL H  < فC-騁M@t`W0ʀ 0! $t!0 l!d!  , !Q#PTPV  R0S  0T@ @ @H@T0 SPPPPPU 0 0! t0 |  , !ЍQ H0R:H ]P0H000H00@Hzhzlzف|10SQp@-HMPH <0sHЍp$P 0 R0 $1aUH@, TP+CPH @L00PLP  P ,$P @ PP ,$P @T-/0U0L0 ꔊmuHف0-C-@q`^M@P @0D 0 T@0D 11 DXp!@xf?!0Hp . U. PPT 0@@00p@p v ^ߍCЍ/0 0 0 |1 80<080<hفe^^0O-,00\Mp `0S 0S  0S0S0S5 0S0 5 ~Xw\w\Ѝ50C0( 0MRM.yh5P0S H5@D<00 ,0<Tw@P+ei0 0 0 tU0@;'w@Pw@PDP0 0 0 [U 0 0,(000 H( $k=P H= (00$0 4 U0  $ S=P$ (0R< $ ($C=P H=(0 0$0 h3 H( 3=P$ (0HR0@( D0\0* c<,0 <,H0S |1 000U H0@0%4`#000Q 20S5 00``'H`3`J= H=80H hP r <,0 <,Ua (Y 7Y 0 W)P 0  R <,0 <,?v=@0HP H0S |1 X0\0X0\e@0D 0 @0D \80< 0 80< gH0S |1 H0L0H0LZ EH0L 0 H0L PU vX 00FUk^^^hف^^lځ-$M840, (  0gk$Ѝhف@-(0@ R+`p 0qP3T( PPQQ0SqPU@q0 000 3SH L0SP0\ 0 r@ ЍP< 0CU* 0qPO-LM  i 0@P`p㬌!< 000P,`(p$@ @@ @) 0)!X<  0@04P0,`(p$@ @@ @< 004'!< 008P0,`(p$@@ @; 00!; 008P40,`(p$@@ @t; 00!`; 4008P0,`(p$@@ @Ж 040; 00!; 008P0,`(p$@@ @幖*0@ oj 040: 00!: 008P0,`(p$@@ @坖040\: 00!L: 008P0,`(p$@@ @冖040: 00!9 008P0,`(p$@@ @o9 00!94 008P0,`(p$@@ @X040`9 00!P9 008P0,`(p$@@ @A040 9 00!8 008P0,`(p$@@ @*0408 00!80< 008P0,`(p$@@ @040\8 00!L8 008P0,`(p$@@ @8 00!8 008P4`0,`(p$@@ @0407 00㬇!7 008P0,`(p$@ @̕040d7 00!T7 008P0,`(p$@ @嵕0407 00!7 008P0,`(p$@ @垕0406 00!6 008P0,`(p$@ @凕#040h6 00!X6 008P0,`(p$@@ @p&0 400!606 0<008P0,`(p$@ @ @W5 00!5 008P40,`(p$@@ @@l5 00!\5 008P40,`(p$@@ @*0 400!505 0<008P0,`(p$@ @ @'0404 00!4 008P0,`(p$@@ @l4 00!\4 008P40,`(p$@@ @ 0!40<D 008P40,`(p$@ @@ @̔ 0!3030,0 0CW^hفO-?MO2F?Ve`P?ЍOhF0JPP <,0 <,p|10 0 0I( `rP m 0 H R> 9)0 9)|1 0000 0 0  0N >(   p RJ0 0 0 |1 0 00 0_I9)0 9)R @ =02F?! !2S28(0 8({8(0 8(0'S(^p0`Q g0 0 0 r|1 0 00 KQ6 Q! Q Q^ `00  4bP Pd7<,0 <,BP0 Q $Q Q" Qq90 0 0 %|1 0$0 0$ o_\( \ q Q$Q Qq Q P q Q q Q q 0'S(oP  0 p00! !0(  poP <,0 <, 0` 76P 0 0 0 )6 P 5 P50P090 00S1|1 000}PT9pWP ph0 0 0 @0D 0 @0D m|1 80<080< o88LD00H00 \0 $0DTo$0pSB 8p0S00:S{|0S*@37pWG DA+N,JWuҟh7h'W0S0Aݟ@ЍOV Lj{@P ?Xc0SP@Ѝ?PP N@@# 6VR  ⷕ3@03430N@PN0 30P""##4 R00Ǒ3S86@|0,6 | @F@ T -@ |{@P@\ |{@P 0倅0# 0# 0# 0# 0# 0# 0#01Q5 %0 5 %U5%0 5%0``&0`&0`&0`&0`&0`&0`&`1q\ ;P $5P0S  P *PD $$P>0S;  U+ . LPc. _00; $ 0P0|;<3 0&&'0 x000C0吠Z PᐠpWUe 0q`W0P:7@"Q  <e 0 P" $P|;<3x0S00C0xPp |PP;@P0S pP|y@Pd|0Sh 5G @\0@Z@X{;0 0 0 I ЍU 0  R +0 0 0 0S00 gP 0 0 0  [@  0$ 0 0$  0R*`-/W0 0 0 (0, 0 (0, 00`S 0S 00 d@P| _0<< 0M@  ,$pځW^ P]03" /A-`pPa^@P7U^0_VP  @A-0@(S`pZ^PPQb7 _(!_( 0(0C00(00@ @@A-0@0t0Pt00`0x0x0|0|00S <-PO 000S --PA  80S ppq-P82  8<0S ppq-P<#  <p0S ppq-Pp  p@0Sppq,P@  @P -P ,8P ,<P ,pP ,@P7,-l 0/G- @XPp f`P @<,0 <,a|10 0 a2`3 0  Ghف7@-0@ Q)R*SP S  vP 0sS :R  Ѝ0 :RS 000:S2u@- @00t0x0|0qp@-``.Q00S@P5 P c,0u0A 1U00S 8P V,080#U00S <P K,0<03U00S @P @,0H@0!a2U`VppP 4,0p0p/Q00 =Q 0U00S  aP ,00P0t0A-p(@P` ЍS0GS#0G *R#0G% S1SHHHHHHHHHHHHHxH`HHtHHHHHHHHHHH\HHHSHHHHHHHHHHHH(HxH`HHtHHHHHHHHHHH\HHHU0S 0S0S 0S 0S 0S.2\  R 0S0S0S 0S0S ^P^9P|uy0S  [+P7dUa0  R0[U0Xt0UT0  RO0 000 0 00PEU0 U?0S< R/9S60S 0S0S0S* 0S' 1%P"0+P  0 000 0 00P U1p U 00U1*P 80 000 0 00PUQ U 00UჁ#W @pЍr@P9WP+0 @@0 0,@P d0R55-pGWHHtHHHHHHHHH\HH,HDHHHHHHHHHHHHHHHHH0  RW0 d0R88d0 A/0K d0R88 d0R77 d0R77 d0R66 d0R66 d0R33V  d0R116S0S0S0S0S  d0R99 d0R55 PUr@P_ A0:PUr@PS A0 (PY 6r@P (= A 0 @`@`T (@P= 9@`0`0000 0CSLHHdHHH PrPs`PP  p6P 0)3S10" 0S20~0S@8 0R;0S8@T5y(@1PqPP0  R00sX800 qP0S0ĕ8#2120 000P $0 P @$0( 0 ,0s po_ P5 x `V 3S100 $e#PpW0 $m P 0S 0 000V $P p4` `qPr408 0<0sp(_fDP  5P O X !#PMpWJ X 0X PQ pD0S85XpTP05Phw"P2-0J!q@P0S S Sd04^d044Zd044V q@P妱WW > 50S+W$,# GR@zğ \ Rv19@ 488`40ⰰM.P 0 f`60S .d P63`&`1`00>hb`0d 0 `0d mW |1 X0\0X0\V1@SN0D0SMx1S500F00< D06@PPPD0H01D0PS<X@P %`0d 0 `0d 0000BU@ |1 P0T0P0T6@ DL P@ D0 p+P D`0d 0 `0d 0@0}40= D0 SC 4@ R<000000> @ 0<01 SP<0SD 3Jύ$ 1T0 P08WP U`H00XD@v  Xl*Q xWJύt0.P% `$<0R00@ U0<<0 |1 0003SB0 0 0 U |1 X0\0X0\3@3 uP x1S 0S  @h0S! 30S00S20SX  @ :P $R*X&Q W X0<V x0S  R SU@0S 0S L0(0@ 1P>LP@0 @H@P@0S `<,0 <,}F (,0V <7 4 [ l@0 0 0 (@^ ]^ lځ ~hفS@D0/ Q0*$ P޸P0<10.O[R0S0Z0S[ s0@0P @ $(  $@1,@@0 3  10S 10S @ ,000,0 $00 @D<?V<0PLV&/0S  /0UߍvS AY0 0 0 d@ X*AJ0 0 0 UUd |1 h0l0h0l[00S 0(00=0",4c8<0X00[@00(00S0 0  , @,00 #  # R 30S @ ,000,0@8#8 0 0C40 XU, |1 `0d0`0d#0S ,0R  0    0QP@ C`0d 0 `0d 7@`0 `@0U@PTECS0 ~,0P00%U?0T000 P(10@T ~ODT~X? I @-4 R0R 0 0H8 Ѝ4 I0S"p@-PX0\ @06S qP `L6S006=M00C0p/@-0@0,M`S6S 6Q0C?o20S =,Ѝ@L@0 P pt0\ 00 00P p$p^LmLjL|1o8p@-0PM@\`P ^(0(S00 N 000 |0 00@X0<8@400 `4 L@^PЍp0  @`rP]C-1威娑1!$M0Ƈ$#2a12p1P00@TAOD.3"`&abB$$Ѝ10p WAG#0s !v0@0P P#`"P  #$P@T#0s v0@0P 00 y P#0 00] ~X? IفG-|1P`p (M0N SW200S D0CS$@rT4   p  0  0 0y 3 9200S D0CSY@TTf p(Ѝ  R   ` Ra R H000S; 00 03 @S #212 00 020@T D@DT 3"(00S"  000"H0 0 @  R` Ra R H000S@K^0@-Mn> J嚆嗆00000 0|0c00L@P  ``XP0P $呆0@ Ѝ0@芆 ]I^]^X? I Ip@-PK@0@0d000?00:<0?00 0400S 40S3 !0 0p0uh0p@-P P@ᯯU0 @@@D@H @Pp@0Sw A-@`pQ@ DR HQ0PP ᐯDX=QgC 0 0 0 qP }01 0S@0@Hp0C Q6$I$ITI$I$IIIIIIIII$IQ! D R   0L S H0`S@%A 0 0 0 /D0S H LD R $ ,H0S / ؁$]^'^^Q|Q/P/5p@-@P p@lH0@-@PP0$M @I|1 03/P;J$Ѝ0p@-0 M @`'JPI|1 0@4/@JU JT06 Ѝpp@-0@SP M 00SsP  P0@o ЍpL`##P 0Ugc P II0P 4   H RII0P/@- Hk@<@-|1@PL2`PM 0CPj 0Pp 7C0CPVP 0P00PЍ1PD (7C 0CPC 0P p0 \PP 3`PP 6(06 06$0Xp\00p osp,psI<1P 0P,0S0pW 0W p0'u?0040 0S0$O8  0-00,0000 0 0$0000000 000S0`V 0V `0&e?00400S0si WiHliHC-@P0,M 00px0嬀P`0PPTPx0P$P IVHx00Cx0,Ѝ PP 0 `O-4Ѝ0SD0S S?0S0S0S0S  'P-0S0S0S0S  P0s. D0 0 0 O (0Q50 0 0 @@TW P 0 0CCP εPWpAP 0 0 0 0 0   0$ 0 0$ ;Y =@P0T 0S P0T g`pP |1@ (0,0(0,0 @Dhف0SGC-0`SM3PP00@PS/P@ 00S% T, 0p 0S0U0S   0∽P Q Ao `0 0 0H 効Ѝ@0(p0p/ސ]H:H]O-M0(000406#@21,20pSP  0 P  PPP00  =P=P16 `PP`00$000:S0` 00S =@P7P@00`0 0 h0H   C'Rj(0C00(00T 0(0(0(080(00 0<0040000 80zPPS4$0Q00SG000`00040<404000:S8P0S^0CS[:0(P3 80<@P ( 0j 80<@P#RH L0S0P  (j<@ PP Z<JPu08 80 p  ( 0P0:S80S& |!  V V F|!Q2|ZIZIZIP F|1RSZI[I<[I\[I|[I[I[I[I[I F RB`R1 01  \0S4<02,#2!12Ѝ  R|1 000 000 000 000 000 000 0001!0 1!0!  !  000 000 000w 000o 000g,@廻004 0 004 h ؁Dp@-`1@P M \8@0 0 ,P@\9@ 0S/@0S@ G; Ѝp7@-Q@T0 QP   N Ѝ0P OP0S)T   Ѝ0@9@iTdTT Ѝ0@k@DT\ Ѝ0@\ Ѝ0@ A-PpV00 00000@P& dVʀ0! 0     !0 0U@Ph$@P wЍs0Pp0 ㇳ HzhzlzHs@-@P` 0R0%0 * 0<P  0Q0%0 *S @ź0 0 0 кx R ! Ѝp@`孺0 0 0 帺 0W^hف@ 廜p@-@@m" " @-0@S00S SS000C0S@  0:P0S]]0S0S0S R @-01/pp@-P@UQ PP 0S  00S`P "pS 000CSp8#<4000p@-0@S8M  ./00 00S 00S0#TTX%XU `P S 8Ѝp 000CS0P0]^@-@ 2P P @0S00S 8#<S000CS/@-|1`SPD PP 10SЍU8 0 Sp* ( 0R*Tᡟ 03T 1!00 Pዟ100!L</^@-^ T0\0SD00@0 @,  (!Ѝ^i^>_:v^^^s@-P`@P0 @Ѝpp@-P`@P @pO-4MP`ӏ@ՏPpP<ϏJpPSq0 0000 0$0 r`  R81#811/*㔡X1*:Sx |QxR 0[ zP PE 0 ⰱ~ 108#81 P 00]4Ѝߌ(pP ypP $W yPyPpxyPppxL0 X2L  7/P ^T^IIyara^&^8^ȂITK_ȀIK^p@-P@P pO-`|M@P3p@p8C@0 000 PpW00 P 3p咅pP `$`=0V|ЍᇌPP  pP | pPu d( pP 0"L pP Z$00⸅T0 0lP`0(0p00t0ISPE ֈPʈ0 R  P  P"QQU1[P#* E 0   P0 0P01hd  R:ihP U  0 SZhP `r0S<0@0D0080$0H000L040` TP080} R\8XT^|^W^^^(s_n_^^^ ^^ 0,01 0 e>?<‴3Q#3?P [@P # [P0  R= 080#80C?o2S>^0 7/,0@ 3 #R(0\\Lp奆0 0,00 <0aX?A^IA-@( 0  R    RA| ` p  nP ,]@[  [Lid0 8/,0@ (0LPY0 5/(0LPQ0 A/H]H^7@-@(0HPB 05/0<0(0LP70 5/040 Ѝ07@-(0$  Ѝ0 @ Q 040HP 05/(0HP 0 5/04 0R40 8 Sps@-,0@!;90(0LP 05/}_(0H`0 6/0S"PU 0S , P(0L`ͅ0 ;6/Ѝpp@-,0@^E^[^h^^^] ]5^]A-@8P`VA((0LpV 0U7/,]A-@rPR 0)S4 )S lpW ,0 t0ht0ht0  t0ht0  8R 0S(0L`0 6/t0ЍAB0SS0C SꄾItI II I I I I I II.SgpW (0L 0V8/00S(0L`߀ x76/(0H`׀ 06/(0L`π0 ;6/(0L`ƀ 06/(0H`往 06/(0L`嶀0 ;6/(0L`孀 06/(0H`奀 06/(0L`址0 <6/T0 0CSPT&23L Ѝ(0L剀 0V8/pWH(0L} 0V8/pW@C (0L`o ;6/(0L`g 0 6/t0@(0L` \ x56/(0L`T0 6/(0L`L; 6/F $5(0L? 0V8/pW m0S p` $&8Q8 R(0L& 08/(0L 08/(0L0 8/(0Hp 07/(0Lp0 07/(0Hp 07/(0Lp0 07/t0 (0Hp 07/(0Lp0 07/#:0`VS (0L` 06/(0H` 06/(0L`0 006/(0L`0 6/x0@ 7S (0L` 06/(0L`7 6/(0LP0 5/?Rd(0L` <6/(0H` 06/(0L`~0 006/t0 (0LPq 15/(0HPi 05/(0LPa0 05/(0LPX x15/(0HPP 05/(0LPH0 05/(0LP? 15/(0LP7: 5/(0LP/0 S (0LP$ 05/(0HP 05/0<0(0LP 05/,0 w]ܖ]] ]@  WW Pp Ws@-@(0LP~9 5/@P(0H`~0 6/0 PUЍp:A- 0pP(@@pD0(0 `H~ 08/(0H~ 08/0@00@0(0Hp~ 0 7/0  D00D00@0Ѝ D #D  I 0 D00; (0H`~ 06/ D0, R0  R1  R6  R6, 0D00@0 R  R6  R6060D0(0H`n~0 6/0 D0< D0 -D00D060D0600A- 0`@(P@`D0(0 pHG~ 08/(0H?~ 08/0@00@0(0H`2~ 0 6/  D03D0 ' D0 0 0D0(0H`~ 06/(0H`~ 06/0 0 D066D0 D00D0Ѝ0A- 0pP(@@pD0(0 `H} 08/(0H} 08/0@00@0(0Hp}0 7/0  D00D00@0Ѝ D #D  A 0 D006 (0L`} 06/(0H`} 06/(0L`} 06/D0?, R R  R0 0D00@0 R0D0D066D0 [D00D0 0 00 0A-@40$003/, , R^`P(0L`n}0 6/(0LPf} <5/(0LP^}IIIIS8  0"S4 ЍpS  0"S (0HPz 05/(0LPz0 ;5/$03 (0H`z 06/0V>00(0L`z 06/S  0"Slp@-IP @]G-Pzp@`9  ⷱ<0

$003/(00Hu0 9/3 03l,0  `&8`c 0 ' 80  G1<]^^l]'_7@-@(0HPu 05/000(0LPu 05/ Ѝ0s@-P B@ 0RI II8I 0"S0 #R (0HPu 05/(0LPwu0 ;5/Ѝp$ #  R= 08( #80SH`^u0 6/000(0L`Su 06/Ku0 6/00 0"Spt@-P x]0@-(@P@0 0D0(0 `Hp%u 07/(0Hpu 07/0@00@0(0Hpu0 7/0  D00D00@0 Ѝ D #D  0 D00  00 66D0G-Pup@`倫  0HpC2?00<0 00$pp0(`0,0$003/(00Ht0 8/3 03LG+x]^^p@-@P(0U PE LPt0 5/(0LPt#; S 0 0//Q/p@-0@P 05/0 00 p@/@-P@ $`$ 0 00' 0 0,00$(00400p 0$7/P 00 004`$00 0(0`0, 6/P400 Ѝ0$0 0(000,00 0S 4 3/BQ;Q%Q" 0Q0 .0 /<AQ04J3J@4J3J3J 4J 4J0 .0!0 .00 .00 .0/5Q0 .0!//0 A Rh0 S / l0#"l 0 S 0;Qh0 $Q  /A-3A@Q5J5J 5J5J5J6Jd0SЍ`0 p 7/P0 U:D0C` 6/0` 0d0P`d`VpPPPEu0V:0` 0d00 00CR00p 08/PED0 P0 5/`@ 0  E08/`0V:P 0Up%p%*`Pp@-0@000\P 0\0`P 0`0P 00P 00P 00P 00P 000T@4\Q@- /6Q@-/%QJ 4A0&S2&Q/8J8J8J8J8J8J8J8J8J8J8J8J8J8J8J8J8J8J8J8J8J8J8J8J8J8J8J8J8J8J8J8J8J8J8J8J8J8J8J @-0 .0!/  /9Q/Q$Q !0AS h00 S 0h0@-$&Q>0AS h00 S 0;Qh0h0 S/1 l 0A!lTX 0 AQ  R 5` R  R  d    BQ / d /G-<0@@`p  d0P3 5/0pW<0@  d03 ЍG/P`]PEU<;Jh;J;JDe0 R\ 0Q Q Q/@-@(0 00<@ @/@-0@ S;? 00 S;?0@cQp@-@M6Q 0A R2p7A,QAJAJ?J?J?J?JBJBJ?J?J?J?J?J,BJ$BJ?J?J8BJ?J?J?J?JxBJdBJpBJBJ?J?J?J?J?J?J?J?J?J?J@J?JHCJHCJHCJ?J?J?J CJSPCJ?J?J@J?J?J?J?J(CJ(CJ(CJ(CJ?J8CJ8CJ8CJp|Qg nQ` oQ00}Q[ ~Q00P( hPldYp<0<<00000@00D00H00L00P0001010 1010001<0 | 00000@00D00H00L00P01010 1010001<00<0^<0000V\ 0Q00000H00T S?S0C0`0S  0S 0d00 00CR-0+0d0(( hl'd p00(Ap,Ap pp@-PP@ p`E(0 0 000@$080 \ P`dP     x Ѝ4@-P@0 080\0`0d000000_Ѝ4p@-Q@<0 Q Q <0pQ *Q!R0 ,R0!R0 ,R0!R0 ,R0!R 0 ,R 0!R@P ,R@PS00 `@06/Q/!R<00 ,R/<00<0/A-XP@Q`1`!PEU0T  p07/`0S T 0b0Tp D07/`P T0 POc`0S  0S 0d00 00CR00d0A-X`@QP1P!`FV0T p 07/`0S T a0 `TD06/`0S T c`0S  0S 0d00 00CR00d0Q@-@( Q`Q Q>d 0D32aP2"5/ PPEPEU+0 pD07/`P!  00b D0R P5/`P  b0Dd 0P2 5/`0S  0S 0d00 00CR0 Ѝ0 PD05/`P  0d0Q@- Q Q Dd 032a@2"4/ЍD0d @02 D 0 @0C-0 @480tS$M:?SF@0C4SB$MJMJ,NJxNJNJ$KJ$KJNJOJ$KJHLJ\LJOJOJ$KJ$KJ PJ$KJ$KJPJPJ$KJ$KJ$KJPJ$KJ QJ$KJ$KJ$KJ$KJ$KJ$KJ$KJ$KJ|QJQJ$KJOJQJLJ$KJ$KJ$KJKJQJTJ$KJ$KJ$KJ@UJ$KJxTJ*SS ʘ*S ʌ*SU  SW $Ѝp*S h8$ЍCT*S ! BS;  SPh`h0S! AP*S7 l$ЍC7Ph`h0S, .PPh`h0S, ]PPh`h0S! RPl$ЍCl$ЍC37 l$ЍCAl0S 8L 0iyQ \PQ R00 P ∑  81 0 l0d S031` SP1 P!01cQ2 `"6/Dd 0`2"6/\0T lR Q3 CQ0C` 0C0R 0S 0d00 00CRB0@0d0=X T0l0 0CS 050C2Q30CQ  `0 S d031bl0CQ3S   l 0R 3R0C0C0<00<0l0 S0C BR 0l0<S03 TX AS` R  R p0d S031"S0!0C0< S0!C TPR:X`R*l0S03@S10B!0FL\X0T TPX`0ld 0l1cP3 PP1 P!1`Q2 `"6/d D02!e`!1ClQ3$ЍCDlQ3$ЍC{ld 0Q3D32`S0!2P"5/0S l0S ! 3\0P0C0 SS0r Qn\0Cl0S <djl0 S0C BR 0Zl0S SU \$ЍCo`\ 0K hHPLPpL\@0 0` ` 09/P3 `` 0` `  0` 00 ``009/P0@0 070S)S)SJTJSJSJTJ TJSJ(TJP0TJSJ8TJ@TJSJHTJSJSJPTJPTJPTJPTJPTJPTJPTJPTJSJ\TJdTJdTJdTJdTJdTJdTJdTJdTJSJpTJCP P^40@0D0HPLPpPPPPPPPPPC$P(pC pl0S0@!0 0 ⟏  8Hl0S S S< 0T 0C 0 S S     l0 p S03S0!R 0CQccPi< T0X00J?u&p$c>_l?p$?_r_i^__________p@-PUpU- @\c_0  RS\ 0  C00p  /R 0 B P S@S00S\ 0PC0ѐ _A-@P` 0!0`3/V0p4`e%n 0!0p3/ WȚ]p@-@P 0!0P3/UPd` 0 0P3/ UP8` 0 0P3/ Up@]]; S 20/ <8#8SA3=8#8SA@A210/</t2>08#8S P2AAP00/<0 /<0 >8#8 S 1A0A`0111Q 0CQ 0CQ 0Q1 A+AQ$YJYJYJYJYJ1111|1 p1Q 0CQAA Q񟗼ZJZJZJZJZJZJZJZJXJZJZJ110/>08#8 SAA QZJZJZJZJZJZJZJZJZJXJZJZJ0000000000x0t0H]2_z_n_/v_r_j_f_b_^_8_______Z_>_V_B_R_F_N_J__~_p 0S -S"0A(0,D R!#(,0/0A-@M(00 00p@P A<00,p$  `< 60PL  D    p A ,(p$00 0< "@ЍJ _ $R _<0S/@-@0f@ӀSA-@ S  pp>lP`pP   03/@NT@D @AWꠞ]b _ˀ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzp@-@p`P7p@@0S/p@-P @ 00 R PD  s@ 0P6 4p $\J@0S/@-@@s0@04@g O-D0Z S(@3?:pPa0 S.  S lc`Bv @ dV`@ 0  >0@0000@X Q@ T`` 0 @)`@X J#@0 800@P 44V (4V 4V@ 4V l00 03V 3VU 3V|@0000 0 000g3V P< S0< S< 0ShPQX3V] 0L3V $@3V X 0g pB`P  f Zh nX2Vn 0V`P2VA 2Vp 2V |@000000000 0 0 000`1t l00| 0pЍA/g 0     0 0 000l000Af0 0000 0`PdA Ѝ? @000000000A00000H0 0000 0`P@ 0 R 00ЍA轇0-h0 00P0`P5 PЍA ``W W @W@W @W W@W @W@WWW W W W WW($8$@-@p`U0P000T! 0CT( 0T 00 0@0TP0S# 001@0P R 00S0<0@00CS0  ЍP R 0 0q`@ @T@@~fvtA-@aP( vB0 pAܪ40( R/$ R R/  /L-4( \0^/LT0Sp@- @RP 00l0p0p@//@- @ P@A- P@B@PP 0SPPUPX0S PpWP0`P`pPP PpܪD@- 4BP@T  P ܪ 0!< 04 0 (   !/Hzhzlz RP RP {//C-QP `M 0q<0 0V@p, 䀖XW Ѝ0 8/P 0S 00p W0 0CW) T ,6W 0WT 4h0 0 : STP 5W'= W: =G<TTh Tp 0: 0: 0h T 0:: 0h T 099>08#8 S=;G"0C S rJrJrJrJsJsJsJ8sJ8sJ8sJX4W00G?o  24W00G?o  2|4W00G?o  2 0T00 0Y  00 e @DoQa Q^ > Q[ QXe @z 0T0 0 0T 00#T 00# 0T00 0T 0 0 0T@0@0 0T00 0T<<T 0<#V T p{' pTP {mt0WppS l00p3/tpT TP 4 @@a0D8#8S @DH$H0S;K; S< S {:< Sx@k1Tp0+ 0k0S0+ 0Ab c0C S@0}p@ 0; 0; S 0 8T .T T!  0@H$H 01AU/0D SwJvJvJwJwJwJwJwJwJ`wJ@@0D8#8:S@@DH$H@@01 $'* @-@(0S2 $0S 0S, P`p40 CS4 ,0 0, !; S  Ѝ0 0 3/Q Q 0 0 04,0 L$A-PRU@x0S( P$ST`T0V S0 PVPRTpT0 0S-l00p3/PPT`TpV@ .R 8ᘈT0SP ` R _ _\ P/0 !8 00 (  , !/Hzhzlzp@-@0Sp@P0PS 0p Sd :!,T0S` 0Sh0T0`!X?Mb@-MPQX0@S `,,x0S 0$ [P`V% 00S" 0p0CS00 00P k< p00` P QH剈<%T@Q0 -KЍLX? _ _̞]Q @-庈/! _p@-`P0@ $  `P0(0pLmJmJwJp@-P@PPP(PpL@-Mp`PyQ0@S 00`,B0S$  hPP:TP0S4 S P0 0!! !1Ѝ@6,h0*U h0T$PP @ R 00`SPU0P00 P Q ޅЍX?Mb- _p@-@P T0S @ܪ@-$ $@T 0T0L@-@<6>P X0SP0S@sܪp@-@PPP@p@-P000p@-@PPP@p <8#8S@ /P/ 00S/]@-Q JJJJ0J<00000000000000000C-0S"@P`p0 RUREFQ ᶐR0S BⲐಐḐᴐᲐ#@TP`p000P@/ "`Vp`W0C2? 200 t$  Q != ^Q‘ @@HPTlLoV  \Qڰ ޅA>M _p@-0@SP S` ` < Rp؜0000 0O-,M @p P@DQa|뼑t',Ѝ0PU T包PU0 T 0@  0^LAoY YPQ ` 00V@D"* ; S >08#8= \S 00 \ `*0Co[ 0 SQڰ  02"s _ _p@-Pl@PTpP0S003/\@@-P@Tp@-P`l@TpP P0R003/P`\@@-@PG-(`pOPl@TUЍ0Z 0 :/PP\@p@-<0 0QP`?o2CP@p)@-  001P)@-  001PG)40 60 0 1PJ/)/@-P`x㤻@f㠻p0lpp000 P$⼂0@@0 P0tp0 Ѝ_)p@-PP@0S `᥻`0Pp0p) _s@-PP 0XP\0p0@`0\0p0T0S 00SPQЍp3/ t0S 0 d `0t 6/PQ 003/P 0\ X0`0R`0p0`0\ Wp@-XP@T0S 00S 3/\ `0R`0p0`0\ 0X0pP0S 003/O-`$M@HN3PV '>C 0CV 0CVP x300 l3V P0ST0S g lpWX` ,3V0t03VV 3V! 6C0CVP 0VlPUQ 0 0RnM0Pi2V`lPpU``PP trttRdpVʀ 0! $ 0   , !0 00 0Y 0!d!0   , !$Ѝ0S S S $ЍOPR X0SP0S0 Q X0S$ЍO$ЍO\P Vp 0`006M\PP $ЍO6P R 00S0<0_P 0 0q`V PP0S 00100  0;/P\p3vt`WW~fdWcWHzhzlz$ 0)p@-`P f`t@P   pPU X0S P0S 0PpppG-PQT@TP `L %`lpWX`UL@ L 800S 3/`P\p _ _@-@LTT0 TQ S S @Q @-廃/ _p@-@PX<PpfLP 9P X0SP0Sp@p _ 0`( "4`#/R/`0  B"11P/  R  ,(0 0//C-Pp@(`V Ѝ 0䐕9/@C-P@pW Ѝ 0䐕9/`p0S@`A-pl `R$:Pp@Q:AQ  A8/ 0| 00CS%p 0 B BR%&<0 19 Q*Ѝ0 A-`l PR :pp@Q: BR B8/ 0l 0AA%\a&P0Q0 R*Ѝ0P#!- \ X:#:^:\:0Qࠃࠓ\^/D]A-Pp`@@0@Dp@0@L$<#@`W N0pG`@A-PlL0pLALA$ `@`W tN0pG`@O-T@ L P0   lA 0A`Pp2"0PS0VpW* Ѝ pA0 A   Q  0 Pe `Fh !$ X F!Y P0!`pW:X  QY Q  O 0PD]S/G-` p P#"Y@PX M0S  rO00H@PR/G-PQ0Fh pY@p`V8h MO0S h FO@pG-Pl @R`T  Vp P匀`#801U 0S  "O0`0PE V hp `G-@ p,Ƞ 0P  XPW 0S  N00pGPp@-@P0P $R@P SC@ 0 S 0  S@C R 00pA-`T0@Pp 13/UT0LpP` 0T01A/0T0A-@p`0S  dPO p A d Q0000000P)QO-P`p@@DT 0 >p0 SX Ѝ0 )p0XC-RP`p(@@DT00  000 0 X ЍQO-P`p@@DT 0  p0 SX Ѝ0 p0XC-RP`p(@@DT00  000 0 X Ѝ 0!< 04 0 (   !/HzhzlzO-p`)@4`S0ʀ0!0)0() )   !@V`WPpP 400 $c0@04 00$00 , 0 4 00CSP ЍTc4,0P S@0 00 P  [  H ^  L X0STX0 000Wp V `0`p00S`0`p V `d``PpT o lTp1qhpPL|00 10000000 P 0 Tp ` 0h`Waf`` T`Fd 00C0c& 0R0 0C (0`00` 0RS0C2x05A05t0505050505110Wl%01 W ,PT% RFDHN\A \ \ 0 A0a00 Q3 0BP R X:  \0 c)0C2#8#<4(",$!8Q(L #8"(!PE  ᾐḐ ḐP0 \0 [꾐 ᾐḐ Ḑ弒01 `@3 90  BQ RZ    0S ax@v}t( nKo@`p@SlP!0W 100#00#0A0S ( H0`0P^ <T"48"$0,04#$(#4 <  !48!00$31##4<  q  0j3 #  $ (#4 <0 $ !0 $ !00A1@00V@`@P0S 1 0 1000 C00Cs0z 0S M "<<"$,00 2#̠$̌(#4< 0 R0#  #4<0 a31#  #4<,<  <,Ġ 0Y.4<.̠̌0Z 00#€` 00#0R B000 0b$00 S\0S3 0 48 0 02##4<00 S0 b##4<032#$(#4 < X!0!  0S  G0`0@PY   j! 4 8!00 0 00R! 4 8!002#  #4< 48 0 0$30##4<u꘣]]]O-P`pV101!00 `#8010 S(1@BpW* Ѝ 0"00#0 R00`00Y b DBB Z Y ? !1pW:Y  ! !QZ ! !Q  F `A꘣]]]O-p4S@,M@0S[70 G[3* `101!P0P P#8",V0 !`1 W㜠0P  Rpsʜ%YJ*P0 0t 0c PRx `RQ,Ѝ S $p RÑ{'U$2 0 2 $0Y:0!448#8400p0P!##48 0S0`0P !  " Q  ` P꡿( ;00 B0c 0! 00#0Qa0 !  R hNP"    "\!  qc2 02 $00 p 1bR0YW:0 $"44 8#8$04  p r  (00!Q" "$,    Q\{ u r  "! RH{  ! R  0E 0` PY*P0 0t xp0c PR`0W 0PE0s00 #  "0  SM{  !  " 0S 0`F qEpG0  (0>  P""$,(00!Q"<< 0"$0,000S  9E0`0P8꘣]]]00 00000100/JJDJJO-MQ@8@Q\2 C\.*P`!!)( !p), !V㜠P` S(P p "(& 0$p(|'"([$* 0t 0c xpPR`)W:ЍpS0S  D0 `0P[:00!448#804pQ 0S  D0 `0Pό\00PE0 S 0S 0 `FDpGO-Q@,M@Q\ C\*P`!!P PV"! p` P P S", )* $0 * 2 )    0  0 XQ:0 E$0<R0S  8D0`0PX;:0 ^0# ^0 n0##C$X0 0cR#0[垳#CY00c[3\;:  "BZ  bP"]000$0Q0S  C0`0PP0 0t 0c xPR`)X,Ѝ0PE0 R 0S 0 `FCHꌠ]T00  ,0X00500\00/JJO-@PM@P\e C\a*PP!"UP8 S0"( !i8 剈`", !)$`p l& (ተ0pW0: 0 `S0S  |C0P00 $"44 8#8$04  ` R0S  ^C0P0pW*80 0t xp0c `RPWЍP00`F0 S 0S 0 PE1CpGO-@Q,M@Q^C^*P`!!P Pp"!)V` P P",  S(ᇠ( 0$ *2     0  0 YR:0 E$0=R0S  B0`0PY<:0 ^0$ ^0! n0#CX0 0cP0[垳#CY00c[3\;: @$Z`R ]08#80$0Q0S  B0`0PP0 0t x0c PpR`Y,Ѝ0PE0 R 0S 0 `FuBIꌠ]X0S  0R   Y  Z0X0[ 50 0\00/LJJ,00S/  R 0|A-`P㡪V0@P0# (㘪( 3B0`0ጪp $'B0$p,>P`%> e0`000  @@|"/p@-P$0@Tp5/@|\0P/ L  \/-  , "  |)A-p`^@ PP@@@ @S PU$R : ^V WQ +@P@^T0 N^@D@D\'LD@D BR@D@D\ @!N N'O-`pP`08@T U00400 Ѝ 0 VP`@|p@-P` 0@Tp 5/@|@-P0P0P`@P , 0< 0 00 20Ѝp|O-dcpT\\CUX 0S0 + <@D Pr!QbU00PC10c4#P Be" "1Ct p R 00 0C##< #"02#0 dR0 <#/00 0oQ98|7@-P@"l@  0 0 Ѝ00C-M 00Rpx@XPh` (   P  Ѝ R 00 b?( 0S 00S=P   PPX7@- @Pj< 000 # 3 @ `,3 Ѝ00( x00/0 <#<0@00( x0 0/ /@- A< Ѝp@-P@` ` ` pp@-`@P X0 &U  0 060P000p4 06000p@-@P0`` 0 000pp@-@P 00   00000CS p $p@-0P@ `0%R @h @ 0X  @ 0x0 000p [;h0R@h @ 0X  @ 0x  9;h0h0p@-0@SS+$JJJJJ`P `PPE S`0P( 008#80"$R*0( 0000C@0$0p`XjR`P`P H;$0V0$0000pg^xG|GQ _p@-@Pj p@p _O-0pM0 0! @@0P 1S 0l0`@ 0Y":0S0  H j0` Rp00 R SPSP2/`0S0S-  R*  8?\0"0,@0/O^@00 C)@C)0c"<3P 00@0@ 0S@P  0SЍ 3/0@-0MP0@ 00P!0000(0$ P$0S S Ѝ0.00(0P(0"0 B (0 g^O-@( $Pp0`ȡ [ :(0$Pp0`0S3000/V"R/ p R+R*0JJJHJJHJHJHJ`JHJHJHJHJHJHJHJJ` pW0( 00$00C$0 Ѝ`  R i"  `PE  p : P   PEp`V6 ,0, ``` g^ _xG|G0Sp@-P` U U@ T?@P  @ 85@P0 <0p/p _ _ _0-T# ;T@ p&  Ѝ QCM? @ R P? &? H$H`pG@00C Q4#0@CV` pU@D 0 p0P6&0`FS A CR T a DR @DH$H@DX W@;@T@;]O-8P@Up=0`P00a040,($@@ @*<Ѝ _; _@- 8 Ѝ@-0 R  b@ @`@ 8ЍЀp@-P@,000 080/0 0 !""##$$/0/0 pG-@ MP 7`Ё][@ x7P $(` 00 c2s~ C1|8Q \gFp Ѝ4, RX\X! 0C#000 ?b pP \f0, 0 0 0S \ 0 fdH `L0 0P0001@00rh0SA 0;  R8 0p 0A a320! r0  P 8 #61S0SS$ 0S 0Y;`0H @R000@0@v00 NSX000L000)|0L 7; _ _$ _< _]^P P /|;!)p@- P+$@P`0S ^}DFQ {\@"Lc000:0pp@-` MR@@P60  `$!1/@P 08SKF@ Ѝp7@-P 0 uM@PQ@P K00 Ѝ0s@-P@<`,` 0ЍpC-0000`00CSʺ0 V0  =# C!Y1 R7P 0S = C!P0S c> Pc>O-P 0X&  ( , P B R   ,0),0 $ Bn 0 h0 S0 2 20S09(  0C  ?o 2  !0  20 -4S S 200h0SP 0_S [ Θ.0-400 , <00SP}`& A 0hg^P0P 00\/@-01"\A@P <]@-@Q0ST RN^ 0A@D^ \0SQLSQ \03=?00S00Q0S0SࠓࠃQ^\ ?6?000-A\\^CQ Ӂ0ѳ 0ҁQ/0G-@0P00pU5` ?w 0R (: {>C 0C"4W0  !1 /@+b! T l0<#! \0r#o7uk7ppЍ0T00W0;k_kų@-@PM`(p! P `40{> 0020 050 02?0@  0 @ Qv@Pod470PЍ耖@-0S00R0100 P @P R0S*@? T .@@D@0 Q RP00]G- @P0A S0 00.SR0 .QR 0L0SZ00UЍ P.P Bp0`^;ZSU Q CB \A R^:^0C `4 pC SRQ G\b*R^ 0S00`p Ub 0 B Q  GcR0b~  0V`: X .XQQ0p`bW PV ` B` R00 0S B Q.Q  W ^` Q.  ^ P^ B`_0R_0 0S00P U]c 36(0f V1P UO  P]C-@PM0Q s.R R 0E $2S KA p R0 0 2`P 0P 庁.  -  -Y@PPĥߍC-`M@@r PS Pߍ 0?``FW - @ T0@ @D T - - 0- 0`W@F`0! ᲀP XPP zpwWV\ !PV RPP]C-P@?00CSLM`LЍ@0 `p0R x- t- p- 0 0S*h0 pS 0 A\0S/Q  '0\ \Q^ AB 0  ("(R ! @ B+ 4-\ Q?,? Q, ? )  3000Q/@-0Qs.\ \ R 0 #@aAON/0S/S 000/0M000Ѝ/ 0P @/0P0 @-@tPt`t0 0x0 @`@NP0 00 @`@N(6' Ѝp@C _ _]/@-@RR@8@-Q|L SCЍC-@$M` ,0pS rXL SUxP@x , !08p 00$0$0 0040X< 0L00!s0X0P0"L0(X0\00M0400X0St  0Pqd 02\0 AXe001@0 @0`Sg< 0M0@0P@ 00$  0 PP 0YQ$ЍP @,0 H0 0I0 0J0 0L0 0M0X+0\0800sX L000 00X0S @A =A000+[!!] _ 0Q0A-` @ P80 rGLppF\P:\pd@ E 02p `0S7:0 00P 0 \-Ѝ\` 0\P/0 00H0 C2 000\0 >0>00C000\ /ЍA _O-@L8`p0,MP 0s H$ Z,Ѝ0 n/\0S* ppd0Ep7s0GU 0X0XP 000Z\P0c 0GPh  ZpG $ld0T 0C@ BÌ)0@ @3)`<0"$P$0p 00 B *0$ % \P0G 0f-P= r 00 0Pd0;0hl0 Q AH0 C2 000 0\P0 0000#Sn_p@-@PR P @0 0`eP`卝Op@-P`A)%@Pz"N@40 000 001 0![%00cЍp@-PL%@P4SЍ %KOpp@-0`P@ R@ 4 Rʈ0@@\0S  0@0$ 8@0z@0 0C?o20p@@-D@Ӝ<$P$ FЍ0 0pA-0Px0 0幜l$@\`FT 0S <Ѝ D%pc%@O@pG-P|@xpv1D0"HC \ ! `.V x1x 0 -   11 1`00C`0`0  0`0 11 1/@- ) Ѝ0M000Ѝ/0@-`@TPPtPU \ PU*x^\  0O-`0ts4M(00P000X 8@ERk X0S04 p000 0 0 0JS 0\0 00h00000p XR:0#S(P Y l0d G BT02000Vp`dp2L0.L00 VX0S0 R d0\QV l 0CP 230Y l0CL3000V00R d\01CpS04Ѝq000 0SNW\0S*(P = 0$00,0 0[ (P (0(l ,0 B$"P$0, (S:P ꄰ0{0 00^ H0[ (VP Hhlj h00\ %S/G-@PP`M/ `0S 0"!0#0\.0l 00p02 B"0$0KPpp`0 00z}(0 {0w(0 l080:(>r0"\!o0C00D0l `$0 B"0$0T$ 00H(0 =0P   Wp.0Sp(() P WЍ]P_l_O-R4MXP0r\0@Sm: / 00$0 0(l $p0 B$"`P3( 0 z-3 0 0 1Q+ q1 :CQ0 ( !4 0 (+0(00t0(P 4Ѝ| Z  R 0 0%RP0 0RP ,,P'`@-M`pP0 0 0u@P ЍU 00@-@  11 c0?o0c0CS1! aQ\51:  P0#03Q0#S 1S c0?oAQ1O-P`pR H0p00?{0Ce\ 9. P 0[* 0R3:U& H0Z 0 0p Aq  o B X0 H0p00$ЍUP11 Aq  o B  X0H0 0p0UP1 1 mNA0C-P@`q嬁,M00T\0S*Q[,Ѝ -00 0 8Y Q  0l 000 0 B"0$0P `K0S s S00 Q0 @0:02#400@00 >0@020000 * 2@$ $0% 80C-@$M0\ S :0P(a`0\0pS*W?5 0 F-x-WQ 0p0w#PW p 0 p l0  0Cp  $#0YP $ЍW O-X0M@Sp@8` 1hh q h l  l 0 PP ЍL0P!h00h0h0p0l0t0WP X0 Ql00vPP0[pG00X RX0 00l PP h  0C h  00Cl0 L0 0 CS  dT00l0$ BL,p 0C#0P$ 0$XPM!Ѝ/O-0lM P00L0 `圠  8@0 J@P)0$     CRv     P 0@OoB@lЍQMP@M@0  4 0.S1R R-0.S*p0Dps 0S7$0S] @0LpS.$0S0bX S B/o" RL 90000 ^0\P+ P2 P0,0 0$`00 C/oQ" 0R pp4 0`(` 0\0<`SLH00 0D0P P PA @  D0,0  ;0l0TP C)CL@H)0c"$<3P<0 L`H0S^0000000    QQ Wp(`Q@K40SH 40SE  I@P?Wp(` W( 0KK2(0(0@,0010 Wp 0S0 00 0 0 00 8P ,0S  \&*P 0 00 d*P08 ,`SRpp pK0p 0B    0C tr  B   C $xL R [ D   pD R`[ W`DppbL0 0Wr LpR$ R v  9I@PX0[0C?o20S( 80@0b$  R Q R   @v0  I@PX 0 B/oS" R@ 0D$p 0D@P tO-8@LM00`\0pQd :,pA0001 0P 0 \ LЍd \002\0d800000@ pP00lSh0 A)A )0aD@48"03$P4 h0@0P 0 P"H0 0I0 0J0 0L0 0M0 0L0< 0\0<0"800s@0 00S00p0 0$0p00(000,00 C00 , 0R$:04S W0Sz L0 X0r00L S000 S<0 0P0<0 00]h m04S4 /d8000@ 9PP,l@ A)A)0aD48"03$PP4 h00P 0P80 0($ 00 0 I00P 006PP pd80@ 7P^l@4 A)A)0aD8"03$PJh0 pG 4000 0 Q 04S= 7 PEPPi h/04S& d0@ 7XPl@ A)A)0aD8"03$P 40h 00 0 pG  P  0CO-`8$M000 $@P @DOoB$Ѝl A)A)0a"03$iP0P Y Q ppQ @ 8'P $'P   P__A-@Pld Qpp0 BT A(`P15"^h05L<0 L)L)lp1<"$PV 0h 00P00Ѝ@- 0$ 8 ЍO-8@@BT '/i0&&4 J?@BT0  @P@P Hd 4 ??A.$ 0R 7000 0N^G-@0S0s!sr"sr00s(sr(srx0s` 0Ps8p  S0s  S0 SЍ(,0sq 0   0P08< rqHL rqp 000 SV@ 0>P00 8< rq 0 R 8v$sr 00 T0V HkL0 0L00000s 0 0 8V,0@>P L000L0000|0s 0 0 V,0@q>P| L00 0L0000ЍG0 r| rSh fC-0@p0S M  RP- 00P S 80 \p`H/ @X!V0 P 0`F`80l A)A<>)a21, Ѝ8 d0l 0C 3 ?SR`O-`@,M0pS8@,Ѝ 0S@\ Q00S) 衟 PU \  0 R0U0 R H0C200 00 0PP 000 0 = SP @P 0d hpP R b0S"$   PESQUP!\ P R0R0P0 |@Pl A)A)0a$"03$@P p00 0CS0! 0P)U 0RSU@pO-p P0` S8$M S@ `I  \000 0 P0S@$Ѝ00S\0S0000 @00\0/0S00-p0d P l0  \RQ B01@ 0 @PZ 0 \ \ >0>00S H0A00 00 0H0  C200000 A@P0S> 0S0\ ~T000 =0000 000@ 0 0 >0 .0 0@0@P001 0 -  0  H0S 0 dd@Pl _ 0* I(C8RP 寱t000 #8 *(80( 0?P @0 S=$ЍO5@7@5_M!Ѝ/A-0 @p0`SP , PW/,,G-` P@U!,@P pp, @P 0 -0N0@ +B@s@-@0P000CSG#SR`88 d0l 0C S c10PQ0`P 0##sr$ 0(00#sr  Ѝp@>8l A)A0<)a21 #Ѝp_@-0P@"XE0@8 4#, #$0EEЍ2_s_T^00\ <00C Sd|K||K||K<|KX|K||Kd|Kd|K||Kd|Kp|K 0 ! /+ 0 0 0SG-0 SS   ЍS P 8pL  PS  Pd;0S2  I00 > `!QQ 0n;mO-0tM0$0L0P 0<00S40@ P$08p40!0'~0`0S0000 0#200~ 0022 0$0X0S rtL Sq@T0x0ᤂ0X@0h0sL0ld0S A A! a,3 1T 0 0 #0X 0000xx0,, 0`00SD: PPD0 @S  @   0 R50d Q a30RQh 0D0808 p00CS0!@0$0\0HXL00$P0X PP3l\X0 A)A T L)a"31$PPJT L00CS0@08 S  8 T8 000X :D0PD 0T UQ.8(0< 0,0 0004 0C0$0\ 0@T0T0 00 00S U   00^}0 00  0U}tЍQ 0S0  0 0J02p40 @  O 0d00e0|0  0S 0d00e068L00S ldA A! a,3 1T 0 0 #0 0m P$  d~0 dl0 0m0 0n0  :0X400S*Tc?002 0 00 P T PL 0(00,00S ( ,     0 R ToP40t0000?(@,D000@0(@,0@0(@,0PDg^g^A-@pM0@P`00 R@@|00V T0ML0 0L08 0 ! VTe@`00R 50 W@TS@M00N0P #000Ѝ@-0`P pMX0S, \0R@#0*x gP @P&00h@l@!0 0\0!" 0080H00 0 0p 0, a@P  0 000 iЍ80 000 m7@-@Pm&P ʄY Ѝ080 000 V0C-0@P8`rr eL  h X0S ld0S A A! a,3 T1 2# $0L0!10P  000 00HpX0000(0""p 0 8080F  0M  00|0L0 8|0080xp000h \0000000 Ѝ 000  0SL ld0S A A! a,3 1T 2#$0mA-`0M0P@ N80 000p L040S cP3 @PH0 0I0 0J0 0L0 0M0 0L0\pp800s  pЍ1@- `P@ P 0   0L 0 0<031008 0P ЍpvdG-0p` M8P0X0S, \0R@#* 0]@P~x 0PP(0(wl0dT A@! 0C#p00$?@ p 0@ 0 00! e XpLP:!0.e2-8640q."@* X @P&0d00t@p0!# 0, $00{@P 0 Ѝ 000 |@P  ] 0`( "4`#/p@-@(0Sp0PSP 0 R@TpO- DMhR/@lp0.`p0P00`$,`A@P!$ @P#W$k`Fhp &h$ 0@o V㨂X@P @Pᐮ,厮$DЍ @P P0`ც< 0P0 8 \$ }$ #  R( p0(@ 0,00(000 $00 @P(`0@T \PI@ PP@H@0 @P M0@SI@H@ R Bឪ(0W0 ,000,0_?@X p, Lp , ̧,00X 08@@,0S 0"@H00|ЍT㜐L L Q! Q QAt&0800?@PH R $000C H@@ &408040 =%u<00<0%$3!00 8J0VP 0@80 3!8G@T$%t'<>0 SC&X02+@ 05:"0P0 @ 00 000 000,0000>0@pC 0 SQ, 0$R00S 0{ *@㌄ 0Sjz @$!X$$(08L0(0+00, 0?@P,p00ʿW 0!"Т3" R 0P03Px 30p 0d@P 0b" 0"@0 t U@ 0(D , P\Ϧ 0 ,  @ 00 00@,0  0@0 07_T@D$p 0 ~$0/0 0 !P"$0/0 0 !P (p$,0pW @ 2$ 30p 0d@P& 0$S !@ ~ΦH@s0 Ræ@ X0R 0! 0p! ~宦P1T 8@@808 0  &!1T+Z ~哦+0S !3 0S兦G0p ,~!! f~0\ Rl 0  8@@808_41uO-DM,0h08 <00Sy 00P08地3$00S 0SpDЍ00  01 $0, '%Q  0 0\:Q`@(0 0? Q  , DЍO<0 $ ,pP Q1' 80080000070 `P 00 ` E`8S0RP '000pQ QM Q&Ж000800400S 0 Q:p0S0 0 ppQ Q QVWc0 SR0S S 1H0C200 0040tpP  0 P0*% 00000$0 0;00t@Pp1`l 060pP $0 ;cS0!00p 0`$0 0:0 Q@P 060 %pP  8W M00 $0, `$0Y (R   Q\ eG0p$ I QX#Q X *Q Pڸ  Q\  > 00 $0, p H I 0 I R031005 000(0<0040(0X*0( 0R{*  0 $00CY\0X(00 00(0)!00 (0 00 0 0 0(0 % 0`0 %(SR0 (0 0 p0000G010S0|0S8Sz$0p 0 qP 0 ; %0600P 1 Up H   X  R   l40S )!0 0 A000  0 . 0p  \v`8q(0 000S} V 00ew8rpL=_O-` V4D`Y2!>3`04\@ 0$p 4/@P 8N7 O(00 0X<_i@\_X?r_lKp@- P0@@`N<04 @ 04/@P 6 _i_@- 0 0000 0>Ѝ @-0 000 00 0.Ѝ@-!>000!44 0ЍO-@Pp`LM$@Wph}6X ᧧P0 7 |8/P $X LЍ ``  4:/P Y6 $B $`?88000`8 `` 0( $;/#PZ@T<P|p0 3/Pt0 Sx0S $0x 00$0_/_ 0夨$Kp@-@P% Cp@ 0`( "4`#/G-@P`P000 C3(10S@0  dU. X(3@@0 0U>003000 8Aᜠ4/P#P  p000@PK R> 0R  CU700000008A ᜰ4/@嬠#0D?oU20S 0 #T T0S0S02T0 P0C0b @0 0C00g te }0 T0S$Y @ 1p6儀00008A ᜠ0 4/#P@H  @P #T 0 T0C007S @3K0 00 S00  P  5mx5 0R ,%(10(1Pwu5@T uP~$$10$1M 0S0Y @0 0000040S: 8, p44\:# 80   <0L\0C1 01008 T 0`000d0嘚*0<00L 0  !  0003 000 s 00bR0d`0Y 2  P:dd0 00 0`0 @<,0< @8R, 9981!p`00h0 !0+@ 0`( "4`#/O-p845,8p /? <*Xy([X0rd0HSa82 00?EY;00 0S  $0  0 48<8<@|@0(, 0>0P03.: R Q# Q3#8#(, PU0 :8:!0 0 0W( :10S<Ѝ8< m8    08 08  0`HD]8d]^<0@-@ P0 M0   0CD T ,P  0 rЍ00@-PM8  @:8~:忙0 00 ' ?Ѝ0@y:Ѝ0S| O-@$MTP`L Hp RQ4PP0UPPӈ U0@/S  0Q PT`0QSR$1 1@!pW?W0A~q1 U4.181q0P0PPS P dq1 1 W?Q00 00U0P00H0 00000`00X0.181qq$Ѝ\0P/Q_4_@_:_C-DMP` p f <  0$ 00 0@ "4i00 00 0 9&0|0 0 P0 S  f P fDЍL\ 0 \0? 0 0 90G0 0 0Zf 0@-8@ h0l P 0lP3<P<#/G-@0 qd `00000`P`0d P Z000Pp"SR \ R3#. A9  H9 8   088  H@ 0`( "4`#/O-$@ Yp%0q00Xp0a@S 0F  `pF` Jp0 S  0 `@p?pPU- 00xpH5po?0尡Z | Q ! |! BR!x&^p p0S 1S10C1Op0S Ip pp0S h@p 0XS  0 6p4pa%o$l*]X%_<@-@ o000p@-<@Po0@S pp 0R@C-@M4oT@#(a(Qq@ 0R@ o 0 v\@oT0 0oЍ00 0R圐 0R@T0 ¯0S   0 o00%o00C0@0,0000⭯q刐! !  *P![& e! ,++:10 0 4 NP !*! 0 0 4 =( 40  ++!hX?__G- MPp  @` ?E@T Ѝ Z @0(01ʟZ R00 00@@dTP0R00PP $ P0Q\(0 S @0 000O-@,MP0p T0P`X 0 T0 0C S 00   @P &Y? 0  P0SR0K|0C!0 SH080@ f  004005000@@?0 S0 ?0 ?@?y-Q P@ 0P 00T 0,Ѝ@0S   0R00   R  @P ~kA-$PU0@$091  j` pv1S#kA表6!4!I @-P 0`S4 R13U  r@Ѝp $`V@ 0@ d@ !00 0C?o2 104A04/@P U- 7T0S 0@0 0 0 0U>0( 0(T (@ T 0@0 0 @0 0 DR2320   (T7T0S  $'0  '9_S_O-PMp`HPH4P@0S#  \* P$IV  $  # $  L0Y@2P #101#0 00 #P  #   B d#  P@    WtX  L R @ R  P " #   0 3SH L0SP0\ 0 b P <  0C S00S      L PHFQ4KKKKKk  #RHL RP \ #0P0, BR    PBVL0Y@PЍ  #RHL RP \ 0P0, BR V   2 % ~~@-8@=P(0, 0(00 , @7@-@ Hi d \P\00P0 D00(0 ,00p0 Ѝ0 Ly_^g_s_@-4@HhP(p@0/p@-PH@h00p@i@-Q0   0P0"3 He 0ЍA0C-P4 $0# @ 0@P y{0  000000) 0㺨@P m2"1ᢤ@P 00' T9@  Ӯ1 4W?o20S 4 j@P 1011 Q 0@4Qq0 A0!0!0(0S+p@x0tT@1eeO∀@  @P1@010@00 @1*:\@LHD@X@T@P@d0`@h@<ЍS p@x0tT@1@eKN∀ @(0S &  000000t '0 R00tp@ሀ@M@X?o~_O-P`1 @۹pᐑ吱!@P4|qdVʀ 0! $X!0 P!H!   !,g0S2g 0! d0    !tT# 000 嘧ꌹ@Py8v/P  R (@- 0@X?oHzhzlz_G-0@@p` ,!4#Q !PPHP!S 0 0   PPP0X0P07 0RI06 0R J0X00H0PTЍO0@SK0@oP DPH PQPL0\61H04P<60 S9(P HPP 00 0 0 0C R  @PP 0 00C S 0 0  cPPopPPp P0 00CS!   0PPP<W  T WW 00P000  @ P|P  0 0 0C R  PP 040 0D05ꬃ0 SP PQn U"1"PAw00 R0$P@ 0G 0#0000040(00c?@ 0R 00PP 000CS0 0   PP 0Q=P t" 1 0 00CS0 0   PP P P nQP0@0P0000 000CS0 0   gPP s0Q P X 000C S    HPPU `GPQtPU 1wP P@ R 0P poW` 0$ S0(0S001RX00P0 0P0]____0@- {"_C-PsP0T 0 P0T d@T|dxd0S 3/PPXdU L3< ЍC> 0PS  04 P 00 0P@0Y00 - 8`hX21X0œ22<0PYXh 0  l (0R`"4U 0 0 0(0$ S4" 10 1, 2!R <0L`R0Ca0`a``( R 0dSd0(0$`V  0000S8 R40C BS0( R)0  0&R 0 P 00@1004 0  08/P Pp00#P00S 0004i0 0 0 0(0 0dSd0(0d00 SC2 |2! 0<0:t0p0x00008|0l 0 0X 00SPk4p 0 (00,0'S0 c0?o0c 0$(0SP :000 04PK0 TPJ!`0  0Sp Z Y XWVU0 ow|J P0S000000 \0 Pp0p q A  P { p|rT  o v z(<____X?<_G-PR M 0GSd2p`0 V Q 40p @P!00(0 0,00000  t p $ x ( 8 , < 0  4 | <08 l D0H0@ 0@ Ѝ0SK@0 J@ VS  7<$(, 0 00@SD@I  @P6ZIY `0 @P)Z `ZIY 0D@PZ `000ՠ@P 000 s@ III@@A-1Ms1RP@ĥ<P0< !0 0嬧BP@P BЍ0( ,#(0$!    z@P(  0p0X0 0(0"@P (M( ) (l!E`p0@`7`!(@T 4kKr_y_<__ _2_ 0`( "4`#/@-0 $0S\ 0 B @B24 b1> 0S& p@-`0 CSR!0@P P  0 P  0 0# Pp 0&p pG-p0M0`0@8 ;8"PPd h"\D00D0D  0oU@ (W 8$ #R Q!0P0000|000A A1(LHL RP \  BQ,L (/PP00$ 0 0 0 0013PP Q 00 0,,PP. &}0Ѝ #RH L0SP0\ 0 x(0000(0 <  0CS00S( 0 00 0 0,00S00  R,0 O-00\(lMP0@0|0\✀0|0 D 0 p,0 U`<Z 8 F #R6 QC0,@000,0000A A1(Lf< 8 Pu Q0,@000,00A A00010(LDuHL RP \  BQ,L ,<`@P w|Pb0 3SH L0SP0\ 0 Nx<0000<,0 <  0CS00S< ,0 00L 0 ,0< 0M 3SHL0SP0\0D!x<0000<,0BHLPP\@  @Q}@ L ,<@PY3P|?@ X808 00U0@00S0T0S@lЍ<  0CS00S< ,0 00 0,0 0P<0 U #RE [R ,@  0,00 0K1 1C!  {@004000080 0 P@P <AU 080 X0000CS000% (  APP(  4{@PHL RP \  B[, 0 ,<e@P P 0 0 XPPX0 080 P000CS (  `P(  4[{@000"8 0\0$300CS000 (   `P(J`X\` E`BHL`='S R00$00PS;#S R7800C?o2080 Dp000CS000 (  `P( PP" 0 0DV`PDp[`$0S0S P00`X0 `?o2X HwP 4zP0%'O-0dM`00,00 0p0SPdЍ|WH$%圀t00t0 $0   W@ 8G 82 #R" Q/0$P000$0000A A1(L;0SQ?Pz 8080)HL RP \  BQ,L $8IPP `z 808 #RH L0SP0\ 0 6v800008$0 <  0CS00S8 $0 00 0 $08 C PHLPP\ : $8PP,00(004 00 0P33PP QųW 4( p000CS0(0*  P ! 0y P808i  @Q0$P000$0000A A1 D"4 0\(@100CS0(0   VP @P T@X@D@'SR0000HS#SR8@@DOoB4( <`000CS0(0  P pP 0 0<P}<`X㜐 0S&T P00X0?o 2P @P 0Sy W808 0R7,00S0U0SPP0%'0 /7@-QP@0 P0 4 8 RP 0H0000 壳 Ѝ0O- 0 `M00000090 00 00CS@0S@ R0.S@ [@P0 0C?oR20SP@0<0000P0 @ =@P P 00 @FP 004 Q\80 R] X 00 0Ჴ <08 : < L  L H $ 0 $0[p8 < 8v #Rf Qs0$@000$00A A1<0(L"Xix?@0 00C?oR20T00S 00@@X@0  Y@T L003L8@H @@P0 x|0RP(000Ѝ 0' HL RP \  BQ,L $8@P xu0 3SH L0SP0\ 0 s800008$0 <  0CS00S8 $0 00 0$0<0 Lf80 Z #RJ YW $@  0$0 I1 1C! o0(0400 00 073<C@PU AR 4( 0@P00CS0(0, ,  6pP, # 0w@T!0S3  K.HL RP \  BY,0 $8S@P e}P 0 0@pP@P0\wT0S  4 [0(  00CS0(0 ,  @P,  04K0@?Sp01wH@ p4 (@0 0 0C R (  , @P,@0<0C?oQ20S( W  L P0w@00 <0@P 0v<0[Tp@pg 4( 000CS0(0 ,  @P,  0vT0S  We U`P 0 0@ @P@p4@P( 000CS0(0 ,  M@P, P 0 0@@P@Pp0vp唀X @@P {b0@ @@P@p W  L}P0tvH@L0:e _00 <0$@pTg<0[Tp@pY 4( 000CS0(0 ,  @P, jXP 0 0@@P@p]4@P( 000CS0(0 ,  @P, G5P 0 0@z@P@P:0 ?o2R0St  o0 <0@P0@ @\@P@p U @-0S00, Ѝs@-P0S`@P  0Ѝp@-@<0 QK 00CS 0_@HK\|@-@08 <6՝0@ 001/^@@-@08<70@ 001/4^@@-@08 <6ᯝ0@ 001/^4@-@08<7᜝0@ 001/4^4p@-@PJ0 R!p@J@-`p PM_@P @ 0@P 70  P030000 A@P0 2ЍO-@P 0Qf`冋ᨋ`Vc p`0 0S00 0UPNP & @00S(!``0000S 0  0 Ѝ0S- 0 00R0S @ 0S 0  0  00p R W:0L 000@000p0 0 000\6_@-@8 0 ,@\PQ_G- P0 Bp`8M0< RXxL{L{LXxL{L0xLXxLXxL{LLxL4{L, 0 @8Ѝ 0S@ T#000D (0W8 `@@$@Q #RA TN0(000(0f000DA AD1(L 2, 3   !  @P A , 4000CS0,0$ 0  `P0  t@HL RP \  BT,L ($@P tP 0 04Y`PT  , 000CS0,0 0  `P0 00CSzLXzLXzLzLXzLXzL{L({L 0  0 0C?o20 0S 1 0 c># C,0!0 0 0-803!@@P& 0 8ЍG0 X⟷7@-P@0LP! "0S, ,00 13/ Ѝ0b_ ^4T^@-@0S @(C-`M @P- 00 0SS S pj0 S2 I00>00 P 0  T 0@qЍO-p0PDM,sr`lE0V0 $P00P0H $08 `8\ #RL QY0$@000$0000A A1(L80 L #RHL RP \ Cn800008$0>`0 P@ QX@ @T@0T Q@DЍR 0HL RP \  BQ,L $8@P rI,000BS8 $0000 $00R# @06 R S 0(0400 0 0 0423@P A4( <000CS0(0 ,  `P,  0]r@ T0RSfP 0 0<`P<T04( 000CS0(0 ,  `P, A000 (r @%r00S% ,sr! 0S 0T00K 0 @GDЍO000 0SS @8S @{ 0@0*p@-`P@M8  ;8P00   08 H@  Z 0 013/Ѝp^@@-p`@M8 & P   LP00  0H X@   0 013/Ѝ^4p@-@ `(MP0k 0 0$00 000 P@P A iq(ЍpO-dM000t/H0p0H0 <D ` $0=X@ 4R 8A #R1 Q>0$P000$0J000A A1(L40^ p Qp #RHL RP \ gm400004$0eHL RP \  BQ,L $4PP p( #RH L0SP0\ 0 l400004$0 <  0CS00S4 $0 00L 0 $04 0 3SHL0SP0\0l400004$0,000BS00S4 $0000$0<0040  pu Q? #RHL RP \ 6pl400004$04Q #RHL RP \ Yl400004$0 ,000BS00S4$ 0000$000,000BS00S4 $0000$0;00 Q40 pw Q? #RHL RP \ 6l400004$04Q #RHL RP \ k400004$0 ,000BS00S4$ 0000$000,000BS00S4 $0000$0900(,40p|  Q? #RHL RP \ 6k400004$04Q #RHL RP \ k400004$0 ,000BS00S4$ 0000$000,000B S00S4 $0 00 0$0800,(80<0zs ܖ0ZS40 ~ ? #RHL RP \ 6Gk400004$04Q #RHL RP \ 0k400004$0 ,000BS00S4$ 0000$000,000B S00S4 $0 00 0$0408)@&H0L0zs t0ZS40 k #RHL RP \ bj400004$0` #RHL RP \ j400004$0 ,000BS00S4$ 0000$0404 0 3SHL0SP0\0 j400004$0 <  0CS00S4$ 0000$00,000B S00S4 $0 00 0$040HP4 0k 3SHL0SP0\0bVj400004$0` #RHL RP \ ?j400004$0 ,000BS00S4$ 0000$0404 0 3SHL0SP0\0 j400004$0 <  0CS00S4$ 0000$00<  0CS00S4$ 0000$0000(00,00 0 PP QX 0( 圀000CS0(0] 8  w@P8 T ,mPdЍ<  0CS00S4 $0 00 0$0p0 0R01 p0 p0 ( 8@p X0B`HP0s0 $ ?@c^Mb 0 0\(p000CS0(0 8   @P8ppPTp kXh@@Dpc'SR0SH#SR8ppGor0( <`000CS0(0 8  @P8 W:P 0 0 0<~@PJ<0X` [W P00`X00P @P , P0%'0 0 0PP`Y@P $G-@|0s-P pr`0s 8<0sqHL0sq0s 00~(,圠p|^ 0>0 ^0P3l:0S#S$Pe PPe "؀(0, 00h1 3 |PP!  0z E0CSHL0sq 8<0sq0 r0sP0 0"P""0 3"srP P P0$sr#sr0s 80 Q3/PPЍPO-00#`pT0DM|0T0D  $0/WP 8d 8$ #R Q!0$@000$0<000A A1(LHL RP \  BQ,L $8@P000002(4  3@PIWK4( 000CS0(0 ,  @P, ` P 0kH@F #RH L0SP0\ 0 g800008$0 <  0CS00S8 $0 00 0 $0WA, 4( <000CS0(0 ,  9PP,  0k@DЍP 0 0<PPT 0|kT4( 000CS0(0 ,   @P, u P 0\k?@R@ 0@P O-0 0p0/PP3LMq:0`GZP0,0$00P00[^T%X00X0p0$ [ 0 0,0Z@@T 8 < #R, Q90,P000,0000A A1(L@0 ] #RHL RP \ Tf@0000@,0OHL RP \  BQ,L ,@PP j PLЍ0 3SH L0SP0\ 0 f@0000@,0 <  0CS00S@ ,0 00 0 ,0,000B S@ , 0 00 0,0ZP4 0!000 0<008000 023 PP QZDf <0 000CS000 4 0 <@P 8VjPf P4 _P 00 0<0D@PDU8l<0 000CS000 4 0 <@P4 9<0 000CS000 4 0 <@P4 !p0@P8jHP600 0< 0D_@PDP 00<p0P 80i0P8i0Z00 ?o 2R0S0K 0SO-M800@  P    `0 @0/\P3:< ,0>m00,0PSX040H00L000(P40$`$0SPkL+H \00\00t`$0S`1800`S   T0 q,0pSde 0 8> #R. Q;0TP000T0 0A Ay0001 0(Ld0  #RHL RP \ }5ed0000dT0xHL RP \  BQ, TdL PP +i0 480SOq>@0( U Ѝ0 3SH L0SP0\ 0 dd0000dT0 <  0CS00Sd T0 00 0T0 0 Ld 0 3SHL0SP0\0dd0000dT0,000BS{d T000 0T0@0PP 80S Pd HL PP   T\`$ A# d XP`0 0C0000 00C00 0 0=000>  d B00X0 0`00\00 0 006 3PP <Q,0S `X p000CS0X0> h X `P5 \Mh P<  0CS00Sdd T0000T0LH | T0d,PP (h08 4q=@0( $00h X%`X 0PE0 0CS0X0 h X `Ph <ptx |x\R00 D0<0R0 4\R8Hoᨂh lP RpIoᩒ0<0D<`X l000CS0X0 h X `VP`h P 0X 0`0lPR<0lSp D0S+X P00pX0 ?o2 p(P U`V` X0 00CS0X0 h X `pP \pgPBP0%'h{P\cgP5V0`F 00000C0 0000 0S/0 ^(0pS SPpp<0 a圐@ 0`a`<(p[ P0hH0\%gU$00 V0C$040040~ 0 L`0(00 ?oV20Sr $0 F000$0C0000000 0S 0 S   P   0ia` 0X 0`,0†=`P \fPꀠ,`%<00C00Sʐ]<__ sLO-dM000%圐080p0p0p0H $ p P $0X` 4F 81 #R! Q.0$@000$0000A A1(L7ZQ?@}f 8080)HL RP \  BQ,L $4F@P ]f 808 #RH L0SP0\ 0 3b400004$0 <  0CS00S4 $0 00 0 $040p V #RF WS $   0$00000Gq qG 1800,000(00  0 @P AijX 0( 圀000CS0(0'  `P  ,e @808eHL RP \  BW, 0 $4@P h("0 0\( p000CS0(0   R`P pP TpX`d'SR0000HS#SR8ppGor0( :-@lЍHL RP \  BQ,L 0@j@P Z #RH L0SP0\ 0 [V@0000@00 <  0CS00S@ 00 00 0 00@ + PHLPP\ " 0@&@P@0Z  Q- #RHL RP \ $V@0000@00"  @Q00@00000(0A A1 ,000BS00S@ 0K0000 00;0s@0 F  #RHL RP \ U@0000@00 ,000BS00S@ 0000000;00@ 0? 3SHL0SP0\06U@0000@004 #RHL RP \ U@0000@00 ,000BS00S@0 00000000<  0CS00S@0 00000000@ 0 3SHL0SP0\0 BU@0000@00 <  0CS00S@0 00000000@ 0 3SHL0SP0\0 U@0000@00 <  0CS00S@0 000000008<@ty uTY@0 Q  #RHL RP \ T@0000@00 ,000B S00S@ 00 00 000408@HL@ty :TY@0 k #RHL RP \ bT@0000@00` #RHL RP \ T@0000@00 ,000BS00S@0 00000040@ 0 3SHL0SP0\0 bT@0000@00 <  0CS00S@0 0000000,000B S00S@ 00 00 00040H\PY00CS@ 0k 3SHL0SP0\0bT@0000@00` #RHL RP \ T@0000@00 ,000BS00S@0 00000040@ 0 3SHL0SP0\0 S@0000@00 <  0CS00S@0 0000000<  0CS00S@ 00000002 0#0<00480 00 02 3<@PW T 808Q #RHL RP \ vS@0000@00 ,000BS00S@ 00 00 0001R011 0008w@p p1B`nHkP0s0 800C?o200 08, D000CS0,0 0  ,pP0 PP) 0 0DܮpPz 0DSp$0S0S P00pX00 00$00p 0?o2X HP 4UKP0%'@T V 900@`3O- 0tMp00,0<00/0圠 `0 l< 00d00d00H $  00  VPHG 8 9 #R Q)H 0@000000000A A1(L尭0SP`J?@P`HL RP \  BRL 0Hž@P J`, BQ0 3SH L0SP0\ 0 FH0000H00 <  0CS00SH 00 00 0 00H0 D #R4 XA 0  000000H H10 ?H0V ~ Lp^ Q, #RHL RP \ #\FH0000H00!HL RP \  BX, 00 H:@P s,000BS00SH 0000000;00PH 0? 3SHL0SP0\06FH0000H004Q #RHL RP \ EH0000H00 ,000BS00SH0 00000000<  0CS00SH0 00000000H 0 3SHL0SP0\0 EH0000H00 <  0CS00SH0 00000000H 0 3SHL0SP0\0 EH0000H00 <  0CS00SH0 000000008<@tx pTXH0 Q  #RHL RP \ \EH0000H00 ,000B S00SH 00 00 000408i@fHL@tx pTXH0 h #RHL RP \ _!EH0000H00] #RHL RP \  EH0000H00 ,000BS00SH0 00000040H0  #RHL RP \ DH0000H00,000BSH0 0000000,000B S00SH 00 00 00040HP<00@0004D 0 05 3J@P AD V04  00CS040 8  <@P8  @HP` V8080<00S0T0S0U j,0043 00 0@P ,0TP0S@WW@tЍ #RHL RP \ 8DH0000H00 ,000BS00SH0 00000040oH 0 3SHL0SP0\0  DH0000H00 <  0CS00SH0 0000000Q #RHL RP \ CH0000H00 ,000BS00SH 00 008" 0000 2000 08@p 1B`HP0s0 !?@cD4 P000CY S040 8  G@P8  @G 0@?SP@GH@ P D 40 0 0C R 4  8  @P800 P01@PP0VTPT D4 000CS040 8  @P8  @VG P^Mb^[.P D4 000CSST 4 T  ᤺@P@V D4 `000CS040 8  ùP8  @G @Z 0 0``Pp@P`P P !D 0\4 $100CS040 8  D 㒹P8`d hTPX'S R00$00S#S R8HoD4 Lp000CS040 8 4 D[P8 `P 04 0DL PLpZ㜐 $0SX P00X0?o 2` P0P @FP0%'T  L 00@PpU U hzO-p M0`s0 00SZ$0@hAv3 1 H`P 0 081   E"   E$EVP  0P 0P3 00 P" [ 3 000 0:VPP PU 003 00 q 0H@Ѝ000zS0P 2$վ__ ]G-P `Mp嘻PL0S@ ᎻP 0003 存P@( 0U&2׽ЍH0S0 RP@UP @ <P0SH0S300 0 CS 8:8ꏽ_G-P@0 pS kT! S Tf፽`uW%Pڜ0H0S0S 0 P]@41 3 00000 00 0 ,` VV!0S 00   RT 0S  0HT@(0 ;T3T /-Ѝ`O-0pdMfA@dЍ%`000D $08 P@@8@< #R, T90$000$0000DA AD1(L唧80 , #RHL RP \ #@800008$0HL RP \  BT,L $8☸@P D,000B S8 $ 0( 00 0$0 04000 00 00!@P wA4( 地000CS0(0 ,  PP,  0lD@\"4 0\( `100CS0(0 ,   PP,_`P T`ZXWP@D`R'SR0000HS#SR8``Foob4( P0%'4 (P0 00CS0(0 ,  }@P,P(ap  Ѭ@P (@ iyaU1u0@-MP@A0 00 98808Ѝ0@- Q@80 h0 3    808 0&8808Ѝ Q@-0S 00 3 ЍO-M<0@8pDu040\5SW4ZT 0x0Cx 0 /[ Ht0[E* 0%u\5pSᕱ 0-i0吣/ᐂ(啱 Ԭx_`0 C c"0,0T ? 0 L)L2>40)l":  00C 040S4L3,0A`0 : S 0003#0 #L#32024P t0t0<Ѝ莼 00 00t0P !t4P tTU T.]K_v_@-003!z?` 0 Ѝ_0@-qPM:Ѝ0@@80@ 3P@z?00`0 Ѝ0_C-M8`0@XP:@DŔ  8TAVp pϬQ @$ @P@ `8Ĕ< Rd`Ѝ___O-p400P@ S` 08`M ?  0塡 0QP_ p(80 00w`(`p Vw &0 &00C030S3 L32  B \%<1R.=S+T @~0P SXprpppZ ڨ ~0  0 ~̆00C00 ST0T00! B!00 0`f 5`` V"%P80 0SЍU TO-,M 0%!@ 0PP``g\%1R=S|g \1R\0 嵟 p1>0S100! 0 $=$S 01000W 00p50 00Tp24$04L3 $2   :  S 00C03#0S #L#320C2T3S! !,ЍOKTU (_>]R_O-PgX 0P@,ЍO y Z TR pP `@0S7 e 0S00 T0T3?R\0 0SP `0 S ,ЍO    @ @ 0 00{  0 0r  o Y @* 000e  ,ЍO,Ѝr]O-TM|00@ 00sc000P40`0x Cs cq6rc4D $`<0p@$!c 0 `pVp0 00000>P T$ (we 00 00 0 000"qT0,0 0SD  ?fp, 00`2@0(0C$0L3T 2 0$PS98$0<4Q4 0000400Sb S<0SD@$! 0 7$ 4P |70S l 00`^H00000 00mP TЍ08SL 0 <0 ?D0 0  0/0S 0/< S T0(0 \%6R0ǂ0## 0 /T0 CL    )pC)0c <3.amPL0<00 S 3 SG^\%6R=S>^ ?Ǘ800p ST 0`S"80 ϣYc8<0D80N,00 ,Qg A!40Y0C40 A40040( 0T S"80YbT3S   , (# Lj$000Sv h00h0 0 0000S TH A)A)@a #;̠S Rd X8_ 00 ǂ !! ^?001>00^33 0^ ?001>,00  ,0 $00C$04 0S4 L3@0 @ yLP h(e  00$0 jH000$ [H0N H0 , H0 00S  <0D@$0C!d 0 ז$ 40`R0 10S  00p1` 000 0p40UP0`W0080S 00S" 0 0 0U $0 0Rh  h    $  0 0000S! T0H C)C) c1<62 8<05jH00( C0ٗH0 H0 ,  H0 00S@~@4X"], 0S HIh__~]c_P=_TU T__|SM_O-p`0P4M 0 ?:0@00 !0\%0$01R 00@ ``&!! X0 00*P@? j4*!, ZS QS:kP ,l 00\ Ó\ g4Ѝ $0 R  X   !A,ehT]U O-P0@Ḡ $Mҕ0\ `#,^ 00 0T ? A)A<)a>21,, X:@ 0@P'kP l 00Q Q g $ЍH  0 0 PihT]L_U O-PḰ@ 0$Mp0\Ŕ00`0!\   ?  ?` a2! Q,S QS1, X:@ 0@PN jP l 00Q Q -g $ЍH  0 0 PgT]L_U C-`PḀ@p 0M 0\Žß0.S\! 00 Q    ` a 00T40 1<0&$40 `001`0 0p0$0d0 01010000 $P 0 PP0s40\pdT80< L31)l< QR>QR!<`0d 0001 F f40P 1`dP<040 pL `l\0<726, @ P0Hd,:0000@ (0 00iP0~d0(ZT0(d C)CR)0c\1S"8 QR!<`0d 000100T<0 &"40 `0010 0Ep0$0101 0 "p `@ H0P ЍP0805@U50P%P0L05P000T40 `001 0 0p00101 0 0PPd001Pp 0 0T0 C)C)ct00<21 ( 0P0 c0S C\1^1 U  U `  Rd ` < #.36,P Z*85@%00L 0404 00R  Q RI 00Ts)\5 S0  11@0p@00 p001P0 0p0$01 0101000040 0@0 0-PhP <0 B2 b061")(!ᾘ''0001S 12 e X0P 0 PL< l52>p, ᇱa Q0:1S 000000 0(+hP%1sP 1db8U@e8 L0PP`P`U1Se 00P000T\5& S0 @qq p0@01 0 0#p0$01 01 01 0` 0Pp@P''000jQ0805@U50P%P0L05P000T0 p001 0 0p00101 0 0PP'Q P T A)A0<)a21 ( 0l0000 0(@+Pl00Cl00 01 0g00Tb1 P  0 p001 P@000 0 0 HzPPx0gd000 000g0T0 C)C) c1062 *(?PPddPP0 0ap0T000400`0  0 F Ϭ 0f2fbd000 00 00  0Pd0- bpG<0S00W0S <0S&0 T 000`p<0嘐l0Xd  0 ` 2( bPdaa< 0(bd0000000%FbeP H0p`d10 `b040" 000 |00S)1S0!0Y8P0 c0S C\1^1 U  U `  Rg ` 4 #.36,P ]*85@%00L p00W00W0SO 00T\5$%S0c 1<00@00 (001 0P 0p0$01 01010000<0 0@0p0 0PP 40 P B2 b061b 0`` 00( 10p !0001S P 1! a X0P 0 PB2 b50>" pPH Q0 :1S1s 1<00B_8U@e8 L0PP`P`U00Tm\5' S0 @qq(0@01 0 07p0$01 01 01 0` 0Pp@,Pg0p Q0@558 50P%P0L05P000T70 (001 0 0 p00101 0 0PPP?'Q P T A)A0<)a21 ( 0l0000 0('Pl00Cl00 01Sb00T1 P  0 p001 P<000 0 0 @ PPx0d000 000p`0T0x` C)C)ct02160" *(PPdaPP0 0a0T00|0400`8PL0d000000(0!cPPrd00H0H 0ql0L R 0P00 +`x0PT40<@P d`R00T1P Pl0R 0 H0P 00 0 0K<@<0@ 00 (0 0><@p001 P 000 0<00@00 0PPp4ph0400 0000T0 C)C)ct0201<" ("BPP4 d_4p80slpx`40V>:[ h04Ch0h4y`PP480L s0H 8001d i`4pP0`Z(`1P0Os`Pw00TH0 010l02H0 0 0p001 01 0000 0PP W4 ppt0p!R  !  0  T B)B1) b072  0(PP 40040l0 2H0H qd1_iI_1S) !00h  0 0(bPP m 0T0() C C")0c7#10 0 d 000"00  ( PHd0s ἐ?00T0 `C0)0c VQQ? Q/" \5 DS 0?!>0  0 F Ϭ 0f2f_d000 00 00  0EPd0, _pG80S00W0S 80S%T08 000`p80嘐l0Xd  0 ` 2( Pd^^8 0(bd0000000%FbPd0H 00dH_|040 000?600O-@P@p(,`PT: [0 S0S qPZ@V 0000000@@000@ @O-pTM`@ W0S^ TЍ@T@Y@T  r"! ( 0  (04 0D \ 0S,0@0H*0 0:00@0圠<0 08000  RȰ%d*}P# P `2@S8NSLQ0 P@UP!PŸI͠ӈ$ P 1/PD$0   0 U$ 0 =$080\< 0/P\00 T0 P@ \0 A!. a4,AS ?0$0 00AQP0 $a^?o2Y0S000@Q9  @ PQ;Ã9ʁ0ˁY @0 R 0@@DT@@@@88%@5L0orAO-p|M00-P `v븰[ 000zP|Ѝ0800 00\@000S/ : hP0X00 \00&2T00PT@p00h@l00<0 h0@S < `\P/0 d U 4 Q4 @P0080\0000P n9Π ^RQR.L N @n 18E \H$@@NU0@@$0@$ ((0, IY! ? Z40 0 Zů 00:@   ^`PU@5 \K$@@@ @L @ Q  N. n*< 0Π U , D   L @   D  H   @HN`$ LP@% 0@D TT{ 0(0 X PP@\[\n@P)Pr@-0 ^ R*@p5 R@ါi_000S -/0   R Q   -//@-P`00S-@! < @P@P 0@0 0 P]@ 0S R 哅@ ЍpO-P$M`00S 00CS 00S  R 000@mY0   P A> a2<! R0:0 寬@P 0ST 0S@Pu@PL 姇0pI@p p G pp 刋뼰0@0 0  @p 00 @W  A Kq@K0P L" l1. Q*  P0 S 0 S00@$Ѝ 0p@ 0 P pL ? F    @P   z  Ŋ弰帀  @-@@A-P@00S= 00CS9< PP0Sk@p?oV20#S 00W: 0R R 0000@0` R }@@-A-P`00SE 00SC 00A0 崫@P 0S 0S@Ѝx@Pp 圊뼀 0@0 0 Tp ]@ @ A HHp ЍAm-@@@O-lM@0P800(00 0080<0000Q.80S(005 0 8(嗈@Pd0`0p00 00 p 0 P6d0 45#T20T20$ ;60 0Rqt ?0:# 80@0(0P0)#00傲dX`Pd!`P dBZlЍd0000S0 0(0 0?`L0<0S``V$` 0 d00 $0@00t R[dZ0$ `0S$0 00 04T0?X0t0pC  0@DpH@ 0S00040t 01,0@0D SP0H 06L0 R00S 00Sp 0 1p0 0 800(0C0 0܇ T0 C)Crq)0c9s400 p@i  R !00 R,  ) 080S06 S600S @" 00 00T00S01 0, A0T 0 0X 0 00 pG00040 040D00SD0H00H0,00C,0{Sڤ0 00\0C00 T0 C)C) c0<;2 0 40@P\ 0T0V0S$0 S<0S d ZS @0$&Oo(0BO<0S@dYV _A-`P!0[ @pr0 Wp0 P  $0 Q D 0! 0V`0 P ( ,0 Q @ @0D 0 @0D 0  UP0 P 0 40 Q$ H 0< 000000:00Ѝ    O-`0Mpp@P$ w  R  p0@ 00@pp\%1R,5S0 0 0 喆0 o."\哞p1`Z 0 ?  Ϡ ,2 0 `x 0w`0 C c00T0 ` C)Cba0)0c03"[0P   \Ŕ P\x 0@L  W Y0Ѝ0  ~8,X0 TTO-`0@[M80  ,00  C0CSR [ߍZ 1 0P  ;10Rh  $  $  ( \%R\ R @uD%p/L/pt{W  Ð!&4$00S$0(0?(01  0 So 0?R0:$0( 0QSc00S(p7 0)QQ 0000  L  R 0 \0[&/ 0[ &/0 00 0Pt  PP8ŕ0 @L ,Q-Y!0ZS 0L 0)R 0X:0 0 0001 000$0 0S0 0hP0  c2# S,P!Q RQG S1ZQZ3PR> 08u< p0 H0pß 0YW0  0:$0 010 0 W00 0 P 10 0X b!#H0 p ~p. ? 0 0 S$0 0100k P w08%Sw 0圠000S0  0 岊000/SP0 0 c SRQR3,00Y$0,0, 000 0Yt H0L 0SP0 0SX04800T\` p BW, W pq0S*0xp(p$ Q0 ^!((AP (( 0 ( C 0[00 0 0pQy1(( R@ 0pPn1XXϠ R 0 00p0 0R       0 00,0Iz0P0[0 S0&t ( 00Sh00Sl0Sp0t\%0R  H ! H04  1/ 040@  p 0T0< C)C)c208<" `0 (0P(040<S" 00 0000S0( @08D 0/@0D pW* p040$04 S000$00 rs \%L5R$00 0!! 0 $0 S000 P,0 A pa1^8970':00圠000S0 00$0 S000 P0, C pc3^09:00SXl"66 00Q00Sy 0\P 0 b32 R0Z1Q SZ ☐ pBᜰ b<  YS:0 B z'z b~3p2z0W p11 0 PS0  0H0 p55C20000 0G0 0=0 p ~p0Y$0 0(_X%0'00 $0哭P 0 S$0 0100qP 8@ŕ L 0  !pt(APn i1ptpt1p 0140S(0#Sz0[ # 00p\%X0R !0 !09 4P L8 l0 ^85@50%00L508Q Q0(010 0S 0 01@0D 0/@0D 40pW08@5L085@00L0T__A^T΄8P* P' @0D 0 @0D 0 圠0 0@R    0D Rh  Bh    R  @000S1 ?@0D 0p@0DpO 0 R !/P !!0/00S1/P11/@-PM`0pP B2> b<1^Î0"@P 000 ~9SsT@ЍQG-p0 `$PR@000 0$0` B2 b>6<bT H B)B<>) b62l@`8`D0<000 "000[QPUC-0P0`pd@T 0 Vp P  ЍT80< @31)` Q0R 0008<Ĕ?|P0 C c00 0 ŜP  d 0# 0 h 0S400 0`,``000˦0008 1 010I> 0008<ĔB?|P0 C c0 , 0傜P `­V0L"ᡯ0 0$ 40h00000RM_q____ MG-p0`@ PU 000W Gh R 00 0h Rh9S000l MO-P0@`H00/85L0<%0/@5D%014%0Q0Q 455405S944S@04TO- ,MRPw p$`W0@: ,0W0:F,Ѝ\0Q.0u 08T @)@)`"30VKPd 00\ Ó\ GxG0哸+0[0: 0 GTU p0Sp/0@-@0M 0@0@ @@@g|P|0 0@0@ @@@YL0 00@@ @@@ L Ѝ0@7T=7_D>_G_8 p00CSp0/@- @D ʡȡ@šT=D-M }PuoЍP_@-0 R  @ @0b ` 0wЍЀO-0,M G P00M0 jp'W PP(@?n /h+p+ 0 $+4JP   0v % ! % F4\%R0004\5 P  ь ,Ѝtl4RR  Ìh0 S 0R$%$5R, ,0R`FL3 L3P3 P3H3H3=0T3T3v  ᠌000S0P0,(5 0S0 @0@00T`0#S> ) %> 1S 0DD@30V:03P4T$0X4S E>0X4#(40`AYL V$5S0P=$ct $.c`P ɋPzP/ n800pH0S40LpHT0 C)C)0c"03IPO  0u  1F80`$%!0, R0 i0PPl \tἠ_<#| YP  0 ?<#Ή p 0Px 0s`0 C c00T0P C)CRQ 0)0c03"kIPP P$b"   EЊe]h_8 TTY_s_i^_0O- ) %> 1S0T$0P40X4S E>0X4PPh04 SE4P0P0040000,8T0<P C)C4)0c"03PqHPP440$ R:0D0400 5 0 0C?o200004PAMX$%,0RQ0 0埊L0Zg$5S0Pŏ, Ht4dS944S@040T3$0`15c1,10 1(5 0S0@0@00P :>0 $  * RPPz$0p0,0 0t0D0t 0b0?o0cH0T0 0CL0804P8PP0基0SH 0 <Ѝ0(($20V0703PJ80 00S0 C40HL T0 C)C4)0c"03GPP*40 0 s4(D80 4Pj$%0 , Rk\4S  5  0 !000V0 0P LT0PP14P CV PPP:0hΉP ȉ(CÉ00P]8 TT 8TV_Y_s_i^_@-0S0nP@ a@P ҈ Ѝ 070@P __070c`0u/Pp s0Y VW@C^B_lK _V_2A-P00`SP pw`@P o`@PH呍0  `j@ЍDC-@p3$M/P++  h0$+4`P6T0h 0s0 51 50@0\%R=S04, 030304040 50r0" " 200(0\5WC`$Ѝ4AT8 O-,M@40AVp PL30U/o[" R ,Ѝ800`H0S40L`GT0 C)C$ `)0c"03=P$ 0r0$000S~C8 P@G-$MR Rp`P/oAQ" R@   hP V ‡0*L)4 ^@P0 R@k0oP V 0S 0 0R\P嗇0M倌0 @P0&00 0@WT:040 0 00 0j@P,V,`T``[ @8T0᳀ f0@ᲀTp`| < q,K*p`=S0 @P=04=S:0 0SX0SO@(0 ^@PP 0 0S 50ó 5v=S  0  @P Ѝ0 5< 0P!P000V<1 [@000C?o20000\4S Tu/V< 5 0 5=S# UⵠT@=S 0 6C>00'x0SUT⛠010@U@S^Y__i^__A-@`L1pPP 00' pPB=TSAP 0 <=0S hP= S傖*$%0,RL1hP wI000:0O-@P`=MS =S  ]U㐱P ]pP$]U 0H0T R8d R5Tp<=SB 00L5CnrPЍU  P ԅيP 0   Z0PᩅIU\pp @P啘4]7_Mp@-@  # Tp  Q000P05/M-@Mp#Ф!0P  ` 000X S%*9  0000'0᝕P 9 ;909  000&00P劕P 9 ;90[ 0 }00p!1/ 0  J0S 0  Ѝ0Z } W0 0 00ЍM/O-0dMP00 0 $0) 0\&(0 0 00 )( S RT 0S0,0, (0 0 0 ^0y:,0S,A 00(p地0$0 P =<00004000@0D0000^P࠱8<œH lU?P(8, PP PH L^EpP n7~ ^y[xQ[ W9 n0 ^U QU^YW0  Pp WU(  0s40 00000 U 0 0 P40S  #0 H0 .P^pP ? $0:T0$09X00S T0S X 峤 00080P<œ0 pPEUP!U$<0S  #0( H08<Ŝ  ß   . ?඗t8PLY"Hࠣ࠳Yࠣ^  pR0@P} 0sxi Z pR0 0s40  0000 hP9H0 C2 0000$0 0n'"R0 0rZD0Sj0)C( 0C8RP_  <100 #8 )(80(0APM ,000$ 00 )dЍ *Q@pR0Pᚩ00 0 4  @  1/ᗩZ 0\r\!p@- @Pb Pp0p@0@-@PpR9S ʰ;S  0"`PQ 0 SL0L0՘"0P0 0 ǘ ЍLPHO-pLMP4  P3r:Po R00`5L:dP @`> $ PS!QS0 @ @`98E R@(@@D@\ @@P:0@(,,0N X !$[0$ [ $ C:8@\AP80& @DXT $@0,0 $9gP 8=080[ 0 0 0 \$  0 $ R0 8P = 4LЍ(@@@ @L@ Y @  `9 \*(L @ 8 <@@<AO-@P `R0 pM0 ЍO? 0 P0?:P= 0 6S ЍO0\0:  ЍO㠰0 00S Y  ᙢ) R 0P0 1R H0C200 00 0% P ЍO-需,0 0/\*0 ,\0 0 ) p,0 V00P `0 B2>@ b6<bP0:0`40 00`FV` f@P 4<" 0 @P<Ѝ8e@5``L0`(04S 9=oobT`V 00 0S:<@-P`c@P0 0@P   0 00P`0 ⇒ЍpvdG-0`P0 XM00 0S  XЍG ?9j p p 0 00000.0>000 㭔@P: W000 08@P-$f 0S) 0 Z@@T0S3 00S00@P  0  0@3 100XЍ2 9pP 0   00g9#@ᏓGvdA-@P0@P l20 p\4SQ^Sl4L@ ^`P @Dő L0 ? 8<őH 0 ?00@-] 2@P 0` 0 00 0b@Pu/V5B@w`=hK_+_P P / J/J=$ 0R0/@-@`@- @00CS0@@`p@-`P[@P0 5@pO-pV@P"0D@0_T譀_l- P0 SQO- P4 R 4#0  /" RH @R` pA aw0y T= T @` pA aw0y T/ Tp @` A paY0WqTPp R  PP`@P P\RUP 40S40p ЍHpAD a4Q[ QVYQ@_ AQ[ a0YPPRP   O-Mpᜠ0W@ᨰP尐`00 p 0000o0@ 0 T 0p*Y   Q L B Pb<" P VU \P*PP\& 0 00 W  R@+ @ CP R ' '1/P 0000 P$8#L A1< a20! 0000P C R 01!01/P 0R0*@0 @!0L A1< a20!  U@PY<0 0P0~0 <00Q0000 0P0<00CS$0<0&U 70Y 000 &R00S P0Y00aL0 C# c 9!300 X0 6SQy00(00 0,0, (0XT 006 UF0 000000( 00,0:PP 0 =(07L0 C c#3800 9!600< 0a2#T20T2r50P0 ( 7Ѝ,0( K5440SU 0 700 Q0+  $ RYW 0@ÏD0T00 S 00!1 001/P000K0@00  $ R  WR0@ď D0T00 S0 1 A1/P 0@00 0G@-0S    P (000 00 0 CЍx2N p@-0@00P`06/ 000`06/P {00pO-PLMt0pp,00@ 0S 00,00 0"R 8 01/0eÿ `"80<n0>`0E&0S R #6:RAƠ 0401$0|PEP0W(0,0ů _Gt1 000040 0 0垎pP >${LЍ0x 0 | P ( 01/P(0@ 0 p 01/SH4QPpUp(6*C/Q @ ?QD   00ã 0Q ONO\C-@p`P(圀0 0001/P#P)SR Ѝ@- 0\ \ 00 0 00 ЍA-`p@P M9S$ 9S000S0(0)9+ 00000 0000 8/9 ?o209S# 0 R h0 "V_@0 V_"@ @@@Ph$(KQ Ѝ0 ],_!_@-0,@00V@"4/ЍtT T_0@-@0@000@@PD @DPPP0 0 P: 08S00P0000_____p@-@`P(0P0  d P bOd000@09#60pO-P@p0KMP0`@`0/U0:Kߍ0 0 P 0 ~0!"R Q0:V&0'0S(.\S(,0S\ PQ)0.SP PO-P10DMp @0! 0`z 01 0Yz 0d0 8 "1/ d:41 TU2Q D$ d( /UTI, Q$ 8( 3$ \<,V  R 00PPV! 400p0A 0000000 7@P0 h 40R 0 h`F ` l 0z zDЍ@>O- p0M`,00P, $00@000000L000$ t0倉@P#L0980 00 00CS@,00|00000 9P |0S080,0@OoB@Ѝ*PM@`00`0|0S0800 0X0000C\0X0S?80SF 0000X40@0 H0X0  @00@0C 0?d00 ?`0 0`0a0P00<00000008#8D00Ch0X0P tS-40S0X0T0 P00400ST[ ?[ :\ X <040  t   @P [X\0X P30X t00?@PlY Y 00<000t0T0000ഀXT X& R  (0 P(0I Z( " Ra H HQU BRX R0Z< <  r  < R  A0 ( R* H R8 R# l0iPl0H RY  R+ 4 \RX0g<X0@U%X(0h0D0C(0(X @@  X 0S  7 BR  X0\00080P00tP 2X0S^ 0S 08 88C?oR20S 9ST0,00 1:4 \RX0<X0@@@@@)R0*#D0@圀0S0@ @000Ti280S 0S`0X 0c0T0(0(儠0" SRwx`,0x000 980S> 9S; L0$  ɇP@`Y 0d `03`0000 L@X0 0@=@DP@@Eᝇ0S 0@0@ @C0 00@0 R000Sk@)0S:X 0(0@00BL0(0儠0" SR!wx`$ xpk@P9  0 $0 0$`p)P @v x0Wx@Px0, 0@0SbL0$  GP@(0(儠0" SR@  x04x@Px0, 0# x0&x@PD@>__@A-M`@ p0- 0?PP$ 0 T 9 0C8C890000b0TP00 0 9S00003/Ѝ0 B?PP0Q   A-Mp`0@8PP$0  @@  9 0C8C8900000H P000 9S00003/ЍO-,M00Pp`0 0 00 P *0 P0 000000 00$00 ?Z@Pm@00$0@T  R@@@@@`ᴰK [00S S% fP[ᴀǑ"$$ȑ @ `@ T@ 0P@@@@@B n`0[ᴀǑ@Ƒ`0S "440 [` 偅0@P00 R ?R *  1/,Ѝ]__O- 4MPRX0U0 `0删00Jp ((e0 T @?4/@P7 0 00\ 00000)'d@ "4400 00C0 0    _@ uX0 00P05/T@4Ѝ 4ЍO]_-DMLH ,  0嫗DЍ]@-0"!P Ѝ@-0 \ 0 00\ЍA- MP8@<`P^0yᨀPPP)0P p@` Ѝ 0 *@-)@0$ Ѝ@- @ 0  0)0 Ѝs@-`@0 0JPPPP L0 00 ЍpO- _t/ 00CS0/0~H>tP@- P O-M000@`00 ptPPwPP rЍ00@0 0009 R0  09P  d11 00*g00)0 PP 00 0 00Qd0X0 000P05/PP    0  P`+P =U000 /40 90000q^t7@- 0@ 00L iPP0x Ѝ07@- 0" 00L X@P000 000a Ѝ00  0/ @o/p@-@nPڈ000P0 5/pC-$!0PM R`p0 R R  @ ЍR , 0&T@P =0S2 9@I00>`9@:#:0*&0  C@@P@$A-`@0P00p0 7/"!""9:#:0900 000""00S00C=S0  0(0 000/< 8000@000/L H000P00 0/\ X00 $0`00&0p00h0+40 0x00|00S; S8000000$)S 00'Ñ(0"#0D0@00"$0@0P00#%0H0`00#&0L0p0 0 $+O-PM0SZ0sW!srS"srO00sL(srH0sEx0sB|p q`0$E @10000! DLQ# 0 K#0 0 ps@PX0|0#880'00 Rd0X00,$00|0 *P\PL3Ѝ {G 00圀z㬠* ᠗00*0 p0@P0嬠0S0t0娰0S0p000*P\P3"sr# AQ񟗪XkNPkNkNkNmNmNkNz 00娰@[@P#sr` $sr&srxG@x00w0F= 0 U@@ 0 p@Pc#sr 00000$sr 0   00hl rq 00S08< 0p L 00H 80@04/@P 20010 P *00)0 pw@P 9  :(090*P\P[2-@@@@A-`p0S t 0d0 0 0P0 LS@P90VnЍ@nO-`p M✐s@PPd1)R:́@t:<1 0G0 0 @P<9 08C890 000000@04/@P   0 @L@ /TጁЍ9 0C8C890000|y@tC-p @`0圀T0L T* T20S-@ Ѝ贐 ˃P@00@ Y  bX 00 0` @݃ 070 @7t$ _O-34M`)R@#*p0 Pሐ0p 00p@P 0/s@P0 "n0p4ЍpP0 000900 0 00Qd0X09 08C890 000000@04/@Pd 0I2(0 0(0$00S0Ӻ20Ӿ1ш000      01/@PA/ᘐ 0Q  000)\ 00iX}@P&0 0009/@P  0 0L 0 @ T{m9 0C8C8900000 90000fmY4]tC-p P`UO 0SP9S B@Qm Ѝ00"nP 0!@0 @@ 0L@P  0I19 0C8C8900009 0C8C8900000 00 -  01/ 0$1m@mO-`0 P\MS0000 00cp_[? 00 A 0#3*pGp W00m@000880DP4p<@@HpP0L 0800P 05/PP m\ЍHP0PG0 0m  0[$0 2 #˿0P @0 00 0U *Y0 SiIPS,@ 0 DQP000 00S U0 ῿0 0 0 VmSm0 0 0\00#0300S00 0 0  000,0$0 S:00( W ( ,0A  V 0000000S  1!  0@0PPkꫪ@- 0 RR@ @Th R( P@ @p  R0  0@/@-0`0CSx8<)Q\8~PP P*'Ѝp#sr$ 0BVP<0S'P`~PP0V0 ": 0S``V <P 4003/P $ 40 <#1/P $PP$ 40 P0<#5/PP 0:06= _G@-`0P@ "6000 "40"ច)`嚅) P*ᔅ0S< <00 13/(刅ЍpP _x _ _ ^4T^0   000 0 01/^@0   0:0 0 01/4^@p@-P@hPڈ000`0 6/ 0p@0 1/^@0 0000 001/^40 0:00 001/4^4p@-P@hPڈ000`0 6/ 0p@0 1/^400CS&~N~N~N~N~N~N~N~N~N~N~N~N~N~N~N~N 0X / 0, 0 0* 0+ 0 0/0)H6@-@`P9#61S0 S 00S0( '0S (0, 0C00000 @00D0@Ѝp^O-M@P D`pI R?PoUЍɯ U  @@H 0L @ 1/P  0 0P*)P !@UP `0S/0SS 000/A-(M @  0P$HpLP`!ЍMT T h(000@0 4/0V0/oS" R(Ѝ000@ _C- 0 M0p0L P)P P@`0 R"0 S (pT0 `0 R ` 0`0)X0   00|Ѝ 0 0 0<000 0 @|T i@QA   /@-@0(0$S, , ,0( =@-@@-@ P 0800,0$ @R(( ,,0@S/S  !!0/G-``pP  ~@P= P P Fj000 Qpq0$0 P#jP jP jP jj (~X 01 4@@H,@-! @P  !S- $MDe0< 0 4 40 , 00 0@ \|$Ѝ@PNN _p@-@ PQii i$0@sip@ |~A- HP0D`p0C ##R@`V( 01S P ᤦ`0D1X  Q R 1P ᑦ`0Sp@-@PDA@ p@U0! 000CS00S@0T:00?p@G-HPp0SЍG/0 0 0S8 0S4 `` B<T@P 00 P ``0t=`P  T 0000C0TA >00C0 0 Ay<H<< 0D0 0p _ _p@-P@ iP$0$0p 00 $0Cp@A-@P`"vt$0S000000AG-0P@Sp`P0p0S(W! !R 0 VR:0S(!0PE  1  BS !!  100C000CS0*O-`@$PMpT T0@0 0 TЍ 0 0S  F0 ' 0K# 0@ 0 0S  `G0  0K `0`  `R` V  0 0 V  ^ @G-H`傊p  V@ P B5^:4\P`R  \ #RP  aV 0S*0S  s  0 D@PH00000  o#P0S .v PPLz0<0h0S00000000C0GD  !! !R   1   0 S  B!KQ00CS0000$00Cs0 D}0HPD0@A-P$0@S`p000$00Cs0 A_000O-P`H@,MD00Pp 0pG'60&6`'v00 `0 B`F$0s w  BrU R$00Cs0 !,ЍXC0I0D$00Cs0  0[f [ Ig 10$00Cs`'g`#gg g 0SZ000_ PpVS g g g^ 0[0$0 qF0@s  QO0 $ 0$  BO `F!lP  7O0S 000D$00Cs R0 B $0Kjo 101P f f eV fZ  f 0S0S 0U  00pCA  !tP  ! mP0PC0Q  P0 0 !\P 0V$0JY0$00 P 0Q< hfef bf0Is \f 010 0C1P0S 1$00 1 00 Q'P O0 0$0 0P 0V$0!Y0$00 0GD0 !P O $`R0 Bl 0K$0 O 0 PC0$`0 0KC-P`dMpx1āȑ@0%T00SdЍ,0(@0P,0Ѓ(0,0(0SX , X00(P\0P0 (0SX@ @S , , , P0X0S\ , \ 0}P0SP0! 0 R00R0S"000P0000S (0X@S, , , 0X0S\ , \ 0UP@ _ 0 !6/ ! !SOp@-PS`@!V 01P 0 _ 0ap0 1 Q000 !  !AR !  B /A-p@P`0 00A0p@-@P`0S00p@S000 p@0j /-@ $M0 4  *( 0 0 00yw$Ѝ0N _ @-yP00A-P@T* 0S' 0pa 0S `Pc@0 LC 0S 0 ; 000C0| _ p@-@K P p pP MPh PP `P0 0:777bV ^p _@-@ PP0 0p@-@PT+ 0S Q 0`00C000+ 0800(Bp@ LyY 0 0 0p@7 0S. p@-P@ 0 0 0^=7Pp@ 0s/ G0( $ A\ @-4 00A A"1S@ ^\10,0//O-(0p7p"AR0PF4`0AAbATW& _q@Pp 1PQS0@ @A lM`p YZ PQW`p V000p@V00C00S0S $  r,0!qpꀳO-tMp0圀P@`@, ` M90 S6 ?9P F90 `oᩒ tЍ(P,0PU0%VZZ=9 00`0 < 09 V9?0J0 0\9P "SR 0 !P690S \9 0J0 00p8 `$6:00@ 000R  0  0 0_7P;Y% 8  qOY P,O{6V 7 !L8h0S9 0Jp@0 00`v !_!_1G-p VZ`'v' dA0$pp P(00@0?o2X0S0( )0Y = 0Q B@1@AS8 80< <@@xX 0@p@0 $ AP0 pB"   40X0X 0d(00(0Hb$p@p P(b,V L] @/0@-`0ML@T LPL   @A0 0,0 0X0@@=nЍ0 !_ @-MP@NO-`$ lM@ ^0@pP 1@N@pP0 * 0tt{$p @v$zF  lЍP@p 7 I0 008P7(, Q   47{ 7(P, ZY Zll} Y @5 5 L5 R ( ,"&~ M5)!_j!_h]r!_ A-?P@ M     6  %:&p@`3V `0 ЍO444 5 0D0 07O-$MH L $P!AYpZ `4!C20(2>B"  YV] xf$ЍO+0 AT   SPP QPUR QP  RQ  R R  0Rkp0@P 0 uM000 A`P X0P`@ď T0,0 PZM`@$Ѝ 0s/@-@dM* DP2*@厽804`S< (q< # Ľ 6v 0`6PP60  O $0AQ0%4 0W.H`dЍ6֝ 0  3}6E(0,#6f54,`ꀴ!_G-q 6@QU|qx|@8PU qd"AR0C4 RhyU001S B YXP Q00P EVU,0!Y00X0S `"V0P `7ꀳO-@M ` @VsC f %  ! . R  I  0SI2!"5    BR - 00> $!*ῖ  ( R,,(, 8 R<<< 8 #, R0 4, @, 4 ЍO0 @ =P $3 2 03X    0 ,  4 @,  \G- P@ U `D`(00@0$V0:Pp$01Sg0 H0L 0 H0P0L T 0P0 T %R0XP5\p5`P(0p!_!_ O-4MX傉 Dd娉0:hR 0P?)v%t(0$ 0AT,0@T)3 0B! 0U QY (@ 0`0DC3f0S   $0P#0* 0 -$0(0S, , " 80S< < # 0P 02($ Q( ((,(A( $0p1,00S8 80< 0@<00\"S040Q,400400`0 0000000\0$0`09 0 *"*0 # 30 #6: ,00$0B 0! 0 0*|h0 d!BHl!0 \    ,  d . 01/pP6 ᤙ4Ѝ 0`0DC3fd0 R   R Z ᔖ ᆙ,d{3Nx(7Id0$0 6 000 p,0W j 0h 0 0,00 X?!_\O- 00S #6:(00  $ (01/#P1 0B!0S@(060r`Z``0T:0<Ѝ0@s 0,  S1J0S$ 0,$0g3P0, 00$0   0 ɒ,1,0,0,!1, Y 00 0 V ,P,,20官y$S60 X?!_0@-(A(Q0 M[+]P ) ]0,0,  P0 aS0$$ ( 0R*0 000|`0&P `x ,#004 ,0  ,,Ѝ0@S L>p]!_8 #x>!_N!_/O-pP@[0@ P@)$幷 0#"SR3 (@00 00 0墷0 000طQP (0SR0(0b( P,0,Tŷ(0Z0 00000 sS@ ]"_@-@P  0F;   0R  08;,0 3100S/ $Q 5/p@-@PpPU  p@ p@Rp@-P@ T p@p@-`$0S 0$0P@P   0:p 0:pO-M00pQ`@HPrPP U @T00@P" 000U## 0@ .P U&0W 0 DL 0D0 00@ @ ]5P 0%: Ѝ&:820*09/"_O-PM8@0pH/ `0 0e, 0V 0 `P Y `-S--j- G5P ` 2`Ѝ0S G---S- 0  /(0, #60 !7P *-,6-"_O-p00@`0PH ,0 2 00 0弎`P  -,- 4P ` T2` Ѝ0S ,,,/ ᗔ d7P ,,,*"_p@-@ 0S 0 0P`P   09p 09pO-P` 0M90pS43#L2H200L2H2V =0@T Y 0V  000 00Po-@P:  y 0&9@4P 10S 00  09 Q [ 0(",#PP @T9!  >0 W9 JEp c[: W PE0 0   XЍ A,X   X tp ,++, D  .X[ wV  0DAU  0 8BpMp pH"_6"_?"_p@-P0`Q@ P0! X   PPp  00CS050000 V$P s P< Pj O-`pAM$ P@\A0h0i0j00$0Xp[D>0S 8.882<082$1<0S$10$1~S:X 0x>A-@p@`@P3 ΄0 [@x>@- .    Ѝ0.   Rp@-P@ 000Sp@̖00̖@- 80000  0 ;  f0ЍP>"_D 0 dhD 0 ^hD 0 hD / /A-D0Dp0Pc00S@ᰎ0000,Ar @-,0@ ,0,0t ,0 1,*,*&& 00S:&0@ 6, P0T8v0v@-`0`PC0h0L0aiA2,@I,(0 X?]"_0 1@-m$@4@-@0StnP O<+0  $4`aK볒"g) 8KU1'BO7 : xЍH "_,?"_O-P$MU p0E0`#*DW`$ЍSZEQE(PEN1@@@TH# p 0 0U 0 00`P 0F?o T20S 0@ TJ3DQ! q6`PE000 pP  Vx>4 0S/(0(0 S;3S8#0/t>,,A-pb@MPA  p101U00 001 000! P m 0 0P$P(0P 0P0<1 000  P  0 ! )1BPPp`_000P P0:PP00 |P00Pp}0 00x(0x0)0:00 T Pj|p@Ѝt>p"?h"\'"_x"##_h#N#_#,\TTn_&RA-, N0RǠȠ̌' @N@  0 `p0PP || m000эUQP(0 c00 0 P mЍ]S#_~#_O-p`1P10@@@AF0 冈pT0WgO 0$P $N % @ `X $$FJjPp6h"t>\ #_G-@ሠ@MT:@Ѝ!%PpZW``U`#VE W@Pp3$`\@-. .   Ѝp@-N@N@`P@ s p@4  O-@@0,M^$00h10 NP  ^P  $P0$`.00@p5A00pF0Y 0$`0S ,P )0  0%0P 0S  $0`,Ѝ zI .#@0 kjh"t>\#_O-N@N$M@0`UzPP$p`AfX0ȋ000  $0PV la)`0 P  z$Ѝ H "@0 %z\#_t>p@-P`N40@N@ 0卋 p@}zt>\p@-8PPp|@|0P3#pt>@-@ 00 v  0R ? 00G-p`䐟V@0Ь 0SP%PU! 0B0 0S0S 0  B;  00S 0S0S#U `FP1P0 #_A-P`pWX  %A0S0ST#000 #]#pX $0 0@ap@-0Pp0 "@+#0S "4##Rp@-@P U  p@O-dM,$00[ @dЍ,0L\D0$0H0,0P0PHPX PDPz@0 S 0 0CA4H0XPP(0( 00C\ S\05$0 000 [ 0P00T0\000D040H0S 0`(00 R0F0H0S 0DP97SX a 4IpP[ 0@ P 0  Q 0S X0D$ Ho@9000p<X0 HD P r #R4 0/p Zo $0 K 6$0d@0S X0HDE0 S@y0SY"000%"b"@ 0S ` X0R $@Hpf0Q D@FX0 ( I @,0< <0@ 1/PV DX0@ (,0 I @< 01/P #P2 |0/ ~D0WX <0 @ < 0 'X XH 0DAP' D < !<!<!< Y 00 0 0 0<PP  PY< 0  !.9< 0 %<00X0 B H@1 0a!pP0 pp0p 0o"pP 0D00 0!V!9!!00@ᨪ000l0\0 DID&DP T  H!X?#_~"_)#_O-4M$0X0 P\!7@hX0T)X0 `CV6`  $ ?0\0q[ 0 ,  p 0,`1/P #X$ T \o4Ѝ=,X  X , !>7!  "0 / \@X?#_/=p@-,P,@0 Up@lꀵ)]@-`@ 0 ````!PP " 0@0 0o 00 0 q 0S  "ЍpC-`M 0 ````p!@P 4 P"?H# W' 0`0C0@ 0; 0R S" 0WD0 07tW1 0S1  T 0005Ѝ 0; 0? p 0S:0P//0 R:P3#//p@- P@g00_p@蠩 a*0 @0 -p@- ` H0@SP`B   DD00 $p@z0p(0, 0 (0, $0Sp0Spp@/0C-00p0(`$@ @`k<Ѝ-OhF_>N#_G-M 0p` @`M6P0 P 00 0 0 `@A?o2P0S0S 00S00Ѝ R 0000 0[P >0A /R0Ca 000/P @-`P010*p@-@P` 0P ,6,P R0C P 0C0060@* 0 0T 0P3#pP 0Q ppH 0R  S01 R  S0100S/0/- 00#R0 1Q 0^ S01^ S01R 10 0  S0p@- 0 P 0@0C0000 S   B T00Sp@A-Pp`d@P p50H10@0P 0A!&0DB$P 00S 3/000L00 @ 0@A-00@SP  Sppp 0X  S```00X   B YWW 0 R 00W K XFVV 0 R 00VA7A-@lp`0S #S Pᕧ0S \˧000p@-P@ P 0S p000pg030/@-aP W@-@ $M0 * , 000 00P K]$Ѝ#_0?*A-P`pP @40 1000000 @ 0@AA-P`puP @4010 000P 0 0 @ 0@A-00\ ^^00S Q : Q*0000G- P`(PЍ@p0S 0X  0S0S$0SH0SV $ 0T`0  00 J0 `000V Y ,0pGp00000@l `0T00T0000C0 00 O-M00@P`U@PT 0@`[ P

P R*0S*VPP0S0S:00P0 PSP 0O-*p@-@PTpHP 0 D B0U0"&00 $00S 3/ `5@A-P`@p<0V`!@0 T@1T@!tP  0S*0S + 0S*0S ?Q 0S0S$0SH0S00 @ 0 000$p"+Ѝ@SA-P@`pS&S<0V`!@0 T!1Q! @P @ 0S*0S 0T 0VhЍ0V* 

 ;@00CS@0I pA-P@UPP0` 0p00 @0S . PU000ЍPP00`V  D#&R 4 R @ R  00B X $6SV T130PPV40S @0S00 80$0S0 0 0m@00@0 P@0S P080 HP }04 R@  B@  0VP`Ub40S @00CS@0  `H O-P@4M0U<0UP!@0, T@1T@!0S:p,` 0 Upp230,0 000C0Uf0  p4ЍQ @ R p U 0 R H$Z 0  0 U01 C00 0C00[ C$ U1Y ( ,p  0Qp   D @J0@@ 1/p @ `D $ u0P P  $R  0S0S 0S  1  =0 S K\P 0u 0  BR A@-` Pp-P@0P  Ѝ\ 0S400@ T:p@-@P0X(0000pS(O-H0S@10 p0`$0 PpCL \ SN P00U  R* HQ Q0 Q11!$Q44P88P<<P22P@@PX  ( R,Q RV  R0 R SW H0S 0S00 S10!$0S4 40R8 80R< <0R2 20R@ @0RX3 (0, 0 RSV200S5000 S000S0000C0 00 {V D0D0H0H000000[H0SV  @P M 9P F3/V2HQOV  (P' U   U    B    5V D D H H 0  0  PN Ѝ2/LA-@lpP`'00LP0PP@O-M Q@ 0|ЍO:Q 0QSp0GSP#*XM 0P UP1W P3 00 0gPP04ͩPP4 X  ?0P`h@00(0(0V b4t0s 00J` W1 !@XZX 0p0S  u? Xg 0 0CRb00x"hD$0(00l $\" 0000H00SU@ C08 !O, mQ ,0P S""D00<00+!D%"D%!D$0 00 0dh00\`0"%D@0L D0<0<,020@0400808004000>/L 00C100L0 @  0L0 ! 0L0000FN `@l r0 S0 S00P0$00 0 0H000s 00姛Ѝ 0FR 00SP3Z 0 !vPP`@GPh]]L]@-@pP`M  0p P Ѝ@|ЍG-0@P0`Sp0S 00S R 3/000y <@  < 0 00y0SX@`@@O-0\MpPT00,00`@L0#@0L05 0 L !6   PL00 @, 00L000 0 P 0P$0> P@ I  Y0 S b00P0(4000000@00080PP 0S*80U0S  XT00(00 0PPX @ P0 0P00<00 S?00 0 0 000 @$0S 0Z  I 0 BD @P 0D 00  0 00C0 QS00$P0$ 00S 3/(,00(,000 00080408 400408080<0 <00@0H 0PHD D B"&*@0DG20 20<0S10010(00(000C0S @@ 0  R*8Q RP0@H\PPR$,4T00(0 00@T*@np 40 00R0 R0%400P0P@ 0S* TX@@0xT/ $W Y  TP-@\ЍW 0 @P0  s 0P000C0 00 $W Y  U $@TP ,0S @H O-P`@Mp@0 0<0V`!@0 T@1T@!8P 00 0S*0T* @00Z R:㈱Q0 Z8Y $ Q\  M 00S  04S0 08pY40 K004 000 MuO00 $0 S40 @0 @0 W fw00 0 KP  @Z 0VUw Ѝ ]@-0f ЍA-` <@"# p0 &0P@00T@,w 20S R 3/Ѝ<0S T=O=O4=OL=Oh>O 00 0C0 @00 0 0 b ]00P 000H0S 0@0S 0 0@ H0R S nS 080 40 0t00000 &00P 000HP 0 D B"&00D0H000 $00S 3/0 $00"00000>O-2*M00P`0T  0pP 08/pЍ@4 R @ RH0  8 $ RS :B0㴁0 0 013刁0&H0S! ȿ DJ0P$H0[00 80 P[ H  H0S 㣿 DJ0P  0  0j000&j` 0H08/H0ݿ000p $0 03/ 0, `F(00 0 NNNp@-@P0S@ S d V003/p@ j$`U00CS0S᣿$_- 0 ^: 0R:   0\ P00O-[$_b$_i$_t$_P@$_T@$_pO-M$(04P, /K#J ?00/0 0 D/00 m/0 0 /000 0/40$ (0/0, 00/04 80/(0< H0/,0L /T P0<0DX0/@0\ p/`0d 0 Ht&xL|TX\      0/1!" # A# 0/1!  @ A)  F A* *! A/ "< A/ # @ A   A @ %- A, &- A. '. A0./p21t"/|"x212/ 1"2/1"2/1"2/1"2/1"2/ 1"2/$1"2/(1"/2" $ /$ 0/281"/3#J? 32= C A@D5 $ÍH! L(#,PT04Xa\8c<`! d1@# 0 0D3hqlHsL( ) 08@ 0  00 2 R"` x"0h0?Ux0 0S?#x03@$ 03030300fߍH hJC-MP@P`` pR"0  !PH1 R*Q,  ! 0L CT04 ,  0000<0@0D0H008  00000000!Ѝ1L0 ^ ^ N^ ȠLȠ^ !P0202 $00P210221ӀрH >0a/Q/0S //C-Mp0@`00 0` P!0 P 00 000 0P?o2P0SdQ P0 04?2c0ЍQ0 a/Q00@-0>00G, R0" R:<0S^ 0 B 10^ 1300,0堰0#3[ * :#:SX  ^80@.4 620 0 0 fP Y 0 03/^X&  0!  0D %6SP0S 0P 46S0 00 0Pu0 o\H 0ʠ,ʠ 0C00S >0 0>000@< 0#03P03 Q03S/O-@M:#:S0>0>0 T*!p#600 0  6`P W  P$ ` 0 01Ѝ R* P R: R ! 0 $P  <R 0T :0 0000Q R:JpH[ 僺U ~ 0T:U κ[ ʺ[U 0 (,0 D 0 P  DDaP 0S Jp`]O- 0LM\$  ,040LЍT  j&j R@ DN@@N@ 0C*,0"*R0 @< # 3 S:P03:RT0P0 008040  PpP 0 0(0S 00 0<00800400 0 @00P@0vC-0$M@؄SP`p0 0Lp@07/p `+P ,0 `00000 p00j$Ѝ@-0@SP`p0$M0 0Lp@07/L0, `  0 0  0 0F$ЍO-$MPT0`@LpP$f R R C< i S X:<0SYPZ 0H00_ 0 ! 0L @0 ."    !P@@ 0 ATQQ@:H   Y  H !0?,!$_@-X0S:0 0B00 (IR0\ H $_A-`Pp(@3P#@.PUPD0S TI !P 0 sP'!%_A-$aP0AS k0!>00000000 81Pn 6810`U 0CS*I뤀p0WkW000N@N@W\0iiЍP< 0 eJ>,H 1%_,Z%_\%_O- B 2p A`P/ LD P⸊U@@p\IP@P%(0崁!S00@0D 00P@061A@0U0C@@@ r0 ᄠ0S 0HP@0   S0P  y J @QP 0>0000000x (0D0 , iP\PE E뛥*@%_H !B}0?,>/p@-`P@-0`P @ p,0@!p@-PU@Hp@x0@QX00 1Ġ  S0 Rp@H%_H %_  @- 0pt0ShJs@-P@ ` `"""&*C6 00#  0+0 0Ѝp@A-@ PP` ""&*C6 U 0pᰉ P(,`0x S 0: h S 0; 0܉`P`ᒉ͉]L]@-@`P0p჉0:0α0 py Ѝ0 /@-@0:00M0 Ѝ/"&*C6s0S/ 0S/ 00CS0/@-@` @-@ P@ @-0@Su000` 0S/@-@x P@m 0*Pp@-0P0@*#p@ @-0@ R0 @S00P@ A-@ P ""&*C60S7 0 P * 0; 00  V0:0 08$0 00S) 0SA0S 0 00C0 \ 0 ; 0(0 0 00 0S0SPU 0⼈P `V' 0S 0x0U 0  :0 V081` 0 >>⣂R P A0S 0 `(0`e 0p 0s1Qz9 0 6 &! R  010@ 0"61@ 0"601008 00000咈` !H O-M 0pDP@Hز2 a 00'603S P0 PZZ@H FZ  r PQ d"($($( @0  S  G "0` "z 0(p @,0@00 + 5  |40L PZ 0 P0 PM4 ЍP  04PZ:T  0(p,0 @@ ^0`ᲇ 0(p @,0@00 R *  P ᙇ ԇ (R +H 8&_]L]G-Pp`ᔐVUGA0Ds 0 0 0 0P 0  0 0U`0 00] @- 0S Q P0Sp@- 0 P@ pqP U  0Rpp]000 //000/ S0/000/G-P0 `0LS#&@"&A6 @|pYx` @`Q*6/OoB0000Ѝ@Y0@-@t0tM@@@0 @OLP @ۅ @4P00S 3/@TЍ0>x>0,,]O-ph1,M`\1PLL1H! 0006001 Z,A   0 00 0 $$P Z夅 0S 0 0 0օ0 6$0$pU0d$,Ѝ d内0X 00L A0 ~`PEz!H D0,Z&_b&_@-PfM`0@c0 06S X0 0Ѝ@萅pp 0 PE 0S  p0} P Ѝ\0,H O-`0M  R0 Q @K Vp@P Y$[ TZЍ Pp PU@ p ( ,"&EPp@0T@ 10 R0PP۬0 0200 0Z00S 2V0 @7TA  0 Q00S; 6V 0S 0 0 0. V  00 0;O T0 P  (,,Ơ 0 @ @  fYr @qԬ V4$qV l! @-0 `E Ѝ\O-DM `@fp PEVW0 0  V0 I3*兄cDЍpC-@P`؀5Y$7p97P gPw0@@,pDX;@U@DOoPB@ap,pIT 0 ;>G@@,H l&_p@-P 0?A3c S 0 S<` , R0L <0`ODS0@ @@@?CD0pH Q| @ P<Z  88 P/ 8 <D@    D< P   (,! /p D 04 @PD <1<  {Jp<q@0PT<0P?\|=T P0R$ 0 R00S @ @&_@@,]O&_H !&_!X >P! l!@-P aP0 `AX!h1@@400@D @ P PЍhJH 0  48 h0Q8 D 8 4P  BP 00 4000L 8 4 L T  T 0$000/း0  48 l0Q8 D 8 4P  BP 0400/ 48 $0Q8 L 8 4T  BT ꀸ@-04040@D 8 4 D P  P 00 00耸@-000CS ̛O؛ƠOOp@-X`PP@ P `U@ 0J,0@U D@_Tpܸ踀O-,MH3HSPHT!LD@! pqta`Ad.h1@0 @@TࢀT0Pl0 C$?0x0 Cÿ0C$?00 S0 00C$ R ? 0 0BĠ/000\` $ IY$ P5^\0@@ P P&^T\ ZO0ZZ @@@ ^8\ <03@^0\ 00@^`0`P 0@ 900H < R80L0|0@H@H0,ЍOC\ 0@Y~P0 000@hJP,ȸX,@-8@00(< R@@ 8L @ <00@ꀸP,O-$ R <@T 10`0 1P < @0R!80L0@0< 40!S<018 L 0!4 @0 pW, 0 S(fP 0S P!0000 SPP0S y 0$0 0$[ 0R0S d @0D0@0Dl"pX^W @0 WJ101垧}p耸P,H ,X,]>L]O-\MP PC 9A0a3@0<|S8<00@0@0FD@`0XT0<`JZUCV= 0 "P U< @0R8D@ 4 R8<  D40@ Bp~W U   PPEZ ^ ~ &(10(11@ `D @ V8  @ `\Ѝ耸H @-@^00000000/000/0000//0M0 PЍ/00M0Ѝ/P0P00Q0T00/းp@-@ ~P0@PD00|`HP !L09 \ 5 h 1 t- P) 2% p@ ꀸO@-@ !00 0/0TX0P/း@-<@R~%0 $ C4X0@ S X @~ꀸH A-`Pо A0S8~ A R 0PA 000p&~000*_~ \~0 0C0QAA- 0@R1$~1$0@00P~P`0 S  Q0p~P 0Rc1$@A*~000000 ~3S X?@-p@ l\ `h Tt H < 0~ @yꀸ&_&_&_&_&_'_'_/////// 01>.2h !0S000C0< 0S0 00 00000/!@-@P R00 lO-\MP0 `S`S@#@2T@U U0!:3 U`0A0C 0000@0 0Y`V0#0#60W((0, 0P0Ç0S jE'(0, 0P0$@#v0#6(00#6C0#60c400,0P 0P00 ,0S $0S@i\Ѝ0K,0Px+(0Sq0Wm*"@?P@!@1#(0S`1`!@D @@0S80*PJW@1@!@D @P`10@0S 400C $ 00C 0@0D < B Q < R80CY 0D0@ @D0 Y A@0@000I00$0Y kG0S pP0T00Pp#6$000c0000c(0}|0I640 6,0P @x*@X 0 ppppP 08 0P0S0P0T0P0 @S00R0SL  00`g 60C04 0PD PEP PUP1UP10S> (00UP1X(0@0@0T@!T@!, 0DS0%#`F :0U*080  $ 80 R:0`F$0 S,00T: Y@PY@PP(5|0FS@1$0  0l  0@R0T0 0P8 00000 R0T0 08 0: @00@0P00S Vj0P p`T0S*[&*PP U P10S!1E pX*P Z PHEY p`W +[P1 P!P1oE 0  pW PPP@`A I@TH I'_,B'_ 4{,08 Q/P @- 90@R'_/0@/@/0 \/у0P1@p@-@`PH1ƒQL"^!^D*Q p`V`F`P9 E@V P^@o#PpA@AQ`V`F` V P L@p@w'_p@-P@x2 Q*    0R p`VHB9`F`V @ LPp@w'_O-1M0S&9`Pp U@770 @07.7W00Ѝ-  Uڌ2Sᅢ \ J 2PW@` P @ KH '_@'_'_,(_0@-@X0S0/"R\:@\*QL0@0C?0@@- pP 02 0  Ѝ@p <0 P 0 D R 2 P///@!@-P@-PA@-P 0@@-P 0@@-P 0@@-P 0@02P 00 /@02/@02 /@@-@P02 @O-pPP夠R I W6` @#&G$0<`@`D`H`L`#Q0R* 00 00 0000~yvp@H @-@PL0"D0S 03>4000,02Ѝ000!F(_,@U(_0@-d@M 0R0`Sr]00 00@0P0@0 q Ѝ@s@-P0@D0S 700Sx TlP: X7`A P<74`P@Ѝp!<]b(_H '_(_(_(_@0O-M`  00P0ll500ЍpW8< 044Q0D0BS0S W7*7P .0FP W`Vv70`F`@V @ DD0S@pp h @p 0p0C 0P 06# 08 P 00C 0N](_()_!@M)_w'_DH O-,MP`@` V.P 0p.P@00㜠N@T ,ЍX PPE%&$ $    01/d 00P@0/@- P00 QP@- P@? Q0 .S 0!  U06P`0!R0P`!R AQ:R 00P`0S6#P `0 S 8P`P`P `0 Ѝ U000S0QRA- p$@P`0vw6 00J9Ѝp0 P/0S  4\Q 8< Q < < 8H  BH /80/H P00S/P 0 (Q, Q/8/0P  /?p@-0@` PU` S R   P00 `800h <0@8@@H00H0pQ 0 P0S  00/H @-T0@T00  0 @ST0@@/G-@0Q00P00CP0wP'࿴P""R,40Xq0S)4D140P !*)wL00CL0$ T00CT048P5 `w000P00P0Ow`0``FV`.G`p>w, (rD0THO,P`n `s o%cH /2d])_? 0 bG/0@-P$0M 0 0 1xЍ0谩QO@-(0 0600"xЍ䰩QO00@-  -0 0000 0.%@P0 S 0l h XP$P6p{P o@0S % $0 P000CSo0@2(2P0X,20 0 4C#"#04>0CYC 0[  IZ. W.`!(0>P|0S' P!0S!   p 0h!AP XX0!h$`Pm0 0 @0S00D0(0,`(0]q0000|0L L P P `KxMqcP\q@0@q @@H 1?F2*_l*_+_*_T*_*_*_+_/ +_++_TO]3+_(1 0S/O-qH0S@ `- q찟PU-Eq ЍOQ@T P 0! 4  p R `-8 <0R<00# H00CH0k8@ Ѝ?H O+_1/v_c+_G-0H0SG0P SQ@ 00ppW R00S0 00@T p 0# 0 0S0p` #R<00# 0800X<0@800 00 0T0 0T0p(08@ pH /@-T@L0S@ DqpdX40 0P@T@@ӣpH ?p@-@8`PXp@e$00$0p@pꀽ p/p@-`LPCpz@( 0F 0 0C 0T00CT0p@qpꀽH 001 7@-@HPZt@ ,0 6@Pf Ѝ0  @-@aM }0Pp@  N@@ ,0D $\030#R0#02S .p `Ѝ. & R  p`*t 0 D`P p 0 D"60 B+ 0 B"6C00S("06BS-XN, !004 0 #6:S"& :///R/>0 0 H@-@oH0 0@o %O-$MPH0TQ@`LpP0#0@ 00S 0S岗V0S R0 0`P60 0 H00\XTPLp$ЍO[%O-Mp8000 0 0RЍTd ` 04 ` BP@P|PPP Q /CQD?C-`|M@Px Dqh0Sh             ($  ( 0 040 080(2<0}>@00   1DH0 0LP00  0TX0\0/S F0h``0d0@ #P 0000S l0`0F0`p`h0l0d`@ "P@p`@ |Ѝ`s@-@P`=BP Ѝp@sЍp@- L@P 0S 1(S3 SP+_O-0M3S P@P1S S  2S T$$P $Ѝ22$0V 00$00 0$pP $iWF$D 0`00,080402S300l0`0V L0L00 06/PL0?Y00` 0` SE V!3P Q*I I`F`00A $(0Sz "R'0&b00CS$ 0000 0$DP $00CP $` "R"V`10 ` " 0VL000`8` `2$S00S,0 40s0n`n`4`800XpSD 00t`D00V P t`0t00S1   0 l0 0  ALp<040S07/D040 p 0 0'Z (  0, Rbc^pPS01 P([)D0<s0D0D P0a B 0 D0H0 0 4D0P-d 0HR:0R050B0005D00D00 p0 . Q 0 0A B40 00C Y (   0,`1!00 000L000H0z V 08 S00 02 02000p0h`|0l0$03/P$_ 0@H0 V 0`0POA-PpU@` U RpP  Q D0P ^ R@T WP T]0O-x02 CMR@#2` 0 00 00 0$]@P  p2 S OoBA Ѝ0S%P U"0P0 0$8P PEPPE0PPEw@ U @-P@`pP  0 002&PX0@0X0 ЍG-X0 P `Ѝ0@S `P 0PPPS*0 P000 S S S 0  R   R R0 R 0S `R p@ ^PpY  冾Z`  N  {`{pD 000X $p0 $0X  0 0%=`PX0 X 0 P<` X0V X V !3X0`P 0X0 0\0j 00dX0"Up]W L7 !l pP +_P P P?@//?@-0`*p"*0C00@ 0 `0 8q> 00. 0.0 \0 (03100 >0#60ЍЀA-`@V pp 00000 PuP 00P?A- $0p0 $0 0@R`P:    U@` P 00 00$00?x @0D0@0D0S/p@-@P`0SJ000p P tP?A-0S@Ѝ` -0) Pp!@P0tX 0007a0 q 0  0 0@P 003/@@-$Ma01@00 0000 PP0p  *AW 0 00 .  00P$Ѝ0@-PMP  @:#: B   B  X0  00. 0.0 NPЍ0@Ѝ0 -,M $001040 00000P$P,ЍA-X0!P 0S00@0#,$04@ R1D@C(2Dp<@`C0B` R 0 00000D0Hs 0 0000 000H0@ 000 0 @@Ѝ?P$0 0!0 00 /Hzhzlz@-0`iM0 0 DP 0 iߍp@P p40 tpfPdF  {#U00> !0(F@F0F8FedAO-Az 4M(hb$sS0S b 3 D oPD 202 000*0kPP  Q0  00 倲倢 0  pAT \XDP`<DP}P\DP D0/S]0`00FD@-0` 0`Q s0!00  "0PU ` P_0 T | 0 00PP;0 0C4/,P000N P0@P@ 8 8P<`P#$ ,B00  z P0T0P0Smk PvAT00hE Ѝ-_Ӏ2^,_ _,_,_7,_],_,_K_`^z^,_,_,_,_,_,_@-<0DT 0 !0  !0@- ! 0 !@- @0S 0@@F8Fp@-T0PO`d !0UF Ϡd 0!T@!p,,0@-0dM0@ 0 Q00 P00  @`T#ʸ@Q  ) 4/0 0 &#:J 4/?&6 :  >\ 4/dЍ0@D2tTR^d-_S^_S^^^X@a^ TR^9Q^Z^,,o-_-_0O-P`p'DM,00> 0 00P(`$ p*0,0> 0> 0 00P(`$ p'0 !d> ,0  00P(`$  p 0 ,00!> 0 > 0>00P 0(`$ p 0 ,00!=0= 00 0 00P(`$ լ 0,!t t= 0 00P(`$ `0,0 ,= 0  00P(`$  p嬬0,0< 0 00P(`$  p嘬0,0< 0 00P(`$  p儬0 ,00!D< 0 00P(`$  pp0,0< 00!;0<$ 0 00P(` pYS0,0 0$!; 0; 00P 0(` B0 ,00!P; 0 00P(`$  p.0 ,00!ʟ: 0 0 0P(`$ 0,0: 00!: 0: 0 00P(`$ p0 ,00!`:0X: 0 00P(`$ 0,0: 0 00P(`$  p٫ 0R!9 ,0 00P(`$  `ūR`: 00,!t9 $0 04P0p(` p宫R, 0 00!90 $0 04P(` p啫R00$,0 0 00!8 0 04P(` p}%0,0p8 0 00P(`$  pi&0+,00! 8 0 00P(`$  pU(0,07 0 00P(`$  pA)0,07 0 00P(`$  p-*0,0@7 0 00P(`$  p+0,06 0 00P(`$  p,0 ,00!6 0 00P(`$  p-0,0;$0\6 00!H60@6 0 00P(` ڪ.0,06 00!6 0 00P(`$ pŪ10+,00!5 0 00P(`$  p屪20,0|5 00!l5 0 00P(`$ p圪30 ,00! 5 05 00P 0(`$ 冪60 ,00!4$ 04 00P 0(` o70 ,00!4 0x4 0 00P(`$ pZ90(,00!44 0 00P(`$  pF<0,0$3 0  00P(`$  p2>0,03 0 00P(`$  p?0 ,00!P3 0 00P(`$  p 0,03 0 00P(`$  p@0 ,00!2 02 0 00P(`$ `A0 ,00!l2 0d2 0 00P(`$ p̩B0,0<$2 0  00P(`$  p帩C0,01 0  00P(`$  p天D0,01 0  00P(`$  p吩E0,0L@1 0  00P(`$  `BP-_5P-_@?-_-_H5P-_pĭWu_R-_-_-_._._2._hBP&._/._=._L?APC._DP _|_N._R._Z._b._j._z._._._._._._Xw4:P._v._._,]._0 0 00P,(`$  p4 00!4 0 00P,(`$ ݧ5 00!(5 0 00P,(`$ ɧ 0!h5 0p5 0 00P,(`$ p嵧DЍO- 1G-`RMAxp oP` (4$1 0 1 010P 0@Hp+?o2P0S"ЍC-鄐|M@P`` pWHT0X 00 000000|ЍKs@-P`M00@0S 0 KЍpFO-PM@`Ȱ0%U0s 0ȰĠp@ЍOPX0UT@@ pwXXV2U`010# 0YC L R?0~P PVAV|pW|V,:V~Z[$(F8FjV  P  q~ &V| RXVf~# W!`JKq@hIVXQ 0`FV`G: UapP(9V  s ;?0}~`,VV UU010#`| 0YV,~Z[ E EV 4 PU|0S Y1`JK@6 Ѝ0 M@ Ӏ@ӀO-PR`@$MB @p&U0 RU@D @$Ѝ Z X       *DU  (sUZ0 H @p KO-t"00a,$@ @@ @P0 0(00 00a,$@ @@ @P 0(0l0 00a,$@ @@ @P4Ѝ0_"_0_…__^7y^1__0_hF_0_|_0_P ƒ #60 P *R  P 0 / 0CA-0@`P P(0p, UP1p1:PUp0S S0 0!d 0 P*0d0L0 0!d 0 P:00 2l0_0_@-L@P 0S  00P 00002A- z@p `PUpPXzE?00ST~Jz<0 80+y 1_22l1_X?51_0000 y20@-M 0000P 0`(@PP8 @P 0 @@0@ 0 P@P Ѝ0S R @! !@P E@0Dp?  @Sp!@@Dp@P2p y_0S 0000~@P O0S 80p 0 0?>@P@y2<1_WP2O-䒟M0S@ Xe Qy0Shu,0 a,0zXBQ08 0(szQ0(@8(0H> C'(@H(!,QL H L 0P BRP =)Q -HP PH8( , <@H 0L pP Q H =)A -BLP H!HP 8! ($ ,!@0<Q}x|P[0* 100S% ,(Q?0 00000000 00 @0X 8P D>,0a0y ЍЏ 02@BX?T?ӀF1_2O-MQ@L @pP `VTP%@ЍH0 0D00@00 01/PP P@ `p@-P,0@TpBP @l@-@@/D/H/L/P/T/@/D/H/L/P/T/00X\ /0\ ^00-@-P0S  Po` ЍX/\/RA-PR`@\p 0!SyP PP@  d!X@@-X^ :S\!@  [s@-D0`P @Pf`00Ѝp3@-@0%W3 0 _30 s3@ @ R D0\ DSR///@- 0@ D  H  L P  T QR #X z ЍX R #D00P0 00@-D 0R  ЍP 0PRpX0S` @W +P0S ` 0 D  P  X R # \!00@00H00L0 0T0000/03/A-pP `V@P P7wP wV @000V 0 `@ 0S 0 00 P000 @  cw3l0@-@PMv0@0@ @@@0 f     t d T  D $4(Ѝ03c1_0?k1_1__1_1_1_1_1_P/D0 R\08 R\lp@-@`&Plv(@PTvp0`0 00$P 00000@v@3@-@P|v 0S 0 0S0   L00C0v@ 0S 0S 00  3@-$ P P 0PЍ@-  Ѝ30@- 0 Ѝs@-@P3N`i`mN0 0Ѝp7@-@[dPPVPP8P 0  Ѝ0@K Ѝ03s@-h` P0@0@PDPHPLPPPTPXPY 0PPЍp37@-P@0@@0D0@ D0H0H0L0L0P0P0T0T0X0X0\\90 00P Ѝ0p@-P@pp@-0@S P@p@- IЍ3B3=3@-p@`MS[1 P@0@0D0D0H0H0L0L0P0P0T0T00P6 ```1 00pP  H[Ѝ 3 3$3@- $Ѝ3@-0 0 0$Ѝ3@-0 00 0 0$0Ѝ3`` @0Q S  QS/S//PH 4/@-  @((bP @ tP@Ѝ3@-@ L00003p@-000@S0S00 L0P0p0300CS0/0M03@- PMP03/@-p0M`0 P 000\@$0x0,` 0000(0 ` 00 000000 ЍT?@3P?X?@-000S ,0 R@hЍ@Ѝ0M00Ѝ/@30G-aA8Mp 0qPU 唽<1厽P1?0P岟0QS}0S  R00RC20@  0,00$0,1P0$1`|00 (`000 P Pp垘P0,00$00(``00 000 `P Pp≘8 U; |8S0S XI; P8ЍGE8ЍX?@3@BT?P?l2_Pp0 DJЍՀ]@0p@- AM@PJQp@J ܁Հp@-P40 AM@JQ  ́p@JՀÁ/@-, 0#@0 F@J]p@-4 0#P0 6@qJp]p@-@4 0#P0 #@^Jp]p@-@4 0#P~0 @KJp]G-@0 `0p0 0#`= CPPP `0 @p~P ?0 RS W* p^3  0S 0 0 0S 0 Up 0 X?G-@0 `0p0 0#`= PPP\ `U0 @p0P ?q0 RS W* p^3  0S 0 0 0S 0 Up 0 X?0S/0S/P/0PP/]/Pp@- P& p  1 0G1 0G1 0G0 0G0 0G0 0G0 0Gp@PG @PG @PG @dPG @HP|G @,PwG @PrG @{PzPyP@pOTO@NhNA-p@P0 MW  00 0 0 p`P 0W!T0``Dz/ 08   Ѝ0 0 0 _9^^2_O-M` t0pQ(0@HH 0,06:/S *wL0  30S c,@а HV`@Y I/@`Pe$0000S 0 C HDH@9%Y. n BR)|P`}P}P`}P`}P`}P<}P}P#z?0J@`Z``0"10"J000y(0> CJ "p HHXH?@X> R;H4Hၺ`P @ 0 0=02  @P1 \HH!FQ. 1  a@P0S 0  HT}H@W Ѝ*0S @ T@ 8NP@0SD@T80 &L0  00S 00D000H000<0 86/0(000 00 $00#1 03/@Ӏ2@^^[^2_\_^DDD 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzG-P@0`0@0Vp @0ppG0Ā崐@TGG~70S2 7 AP V @0 7<G@00@0G^P 7Ӏр@@-@@00@0@{A-8a8q0Q:$@1Q/p) 0H!L1P!h1 !0S0 Am1PP0T313h|@ᣭ0 0!4104 00000<4?2_<<2_</00S/<7@-PQ@@0 0S0 @2U h000\ 0@ 0 00R Ѝ0@0 000CPP<@-P@$`F1UP 1CUW 3C7CU( X1 03/?@1U( P$10S&P" @000@000800<000 0D3$0P0 000@0 0PP00P:PdFЍppP QrP@0S RS 000<clc,4?<@0/@``@o/@ /@ @0@ @P/Q-//0 60 2/@-`|0@T L0S p]F0!PVF@P P$`0 Ѝ@Ӏp@-@Pn@PoU p@E@-@ @_2_p@-@/  E011>101?1?11` P@V@@pp@-@HPE@080C@00S  0 Fp@E΀@-!2 !@!$!!!r!E0!311Sp@-0@P0`@ PEE @0 PUEtt-p0@00\PS 0  P@oE403EEp<΀@?2_)_΀2p@-P@ap@-@@Tp@-!2 A!R!!r`!U!,!P!,!001Sp!AA2S^ 20Q 0 SQ Q 1p0C0C00 Q2-  a>Q 0 "Rq0 o`/O-M AQ( <0@@|_ЍOÐQY(0p S<0(000?o2?L0ISI0 00I?oR20S?0I?or20S8<YD`xW01x0#L0D4`P(000U L0S:Z0S7 0S`0 S0D0@0 P 0@DT`?D0 m`P D `=,0vD1@8004080 0S`,DgDDlP40 R$ 40h 0T0T@Tc YSl3$ 0R\ 0S030#[0S 0H0ED`0H0$33X`x `DV`@d0X `X@\` 0lVh0(0p000t040x00儀0X00X \`ϓV 0 0唀 )0夀0(0SF嬀00.0S030#[0S0000Ks000~X00X \`垓 )0X X00\`唓(0SX 0\`X00ሓ"+0V0000000X00X \`uH0000$000$00|0C,CL00 `@Ј`,CV<00Y00000C000$0Yx x@00S0f000HC<C(0S 0 '" <0 Ѝ`lFӀ@ӀlO-3M3WX`3@03?P0ЍV0@T3 044004@wPP ΍0Fd0LC\JCX3Xp`V L0S4Z0S1 00+?Upbpp  "q EŠ  " !΀O-13A1LpgPPZ넁`pU/^U Y8 Q020?SP !O011QP? QQ ?10 ЍO[ 00P 0SW ( R 尐U P00 Ѝ΀s@-0Sa @1S@ @A1S P1Q0``1SЍp0S  R R    Pp@-@T 0PQT@dpT \">IPH \>@pX>pT 0d3IPpvtӀ1MR  !Ѝ/G-pP\3a !@P   Th@-@`Pp0P @ W#!!  !  0@@ @0 @u0 @P ЍO-upWpMC@`X3쑓1 0 00S:P = 210030 10 )11 RPP =&+ doh 0l`0 03 kU Ѝ3 =80P  V= }2_0Q`/wt@A-@PxM␀ Pp`x Edp` P6=T HP  n,k=xЍdHP 0 oӀA-pX0X`@0 0"+ P 0(00 p 03 R3Q-//-//-/-/-/-/-/$0 0!0 00 /Hzhzlz0M0 000  c P0 000 cP000Ѝ/0M00 P000Ѝ/ M0 00#0 $0  00#$0Ѝ/Qs@-`P@0S00000S! 0U@" H<0S@ Ѝp<0S 0S @΀lp@-XP`@ PD03 1pV T( P p#p΀π0 100S/I΀̀p@-P@W<M5p@<΀@-000S ᠎ 0#  Ѝ̀@-@0S0 R000000S 0s0000S0St00ddWPX00SLh$A@50 0 0 Ѝl΀2_3_]4̀ππ7@-@P  ផh04t 0<00l00p0000 Ѝ0HPp@-@P, 00 00 0X0$00(0tp@xP@-@ I@ 5`@17@-@`P)&0 0 00h1S\0\PZ_00~ @00 0v $00@0n Ѝ0h5_$3_)3_:3_@-QaAM0 0$0 0S$0 S*n;01S< `10X00q01;W  c0 f  Q;!(0,0(0,x  帎 Ĩ 0R1!0CQS B0 00 VP t.S1! B0C 0Z;0  4M{πP΀X?πPl΀2]4L3_{3_A-P~`P p吀H0L,A0 U P#H0LTp0    0S%;|03/0S:@l΀̀@-<0DT 0 !0  !p@-00P@00.pπ0@- ! 0 !A-p@xP `0 S S R00S0C0CT0J$ h0l0h0lA΀l@-00@0pπ@-"0 @0 0Ѝp@-PHM` P @ (P Ph@G:( ṍ (ŧ $ ᯍ  ⻧q:HЍp΀0@-A4MP000S #:\0S)  BR/*  t劍00 000X!h0l0h0l810000S+0P=P4Ѝ0 Rn4Ѝ0@*: ,aR !080!#4# 11 | p+h003/PP@pP |+0 0P+X00X0+09 P+X0@00X0X0 R)0X008 0@@0@@0@0$|$0 R 0R @TT0i ~ 0Pl+X0@C +P c+Q 0#$# AT S Q Q @ ? 11 0R!rVP||+0@8+X0@0X07300p+ zSZ @0X06300x0S(  Z+U+ + Pt\SW Z U0@,0@`S 0 0C 000|2+| *000h0 0S 0040*h P 5/P40+U + + 0\00`0 PP3S0W L5310 0P3S5 H@X,p 3 C pPpӀ hⰷ0`0xP*00@015w  89@P@0!S&3S XH pP@st@ #T *@ 0S 03# @04/3 0C( P0@0p00h t0 p00*萍0U*S*0@hTX x" S 8*8*@  S 8u*Zq*l Q   h T8z3 S]*~X  X " X @  B@ K*|00* 0@*)X0 0Z!0X0@00C@00h0 0S[  0 @0 0X0N @ X ! 0@0#X00 @00C@0 * )) 0S@08)) 0#03 @04/@))0萍000 0[  T RI 'R 00'@ 8)) 3/  $!0X0@00C@0 !00 00X0 0 0@@@(5]@-,0 00000 00Ѝ]p@-P@Tp`OP w@G-`p3aMF)1 PUG~)P 4)p@-P@``+) 0@I @p@d)p@-@PP) 09 0p@X)00/A-@P@pET|` )h0000h0D)@]00/0 S  0S o/p@-@PP(X0d`m)P)ykX00X0F)p@)0 o@-@LPP@?@-@X0 0dX0h$l`03$!$GH@H #pP RtP N@85 0'z85 0z85O-p`@嘰  HQ:/PDPWe \   0DP ?P Ѝ0S 40A3/0`@00@`FO-dMZ@$ ` +㉚0T L0P $0(`T "`P8p$p* dЍ P5`P$0p$p 1 00]`P /吁P0Sx@!%PPs!(5PPm00h( 0;0!PP^P1 00 0000 0 _PPM0$ 0C0:P01T01 R !d ` !l  2/`PH0T S*P S:00S18 ,0 0Rn pP XptP StX ZxP P0`Sn85G-M@` 8pYP+0ԁP@@0/S WuЍA0 0 S?@# ,* b90 C /  C1$@ MO00<`00 ` OV@ k`F 0W@C0`F`O-`4Md@qȔ 0L0 ?0OX) 坰Y|4LP0 0/0 0,0p p00 000_P u,0/pt0Q0*#P,00 0`PP,,0L `0P0YP000 PhP|P0ٳ0(0L0 C5<0X0pPtPlPxPʳ N >_PP X0H(``QdX0S X0,X0X` 0,020(0PP`1, dQ0`1\0S l20` \(0,PPUd1, 0d1d1`l H(0000C01\1 $  BX! 0D 0TRk:D04Ѝ(PH! E'b$ $ R!0 R $0a$0P(P`10`1Q\`X00X0 P\`X00X0LX0 0dX0o$!$$ H P pP tP \\N<XNX0 0R0U0S  85r_6_ЀRRFhr00S/ P 3/>A-P0 `p00l 0 0010 (@0P Ѝ P'0P 0@00 0 0CS 0mP`V pZcPp ^P'0P 00@0G-PM" @@M a0 @@9 vQ1 010;0 @00d!PpL(@T `X-W0AU2@P 000` S'Ѝ 00S S S 00@0P0p 01@ 01p@ 00P!0 R Ѐ8?x>85n6_6_n,]^^C-@PM> (0S; $ X7 `V6 e0Ԑp03/ @0^P00^P 00` 0 `P 003/Ѝ 9 D0 (0p`003/x>6_rP/(0S/P/ R  00/G-Q @DL08( Q!P( U Lp PU PU ^Lp R(0  @` jpP PU *\L(0P(@S0`(`(@0S   0 ЀnoG-PQ pJL@(`T `(耟VL?$t! 0Sx$@0S LPPpk$dyLv"(@T 0Q S   0 T`@ЀӀn]A-@`PpU 0S }A y 0S SP@-@#b,P]S_#hP lP 0W@SA-@i`00Sʬ#Ѝ0 0 0PP-0 0,0pp00 00 0P ,0/pt0Q0!*рH?O-@Pw@T ,0〠X2 P@PP  yP< tP` X !P P`h@#0SK}X2V 0YU> :$@J$ j@PN @`0V):: `V 020 ` R@P0 00# $ 00`00@PQ  $U@0@,Ѝ 0S S +$0\@P$$ ߮`X g}@?р0P|0S/@-@h3/0|0h0O-a0#6040080>0#60D0>0#6000<00@00屈x80S *}l0 0$J(0Sp Zn Yk 00Lp @07/(0 03/3 0000 ( 0 0pP(01J 0 03/-H0Sh(HX L#7]H<l GpP vtP r0S AWpVW  00 0003/p0xxr8Hd61S m l0q 00S p0S$@vG$0p  $@G0tp0P # 1S 8 R l Q 2/l0 000S 3/l0 0 1l !D03/@10S ZG0S,GG%0"# " p>  R8P0. pl 000p-(p(p ,p7M0 0Z000C0(ZXX 0 `(0S L<p<ЍDFӀЀ856_r_Ԁ0@-_MP P@P0 _ߍ0@-(000000 0Ѝ0P@- $0000000Ѝ0PO-dlQ 0S P0 P08P0L_A0C0  l0S/Z B\R R  B 000T00S0H0`0<1p0St t ' x0Sp p0t 0xt0l/2H-xvA0`SM X P0P:P00Sړ00P0 *   fJPMK0l 0000Z6 00C0 E w, 0 29].0 11116J0Z0N0S I81S 뒏 Dz6E$u0$0N4H?` 180S 3/*?kT0  o .l[0 00[ 0 [ 071`0S! 0S0  0Vఙࠉ䠉  [  M 6(0 0 0Y  (lu*5 x `V 1S!! !1 0S   $3 R @@00l`Z0000x0S p0St t ' x0Sp p0t 0x@t0L0 `Y`H0S l  =M0(0 = _1S ~'[ I 01501 X 0Z0C000000Cl zV ' 0 -4\l\g  Yi <` & : ʽ\1 P 0P^ 0S 0S5p@ 5 =55l0Q QM00pO `<C?;x0S .`\2 7_ԀӀzӀC7_@Ӏ+7_p@-a@PP0   DO-M00SP؀  ᵧX ᯧ`\63q80S0r ZYY1 `x0  $ S,0O 0 0 0P,*pD P $0S,02 H0S5 `[,0Z R3 RW ,@/0SRP0O 1P00000C0X000_T-0S00S% `P (%@H0S PS0,0,@T V5  Y4M %P0 Z0S 0W 0 P0P0W0 `0 0ЍB ,@Z0S0S5@ 0000C0X ?005@000`PV``0,0 ,0p0WZ0S000VP0830NP0 Z0S000W 0 P0mP p0W 0  0`P cVa `5lP@ 0U 5 =5P@UH2PH0@S 0  0_K {T|p(<(X<((X<0S X (֦X (0Ц0020Z00S   00C0p0St t ' `%D媆% a P,F=(P?P D 73 )Ag%0 S Q R0 400``0 o0ZQ"04P B+ 0 0` LӀ@ӀӀ2р0@-q@M QaT0P0` ,0 2TP X GЍ00@-P0dM 0 0@S0 0S0 Q  ?o 2Q0S X }dЍ00@-@P0 SMS0R  0 0 0000Q P _Q P  W?o2Q0S MSߍ0p@-5lP@0U5Pp@0`P * P{y5<50 Spp@@-X0C50S[0  KQ 00S @SFO-`$10|0L048<0L0 !80 !!L0?! 0  ?  # 0 0 tq00z2P jDP  ID )<0<0 ~,0S;,0[0000[` P055 l`0<10x080C4mP P0$(, 0P0'T0T0(V= ( fd 4R =0c?0h0d  0400h0$  0`00,00?% 40!! 140S  3/-10 0S [0[00[0x0Sp p0t (0x@tH05A ARX B0BSl|505 V@ i2~$j:mB0BS  R`0@1d0Sd d0h 0d@h02 R @0@b[ 1\D03/2022! X! ! ! X! !20C22S X 20S tQP1211S T0  p(Jli?p4P0) 0 0Z 00400 [`00005A ARX B0BSo5(A0AS h5Ic 04pZ0YB0BS  Rp@0S5D0DS Y D IL4}IрH?ho86I7_hF_h7_o7_y_6_2=QӀ@ӀF@-0  000Ѝ@-0  000Ѝ@-0  000Ѝ@-  <  S 3    0 0000 Ѝp@-QC 1剸@8h@00@00 00 !!0400000, !  !R==P 0 V@0es=Po=P3S L6oL6p@-X@P0`S @8<@Tp@ <03/@|oJQL6 0o_@-0@T0 3/@|oA-Pp `4 @P  p `n00 (R $@ @0@0|o7_o R 0$0 1 |oPA-@`!PP0q$0开0PU(0(0SAS 0 0 3/00PTp PDU(0 S 0 0 3/P|o8]7_7_c^p@-`P㉷@  ` mk000p@-@Pa@k0S   cG-@`X 0p013 0PUPU'1Y P 9/0SY P  0  "0PSU0PP PPA-Pp`@ ``p0S0@@PA-P`@pr0S 0S   A00 00SD0 3R W@ pAp@-@PD@Tp@-@ 0@P68_O-`0Sp,M@PTXbP ` x` 000000 00P0 00<00 @@0`P b,ЍZ  |$ \0 $$0w[?p`p  cU 0S $  0P 212 2<22@022 02oUY 00@qr@-0C0P $p!Qdr2  TLP1S  < ,$E'8_/8_P6T6`8_0@-@H0018,@0S ЍP6T6p@-40CpP0[;P0U3Mpp@-@00S^P00#;#P0mTpp@ M-0 0/m8_ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz00S/A-@`7ăPq3PX`00S eP P P4 0,,( $ Ỳ8_P]8_„_F^p5_0 0 0/@р\6O-`PC1(S 01O000O~㌐0I0SOa岀p~@n0S p0I0SOa岀a ~O~pL@рG-餀PopWUpP@@ t@]!8R#8 @L A@ 0B072S S B! 0B0+@р0@o/@р 0P/,р0@- 0D0R@00,$00۴P u C-p0MP0 0`` @姞0 P 00 000 0@Y?o2P0S  R Ѝ脽@-@08M@@U0 00@ 00@@0@8*~*0|0 0000,00 (00!P0 0H0$@ @000'> @00b]8ЍрYQYQ8_р$ZQ8_@-p p@p@0@@SC 1X01ut@ Ht@@E<<B80g@рopрR8_(q8_prA- 0b@SPpb}b0@X4100S 0 !!04L0H0@000, !  !Hzhzlz@-@Q't T 03100|P0v6PЍjx 00SP 00S t T0 #!R`0SӀ@-P 00Sp@-P@PpTUp7@-P@g}00 Ѝ07@-P@]}00 Ѝ0@_7@-@00PP 000U O Ѝ000/0@-P0M0@000TЍ070 0 @1P 0 P QRp@-@Q 0S p@0Z0P01P00Sl 00C00Sp@mR?0S P00 0000@-@ 0  R0Q@R  R 0CSaQ`QaQaQ`Q`QPp@-@`Q* P08P0Z0S P0S 0 000C0 p@QQ41041/41!0CS41/Zp@-@Qp@8p@-01Q@101`41SpZ PP/@P/|0S/@-P1SO-餓MsQ[0`J`V  00 0C0`>8AT/@ 0`` 081S.8AZ/ .Oh`0 !0L @0;/2 00  00q`P PЍn8APU 0R `0SNPXױPܡ  2/0@ ! * 0 0eq`P X㽱  2/ `0*j`P o 0*rXᦱ 0000@ :0<`0"0S0P0 PP0 0Q!R 0b0?o0c#"! 2 B P !  1002020 20C22S) O&#x>#1[  00/p@-@8aP 0PE 0Q"000P50001S 00S  R0 0 0S0@0 @@0p@ A-,2Q@Up` 0S 6v20z0u1 00$_V;0 0 `!`0  0 0 0 004 00 0(0001S ! !! 1 00C000C00100C0 Q v P g P!;0S :Z0S YP 00$P 㪰\W,0 ]ЍGrӀрO-PM`pDT 3RU 堼@u,0 \ *00 0 0P 0LP ju* #@T  ᠰ5/L h Q4p 3  2 @,@ l p PWp t x | " ဲ"/ⰰ0S00P0 010S >L0P0<P0߳w+p pZ20H0S@1 18\X@00#\t @p50100qcτ00P0P Q469390P0 0 ! !01P00 1!1111|0SG/1 !0|@ 10000000S 0P 00=P 00S h |& x p@0@@SC 1\0100Y 1<0SЍ3/rрR8_8_0] Ӏрр A-0p3a 8Q@T0S 00(p j081 0*pX^@x>03hl2/'@-@1 0S@?A-Q 2@s 0  BR A00 1@0S 3/dLo 5P0PS P0   1hS!!1 !   P01 P  !J>x @P0#ݴf0$ 0P+t00C00S   WM0 S ZLX(1S,1S |`V ;Y:La忔Ӏ8_8_G-@QdqMP00`P  衔& 幺P03P0(Z F7S  f>PM ^@ ኴ 00C0 : P0 K $  0 000P00P0Ѝ O-`pA000,P0   P   W| Ps 01P90\+ W !W V$ 0QU  0OW(!0 R (R3 \!Q, QB V:  R \S; Y.   PW P (1 S0(100C00,1 R0,1(10X 0C010Mu P  0R PĿPPu PPA- Pp`3@2::P@1@!<`JQPP   00@D@P0Q @@pp@-@P0p@S@p``FSPP  ^@  B PR / t0Q   0RL     / Q `r`6p@-P00@Tp0 唕P @`rp@- P0Sp8 P`@/0 QV & Pp!!0p@-P@@0$P0p`6@-@000P @@`6C-MP00`0p0 0` @Ӗ0 P 00 000 0@Q?o2P0S R0 Ѝ7@-D 0AP0PP0@EU Ѝ0588_0/`6-@-,00 ЍЍ/9_T^O-P`С,M @TpPP VPp P @W0 hP,ЍQH 0 P @3/ PPP9  )! 0S ,S0PU,UPP K R #b0S 0 PP 0x P B0 000!R00! 0V0C0@`r9_`69_S9_O-0p@!T?Tr P `1 !R  !1 `Vp〱唻 `10 V$PQ0T0< `  Q      Y@10Q@Dp0 +P* `0   `P 0 0 Y0YV `P `T@᭫ Ѝ`d]`r`6x]9_7@-P p 0@P X Ѝ0Q000 $!@ 9_9_/:_z:_-@-<00S 0,0 ЍЍ/р:_T^G-`2Q " @PpX  p$0S00SpQp @W 003/pP  X 03/p80S 8V$0S I0 0C0!R 00! 0S% P r$`X!P  Y0000000@0@@000000!00C0:_:_:_:_;_0;_`6\;_`r;_G-4Q4q `^,@T jK ټ@$0S- 0* E}<0P000@03/ P R00S $ 70S (0, 0 .Y"P<000 @ 0"  `6`rH 6X?р;_;_0 /$/@-@RP` Ѝp@Cꗷ0 0 00 0;P Ѝp@-Q`M P0 ( 000)@Pܹ @P ЍҹXp PU@ 0  吒@P0P S  !  00C0`r`6O-DMB,0RbS20,0 002@000"S2002000u xxطtBT:0(00p<`@PH"0  < 0A ,0p,`$  6t6;_6 S^wQ_d_<_6рA_&<_ ^,_trpyQ8<_]@- @0 400`$0 P oЍ]A<_Q]K<_@-θ$0 0S@ٸ   0`r@o/@-P`W0 H 000@P@ἸЍp@-@᥸000@豸@-@᝸00C0@詸G-`PAqT:pW @P P  0 [PP  0 0S  9P$P0 -Ph p.PP 7 80p0@@@d__d]`r<_R<_<_<_0   %`6p@-(@ P-0$00倻p@e`6X?O-M00p00g04 Q⨐ @ 8 00(0<8 T@7   ِP @00Sl 00 0Ѝ0 P0 S  ! 0000@00`  grPK PB@TP 6YZ  0P0 0@Pxz 0 P0 0(00$P0 5/PP  0 00 0 P00@00qPP  S vT 0BS  5R C0KP =0S Q |4PZ P<P  H&$0S0 PPP$ 0 YPPPU$P'0S P$Y `]  ,PPe  `(P #|0(0!R00! ,4 TT 0 P ( PP@]@0S O @ۏP 0P00 @PPP 0 @ `!$ 0S ,S0PU,UPP J R 0(0S[ PP厄. P@}  9P 4}P4}$0rS @  `0, ⚧P $0S)( Q03/P( P-U .  (S80S 8R$0S 0`P,8PP[ 03/ `0, fP`P,PP[ W{0(0 PP$ `03/P!R00! ^0Y@S㤀 0S ZU00(00,00 0 0 05`V; 03/`PP' 0 Px (`r2=_>_(=_=_z=_=_=_=_$>_8nAE>_m>_>_>_>_?_@_?__?_?_6?_?_`6@_@_8_A@_m@_Z=_@-pM0Pp0Da @T U 0S @T%@0S U  R 0S"000 !R00! 0p0@@@  P00@   Q     0000SŵЍ`rA-P`p᫵@P  dd@㲵Ѝ: @@@@ 0@P@0 ]@(=_z=_@-P1M`3A偵z?0` o00S /ՍP a@|Ѝ@ȍP.Í@Pp @@ 0㠴@P LEa0 @ 8@_р@_@_ A_-A_ 0 D`60p`6 0 0`60 0`6p@-`P㏥` P@00@0  @@0000PUp6/0`6`rp@-@L0PU  R8 00 p@d 03/P`r`6@-@70 f00Ҁp@-@@`P00 X *p@DҀs@-@`k0P000@ 9Ѝp 3Ҁ@-$@  ) ҀIA_O-M 0Y0`0p  XP)/P$ 0 $j~ 0  sP@ P 0 lЍ0$0 @/͌P@t3t#``=HQ 0  F@P Ƥ,3X0$0Y@X@  㳤p+ZᚊP`'@ P 妊/sPᛤ  @ 0 ᐤ`2V㉤ <(CZ` (00,0  ```僫@P rk T~(0@@P*0!R00`@" R1, 3 01(00 0000 0;0@P`,0S$ @ 5`(Q(Z  r'TX P P \x@} ؁`P @ $ 0Y0R0S`rxYD^^RA_i^wA_6iA_^qA_A_A_A_A_A_0  Sr Q6B_$0 0!0 00 /Hzhzlz-  0  /'B_/20C22S/JB@- $0 C0ޤ ЍrRB_']@-<0DT 0 !0  !p@-P @U00p00000P0p-0000/G-`@#202P̠ X4 CX$S\U  PmU P0 Sd pmU d 0 dGy]@-0  \X40SX4 0 !H0  !Ѝp|0@`V  l00[dPPPl00Ѝp@cd `l 000 Ѝp@d̀P/0 00@o//@-D@ @X4 CX$S\#{@loA-P`@p|@0 80000]ȣZA-P`@pi@P 0 $0000]ȣZo@-@kltPfl(@ア/ 0  0 x0S0 0l0 h0S0 0\0}?r0}?}r00<0 R / /6@Bx 0/6 0 v6@-0000(0( (0$10c003Ѝ]$QoB_6G-P 0$` T@`FH0 00 p?o2P0S 0000 0mP0S0 0Ѝ@-p0 0  ^8 0@0000@00C@0Ӏ@Ҁ@-@TZ0S[00[0''d@ p@-81M@T-  XQ F 0  P@@  `  t!00P I 멷0 x0@Q 0l0300@ @@ DDЍp@ئ]ӀP8Ӏ0u@ҀrE_0?QF_Q1_0O- a 000p(P$@ @A0찟,00 000p(P$@ @ @PA/0,00 000p(P$@ @ @PA00,0`0 0X0000p(P$@ @ @PA<Ѝ@uhQF_\8QhF_'F_Q-F_000/00CS0 HKp@-@$P,DU ~Tpp@(xӀ A-0 0 2#@T 0PSpW Ax$`p0S RpP$ 0RA~@TAFӀӀz@-M`po@P00a 0 0  00@00T0S@1 0 0S v@Ѝq 0S 1S Ӏ@-@P0`0a 0 0  0 0 @00T0S@q 0S@Ѝp1S1S Ӏp@-P`d  0 0@0T 0R0S 0S @P4Pp@QG 0SӀӀ @>D 0  !"P/ R0S//ӀQp@-@ @PXTd0P1@0P !0@@T@IpӀp@-P(@p`:pӀp@-`P+a\ T `@00  RAP @ppӀӀ `0S  0  /Ӏ 0 P8p@-@Td0QDSh h h0d 010Sp@p@zӀA-l0P1@Q`p 0SR 0 0 0[00[0xPU1T  R Z BRQV [  [  pP0CS 0  BR O-S0@` (ݖ`ٖp0Y,#0 0+Z  R` R8 LP P`Q l TV7Q R pP Z RL  \d PW ᝖ ЍQ@ZSP0QS  Rz Pv QV >P(yoYQcVZ U Z RY Z&PU V000 ` @ $   1 00001- [00[0`0`p `p  d Rhhh d!QPP Rdd h@hu PVu $V (PpPIӀӀz@-1PM?@?@`pL0P?oP20S`ߍL 0RP S@0@6/P0S   0Ӏp@-L0@3P1S P0 00S/Q000ppp@-P0PSA,00S 7aPpǡp@XwG-0PPpa|@P @T P03P0!ATAU ᢡYL0<L0FWۣTG֣ 0 P80<P80@OP8s@-xR   @ F8C | (2(BRG !"|0 ! " 0QQP1 #"10"RR"Chh0 1d D03/ᡣ  0 R0d1`0S00#0H1``0S/00 /0 g/6& *P 1:g@ 0}0`0/0? ?,0l`000003A߱t0*|`qQ4  IЍp@Yry_6_oP8p00p0P >p00p0>p00p0[>p00p0T>p00p0`0t0<1x0呞匞呞匞凞办嶞(0B(-R #ў- . A. 001Vq1`00` Fd`y>1 1mR| qV|00 0 Z &h!Z|2x1[k1"04P B+ 000 0zQG 1 LG0/h2p0l"/`2 Z0Sz pCSWppp'pr00 $! ! ! ! r"&" 0r &0B28b0V/p2t"0 0p0`00` d` > 0,h1P=p00p0T0000 0S00@00ip0j10S  bF0V100`00` d`=00  1 |0 S)W 0@DHLPTX0\ (!@0@J0@0,!D00D00!H00H04!L00 L0^{ PNZ{10S7 $0 |01f0010 0Sh00h0100Sh00h01F1 0=[0 100S R  V 0X00\0`00` Xd`r=Z 0BRS000#0s-( (!!( 0!!0 *00X 080`00101 01(01(z` @"D !HL  $ (,8"04<(X0h\ l00  ` p  R00=9B =C00P20T2Ѝ0`` d`< 0` `00d`<$0` (`00d`<(0` 0`00d`<,0` 8`00d`<00` @`00d`<40` H`00d`<1` P0d``00< 0%(0` ``00d`<q qqqqqqq  ppppppppp1p00]]$]@]T]`]@B@-`P@v1S0 PЍpwP`L0 00000 00PP v 0ӀO-Q4MX@dp|4ЍOs8QT@@Z`PF J[o@QZ6 @PG >0 0O0$@ 0[;00 U@ T VJ 0 Z 01m1@P0Z@@y 0}ṏ6  l@P DATy j@64ЍuV 0X01 <1@P0X@@y M6l P% [00 @@0 0SP@ 3 VJ0700Z0 CSRL0 @꒟ gP@0J0 2@P Z$0,0 0000@0 00 0p`5@ӀXQC-M p @P0S !PU  A` 0 's@P`P Ѝ@@-@*0 000 0@0ӝoЍO-LM00|0 P<00<@3ppU#`v <0 p|000xtpLЍO:70 00S 0S# SV000$0`0S0000$00S 0U `V U00=0 V$`U@ 00?05 㔎P ㏎1L0:p@ 0@A400(0080T(0Ss |:ATo 0(0L0SZ0S 0 000<0@ 0@P ! @VPQ,QHQTQdQQ(Q4Q@Q` PP110$[0y0S 10 R 0S(0S5 0S0p0p@,0$0Z,0 0S0R0S$  0SX ! 0 000 w00 w wX 0 000000000 0 0$0$0(0(0,0,0000040408080<0 <0@qwH0XH0L0L0P0P055[0[0T0T0Z0Z0\0\0`0`0 d0d0h0h0l0l0p0p0t0t0x0x0|0|0000X0000000000000 0000000X0000000 00000--....////1X1 1111 1 111111111 1 1$1$1JυJ?X$ 8181<1<1@1@1D1D1 RRJw1 1BwX 11222/X22!2? !. (2(2,2,20, t0Z 014 <.L[ ,0SDS 10 Ry ?R Q 2Y,1, 3( P(00 '9 xv0 90  90 90 90  90$ $90( (80, ,800 0804 4808 880d d80l l80p p80x x80| |80 80 80 80 80 80 80A/A80B/B80C/C80.80E/@8@0F/F1080G/G80.80N/N8<1Q/Q<1@1@10w80/q82@0@ 0 Di80e8(2/(20^80, U00C040 040$0 0C$080 080,0S @T00 V0S  400C0 08 S * @800 U=0 2 LЍ0S   @ҀӀ1`00/1`<10/1<10/p@-@$PaE100pӀp@-PP`@7V11 P@ 10$00@gpӀp@-PL`@V11 P@ 100@OpӀ@-@ᢗp@-P@ᚗ噗p@-@ᒗ@-@Ꮧp@-P@ᇗ冗p@-@p@-@`P᧗ PpR0p@迗pp@-@Q0` R`00p R0Q`R D/O-MP`8嚙p^u@;vux lM  -Puv\)P ᘙu P OO널IiO Ox vc _  P @ P  0 媙P[  ЍޖPvx֖P IΖUv ʖPx  ῖP  ỖPᲖPx|uvr ᪖Pn ux᪖ c  ᖖPf   ᒖP_u ᇖPv O-MP`8Ԙpu@'vex :  mPuvLiP Ҙu gx fvg c  OP @ KP  0 P^ i Ѝ1Pvx)P ᖘ-3UIv Px  P   PPxuv P~ eux s  Pv   Pou וPv Ao@- 0  x Ѝ"0@-00 n Ѝ@-0t`q᭕@u᪕Pᥕ$0P 000S Ѝ7@- 0   Ѝ"0@-00  Ѝ@-0t`qᄕ@uၕP|$0P 000 Ѝ71L0#400/s@-@`ṗ00 0Pᖕ@PЍp@᎗Ѝp@-@PT@#D`qM1  s WЍӀ0A-a(M 000` 0P@P p0 Y@P ?T@(Ѝ{1P0 ` $0R  ^P 0p0z/`00 0 00>Ӏ7F_(0310S/00S/㓷<@-d03" " R @" B"2S @'@T*P p@-P@Tp 㝈000000@p@-\03Q0S m @T 00@ よT?pG-@`PT1 TG TGUE h1*FRA:0CU= bp81P3  1 0SP|% P$ V* W%003A } @T@ 0V00CS  @G@@  @00E @(vA- P@`N70 0S\Z0S=Ɍ ͌pWX 0 S RQ   ЍS@-M p@`P 70 0S ^0S PQ S 00U0Us00Ѝ@-pP`#I@P∀ 0 |0| 0 00 h0 R\0Q VK%~0 M$3SEz^̀2̀YH0@-M 0000 0@R0P     ȢP ЍBA-@ `$P B  pyPvUV#3jPiU V VX031S ( ,02 0P03#P qp@-`Q3 OoBBP @H]PP0@p OoBBӀ@-QM`@P0T  R 0@ 00 0@`̕PP PP pW pWP ЍMO-QM@p帰Q @PH0P @@0P 0唕@P:00CS@5 aL0` 000 0p0 00P 00 0 0 p}+0@?o2P0S` 00 0c@P 0SP000P0<J Ѝt]O-QM⨠崀:p0PS5` 8@P0 @@0 05@P⒟ % Ѝ 0` .p0"00  P 0 0 #+?oZ20S@ @@O- DMPP 0!@/ Pq B,$o 0   0,p(P$  .0 000@!. 0 .  4,p(P$ @.+0$ !00/>t.  l.00 0 4,p(P . 0!0. 0   40@,p(P$  . 0!- 0 4  80@,p(P$  . 0!/>͟ 84 0 0<0@,p(P$ . 0!/>4, D40  0<8@0@,p(P$ u. 0 !, 0   84@0@,p(P$  _. 0!/>x̟x 80  0<4@0@,p(P$ H. 0!/>$ D0  0<8@4@0@,p(P$ 1.0 400 !+ 0   80@,p(P$  .0 400!/>\˟\ 80  0<0@,p(P$ .0 400!/> D0  0<8@0@,p(P$ - 0 !* 0 4  80@,p(P$  - 0!/>LʟL 840  0<0@,p(P$ - 0!/> D40  0<8@0@,p(P$ - 04 !) 0   80@,p(P$  - 0!/>4ɟ4 840  0<0@,p(P$ w- 0!/> D40  0<8@0@,p(P$ _- 04  !( 0   80@,p(P$  H- 04 !/>ȟ 80  0<0@,p(P$ 0- 04 !/> D0  0<8@0@,p(P$ - 04  !t' 0   80@,p(P$  - 04 !/>Ɵ 80  0<0@,p(P$ , 04 !/> D0  0<8@0@,p(P$ , 04  !\& 0   80@,p(P$  , 04 !/>ş 80  0<0@,p(P$ , 04 !/>| D0  0<8@0@,p(P$ , 04  !D% 0   80@,p(P$  s, 04 !/>ğ 80  0<0@,p(P$ [, 04 !/>h` D0  0<8@0@,p(P$ C, 0 !4$ 0   84P0@,p(P$  -, 0!/>ß 80  0<4P0@,p(P$ , 0!/>\T D0  0<8@4P0@,p(P$ + 04  ! # 0   80@,p(P$  + 04 !/>Ÿ 80  0<0@,p(P$ + 04 !/><4 D0  0<8@0@,p(P$ + 04  !" 0   80@,p(P$  +8 40/xx! 0  <0@,p(P$ + 0,$4F! 0 <8@0@,p(P$ s+ 0!/> 00  0  4,p(P$  @\+ 00/! 0   4,p(P$  @G+ R1_eF_ERmF_(5R._vF_}F_F_3RF_F_F_F_F_F_F_-_F_F_F_8_,RF_F_F_0! 0 0  4,p(P$  @+DЍA-AP,p`0S S% S=V W@TAV NP )@0S)T @D@!d0T@V `)@\0PU L0S fP1T@PӀ@ӀA-`Qp@N0S S0 STT PUQ > @w,uT P= PU@.$ @]T"dPT對0PU L0S 复0P CP r@:T ,5X0@,@Ӏ@Ӏ@-` V@Q,  ;k 变Ѝp@-@P80< 00 #3  0 0 0 004 00  23 48<0@S- 0JHL 0 P030 0 0S 0 @0 D R0 0``#`0  00000 0 Ѝp@O-`ᑿ0|0@0C0000   0 S po0?C-@`Pᰐ1qS21 0! 28. h R R R ' —뒌X0@00P0#*1S0Ap@0 0@00002S000000SP ЍCD000@=G_@<@-@q0( R (   B "R    B \!R A 4. R Ѝ!R b /o" Q AG-0@Sp00SW GSP0` 00Q2@E`　T`W p ៚W 3U  GёݑP 0S<@vp@-@P p@//// 0\ CSR0d 00P0Q#7Ó7P00d0\0Bp@-TPC‹%0C0\0(@T@ 0S 0ABC뱋Xp@- 0!0@@0  /aG_0/000S/@- 0 00| ЍYRB_bDv]00/00//O-H`Q@S 0p0202  X0$E3" B"2S1 ЍOp `00S<<0 ݙX <0 40<V 00S 0 Ѝ]G-0P@s ppD EY ᵙUPX<`P WVV `XD 0G<D0 XD0 QA-Ppp `D0@c`  wTD@A-PD`@ b@V`<pX0# R@ < S" GV@0 A<;p@-P @H0c   00S@MDp0 S pP/0# S/P/ 00@o/P/P/ /p@-@P z@0000p]Ӆp@-@Py@P 0000p]Ӆ^@-@D ^PC@z/O-1p {P{W%ȀN@ \[`R03/@ Ѝ @PR  03/@ 0 @O-1p {P{W%ȀN@ \[`R03/@ Ѝ @PR  03/@ 0 @/00/0@-003/ ЍC-0`M00p@PUЍ 0R P 0` c0 P 00 000 0@?o2P0SH00S 0 00,,ɒ03/P 委EPv]G_G_@-埔G_@-P P d``宒PTL婒 Ѝ (,埒嚒EG_]G_ H_@-e厒]H_@-@ xx兒t4Qڀ  !P H@, ! i]8H_HzhzlzOH_A-@M0s' p`P@T#0@400000 ,00(00!0$@ @ @00 000'>0<0!@P h@@ЍAaP p@<0W(0 00PSPPvEXFREA- @M,L(1 000p<`@P0<0A0,p(`$  !0P  @Ѝ<     '.A 0 ,p(`$00 0! P P\ؑPT@<`PppP  ̑PU@EkH_]sH_PvH_H_XvH_s@-`P 0@T4T0@T  S  0D 0 0 "P $Ѝp 哑EEPv,]I_h0#(1< /@ ρP PQ00@0!!#/ 0S(0, 0 (0, (0, 0/ B@- @ ΄P 0S,031!10Pp@-P`|@Tps 0SP0 `00C0}A@- tap@-Q@Z0S P0S00C0P0 0aH0 Np@T \/ Fp@-@dP@F?p@zp@-@803Q 0dP 0 0/F*jpp@-@00C"0!300 P p !A\  Q` ka000PUR0(00@@@#p$0P @- /F0S co `/P0`o@`/0@-@0M 000@0@@@50xP 0l00@0@ @@x&DPN7 07 ((Ѝ0@MRI_ԀI_ӀdRLR1_p@-4` Q[ ZpT0妋@  0P8+``Ԁp@-@[@ZPp@u0p@ 尋Ԁp@-4`8SpP0P u@  Y+`084@p@Ԁ0O-4`@ q@0D0H0L000000000111 1P    @@D   Sတ 8  S%  0 Q31?Y$ ( , 0 4 P00P00!!!! !$1|0(!,!0!4!p!!!!!!!!08 0@Ӏ<]p@-@T 0 R X0 PP T x 3`0000@pt _0Ԁ0 0S/0 ԀG-PPp@U3P @T( 0`S 0V00 U00 t  _V  0W` S `0W P x _0p0p@-@0PQp R00  㟊Ԁ@-@P`P" RS . 0 000 00 000 00 0 VPP  E2 1"  yP0E"0A 30Ѝp0Qp@-!0 P`00SpQ LBA L ^@P00000 00 0 0 00 00 0 0p@-@`P|@Tpg AG-@Mh04`pP(0 000"!       P0?S$P(P,P0P4  L0QQ 8QQL02 SR|0p!!!!!!!!0S Ѝ<]@-Pa@> i?,10!(1T00!41  1 00000110010 0 p@Ѝp0D"! 0#@0A-q01P0c?@0010!(" !0 & 0`0(0o ᜓA(10101A-0P`q Y( @T  0 @P 010 10010-A!  !!! 1P $P pA-@ 0S Pp`P0 8P0@0D"0!!#  0SW00S@ p0>S?, 00CS',]RD]R\R`]R`]R,]R\RT P@G  0 S 0 0000@S P@@ -@@O-Z0M0C21@S FP4 q<00Jp"@03 [P`+ q`P -PPP  !QP PЍ! 1 0S P 1PS01ą`$ 0 00 0  (  0S @1S Z RP Rp Q+  忿0P pQ   BV 'V  `P [0  ᤿@P7 gPP= 0 B "Vx1Sp` 0.] 0p!x!ZR|||!xuZ0S*P0SU <|@T@P`?o22PP V Z  R ; 1UP0/1P0X Z  R  ZS 0Z0P0U1P0Q 0Sl 00C00 0P?o20SA Z1UP0 <]@ԀԀG-P葐tp@RU" PX1@T, L0S` ZR`@ 0  ``唁PX Po@T PdЍ@T\U `0SL`` 0  ``dP X Z0 CSRxP:d@Ӏ@Ӏp@-xM@?x ` P[0U0000`0 0~~(0$(P lP, 000P0 KxЍp@-P0@1P00Z00l 0000l@ A-`pP@T L0SP0S@0SPUAB2Ӏ@ӀӀG-1`pAZ0PS&\W Pqo0SP0SP;0S|PP0S G0 fQU 1ӀӀ0@-|M@t PC[00P4 o|Ѝ07@-P0@60#R00SP  0$100\ P P P $  Ѝ0@CA-P`p@TW [0  d@p@-xM@`Pt Z0 0 0`xЍp01 10/O-1M`p0ApPpXP0  @4aSO54c@㇒) l 0R[0"? R (`pap0` 1RZ  PZ 1 ` ^0% ЍO/0G" 0# ?o\20S d20 d2ЍOYP k` 0 Q 0 0  2|wЍOsЍӀJ_O-p1唑|MSA僿P0  `l^XO RX弋%@S8|ЍOO R (alS E t Z0! Rp 40堀尐1!` p$IZ0  [Wphp`0STP 1`@T 0c/ 4/|Ѝ7yӀJ_p@-@HP`50S p@@!p@{ӀO-`PA$MZ0S P R 3Z 0 1SW [i?Z!00!00000!00000!00 0000pPWJ?Zn @3         0000  00000 000 000YP'8P04P0H ` ta$ЍfP @ p `3 `X2         000긕@  5@0goG 0J"0!!#V p Q; p0` 1R\Y J2  p  RT Z [ [  l P V1    ? ᰠOP. `0 !402S S1 pX 㨑X0HL1`0S" W[0  lP 0 E?ⰠP0  1P0!\Z Ӏ<]A-`@Q` 4R{pX2! !! ! ! !! !0 0F"0Q!V31 $0110102A<]p@-@P0` $׈` 婇p@ %J_J_@-APP0  7P08P0ǻEw׉  oe!p' :P0|`V0S 0 00p 兀00C0VP08P0a7P0去ᙻ/000X X 1XHqL1# .+P"  03/`400S$ P uzz?V` 0 `UP0 :P0P`LEP02P0V P0P<7 P0P000# #$ "X  q {P 01 QP 1402010S   Ѝ<WP0 @0P0+00l00 W+P0@ #F<]A-P@`pQ 0嬀S @TAp@-@P Tpp@@-@ᙷ0S ,0R@褷P0@0P0@腷p]p@- @dPVʀ0!` 0X P   !wuTU pHzhzlzpQx0tS|0|I 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzG-pc~ࡖ 101APU0 0 0 0 XP0 0 0 0S@00:#003/G-@`pPԠ ,1{?R 啃@P @ zO |fP`P\00S 0x,!##)" !qaZFxJ_R0>00J_]…_K_͓^ _@-L0!C !!R@ 2 2~P@~A-l0,q@0 PN `  0*  @X @R X A  Q ,1eP ,1! / x/ / /@-K_////p@-@ PN  NpӀ///N/-////@-   Xo Ѝ@-  Xo ЍQ@-@ @>P  ,P &K_-K_@-@oNP @裥@@C-@QMPЍP`pP PP M P@PP元 D0a0CQ R P 5R0@pDPP lMP hMP 0 aMpPt#MPMPYM0y0 cRY0 0@ÑNM뉙! &ခ"** 0 ?M@@LPL`^=K_]^rk_SK_YK_z^^IK_A-83@M` TV 0  n30S& OP B0 rs #XOPP  Q0"0 !& 0! "Ӏ @PPLPC`LP>PLP9D2,b0`zL@wL7:!#:  : 000@0QjP1dL堃ULPLP LP?a⋃x剃Ѝ>@DT>Tz ;L ^O`Ps2LP/L0 40 0000LP!LLP EVPP p y0 p;w`k PveV`)OP =@2FTK_gK_rk_^sK_^T^zd@nK_O-@0pSM800880S NP8 830: PP>@2HPP t8lNP0ST KP//00 000 `@ hT KKP KPKPa 0ut?oT20S vK 0v00LQگ0 0RA*S 0 0B00 0+PP 0 00 0"PP & $00CKPC 0"YY AKRP0/t`P;Y H&0 *t6 006 #:: 0( ,0 `5'86000S ~?CS B:/00%000b#a 1003KP.KPV0NPG   (00`P l", `500Y7L H~0sP8 $MP50J@PcJJPJP JPP4?a4PD`D R MP hPP0MPP00MP 0G0P D R~30S ~P0MPD R 0~0h000.{~p30S ЍPTUET5 YJ |MPP.HJbPdR)yJP$tJP?J0w0  cRW 1J 106!#: : 0000PJJ 6#::0J (0jPPa& " I@PWJ@IP)JP x$JP41h?a*P1 LP p}PUv^ 0P0000i_W_rk_^^K_K_K_TK_K_K_e^K_K`^z^K_]^YK_K_L_X?1_gK_ L_/ p@- @RP` x0tPS|0|Pp@Ex0Q0R h R t|0 p@tP|0p@-鰰FCL_p@- 0@SP`pPWp@S h0S p p@pPpP00SD0P 800S,01@o/̀YY 0!< 04 0 (   !/Hzhzlz7@-h@hhPu \00@0)U D000"U ,000U Ѝ0QL_WL_`L_xL_5_G-p0`P&4P0Q !D @ D0@ 0, ЍGtЍՀ]O-p0PtP X0`@ Ѝ 儰%40c!D  X@ H0 @]0 0$ X@0˿Հ]C-@0<P  ЍC(TP`  (p <0P.0$ eTP ឿ Ѝ]D00S/p@-P0` D@c፿0 p@̀ՀL03"R  R P2@@-/0#202/P /@- @PR\0M( \ %*Tq R!0` p0 02220l0ܮ@0#0$@01S3x0 02P22 0S P @pSeTTp0 0 0SP 2S(@LQ222@0#0 0@0ᑜxW282vDF@-0C6@ @-(0C+282@G-pȁȡCRU 0S +Q t!@0D0@0D$+2@ +dVʀ 0! $!0!!   !0S0S B 000FP10 0 0 ᇭ282202+20C2Hzhzlz20C22S/|@-$02020CT@-P@[0p@- @0BQS$|RĪR|RPRĪRĪRĪRR5@ ?0S Y000 R 0 0p@*P08P0000s|{2R 0 0p@-M0 `'0 0Pp@KM_A- 1aq@T. L0SL00 7@Z R  BRl  00Z0|PU 3S ׬P0 P R {Q߬8@,`T  @AeӀ@ӀO-$3$#$c[3$M10100S0#0嬼2@T L0S壼0p|P0U0"W50a 0S0z/` 0Jyʼ@P0Iz40\ 0S؃0$! 0Pz/ 22 (y40T000T00S P0  0S 0CS _0!Q500 ) )Qd00500pQ0S,0 P: ^:pz_Pp0` y`0 [xW   M0S L^rP$ЍOBdd 0@c5T50D3vX?Ӏ@Ӏ{M_i^_2M_M_M_ ],P000@-0ll@lP R P00Q# R" 0RR 00oR,RP00G- @`p PĀP㰀尐P᤻PU߻U@  `R0s#0"s#R Q0Vs# o,RRӀр/0$ R @- 4/F 00S/(Fs@-80`SP 0 00h,U`@P  Ѝp @P ,OHP` JH0`0P40P0 R8@0`m N_i^^M_@-0 =000404  R4  000@>1t A 0st@@@ 0 P 0?P8D. !  11W000PPP Ѐ 0 ( W# W W 000P`1PP0@p400 80<8`PP  8oYߍЀ԰10804 P00D0p<0,VP@B>P H1R0!sR u oPP1 00 400@ 808`cP8` `404SR40 8✦$@TR4`S~o` `0Yp8p @T2o@P @jPშ0Sp1S X@T01X0| ;Q@Pt  ?X@070l@ ?00 0@0QS P0S p0 0R  R 0$0S !0(0, 0P$0 , a?$0 ! ?0$0Y 0(0 0 0S[ X Q B & 0 0C 0! 01PB(     P0SQ 0 P0S@nsP 0 0tO_O_P_O_O_-C-M0000P Uy 0  0 !0s  0PE( 000  0o@P iT@ЍCЍ/X X` p >4X001 ``\    p @`$0$@VBPP804 \@\CRQ f%PU Q@R0 0P,@@`  R XP T0@:$Q@P 0$ X> 0 X@' ?@A-`t1V`04S /nAPp`8@T 00S8@P @4p0p8pPPUV  0P 20p0 XP *Xp`@4 802#T*0 R0 R P8@hFv?P_G-P0 m0 p堀堐堠 RGm sA S shmT  m@m@0p`C m@dP_)_m _[^P_P_O-`PM PU (` = SʦȦ004Ѝ    p @$G 1( P,00 00R P 0 10P0 00`0 0@$0$ K 00 0hFC-` $MPS0@@ 0Yp00H0 0D0@00@?oV20S @T @@U00$ЍA-pXP@(`:m00 T @ 00$R01 @00-P_Q|J-//0 R/ 06S/`WvIJR@- 0 DX ЍHF@-@0 00 #3  0 0 0 0 00   0 À/ʚ; 0 À/@B 0/Hp@-P@03/0@0pp@-dP@0S03/03/@p Q \ *@$0X{@-@=@-@000Z`Ѝ@@-@N Ѝ@-@  Ѝ@-@  Ѝ@-@TpM00PP`  0V P0SЍX{@-@  Ѝ@-@  Ѝ@-0a @E8 01 0Q1*S10Q0 0kk`P⏬0 @$00R000R 0P0*03/03/@iX Ѝ@讬SD  0 0(okX?0P_Q_HX{H2BQ_c0@-0@3HG-PK1@ R儬R$0$ $ 0S2. p崀0⬐000 0l`s~'@TbT h0h00"#O"?o2W0S A$@HX{HӀрMbX?}Q_0M0000Ѝ/X{C-pa0,($@ @ @<08 ZDЍQ_RQ_C-Mp 0@P`` 堐?7t0 00  00P 0 02?oY20S 0S0ńЍ80< 0S 800< / `p@-@ᱩ@0`0@0`,PU 80< 0 _p@虩_P_@-@PP@ M@-P@ᆩp0S 444a 0S@0 Z( 0R0000 ᪩^0 a㠖^ 0S 00"#! "#1^PB3 $103$!Oၩ0 3/<0 00000@000MbX?@-gQ_0p@-`Q@P0 20`, fup20` p@eQk_+_0H-@`,M0P0S@ XX$PU? ,ZU80< 0 80< 4 `P @ U^H D?Rp pӷ1 000P1D H墕pҨW  a !0  t0^@0 #^p00 0P00000p^p/埨0Sᚨ 0R 0(0 0 ,P0$  R 0(00$P 0Ĩ/P^弨zv Q 0   P^&R_.R_LRX?;R_C-@,MP` V0 $0(  ,0p@0000 HPD` @]?U  t000000 T0 PP ],,Ѝ+00^eDR_MR_8Rp@-@`PPK PpPK00p@-@X0M 0@0@ @@@ h^  00@@Ѝ@XR_H0SA-@p`@T!`\K Ps@P `TKH0V P@̧@0T@SP P0PT TPX0\ P0 X0\ U `0K@@H V P@H@-@l壧X0\ 0S X00\  @@اP04ST T % ЧT@`K0SA-"<p8`}PU 帧J0@!`R R0S eRJ Ѝ0V PVP0UPS 0 |0@ 0@0 T0 0 偧T >RJP V PH$RRRH@-@p'0 0S 00  @D\08S   TTR@Jp@-@QPQpp@-@PHR@p0-@- p@ 0P` 0c0`00P\PЍ@Ѝ/s@-P@٦00`V `=\ 0  0Ѝp@t4\RaR_p@-@8P峖 3 $!–- ]00p0S/p@-P@-ᤦ,0S  (0 0@0(0\p@Ԧ0 0R0000 000 @0S  Sp@-0P@0{ 0R 0(0 0 屦-P\pp/p@-@PPp0Sp[@-@X0HSi@ ip0S/ R/h l00hHD @-(+ 0   ?0@H@SD0 ,P100S//@O@A-xM p@TAxЍ&Rl00& `吀0S p Rt00CJQ0S\00\0x 2t0000x0(0\0\P0 ӀH0@-P0 4MQ003#:@ 0 0S$0 ( @P0S00  00U  0@T4Ѝ0GV0 0000 0@0WP H0L 0P0S 0003/(@ʚ;H0@-@,Mh0003/80< 0 @0S P00$,Ѝ0@YX0SP 08jH \00\0`0SA,Ѝ0'p@-PH 0@   S+0S@)p&H@@- 媥P@X@-@ hP _Ѝ \QC/ɚ;0@-@MP ^P0 Ѝ0P@-@ P P0 L0S003: 0 0Pʚ;ʚ;@-@ PQ  _ЍO-`DM00  0hp%iPP <UW 0 00 PDЍ 0S0 0W@0@C@0 #PP ?o2W0SuPP ThPP 0$  0P0 ( BR %0Sk) ,0 0SHUgP ʸPQ( ^0S (0 AQ 0S00  00S000 PQ ^0Q 0 AQ0S000  00Q00iR_ʚ;0@-@,MP ]P0S00 0EPQ 0 ^P,Ѝ0p@-@(MP` ]0P 0S000$ PQ 00 00(Ѝp ^0P @- R R S12S1`01 0^ Ѝ@-0@SM 0Q  00t^  0 i^P Ѝ0@-R@P$M 1` l%aT U  8]P  @04 S#*/00$Ѝ0qR_@B@-0 ЍA-@QP  z0n0!/`Ap0 /R pW=) -` p`嗣USP0 S00 10\00 1 p 00 00\ @@S0P S0."? Ak6H@BZ{c /H?B0p@-0M 00000` 0PiU@PP  \0P@0S!Q Q  ]@0ЍppC-P `0EQ@P XP\ ` x HUp0Sp0 0@S((0,0,0p0 pt SHH0`0X00CS/@-@8X0S000S(0S, , " @@-@X00CS@N0@-@00S &R, l00& 00@ FHA-X0@0CS8UPH0L 0P0S  0S'H0L 0P0S 0S H LHPL`PR3PPpX2\C  R  @p S@0 00TTS  SH L HLP H LPPP QP H LP0Up RH LPPPL\P RH LP0 R  @HH LL RH LPPAQP R H LP0@ʚ;ɚ;6ep@-P^H0L A 0S PH0L P$0NSQP8@<`0@0SP0 HP80P00SP0UZ, @T` P H@L` 1ppʚ;@-P8@X0 CR3   R* S x0 RS ^0S 0 AQ0S00  00 2S0 00!Ѝp 0S 0ll RR H0L`00P` Q00 ʚ;ɚ;6eA-@T`P9V`8  0((bS \J S HL PH LP Q H !L P R 0@ 0aS \/ S9`p1S d`$V0SF 0SC0S@0S=0AtDHLp P Q 0HLp P Q 0HL PH TLP Q H < L P  R  0 Aɚ;6eQG-PЍP(0p`V W`!DX@ p 5/PP Dp0SSt00C>S Ds $\RmC#P0SRX Wp W xt 0xt00  0xt00W W @ _ 0 00⌠A9 [Ph]@-0 Ѝ@A-1`P F?o2!R0S0!RX00CS 0S 0SxxS 0kHHL@LpH@L@PPp^P@HL@P0ɚ;6eG-0M`P0p @?o2!R0SPdP dP뤡P`AT 0ЍW 8H0L 0P0S@ X0 CRV:S H L0 H0P L0 RP (0L00H0P0 LV oH0L 0SH0 PL AQP0SH0`0 L 0P0$ P0S p fS0 $0ɚ;6eʚ;p@-@HM` YP P1U(P0 0`PU ( ZHЍpA-p`?o @2!R@@TPP,P+&@-@ M P Y ЍA-1@p0Do!S``V@P1S0 S 00Q)p@-` MP@0S PP  0!  Ѝp 5!!04 ?A3c00?A3c0/Mb0@-@Q$M  + P Y$Ѝ0O-QM ЍP`cPc@Pp0 0[W 01S 100[%T B@WBpU0 @ U 0  0t pxP 00匀P@@Ϡ0H0L0P #0 RQ @ U U' p IT A*H~cP H L H PL  QP H LPɚ;6eh]C-`PV@p,M0S,Ѝ WP0S K p00PV10S/p@-@`1PU V @T h00P 0003/@T ,00P 0003/p@T?p@-@`Pӝ0SpG-1C0(qƝ@@XP`X R00G 00 CQ;Q Q 0d 010d0 0 01 C40dC?10d8 0C?Q C80d?10d0 0?#<d?10d8 0? 0000 0 00 奝 8/a @R 0@VA-0p @P  0 0S0 0 \00X00\0@\@Av (aU0 000000屝P ` 000000\00X00\0@\@UO-@`pP0T! 3R V"0< 00800 80<  m 0 `s 0t ` %W  ЍOߜ0p 0 ` 000 Ѝp]R_@-e<0 XX \   ` R`d00(@-(APT2 (@@F0-XX0\0 `0000Sm p0  zY ,`p0pp10 \ nY L0`8e1:xP(A Ѝ (($0P[R_R_R_D(SR_ 00(1 (  S !$00/00/A-@p`Ptp ` Ap@-P@i p@p@-@a0 0  P00q%pp@-@PP0 0  0000 T  ,03R pQpp@-@`P/` Pp@E@-@(@@$A@@-@0@@4@-@@-@@@-@ @$A@@-@000@p@-t1(Aӛ 0XP0 0!` \ \\dPd\`dP:C$ `ȑC\ \\dȑPdȑ\`dR&C!*`\ \\dPd\`dQ#P嗊A威80S-ЊQ0SL`PPULV0\a0PPJCT1@0 X (v0S (PG宊T1TG! "G= @0R:<R0P!``!6/Р8pW 6//0t"#0? 6/Tp3/P0 3/P` R0T0  -HMb ^2?X_i^_^GX_X? TT*X_]^T^$0$$08S 0  2`SHHp@-@PH T 0S 0AT 0 0 @9p<@-@Lw.G-P`Up夀0S@ 0 @T 0 0d0S\0S #S`0S $0?ᾉH<IG-P `p@POH 0S0 010SH 10SD GVCBH=yI01,XJZ#}0 03/DwL\?0岉1 nP`嫉V<04H; 1SH H -IW 7/pP 0R  P0 4S 0S pX_H̀X_IX_H IX_X_A- Mp` P @P 0 P@ ЍU H00S <00S \F5/01,HH̀]^^@-$M@P8 `p0 #$Ѝp@-PM ` @P 0S0 0,0 03/8嵈00\0 ? nЍpHIH L0)-HG-@pᘈbP0S`PU23`0̈t刈0 0 \ˆL倈P`P>8廈P0=PP 岈Ѝb 00 0姈50S0S<0K 0SH 3/PPD0e0<00<0Mx!L0,h凈>4P 0(0S 3/,Y.0S  $H.0`0>h 0U0C 0   S($0S%p-P  FP  0R P 0S0 4S  +00H<I^X_p@-@Pp@>@-@P 4@-@P +Ѝs@- P`@P 0 0@ЍpVGY_@-@P @-@qP@@-000 ЍWS@-000 ЍXS@-000 Ѝ [@-000 Ѝ8 [ 0Q/P /@-00 0P ЍWS@-00 0P ЍXS@-00 0P Ѝ [@-00 0P Ѝ8 [0 Q/S/< /< /0@-S@p0S 3/P <00<0/<   /0@-S@t0S 3/P <00<0/x0S //x0<0pt 0<0/0p@-@Pp0t0<0`0<00Sʸ0Sp@+==V<@-@0P|0S@/|/A-`@ӆpȀ<0P 0S#Q003P0 000+<00C0 =p@-@P᫆00CS00<p@//<0 0S /0@-S@0S 3/P <0 0<0/<  0@-S@<0 0<00S 3/P/0S //00 000/0S/@-@3/00000/< 0@-S@ <00<00S 3/P/<  0 /0@-S@0S 3/P <00<0/)00/0S/@-@3/00000h0S p@-@`Ph0Spl01S 3/P/G-lP 0h@S qe)0`S0Z 3 #pG Shl`T  P) P0!!00A-P@l`hpT1S S@ R Th@l@A!)1GQ @p@-P @P0P $    $  PU  U p@p崅Q P  80R 0 Q P 80R 0 <p@-PR0 0S S, S@@儅p@P`F``V80S@@P``` 0V80S@P<88@T V p P0 W 0 Rp@T Vp@V + + ' f}0 ST  `ۍЍXT 040 0 G#P@03/Z_Ihr`Z_Z_0/0/0/0/p@-@P0Pp$ P p@-@4P 03/  00C 0p@#I0/p@-P@Ppp@-@P$   u40 0pZ_@-@m@4p@-0 P@h0000@0@00p@p@-@PX`0S0S00 R00 00C0p@4A-@`p;000vV P000CS05gP U P0 3/0PP0`$0 0!0 00 /HzhzlzA-`@MP3 ` 0Hp @00;tp" k"U07 "P <=8 h1 S(0Z?00ЍJ_Z_[_$3_@-@w"P h= @"t@<""[_@-<0DT 0 !0  !0@- ! 0 !@-PDMp@`) 7Fs)0 000007 Q"P =7 0`DЍ9[_p@-P`!0@`  )p@SXSO-Td"0P 101S@0T<@0 @0<) 0 @  P011 R@0 0@0<@000Q@  S  R@ 0  R S0S 0S069T 0S@0@0@0T @0 00000 0 0SЍT 0S 0R;`P嬰  0;p6Z ;@Y q Wh`;V HPZ/ЍO:@:<[_d_[_[_[_[_{^[_h]^T^[_\_-PÑx|0x|120C22S@-82cM0S-$$] cߍbpTUʀ 0! $!0!!   !U/W@ 1200Tcߍ@-|!202VE 0^/B` ` ``  $`$ ($,(,`0(04`,4088<`4<80P<@ @0<`-B(x]|\_p@-@P`u0p@MuKqp/<0M 40000P0000Ѝ/Ԟ؞qp/<0M 40000P0000Ѝ/ @-T0@00 @ 0   PЍ  Q Ԟ؞@-T0@00@ 0   PЍ  Q  @-@tT00Sڰ001S 000 \^  R @Pt@ 0DP8AT @tKԞ؞  @-@P@PctL0H0 0P@\@t 0K @-@P@PFtL0H0 0P@\@wt 0K O-PP' `@p't0S000Z.  P% 0 R 0 B RPUlDtPh00S\001S V  0@0D.t ЍpK Ԟ؞O-PP' `@ps0S000Z. 7 PP% 0 R 0 B RPUlsPh00S\001S V  ]0@0Ds ЍpK  p@-P@ Ts00S001S 00 0P\ 0S @P@lsPp 0\ RP !R P< J4L @sK  Ԟ؞p@-P@ TMs00S001S 00 0P\ 0S @P@lpsPp 0\ RP !R P< J4L @WsKԞ؞  qpO-M Ta dP3<1@0V ,10000V3PЍ00 0 010pW 0 000S aV b3 @T 4/p PV x R3`$@P @00 0;/ 0PS   ^Ԟ؞KA-pP`P ^ 0pA/A-pP`P p0A/@- w@P00$0 0000/dA-pP`eP p0A/A-pP`SP p0A/@-EP(@-?P(@-@90P 0S @/A-aP*P a0A/p@-P@Pp 0Sp3/pp$Ppp@^qpO-M Ta dP2<1@0V ,100<0V2PЍ00 0 010pW 0000S aV n20@T 4/p PV x ^2`4@P @00 0;/00PS  ^ KA-pP`P ^ 0pA/A-pP`P p0A/p@-P`P 0p@/pp@-P`P 0p@/pA-pP`~P p0A/@- @ mP@0/@-@c0P 0S @/p@-P`UP 0p@/pA-pP`FP p$0A/p@-P80P p@(0/pA-aP+P a,0A/@-P8@-P8p@-P@Pp00Sp3/pp4Ppp@;/ 0 6/O-@M(0嘱p#09ᡱ ⃡P@Dlqa` d\.`q0\!PT100 0@7/$08`U@PU P` ( 0(3/@P`0 (ū@P```p MP1#\A-`p @ \@3 @# Ƞ1\ Ġ1@D2|  @D| @D\@DSh PPTV TTTT 0$RPEP 0$R0 4R0 4 Sp@-@P!p@ p@-`P PcPP @ @P@PW<@-@p" ``P`= @` @`@PT=IDP MD /0@BG-M0S` QPPRp`100Ѝ  \U1#H1@ U00T0S `7  ᗻH000P040h080p0<00@00D0#""$(, X\ 0$0 0 #%@D `d 80<0(00 , h00 l00p00 t00x00|000e`P0pJ00@$M(MO-@Pp$M勊0`VPۊ@$ЍZ0SW@@`  U   %@  R PP0p@I 0  0 (M 0SP// 0SP//G- 8M+0@`p\,00 0000a0($@ @ @P凮0,00 0000a 0($@ @ @u 0,0\0 0T0000a00($@ @ @Pa8Ѝ(M$TI__\TS__(T___p@-P<80@T$2pP @(MA-p`PN@\P ax`H⊴Ὁ0000 @  000$Mp@-dP0SXP @⡉ 0<R8 00, 00C0p@$Mg__(Mp@-@P$`ᅉ 6p@Չ(M0@-@,MPAx0 |  R0 0CS 0 R=9 =  0 0R0 00?!0  0 0  8 R00=9B =C0x@,Ѝ0@BA-@(M`Px p0 | U0GS  0 R=9 =  0 R 0B000?0  0 0   R00=9B =C0xh0l PUp0P0GS 0PU=9 =P 0 0R0 00?0  0 0  8 R00=9B =C0h@(Ѝ@B@-@,MP`pሳX h0l R0p 0CS 0 R=9 =  0 0B000?h0  0 0  R00=9B =C0hV W? 8 < 0# 0$ 0 0$ ,Ѝ@ D 0$(0, 0 (0, @BP/004 0 004 /@-@pT0T 0PS10`V q03/@T Ѝ>s@-`RP1`0@u0qЍp@Ѝp@- <%`80,2 $01000 Ѝ,M=Tҹ^__p@-@H`PS0S(0p  @<>p@-@PT`_L0!RQ41`2`p@ T+`@,M=__s@-d000S `@8P0d0?oT0cЍp!C13/=A-@`TPp WPhd圀PVpʀ 0! $ 0    ! 0!d!0    !Hzhzlz 0 <0G-P0p@|0|`cP@  !P  Z0 0 0 ZUPG >>p@-`<0@@P@}Up0p@/p@-P(0@00C0nUp0p@/ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz G-0 M P   @p X@`lP X 0000 ЍG@1  @P>0MA-X`PpW0S8 Aq P@m@0M__p@-@P0 p@>p@-@0PD@Tp>@p@-@PDPpUp@00@p00S:/>00S:/>00 R !>0 ,>0 '>0 z>"111/"111/ 211/ -L0!0\Q S0>,0 0R/Q0 />@-0 o>D0 0R/- 0R> <0Q/1S co `/ > -@0^1 0 co ` >40@0\/- 0\ >40@0\/- 0\  >40@0\/- 0\ >A-@`P$0pWö@P> 2 2A-P`@$p0SQ @>A-P`@$p0SQ @>A-P`@(p0SQ @>O-`pPа$M @T$Ѝ0S:?T@WQ; P 0 ?0@4'V`1  L     P T: 0I37@-@0@T t0Ѝ@\P0 1 8*b0 ZPЍ@>)p@-P@P  p-0t  B^\  ŠP0 !.0 . l@>)p@-8`8P0+[$@ 0*Tp>X]@/-s@-`0 04@P0 0*Ѝp@Ѝ/A-pP`@k0P U @0p@-@`PX@P  00p@-@P@|PB /R/rN/@-&a_N/@-&a_@-&a_@-&a_N/ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzp@-`P@0 0/0 p@p@-@`[PP 0 000 p@[0@-@0as@-@0 PЀ `[0 <-N-[0 000Ѝp0Tzp@-@`P0S l[0 0S 00 [p@/pMG-`MpP@ᰐxP!0 +3 0000X0P3/H3 00P00 ЍpM2a_:a_tTT^a_p@-DPt` 0 Q@[0 Q Q 00B0C0/T(0@,  >[pxM|Mp@-@$P`Z@ @@/[pxMp@-TP`Z @T@ 0 001`00 0R@@[pxMa0|M@-$0P 0 0 ЍxMp@-@ `PZSp@ZxMp@-A@ <`PZ0 0RS@ ZpxM|Mp@-@0R, 1R >0R( >C 0CR$ p0R >0R >C 0CR0p 0S00 \PyZ0P$PBU 0PZPp p@$60 p@|f~fxM|MMA-pMP`XZ| 0R) p@T1 00S 0E0C@S@1T( T@# 00S0 SrZ @@+ZT W 4dZ#@Ѝ@P YZxM|MMp@-@T P,0,h0 Z SGZpp8]|MMG-頁@0MS㠠P# px1 R0S! 5S-@Z@W 00@ gY ` P@U`1ZV @O0@0Ѝ 0`` '0  00  00P 0 0@PEUP!U @ c0@S 0 bT0p`FP@xMa0FQ/p@-P0 @AlP Q PP ~ @ 00H0pxMa0O-@L Ѝ0  MMMO-@Q` 1 t`lPp@ 0S 0>S @T`臁 13/ pUVG-p0 @0 0 P  (`,Z(0, 0/X(0, 0Q (000C00Ѝ 0$ 0 0$ P@  13/P lV 0 'P]\A-@Px`K@pPEPE804P"8%< 40R:AKUp@-@Px`KH0,PU< 40R*p@Kp@-@Px`K0Pp@KA-`@xPpvK? 00+0`@`PPPEP0pEF8AK//\00S /@-X <!t  L  R0S p@-P C  1@0@/Q Qq QaUB  JU # 3Q R.Zp W 0S8U: 0 S00R0S0&W8 p0 @CT20S(U* 0 @DS00R0ST `x4Yw7   ᨲP0 JZ 00,    Q  [ p B[ RU  KR  Q R|[X} U )p0@  00`w0%G P0JD*0J&``  00``0@ "8`; `7 0`01@ ,G000 0i0SQ000IB 00  J R(0S0P103/LЍ  pQ   j[puX  R%U  /o"QQ 0P RP P E  ,0,0KG  0 00 ,0  ,0W0  0 0pGZp0  0 0J W  Tp  @D ]f_]-0@-M P0$@ @ @800S @ @Ѝ0@Ѝ/M-@-T031[  1 0S 00 00 ЍЍ/-@-T031[  1 0S 00 00 ЍЍ/-@-0 000Ѝ Ѝ/s@-P@`J0 `{Ѝp@I-@-   Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/ -@-  ЍЍ/ @-00S@Y@-@P`00 `*TU 0P0F%07Ѝp -@- 00 ЍЍ/G-PP`M <u!1 @P >h`Ѝ c00 U00S`C 0S. z,@T@p T @@⇕ 0R#T d  R  /A!b CQ00 0@!@ x @T 0 0 `ЍG ?@1c  p U 0 [^gffff_@-m@ @@ 0 4 00"  |@cY ] s@-@Q@U-?@-@PH0 @ @ @u800S @ @k;7Ѝ0@ Ѝ/M0Q   f_f_@-`@P 0 PK000S   A ЍpM-?@-@P@P 0  000+Ѝ0@ Ѝ/ 0S GP P@@-0`Mp@  P}0 Ѝ0-@-0 000 ЍЍ/-@-@M0 4 0 000 Ѝ@ Ѝ/&^@-P`|10S A3S W lPT g#T212@00@00A0S<$10SA0 00S 0 0Q00o0 Z#p0 Pa 0 pp0 [0S `0` 0Q016]P.0 `toYYMxMa0f_Y^^T^f_-@-`00/s@-@P` T 0 ,@J0 `IЍp@2&^-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/@-@x0P0`ppT 0 H@ 0 ` $00S Ѝ@ Ѝ2&^Y-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/d008S/s@-@P`T 0 ,@0 `Ѝp@2&^-@-  ЍЍ/-@-00M Ѝ Ѝ/-@-   Ѝ Ѝ/A-0@0`p ppPW0T00 0 \@~0 Hy0 xH0SЍA?Ѝ2Y&^f_-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/@-0@0Pp` ``T 0 H@/0 p.$00S Ѝ@ Ѝ2&^Y-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/ 0SA-aS_?&@@(p?01 010101/A-a(P!R Ap@1!#880Ro?$1 q0$12020 A?@-`Rq' _@?T (0  !R@D!!!R Ѝ@?A@? 0P ?? Ѝ0 008P n?Bp00S/@-`0`@0S@0D 0 @0D [?@0D 0 @0D @?Y<B|0P-  !T LD.!      /Hzhzlzl 0CS@-T0 !< 04 ,   !/g_Hzhzlz@-P 0Pp@- 3 0P@3OoPBp$0 0!0 00 /Hzhzlz@-<0DT 0 !0  !0@- ! 0 !p@-@P` 0S@ p R0@@-@P00/p@-P`@\ >Pp@-@~> @00/A-@Pp` U00$0@p#0 ^AA-P@`wp >0S00  0S00 Dx0SAA-@PpY` 00@000#0 (A[A-0P@`xpx00Q ` 0 * 0S0Ѝ> I>[<ФT?/0 0 1PS/ /@-p @=00@-Bg_G-@R`pp= 0SP!R PPK Q PQ & AP0 00 0q=PpTp@-@P=0S` p@=0U* `V 0a@-@@ =p@-`P=@Tp00=`0S   0S=p@ p`p@-@`Pj=@T 0S@A @=pP/0S /O-p`PM=0S R 1 ЍO=~=<=@X:w= 10@+=@T R Aa=_=  ЍO R !p  R   B=@=T  Ѝng_@- M@ ȏ 0 R0 00CS0 R=9 = 0 Ѝ@- 0 ?A3c 0ЍMb@- M@ ᘏ0 0S 0  AQ0S00  00 Ѝʚ;@- M@ O0 0S 0  AQ0S00  00 Ѝʚ;p@-P@P@-p@-M pP@$0 `\0`^Z\k` 0 R S Q 0 Ѝ\ 0S AQ0 0S00  00iʚ;A-qP M3 B6<T t13AT \m<@ ЍG@#<000 ^Z<X<0 000@0 0i@P! /00B! 0㨀!!3Ba;T +P/<p@^(p@-P`GT0ST X0S   0 T00CT0puP ̱ 0 upg_A-pP`@P PP 0p`1010p`0d00@d@0S0d@"101A- 1@0C 10P0C00S   0 01Q 1S 0S   0 0 00 00Q 1S0S   0  0000000pP0S 1S0`V10C16@ P0\A/(A@ @-00p04 R0* 40 \@ @ 0 0S00 10 1ЍO-P`41,@TtAB4  ЍOO000P3P#00PS\0P0$Aa0Xpw40 S 00CR %05萔耄[H쀄4 10C 100C00S   0 QY40[ H\ @[A-pP@`84 XVAq4!X0`FS0 X@ T0@0T0@-@04$1$S(!(!(1$! V4@H\/O-P2TP Ѝ000 @ 00@- X( b0A*(P Ѝ @- X b0*P Ѝ-:$M: 00A 000   0$Ѝ7@-P@2 X0P4 R0* 40 Q Ѝ0@W0U -,^ :!!<  12X0 0( X 0 p@-@Pf2`Qp@21S$A-@pP`Q20 00@2ЍO-c,M@0pPW`$ 0)p B,2 (2  #2400#C8."<`Yw#?NW4 `Ï2`8<000Td0a@PZ `oh 1d0H0> T`X` 0墋P0PP0C1p@W U P!T0L0X0$ P0\0 \0q``a a,Q1011410Q&3*`5WpF&8!U. P0`Pd PR0 ž 0 PSD d0 $UP= =@,Ѝp\I  B(pz`1QES 0 @APx h00<  W0O< @@ Qr? P q`F pఃd0 cLh1( @,0,@SI$1((0(11 @[bg_XTTg_H\L@-@`z0$MP00 00 0`0@pN0 00  0|0|`0@0p `0` (X00P0 `0@00 0x$Ѝ @[\TTg_NNg_ 0?g_-$M<840 ,(0 $Ѝ-$M<8ƌ40 ,(0 $ЍQ Q Q /1 !C//@-xg_00@-M00|0|@| 0x00c00PP  TTaP <委80 0 Ѝ0@e]@[Tg_<]g_TX?,,00 C#' ,00/<0?00 Q0000$  B',#  /0?A-@PM` pn00 0 0! 0?P W 0  \ \0P  &PP P0Ѝ$ 0  0 PJ_,T^^p@-P@>0 Py0vA-@P30t0 3R 0SP` p!VU A\0S0G-0P3x0@ 0p `V 00 090`03/V/0 0 0 @T@-@G@Qs@-0PQ0 7 0@S /000`ЃЄ 0S //$ @Ѝp@,lTO-0Pp,0 `0@ `F`! P F(0P@0 0 PP PUP@0?p@-P@n/000PPp@//G-`/P@p0S 00 `@/ 6/O/ 0$ 0 0$  $0RPBB@-L@L03/@1/`0d 0 RS`0d D}@b/BBA-`pP/@"^\Up `0 0 P0 @0 00MAT6/D`0 000  0BB 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz0@S@-E0 /h_@-@q`PMU:,A0 ᚻ . 0 @⏻ @y.D g g  g ~g0  00I0 0t0B00d0 0T00000<0Ѝ蜂Bh_h_T*h_ h_^2h_8h_T\00S/QA-H@H@`PQ..p"R0:Af.PP00S (HR L0CX?MbC-pMW(ڤ00W$PP `@P   @P Ѝ0 S 0 n@#@ꠂs@-`P1P @ 0 Q@00ЍpA-p`PP @! @:(@00000t(d031,0(V0*H00V *W  m@30` @@?0@- Q 0 Ѝ@- 0 ЍC-`pPP @- 00Y 0X3A X% X, @@!R" R R 0 @ L0'L00L0(0 9/@ ЍP 0@00010CS@0 00O-pA WMC `30GSJ PP4 Ws 0 @g GXNY`P0X0>[  ᑴ 0 03/@PF0X0>B  2@< W10 KPP@ @ЍZ P@<P  @P  OWP@ @Y X` `  @P Y  `WUUUUUU@UUUUUUdUUUhUUU0!, Q *" Q: @0 @001 00100   @#000 S 60K 00C 2 0 0 00 3/@P 0  "  00 0 0 3/@P 00 3/ @ @00 0 0t 3/@P 0 0 0 0< 0 3/ ,10 0 0 0 03/ 0@0 0 0 03/@O (0pS10 0᱑P@0+]@5 0 03/0 0 0 0 00 @ @?~f}f3{f@|f@-@%P p p@-@P0P @ 003/@p@-@M P Ѝp@-`@0P @ 040S-@  3/@p@-$M@P @, 00`V-@% 0 10 !0S! S S@ 1@ 000 00p qM 0 006/@$Ѝ0A-@PP @ 08Q-@ b00 0`01/@rЍ@-0@0! Ѝ@-@  pP0000Ѝ7@-@P  pP OP Ѝ0@-"0`p SB@ pP P`0 @  G-@`p W T0#03V0S8P (0S0P  p(0SV @ 1!H  @@ PU @P-dM"h0 (00@#0 00 ,8dЍD UA-0P`p@0 TЍ@- #h0@-aG-P1p SB@>(21X`1U @ T 1P Ѝ@-050. ЍO-`0x#MPܰ" 0$0P @Ѝ(0ShP (0S00SS Y@V@S PV X_ @T    Ap0 0p$ %?\0?4H0PX``Pd0pA 0 00! "?,0?P (`0P40p@P  0 00!P pMATX X  &@P 0 00000 00 -P@|  @u0  @P @k0  @PP ([1 01  010 0PPQ`v0 @ @l iTD UEp@-0PS@`M  |P0 Ѝp0000 O-14M`P@X0`0CS*qP  (0ShX\00X0 00 ` X 4ЍT#  0#[ #0 #]O-0p IR@4M, [P  @P!@T   @P @  @0` @P " @ 4Ѝ?@-@E#p0t 0 0x0 @x#p@-d0@P &r"0@3@#p(#&r"0@3@#`#p@-d0@P h0l (00@@, p#h0l (0, 0@@E#p@-l0@QP 1CQ 1CQ p"h0l 00010+#p00f@p@-d0@P0S S p80`h0pP"#p0@`]]p@-@d0P"@p@"p@-@d0P"p@"p@-P@P @"pp@-@P` ៯"&'00F= 00'`P000@0 "pp@-P@m"A` h0l 0H0@`P &r0`1:0@4"pG-0SP'@  pYPP srF ?"h0l Y^:0 h0l u$A"e"ЍX#x0S `Z"P000p0t 0 p0t p0t `0Sp0x0 t S PP #`PA-0SP-@ `!phl 0 y0S 0Q h0lt 1$@"  PX!x0S P"Ѝp0t 0 p0t 9p0t P0Sp0x0 t S PP #PG-50S`5 P`P-00p 0 0(00 0 @ !x S@Q00y0hl`Nt%+  @g(03i00Ѝ]h_h_0 0R0,00 0 0/s@-P`00@t  \PЍpp@-P@H`9!U88P@P PP@ @j!pCCCs@-@`00P E1PЍpQ@-@ @ @-@6P@oЍ0P :0Q:///0/P$ Qp@-$PP $@* p@  0/P$ Qp@-$Pp@ !P $@*!!C-@`00PUH@ P ( ЍC 0S 0Sg00 T5 0` 840S$p  (PU  * P y w ^@ ЍCꨍ EP ЍCCCA-P0`!Qp# `!0   6PP   PP0S ,Ѝ@@P! P0 0$pP%  0! 804P(Px,0 0SddNT0`0 pP4`O 0S GG Ph_CCCG-SPM@gM PP#@D V x0S@P:0  00 0 , R0 0300`  f@P (,0H4@L@$ P  #@P ,(PЍ(,0( 4<08@ 80,0 (@P$H0Sx 40Su UVw JPP0  RS< QQ: 2  d+& &bR0@p 0S4#,S  @P @PP `10࣋#h0S00 0 o@Pa Y 1X+U*U4+U<+UH+U $0U@PR$ 0RUp 00 0p[7 *k"*A 0 BQx+U+U+U+U+U 0  ! 0C?o2S 0S0S000  p S00S00S  pP BpN@Ah_0@- 0@SP$M  oP 0 P     $Ѝ0 0 R  //p@-`Q0Q@0 ^ Pp00p 0@-@ 0P  JP DЍC-@$MP  P 1` z?0 0?.$ЍP`p崀P`0S X *1` z?0 0x?V yPPP^X V  h_@B*i_@-P04Mp3     1U`00@ P P$ (0"L 0 @ 0H4/@P R tT00#T0S@D0PE0S 0 @VP0P4ЍF@-P@`P 0 Ѝp0 ` O-R@|M PP 0 @|ЍY 0,Q@! 0000 1/@P0qlX X@0` O@P V $ Y8 `0P!,0#(0!0 0 X/(0S8(0 0 0 @ 04/@P( 0S tT00#T0S@0X0C 0 R   @)V (( R LP0VP ʾ ᪨@F0@-0 0Y ЍC-4MP 000 0 P$03Up1@00(03`T 0 @ 0P4/@P 0S tT00#T0S@  T  0h3 LPB 0PED00S 0 @UX0P4ЍӀF@-P@`P 0 Ѝp0 ` O-R|M@ PP 0{ @|ЍY 0,Q@ 0000 1/@P0qlX X@"`  A@P V L8 `0㔱,03100000(0X>d0SG(0 0 0 @ 04/@P (0 R tT00#T0S@  T  0]3 L (0X0B 0 R  @ UĽ (( R LP0TP ᭽ ፧@FӀ0@-0 0I ЍO-1M@`0P 0 @Pf#΅"^0@@A-QPp Q! Q`+8p`@~2` R`   Q`02@e20C-Pp`X2  Ѝ S @ R0P0@A\0 00p](0  #j 0R P A-`Pp S@"@Q  0" R0Q@D0 00>] 0@  "i;ЍG-XP5P` ph @ yWc 0 PP!i2 02PP 0 ( T @   00ЍY 3D]L]G-` R P0S0R@9@ 0+p@P)V  U @$P 0p _@P˗P`@ P0 Z@ dpW O-0TM00SFU8FUIULJU`FU 0@P#@TЍ0 0 @P0 0@P003 @@3 1P00`@<$PSpW$0X3X$p^s៹᛹PYZ43Y.4P0U0,0) U 1 #$, ,0@PU00P00S W 1 !, ,0@ U00P00S V 1, @]ZTpp 04p|0$00P 4``p0p$pP )``  do R<  <  F[o P T R , (⋹( $ , 0 0@P00 0$0000u  7o R<  <  F.o P T R , (^( $ , 0 0@P00 0$00NlP@hP 0 03/@NT@ P@N@`rlrĀi_ B @-00S/A-@P`p 8,00P0000 0n?@r?v_` PA-@PpA` $0SH0( `@ $ 0R`0P 1p@-P80@T ,lPpAD0O-"LM@!2Pp`0 < 00p0,`(P$@ @@ @<D@)a10< 0D0<0p,`(P$@ @@ @PaD0SU '`Q`1 P0D 0<,p(`$@@ @a0 010D 0<,p(`$@@ @`0 000D 0<,p(`$@@ @` 0 000D 0<,p(`$@@ @`d0P00<,p(`$@ P@ @D `LЍ i_i_i_i_i_i_i_ Q· 0 {DDp@-@PBoPPUP 㭷(P p@z㟷 R00 A-d0@3`q00CS0 G<XPR?U A-@p p0` PP gЍ@PP0 PP 0*PP   P1S!!1! pW020 ( P Wm@Dp@-@PM TP0WPP+@@@`V& WP0@0@ @@@0  tP|0 @tT@W PPPL0Ѝp80@e0a]D j_0?DDhJU_lzp@-@P`40P ( R  pU  @G@p@-pPPM @P Ѝ @P0S00C>S@0`S 0S@ x{10V0@-@M P P fC Ѝ0@-PM @P p@P0`S  D0000Q  @ЍO-@$M 0HpB0` PP 9PP<@ޙ3 P@P   (  , ^ !$ R W  RR R0R Pz@ u@80j/ 0S(A P? 0W`0" ğ1 00 0 100嬡@Q`pP= @  P $JD1 00? 0@0 4<00000 P e Py0 00^ pL0 T# $Ѝ0S@JP^vod`rτn0X@Sk/1!p5@@PFV0ꨂ]j_j_o D@D0p@-P @`M P  wPAЍp/O-M p8`bPP @nd 0 S/ i(PЍ"V   0 PP U `0 20;0P"  P#PPP" |ЍӀp@-@aP1S  @T 0S 0QU00001501 0S pPPO-03pPW@`ᄠTu P 0 S E @ 0SPP02P0D]C-p`$MRP0P P0ChP0 4P0v%@ RP0 0  0@P $Ѝx0x E0 ` Fp@ #P U<@ K@U  eD](j_@-`PV  @P  ` 0S  @QЍp i@P 0 \C-T;M0 0H S@#* paVPuP @P U kЍ6@A-p@WqY0P @P ?T0003a ~@P @@;$q$Q W@+@-0P@3UQa SPP Ѝp$Q  ,0(0$@ @XX00P000a0,0($@ @ @< X@Ѝ/j_pzoU4j_nU)_C-M@pV ̯0 P3H `㬀嬐0 V: ᧕T` V 1@`宯VЍ0`1S 0 + e>j_ V  0RD@P0P dp Xm @ЍwP w3pU W @0UX @ PU0pPpU#I G Q  @0S P P d. T, @ Q0S 2q2 Q<рӀ@0G-M 00 00 0pP @Ѝ  `P p @y`1`3P@刐 0S S 0  @u `u`a t` SP @L@@' |PU Z | Q  -@V 1S `0ሐ01Q  <Ӏ0"!S/ 00/P /A-L0C@1S`H1P9 @ATAs piw`@O-TMxT$ ,0Y〰CR|0S |@1 00 00H1|4R00L1L1,0P10(00Y@1<10 @4 0/00/000810000+w0#S' Pp0ԣ`$0Sd岀FP0P #FDV 003/ Rp` @DpPTP,0 0`,33 0Ɩ000008000#p h /oX b 0$0Q5W 20S000 0H1 000 0` 00$  0R   8 RUP6 881SQ00BRUbPEQᆢBDU"XOW[YgP @Pa X g /0Pe Z  00XWYPELD  0P P 0  0P P  0P P   0PT P   0PrT P   0PdT P  /W < 0PY 7  0P0 01 0 100/oX" R0  0/oW" R  0/oY" R_  ᕰ 0X   l]p@-P@U`0M  qPPP  hP P 000Ѝp@-@PP4M  RP0D S# *a/b(0 0 004Ѝ@BO-p0EM31, 0 ? S @3%:a V PP @P81 00HA@P $@ U Eߍ]@-0s0 H ϠNl/ / ( 0C00 ЍMb@Bp@-P@U`(M  PP P  P0(ЍpE/08!PR/p@-SP@HaNtP@10D1@A `0p 0 pO-0@SP 0S 0`Q X280SP81X0S >!`0@ 0 B0p $ 000!   #88 !#4< !#2> !#1?  B pBw 0b8s!%&00   0 >VU@ ЍXU  0 L0Z#  P21p ppp pp \ 0R 081<10<1    (PB(    ЍO P `~HDt]A-`唀p?`@T|@0C0éP@PEPo= 0 F0 f021@& 0@@AHD0?@-@( 1@ p@-@ 0Sp 0P R @1S@  0S00p@G@-0M?SV1``0@SP T;8pP 1@ S @Ѝ$p偵W00SZ@@D@ @ @@0p 00&@P@T >5@Tt T T0 d0 Ѝ@Q60@Ӏp@-@xMP` x 㩒` =P0 xЍpp@-P@xM`x ᓒ001`0 00$ txЍp@-n@PqeM  zn 4  eߍ0p@-MaP. @P 0@ R ,4@T@ލpO-p0A$M>SHL0&0R00`A 0 0S9 S7 ZZ 1SL0  3 [( L0  3Z P[030S x3 [0t0[0AZ Z[1S W4P0S 31@0r  " ? 0     X P   P L  `Q((L Q`Q''L pHp Hᢲ"!    Q QpR RGE 00000 0 0 00 2XP1 01 1007[0b ZZ[Y 10SuTjW4P  m2 020廑0V000aP0S 1$ЍP101 1R 0  02P .P0 4P0 <PZ[|zWj_@Ӏ<]Ԁ0@-P@P+1Q>C/1C  Pp@sX1QE 1CQ [?0Q Pp@u0S1::8C81Ppf0 S10011000000S0S: R :SP0C BS000;KMP s@s@~f s@-@QX0 0 0h0嶴@JXp@-d0dP@ 0\@,0(@@T@p8X\@,`(@@T@5Xp@-0PQpl0@Q `0Q"X\0S0010X R0*X0\0pp~fTf@p@-PU @d0`(0p`h0Xp Wpp]p@-@d0PWpp@Wp@-P@PW1[H[hfpqpA-@Pp W\00tp00@`0W00F= 00'`PPfi @-0 @0 hp$@A\  \ R/ C-0SP)@ `W耟 hp\ 0R$S$Y#P0S0 0 0  0 P0S00 S PPlW ЍP S cWWP\0 FP\W  |P@p@-A@ PMW\0S`V0p@4DWpO-50S8QpP Q1 u@P)00夰 0 0(0 峠`h➲pPWWKK0 0ZW%+  `,0300 Ѝ@]j_0p@-@PP D0R ᵻp`V>[V᫻p p]@- M0@ P 垷 ЍO-P4M`UXpPP ᦻP  81R w 4Ѝ@VW Z8H0L 0P0S XX0 S'vOH0 L0 H0P L RP 0 H0LP Yp 0\0X0SPP0PSOiV/&O]ɚ;6e@-@LM`p  P P0U(P~?oU20S  LЍ B 0  @o/p@-dPp@dB| 00C/(0, | 1R@0@@1B @@VkpzQQ 00 Q10C2q0Cq0CQ0C0C3+C? R0//p@-@ Pp`p@@zp@-@ Pp`p@3zO-M0(0P`p` @F\$ X $  Oo0>DBP@T$ЍOЍ-@-0 000̴Ѝ Ѝ/a^ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzzz@- Pzp@-@,Ps080Ʊ(ıp@zⓂs@-Pn10@T H\ᝂP4宱(Ѝp@ DdPЍpzzA-<1P@4"000000D1h1P[PYP UD!  _0`a00h W!F0000Ϭ00000UL!000000D12 !_0 ? R2ꐴUxUpUUUxUU U D P 0!00 hP  U  _?0ShPS0C°0,`0(@$ <08 @DЍzk_U(U1_k_k_I_k_k_z_Uk_- B 1011 S!1 0 !q 0$.zp@-@PX10U00 00@1B  ap]Pz@-@$0  (@bp@-@P LQ 8Q  _? = 0>;0p0<0傂|Q h:$p@p@-@P  cc/0000`0001S 0V (p&z_ӀzA-P`p0| @@ @@1B  lAT 4/0 #P@P zp@-@0P#PP@ {m pX?z@- @$l^zG-Da@ Q8# 0 4 0 T 4 T ( ,8q X( ,:T% U' . 8 < 8 $ < $  @ !    0P @14 0 LS0000 ?X#!D1  L0S81  UP hP000@1 t1S 3/P0000  P   +) 9R0\0[S < SEK1 C/oS" R 0Sw rX <0SP@4ePR? V1 C/oS" R   ^KH090KW1 S S R D15 q0L s `D15D1G!S3  U@n P; P1 C/oS" RQ1 S S R VBP1 S S  b0 :  8T!U1R3R1 C/oS" R Vv  & U1 C/oS" R 0<0孀T1PSPSPUT1 C/oS" R D15D10<0 U  P,M1 S S R# _ 0 R P /  *Q 000S0>;9 H L1 C/oS" RP N1CoSQ/ q P P ph p0a P P lyp0Q P P V  "@ Z1 S S R :L 00 S   | 1R0&,`( dP"YE U_ H1S I1S J1S+ ) U' 0 08L*0  :/0H1PC_oSRPU  P PEUP#U PE0 S = zT]p@-@AK `P @Kpz@-D1 M2D10@9000 00B P090 Ѝ@-D1@ D1L 0X1SY1SG-@LAP` p VW 0 Q(P6@QBYP1PVW) ``&@1B  U!!|0R W PP Q yV t| 1RWP 0@1B  $PW 0zp@-@pP ?P,00(@@p0k?P(,00@@zO-0DM S @0 P`#48@3 @(00GD 91 Q/[ , S) \47P[01 0S,hpDЍb  ,"Z3KpQW`<0}Yq00WX03QHp=0K Pp # d/ bQ8!  TP h P  @! t!R 2/P   "Q8 SQY0B@0T 0R2 @A0.@!B +@) Dp Q B("008  R(00C?2cO 0@CdB$@GSYL0S800ڄ0)T0S 0  |#pR 0]pTX!R#W W#W[ BfSQQP 0 S W] 0pPX?0H SQ00Q00SH upt:W>Q; 0S  R5 HQ IQ JQ  R(`!`zӀX?gfffQMbO-M|>@QP`q P\>Q 4P>0S%D>Q 8>U9 ,>U1, NT|.23i 3!1P "=U Y-23=QЍOG=0S=Q%>C0CQ X=Udl=U0 oGL=Q Kk0CQ=0CQ(=0S =U& =U2<U<0 S| P 0 :/zh| P 0  9/TX<Q P<U 000<Qw $<Qs <U4 <UQ Y_Y P]  { T;0SV[ ] SZ 1 0SV [0S 9PN q\ / ; D i '8;ZP5 _ Ѝo ;Uq0CU::U< LQ0CU' ? 0CU %40cSr\:*0#Vl:Ut 0CUPuG p 1 0Rd[0a PP? SUPUPUPUUPUUPUPU U:0SUUPU,UPUPUPUU9U908p 0;9U 0CU 0U %40cS KS V0CSt9U l90SX9UG 0CU1 @9 I0CU00 C0U %40cScU 8U  0U0{0p8UEPP[ 0Sq l00 3/ 03/P\  8/ =@8U 7UL@ 0P  ! R[   Q!0(03/G7UD >0UR >C0CU, %40cS vS<70Sl70S PP7U Tp0p p1S 3/P HX0S00004 3|000| 0C0;PUPP8v80 0R01 ST 0H0HS^PP' 0D 80< 0Pa@dP ^!$ğ$D^Z @Y 00\T 0< s0S ! S f[0 0S00c0z1 0R[0 0S00Lk1 0S[  $0_@19@1e|00@1$0\1(0S`1 xI3U D1"    2D1 0R810<1D1  0;; 0D!"0D1 ygi0 8P # D12D1o Pk\0D!  %<D!0 0<0zD10S 0RS P100100@[00[0NP x PP0S ! S,[0) UUXepPP 1 0RP_PQv0  [Pb 0S ЍO78&ЍO3& Retrtht@|ft,@z0^t tBt @utt€k_Ȁk_tCt gtӀX?f@t nt ot st@jt@wt@HtH~ft,_z,_p@-P@?U0  @  @1B  !0jp00`PzH/H!/81 , p@-U1@ S S R 0\ <0 vP 03/pT1 S S R 0<0l1S (l13/(#/#pz/p@-P,0@TpvP @؂/@-@PD0@PP  80P  R 00 0z܂p@-PPL0@T 0S 408 CTT 00 0p@z؂@-@P($08 TT 00C 0@z܂A-@sP/pPP` GvPa00|0p @R 0PQ 00400S  R  0?z]؂@-$PP ܂k_k_@-@X9T08 CTT 0S 0o0S   ez/܂ 8080 1l1S 0 0//L 8080 1l1S 040//L 0 601/Lp@-PX X0X` 601@0003/000lQpLzA-pt`P@@@ @L0 @  ARSD1 WH@@@S@P0/@(0, P00Cz0 /@-P0 @"6 0<  $0000P0@۟Lp@-0 PQ"6 0 A X0 0 X0p 0` X0 0$_0⺟p$Wp@豟LO-0lMS 2P"0 & q`D될@@, 0 XY 0X0v o@P@  ,Q,#N;plЍ YY 0PY0] lЍOo| R  @ X>  ጞ@P H C o@T0@@ @phdRd #e@P* o@T 0@ ?o 2R0S@@#@@LzO-@`2P"0|M & tr< 000 0 @  c L Rh00+  0Su 0X#00l ,TdRd #AQ@!@1 oPi @``Q` @P R LP8p UXƞ<`D!L"$ L\ "P R (Ⲟ ( 2/P@T R R TdR`1d`# MoP@h6 @0``Dm  婝fYn 000 |ЍLzG-`!1  60Qp A@0 @ |Q   XP YQ Y.S  /Y SQ@@@@ @S @ Q YQ 0@L  Q S 0 T @\QD  @Lzp@-@p p0 601 R R p@ Ph p04 p 0PL]z]p@-@ Pp`}0sp@zp@-@ Pp`pfp@zA-p`tPa @@" |0S  @ X R@ Y@T /(0,  XP YQ 0 (0, @@Wqz@-p0Q0A T 0SlAOoB@ 8T 0SlAOoB@ QLzA-q`0S3@Thh姤0VT@ PQs00TS@*f R P!?t0@@ R01S`J@0Pl01S TX`10AL@l_c_zA-@0` F@PP x0x0q@l1S XPH0@`l1̀0003/D1;D1PULzUQp@-4Pp@$n0S@@ըpLz@-@ $VT@ ։0zL,sr/p@-Pl0@"6 0\ \ aC $8ⓜ 0$00⋜p@pLzA-\A0` F@pPP840101@0@$l 1810<10D1K<@1=`1\1l1S000( >0 03/P @ 0剘P \)PЍ00   0PP0C0 zL+p@-PP0 601P003/@@epLO-졟p3`!1 ر 60P@ @` 1 Q[  S%L0S> xq8L0SI@T @l@T L0S8L` VqP1 0S [ @ @P < t#@ X2@PT @l1S 0 03/@LX?zG-`$$ 4 6 0Q 4(,V@!0S 0 X0@0X0D1;D1pЍD1  0 X0@0X0D1; pP `3R X3Vl 9>C1CV %83Vm 0 $p 07/pp{ 0 ppr0o 2 Rk0S Y`w2V, 1\0CVh||t2V" 0CV 0LR 0 00($2V0CV 20S0S00 0R 0 py00u 0R 0 0P0E>SpyD1Sh0 000i|00D1  0 1V '1V 0CV X0@0X000S80 @  UQTQR+ X @0 X 0!p0V T00SRX @0  X L`tVft_t u wt@zpt tttut 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzp@-`@PVU VBMP0P0 0`p@-@P <P 0SB3000p@-@0SP  \P 00BS0Q3\000 0S00000CS000tpG-p@`V0SS00aI"U P PEVP p0 `F0C000S000p@-P`^Q@ V0@@DT @@D8p L@ CA\@ ^@\ A\ R\Π p@-@P%0S0000p@ S0C0LU0 Q BPE0 0U RR  p@-@`0 PSpS 0S嫟  P0000`P  BR1 " 0010 0000S000pVl_O-`QM@p0 SB S0S5 000 0R4P 0PPC PE0UP o R A00N \ᡡ:50C010 `F000p0S000Vl8 P \ Ѝ@ ࡡ0030c00 [ nl_0PPQ/@P - Q^00@S0\3z X0P/-0^  0CS0\3 zp@-@ RP 0 BS 0 \0C0P 0CS0Q3\R  pp@-@PDpp4031[  10 P /-[  \ @- @ [0  P p Q  Q\1P!  S[ @ [ @@~@@at Ӏp@-`d0@31[  10 PU 8K0 @'p@p@-`d0@31[  10 PU 8,0 ݔ@p@p@-0@1[  10 PU 0 3@p@O-@DM8 p`\0@ <00  <0,(p$@ @@ @`P-*0 L 0  `<4,(p$@ @@ @-DЍzS^l_7@-@00P 000U  Ѝ0@' Ѝ0@-@H$0S 4D 0 S   0 9 zG-Pp堠堐 M@T( |`  Wj  q: N0SlP$g  Ѝ@zXl_hr0S/(XTVA-tp@hP`V U0PD 0 p@hlP`Xz h000@-@AM,P mLA iQ i, Aߍ0/01 p@-L1@SP(0:0p,18`S 0,Q0Q:01 01z"PLaPU 0S 3/P 㿃 㼃0$L1M/@-PAM@zU 0SAߍ@, c`P  Aߍ ``0pP` ㌃0PS 0S ぃ i0 L1S0Sp0LQ:03/PU`P ` ]$/MO-MRQB 0$P|ߍO+Q0S 0 S0  pL\000 09* `P,* pߍ3@00T 00PS+ (0S(pW% 0 S!0 00S0 000$0p 0P [030#Z0Ss w00S@0000S 0 0`023 -0Pbl0 H 0L000P0@0T00XH 0P40@pD01 X00& 'QI x l0S QD   l ) @X ? 0"0 2" 2" 2" -0әp+XPU000 W A0 K =00Js 0( 0(P,.0( @(p,.0x0H0y001H010( ( ,.0( (00,.0( *(00,.0( (00,.p$=0S02;)΀΀p@-D@(PJBGB0 WBp@0 QBzh%V$Vp@-` P00P0T0@Tp@D0DKBP0SX@$0S 3/,PzdX?{p@-h T00T0\0@Tp@L0L 0?0c*BP0SX@ 0S 3/,PzdX?gfff0p@-X00@ X  $R|01X0S 3/P0ST0 R D 0 08 04 0c0p0S 3/,Pdz~~~~O-LMD@p`\" 0  t 0p,@(`$  @P*H" 0  0 4p0@,@(`$  @Pn*" 0   4p0,@(`$  @P\*0! 00 0 4p,@(`$  @PI* 0!hh1 0  0<8p40@,@(`$  3* 0!1 0  08p40,@(`$  * 0!00 0  0 8p4,@(`$  *D0 S @tPt`tpU:T /LЍOP 0"S %@LЍl^{^l_l_ V^_Ș_{$P00 !XP/ P/ R/Xzd@-P R0CoS \,0P @-@P0^ R\ T \RP \,0/@-@P @0S @/@-@P <0S @/@-PL@-P@@P0ӗ/ ]Qp@-@!@3PPP@p0S @-卛 Gj8]l_p@-P@eP`  H0S p@/p@G-`0P @NP D0S G/PpU 1 !hpPGPp@U 1 !T Y B BR !  SpP @U1!W``@- @0P @kp@-PP@p@ 160`S% S S  p@]S S60\ FS! S S |xS S p@Ί0P L\ 1 p@c p@ p@f_l_l_l_m_l_l_l_^^A-`p@0@TP0SX@0S 3/,PdA-PQpT0@T0 R X@`0S0S  3/,`d,0(0 0#1P! P #/t>,,0@ S /@-$0 @PЍ\G-MⰠ P`p ` @1i0P00SS-ЍS000 000000@$?o2P0SQ $0S S S h 0QQP<0H 坓80(0唓$00,?X|F](?$?C-釟M|@P` php0p $  0` h2 020202HX00#ߍX|/Vp@-1@SHPL0S0L0 ~HHLbP UpH@0100p@ rlHUH  L00L0H0P @0` `T^ p@X0\ /m_X| 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz@-$M`0@T4Pp#2Q12000@T ~ODT3"P%QR 00 0$ЍP0SX@(0S 3/,P "0S 3/ C10@dX| 0O-DM!3Pp'`0< C (PP00p 0,`$  &3 0P(P?0l380  04p,`$  &03 (P?03<0  04p0,`$  &0 000'Ȳ!2 (P 0  04p,`$ &0 000x!t2 (P 0  04p,`$ & 0'!$$2 (P 0 0 4p0,`$ t&0 000!1 01 0<(P04p 0,`$ ]&0 000!|1 0< (P04p 0,`$  G&<1 041 08 081 0@ 0< +  弑0P &R+3'! P<0 少 kH0$姑<0DЍO衑_X|(],m_$]2m_0V,?;m_(?Gm_$?Om_t1Vq_Xm_/Vjm_om_4V,,F]A-@`(pP$d!$rA`X|P 0 0S/p@-X0PP Ln@P 0 H@Q000 0pX|@-PH00000 0$0(0,0004080<0@0D0@-d0Q@\` ?PP0L00H@40 400;\00T0X0X|G-0MZ幗0 S 0pWЍ@L\ T 0E0 0 増P@T 0H0 0E0 0 D p受` `FV`!  CfpG@0um_m_m_P/Q@- 0ࠣ @a0 RS000(00\ 0C L000RS ( 0A0B(00 ( 0R 0S PA0@-@P 048900H0000000H0\000 0C000/A-@PpPU0S@@``FV`! 7/P@PEQ/\/0 ASQ/p@-@TPPpP@p $00$/$0 S$ /0S /@-@p@-$PUp@Qp@@-@0 ( 00@ep@-@s0 0P0 p!R 劖100 m_X| RA-@P;bS`:pe@P PU0P SA-@P;bS`:pa@P PUn0(PPp@-P IP@ X0@p p@-@PPlTp00 00FS0d 000l@3S @pHL0SP0\ 00CG-P0@0,0S *`V 0Sp@ATpP 0 `0 夐0J,R0TPUP! U P!0 d0@DJ0000CS0000`VTT`pX|O-pPUK `V#:S`F#V@`B @P< 0< 0 !000 000HL^H0H0`0000%PH0 }@P 2V2(0 0C(000(( 0 > P(@- d0O-rMP`@0 ``(`0 0`S`F 80000U V0  ( R(PE0Sv80 0pfW &R Y < Q<&0G 3SL <P 0F 3SH0L RP \0 = >R 3SH L0S P0\ 0  0CS fW< < 0CSSp10U 1 !&c0 P H00 < 0CSH L0S,00 BW 1U  1c@rPp@ppWt 0q 3SH0L0SjU 0< pP7Ѝ<ppP U(0% =0S0%8000T   #RH L R!Y B/o" RY0@ 0C0pfV00 `g000 ; Y 1S  0 t 00IAQ00@0Wp!S  b000P`V PU @P@-P   Ѝ@-0000 ЍP/@-PPQp@-pp`P@Pp0 0` U P]m_@-@P@Ѝ@-  sP  Ѝ0bSG-@9p`PP2 0 i0 0  I,b0W`!V`! V `!0 Hb0pGI0000CS0000@TWW@yPX|O-PR``Ap0PPPM 0j@P 2 (`200V [ ?@P Q Ѝ00pJWp!fW\  W 1+#  a @PZP`F R[ 000R000 pX|A-0@S" `;(0 S8ʸS C< 0CPHP2`P (00 A2(0000PP 0 06@ a.pP `(P0PEU0 U + (0A0PEUpP `$P/0S/p@- @PP LapA-@pP$`V@PW0$000@$@p`0@-P@ 048900H000$00@O-M@0r000?` 0l hGQPp000D vVQ@%U -0SPpGW0pUv    0  P@ 0ЍS* v(`  B'(00C(0  B 0E 0S000 0 00HLZH0H00v p`F0Sp0P v B R ! 0 3SH L0SP0\ 00<0Cv S0!0  BR ! p`n_]n_0n_@-L Ѝ@-F ЍO-P嗑 RP@  Ѝ0S@PETUT 0S     @ QHLQYUP`C !ZP 00YPZ0 P 0 0SP_pJ^  \ RU [ #RHL RP \  $ #RH L0S0P 0 , B!R \  0 I0000H  0CS  B00Q 0    _  B PPZ0 1AP? ` _00C0 00 000<00q]\^G-0P 子p@P: 3  0 0  000HL*YH0H0`夀VG_xPP P  0  0 00HL YH0H0`*_r@]Qn_/-/-/-//-/-/-/@-@ZX-@-A-PUp1p!0@W`DS W c cBePW(0G-`P00 00@pP) X01 0!00000P XI Y 0 000P Y J0S@FЍ-/-/-/-/-/-/-/-//A-@$`P Pą@ p00  -^XP  ~^W`P  u^`G-4pPPP8 `@P 00 00 `Ph@ЍG-PP0 Sp`M 43Q0S Ѝ@50TAZ @ 00040"8P 0  0Sq20@T D@DT ዑp2W_ @\2W+ W^ $E8P$iu2W0Tz 0Tw v $] $"H00@$N/0p 20@ T 00C?o270 T:0 v;$100S H0 0 @T D@DT($1mT A@P$# 8 O~ 0 0S0"7  $3@ 0S A >$9iiip@-@PPPU@` i]`Pp Bp@- P`8@<0P p@0PppPp@- p%0Pd00S P0pDP<@J80 @i0]E~Fp@-P`0` 0@ 0AT 0S`0S@ 00 0pFEA-@Pp \, 80R) 0 R) *`00<00@0 0$0t`|`p00S0x0 00P0:0"`P@@A-P@pl0`,PVU  ArVG-41p!,10RC*Q`= X PP<*P00 /R0S /ZPPr@ (`Dr@ $|▄0PP 0,`8$0 Pa~<~@<7$OV@P?Emn_@-@P r00@-@<7lK< 0S \0LS   :,P 0drP@D\rEFp@- 0@0CS 0P upp@肍40,0Sp@-@P 0S 80 31R00 pp@-P40@AT ,sZPp@E@-0 00 0P Ѝ0A-0SPp` xx@dTPPP (0S #@i 00 0@PF0@- P,0@S uЍ@薌pt Ѝ@-@ P$0 0\  Ѝs@-` @P$@P,0PS E@U Ҍ(0SU 7Ѝp@XX #!Q *@Ѝp0ڌ@07@- e@PP$0sT@ 0$0(0S : Ѝ0O-@PDM TP\DЍOlQ @A@AH1  (g @00,ap0 !@(0 0 <00,p$@ @@ @0 00< 000'>,0(p0$@@ @0\00 P0< 0,(p$@@ @@PP DЍEFh_V_~rn_xn_T_]p@-@P8p0 4@P pp0s@-`PP M@=TPЍpPP` xhv0\S   @00C@0i 0Sd"40040@FEA-p MaP 3/@P=@P 0 (00 0<1R 0@ Ѝ0 @P    P0Q" #Ȁ!0 r@BP 0 @0@ 0QPQT 00 803/@P  P尌 ]DRSPFFE@-00 0 Ѝh@@O-pP0$M 0*@PÌ@P $Ѝ0 (00 01R 0 ᑌ@ L P03/@Pe `Qn` ^VZ: UPH000 PP H   >P  W@PP { 0 0 0u  `- #P *|0!0R:b P@1P `0S1@01@Q00 P ]EF@- 0000 00[Ѝh@A-M` pgP&# Ѝ(0 ( W  R  0D@P  V #@(0 u(0@P0C(0P$P @@$0 0@-@MP YP 0S 40 R 0#P<Ѝ0ɚ;0 <08 SD @R C0BP// 800C80@0~@-@ 0@x>O-Uܐܠ`̰PUV |{0 00HP0\@P `N@@ p @@D\0岤 $`0 ,0_~U ~~\\|O-LMP0D0p0D 00RZ(Y`t    ""20x0x \20\2p0S@t0p@3080X00t004082 P x4S @t  $R 1DypwLЍ00 ?o2Y0S 9@00SL 40 S R08TC0PI@ZD Nt00001`7 DR   Y;4 10R0 D0p 3/0@S000Y1;ò10PD0Y[pYY T0P t0   z PayP00 R0S D0(0 D0S 0c 0`(0 0003 R80 R00S3Q. `# ,  , R& S 0!Spx 00 N@H0P$0  H0 `0 @P(6<00 $@ 0S@@ [fYu0o Ti h2 0{b W p00 KK@C{0`H01`:0 @$06@0<0S,S0$ 0H`\p:XP#:0 P000L !4040T 00 0C0000 00C00 R0000C0 0SK (0p`D(00(0p*TY(`t0000 Y p{ [ p p0WpS@@T 0[00Sx  @@0 p04/'@(@#@ @p0ꐄ\~rVI0O-@`'~0s@! !@-@ss@s P4:A-`TȀ@Upʀ 0! $ 0  , !|0 ,0Hd0 0!!T0    !/Hzhzlz~@-0 @Q# ЍhQ:!<P, i` @%P 00@H 0TD@D0<0RH0~G-RpP`0<  ( 07`{ 0R<8 P0D @R, @ BPS@P P 㭲PP 0L00H@40B300\00T0X00 W 00 'JX0ST0S@L@T@Pn_G-@R`1 0)K{TPP2  IT@(0 0(0PQpXT0S@L@Tp0pWP0@ppQPp@T7n_A-@R0 {p0 S00 S<8`^D@P\N0L^0R0ST0S@L@T@Po_A-`@PpTXUd 0000 0R'X 0S UQ 1QT0S0T0@1Q U? 0 @P@?0P00@pU. 0#! RQ  3SHL0SP0\00<0CR1Q0/I 00080 080L@A~x o_@-@P L0T0p@-@QpT0PS@0L@T@0Q 0 00000 p@hQ/T RT 0 0SXp@-@QL0LPpS  Q QP0 R00S0T@@0Q 0 00000 p@.p@-PL@Q``UQV 80y`0S0C0000800C80Q 0S L`L0SP0  RpT0pPE0{*L`8o_@-@@0S87@-@P1 < @#0D0 Ѝ0A-0Xp@P` U[<S !P  P71S010SP0 R0蘄p@-4$P 4`0?RL1S(@pP ,!80R 0,1010:01 010 `2@P 00000111010044P0P041418181@1@1D1D1H1H1d00 P -00111100!1.01 0.000003/P %V 101~p@-L@Q0L00P0T0]PL0SO-(ppP U [  w@`(@P U U PP  H@L BÌ\PTX0"( 000P G GG]No_@-P `@P   ^GЍp7@-P@000T Ѝ0.00@0s@-X,`0 ( P@\  mo0@00U Ѝpso@-DP0P@-;P/ R/@- @@z@谹~@-X0@P0X0 ЍQ#P,p@` o000S X0 o0P00V U X0, 0X0os@-P`Q o0@00V pЍpn 00S/%F垹7@-@00PW000U  Ѝ0@R Ѝ00BSp@-P@`rPP  $0S0$S0ĕ`pho_p@- 0PS`(M  r@P- (Ѝp0  3x@P0rV" 0;;0@P R 0  R ! s@P  s@ 0 S@ R  r@P Swp@-M0000`P @P x00Ѝp@-Pp`w@P @rw Ѝ0@-AMP@ fP Aߍ0s@-P`w@P @QwЍpO-pM`P8< jwP (0S =w&@Ѝ x@P 2w 00PY 00 t 0} !4* S  #@i,t@Pb!401  504DT04S0S 0 P\v0H(0=0@0  0$ 0 1 ::8C81@PgPTP 0000Q%v3 xvY ٴ|(.  y3 w-@v40 3x@@ @_b_]@-Pp`w@P5y1%@* t0`P!300$@I @1P pP% 0110 $R 0V SD1d EZv Ѝ0 `S1 @01@ !t@ 0@-AMP@ >P Aߍ0G-L1p30Ma0$000P 0 {@P/$0 (00000 0 m@P*$0r,0 WP@ @T (r@P , =w( 9w0Ѝ, Hw ( BwG-Pp|UUpW @0 S0S``F``T@PuP Qu@O-`RZPP Ѝpİ@0 T    R R @ 0qP0p sUXp 0pGp@@JZpP qo_O-tM  ᜀM 0X  aW RD R(@OZp R<@P  A0$ (\?<" REP 0 0 0$ 008A 4/ 0@0BPS 0^ pP  7U ! RdY@0p o@P 00W YtЍ0p  FJ VP Y PC#P U RYP00XP PU@ hQ @U H R   @YT @@{o_FA-PM`p u@P 400000 0(@tЍ7@-P u@P z@rt Ѝ0p@-`PV M  V00 R0S@"  t@P0V 0@0  #  Do@P  Rt Ѝp "`]@-50S@,M[3221P0 a p 0@PF0 000$000u@P& (00(0 (00(0 1:11:1010 S;305<0@T $ Ru Lu $ 1u -u 00$00,Ѝs@-`PPt@P19@ 00003/@sЍps@-`P5t@P 00403/@sЍp@-pP) cP@  nPT@ 0 S05 \x oPV  o Ѝ0T@000ho_0p@-M00000P0` @P #0@P PsP rލp@-p PP`IM  >n@P0 0000 0@P # 0@P P_sP rIߍ@-pP/ cP@"  nP0S ЍT@  lR   oPV  o0S0T@00ho_p@-0M@P` GA 000 00 00 0 0`4,0000,PP #0PP 0Ѝp@-P4M`p m@P043,0$0 S0 0@P $0S  @P P 4Ѝ 0o@ P T z n@{o_O-PPlM%  (qm@PmB00S@h8(8xP- ( 80,00< (0 @, Q00(0D2 , 000 r@PF0DT?0` S;# p0 @ts0S@' 10@" H+m@P↲ :`0P @X0 S$0 00  H0P #0@?oV20S@ P hTV0`D@ rlЍX0S- 0HL@P H0 Hd0n@P`0`0S 8(,08< SP00@ S00S p $ H!@P P000ɚ;6e{o_@-@0M 0P 0#܍@-@0M 0P 0#܍G- `VpP(  R0U@᫨PP 0L00 H@$ B# \PT0X0Y P slpP 0BS'@V@ V p T0 R $R ÕPpx0311  U`XpV 0 0F0ER4000  R`ho_qo_O-MP 0 4qM Q6 Q(@AU` R. 4  0$0 8^4?o2Q0S7Q=@20SF WP? U P?8@` k@P @0V UЍ@`00\J 00 0@P  RM[00 0 @P P0 Q00 04A004/0@P0 0* R tT00#T0S  T 0 0$; |ޱ hU T00S 0@ 0HU0K@@{o_FӀA-`MpP p@P 0 Y0 TЍ000! @Qp0-4M$0(0,00000 000 00 00  0 04Ѝp@-@(MP` kP3`$00 (ЍpO-DM`  yp@P0P S;# p0 ts0S 0 P0p0U@DЍ j0Pⅲ! 8p0P ,0 <0k0PP{o_-/-/-/p@-^. ` 00S0S0000 0 0 0h 0@@0 PP00@@0P !@100D1 0pp~O-P0㄰U`!R `VP R@ R R ppG'qZY08/07@-@00PẰ000U  Ѝ0@ Ѝ00R0 0S  0Q >] @- @-p@-@0`PVp@0 `Pᇰp@~p@-@P0S 1`0D0`H`@0L0@0pp@-@P C P (@PS@-@-p@-@TpP0P R  RpPp@ R   R4n Q  101po_@-C-@MP_` 0` P 1 p`00___ __0S PЍ_`sC-0`S' 0S$0S P@1,  B0001,0 (00C  @Z0(00M  XЍpdno_o_p@-P@e Pp00Fp@-@  000S0S P A-@pP`V 呯pί>Rp0S 0`V`x` 0S P 0S 0SDn@eA0婯6P A~΀~@-@5p@-0@SP 0S%Q0S 0S PRP0D@Pp0S@`00d mP p訄~o_@-@P,80 S 08  @< @I΀~p@-@PpP 0  p@;(0 S 000C~p@-@P400C40% 6p@l~p@-@`P᢯ᠯ 0 ` ᘯFp@B1M/ @- ^  0S 0S00Pm)o_A-@`pPP 00S0pO-o@P4m厮Sc0S 0S 3 dpWp倓pW[^Pc<0880娮XdqH &mp[p0 Rq  o4Rl 8 Ri ( RcpW`  2Q[ X  R  @ 0  0 jhd 0 5 Y 1l [ 0SXpБWQ{(帑X 0娑X  8   8  0 0    O  B 0 R d0S 0 0@000000  kp0Wp. 00 峭(0S 00S 8 R4 S 0 0S  po_΀~X?~΀\V0S p@-0S pP@1` 0  0S 峭/O-PM0S@i@0%@e@`0@0  p :0_`PR 0,0X000`]4&%@P <@T ,bPOO,0@j@00@0(O@10@0$0 00D0, @0_@P O\ TK0 0$pbO@00@0Ѝ @O-pDM@0%@(@0@0P'⩢ D:0`P @ T0,00`]4$@P  ᭢ @00@0DЍ0S&@!_@P嶬`V=@ 0R )@CO ߬001 0P @`0S $J$ 9$0$0@0@01`0D0\H\@0L0@0@0 DD9@00@0 `@P 00S p@0@ 0 { 0Sls/ 0O-DM!2P`p0'>`B` 0`,` 0 08p4($ P0 00!'> 0`,`0 08p4($ P{0 00!'> ,`0  0 8p40P($ Pd 0!'>X ,` 0 08p40P($ PM 0!1 ,` 0 04p0($ P70 00!0 ,`0 04p0($ P" T``$@a @0`@sP (FjDЍ^~^o_o_p_ V p_0@-00PSUP`- P!0 C  SJ,10SF @P0S S S  @0R00 @0R 0 0@0@ Ѝ @0R00p0S S S *@@0@ D@@00S @*@ꨄO-pM00CS@t#0a 0N P$@@10 Rk $0Q0[0!0 @-P3 0~O-3#CDM  J FZ0S00   8 < 8P`cP$PP3 00@3 YPP PP00#3[003 PP PP00}[ pRԢ(Hg V""0&5a V00 S"0  0 ,OTVYpeYW0P<"[x 02`  2?>L0 ,00! ! (0 0 00`$ -@p'1少 01 00` 0,p(@$ @l 0lQ!h1 00` 0,p(@$ P @y 0E 0 0!1 00` 0,p(@$ @y0E 0 0!0 0 00`,p(@$ @yDЍO%>0  dW~GGp_x>p_,,p_p_(p_p_Ȅ@GWp_ĄlWp_p_p_p_WCp_  @-U0PbW~p_000V-P @P\^\ l~p@-@P0  Pp|Yp@-``BBp ,ʠ,V P\ 0$000 0T00pT00T0p@#$ W@-@P`IYHFY 0"00000 00 t00 0#q_+q_!CeGG-p`DRDX($0 S* [@P8 0000妣p S R I0$ 0C#2 BS*p@TX@( 0`00Y2003 D徣B?,x u00 0?P0` |@TX 0#0L0R    X@X 00 000$0l0 PSp  p p0l U 2%nG~!p@-40P (a/[@P <UP00p~@-@X`@Xp@-@000p]Y05000  00;080)000 Q :00`P =>09#900S? ) 0R9ڜ  I S `P 40083/â0` =V0 %c% Y 0S 1pp@|Q t  | x x |000900000 0S"Xw0p@ ZxS0000 |  @|    , 0C1p@XGpG~@Gp@-@P`aMp@蛢Gp@-@V0  `<00 02H PU 0 00p@/0 vp@Xp@m3q_p@-S  P8 jl0Sp p p0l O  @P  0!P ?x E4 PllpA d0ic1p0:a!uP00G~@-pM(pp@,`PP+ 0  0V060000T0#T20T20SrP V0 0 0 V0S PЍ0S P 0 0 0 rPrP@- (pP @ P@P $0 8<`P Ѝ`U0@0O-0Dp`8 P @ P娞븀4@<0Y@P@0  <`P Ѝ [P ˞ 10 Vპ@`0@0GA-P`pq 09@P 0 p 0 0(90回AEA哞G0/~202/@o/ 0R:****1//p@-@|P00 dS(0 1D 0 D00@0D0(0(01@  B@ P00P0p@RH@-P`pAT 0S *1P A030#A(0000S  ЍA- P$`@ZV Z Q+ a 0R010 &` &Н0 S(0 1D 0 (00a@00C@0U *A7A 0R010 0A UHH@-@0Md墝`2S D!0,0D2N0, N 40  N 84N8< $N$ @<(,N,(D@04N40DH<  8N<8 HL$$@DND@$LP((HLNLH(PT,,PTNPTTT X 4u*0 00000Ѝ@IHX?Hp@-]@L %Pp@C PT0QP3Q/0@-@P|@0S0(@\DLP00L0P00CP0T00T00Q0HD?H20C22S/0@-PR@X0\M0 0S\Ѝ0. "0 XSX0# t0 0 P4/0O-p048 X001 0A S *0D!000@ Ѝ  0 0i "!W]0^ 0NP D!00000  `D!000$YX)00`V`W`V D!@000t @~D!@000g ?`pV D! 00 0D!@000Q80H@-900pЍO-0$ML0  82p 0S *("D!000,$Ѝ@ FH0]`V hP z@ 1s !z6 1sP` @N0S2  1 I00>0000@001 :#:0 1!rd 0N P U  MD!(00(0P` 0~P@ U 8D!000$pW.D!000V UH0PpD!000HO-d2P 0$MS ao@pQH0S< 1s@2K@N0S2  1 I00>00ġL001:#:0 1!c 0N P sD! @(00(0\$ЍA81T b !D!$00$0K2 @ *0.SY Y+0.S (0000S X 0 0CX:009"@ *D( \>@,T X0 0000$ D! 00 0 HO-Mp80 0 0S:RP0b00T @ 0 S᪚`0cV`V``FHZSܚWs R` $@ 0 80)0  *' {"V "|v P0(  0P0D00`0D0yD娚T a_[W 0 W9 .R6 .R3  ! `1 ЍO 0=0P0 Q L  L 00 L0`V*n ;y'*=!R 01a@ЍHHD?G-`0 S@Pap ZPp` Qq aKGH0S 0 0 /1M0Ѝ//0S/9@- 00 Ѝ^@-0)  0?Ѝ^@- 0  Ѝ^@-@1;P 8;P 4;p@;$00S/p@-@P$$Pp@-@$0P@;,0 R P/20O-@Q1DM0 00 @@@GX1pTa 0 0 @@@G z4L0A@(0000p0<8 00 40p,@$@ @@ @0 0<08 <0,(p$@@ @t\00'>0,(p$@ `@ @<08 cDЍ@q_q_섀q_q_q_A-@P0S`Pp0S  ! ~JQPW\PQ 0L 0000 0C00S  ! `J8섀p@-@TpP`Pzⲗ 04R00 0 FJ00p@(Hp@-@`T H@ 0 StPz⍗0S 0R00 0 0 8000R 0P0@嵗@pH@(p@-@Pj00C0p@褗(O-`40@SPp0I  0SBQ  0RPCS 4 ! I$0 0S1z61000 0PS+jHp `000000 00 00 00 A 000S 0 @ Ѝ R RQ 00 0R0008섀@(A-@p`PUddG0Pp `P00S 0 000$ 000 00P8섀A-@ `PY00pQ_U0S0 R\S  ! 0< 0C0 00C 00 0C0 0pAq_섀p@-@0PS`#00\ p0S0S 0S0 0S0/P: P/O-EM0@1 `Q1P$ @1100(0,0`V4`990S00,0V@,0S  C, /  C@ UK0@TK@0(S,0 0P 8U 88Eߍ880 =P@@p@@0, (p@W=0S K@T P`= I@Pp@11 00S  pI@P xK0(0 :@0 0D02< (H00L0z_P0 PLC1 X1V1000P @0 Ѝ 0    0 0A1'1 0@000 0S 0 6 APP) MU  6P CP@U 0 0  P10Pu0 7SP PUPPT  000 C 00 Tr_ H0R  R/R20R/20@-@~1@ z1@-@ s1 @  p@-PO@P 0+@P 0#pp@-P`>@P P 0+LPP@ pQ@-@@P 0k@-0@S 215000p@-PPEUPp@"1PpO-M<00`$008, 0000 $0 @0C@0000P@ <0$@S x?0S 00@0<00 900000@T 0S 0   f?C0 P 00P 00001$@@?Y 0 >00@ /Q 0S  @/0 P 0S  @ 0 0T 0 P /0P /0圝00N0S 0p- 0PP 0 pQ  01 P 1PRx K0 pRn j0 D@00 00 R000 0: 00 00 0 /R RH@D  0Dp@T0P 0 0000`0"P0     -: 0 000C0+  Q  000T0 `0P `PO0 00  ' RR T徴/ D ` H [aH0S R 0S 00 C0H DPMH00D000S 0S0*000 0S C0S ..00000050SM /P 0`0` R   W~ UeTg`P .0`0 0 000` PH ` -[^ DP C Rf .      $0 R   000 000000$00f$0 10 0K0S `00S`0SP0`  H/P`  R Q0  `P7/P 0P 0./TY\.DP` -[H <C00DH0D 3TP H.SO009   R C R C0 .0D00H0C0S 0C0A 000 00C 080S0S 000(07S0$0 S$ 3000 (0@ i>P @DP -- .L0 `00K&0Lp`t0P@dp@(0` k@@[ .px.,0S50S 1 40.,0/@ 0 P@R 0  {R P0X@}T }@' 0/T 0X k@/Th HoP`40J  [ */T P P 0 6X0S 0X0SM 0X0Sa 0X0S 0X0S 0X0S 0X0S 0X0S 0X0S' 0X0SC 0X0S] 0Xu0Sr Pl/;%:6/T0X @/T P  [:*/T lPP/@/T0X2 5@/T2 0P* 3 0 S* 0/T P P200/@0XO0S    -0 0 S%:-?/@/Tj 0X @/T TP D  [ */T( P P=/@/TT0X @/T P40 1i  [ */TPP/@/T: 0X @/T poP `M  [ */TD P P/@/T$ 0X @/T SP0 0 S* 0/T P P0l/@/T 0X 4@/T1 4P)  [ l*/TlPP/@Tr_F@v0_s_n0_r_G0_xG|G20_S^|_r_R^P0_tFxF+0_S^?_r_G^R_s_/T0X @/T DP: 90\  TSF  [ .*/TP PT/@/T0X @/T P980  T1F  [ */TP/@/T0X @/T  @P98/@/T0X @ 0/@ /@/@@ 0}T {  R00Ǘ0 j00 0 b},0( 0 00/S+00S0 00 .R  .R0/S0 0 00+(0 0 /RC 0D0+0H00 00S D0H 0 090H@DT{ 0TP C0S8 V+0C00D0e+ Hz+0D0SY P) H  Q   4 RK 0CSHC0SC 3+( 0 00 00C0>><:7+L4+2+   R& 0CS#H%+000000sC0S +H+00000000S: 0CS_F++00 RH R=0C00D0@P *D@D00H00 0S $0 Ѝ H R /&@-(0M00    0 00  i@ Ѝ0@-0M(0000 000000000  M@ ЍA-0@P0MKP?PX/JPPPR`(p>,0P0,004P 0`,0P:48 (P@p`$0^:PP2804 Q0C00 0,0ɀ,.Q .R: :9,0j*0 0PS 2=00U P `0P000@0Ѝ3*0S P +*P ,0 \+/ R0S ,0 0 -`P *VA- 00S : E0pP`900@   0S P )@00WP@.@P )s_-s_0@- DMP ^@, 0^ 0^ ^P  LE 00 07U4PP00DЍ0@ ^Is_A-P`p@P P 0 P0 A-P`p@P0 @Ѝ0 G-P`ሀ#pĆ@0T00/ 0P0T峆2)P @ ,PV  6/P 00S0P00P0҆#*P07@- 0PO @P  V>C Ѝ0ss_p@-P```@ P@j @fvH  ` \ 0!pI8 @-@ PȌ<0(H0P @C"8p@-P_"@@ c"@pn p@-PT"P@@@ R"@p] @-@I"@A-P`P 00묀p@TK00 0S0PPP@ 0S@1 6V P@I8p@-@Q `P @ P00S Pp  ` @V opp,p@-P`'@0 R000@00P0@pp@-@%P 0Pᨅ 0R 00/ 0P0܅p@'0A-`@VPQpዅ0000@@@…VA pz 0R 00/ 尅UPO-`M@'$Pرء$008PI8@!OCAd@ 0|P p?oU20SR XPUPrN0 S   '* pW ,PÚ `9pP : 'WP#( !<8p :WX R0 R (P I%P ڔ  BR* ('W ЍX?gfff@-@A0 !!|0x0t0l000, !  ! 40 @PuAs_HzhzlzY_v_ 0 F80F80(G8p@-P`6 (0P0P0P@0.*&PP0`` }0 0@0D岄pI8A-Pph0`V墄@ @P h`00 N/ V?U 0WI=.Pd0$0d0PP @@I0(F8 0 (F80 (F80@-0MS@PW@P@ 0  gWP W@P@ B&Ѝ00@-@P0VP0S# S  Ѝ0`@P Qqp  0'P 8`&VUP0P (`@0@ R/"A-P` ƒ1@S0101p F@ 01$@ᮃ 0ShAqAXA Q PQ1@0108IDp@-P'000@ 00倃,0$ R @@0@嶃@pI8@-@P H4j 0$R 0 塃@&I8;s@-P`@P !0R!0RЍpA-`pP@PЍU$R0*d PP*R0*C-cMP P P8 P/d3qpTAH3 sr* <"( "AS P* 5@8T ?Ѝ ?@2@PP( PPR D0Sd00Cd0L 3/d0@P0Cd0G4Pb@H0 4R90d00d0 @Pd NAr姂@T8埂0SKڂU S?哂Q@TA͂I?3 D?$ P(1x B哂h@h0P?h@0 P $ 00$0%0$0@ȁSKs_t_s_2:t_et_t_譀e^8>u_@It_u_]^T^u_0u_t_u2p@-P%`@P,P ` 0`  @@p@FI8O-0dM`删匐0@ p0 I4@P dЍ0S @  @<PP @p13 00 00@PM80 gpPp 0庁 @PT0P00L@$@(0W2T$@T8P ?$@P >@0S 2$@@@0!@P 8%$0 8000a0A8P$!P^  PBg2 RB L0S=$Y: V V4@ᒁH V  V ᗩ C၁ $ V ᇩ V # # y [ # @]0V# # 00 #0PWCB3@P #0 0  hP0400/W qu_Ӏ_u_@Ӏ8p@-P`݀\0@T Q   4 p@L$ R R @I8G-@VpP3 P000嶀`@00  0'00& PP( 0@`000`A`0րW 0P440PP !PP 0帀0`0V0PW`pW <4?zV  #u_u_7@-`0P @P  P N?U.00,V? O? Ѝ08u_u_O-pP0$M`! 90@P $  ] P N?U.0  V? $?p V  V<V X<X L<s@P$Ѝ8u_i^u_v_v_@-@< @Cv_@-$0C00S@Yd0P0S R 0 R 0S 0S/008@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ @- 0 0$00Ѝ@- 0 0Ѝ@- 0 0Ѝ@- 0 0Ѝ@- 0 0Ѝp@-@H0  9PH0 0\10H00A PA+00Q00@@@pX"0O-DM 00(00!1@p`0< 0800p,`$@ @@ @j 0'Q!18 P0<0,p(`$@@ @T0 00!018 0<0,p(`$@@ @A0 00!08 0<0,p(`$@@ @. 0!0P8 0<0,p(`$@ P@ @ *"0 T @~%DЍO1 0@0X]_^_v_iv_rv_`O-phQ`PM@8~P 04PP$W y~d@T`@T!~ 2P P 0 < tP { ~ PЍA @0 < tP03 0<300~0:~% @ G O-`P0M@ B2 b061(" pN 0 00@ 0 H4pP~ؠd@T`@TE~)R0t0 D 70P s t03~0pЍ  @)R0t 0 D 0P  @G p@-P@ P00CS 00 Ñ"`0St t0x 0`@x000p7@-@000 0 Qo Ѝ0O-P`㸀M v 0UЍ'J0J@V@ V d8< d  0PP Pz y 1/ |v_p@-@P`t}*p@}`H0 /p@-@DPe}H09H00 Q1  . p@}X`p@-l t0@SP Sxxtx0t H0; Sd0S0000p@ !CeGp@- t0PS@ Sxxtx0t H0; S `@0St t0x Px@pd0S 0\`S S PP  0S 0@ d@z!Ce@-0@  R  R / R      + 8 R QX0;0/O-,MP0S`0Q@`,` p7|0PU W@@hP  V   J0'0` V`p|@,Ѝd d| 77` y|d V Bd 0p@I@IG-Q-PBM:p(1SP5R`<1@0zN@P@)@ O?P@D | P Ġ Z P @D@Bߍ   6PP 6PP  e @J@- @ 000 0000p0`0P0@0x0|0p@-M`P@0(@0 0`P Ѝp,p@-M`P@0(@0 0`P} Ѝp,P0/^v_@-@aM  |q0U d40  H0`0L 0/0 4 $X80$S-! !Q p E8\0 0X0<8T00" "48= /80 00dt&8`P`0FSX8 4L8aߍ8^^^mw_v_g^Z^v_v_ w_3w_Fw_T^]w_@-@P (80S7@1&^Z^C-`00VM@YP# 0 PZ1p{dPUZ{V0t  9 00H{ 0&R0S YP ЍPz@PT0SdP.{U V0Gw_w_p@-PHzD0@T0{pPh@d00d0@I0P/p@-P@ p 1Fx01000.%/&.%/&  N +VU +# + 1|0pO-`$ML@PpH NP08VN 1U㬁$10SI  @?0P 0l<\00 ᵢY  $Ѝ P1 ! V0[ V I08/P 0V+cCW p 0V8/P  H0UNR@4PP0 05/P +`$К@[T0@-p0MPU U@ UPЍ0Ѝ0@  /00Ѝ0@I0    4 6::0070/0/0/X00/^-/0 0/00/00/00/00/0 0/O-QMp)a@P;y0` |a0S@l@@T&WXH!D1 @͹4y0  0S80 S 00BQ0B03!P 0S T( y !!P0   - Xy0S T  KyXX?`]-_-0/0040/0H0/-L/0P0/T0S000/p@-P $0D@$@@T@py$@ @T@Sy|p@-P@ y Pp@Fy|p@-@,Py 0 0 0O8yp|Q3oO-M  @ (R02@PBU1# (pU< ` P``0 V@P 0|3@P( 0t3@P  ,n3@P@  h3@`0V %0U ߍ`PC-$M@p000 00(00@ 0 ( 0P1 0  !00 `0`1.` 0s.`P  # w8$Ѝ<  ` I:^p@-P@`M$ 7 !|`|+Ѝpp@-@P`M< &!! i+@-Ѝp@-DMp `P=@P 0P,@@00P(4@P DЍ .@C-p`M!(+PP*0@S+   0P0`'0*PK0  000`0&0*PK0S@! @+Pg-ЍyKxA-Pp@Pdu` 0/S 6@P0 Ѝ0 rdu@ 0/S J6@-pPdw`j@ Ѝ0/S {6@P000V0@/S %6A-pMpP`@PE?`00\@4@80(4d@P OpЍHPI0S@0!0000 00!0$0100! `(0 `q,@P D*@P 0`F0`@-Mq` P8@P 0,00000@0'4x@P 0S ,K,0P@Ѝ@0@0$0, 00:#:D0@0)@Pz@-P !M`#q @P 0,00@0000p'4/@P @T ,,T ec@ЍG@0@0$0 0 00+8+D 00, @0k+@PE. G-M⨀`P p@P @P0@0'@@P($pY ,H0SD00 SD0 .R0.S 0t00Sp280x00L0 0P0&L|@P0d``PSx08x0V +0tS00.S @cS0 .R0.Sm 0W@V0T03/@PP0 `@P@U `PUX @5 0R'S)XD X 0S#YH 0RD @P 0 8 *0@X03/  ЍS@@UV q+o+0X03/ +zU v8 + qo@@@8 @-DMPp @P`P @DЍ0,00000@0A&4@PP0!0S U@0SU  @ , d*@n @, )@,*UC-1@3p MaYP9+ 0 4@P,d@P'L10S 8 B0<00@00000%D@P (0S" ,<p*,(0P(@Ѝ~  pP @P0P0$0,( <0P0T0< P0*@P(,Fy_@-@K@ t|O-LM05@`pP$ P.A8. $00pY[XX |0S0oS  %(p0|0|0H S4*3| ` S.PA 0S y$P6Y( LЍV0 (p3P Tx4Q (>`(`Pf0((0pP 00 ((q(pP$P `! `G |0S 5$P @ 00P00&P0 P0Pt0 M850|0p 0M( tZ[| 0  .|0 P0B-t0S Jets $0  @2 0   0S 0p0 0\&PT PO0s M8M( 0% 000010! 0 000 |0 PV  p Z ( M(  A +#R0tZTU 0 ~P Vm0040z   R Un 0 bPf VQ000|00 `0$PS `-^(^U_|w]y_y_@- 0 0 0000 ЍA-pPMw@P 0@00<@@0#D.@P DPЍ(`>P(0 @@0P 0%@P 0 0@ X@T(Ps0S ILs|s@-`x@PЍp0rP @00!00@P000,sC-P@ЀАpM0 0S `P gQ! T@ /0 /!bR0 0SPU 0@ ЍĺW4^QX?y_@-@-3\M` @P 0P0 SHWWWWLWWWWWXWxWWWHW, `@P,  1\Ѝ P @P (-@$ Pp @P$ ( Pc +@P  @P(  p+@P( +@P  +@P@ `4@P@ @ +@Pp@ `+@P @P@ 0000p@ `+@Pv @Pp  ,`@ +@Pd @pZ+`z+@P RP w@zZ@D^@-@M `+P ЍG-@!MS$ ` p! WP0O80-PP%W$! P?@0Sp 0}<P0@0 P ǙU Ѝ P@ Ȑ  P00/S S 80SP +4@+  Tr_@-PX0M`p j@P 0 0 0{@ Ѝ^p@-@`L 0P@P +@p @-PM p` 0@P  04 00#0G@/Ѝp@-@`Lp 0P@P +@ap O-1MP`@0DQ`@ p=0 0jP*[0$0P 00 00PU@ @0 3/0P@UT@H0@00-x0ЍUT*0 0 0P@0 3/0P WP P@ r_@-0 000Ѝ h@G-p`i/@P.0 . 0S@ !t#PPY %$@@G0S&   /P  PᐘP @.Ѝ @ T  `@ TG-0Pq$@ "@` P  PPPO} "$! G}0@-Mp 00000` 0:"@P.@P 0lP0S q%@.Ѝ@!"@d%Tp@-@MP `@P U?000,@@0X 4@P @Ѝp000S@@!"@P3%/0s@- Q@P $P@`|300͗Ѝp0 0p@-M 00000P 0`!@P0 @P?ЍpG-5(M@L` CP@ q$$y/P 0 00000 0H  0 00 0@P $ A/(Ѝ $0R  6/$0  ?1P$00PP$$  / C-p0MR`P0';mP 0 3/@EmNT T+ /du40000 000@S -꘩@ @P0/S -@P0  Ѝ€@-p0@ @`PP @ (0 Q@ Ѝ@- 000@0 cP 00Ѝ@- 00 0@0P 00Ѝs@-@ PR0`00BS :00S03P R30Ѝps! ! C- pሐP@``V`31P01 0 @PP  ЍH0p@-0P@0P 000S 0 p@Fp-p0ASG-Pp@ `'PP00S!3 T` TS @P0p@-`M 0000 0PH @P @P T0P00L@$@(0T$@P `Ѝp8`p@nT  m'@P`0 0S030z(@P 0S@3:p(@O-P0!M0#q` 0000 0@PcUPd  b-@PX  a@PF@T0SG  m@P  R @P  }-P 0S-@*" M 0$  @P  0Mm0X  X m 0 P@P" 0  4-Ѝ-@@@- x Ѝ@-M pP 0`p@P @P`@Td@Ѝ@-M@ 0P 'ЍA-M P` 0p9@P @Pp@T 00 00@dЍs@-P@P< 0`00@P l'@ ,Ѝp O-P0M 0000p0 `@P   @PpP @Ѝ0@00@<0'D@PN(`V@Pc$0 0АԀ0:#:T0: S"  S-  S0 @,<!,P6 V, ) S  S0xy,P0 P0< ( 0,-(P0< P@P ( 0 ,<B"@P ,<u!,x@-@# Ѝ@@iЍ@- c Ѝ@-!  Ѝ0 cT cp@-HMP\0  1 1 0+@P+X@P$0`800 @4`0 <F@P 0$S@0S 0R@4 j @$c!$uqHЍp@4!$ 0Pf PL^^@-; 000c0 Ѝ@- 0;0 00Ѝ0 c1 0c+0(00@-DM @P$P0@,P0000!4V@P l0S00, 0P P W@DЍ0  ,e!@P ,  0c 00 c@-0S@`@P*0P @ 0,Q@ 0P000 1/@)ЍpC-pM`)PP 0) @Ѝ 0,Q !!1/@P N@@)00@-MA0 0@OЍ0C-pM`)PP 0) @Ѝ 0,Q !!1/@P O@@q)00@-MA0 0@OЍ0C-SDM@`p- ` U_E_@P"00P,@@0@|Q4 P(3)4 4P@P yWSDЍoX@ cl`@`  ~@P N@0@-0 c Ѝ@- 00 Ѝp@-@M` Pd@P0P,@@00P4@P 0@ЍpP@ @-0 c Ѝ0@-MPP @@0cP $Ѝ00@-MPP @0cP $Ѝ00@- 0MP 00P@3P $Ѝ0@00@- 00 cn Ѝ@- 00f Ѝs@-P@0` @P u@_ Ѝp^@-P`(@P 0 p`@Ka( Ѝs@-P@0` @P J@4 Ѝp^s@-P0` D0D0 0@P B@0 Ѝp^^0@-0 c Ѝs@-P`j(@P0 %@(Ѝp@- 00 Ѝs@-P@0` |@P  @ Ѝp^@-P$0` L0L0 0t@P@0 )@ Ѝp^^0@-000 c Ѝ@-PH0` A@P00 0@ Ѝp^@-P` '@P @0@'Ѝp@-00 00 Ѝ@-P` '@P 0 00@'Ѝp@-PD0` @P@0 @ s Ѝp^@-PH0` @P00 0@ \ Ѝp^G-M0`@S11\p @T᤻0s_᜻ 0s0Sp 0PPp?X0!(PP 0 SP? P0UPP(R0 s` 0 s pUZ0!(00PW  0S  !PP Ѝ 0s9P0PP^^p@-PM`'@P @0 @0c0 f@&Ѝp@-  00 0 0030 SЍ@-0 cHЍC-LM@hPP$ l0S (!P(0 !R x S:LЍ/``0 1S<0Q*!!? 0  0@B@- 00 @0 Ѝ@-P` &@P @0  00@M&Ѝp0@-0  Ѝp@- 0MS@$P0` @Px20S@ b@P!@PY #!@ Ѝp^p@-P@1&0P @ 0<Q-@ 1/@%pp@-PM?&@P0L` 0 0 u@%ЍpG-PM &@P2 0 @+ 000  0- @`@0! 0 J R@@`pXP0  6@%Ѝ@p@-PM%@P0L` 0 0 @h~%Ѝp0@-c 000, Ѝ0@-00$ Ѝ@-0c 0 Ѝ@- c 0 Ѝ0c00 c0+c@-`MPp%@P 0 @ 0 @@P0 04@0@0S 0 -00%ЍF@-,0@31!$ p@-P`Mt x@T0@&0S00P0!@PRЍp07@-<P S@P@ Ѝ0^O- ` 0M&J0 S1 0C 0 p %@P 0  @ PT 0S@  0 @$@Ѝ@G- `@ 0p%J0!S B   $@P 0  @ PP 0S@  0@^ t$Ѝ@@-@(e$0S( ( (0$ @eI@-@, 0e,0$ @R$$ ((0eI0S ( #P QS//A-@exPx` 0S0hP 0X` &p0S Q R$0I0@-@ 0 %@eꄉI00CS0/@-@P $ 600C0@ ꄉ0M, 0S00Ѝ/p@-Pp0 0AT 0S P 0SP@p0S000 @ꄉA-p䀟3AT d`P5e0S @000)ePU PPhdX0 $3`U3@103 P000 @I@031SQ  R R0/0A-`@P 0pS00Q%P P 00 k%h%V LdDPD`P 0$0 dI@-@M @kd@ fd|$0l 0 ` `0 X 00  , $0 ЍIz_ z_XX0?z_1S/p@-P`t=dAT`xd\@Q p0S `` ```@` $_IA-p` P0@p@pPP0PPP d 0 0! ACdIp@-P@`c0P 0 1S 01  0S 0 0000p@!dI * ' $G-PP0S0C00q0S u$0SB $c00Gc`c3}?@T cV @ $` R   R  R R R @ 0S  B 00 0003``}?00GQ$ꄉI@-P0S003@oѠ@-P003@oO-`P@& PpW@! ̀Jc `#뼐崠@TW030V@ @00 |@P WdPkc0U 0S  3R  P $@ꄉI@-K0@-E@DcJp@-00S-@ `P4@P V\ }cP#@b@P ('cp@@ @,JA-@t`pb0@00LcHPp `B0S0P0P0`Ip@-@P`b@b)PXIp0S0 R S   B3pIG-0 PP;0`0SE6P ,10S00@S00# 0S) 9#bb`p 0S00bpW`0;00S0C0" 0S #pFb0l0Xb00 # 0 3/`Pp0#,I7@-P\P00@1S  DP0$T Ѝ0@-@- 8 RA-P`@Pp ;RV@ @AR8P_V@GH034ꬉ0P R05/p@-@@P0SSpFP@-@ P T@pP P p@-PX0 0ATp 0R 0R[P @ꬉG- P@M IU `D` 00@0$V0:Pp a01S a0 H0L 0 H0P0L T 0P0 T %R0XP5\p5`P0pz_z_@JA-0@S`; Q@ZaԀpX<`0SN ؀0V0@0@@000,1@⑺ A 0R1@D∺0S  B2 S3* 00"#R 30[%0@00P-R00- `0S00C0 00@0@@V0@LA8a@JD?X?MbJ/z_@-@+aP00CS 5a ֈ27@F0@ t ꬉp@-0 t@- ⷈ_a0p P7T@PL0P00 00""00?p謉]u_K0P/- R  0 RP <04Q0 4R/00C-@2 TMc刀pZ0S @700`RW`H0   . b?0H0<9H0`嗈 00@SPP0S 5` Pn`L0 000P T 4P 80S -40)89/0 w00CS3cm`P !0SP `0S h`_0  1S01  0S00`0U Q_t0 0000`0HP00`$_TЍ@Jh^6z_0,P0M0Ѝ/O-@P`㤓夣夳M 0R0S P00 1p V ۇU _#_Y`P _AP00pQ! P! WPX0S "P0S&V 嫇U _S_PP00`1S  FP^!VaVz0S\0S~HЍL Q00U 1P h_$_U P U PP0 0 0oH0 0 V 咇P@_^`YH0   . b?H0@p@-@"PPpF] p@p@-@PPp:] p@Pl\0S\/@- {P@K@-@ ]@[]@-\0 S00 00CS\0]P@~^z_K@-@]@;]p@-@\`V  ;P  #]p]8P\Ud (p@-@H\Q  L @C-@MP\0S\Ѝ`0FSP\0@؀\ p 0/P 0P 7@-PP00@T  !PT Ѝ0@@-@\00\0\0 0CR\0 SPf\\G-`p$MP@vWp0S*lЍ~P ʄ\P vP0S _\|Z\눠 :P S\X\P PP0\ V &@JJA-\0P0TP`S  BBC[X4>X<>XD>XL>XT>X90000 000 0(""'80@H0PX0`h000 0|0004;$x0| Ѝp9:: :9: P@-0C 02A-pSM 0` Ph0S@ @P   (,pZ @ Ѝ@p@-@`P( @ pG-@1pS ` PH0 00   0  G O-@ MPRࠝ0 0`0 dZ& Z? Z  00 P0S@0S@Z Ѝp0SW RWT W  R! B @QYw!T @Q@P  PD@ PQA @PO-@M pRR20P R  R X Ѝ0 R! T l"`  Q^0 00 PPP ` P`  !W   R `    R! L13!1 P[pH 0+""0 #S5000, 0Y  0/oK[" RpPu  0 t000~VH0;H0W[ 0p0`0Pp ^&p@-@P$e@C pA-P0pS`MS0CS"@AS @70 ^ 1@PW2KV13110 @ PVT" $l1Q d%  @P  0S\V 800C00SV @Ѝ00S000Q 0S'0H0 @0Q@Tl0 0 0 ? @ 00400S@at Ӏf@zfzfG-P,0`0Q @0@L0S% 0" MKJ   pP  0 e 0p  Y  s L0 I0 0 0 G-`, 04p , - +@JPP Zb0SUZ 0SXZ  0 @0 H00 0 U 0@  0Z@ O-P3M0@ 3@s0聗,000 00T@48<40O  L0 0 00, 4J `P @ 0 2"@PY[ PG YK8@%0@01TD00, 00@0@P=[  Rm  RW  &  ?  @P$CY 1@J ,0D000,E 0P0T0=\  @P 40S&Z5 0t@@ !01@ 20@  @@P TX  X T Y O@0 2Ѝ N@ G-@ p@-PP@`V TX00CX0T P)p O-,M\`ကP@`dpP/0 0%!X0ЍS@@  +@PY 0 0W@0/oS" R@X ,Ѝh0100 0SO-P@1H# 娡 0RP  0  V@ ^@-PGM`p0 @P"@P  @0 0 0@Gߍ@-PGM`p0 @PP0 -@P  @0 0 0@Gߍ^@-PGM`p0 @PP0  @P  @0 0 0@Gߍ^@-PGM`p0 @P@P 0 0 0@dGߍ@-PGM`p0 v@PL0 @P 0 0 0@?Gߍ^@-PGM`p0 T@PL0 @P 0 0 0@Gߍ^p@-PBM`0 3@P X@P0 T@Bߍpp@-PBM`0 @P@0 h@P0 7@Bߍp^p@-PBM`0 @P@0 J@P0 @Bߍp^@-PM`p@P 00E@Ѝ@-PP0M`p @P00-@Ѝ^@-PP0M`p @P00@|Ѝ^@-PGMp`0 @P0 @P60p 000 0 00[@TT0 -T0V@0Gߍ^@-PGMp`0 b@P0 @P0p 000 0 00,@%T0 -T0V@0Gߍ^@-PGMp`0 3@PX@P0@0p 000 000 @ T0 -T0V@0Gߍ@-PGM`p0 @P\0 V@P 000 >@-TV@Gߍ^@-PGM`p0  @P\0 0@P 000 @-TV@Gߍ^@-PGM`p0  @P @P0@^ 000 @ -TV@GߍA-`0 Mp @P$`00 0@PppU0PV0 `F000pP Pp!00J Ѝ@D-TV@^A-`0 Mp @P$`00 0@PppU0PV0 `F000pP Pp!00 Ѝ@ -TV@^G-P MJ @P&0 000 @PV0`W0 pG00 0sP P!00  Ѝ@ -TV@p@-PBM`0  @PP0 6@P 0 @-TV@Bߍp^p@-PBM`0  @PP0 @P h0 @-TV@Bߍp^p@-PBM`0  @P @P 0@F0 @o -TV@Bߍpp@-`0@#2000FSPVPp0PpV00p@-@PM0 ($p@Mp@-@P~M00PPMp0@-P0M 0 0P@P0 03/@Ѝ0^@-000 03/Ѝ^@-000 03/Ѝ^@-M0<00  3/@PЍ8^@-M@000  3/@PЍT^@-4000 03/@P~Ѝp^0@-0M00 03/@{TP PL<0 0R 0#*MЍ0^0@-000 03/Ѝ^@-000 $03/Ѝ^@-000 (03/Ѝ^C-0M p08@P% 0"sr`@ P`L $L0 ,03/VP T 0"Y0 3:UЍ`^@-M@0000  3/@PЍ^G-M ` 0@P P 0 pgL $LP0403/ 0` Zp@@T Y0P3ЍPp4^@-( "!0 803/ЍP^@-( "!0 <03/Ѝl^@- 000 @03/Ѝ^@- 000 D03/Ѝ^0@-P0M 0 0PO@P0 H03/@$Ѝ0^0@-P0M 0 0P7@P0 L03/@ Ѝ0^@- 0 00P03/Ѝ^0@-T0M0 0 P @P0T03/@Ѝ0^-00$M0"!#!0 X03/$Ѝ0^0@-,M\!#!@0 00P @P0\03/@,Ѝ0L^0@-P0M ( @P [000`03/PP T 0sK U 0KЍ0T 0cK 0"h^@-@000 d03/@PЍ^0@-,M080\ 0<0 $0 0P @P0 h03/@X,Ѝ0^@-M@00l0  3/@PЍ^0@-P0M( @P 0 p03/PP T 0J08KЍ0`T 0J0!^@-M 0400 t03/@PEЍ^-$M0(000,0 00 x03/$Ѝ^@-000 |03/Ѝ,^0@-P0M 0 0P@P0 03/@Ѝ0H^@- 0 0003/Ѝd^@-000 03/ Ѝ^p@-0M` 00@  00 PP 0 0@03/0P0T0SP Ѝp^7@-00P00 03/@~ Ѝ0^0@-,M!80\ 0<00@0P 00 @P003/@`,Ѝ0^@- 0 0003/Ѝ^0@-L0M 00P h@P003/@=Ѝ0 ^@-000 03/ Ѝ(^@-000 03/ЍD^@- 000 03/Ѝ`^@-000 03/Ѝ|^-,M 00H0400800<00@0 0D0$00 03/,Ѝ^-$M "!00 00 03/$Ѝ^0@-X$M 0 0P @P0 03/@$Ѝ0^@-M@000  3/@PЍ^0@-X$M 0 0P @P0 03/@$Ѝ0^@-000 03/Ѝ$^-$M0(000,0 00 03/$Ѝ@^-$M0(000,0 00 03/$Ѝ\^@- 0 0003/Ѝx^@-(000  3/Ѝ^@- 000 03/Ѝ^@-|}_p@-P@`P00@000000 0(0P0Pp@ 0 //00// //0/@-{@-v@-@P 0P heP v@-@0$ @ 塦@-s}_@-0p$0@@-0p// // 1R *1 4SHP// 0 //0S  0S 0@-@@0S  00S  /00C S}X(~X(~X(~X(~X~X~X(~X(~X~X 0$ /, 0 007@-@00PKH000U  Ѝ0@F Ѝ0}Hp@-0@ R R p PT `h 0pPAX0n0`S` 0`V,0&f j1 Sd080P0 P?!L00(0S50(0Y7C2PqCU\400 # (0(*40803/PPN 0S0h0 k" R 0 0S  0R d 0S40S   X0?o2P00 W,0"&0:808 01@0P0 000@0000 0 $0P 0S $@#kP 0R dJ<@ p0& 0S P@` 0P0 0B0S8 00<08 `PS$0Pp @4\  0P 0SW 00, `YWpp$0VpW @d 00P0 0000000,00P 0S, j0pL00LPS 000 $0 T0h731|0X0S  |0P\0| L06D00D pW,0P0UpPR0pD0 0\0$pp00X0&PS&60DL 00Sl`,`000W 0 V,0"&0:H00H 1 0@l 0 0c60 RZQZ3l0000000 l0PPh 000 X0S 00S ǝPL\t`0U00S 40S 0| D0  D / ,01/PPiL0S jP ڡ 0Sv iU  %6`1f 0@ \0 0jF P00|`00 W`001:# `  H pW H {Pl 0 0/, A a3!<0S W 0# . RP HH L P! @=*V"*PU SP0t00x0*sr2\0 C O00040St 2n`0x >0 `S 0&fj(i0H 40V wi0`0t`xpGP0 0, RS00W00S0  00  F 00)0 C cl00182T TVT0 b8 QSQT S10 8<00P 00 0cP 0S P 0S hP i 0X p0 ?o2"@  8 VPWY" 0@ ~ 0  `0ShP $0@!eXo 0D0 0  P  W}_܍OO-CM@001< @041 0810,09309L0081 0D000H00p$0q0`S H000 P@H0  d0S@W $0S 408 03/d hPCߍW5812 0 SpLPP) uh rh`?눀X `B$00 h0p$08P 81 40/03/PP *000 (0l 81 0SD7  01 V 0d 81 0S0 0 800<`@400 0 0IPP "R 0[P?X H0  0S0000 0S 3/H0  ıP d0S8 g(0, 0#R00SjH`?i`V`fmWY $0S 408 03/5010 8S0 080D0S ,0S  L0jP0P (`,ge┸ \g 0`! 0  <1S<1P P0  S ,0(`,S Xj|(g $峵(0 L0,0P0n000 X `P @ p. 0(`,0 00h 0 `  01/9v0 )V. `0dS00V#6:X0\030 000p0*V0\000\ R Xp0A!\X00CP1  pp0\B?l1Ph0 aX  0S 0S#6:RNƠ 0X00 000p0*X000\ X0 0X00(0`0 T0X0S5X2 \ (`,0C6` ïf0X p0P 05/P· fUX (04 ``X 0S00`04``L0pPX0\p0X ῰0P 0  <0P@0 R T0S  R + 7`00S    80 0 S㽺  +0 S\ 101T0S@` T0S  f!}_~_H @-0 000! Ѝ 0  /A-@0MPb ,,0F00 00YЍ܍OA-@0MPb ,0F00 00@Ѝ܍OO-X2$@LM3@P1`00 p     0  0AOoBBLЍ06 ?\0e@@e0 0 0 PPpe 忷0S@}eQ (T 1 0@  @& (  6, ?(#<@$8 0(@P8 R  cT 0@ P 0R 0Ҷ#PG-@0(MP3 聓0b^Fa @x 0=T0 0T0X= 0000 0$@ b62< RW1Q00Wrp @0噸(ЍO-0TMPS@$0 8Q$    $  # Q $ R0,00S$0S 04 8 TЍO/4 8`#6/P TЍ0S0000C0D#Dc S``V 0 0 00 000000"R 0 0;;020S(00  p a 0Q2! QP#Q0q0Xp a8 QWQS1WqRk+ptd0 @20>00 0  .p0 P(0 S00 ,40ʋP1~pp p,00 00pG<010801 1!&ᄎXK:8|1 0(0` 000 :#: 000 80 L ,囋XF00000C00 000 0C03DH8 40P*qp& D8 40 ?y#p{00H < 04 H\}_x>H ЈXp@-@P;0 yp@~_AO-@`8p0P:0 20@ R @P 0SV6L4400Z:T@ 0@V6L  @@h1A0S2  @00CS XPX(XdX(X(X(XXV 0 Q" @ 0PP@0S P 40⫢@$Gl0  @40⛢ @ Ѝ00I [^C-P` (p@P0S  O@    oP0S@ Ѝ  L@P@A-P` $p@P= 0VP @ЍW 7P  @@P@OoBp@- @P`Pp  P ppp@-P`@P@T@Pppp@-`@PP Pppq@- S S 0 00 0 0 Ѝ ЍPW@-0@07PQ >Ѝ0S S S+ 0 / 0 ///0@-P M 0+@P 00Ѝ0P/00@-DM000,00(0H0 00@0P<0A$  <0< LDЍ0U~_/p@-0P@T `@pp@-P`ᅮ@P @ᜮpA-pP6@r`P$ `ቮV000000 0 0!!!!""""####$$$$|0|0Ĺ  /@-p@ P`]ԥ 0000 0CS 0 rp` 0@Pp! 0` ЍC-MPp`04@P  0 $ 01/@T 00Ѝ   @P  @P A-`pPۭ@P  0 Ӻ@T 00Ѝ @P @P 0幺-/9 0T0/ 0X0/O-`DM@ 00 0 刀匠00  `` pP 01s$ 0 0p0 13/P 00s0?o`2v0S  PP 0b 0 DЍU P \ PU˰p \ P 0 9p Wʠ$^_G- P0` 00 00CS @0 00 013/ 0p@p Y 00 00S@X0`W  1@P  |q qq 8<q|HLq|q (,0sq 0S S 00 000/0CS///p@-P@0003/Pp 0! p0 0SS 0 /S 00/p@-0` P 00CS0@003/@P 0 2X00X03pp@-0@` 0P2X00CX020p@00/ 0@-0@00CS0@000/<P /0 0000/p@-@PT0003/@P 0000pp@-@PT` 0R@90003/TP P 000pp@-@P#0003/@P 000pp@-@`0P0003/@pA-@P0圀p`0S00+2X X00CX0e2PP 0  01/@-0 ]~_A-$0@@@P0`00 [pJZY0S 04 0 13/@4Z@^0     0 1/@-"Z^ R0R0#3/ 0 / 0 /0S  0S 0@-@@0S  00S  /O-`1@PpW  z{   Pu  Pp1 Ѝ@@@-7@- 0 R R A@ D Ѝ0A@ &~_p@-P0S0@0 0S p@0\03/-Ppp@-@04400 # #$0Ѝ~_00C SXXX(X(XXX(XXX 00 /, 0 0 00 00ğs@-000S @D1 SJ0311p0S0 0S-00 0Q 0 01;oz000C0 00C 0 R  S \0pH000S<(00000 3pPz  Ѝ1<10# 3R0 0 νPk 3R0 0 Խp^Lh00L040Z0ꢾ괾ӀzK~_~_8s@-P`00@T HF0ᇷP4(Ѝp@|0 DNTЍpK8p@-`MP  @P t0R R3000 0 塾 0@Ѝp3000 0 咽~_@- Y@Pᮽ0ЍO-84PTM3p؀ 00`S 0Q Q @PD/Q Q8崳0S 00 0000 F@Px p0) 0S#0S 0S00 0P0/0S ᜾P000C @P V=/@TЍ0"弲S(4001 00 0 0 :hP@ `}/ ᆺ@H/T @!4) m/0S1 T/ @P ,0 S00 0 0 :BP@K/ ;@/TP ,0 ST#080r/0S3 ,aPp13 0 !p006/P&@ 8<(1#,0"{ 0S R 0C 000C00S00>l@/ d ᩼d`P]003 0D p(06/PR@OK8~_hrShd Sd@O-`|M[ 3#0S S@ h X TP 0 +T0k s |Ѝ 0S0 0"X01PKl@ TLTHH2@X1100140 PĤ0j80?<00 0S 4;j0$D0?H0? @080t{p<0 @00D$00U, (0KD0 SH0 ?X1!U3T0000 0  00 0@ 0L哏LP[T0( p0,0pDWp!$ Wp! KT͋[0SW04 n0!#?0 0APT000 0 0@7PEhd  _O-2`P#0DMS Sz@ OP 0 j0 DЍ0S\ 0S0 0l! 0_PK4@ TLTHĔi?0?00 ᠄0偋g0DpQ1! T 0 00 0@0 0D X !ḴP 9000 0 0@廎P pW U0Z0SX꣋ %hd _0@-PM@ P@ 0S 00 30@Ѝ00@-`P @P 0S-@ @0Ѝp@-0P 0@P` V $0@0  " ᣺V@Ѝp@P D D0 4S 40 60CpS//^0S@-0P/@- G@  `w0K*}.0Pd 0 ΂+"[! |*!/#1S%P @ LP WZ 0* (!P 000P@  P 000@P QZp 㰠夰m@_pW0: 00C@_2 < 2 ,2! Q Ѝ:;,mnO-Q`0p"᜶@ pP 0㓶 <2 S\02@P? ᅶ ":#@TP0!yp!9#@TP0!m!dƒ1#. @TP2,! 0)"0|| pP 0 0 T  (0TPp@0T@PpP 0 0 TpȠȐTP0I 0@P ?T @.0 @0<  Ѝ:QO::mnP/O-$0(P`Т@p(0嘿Q< 0R00$00S ?⃁X *;#$+4P Uc): 0$0@0D Ѝ(0P U8`<:$ 0ᬵ (001r00 ޾&! ؾ6!@-0@00$00͇Pp@-@P`R/PP`} }Pp@-@ )0!( :@ @-0@W0!80@)A-P?@ `!tpR) W\00\0  WX00X0%0S`00S 3/050)A-@`PP p)mὩ)p@-0@pPn)崩@)Tp@-0PS@p 0x 0000e\`O)0 $A&<)0@ Ѝ@#v^T^0/G-P`t@0)U 1P0j0SGa)0S0p 0SڬP嬐UWPP K)03/) Z#Z P &00C0Z $00.)(p@-@PPpp@p@-@P(00P 00$00嵆p@ )O-M00pQ  (@`TB  0 X : 0Q 3㋽t 0U0Ѝ0 @00D0 0(9 0S<0X0< H00X0000880 00(0S 3/zp3_WEVO-kMA`Tq! 3AAT ß T; LL T;7 PkߍT#ATA2AAQt \pP@3T 316T !7T 26T PT  T  PTT CAAT !T T A!AT X2Ts 7C0CT 0R550P< T742Tf/E/Kp℀&0 700aPP1 TT! *60 00!00 ;P070&c`10S 0R889SvE/@&PP  EP&0$07 0SP3 0gPP,P&@T00&00&˦v{dЀ~d(gdmdydvdedAd@d@hd gdedg~O-@P`tpM -b!%6000!0 0pP Pt` t(0S00 3/y0&  0ЍO0 (p(P  Wpt UPT<$',P* 㴠8SЍR 0#2Q  P0t $5 "S*0 0  a >__L___O-@p?t`嘐PQ4%0SU`V`& Ѝ`0S 0U%0\5 X0X \0  X0X0%0``0$Q 00 0 01/`P 50 0.0 8S0SU/A-@PsMkMG-`pB@0P &`PO00k*]%01%a'y吰0  ᚧ 0 ᔧ吥  0 $t8% x00Cx00S  . tk%傥T M 0!400jM%M^^ _DA-@|`8 P X0 0 1@01?::0 5:1<,@pQ `0qʹ0` ᆰWp00q50@00A ҶA-P@᠀v0  *Pn`tp$lLdP M$` G$$Y{00W^D 多ąG-(pP`,@렐X Ll0P0PP*>:2<.`DpP00 p80Pp ЍP@-p@-`Pp0S0X0S C\ c0RC  PTP1#pnK_O-M`8 H|H$RP 0PY+ἰ$,0( ;P( ,0H` x00Cx00S  . O 媠 GH-00\ ! ᧭x H !HY H@H[P+ ($#H 0 4tH" x00Cx00S  . W  l H 000 0RPpP{UWv 7 00J G<Ѝ+_YHT^_Dąm_A-@`@GPp吀0T:$HU0QU P rᙫP 0哫Pɕ HA@DA-0MP00p 00!t0  00 |@T`x00Ѝ0SP* 0 (0y 8߬000 %y*, yy (x`c弖V 00 0@G-PpMG@ᤐ夠0SGT ᣖ0aV X P T ݧ 0 P7@D€_G-@pPG@ T:thG@aV X 0ߪP,VG@T@@WDp@-TF@HPH`0Sp@0=G0Q 0S @D_A-AQF F P ⫐PP p F`P帀PpU:AGQ  R 00 00 0\ S @-0@ (w$WP@꼪l<DŽ_0!L0 0/R-/00R>0/P}ft,@|f{f@~fp@-@L P & 0 pP$ pO-@2 600o RQF 0Q0000C00 S񟗇?Y`?Y@YLAYLAYLAYLAYLAYLAYLAYLAY AYAY`p 0 V0":P ZeUP!0S   EgP   o RQ 0Qd 0pS  Ѝ0~pS {PP Z%ZjeV`! 0 0p< Ǟ@2 R Z R 0 R0S000S 0S00i 00 Q #埞bDK@K\p@-l` dt0 i@H0P*0,P  0@ipx>@K\DK0 60S#3//0 R@#0 Q /Rc0h0//]0( #&0  R /E/00SF/კO-M`0 00000P@P= 0 @@@@p ㄺPĀĐ@TT ,၄uZ ЍO T1# @PW01 {YP0 PEP @Ѝp4!  \ / : _p$0 0!0 00 /Hzhzlz0S  0 00/p@-0pPd3@1`000/(0, 6Q 0/(0, "R0@@Vp@-@w0 00R 0(0,000@p@-P`@P @ `T`]0S $0CS@ R(08 8@@pp@-PU @`00p`h0=P1xpp^p@-@pP.P$p@hA-APp"0S$0C@PoobT  R*  R PPዹ$ R8@ (@T $0DS R @TP8 R8 0 RP`(Vp@-40@SP 4 -\0c,0S S 00 008@Tp`0 6/@p@-@P` ῢ 0P6 #::0t $00000@0`014: 0p^A-Pp@3A`1`00 zx0S60S50S 0S E`LP= Q 50S0 xy050pJY@-@BD0S OP$@=@-@>50S0500S @qA- p^PPF㥸9@0(0@P<1``00gxxP NPPPPPPPPlPlBd 00 0`S 0 $, `) 0@PЍTY_<^@-(@,000S S 0 AP 0S Ѝ@)OЍ-\M0000Q 0S 3/\Ѝ G-`1@p31`00sg 0RPZ50Sx`x0550B R  00 0S#P> 0 0 0  傛Pm0 0000( H/o6"Q R  R   0 0 pPP #P 0SPU  P P |O-1DM00P`p0 <0 a0,(P$  @<`<0 SB 400 ,00  0000a000'>(P0$ 0 n`<0400 ,00 0000a0(P 0$ X`<0400 ,0X0 0P000a0(P 0$ B`DЍ_h SY_8RYq_DPY_O-QdM@0 | PdЍdЍO_Q0 00000`0 <PPPV0/op"/8A  @T@DHX01H0#0T0Z 3 #W R+   6 4 8 < $ ( ( <0 , 8 0 D@ q RH  H m X  P `J@ GrpT @DPO-造Mx@P` pM0` ᠠ00l ,1 0(10$10 1H00X[ 1?o2P0SЍWYC-M 0P`` @p|p0 P 00 00 0 0@c[?o2P0S  BP Ѝhp@-@P@T $@DT`\\ 0S(@0 80 0KP p@ k|^#_VY_A-0pP@TU,Y`T`1 @DP0>_D0S/0@-0 HW ЍA-@`p`P0(@S$0CS82 R (0S $0C `PAG_p@-@P T-p\P k@<0@ @-$Y x p_LKl@-<0DT 0 !0  !0@- ! 0 !A-@`XpPUA00`0S 00  03/<ꨌp@-@P0 0 0 0 00 0 00  p@O-pp34M1`00#212@T * 0"0#!"4Ѝ00 030 ad`JP0S @D R 9 R9YYdYYTYYTYYTYYTYYTYY|YYXY\YYYY PP  C\0 : Z80 @0S ( <X0000< 3SH L0SP0\ 0304 sR k "Pt"P\"PH"P4PPE_o$"RQ '807A-Pl@`qTH1x`31`0050Svr0500S #00000P P  P P 00P 0000rPGG1/BO-(@4M3p1P`00R50Sxr050`V :W 729 `Ӣ00 ?90p9W 1C7CW 0SY 00#212 900pWr `$pGWA#2!128W M8W4 0CW8W 8W0CW  0W `4Ѝp80 STpYhYhYhYhYxpY0nYhYhYpYhYhYhYpY(8W 0W 0S 00.`7W ~;C?>CW_ >0W >C 0CW H4ЍO7W  ;CW0CWx7WW 0S  Ⱊ`@7W H4ЍO6WJ 57W >C0CW`즟 W 6W`VlX 㤰0 W@0}Pd0  `QzDVQ O V $ 0,p(`80OPP0 00!10 ,p(`$ 80< OP@ <0< $  00,p(`~OPg 1000<0 ,p(`$  lO0PU     '. ,p(`$0 @ 0< XOPD @01Q[P1S ~?S?11S1O@pqMY܂Y_݅_dY_YKY_^_ _>_ąYG_O-DM@c ;`d` P@; v l |D1n00,($  p<0NP@ LDЍ 0!<0$   ,(@NP 0!0$ 0<0  ,(NP 0!P00H00,($ P 80< NP ꨌY Y_݅_O_Y _@-@P; 喭 C@ 㼥Yp@-@PQ` Q   " ,p@O   RP PP  x<0 <0x 8RR00R0S 0S/ 2c<꜋YYA-`pS rPTP@ p :0V`` BYlYp@-@P`p0p@/A-Mu`~Px@ppTЍAm E*hP R~k@K@-@X0l0T0p0P0t0L0x0H0|0D00@000S40000000@꼂YĂYȂYŶYԂY܂Y4Y0Yl 0@o/ἂYA-P`p+D@*PUAFD)00S<7/@P@-@4]00( R @@0000@갌܆@-@0J0$S   00C0@~갌@-`pP@M5PVP@nЍT@UP\0pWU  Y0S   ѻ@PpPE`?@갌܆0L KO-0M0i5p  /PP, 0 X`0@"40/00  / $0(0`0`ЍdY0@-@n0 Pm@,/0A- 0 `   H0D0R@UDp DPU ?D02SH H0 mr0AهPH0S D0SH0D0H0SH H0 mHp0 Q  ! H0SD  D0H 0D00H0Qp@-@ P 00`VpP000p@7@-0@S NPP0∇00 Ѝ0p@-@`P5 0 50'0Upp@0q0 L K0S/ L KA-M@`P:p0UP00HDPP@:ЍA I.PD@-3M@03XRpD`PPP80PUЍ#w`D{0S00P00C0b*,0S 3/XPdG-VM@V/ ᰌpN }? 0@c1 3"0 2Q  ! R!0S Ql050 5c,~ cY8٢䁄刀 2S 8  Ϣ0 2VRU DPEU RU& DU# 0ZHP !0 RS  R H0 3/0,PH0 PU.&U$1PU"  .68+(P Q01Vߍ40S 01Q 403/0SXP0S    H03/,KK܆T_ Yd0L KA-~`i@pT l0S~g@DZPP 0 R DW!P@3 P 0S !PYp@-@`0P@P @LpA-~`#PpU@ l0S~ P3 DP@ 0 0R D Q z!PYp@-@`P@P pG-pW0S !S* 1S l Q`~`P̐Ul0 S DP@~P 0SP 0 S:V ` ,  D.P܆Yp@-@`ᒾP@P ᮾp@-@PZP@p@-@`wP@P ᓾpA-`i~P|h tpR@ჾl0S~a DTP@ 00S DRYA-P`$V  l0Q R D6P@ 0S 0S  P Q  P   0S*p0   D꼂YA-@p`P@P P/@-(0pMPL0`  @P $(0, SS  3/ЍdYQ/p@-P@} \0`80S)p@N0S QQC^T SG"A\H$H@ \ 对!R01h0s1S0## 4 0@@S@ S g^_K\_z_:OA-`pP40@TA80S 3/X@dA-pP@H]W`40 p0H0(0DQP@AmP DK 0 0R DAPL0S G$D+갌@-@qy@@-@h@|0/0/0/0S/  K0 R0/܆@-Pl 0R輂YA-0` `00R@S 0`8`0}? >aMCaaq L.%a ab噽bX T! 0$ $18!0   0R200 `p00S0p SV 出`p02P0Q:0"PSp`W !&`"0 AЍA0܆KK__@-@k@0A- P @0L ^U 0S G~`pF@hpT b 0S0@A7l0S QP ~4@Yp@-@`!P!@P 0 :pK@-Q@MP@`pPP@ \ V0 0@Ѝ 0 <R0%0 Y@@0A- P` @0L ^U 0S һ~p@ကT l0S PX0 ╼ 0S0@A~@YKO-`0M#08@Qr 6^0Qp XX$P  03/-NZXP   03/NZoWP  03/0S  P `@P@tWP  0# 3/0@WS8'S;Vp (]0 00000 0X ("Z ~X PUP Pw~pl`dV 5 X0PCP Ѝ< <0ػ# PR_0SCDP `HXP Uڐ PP0PEDPp  ֺp <~`XP `v Uڐ PȴPPE⸺D?< 坻44)454P$SN $#(u (PPL\0S$PP4 <P <q L0$3/PP 0S- <@P 3|`|0<N03/P |` ^@S"0<#S 80#S %'B BS #S #S#V6 0 0 0P 0P* (q"S  S "S "S's |"Sx"p"S l$'a S `M BS[ BS30E P0S- vP[ `0 ` 6/ |NZ0 0(`06/  "  0`a@# Z  R @aGP/  03/P[  Y 0T1{ S#B%B}e Sb O!"'S s[ SX *.l33&iȀǀɀ@zixiKxi ̂Yiiiii{iFi@ui niii@ɀIii7iiiG-Pp^~`]@|T l0 S 50S0 0JP80 e~F@YK0  K0 wKA-p`Ps$@P 00S0L  " PP - @  ۵꺆__0 寣LY\YK 嘣tYp@-P@]40x@XPx0D#0Uw0D"0Uv0D 0t0!E'D!E&D E&Dp@-4@QPM `?1h0Q o0CQ 0Q 3QN `Ѝ3Q 3Q31 1}0Q0 00P0 0㋪`P0@S?` SRp @n? p危`P @e2Q 0CQ 0Q2 0CQ00l2Q 0Q XJ`0!  Q SS  @#!@  ! ! !1 ! ! ! ! ! ! !! !! !!,!1<13" 4`q1#  `1 3 1#>0880R 3W0`N}`H0@0< !N D!0/H0L 0/QP @0D P @㺚qP 0?S@ Ѝ@S``iui vi iiiG-x Qp`PM \1Q-@UVDD嵵빧0 00 00㕩@P ލ@>3T @P  0R 랷DPP1@ ṷ 0Q D@P W14 (0W-@ 41i i^!_C-qM@`P)  03/PNU# 0S   Pp@0S   ᝃ  0SЍG1PpP  ܃ɀx0/p@-`Q@P R 0 0 0 !7p000SP0PP00pS*R  0 0 0 `0SP0P0P0zp@-^ 0p@/RP@  p@ PpiXi3 4 RA0ACo//1S /p@-3tP@ !P0#3 R`M3  R  PU3P%SЍpRip@-Q@$P U0$0 p0ES$0ʰP $Ppp@-@PP p0@-@0M0S0c@P  RЍ0ϖo8_p@-Ph@ᔠ1 01  hp@蝠@-p0$M03`A0AS P R R R0 J/@ 2 MRY R ނ@ ق000 S""44 0 #RH L0S0P   0 001   01^000000000 0 00000 00|6@P #T@$Ѝ3  #0P0C@0@ 001 0 S 0 x< 0"448#80CS=10 001   `1100000000<1000 00@P @j0 | 0H   C Rw0C0000 0S(  (  ( 0   &0T0 0 0 @P{ Qw 6@t2@7@__33@-3A0@S AS S 7<2@S 3/4P@*O-Q,M0 #21 2@P0 40S `0` " !",Ѝ0Sbb20ؗpHW2V HΗbVRUH0 0X0\Y90PPU:0嫗0 00 ၁ }P0p@-P`@Tp ệP േP @A-0PXMP- 00 0XЍA/`@p K1#`101"4410 0CH00UL 800(080@`, 0 0 0 03/XЍ訌\00@-:PL@0 R 00 C0.APAAꫪ ] ،0@-PQ@M 0 <040060000 $0T l00p0 200P000 %U 0 00#000PR,R02t0HLR0h00 P(05/L 0 L NDЍ0ဖv_YYxY^_p@-@0|0DhDPx0003/HCRUH~HHRQp0S  0 宖20C2hR40SD/Q/D00S/   ! """ ^00@-0PS0 O T  RQ40S47/aC^-9S 0C570C03>C<A \0 S?0aN^ >9QC< A(.S,S :S 0S70/00@-0C QAC^9S000@N TAPNU>9^C<7A@-@ 0R R% RB 0  R    ^           R R  R  R P D3          /^^$^LJ_@-`Pȕ@HH  `P*0& 0# " !P 00 0  0 024`S 0 0B02H02[Ѝp`HUT Ꮥ@-@HP  a`P "@P 00CS 004`S  0 2H0C2,hЍp`H#</@/l2p@-Q@`P *P2Qt D2Qg <2QT  p@ 2Qi M0Q 2Ÿ2 0\00-\0Sp4Pp3" p@I1Q 2?5Q1 20$201Q( &0V4"R= 0p@00Sp3A AR00S(703P pGPpp@APpL2!4<010 " $"S $2p@p@F8"Rp0S 0 0 8Pvpi1iii2i(#iX8i(i*^ 2 @-$2@0$2 P$20$2/(2S@-$2@ 0$2 P$20$2/G-@|pP(ᰀH(20(2p02P0H02/(Z p@2S,`Yp`V v H(20C(2,2S0S,2?02H W = p 3/`P  0S0S0 0"p@-@Hj,2&jPUHp R&U R?,"02(2H0C(2@2S(2Sbp 0S0S0 0"P 3/A-@` Pp0H   CR0C0000T7@@#RH L0S0P  @0(00(00S @P   |0'  $ ! "$& $ "$ (?Q0@ a0600^@-0S 0 P P Ѝ0 $"$# &  $ "$  $"$# & {0C-M 03P 0 SP0ht`0开cS0 ᜹00044@X 0@ DC5(00X 0  R:0 3  00AP  ;0P<<00   0:00h([(0, O 0@,@(0he0#:0#X00S(DD KP `0#DDH$H#  3  0 0P0 0  P0S `0#DDH$H  3:#:SZ2T Tr & 1T (0Sp0 00C SF0 ^  2 0:01T7?T+ @P  Z|81@ R   P0-ꝶp'  H/o"!20T  T x 0T00S 0@000x0@000 04Ѝ\ V،G^ Ld5݆P1O-0Q@00`pDM(00 0<0a0,$@ @@ @<@:000< 0a0 ,($@ @ @: 0$0\00T0000'>a0,0( P @< :DЍ^،·_HY^Zԇ_A-@`pP0S 0Q  6/P Pp@-@P+0S| |0 @Pp@-@ @6@/p@-@P,03/ 0&@P@ D&!R @A000p6@/0S   6@ H0600C0/p@-@00`P 6/P 0S| |0 P@pC-@4 `lMPz540"p  8PPpC 0S࠳ࠣo\p^ 0$0\@X`8pP@X@\`}80T`!C`<0@0o$0@(0$$ܤ@`xX?ZMbQ^c_O-ᠣSM(00&@ pt Q  G[SߍOQ@ 4a4 fs Rk` Z( ZZZ Z` Z Z Z Zx  Bx 8 2/.>&RpPPU@; p&& r&R@ڰF@ 5 H,sH@, $2/x RnL R 2/ H 2/ 000 0;/ydX 4KSߍp@PPPTX \    &[ x R@L R 2/ H 2/X \   Y R x  Bx 8  2/P  & &p& R & &pP&Rq && & Bx  Bx X0 4@4/~O-@0P 1DM@a3ph 6S06Y6S0606O6ᬐS 5  R !wr d pDЍ08#8S06đP0SP  0S0 S5T0岆0T00X#pW@p 40@pApX0\ 06S(X&06   0 400 ,p$@ ` @,T00L00 ,p($@ ` @400 +<Ѝ蒈_Z^pZ_Z _0 @R/p@-P!A` ! 0RpC-aMPpނ@Aᳰ0p 0` l0 0000P@``000*'PᾂЍ|!Z- 0S0!Q\ ^010 BS   " 䄎0 S 0 / \P:/p@-|0P@`T   @PH}p k00 000P`0@ꄎ_0 0R  0S/0 R/  0Q/-   QO-` @ 0  SR00N\ : 0P PUP 0 @0S 0#0JR㊑ PPU @X0 0 0 S(PI 0 0 SP +P  pW 0R  Z 1P Pp[p@- 0 BRPNP0@ ` T0Q@:T:@ #pQ p R\:p0-S>"0000( $ #0 0A-@P`p/ 00  Q:00 ^ Q0SA P 0` `0S: 0  000 @ ``A@G-(r@P0T@`RT` P(PЍTV Fi Di0Z* sR Q HX TT Bj 0  P  9qPP 0BPP  0@ 0 j Oi 0 bpQ` EPV *0`S R0B1 08C80 00 00008C8 QHR 0ꄎՈ_^p@-@Q`P 0 d0P @pqPTp0SpPO-P0M`Q@0  EpP ` @Ѝp0 0@S0VV0p; 0-Q V Q P  P P [[90   P QPP V@  `    pR5PUP 0S(0S' RP0S000  P0SP00S 0 SQPPUVy 0Sv p0S00R0SpPUea0 S0 0 PQV 00 0PJP3Pp_A-P@k`P p   BoP TO  fP@ 0@@T  R Q 0S  : T4 R1 R; 0P\d T0WP0S#0 `P0 Q``(0`,0` 00 0#00#0@fQ `  BR  \R\QI 0 Sl!0 SD4 0S0S0 0 S0Q00 R Q RSR 0Q `U P0P0 RPPQ AQ  0 -_Q__z_0A-`pP0S k@PT 0 P 0 @6/P A-`p@0S KP@U 0 @ 0 P6/P <00S/p@-P@ ~0P@  p脎A-@`pp  h( `0PX 0 0`0d0(0 0 0P0000 0脎+Z 2Z$Z*Z0S p@-@Pp0P 0p@/pp@-Q0S   Q S PpuP@Q$XP0   g 000P:hP`P` @TpP@ 0 00~ꄎ_dԉ_܉__A-Pp`@ )bPP000q10S0@@`p@-P@0`S   00U(P}0S p@F~1/1M/  G-`pP 0@T UK 0 PAG<!0R"1S RP  mP P  mP 0SU P 3/P @P  0 P GG/0 9g0  4gA-PpS`  0S rp@1Q0 S 00 03/@P8/@h8@V9@S 0A/0S @->/_ B 0P//p@-@P0@UPP :^N3A"Pp( Ep@|f@`@@40 0 P/@-@M \ \S R   moЍ@-@P 0P P 00000 復ꠎ00SA-p@W 0S `ՙP0P 000/G-`܀P`U-0G < 0$p0+Yp 0S   0R0 0 8'`03/ላ0S0C0ផ@TPꠎ _X?:Z@-@(O|G-`P @T@G0 08F뼀80S`pM (1LL0C(1H[D@LHL 0!< 04 0 (   !/Hzhzlz\ P/0 !8 0 0 (  , !/Hzhzlz@-@P0$`S- P0 ^PX0S0S;@0Sp S S $L"@P $0X\X\ (, /  X\ 0?0::SL PP $0P`H R R: `$! p7/` Fr450",p 00 cV F $ 0LTpP- EKP0P0<@K@i|!$0P000T00X0 p 0$L@Pn 0SPQ @f-@db@`@^BLZ t^`000SW 3pWPRU 01VP00H0a WVaA[@^^^\ P/0 !8 0 0 (  , !/HzhzlzO-QM 0 ~ЍO\ Ѝ\Q|x0 0|P hm| x |  0d  h 0l bp t0dpWWWh R   0SK GR&7YD RA| R=d )` EP 0S U d FPdP`&V4004 0V43!"=@40$0$`0 0V1 ~oF0VS P xl 0p lS tA0Q 3fh0S "S]2(0(0SX DSV <*0 00 00d0Pt0嘐S, PU) p0S&W W W<PvP@C<B030SB 2 030 @0 0t؃P/t00t0ljP2,0,@T D@DT*0000巉<@1808`V} ~oFyd9P PB P 0 d5/?Y NYY<0S 0 0S#P᫉0W00000D000 d0%P.t R R pQkPPH0404@ ,4 Q㸐 QԐ0Pt WPt00t0EPP_d<..P 0 0 d3/d*PPDY 1 00/@!b f,hZ@^ƀ@ĀǀgfffA-P`,k,pp@%t `P Wk0040 0(0 0E` 0@00ꈑ8jZp@-@`(PQ $kp@*p@-@`P pp@-P@ pA-@`p80P0 0 00#@ЍXmZO-p`@PS pPL fP44倆P( kP= 000E(P00  _U  ETp1GS ! R``B``0D0Q  FT0;Pp W(0S0P0 Ѝ>@Q^i_Y^A-P@`pM4 T  T2 0&!0 qЍA-@PP`j@pD0W !H0L P0 H0L A0 `0<0SP@0P8P000000 0/p@-&@0@ PM R00P H`6$1Ѝp@(p@-x P 0MS`  0S0 0 0u @T  @  0P0Ѝp,-l 0/O-M`p8SPPK 405S0(@ N40 S;000050< 0NZ0<0 ~  N N d@N`00Nl0 0 00  00  Sl 0 Ѝ茓@-`0.#HBcЍA R% 03qA0AS   00  0RePU0$!g# R%000T0S p p0 (}000 0S0 0 00RT0T0S p p0 0}꜓$^׌_c^_ M^X?Zy^_G-@P`0HpM,PD ЍG40>P P: ЍGy vPP!ЍG|40!  $#21240 0 +P 0  Q 0S (!4|3"(Ѝ5Z:400204048<0S0HyP4074040 0 0H00&0PPT0 0H00&40740(0L0S 2^+_C_Ȍ@-`S`PR@ P$1 03/PЍpO-`0Mأp P@P 6ᬀ 6S5 L@Ѝ3 V@433 $1 0@4/@X T06-@ai0 0 0 li@F'P0! {@=P  T$1 03/@T0@ 0 8ЍOꌓQ}_@^Z_\}_O-M0( $$0P0$0p@0T0P w`PP M i`0d 0 `0d i$$0PP 3" (lKe ,fK$00  xLh004 0 004 h(,[Z P~0 0 7S 000@T @DT)Y Z"~5 0R( @kh@0D 0 @0D h( x5 0 dx <{T d  Q Q 44@(d @PM~`2808@T D@DT Jf~vhX0\ 0 X0\ h00Ss H0<0<@0 #448#80(0SoDXhP0T 0 P0T ch`V`ZIhH0L 0 H0L Th9X0S``V (0Y SY$00 6 03 $BP` V PP40"x ` ` @ /Vp  0 0bp0  p@0z 00V0 0O S|gp0t 0 p0t g`8X0S( x 00/40x kz,0SB S*gg(0, 0 (0, g(0Y S  Y~7X0S``V(0S Yr( 0`P$1 0`6/`[ V06 00 5 EPP 0 0Ҵ6ᤦ㨶A lgx | x |wgL0S ( x~ `x0yȠ̐ 0   (p@0y PZ5 X0pS@0<Z0 (o`P_@  R &g   1gP0S xp( 7@00 L00p0y g   gH0S ( x0x y005 iI6 & & R R&WU [  0 PNP ZI T00PTd0f0/Ϭ ff0  f 0 Z0S Y060 o᫲0S&`3 0S600bf 0$ 0 0$ f,0 SO0P  H00 HdJ H ,H<00040S$0 L,,     ( 29?f0 0 00 00 Df$ 0PЍB,40$1 03/~Yw 6ᬰ  Z   H H l ,    Z*YdҺ{`5 NP【x`eh0l 0 h0l e( xtx0 sx7dⰺ{ 50R` ꌓ~_ b^___p_A_Ȏ___G-aqQ˺@PG0cye0 0 0 e0S@PD [{[P 04 S Ioᩒ q{eX0\ 0 X0\ e<ꐐY `{Y ne80< 0 80< 00SL@P  "44X ;C R&Me@0D @0 @0D We~L_-/0@-(0,0@<,00S 0S 3/0000008004000 $ X R0@l괡ZZXZ P/@-0 HL@hG-0S@@P0  R 00S@PP "44D!;C R zpᮽ`P 3 zG40S (448#8SX zG X\0S `0Sd0SP Z0 X0 uMP 4G  G0d0 0O-paPd00\\M `\0Y. L@P 50(p F  5   FP y0? 0C#P @d0\@S300F0 <00⸠ 4F FЍ X?&_A-8pP`@(d1!01@@A1dꌓp@-\0 up^0 RP0Ƞ@,Ƞ00   ! 0 p@$z 0, 04x^-_U_0 zp@-@`P< E  p@O-<`Pl2M@0 0 0ED2U5P0``3Xzy`@P 4l衟< lPP q00PU:yЍ 0 S S R 000h  )z0S4pP0p ny @$04/pBy@W  *z W V h"z 540@P吢H0 0@X0xT DdP< d`PH00`VMxU 0bh@Sw Yt  $09/ uyЍ 0 X S R 000h  ,Ly0SDT0 x $09/dxY  ,LyY U hDy ,^y @P 0S 0 X S Rh  ,yax $0:/4xZ  ,y00`ZU  hy ,*y @P y ꨓMO-$M pp@P0 `fP 0倐hS [  $0;/@ x$Ѝ x @ x@MO- qdV Q ʀ !  , !p0Z@p D00  0唀0 0$ h}x R *$@ !d1000  ! ЍHzhzlzMG-P`pU U7 $1pDZ@ @Z0UP d0' U+  D D$0h(P 0(0$0 000)x 0< }T`00`040<0  000  0ꨓM0SmO-0S4M%PP"P@4 P 10S R *R 0 Swp<00`V/w ၣ4Ѝ`` 0 bP 0h wI0S" 0 S S Rh0  0w 0S  0R v 0 p$07/vp hw00`/ސ]MA-d0Pxq@M0D 0S S2T1pH1p(@< ~U`F00< <0~@P~PĀkv~hwRYpOY@Ѝ`0< 0C`00(|<0S `V0S @P 0 h@AvwMp@-H姵DP@`L@T403L0$k@P ׵p@MMDMp@-$@@Pጵ0DL0kp@ŵM0L03@o/M0 0 0 /@-@ XO-p 0M !P``  @BP0孆 0\ a0 000000@P?o2P0SЍZO-,`tWʀ 0! $!0     !`@ȐPU ` 0! t0 x   !00C0 00 0S003// gHzhzlz~O-dM0!P`@ q WXp1!p0p@0c00@&P ls 0  p d 0 x` 0`pl!H1 0 0,p($  `<0 P 0  rdЍ 0!<0$   @,(pPP 0!0$ 0<0  @,(pP 0!`0@0X0,(p0$ @ 80< P ꕏ_]Z^^Z_^_ˏ_Z _A-Pp`7_@0S 0 0 0 A;_)eP 0@p 00S 0 0R000ⳄQ @- t/ҏ_@-cop@-`$P @P@p_p@-@P@D@ pp@-P`@PU`U`/*U,xZxZxZ ZdZxZxZTZZxZxZxZZZxZxZ8ZxZLZxZZxZxZZxZxZZxZT p@DT@DTTp%@DT @D@DT @D@DT @D'Tp@-@`P@T`T`/*T,HZZZZZZZZZZZZZZZZPEUZZZZZZZZZZZZZZZ p PEU pp@-P`@JPU`U`*U@ZXZZZxZZxZ,ZZZhZZZHZZZZ$Z@D T T Tp+T p@DTTT*T!@DT%TTT@ T@D&@DT,@DT @D@DT#Tp@-@P@TP TP 221#pp@-@P@TPTP *T(Z(Z(Z4Z4Z(Z(Z(Z(Z(ZZZ(Z(Z(Z(Z(Z(Z(Z00CS p pp@-@PP 0p.! " pp 0O-@plPDM(00 0<00,p$@ @@ @`00<0 @,(p$@ @@ @P0 0H0000,0(p$@@ @`< DЍ_!__(s_/@- c@ |c tpc hdc \ Xc PLc @@cPZ1_|Z_Z1_Z1_XZ1_Z1_ P 00T@@@pp菐_ГG-P0M`0 0` @p>0 P 00 0 0 p@?o2P0S 0 S$  Q0ЍГ2 0O-DM(0 0P`! 2 ,`0800P$  @80 <00!1 0<0 (`,P$   0'!0tqt< (`0 0 ,P$  p 0!80 (`,P$  po0 00!08 00 (`0 0,P$ Z'(` `08! 0 ,P $  p`F 0 ,00 ! 0 0P($ 6DЍ__ؐ_@Z_(s_@- R0R0 &*R#Z(Z(Z(Z(ZZ(Z(ZZ(ZtZZZ(Z(Z(Z(Z(Z(Z(ZZ\" \ 00Su `\ \ `00SH00S0 80Q L\00SГ R0 Rp@-0@P&* R#ZpZXZXZZXZXZXZXZ ZWP@D T00SpT K,P X0P0 SpSp$00S000SГ 0 /Г@- tt|ap@ lhva `\qa T Pla HDga 88balZ_ГTZ1_Z1_8Z1_Z1_Z1_@-0@uasa qaoama@jaГP@- P0@ P@ dd d0 0X A@P HlЍ0A@P lГZĐ____@- B 0RS d00S Q PQ @_P ,,0BPЍ_ _@-B B  \03< x00S @_P PP0APЍ$00S _o@_ _ 0O-`Pp@DM(028 0p0 0`,P$  80<<042 0p0 ,`(P$  '~ 0쑟k`___Z1_XZ1__@- 0@P Ѝ䏐_Đ_C-MP00`0p0 0` @;0 P 00 000 0@?o2P0S 0 0 R S00 ЍP C-MP00`0p0 0` @;0 P 00 000 0@x?o2P0S 0 0 R S 00 ЍP /0@-M @aP  pp0A@P TP0S 0S ]PЍ0n]0P_ _A- BM 00S Q Q# Q ЍPሀlU ``IcV @B]TPA8]TQ2]U@- $$^ @ ^LZ_Z1_@-@ ^@^O-aDM0P'~ 0 0㈑<@P @mi 88 (00>@P @Ѝǒ_q_V__///0S/!  @-@J00A-@`PpW0PV0SASW 0003s0#0S0  " \ R0@-#10lS0! @. TBo0PP P. /0S/p@-0@S`P `UFUp 9 *900#00p@ w9 900#00~PE@-@0M 0@ 9 Z9Z ZnZ ZP ?P Z8Z ZYZ ZSZ Z ?P ߍ Z8Z ZiP & ZcP  Z/Z{ Z{\ ^?P Z8Zl ZHP & ZBP Z^ Z ZX ZX ;?P Z8ZI Z%P ZA ZA x$?P Zw8Z1 ZZ+ ZPZ# Z# ?P ZZ8Z ZPx & ZPr  ZPlZ Z >P` Z78Z ZPU & ZPO Z ZPG Z Z >P; Z8Z Z >P+ Z8Z ZjZ Zd >P Z7Z ZP & Z}P  Z ~>P Z7Z ZZ Z i>P Z7Zw ZwZq ZZk Zk @N>P '^$'^4'^D'^T'^d'^t'^'^'^'^'^'^'^ P0C /-P, 0C C-Q`@PLM 0 6/|0 p10 0萟耟2pC0DPUQ 0#LЍ0H  #QHBFpBGBH  CHpN_R.0#HQ 0@ 6/  00\H0 00A00A 6/%_ ]^^P/Q //  00  00  00  00$  (00,  0004  80<0/@-@"M@P @ 7C-PXp@DMp P` 0@DS DЍ@`4M@ WpO-0Pp@<4U 0 i I3il8`Y`( ZU0D0 ЍIP\80S   U@IyU@DDAD@\ZU@DDAD@P C-\MpT@T @DT00\Ѝ``HPP@LP000//o/00//p@-@M P@`@oL@T@@L@T*@Ѝp@-@M@@`PpaP(00 0 Ѝ@-O 000ЍG-@XM`@@`P>p@@@DT00XЍ P@ ULPPU @Dt@-PЍC-\MPP@gကTQ  X01H0 RX \Ѝ !W Q A  0CC10S 0 Y 1 R  Q*10X @-p\M`pp`Px@TQT0# X01H0 RT \Ѝp !t R Q A  0CC10S1 01:qW 1 R  Q* 1<0T O-P\M`P`pሐT@T   X01H0PP PQ Q\ЍYT D PP0CC10S @ 0 P 1PP T*10@Y O-`\Mp`pP9T@TU@ 0)   X01H0`P `a Q\ЍUT D ``0CC10S @1 01:P 1`P T*`1<0@U @-@@PЍp@-@XM``hP0SXЍp  0Cp@-XM@@Ph`00P@XЍp?#? 00 01dPEU 0 R/R 0'^0R/@-0CA @R A@BT R LP^- @A0@S0 AC^ 0 S LPR/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@3 P//8@-@P$0:08R0* \ A/Q :@/Q* @-000 0@0 ! 0#2 /UUUU3333 @-// 0SAS/0-$(0@# A  A A A0/p@-@P` VPpR00/ B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/\ S?/\S?- ^ S@-_1o @-@oQPO-(p@@@, P`T @.`VPW:/@P WRQp@-@@P@T@ P`Q@.PPPpQPp@-``` P@.@T`PpQPA-`` p@P.W PU`@@@-0 0(0000 0P 0@Ѝ@ [@-0 0(0000 0P 0@ЍT [@-$0000 0vP Ѝ@ [O-pPU.` dH@P Z 0 =2@ Ѝ 0420 /2  JHQ p@-8R@P$3U @2C AQ   0 0#01R,# p 0 B 0#01,#  PE la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., Ƞ ľ a . `.. .. .l. a  ,J0 0##Ƞ#\#40Q <1̌ .0#,B/(^0A-@R0@P0`?S  S *S R :[S0^\PP^1(R$#R& `0Sp0 R0 P P P`0SW pЍp]^ S -^ pQ[W 0]S RW00P0B?o2^Lo  S0p@- "!A0 P#.. "P!Q" Q Q00#&" p`04`@N8<#<# "^@E!10@("$"[@-@  0Ѝ@-@P $0@ (?0 0"H^O-@0$M(`00p 00P0$00D2 0@00  v0 $b8"#4b4# 0  0%e#","0    "0 '0&f!"f+"! 0YR  @Pl.  .ɠ,),  ! b..  & Ơc, .c,   00000 00 00 000000000 00$ЍppP`wpP` 0(H^dH^A-pP@, $`QK ?PU(7  08R(#)8 bx/ `/`6`0pPDa(!"$a$"  /0Vh \/Ѝ@R )@ bR/8 7 )G/0(0G-PR0 p@q?p` @g(U: / 0$ 0 @PE 0$ (P`p(*?XG?0?PU  (m/ 0$ Q0 0$  0$ @H< 0$ @ W/  0$ @H< 0$ ?XG ^@-@P $A/@ (. 0"(I^ J@-@P @ (-/ P. 0$$HI^0O-P \M@00 0 0$8`000 : $R?0V FA$E@P7@-@P + !? 7R8 bx b8   X  Ѝ0@=$JL^0`( a!"$,a c"/G-P`8 p#T0.@``T%0  o, Z0DD 6ੑ  cZ&1000DDD0DpW@@@%T-M Ѝp@-@ P` !LNJ, !@ApA-`PP#*pᝌ@P P  vPPP ᰌ0PPW` Pᡌ`ᛌPᗌV@-MP@@@`@pT:Ѝ Pp0P00 E_<_00yara0tcid 0 꼭 0 꼭yara 0 꼭tcid\ 0/\ 0/yara\ 0/tcid0S 0 w/Ἥ0S 0 l/Ἥyara0S 0 `/Ἥtcid@-0p3A&`P @ 0*.P 0@PP P@P0( Ѝ /p@-@jP90PPptcidp@-@^P- 0Ppploob@-@N@@-@H@@-@B@@-@<@@-@6@4@-@0@@@-@*@;@-@$@6@-@@1@-@@,@-@@'@-@ @:@-@@N@-@@[@-@@h@-@@u@-@@p@-@@k@-@@f@-@@ap@-@P(0P pP pgntsp@-@`P@0P p@P Tp.atadA-pPzX0P ` @P  P @gntsp@-@RP P" pp@-@P  p@p@-@P p@???p@-@P p@000p@-@P  p@p@-@P p@p@-@Pd p@p@-@Pz p@!P0/L^i^@-ZZ@@P\DTPP P" P; P\ÀP0 P P\(:P0P0P 0P 0 P@\0 0 P@ :\0:`0` SP$0 S 57$00$0/@-(0$ @ BR00C#$0$0,0(0@-@$ P *  L0QP$00$0Ѝ  p@-PQp, @Rp$0( 0CQp$ >!Pp00@-S@ @$0,,0<000G-@P8MeY@ , !`0a0000P SF SF S40 0 YPP`pP@XK FX Z:X =X *X # i@ Q l ` $0SR00#  C R00  R00  CT$@8Ѝ33 S R 0C# 0   Q b@0S00S > #@ 0  0 SbX fX ?R0@SQ)0?S R  P  c5S CP2QPx B0  PU !p  ?Rv0@Ss`p b6b` B@S7a7r  C# c,1 cp0 0FXPE  0  Y=  0 fP40FU0= 0R9 WV$0  Q  0fU0'0 S# WV U 0S Y P0  0S  0 P  l $0SR00#  C%#jo%ju%#jx00@-MB0@Ѝ0/p@-@P` TPp-@-@`P TP@ Ѝ/p@-@P ETPp-@-@`P TP@ Ѝ/A-@`Pp TP-@-@`P TP@ Ѝ/00/0-P@  P 0S RP0/P*0    PP0/0/0R/ \/S/O-P0KM0 0000000 00$0 0(0$0,0(000,040008040<080@0<0D0@0H0D0L0H0P0L0T0P0X0T0\0X0`0\0d0`0h0d0l0h0p0l0t0p0x0t0|0x00|00000000000000000000000000000000000000;04 8T`. 00" <0," @" Dp" HP"$ L@"P(  ", !X0#\`&`+d*h(lp'pP%t@$x "|)0#`&+*(p'P%@$ ")0#`&+а*(p'P%@$ ")᫿ +! ! +$ό, ό. . ,᢯*p0?0#`P@$pP% ` /`&pP_pPXP\` "P!`+q~Q^D`XP@P`,\pP.s%}S&]P``PpdpP% ``&u%{U&[`PP`,pP.wxWX`PP`*pP"zuZU$`@P P`*DpP"~%r^&R`P0Pdp`!4P&~P+r%^RP`Pp`% Pp,P%yvYVPHPp$`"LPtምP*{T[P`PppP% ``&q%Q&_`QPqp$P#g%iW'Y(pp#৒}rpp崐!p娛p+{tppȐ"p(p*'t|ᤀpp$p#'t(|ᄐppph "tp.l*|s,#,੪ሥᨊቅ .),( 娀!଀+ !)x #|媼 $ᩜና帐< .༐ ,஑ጞΌP0#T@$#:$68@P0 1. @ @$.$JA@@D 0$000.0@0@D010$0 10.0 1@$1@00$ 0D00.$0 1$@00$(00.,0PX0@\0 `00$00d00.40X0@0\P00$80 0.<00@0X00$@0\00.D0`0 @d0 00$H000.L0P`00d 0#P0 0*T00,0X0 0#\00,0`0 0#d000 ,h 00#l00 "0p 00#t0 0 0 "0#x |0 0 00 " 0#0 0 00 " 0#0 0 00 " 0#0 0 00 " 0#0 00  0#000"0 1 10 " !0#0!0 00 " 0#0 1 10 " !0#0!1 10 " 0#0!0 00 " ! 0#00  "$0# , !1Sw000 00000 00$00(0 0,0$000(040,08000<040@080D0<0H0@0L0D0P0H0T0L0X0P0\0T0`0X0d0\0h0`0l0d0p0h0t0l0x0p0|0t00x00|0000000000000000000000000000000000000PKߍM^M^-@-(00SM ЍЍ/Y@-@ / ?!BC# @p@-P(?@P 0P0 0p0M^00@-@0 0 hQA`孎000S DЍ0a$ގTP w0 $A-P`0pS 6@P ` ptlT` eP嶎R<A@ 媎Eĭe[ $0@- @ Q ;0M^P 0R @-0,QSo//i^p@-` @PsP P p@p 0S  N^HA-pD@P PӃ`P@` P-@- p$0 0J@P Ѝ@Ѝ/`᳃PP  $00J R^^@-@H@ Ep@-@P@p X0R0 ⇃PP  0QA p@%M^i^p@-@P L0R nPP (0Q( p@ pM^i^P/ 0R /M^P/ ,0R0/0P//M^i^\ ?o@-L2^0S0  Q 0Q0 /M^i^P/ 0R/M^p@-@PPp 40R  PP 0QM^i^P/ 0R0P//M^i^A-@PЍPo0 RQ R0 ` 0`؂pP  H0R Q0 , I `pPM^i^Z^A-@PЍ 0R0 pW 0Pᩂ`P 0< S0p, I P`P굂M^i^Z^0P -?o42 ^0S0 S</M^P/ 00R@- 0Po/M^i^P ?oH 2\0S 0S0QSf/M^i^fP 0R0PV/M^i^f@-(0pSM W`@V `0P 'PP 00 0P S 5Ѝ`0S 0 "R00   Pꓖ_ 0S/-S0-S0>S/@-0\S0uS0:A@LT#87La@LTWL0L@ T 08P#8000//p@-@ PQ ށPp0< 0 Ppp@-@P 0Sp PpPp@-P@AQpPpQ@-@@ Pp@-0`SQ 0p<@PPpP U> P Pp@-0PSQ 0p<@Pp/P P >up@-0PS`Q@p@P QQ p@P<UP@rP /HP >CA-0@A`SPB DQDqDQ? <Q? >QC &QC: TT0DSs[s[s[ #> 00 YcXV@ ЍP <PK &P@  aR mR# pRd ;Ra@U W\0lR gR tRR ;RO>@ tRI ;RF<@pRA oR> sR; ;R8'@qR3 uR0 oR- tR* ;R'"@X0 (0 0C0S/Q3 /A-`Q@Pp p0<S 0S !S0-S0E?o 2-R0SP/S8PEU0SP ,P 0B0S*\30HV0 S P0/S0(0U0(00>S0>S000 0$0P>R/R R0S 0S  0 A R^"C "R R0  0 "Q 0@$00>Sy=Q QrQoQ@- fo/@-IM@pQ`V P0P P Iߍ 0P PP 0P5/0 0P0 5/P 00  0p3/P 0 0p0 P `N^A-@`0#~PPC V`@@ `p0@<S4 P@0>SSS% @0S0S@ S0S P  HP@@P @@}PȖ_Ζ_ݖ_}|{=A-M  p @00S 3/P0`BP V 6/0p Pލ0 03/V@ 6/T T T 00P00S 3/`0@P T 4/003/003/P T 4/p@-M@P PPP$PPP(PA0fS^ "S4 [S. + Ch 00C S9dtS3 {S]1S/  P3/P0 0 P0 `PT PU 0S e ` H1000"S0(0 10rS PP0 P$ލp0uS0eS 0  00( 0aS0lS0sS0eS 0+0Cd0 0`P6/0 0`0 6/Pm 00[Ȼ[m[[[p@-@`V@p<VPP <V( P (0SP 0| >P T@ P >@P  ,P@|%@ז_-_P0/A-PJM U0`0p 0 `` Q-0 @0  4/@P T p0  P$ 00 0 0PU00@0@  PJߍ0 000 003/ 0/0/@-@i@W| RC/A 0\R#R! R/P 0 0#/-0 S RS R RP/$0S @--@>̭8d[y8@-! (M@ d  `0P\   C DaP(Ѝ@P __s _,O^p@- @P8p8@- @   8-Å @P 6@P tT嬅L PP 40B8@p @̭d[8'0}S "S gxt00Ѝ000"S 00  0P 00S80"S0:S@@0 ]P  P 0 P ,0S"x0h P ,0S(0S  ,P P$[[_^ _p@-@P `\0 R@VP  PPPV @pWxO^O-P0p@S쁟0SE ЍO{ *P@7 ЍP `P 00 0;P> U LL0 S K P0R P [  0xP 0S& P 0  03/P  0R1#P P 00C 0P ,@P #^O^xO^K_0,S<S4H8(@-@, 4p@-P@PX 0 0 0p@觩G-@P 0R@ pAPP`ᑩ@ 0冡ᆁ!$ " 0冁 0` 00V:000xO^0P ,0R@-P000/xO^p@-@P 000p@Yp@-@P ,0R@P@JpxO^p@-@P L0R@P`0S@#*+@0pxO^p@-@PШ@"pA-@P x0RPỨp0S ` VP 0J`P pxO^p@-@P @0R@ P`ᗨ v@pxO^ P /o00"\ RP0\`/xO^O-@Pi pt2 R0j  /PP @UpT@L0S '[ CPP B哀0Q=P87/兀 P,U<UU x 1P` h+  @P* 4PP bPPYU@d Ѝ` V P 0p000000  P [K ! 0P0 F@ B!  0 P 0 0@xO^ԭ0[04H8(O^G- p`WPu 00@ >Pu0SH0,S  0 G 0P -?o<2 ^0S0P S/xO^@-@P+ 0R'P`}0 ?P 0 0 B!I 00C0000VT Ѝ@豧 ЍxO^0P/?o( 2\0S/0P S/xO^0P -?o42 ^0S0 S/xO^P/ 0R/O^0P -?o42 ^0S0 S/O^PG-@6 @`TPp P*  0 S @MK  S 000 01 0 01 $0 0P@ @A0SA-pP`x@P (Q@t0P@ A/O^p@-P(/@P 0P0 0pP^P 0RR @-Ko//0Sb G- 0PSGt h@PR  pPWW(G0 0"!00 Pa#l<`P%c?P6 0bP0 `0\P* P0VP$ pGP唀W%10``IP R0P&RP0@P Wa<`=06P =1P/8P^P^@-@0P t0O-Pp @`QU A R<QYm L[" =QX m PC Y ꤧ[̧[[<[U T8*@U0 W- @ " @U0 W @ ! @U T*0@00@0`<S S CR=S Q"0S 0CSR30 R Y Y( 0<S@(0@SHP^A-p`PV@PCsPPl  P `PQp@-@@0PPJsP`&s@P0p  0P @ PQPp@-@PP@PP @p@-@P H0R00S ( @P000@P^P/ 0R /P^P/ 0R/P^\ ?o@-H 2^0S0 RRQ f 0 /P^p@-@P <0R Pp P rPP L P^0P -?o42 ^0S0 SS/P^P/@-@@T ?o 2^0StoP^A-0S6 (P@U2pP& 08!P( $0S%  $ 00 R`ZrPP 00  0tP kr 0iPЍ 0V dP V RrPP PDrP `U^k^/P/?o4 2\0S0SP//P^p@-P00S $# @U 0D@(pܭ[p@-,@,P+0 0&pP^ R0AP^@-@P 0R@P^P/ 0R/P^0P -?o42 ^0S0 Ss/P^0S(0S @-0@ (/P^00C0/0 P R   //A-`P qPP@d,@PqD,@P P4pp䞣0 P`000 P^@-@@PG-@" @`TPp P* ဣ }0 SS 000 0! 0 0!@$0  g @⸣ⶣ@p@-P@@UP᧣pp@-PP T0R q@P@p,00$00-0P00 0P^[P[G-`0@S,%0SwG ]P@jGP PP 00 0 /pP  00C 0P le@Pu0 03/P  0R 1#P#^Q^s@-P@ T R p̢`r-ЍpADAP`@ 0 0P@00C0@@ A-` pPsp@P W @` ! @`p@-0`SP@p*0]S @0 @P  Ѝ  Pg000$ P ,0S<[_0 /p@-P0@Q G0 Q000pPpp@-P@P< 0 0 0p@苢onA-@P x0R@ %`PP` u@ 0q 0q`0V:000P^@-P000p@-@P ,0R@P@MpP^p@-@P ,0R@P@;pP^p@-@P L0R@P`ԡ0S@#*@!pP^p@-@Pp@pp@-@P㴡000p@p@-@P᧡@@@pp@-@P @0R@ P`㓡0S 0@ApP^A-@P `0 R@pP{0@0S@š 0\ 0a000W@P^p@-@P <0R@ P`Q@ᢡpP^A-`pVP @P0.00)0S0,S00 AA-@P 0RPp0 0a Af 0!1 0S0C0000WAP^0P -?o42 ^0S0 Sn/P^U0Sp@-P`@P (0S p@:p/Q^p@-@P` :Ppp@-@P :Ppp@-@P`E :Pp0-!00!!1Q100 000000 0#0, 0# 00!R0Q000 00 0 00R0000!00p@-@P1S 0p`%T 00S 00S 0P0!  T# 0 P   R   R  00000p000Sp@PP@1S 0r!000p@i000 0/A-p`PU@@ @E 8/P QG-`pPUV@@@F@ @E 9/P `QG-`pPUV@@@F@ @E 9/P `QG-P`0pX@S\@ @!  A@@ @H :/0P ?! Q@ \  !    A@@pP!R 0 000000T 0S001 S@o 000Q0P 0@/-" P  0P CR000S AA- P`@T0 \ R ^  0 TT 0^00AR"/o"!T0#00#000!0000\ !0000000T   " 0S`   T" qW qW2 8 T&aa..1000T0\00RqaaT  0S RP/0    P/-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/0BR"SO-4@`0P pE UWpp-UPp` +UP`00UE00XS 0 A B0C QRP@`T@@Ŀ 0~  0w00E ^aE\WEAE\ 7E T0S0:0QP00\00S 0!0PT@ @0 pY ЍY S F Q^A_0BR"SO-``74@`0P pE UWpp-UPp` +UP`00UK00XS 0 A B0C QRP@`T@@ğW 09  0  0h000E Xa0ESW0EA0ES>70ET;W% P=Q PPS^3 .QPT@ @ 0   \Q PPS^ .[ ^F Ѝ[)Q^A_0BR"SG-3@`0P pE UWpp-UPp` +UP`00U400XS 0 A B0C QRP@`T@@  00E \a0ESW0EA0ES70ET P  S  R 0 PT@ @  X`FXR1Q^A_  0S S/P/$(0#   @// / ////H-M 0ЍH-M 0ЍA-`p@P0 8#@T0P@7@-_/"Ϡ R# O,!0 P  P! Ѝ0 0RR! R/P/0@ 0A0S*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R*0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/ R.0 \ Bє BÔ4 B24r- B R5:@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@* / R:@P`p@@P` R@* /@@t@P B@@P B@@P R@/ R$$/ 2R $х $Å/-\{F ,DP`pL%T\&dl't |@P`p B R*R:,DP`pL%T\&dl't |@P`p R/ RA2n:,D R L@*Af,HP`pH%XX&hh'x x@P`p B R*R:,HP`pH%XX&hh'x x@P`p R/ RA2::,H R H@*A2,LP`pD%\T&ld'| t@P`p B R*R:,LP`pD%\T&ld'| t@P`p R/ RA2:,L R D@*A /R $х $Å// 0 R/ ! 0O /0 #4<0/0 80/0 #<40/ "4"0/ 0 0/ 0 "$$#4 0/ 0 0/ "80/ 0"",$ / 0 0/0 #4"<0/ "4"0/ 0 0/ 0 "$$ #40/ 0 0/ ! 0O 0 0/ 0"$,#4 0/0 #( / 0",$# /0 #0#<4"$0 / 0 0/  !<0!40"440/ 0 0/ 0(#(0 /0 #$#, / 0 0/0 4"0/  "$,! / 0 0/  "$$! / 0 0/ ! 0O 0 0/0 #4<"$0 / 0(#88 0/0 4",$0 /0 0"##<40/ 0 0/ 0 !Ġ"ĠČ#4<0/0 0,8( / 0" (#8 0/ 0""#< 40/ 0 0/0 #<"4$0 /0 # #"$, /0 0,80 ( / 0 "ĠČ!$ #/ 0 0/ ! 0O 0 0/ 0,,$ ,#$! / 0( #8 8,0/ 0 $ #< 4,0/ 0" "$# ,̠  / 0  0 / 0 "$$ #$ <,$,!0 / 0  0#8 8,ȠȌ!0 /0 ,#88"(0 / 0"Ġ ",$#< 4, 0/ 0 0/ 0"Ġ,#$<,4  0/  "4 <0,4<0!! / 0 #( 8,8 Ƞ!Ȍ!0/ 0 "$$#< 4,̠Č! 0 / 0 0 /R4 R0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/0 P0/S0/ P0/S0/ P0/C/011/A-@pP`P aPp` P102 P @-@\& P QRS  T00aLQ R S "  T  00 A-Q@`pPS2U @R'SP U @0C @g@OoU0@d08D/o?o0CS c"U@SB BU  V 0f0?o c0B0C8/oo@p !1 Q  a4Π81@0 @V@TΏPO0QU  @@a4.Ό8?o/o0CS 0 Qm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /~-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/@-(U_A- % M2223XV>N[ ^"*UC2\A =a XcZhgF릥6!tXX+dDBxY녪e@,j(^0"Iud*48< ~3Q% 30S#* :3#Q% 53#Q% 5Q *c@G';ljtejJۅ0eq֥ frfh0  d08S(B&6{=xR 3R @00@06U p_2pa fKj8@dm~>3eg.s0\"  000Q@P8<4Yiu iPfc븳NBrfT'P'TT41o:i1@T(ti@≻U D 1 @10dx1U P. l'%0 000rs/ϥ i!( A0( ?A3c01|pWD?,,@? N'2-_̀<P-_ӀK!-_pMb@Ӏ]&_TO@-_P-_WX-_@ 0A @ 0H @ P `@ p @ p@ @ zssp_initzssp_ic_startzssp_ic_stopzssp_read_max1111zssp_read_ads7846>@,>@8>@P>@h>@>@>@>@ioexp_set_backlight ["$&'X4gklr'/57<?BCEGHIJKLMNORUVWZ[\^_:;<=>?@ABCDEFGHIJKLM/57<?BCEGHIJLMNOPQRSUVWXYZ[\^_,\\ m1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & '(7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FKT]  1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & (7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FPQSTXY] <d b _ ] Z X U S P N K I F D A ? < : 7 5 2 0 - + ( & # !    8nAc@__@`@a@a@i^\5TE -i7i^\5TEAiIi^\\5TEAiWi^\\5TEAiei^\\5TEA si^\\5TE A |i^\\5TE`A i^\\5TEJ`A i^\5TEJ`Ai^\6J`Ai^\6J`Ai^\6ZK Ai^\\6KPAi^\7ApAi^\7AAi^\7A/Aj^\7A?A j^\7AAj^\7A/A'j^\7A?A4j^\7AOAAj^\7AANj^\7A/Aaj^\7A?Aoj^\7AOA}j^\7AAj^\7A@Aj^\8A0Aj^\8ApAj^\8ApAj^\8AAj^\8AXVj^\\`Aj^\\XVj^\\?Aj^\\@XVj^\\ Aj^\\@X/Vj^\\s_g^f^g^ g^g^g^%g^!g^.g^*g^7g^3g^Dg^@g^Ig^Rg^Zg^dg^Zg^mg^tg^~g^tg^g^g^g^g^g^g^g^g^g^g^g^g^j^k^ k^k^k^k^$k^*k^0k^6k^a`f`dXY`c`~a`f`dXYJ`c`adYc`*c `@a`~dXY`a˃YYӤ`c`eEK`a`e`deFX+FY`c`Na`deFX+FY`c`a`deFX+FYi`d `"b`eԀ ̄eDeD̄|c`F܄Ѐ`F `F܄ЀdcD܄P3D`|a`XOxFE`XOx`bfDed@*``vc d`e`cd`4b`~beD`0`P`y````EĄ$`0d%`E)``d-1`d&*`d.2`d'+`d/3`d(,`d04$Ą57d@Pcd@T@U@A@B@^d@R`:e`@* &`b`zbdD>`\e`@ &`bdDL`bdDFd@A@F@G`c`d`fcdY`Av`_xu``*b`d``0`x0Dbcdefl@AC@I`x0DdrD`Rd@@܀d@@H`@: g`ed@:dpmd@Kd@M@G"d@L&D@Fe`@&:hhddV`Tl@`DdFGg`\bdۜ d@&D@F'D"@Gd! d!=D@]D|@^=D@]`>D@^FG`d0Dd@@@D@C@B@A`d@N<`jd@M`Vx0D` d@@ d@K`edd@\` x0D``O`O`6C`@C`D`RD`4E`}E`XG`G`H`GH`I`I`J`J`4K`K`XL`L`M`M`N`N`@`@`A`$A`B` B` :\+t@:\+ t@:\+t@t@:\+1``:\'1``g`d:\0`g`d:\:\@'```0`g`d;\;\@'g`d:\٘`d>@g`Lbd d@H`d@Kg`Jb`dd@Li`qd@@`x0D(`eddd@FX(`XOx(`XOx)`XOx(`XO;x'`XOx'`XOx'`XOx=`/xN`aAM@`XOx-A`XOxOfD`Av`|`dٮ0`x,E?A0D 4C)D"&:*Dt )D@I$A`eŔ A@d>D&Ad>D*b dg`Vb܄g`bdd@IrR2{MD)D@Ie*`xd@;`_x`tDt@^E^@^|`"bXOXOXOXO|XOXO =D@]@]-`xe`Gc=D$@]4@]`G`Ac=D$@]4@]`G`Ac=D$@]4@]d@&Dt@^|`FbƂXO`d`T2D+D@^=D@]>D@^=D@]d̄>Dw@^D4E^&D@F d@LLN%dKt`xaFG`x>D@^F`}`>D@^FG&C*PCF*D# Dd@@rE܄`UeR$܄'܄(*D܀X2@*]`x-D & &D@F6]'D* @G-DX67d!&*$@Gd!*D܀X'D*@G'D*@Gd!'D*@Gd!`x&D* pDЀddP`xd"F)`ddd!`xdFG d@L) :`d`E`dĄ܄?k>D@^=D@]>D@^=D@]d̄>Dw@^"c*c(D& %D`Fa^+!F (D6 cD|@^=D@]`}>D@^FG`xd`fFB`|E5[`d܄ڂ܄`xA^d@F!FFELd@L&D@F.D `zbd@*fihD`E|ihD`Ge|ihDЀdD`G% 6676n6&|"5dW.DlC!~iÔg`^b܄d'D@G`xd@6`x|@En6576&6 6Z`d܄ڂ܄!c'D@G`t`xLH LHLHDžǃDžメLHǃ'σHCCLN|МӀ DZ`d܄'D@G`t`xRJpRc(DlE.D+ eDP*&D @FЀlDąЀa(D*@'alDąЀ2D*'(D6:d8d`x@LlDlD a(D+a`@@'ANlD(D666`xa@"1lD(D:Ha6(D:MaIaAMFNd@Le-D* -DI6H:e'@@&0e`x50elDlD`x5EN#D`C`xlDlDlD&A &-D"2@*P@Md`d܄'D"@Gd!H'D@G .D$@AFp@MlD a(D+a`@@+ `eC(D@H)d"#DAN &(@@'@C8lD#D+d@C8#G?eEL!pEԀd`PlD.D"&#AlD4TlD.@ *lDlD.@&#AlD7?lD72D*bFEڂlDڂlD#Ax|eaCрFE7dCс||;H#DЀ`C `xlDlD]>#A>||e%DՀaCE56`xbрFEa@&a\adCсDZ#ՀaC7bрFEDa@&a\adCDсDz lD|FEdlDZڷdA(D@+2D&lDD}@^d̄=D@]`k=D@]>D@^(D@+>:D+`:\+t@:\+ t@:\+t@t@:\+1``:\'1``dg`d:\0``}`>D@^FG/Xd?;D@'@`@*`xA`@'d@*g`cew+d@* g`c0en@+ d@*g`cee ``xd@*g`cUT`*e0/`AdCDaGD냓`eD`Ncǃe`@+\aнPYЀYЀЀeDT`Nc~e`@+\aнPYЀYЀЀeD =`LdăgD e""dD@[dG@[dD@[`G`AE7cBcd@: cZ݁`Ea_@[eG݁a_@[Z݁a_@[``d@:``3`d?8(d@IFJd0D@Q`x@*F`@&e)C'D`A;@+`Ww_Ɂ`Ww_% &c@J`F;=F8*F`@*c@&c`F+FJ`Ww_`G c@&c@JCIAGd0D@Q>|>=FDG`@& `x=F`edC`x`x`xL/~ =F>`xd0D@Q`0` `d>>@:D;D=F`c`|`xwD`W@J*1$D$F ,@D`F`\` ddD:D&u;D@[ -EԀZ`pd܄ڂ܄*D*#D<`@d@GXOSFCfC`\`"ddD:D&u;D@[*D"K"D`FFd@B@<`Fd@GXO+FB7"fC@*`$d:D&u$;D@[ *`$d:D&u;D@['B`F /X*D*!D`F<`pd@GXOFAfC`d:D&u;D@[4@&;*D :D* ;D`Ud@Z@[=d@J5@*$A@U, GXO(FDf\` d:D&u;D@[5@*#A@U`}x5@*"A@U`x5@&4@*!A@U@T?`ha'BLAN@E`F @K`^x+D N.X%F'CսFEcEdC`Ad۾eC%DaD aF%D %D'C`F fD.X(AXO.X(A@XO(AXO&XOV.X|c@EeeD܅`F@E3DT3D`|ddЀ/XfC%FaDg<~dd# acY/XL|aXOc,F%F,F%FdЀ dFgXO.X'C%F%D `F%D ܄/XLXO( GXO.XLXO GXO^.XLXO G'D %C cF'C fCdDX`F%D .X%F @G dC'Bڂ$ʂ`F cF( %Fd 'B̄/X%F#`F xgg%Fd%DXOXO'.X'C%F %D`F%D %Fd %D/X%D%F|d/Xa%D`FfC݁3EE3D/X%FЀdC`FgddFFEXO.XfFE)CfD%Ddae<`cCÍ`Vx&Ԁ`EѽDGDHDE`dD3A@E`F`|dM3DdЀ/X  Xee 0DP@Q0D}@Q?*F\g`Xbd`.d@D0DA@Q?0D@Qg`XbdBe`A #`E`A6aDd@&d8989܄8dD$܄`\aD9da\Ad@&`@*g`c0d@*`@* g`c'd@*`@*g`cF\"d`x`@*eG6`EąŅ=`NdăagDg`c``8d^@ZdG@Z9@Za\Ѐ0`E@ZeG@Z`E@ZeG@Z`EE@Zd@:aeG@Z`E@ZeG@Z`E@ZeG@Z`E@ZeG@Z@Z `g`b*=d`:\+t@:\+ t@:\+t@t@:\+1``:\' 1``:\+dg`d:\0`:@@'g`\bdE`d@Z3`??`2xd8~`GSQ`\PQRSdT) :SdDcc cUF\"`@&@!`EELĄ!,D)dd@:O'Vc))`Gd@*. "bcL4L)`@:v`@6n!̄`Ad́SUdA6dEbá$Ƃ(ւ́(*Ƃ`C`eddÁĄcEĄ@H`Eh`b`dh`beD(DpEą`XdĄ`AsEԀ dD68aEĄsEԀ.h`b` d d@\"d` x&(E`@:`dĄpEԀ`P`Eh`b`0dh`beDd (Dh`Eh`b`dh`beDg`Nbdg`Zb`b*`dѕdA) `@:q݁݁݁%`G`Ca@"#`XOJx`dݸ#`XOIx`d)`Eh`b``dh`beD"`dڎF\fD `xdhh`b`adF\`@*g`Xbd`id@D0DA@Q?0D@Qg`Xbdۙ:D+P' g`\bdE`d@Z3``xL?~)`@:Z`Zd܄`e"d`xdD`A`G`EaD脤`AeGaE.XdD`A`G`EaD`AeGaE.X`G`E@M`G`A-D́`EaG.X"`kx0D*G!XG?2D&WdEGS 2D&N'`T `:d@B0D@Q?2D&6dEG2 2D&-O:c>D@^@^ `dd@B0DD]@Q?2D& dEG 2D&!`;x `d@@ `d@A0D@Q?(``bg`bd"dڙ0DY@Q` d@@`xg`bd"dڙ0DY@Q` d@@`x!`d@@ `d@B0DD]@Q2D&dEG 2D&`e >D@^@^?2D&dEG) 2D&$g`bd"dڙ0DY@Q` d@@`x`ē'% `x `ux(``bg`bd"dڙ0DY@Q` d@@`x `xg`bd"dڙ0DY@Q` d@@`x)`@@+%>`@& :\d@@' d@+3` `x:\d@+&t@t@d!Ĵ!!`d@@d"0D@Y@Qh`b`pdd@&dh?d(``bd!* !dN`e"``@&`@*;D+@'`x&g`bd`@*`x<`db`Fd@:pdg`bbd@>>=Fd@)@+g`XdF~`CEeDF`@*#`xdek>Dp@^=D@]e`>c`"edHdG`A`J׀h@g`b|`@* @eD@^$`x D @@d&dG?dD+ `HeD`J eIdh^`\` ddie@Qd D *666 Dش@@ D@*$@@<`bڃaۂZڃaۂZڃaۂZڃa ۂZڃa`x@DbC Dԅ5$E`2dDCE D @@dCӽ+ dIhD%CCE D @@dCӽ@D+`HdD`Jh@dIhEԀ%C<`acY1YcY,YcY'YcY"YcYYcYYcYYcYYcY `x'`x'`xI`@666(:ZӜ۸`q̄eD`usD`b `b'`xf`b̄:D@Z;n`G#̄`G"dnhsAIՀ'pEą`XdĄ@M`AsEԀ dD60aEĄsEԀ g`|bddh-DpEԀ `P`Eh`b`1dh`beDdf`d̄v`EwԀԀ(``bdd=`b ̄ =`c`dЄ2D*0h`b;h`ā3 @@*d-dd`A D@@@$`daDde * `bЀ @@*g`|b̄1/dA"D 1@* ^DB!DL!EԀXO?<`4b`F@FH`bFg`rbd@7d@7ga#X(`cd۽۽d##d"%D#$%&'ga#X"(`c $%۽۽d#ga#X8d8`G?(`G q9+:,;-./0<1=2>3)RP<.Ѐ=/Ѐ>0Ѐ`AaDB=JCd@*(d@* d@&8`\dD`G@`G)9!9+:,;-1231:2;3+,-/Xd`eQd@*Dc)s`d+c)d@@'CK!Vad@'ba8DM`@&"ÁрcE dCׅELӀeec-D,E`AԄ߃aD)d`G),C-D -D+Eāрd.X+L`@&9+`AZ`AZ`AL:`XNx N D@^ cXOv~F=D@] cXO>>Dw@^ cXO4D`夅@^k`>D``\`d٘g#X<`bʂ"d;`x<`bd;`x<`bʂd;`x<`bd;`xee`Fce@*d;`xg#Xg`Pbg#Xg#XCDw@^ cXOlm>D@^`k cXO_=D@]=D@]`\`dMdG`MdD`M`G`MdD`M`G`MdD`M`G`M`CdD`LcFCO?`G`\e/FdCbڂɁ`Lb`M/Xj` x`bр`d+t` ``b` ddtudu`b`d ?Wg`b& eEHN`aAM@`XOx-A`XOxOd"`dZ(DZe<`b<`pdfDZ dZ+ET;7Xa`FN`.aAM@`XOx-A`XOxO!adX`.cd"`d#Hedѽۥ́څ<`b<`pdfDZ dZ+eET;6E`dDd1D@Q`b` d=`/x>`x`cӽѽѰ 1D@Q |` d>`x`Gā>`x1D@Q &`|b`@:ec `@:ecce`@6e`lb`|b`@:ec `@:ecce`@6eg`rb`Nb`A&e^a@&c^Zde`Dbd>`XNx&`c`xa`dXY`rc`@a`dXY`c`adY`d<`bʂd- `d2@&`bӥ`A6́`bNB`XO`xO=`/xfDWd@FNFE<`bdfDZ dZ+`XOxO7X*4`Db`E`b`E`Hc`a݁ԀaD`DbaEԀ`Ef`beD`:dD`b>`zb>.X<`Lb`Fb`G7:66 `bF`d<`bdfDZ dZ+NFE<`bdfDZ dZ+`XOxOY`d܄ڂ܄ۻ<`b<`FdfDZ dZ+Y`d܄ڂ܄ۢ :=`/x`b `d`e aXOdXcZڅ́`b`e?`cdZրZZZ`edZրZ/X`d@A`cdЀ áۣ`cdЀ adD́@BCDACXO`X"D#A$C!C`e׀ѽCA?`ddX@O)`@&@`.x`@6 `DdXOdD`"12Ѐ Ѐ3ЀA`vx`eԀdЀdЀ&F" g Ѐ&F"@g&F)`@ *\c`@+bcҽЀ\Ѐ҃XЀUd`XOZxA`Lx&F) &GcӀ`@:Z`d܄#:Z`d܄0:Z`d܄:Z`d܄:Z`d܄ `HdXO-`@: h`XNx&FA`XNxA`vxP: Z`d܄ `PdXO @:Z`d܄ `JdXOA`rx:A`XN}x `RdXOZ`d܄:n @@&2)12ЀЀ3Ѐp܄pdq `dnd@6PZ`d܄ `LdXO `NdXO= `PdXOA`rx`Bb)1Ѐ2Ѐ3 Ѐp܄pdq `dnY` d`@" h`XNxN&Fg`XOxO&FV)=`e dd@+h`b`0dA`XN}x^`EsDd@*Ԅ砖Z`d܄ `LdXO `NdXOf`b#A`XNx&Ff`bdۺ<`b<`jd&DZ dZ+d@FfD>`XNxVv`XNxdd`Xb젢(`~d<`b(`zddJ`b`dD`dZ/X`\(`~d<`b(`zddJ`b`dD`dZ/X`bdf`b܄dd e=`XN2x`cd|̄g`ve`@"3* `cf`e`EĄЀ% g`ve`E D@@Y`d܄NR`XOxO`b`dE`dZ/X`bdD`IxdGdDJ`bd `b@`dE`-dZ/X<`b*Dʂd-`b `dE`SdZ/X`bd۾`b@`ddde=`XN2x/X `Pbg`d `Hbg`dY`tb(`dwd"8d(` dd)f`b`4erDf`cd۽ۣqpG`dӆf`cdds9`bd^h`b`df`cd(`c9`|edGӀG`Dd[NR`XOxO`b`dE`dZ/X`bdY`d܄9`b K`XN+xF`xY` bc`@:n af`b@` ec$́d(`~b<`b(`zddJ`b`dF`#dZ/X`bddn9`b`Egf`b̄ۼY` bf`bs.dD:*eD&`bd@&`C(`~b<`b(`zddJ`b`dF`mdZ/X`bdE`xf`cӁ܄ۃssd^h`b`df`d܄G`x9`cсурѽY` ebEdA݁遽ѥڂ́bE:`&ca`E66 66eD̄`EaDa`E:`(ce@*d݁e@*d݁e@* d݁e@*d݁:`&caD`eaDڂbEӽ`Gڅ́́:`2c`b`EӆeDe`@&e`@&e`@&eY`hbeD`c`cنd`dbvf`XN:x`b*d *d*ddw./0123f`cddDJ`bd `b@`dG`bdZ/X<`b*Dʂd-`b `dG`dZ/X`bd۾`b@`dddh`b`pd D&e=`XN2x D@@`b`d`b`dG`dZ/X`bd=`bac`EeD&߃́cD =`b2db`@6`bd=`b̄=` b`bedjkmod@&J`x`b`df`e"l^d`b`d`b`dH`0dZ/XI`x`b`dی`b`aZJۡZn`@&2vd)c8"d!d`bd<`b<`.dfDZ dZ+`b`dH`rdZ/X`b`aZJۡZۆ/<`(b`F%@Hd@L<`*b(EԀ`F#+* @M<`b<`(dfDZdZ+d@L-D`F I`xdmI`x,D*(F+* <`b<`(dfDZdZ+<`(b`F+*1K`XNx`bd<`b<`.dfDZ dZ+`b`dH`dZ/X`b`aZJۡZw"&dmdo<`(b`F@H`FI`xlЀ+w`Ck*ci`XNxji`XNxefDiK`XN x`bd<`b<`.dfDZ dZ+`b`dI`RdZ/X`b`aZJۡZw"iFHi`XNxd!i`XNx#f`b܄ @H<`b<`LdfDZ dZ+(Ddo i`XNxi`XNx(F lЄ#`@"d`C(`~b<`b(`zddJ`b`dI`dZ/X`bdmmdjdf`b< E@@f`d܄یd*`b`d`b`dI`dZ/X`b`dی`b`aZJۡZE`xg`ve`@"=* `cf`e`EĄЀ& g`ve`E D@@Y`d܄ `PbV`SdNR`XOxO`b`dJ`JdZ/X`bd `Pbg`dqpddqf`bvDd*`b`d`b`dJ`dZ/X`b`dی`b`aZJۡZh`b`qdf`d ddpe=`XN2xf`e`ddC߃ЀHf`bd@| e=`XN2x `PbV`Sd`cd|̄E`x"f`bdpf`bdf`ddddh`b`pde=`XN2xi`XNXxG`xw`d+,- w+,`CdF,+(F-dF-d)Gc8"d!dd.X:`bC`A脐 aD dD *dG.XL`?xxQ`XN(xQ`XNxg)Q`XNxc8d":`XNxfEa}dd@&dcYdYڧ(`~b<`b<`.d~eDZ dZ+d]<`b(`zddJ`b` dK`dZ/X`b`d.<`b(`zddJd]`bdZ&F8`AL`0x}L`xe8ՀL`0xC&FQ`XN(x~d(g@g)+..+,//,-00-d":`XNxfEadcYK`qx.&F>`XNx DL`xO`x`dd]`bdZQ`XNx DL`xO`xK`x&F>`XNx DL`YxN`x(`~byQ`XNx`c'`da`cӽa`b`c`eӥЀ@GR`XNx `bdZf`edD`x'C`XNx `Fb`EՄ`E e>`XNxg`bd`bd `b@`dL`wdZ/X'<`bʂd-`b `dL`dZ/X`bd۾`b@`d D@@K`JxyQ`XN(xd)Q`XNxGb`dcaYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dM`$dZ/X`b`d!<`b(`zddJc]`bdZ&F=&F>`XNxL`Yx`d<`b(`zddJ&F>`XNxd]`bdZL`x`dd]`bdZQ`XNxL`Yx`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx'CaeǃY`d́X&F>`XNxddgde=`XN2xR`XNtx`b`d`b`d d]`b`dM`dZ/X`b`da`bd`@da`bd `dIa`b d^`b`d`b`dN`dZ/X`bdZd]`ba`b`ba`bN`XN]xde=`XN2xf`ed`XbdۥD`x` d c]`bdZM`x/X<`b(`zddJd]`bdZd.XdGF`e`cӣۧ(`~bٌeԀ `b`dN`dZ/X`bdZ`c'`dd`Zbda`cӽa`b`c`edAЀI@GXՀ`Ea`beD:d@*7Հ4a`bf`b'D>`AЀŅdDԀR`XNx'D`AсЀYhЀYdЀaN`x`bd `b@`dO`dZ/XFG`c<`bʂd-`b `dO`/dZ/X`bd۾`b@`dd`Zb<`(b`F `b`dc`b`dM`x'C<ЀN`x'C@`A>`XNx `Fb`EՄ`E e>`XNx`bd `b@`dO`odZ/X'<`bʂd-`b `dO`dZ/X`bd۾`b@`dyQ`XN(x` d)Q`XNxQ`XNxaGddYځY؂YYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dP` dZ/X`b`dd]`bdZQ`XNxd`ZbdN`x`d<`b(`zddJd]`bdZP`x`d"<`b(`zddJd]`bdZ&F &F>`XNxN`x`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx&F>`XNxe=`XN2xR`XNtxc`b`d`b`dM`x D@@K`Jx])dA`@: 1`b`d': "`b`d:e:e0:e `b`df/X'CdGYdA݁bD́XX`c-DȄdEdAAĹX--C`G~'D˃D,A `G~`É.Xg`Hb*d *d*dd.X`ef`c'B>|Ԁaae\f`baDf`b.X'B2ac$:: `@+e׀c: `@+ e׀c,:`@'cY`hbY`jc`@*cd *cd*cdcdPQa`bQ.X'C+1,2-3.X./0` dd(.Xg`fb܄(``bd(``bd.X'CeDž`GZeDž`GY eDžӀ(`b<`e?`d`A脥<`ed́a`c&F123.X'D`AC腔&& *`@* a\Ga`bP'Aa`cӽYЀYЀЀdd.Xf`cddۣg`cddۣ'D'DЁaf`caDۣf`bсaf`baD.XY`bf`*cd۽۽۽g`bd.Xd]<`c!Dd`bdZ`*c `@a`~dXY/X`b`d/Xz./0`bg`cӣe~g`bd|d (|`E-d`dxd`bd D&d'`d @*`bӱ=`LbdeDq @@&n`ez@~)`d[`Ce @&|dGdA݁bD́XX`c-DȄdEdAAĹX--C`G~[ڤ˃ @&dD,A `G~`Éz-D8f`bf`b`Zcq\`G`VbeA`EaDԀԄ`E`TbĄ@J`Xbd `ddT`xdR`~x`Xb`Zb*D܄d*D̄d@J`c @@&dD6 :`6c*DG`bd `b@`dS`dZ/X<`b*Dʂd-`b `dS`dZ/X`b@`d dW D@* `b`d D@"T`rxz{d":`XNx<`b<`.dfDZ dZ+`bdۯ(`fb<`b(`bddJ`b`dT`%dZ/X`b`d <`b(`bddJg`b(``bddS`|x`bd۱(`fb<`b(`bddJ`b`dT`fdZ/X`bdW.S`|x`bd۱(`fb<`b(`bddJ`b`dT`dZ/X`bdS`|xR`x(`fbٲ(`rb<`b(`bddJ<`b(`nddJ`b` dT`dZ/X`b`d<`b(`nddJS`|x`dW d <`b(`bddJS`|xW<`b(`nddJ`bg`cӣЅg`bԀeDg`bAd`bf`c Y`d܄`bd `b@`dU`$dZ/X~<`bʂd-`b `dU`JdZ/X`b@`d D"e=`XN2xV`x``cÅEM'`eEL@HY`b(DԄ脢-E׀eGeG eЁGaaD,BZZD(BJJBHD(D'`cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB`Cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB D<@@`b`d`bdZ/X<`b(`bddJ`bdZ/X`b`d/X`b`d/X @&``c`d#=`Lc`EDžc\d1PY2ЀY3ЀYЀvD׀=`Nc=`Lb`dЀhÃ%dDdG123`|8 D `Bb`@:d@*;W`XNYx`dЀ2-6f`d`C X`XNx`deDЀ`>`CaD`dЀf`bdۇeăddG`E;F܄dX́؃d@Mae@*dD-ZdG-́Z2cÃae@&Y ȲdYYYЀ2eăa`@"*`@: $::6`XNx`Va`c`TbaēdD|̄eD`Bb| `Pbg`d e=`XN2x`|X`exEMX`XNx`dԀ9cD"`GeԀ*X`XNxe\X`XNxgAX`XNx-DEMX`XNxeAX`XNxf`beDX`XNxf`beD-E`|dAef`b@N.Xf`b.Df`bZZ`C6ZdE`AcD"`G`\cD"`G`EdDɁՁaDǃ߃X`XNx`dԀX`XNxef`b@N.XcD"`G`EcD"`G`G.X/X`b`d/X(`b<`b(`ddJ`b` dX`dZ/X`b`d Gg`Bbo`dXO)O`b`aZJۡZ`zb*Gg`Bbf`dXO g`Bbi`dXOOHNdAAM@`XOx-A`XOxOZ`xg`Bd`Gf:YP[`8d[`:dل[`Bd[`Ddٽ[`Fd[`Ld[`Nd[`/Xg`EԀH`zc&Ag(Fdd .+/,0-./0Cd@*`G@`G)c(":`XNx~<`b<`(dfDZ dZ+d@FHo`_x+gDЀ8{ܠx`e Ԁ`dpЀg`clg` d܄Ѐ`Ѐ]\`d ca&eҡСdDՀف&FC`Gd@&@`G)~(d8d"(+,-./0`E&F3dD2eD1:`XNx<`b<`(dfDZ dZ+g` d܄o`x&Fk`x`dfE FKFI0eF0/Ѐ)F/.ЀeF.Ѐ)F.Xdh`b)`@64:dDeԀ/+dD DdD6&6'6(6)@6*6+6,6- 6(06)P6'6(6 6$6"h`bh`cdۣj`Bxr`xq`Zxq`xq`xq`xq`xq`xq`7xr`xr`Rxh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOxh`bdp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ+Ѐ,Ѐ-Ѐ.Ѐ/Ѐ0ЀVes`XOxh`bdp`xh`eh`cdaѥрp`xh`eh`cdaѣрp`xh`bh`cdۣFJ+Ѐ, Ѐ-Ѐh`bd +`dЀ,3Ѐ-0Ѐ-8(`DbdGЀ`Ac `Fd`EХЀeD́d@'HРdD`EdDԀ*Fp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxp`xh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOx.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ)+:+Ѐ,Ѐ-Ѐ@h`bBh`b@GVeh`aeCPҡЀҡЀҡЀ'D̄@G)'.Ѐ/Ѐ0Ѐ\es`XOx +&h`bdp`xh`bh`cdۣ8FJ`Ah`b6h`b6aDs`xs`x.Ѐ/Ѐ0Ѐh`bh`bh`b@G"\eh`aeCPҡЀҡЀҡЀ'D̄@G h`b:s`x8s`xh`b6`DbdG<9c`A`FdР́d@+*Р'`DbdGЀl`Ac `Fd`EХЀeD_́d@+ РdD`EdDԀMe~`GāaE&~`Gā&`GЀ-h`bh`b`AŅh`dā*F\cҡ۽ۣh`bd*F./0*Fp`xh`bh`b@Gh`aeCPҡЀҡЀҡЀ'D̄@GH/X`*b`d``c`f `{d̄`*b`d` `x! Secondary F's~ 8   $  F@p 4 ''dd'/  d #+ `xA`x`x`xCD`xD`xF`x`x`xLN`xL`xC`x`xF`xGB`VxC`VxD`VxE`x|`d)G` x@$XA!X"X `x"`vxE!X`x ` x`x@`xA`x%`-xC`x$`xE%`ux`x=`%x?`Gxy=`.x$=`.x=`xD=`.x=`.xG=`.x0`7x1`x(0`xD0`xE0`xF0`x|`d)G0`xoo?PgdN-SV8hXoooooooooooo h0313DD031303132323x==3F44645"4546"454545"45 4~7 45 45  45 45^45p4545:45D45F4540744f45j4545vg45499 4545 45a!45a$57%57&57'57#45(77*45+44x,48f-48.45f:45g)5<5^X45454540747Y45|45z45445454-8~47t4r74545/4504K814844J64L 64ZA6444844$44`44\44v44r44>$44 %44 &64t '648E44G44NH64lI64nJ44K44M64\P44YO64X64`446464b44 h64:!h64B "h64 #h640 @44A44 Y"B45C64D64F44 L44444444f64d64f*55596^mY0$\$Y$z#\$\$b$b$b$$%{#w$HH  \ "t$& (*,.0 246z8 :$<>@BD F&H[JL)NP R TVXZ\^`b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.eg\2e~Z~n*>Rfz"6Jz;;;;;;;;;;;0;;;c;q;;;;;;;;;;;;;;;;;;$ZBZFZJZNZZ>g>g>g>g>g>g>g>g>g\^Z>>bZfZ>gpZtZxZ|ZZZZZZZZZZZZ>g>Z[> [>> $[([,[0[46ێYYٞ>يٌ٦٨٪ٴٶپ٠٢٤lnFJLNP>8>PZ\>^pr>xz|~ـقلن:Z "$&Z*Z.Z2Z6ZZڪڬڮڰڲZZZZZZZٮ>gBD8>H٠>>`j>:d"bflZ>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>gٺΘ\`TVYY ZZRZVZZZZZZZZZhYjY,28DJhn̘aa`$ P[<_xbda*g8Yg4UYYYYZZZBZZZpZtZxZ|ZZZZZZYY>gYYYYYYYYYYlYFY>g8YY ZZZZZZf~@    $L~  F@PX~Z~&~   8 č~!ZFILE: EPRIMSYM,T3.10-04,F3.10-04,01/17/2002 PRIMARY 3 72 36 40 ~~d d d d d d d d0D`x DAdd@+d@Qd@Pd@@`*b`d``(b(`d(`1@&`U`"*2:BJRZbhpz!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`0D `dȁ>cdY`Av`>c`a`f `dXY`c`a`f `dXYXO.XO0DdceXOA`x`|c`da`F܄́d`eD@^ c`XNpx>D@^ c`XNpx/X.X0Dd@@C`exDĘ0D ``@`q`>exDĘ `cexDĘ`d`Av?`d`ddD+P`d`dЀ`d`#dЀ`dѺ`EdЀcG`C`d`vA<wD`W@J*D D@@/@@ D`A`daD@@@@dD? dDd`d`d`d?uD&& & & @&`e`d$g`\`d`d@E+@E`XOxXOJfPeRaQ @g&E@F`dP R~q&\`dٶ`e`d$g`\`d`d@E+@EXO<XOfPeRaQ @g&E@F`dP R~q&\`d%F&ADcՁc`FBaDŁcEŁ`EdԄeD/X%DЀЀЀЀH%Fg/X`q̃eD`u?ga#X@DDEDFDG? $Dg$D? `dDXCaC`E$D?'` d`du?`(b`4d$E'=`dga@ D ߴ@@`f`d`AcXY`&d`AcXYd@Pced@Pg`f`c`dЀۃ D@@d@Pced@P `x`dȁ>cdY`Av#X~`d$Ega#%E+ `pca$D'ӣԀ́$dXad"%DZg ӾԀ́$dXga#XbCdC`A܄"ZbDɁXga#X"bC̄ dAՀdCeAFdXɁga#X`d@KK`A؄"%D#fEHcȄ+FXeFɁga#Xd@E`d@Fw` /`b`XN{x%D`G~`XNx%D`XNxaa\ZdG`XNx,dD`XNx&́`XNx`z-$`XN{x~`XNx`XNx`XNx&E%DԀ@E(`dU`ga#Xw``XNx`XN{x~`XNx~`XNx`XN{x~`XNx/`b`aa\`XNx`G`E`XNx́Z`XNx`XNxU`ga#X``.X``.X c?@&σ.Xc`@*```?@&dd.Xc?@&܄``.Xt c7~@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@c        < t 8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.`_d`,dE`dG`d@ABCDE ~ G` d N`@99SA01000000Primary F's F3.10-0401/17/2002~~ &~~ ~ ~~~4BBBxBBBHBhey\L*JͬQJ}k-(*q8dڅWr65)\9:;Xacfm_kaÄn7Tm]4`Y ms  ׂ%b6ߓk @6 T]V] T]8W] U]X]  ֪tүrڦx֫v d=h0tNɿlY iAG5>l2<詟PW"^9}U= kp_D MN&GC5ezT2Wh휾,NJM+0 XF\CTJXGHV\C@IMHCBXQU~AbE *K:b]fA rD~ʇ><aQi4|Q7*S |Cw~~/h`BT_#zZ=)R:`x',#خ2 3x q] sŸvĘΓrQD]@ޮhgmHoOuSsQVɧo)LlY=:uRGu'T9 ܐ_{ HRE/E`Ӈ0 M3d |Ta)yץdJ@%Aq%Zr NZfO~W+$y̿ y7xr _xx.'c&iX J?2ިM ~ig@2G0mc "`$aV]ZY  3x q]־ IMs>sh9؝ƌr}nB?TSx1WDGeGf;΍ g?}\JB:.ްy#d_V|\Iėx1<֖U`)$b/ KNMMWRIIGBII $y̿ y7}#$z4Ny1P&vkvP_>|-Fei7%7HQXM|%Ix)v:BN   !"#$%&'()*+,-./1AY&SX#bd3'A7Q tE'((EE#S`(tq5&bIwW$piYWIfv''GvH0ϦnK2%(}ӁnjCD_3V'ص@6ݴT2c*S 3%ߔz\Q,f`ΓfI"aF ΄kܛJvz ae^-RQ1tQ;:/wlpϛ?^H#W;]1vJfh?Dh 53EKWvlI ^pi*}!ԧAM_)a:uq#)*>z}}U\m }  !"#$%&'()*+,-./8nA D^expand 32-byte kl^ D(D4DD8 D$D(D@ABCDEFGHIJKLMNOPQRSTUVXThe dhole (pronounced "dole") is also known as the Asiatic wild dog, red dog, and whistling dog. It is about the size of a German shepherd but looks more like a long-legged fox. This highly elusive and skilled jumper is classified with wolves, coyotes, jackals, and foxes in the taxonomic family Canidae.The dhole (pronounced "dole") is also known as the Asiatic wild dog, red dog, and whistling dog. It is about the size of a German shepherd but looks more like a long-legged fox. This highly elusive and skilled jumper is classified with wolves, coyotes, jackals, and foxes in the taxonomic family Canidae.EYNHa,P/ ~Y*S鍍d@7[& #1< HW]M ,g;fosa'w :kXBH㩴ٍ ~z0{f31d$ l?OhD0V:D+HϦFKtB@|Cv`[hFnEu#aR ktjtFA^{*)*IWx R ?*j~h|y` HCHlˇ_ E瘚 H'QJm\bאc1]BIt8-d5!w.s+o &mZn9 t1=._Ÿ0^ASm0pxZip"˘jQƧ=v䓚!:oW o!q5W:NRDu{=-oqV8c^U(R=ؖ *w}؋If6U3mUؕ22UXoÌR )'5»;D!UhF/|,Əͳy2qٯMB#8VoD:Hm3Oj3mv[jUS_&)ûIt~._dyz,(4y:b,ia /A&"3DUfw̻wfUD3"-  J1AY'A;B'{BP}sՊtS.&dq]q]]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& Nuy6Urwk=veKpm5?R/XS?pFRD+}!БwG"lF4v!/wZ}NJؓM^,|0E'w;>5tv0eF9pJ4)N~_I<@;ruf8) ^(P  <`*KO4=I|`U{V;Qdq]p]]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& ;0yfe}Xq@߾ށM"m5?R/XS?pFR|Z-*f:+KOyQ$:顂psq$c(N~czt;6DɆ'@ZzF|3@ 0bS:FȲc\Tn~.3h8}ȉ0Ͳt6ѽH$q]q]DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)]رlbM*i֦n6۪;(;q{3n[.nZH/vy,c*ڌ}8HHq f@ZsyTH$q]q]DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪlE˳#bk'ȆEœpÄEw'iR_ A0qYHuhhOިXr^>34 z3Ӑ3`X7^s50uRXȠ^(Q3X؛r%ߞ;6]6: {AD^q_eNNL4ʧ= 1@dO*T%SRQt@$q]p]DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪ6̼W:6|5:)zflQLGK5uM} uwMai[#xv%43|G- O0dz,pgR'CY,Og2[6@Pq9+4;4t?GuW{Nl>2FLQiq{ŵ_rq^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,ieee80211_hdrsize0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-tkip_encaptkip_setkeytkip_decapl^DDDDDXDЉD0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-ieee80211_hdrsize^DDD0D4DĊD\Dieee80211_hdrsize ieee80211_sysctl_treetopieee80211_sysctl_setupieee80211_sysctl_attachieee80211_load_module_ieee80211_free_nodenode_reclaimieee80211_free_allnodes_lockedieee80211_node_table_cleanupieee80211_reset_scan_ieee80211_find_nodeieee80211_setup_nodeieee80211_cancel_scanieee80211_get_rateieee80211_tmp_nodeieee80211_find_rxnode_withkeyieee80211_find_txnodeieee80211_find_node_with_channelieee80211_find_node_with_ssidieee80211_free_nodeieee80211_create_ibssieee80211_ibss_mergeieee80211_end_scanieee80211_next_scanieee80211_node_delucastkeyieee80211_iterate_nodesieee80211_node_leave_11gieee80211_timeout_stationsieee80211_node_join_11gieee80211_node_table_resetieee80211_node_table_initPieee80211_encapieee80211_compute_durationPPPPPPPPPPieee80211_send_probereqieee80211_send_mgmtieee80211_mgmt_outputieee80211_beacon_allocieee80211_beacon_update^^^^^^^ieee80211_newstate  0 0   0 @ @ @ @ @ @ @ieee80211_wme_updateparams_locked       ^^^^^^^^^^//f/f////f/f//       ieee80211_wme_initparamsieee80211_rssadapt_sysctl_setup2^-F7F6F8FCFxEtEp]F GpElE4]GLFhEdE,]FF8F$mFxEtEp]C ZxEtEp]̾Z)C ZxEtEp]̾ZsC ZxEtEp]̾ZCExEtEp]E̬EEC$mFxEtEp]lrF     }E#(D(@AAA==A*ip_outputlFlFlFqFkF8pFnFrFDrFlFlFkFqFqFkFkFwFkFHqFtcp_outputsyn_cache_respond @@@@@@@GdGG0GX>GxMGDG@GGCGCGJ(?J@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_#@[\]^_`{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%##%##%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!______ _ _ _ _ _ _& _, _8_2_2 _8 _> _D _______________wsevent_copyout_events`^J|[J|nJ8oJcJ`R????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? ????@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?*&8+&*&]]o]]                                                   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~]Y]ak])̺]2]'](]ͳɿپ̴ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ᅠPXJJTFJ|JPNHJRRJCEJSTJNMJ\JCL,J0PL,J0REJ@RRJCEJSTJSLJRRJCEJSTJERJCEJSTJX ]] ]8nAJ _(]t ^`OW^X^`RX8^`RX|^`RXT^`RXp^`RXP^`RXl^`RX^`RX^`RX^`RX^`RX^`RXL^`RXh^`RX^`RX^`RX^`RX^`RX^`RX^`RX,^`RXH^`RX^`RXD^`RX`^`RX^X^`RX^`RX^@ K^X^ K^K^`RX4^`RX^X0^`RXd^J^J^X^ X^`RX ^ K(^8X^W]t ^`OW^X^\X8^X|^XT^Xp^XP^,Xl^X^X^X^X^X^`XL^Xh^X^X^X^X^X^X^X,^XH^X^X^XXD^X`^0X^X^X^X^@ K^X^ K^K^ X4^TX^X0^Xd^J^J^X^ X ^ K(^8X^W(]t ^`OW^X^J8^,XT^,Xp^X^X^@ K^X^ K^K^K4^,XP^,Xl^,X^X^X^X^X^pX0^XL^ľXh^,X^X^,X^,X^,X^X^0K,^LKH^ؾXd^J^J^X^ X^J^ K ^ K(^8XD^ K`^ X^W^X^X???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()+-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ!K!KX,!KTX4!K8XupdatefatsVKTKUKTKXUK4XK(UKTKdVK(VKUL]8nA `K_. .. T]t ^`OW^X^AK8^KT^,Xp^X^K^|K^X^PK^nK^ sK4^tuKP^,Xl^,X^X^X^X^X^X^pX0^4KL^ľXh^8yK^,X^t[K^ЋK^yK^,X^t}K,^ XH^ؾXd^l+K^)K^X^ X^qK^PzK ^p{K(^8XD^{K`^{K^W^X^XAaBbCcDdEeFfGgHhIiJjKkLlMmNnOoPpQqRrSsTtUuVvWwXxYyZz      !"#$%&'()*+,-./2345679:;<=>?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~sSTVWY[`cihoru      "#$%&'()*+,-./0123:e,;<=>f,ABCDEFGHIJKLMNOE{|}PQRSTUVWX Y Z [ \ ]^_0123456789:;<=>? @!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O`abcdefghijklmnopqrstuvwxyz{|}~     1a2b3c4d5e6f7g8h9i:j;k<l=m>n?o@pAqBrCsDtEuFvGwHxIyJzK{L|M}N~OPQRSTUV--------- - - - - ------------------- -!-"-#-$-%-      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~a     ( )!*"+#,$-%.&/'8091:2;3<4=5>6?7H@IAJBKCLDMEYQ[S]U_Wh`iajbkcldmenfogpqrstuvwz{xy|}&!*!k+!2!N!`!p!a!q!b!r!c!s!d!t!e!u!f!v!g!w!h!x!i!y!j!z!k!{!l!|!m!}!n!~!o!!!!$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,0,,1,,2,,3,,4,,5,,6,,7,,8, ,9, ,:, ,;, ,<, ,=,,>,,?,,@,,A,,B,,C,,D,,E,,F,,G,,H,,I,,J,,K,,L,,M,,N,,O, ,P,!,Q,",R,#,S,$,T,%,U,&,V,',W,(,X,),Y,*,Z,+,[,,,\,-,],.,^,`,a,b,kc,}d,}g,h,i,j,k,l,u,v,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:ZKhKKKnfs_sillyworkerKHKK8X @]]]]]]x]^]B]&] ]]]]]n]Z]D]8].]$]] ?BEF   F''FF''FF''F'' F''''' F'''' ?EF''' ?BEF''' ?BF''' ?F'' ?EF'''' ?EF''' ?EF''' ?EF''' EF''' F''' F'''F'' ?F'' EF'''F''  ](]]8nAt*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?'NNTXN8Xffs_newvnodeffs_reload,MвM4M0{MMhN!N ffs_sync]]]8nAMV_U_T]t ^`OW^X^`RX8^`RX|^`RXT^`RXp^`RXP^`RXl^`RX^`RX^`RX^`RX^`RX^`RXL^`RXh^`RX^`RX^`RX^`RX^`RX^`RX^`RX,^`RXH^`RX^`RXD^`RX`^`RX^X^`RX^}N^X^dN^0fN^DhN^d}N4^}N^X0^$Nd^|?N^N^X^ X^8;N^M ^{N(^8XD^4~N^Wx^hM$^M@^ܤM^M\^ĨM^M^,X^,X^,XX]t ^`OW^X^\X8^X|^XT^Xp^XP^,Xl^X^X^X^X^X^`XL^Xh^X^X^X^X^X^X^X,^XH^X^X^XXD^X`^0X^X^X^|N^X^dN^0fN^DhN^||N4^|N^X0^`Nd^|?N^N^X^ X ^{N(^8X^Wx^hM$^M@^ܤM^M\^ĨM^M^,X^,X^,X\]t ^`OW^X^xEN8^cN|^ pNT^dNp^xdN^dN^X^dN^0fN^DhN^ N4^NP^,Xl^,X^X^X^X^X^X^pX0^$NL^ľXh^mN^xnN^_N^4qN^dtN^ԁN^uN,^PyNH^ؾXd^|?N^N^X^ X^8;N^zN ^{N(^8XD^4~N`^~N^W^X^Xx^hM$^M@^ܤM^M\^ĨM^M^,X^,X^,Xp]8nA*N_V_hx]t ^`OW^X^X8^XT^Xp^h.N^1N^X^X^X^X^X4^XP^,Xl^,X^X^X^X^X0^XL^Xh^X^X^X^X^X^X^X,^XH^Xd^.N^ /N^X^ X^.N^/N ^.N(^8XD^X`^X^W^xXufs_inactiveufs_dircompactufs_dirgrowUN VNlVNVNWNWN4WNpWN]N]N8nAtaNU_ ...NNN Nuao_putN NNNNuvm_km_suballocNhNNuvm_unmap_removevmmapbsyL]]]p]uvm_page_physloaduvm_physseg_unplugswap_offswstrategysw_reg_strategyuvm_swap_initswap_onRR`O O`RRUSP`RO`RO`R`R`ROOOODO8nAO+_8nAO+_NetBSD8nAO+_8nA P+_,_-_-_-_A,@A#7$wx@g`8@O@cv@$tPRR4Rdeadcv8nA$yP/_RRRRxPRUSP`RP`R`R`R`RRUSP`R<<<PPdPfilt_timertouchE_hRhRPP,PPtP PPPdPPtPP|PDPRcrashme_sysctl_forwardercrashme_mutex_recursioncrashme_kpreempt_spinoutcrashme_spl_spinoutselfdebug_crashmecrashme_removeAD 0  pid %d (%s), uid %d: exited on signal %d (core not dumped, err = %d) pid %d (%s), uid %d: exited on signal %d (core dumped) NRdNRLRsleep@RRR4Rkpause@RRR4R\schedRRDR4Rsysctl_lookupLScallout@RRR4Rtodr_gettimetodr_settimeT_T_ T_T_F_acl_posix1e_mode_to_permconfig_devdeleteconfig_finalize_mountrooti^2L_Y_bdevsw_attachcdevsw_attachopendisk4`_?`_J`_ U`_(``_0k`_8v`_@`_P`_``_p`_`_`_`_`_`_@`_`_`_a_a_a_`_`_ `_@)`_h4T3T3T3T5T`R4TR4TS$7T`Rpr_phinpage_checkpr_rmpagepool_initpr_item_linkedlist_getpool_do_putpr_item_bitmap_indexpr_item_bitmap_put0123456789abcdef0123456789ABCDEF|/-\ظTԸTvmem_rehash_startT T@TThTLTT8T8nAlT|h_d U8 UUUXUUh_U0UhUlPUUUUTUUtUL#U$Umemfd:i_BUAU=U0AU|Pt@U=UPP?U=URRt?UWU LUOU,SUSUhRUT^UlZUp^UZU%j_PPPlP@KUJU OUPP8nAPUi_lwp_parkRRR4RselectXselect@RRR4Rpoll}j_ U4UhUlPآUUUhVUlUUHUUUUUj_ĨUP`UlPܩUUpUUԥU@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@|UUHUTUttyoutttyinttybgttyopnttyclsl_ l_%l_,l_1l_5l_;l_ VVlV@UV@VVU VtUUPUSU`RVUUTU VRU USV`R`R`R`R`R`RRUSP`RVRlVV8VRVSV`Rj sockaddr_copyWARNING: mclpool limit reached; increase kern.mbuf.nmbclustersm_prependm_copy_internalm_pulldownm_copypacketl]tXVXVXVxXV8ZVHZVXV@ZVXVhZVpZV[VXVPZVXZVXVXVXVXV`ZV<VT^VT^=VT^lV`oVjVeVgVlpVpVdfVfV|pVn_aVPPlP|P`VpdVPP8nAhVn_|wVvV|wVlxVXq}_l ^c}_d ^X}_\ ^ M}_T ^ C}_L ^ :}_D ^ 0}_< ^ %}_4 ^ }_, ^ }_$ ^ }_ ^ |_ ^ |_ ^|_ ^|_ ^|_ ^|_ ^|_ ^|_ ^|_ ^|_ ^ |_ ^|_ ^w|_ ^ n|_ ^ c|_ ^ Y|_ ^ O|_| ^ C|_t ^ 7|_l ^ *|_d ^ |_\ ^!|_T ^"|_L ^#{_D ^${_< ^%{_4 ^&{_, ^'{_$ ^({_ ^){_ ^*{_ ^+{_ ^,{_ ^-{_ ^.y{_ ^/n{_ ^0a{_ ^1P{_ ^ 2A{_ ^31{_ ^4!{_ ^5{_ ^6{_ ^t ^^^^8^T^p^^^^^^^4^P^l^^^^^^^0^L^h^^^^^^^,^H^d^^^^^^ ^(^D^`^|^^^^^^$^@^\^x^^^r_ ^0 ^t ^|X^W^X^{Xp^{X^X^{X4^{XP^,Xl^,X^X^{X^{Xh^{X^|X^|X^|X0^XL^Xd^{X^X^X^X^}X^p|X ^|X(^8X^X^|X^|XXXXX܇X4 ^t ^`OW^X^L}X8^XT^Xp^XX^|X^X^X^X^X^X4^XP^,Xl^,X^X^X^~X^X^X0^XL^Xh^X^X^X^X^X^X^X,^XH^Xd^`}X^X^X^ X^h}X^X ^X(^8XD^}X`^ X^X^xXgenfs_suspendctltX̽XtXpXtXXgenfs_can_access_acl_posix1e@ @@ @ @8nA|XU~_layer_bypass@<^t ^`OW^X^\X8^XT^Xp^X^X^X^X^X^X^ X4^TXP^,Xl^X^X^X^X^X^X^`X0^XL^Xh^X^X^X^X^X^X^X,^XH^Xd^pX^X^X^ X^X^XX ^`X(^8XD^X`^0X^W^X^Xdevclsdeviocdevoutdevindevwaitdeviodevopn8nA0X^Y YYYYdY Y YSąY YYY|YYRUSP YSądkdump_F_ɂ_K_EFI PART(s*K>;_2IчHnK_|nQn- q+nK_ZIчHV_|nQn- q+V_SFU0eCV_IчH_IчH$_-чH_-чH._SFH0eCK_S'@ )Ѹ_*1@ )Ѹ_1x )Ѹ_3Dh&ǰ_=rGy=iG}䵄_|nQn- q+_5YQ7Y6Y;Y:Y;YRUSP`R7Y6Y5Y;Y`R 4Y`R=YR>Y>Y=YRUX>YP`RAY BY8DYBYBYRBYS(BY`RFYDYJY`R`R`R`RRUSP`R_LYxWYfYlPTIYHY|dYXFYP_bpf_mtap_softint_init8nA|UY_~_8nAqY~_ifaddrpref_ioctld n;0&AvQkkXaM* ʚ;! *" T# T$ T% T& T' T( T) T* . + , - / 0 1 2 3 4 5 6 /P 7 /P 8 /P 9 /P : /P ; /P < /P = /P > /P ? t; @t; !@t; "@t; #@t; $@t; %@t; &@t; '@t; )@t; *@t; +@0 &`vH'`vH,@vH-@vH.@vH/@vH0@vH(`vH1@vH2@vH3@vH)`vH4@vH5@vH6@vH7@vH8@.9@.:@.*`.;@.<@.=@.>@.?@. `!]!`!]+`!],`!]"`!]#`!]-`!]$`!].`!]/`!]%`!]C =D$E =F$cde@B`Sا@BO[@T6nQ%l7Jnd_set_timer#_@Z_HZ_Z_\Z@Zrt_initrt_timer_initrt_deladdrroute_outputrt_msg1route_enqueuert_addrmsg0}Z~ZHcZkZcZbZkZZ4Z8cZcZcZfZfZcZ cZ\ZXcZ(cZx7ZfZ|^,bZarp_llinfo_outputarpannouncearp_dad_startarp_dad_timerarp_rtrequestarpresolvetZ؛ZȎZin4_cksumwqinput_createwqinput_sysctl_setup8nAZ!_8nAZؐ_8nAZ&_8nAZ__ pP|DYd=YqY@YVjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfag jgrn<:ORQhك[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG;_nK_B_E_F_H_M_V___P_V_ _|^[_K_`___$__i_P_n_t_x___.______  gntsd[f[0f[|d[ld[_^^0 _ ז__Ȼ[_[_[k^[[_^[_[_m[_$[4[rbmn4[[̅[T[[P(_tcid[ؓ[d[[[[[t[d[ _^^[_^2[^<[^_yekd[ȓ[[@ _(_8<_H,'_atadԦ[,[[k^ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+//_loob[[[P^P^P^P^truefalseyara[[[[[_Kk_On__ 8_strtoullstrtollstrtoulCopyright (c) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010, 2011, 2012, 2013, 2014, 2015, 2016, 2017, 2018, 2019, 2020, 2021, 2022, 2023, 2024, 2025 The NetBSD Foundation, Inc. All rights reserved. Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. INSTALL_C700NetBSD 10.99.14 (INSTALL_C700) #0: Sat May 3 21:34:09 UTC 2025 mkrepro@mkrepro.NetBSD.org:/usr/src/sys/arch/zaurus/compile/INSTALL_C700 @(#)NetBSD 10.99.14 (INSTALL_C700) #0: Sat May 3 21:34:09 UTC 2025 mkrepro@mkrepro.NetBSD.org:/usr/src/sys/arch/zaurus/compile/INSTALL_C700 10.99.14NetBSDmd%d: internal %s image area match_bootdisk: can't get label for dev %s (%d) no mainbus foundwdWARNING: double match for boot device (%s, %s) boot device: %s ziici2c-indirect-probe-strategyThe operating system has halted. Please press any key to reboot. rebooting... REBOOT FAILED!!! ffuartbtuartstuartglasscpu not recognized!initarm: out of memoryinitarm: Failed to align the kernel page directorydos partition I/O errormbr partition exceeds disk sizeCD001BEA01NSR0disk label read faileddisk label corrupteddisk label write failedbad sector table I/O errorbad sector table corruptediso partition: I2C controller unable to attach PXA I2C controller pxaiic: PCMCIA/GPIO controller %s: invalid CF slot %d%s: failed to map memory %x for scoopscoop_pcic_read: bogus registerscoop_pcic_write: bogus registerscoop_pcic_set_power: bogus power statepxapcic_scoop%s: not configured. can't map bus space couldn't establish power handler %s: not configured zssp: zssp_ic_send: invalid IC %d zsspSharp Zaurus frame bufferSharp Zaurus LCDw100lcdstd: ATI Imageon100 LCD controller failed to map config (errorno=%d) failed to map register (errorno=%d) failed to vram register (errorno=%d) unable to create new screen (errno=%d)lcdctl%s: this kernel is not support SL-C1000 couldn't register event handler zkbd: pseudo power management module zapmunable to establish nSD_DETECT interrupt unable to attach MMC controller %s: zmci_set_power(): unsupported OCR (%#x) zmcivfp fpscr trapscnopen: no console devicecnopen: cn_tab->cn_dev == devcnopen: unable to get vnode reference   base 0x%x-0x%x irq %d drq 0x%08x core %dmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!cpu_mainbus, rrx, %s r%d, %s #%dlrthumb insn und%s %08x %s%s , #%d#%d ; #0x%x[r%d][r%d#0x%03x#%s0x%02x%sr%d{r%d-r%d}^f%d#%s.%c%d, #0x%04xspsrcpsrp%df%d, c%d, c%d, c%d, c%dr%d, c%d, c%d, %d%d, r%d, r%d, c%d[%c - unknown]oshstoshnshstnshishstishcpsC!csetend lesetend beclrexdsb!ldmbisbsrsXnW!mrfeXnWblxmcrr#&mrrcstc2L#vstcldc2ldccdp2#ycdpmcr2#zmcrmrc2mrcsbfxdmirbfcdijbfidmijubfxstrtdaWldrtstrbtldrbtldrstrbldrbpopstmYnWlldmXnWlblimbimbrangeswistrhtldrhtldrsbtldrshtstrhldrhldrdldrsbstrdldrshnopyieldwfewfisevdbg!dmrsmsrpFmpF2bxclzbkptmovwdZmovtswpdmoswpbldrexldrexdldrexbldrexhstrexdmastrexdstrexbstrexhSdn2adcsbcrscDn2teqcmnmovSd2mvnSnmsmlaSnmsdumullSdnmssmullumlalsmlaladfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtlgnsincostanasnacsatnfpuopstfQLvldfPRgdfixPRdhwfswfcrfccmfPRghcmfecnfevandvbicvorrvornveorvbslvbitvbifvshlSINuqwvqshlvrshlvqrshlvaddvtstvsubNo support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcacheundefined instruction %#x in kernel at %#lxbooted_devicebooted_kernelconsole_devicecpu_archpowersavecpu_idfpu_presenthwdiv_presentneon_presentid_isarid_mmfrid_pfrid_mvfrsimd_presentsimdex_presentsynchprim_presentprintfataltrapsunaligned_sigbusWarning IRQ's disabled during boot() single-skdb-k-dask-auserconf-chalt-bquiet-q-v-xsilent-z%s: curaddr %#lxnot in range%s: _BUS_DMA_BUFTYPE_INVALID%s: map %p: unknown buffer type %d _bus_dmamem_map: size botchL%u %dKB/%dB %d-way (%u set) %s %cI%cT Unified cache L%u %dKB/%dB %d-way (%u set) %cI%cT Instruction cache L%u %dKB/%dB %d-way (%u set) %s %cI%cT Data cache sctlr: %#x actlr: %#x revidr: %#x isar: [0]=%#x [1]=%#x [2]=%#x [3]=%#x, [4]=%#x, [5]=%#x mmfr: [0]=%#x [1]=%#x [2]=%#x [3]=%#x pfr: [0]=%#x [1]=%#x Processor failed probe - no CPU ID %s%s%s (%s V%s core)unknown CPU (ID = 0x%x): %s %s midr: %#x %s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s does not fully support this CPU. This kernel does not fully support this CPU. Recompile with "options %s" to correct this. arm700swibugvector abortterminal abortexternal linefetch abort (S)external linefetch abort (P)external non-linefetch abort (S)external non-linefetch abort (P)external translation abort (L1)external translation abort (L2)alignment abort (0)alignment abort (1)translation abort (S)translation abort (P)domain abort (S)domain abort (P)permission abort (S)permission abort (P)undefined insn trapsundefined cp15 insn traps: disabled : disabled (uniprocessor kernel) write-throughwrite-back**unknown 3****unknown 4**write-back-lockingwrite-back-locking-Awrite-back-locking-B**unknown 8****unknown 9****unknown 10****unknown 11**write-back-locking-linewrite-back-locking-Cwrite-back-locking-DCPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10ARM10EJSA-1CPU_SA110XScaleCPU_XSCALE_...ARM11JCPU_ARM11ARMv4CPU_ARMV4CortexCPU_CORTEXMarvellCPU_PJ4BARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM810SA-110SA-1100SA-1110FA526IXP1200ARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM920TARM922TARM940TTI ARM925TARM946E-SARM966E-SSheeva 88SV131Sheeva 88FR571-vdi80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA27xPXA250PXA210PXA255/26xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1020EARM1022E-SARM1026EJ-SARM926EJ-S r0ARM1136J-S r0ARM1136J-S r1ARM1176JZ-S r0ARM11 MPCoreCortex-A5 r0Cortex-A7 r0Cortex-A8 r1Cortex-A8 r2Cortex-A8 r3Cortex-A9 r1Cortex-A9 r2Cortex-A9 r3Cortex-A9 r4Cortex-A17(A12) r0Cortex-A15 r2Cortex-A15 r3Cortex-A15 r4Cortex-A17 r1Cortex-A35 r0Cortex-A53 r0Cortex-A57 r0Cortex-A57 r1Cortex-A72 r0Sheeva 88SV581xSheeva 88SV584xstep 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step A-0step A-1step B-0step B-1step C-0rev 0step B-2step D-0(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step B-3step B-4step B-5step Bstep Cstep Dstep Erev 10step Gstep Jstep Kstep Sstep T*p0*p1*p2*p3*p4*p5*p6*p7*p8*p9*p10*p11*p12*p13*p14*p15Fatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=Invalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abort Kernel mode double abort! %d.%d(%s): trap: signo=%d code=%d addr=%p trap=%#x r0=%08x r1=%08x r2=%08x r3=%08x r4=%08x r5=%08x r6=%08x r7=%08x r8=%08x r9=%08x rA=%08x rB=%08x ip=%08x sp=%08x lr=%08x pc=%08x spsr=%08x %s: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x) -> %x UVM: pid %d (%s), uid %d killed: out of swap %s: invalid size (%zu)Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)kmpagespmap_bootstrap: No PTP for va %#lx pmap_enter: failed to allocate L2 bucketpmap_enter: no pv entriespmap_init_l1: can't get PA of L1 at %pfixup: pm %p, va 0x%lx, ftype %d - nothing to do! fixup: l2 %p, l2b %p, ptep %p, pte %#x fixup: pdep %p, pde %#x, fsr %#x pmap_pv_protect: page not pv-tracked: 0x%lxpmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_alloc_specials: no l2b for 0x%lxpmapplpvepll2dtblpll2ptpplCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L1 table provided%s: no L2 table for VA %#lx%s: can't find L2 table for VA %#lxxscale_setup_minidata: can't find L2 table for VA 0x%08lx dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console vmapbufvunmapbuf address 0x%08lx not a valid page pmap_pv_untrack: pv-tracking at 0x%lx: 0x%lx bytes, not 0x%lx bytespmap_pv_untrack: pages not pv-tracked at 0x%lx (0x%lx bytes)%s: not supported %s: status=%s %s: (error not notifiedwddump: device timed outwddump: drive faultwddump: DMA errorwddump: wddump: unknown error type %xwdioctlstrategy: No matching ioctl request found in queue physio split wd ioctl request... cannot proceed device faultdevice timeoutrequeuechannel reset, xfer %lx, retry %dsoft error (corrected) xfer %lx ST506wd_get_params: bad return code from ata_get_paramsIDENTIFY failed SPLIT_MOD15_WRITEquirks %s drive corrupts write transfers with certain controllers, consider replacing drive supports %d-sector PIO transfers, LBA48 addressing LBA addressing chs addressing %s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors (%d bytes/physsect; first aligned sector: %jdWARNING: block size %u might not actually work hwcould not create %s.%s sysctl node use_ncqcould not create %s.%s.use_ncq sysctl - error %d use_ncq_priocould not create %s.%s.use_ncq_prio sysctl - error %d standby immediate address mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectedobsolete (address mark not found)no media/write protectedinterface CRC errorST3120023ASST380023ASST360015ASwdc_ata_bio_kill_xfer: unknown reason %d wdc_ata_bio_kill_xferrecalpiomodesetmulti%s:%d:%d: not ready, st=0x%02x, err=0x%02x %s:%d:%d: timeout waiting for DRQ, st=0x%02x, err=0x%02x %s:%d:%d: %s timed out %s:%d:%d: %s drive fault error (%x) %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: read intr before drq atabus at %s channel %dwd at %s drive %d%s: unknown child %patasplatainitq%s: channel %d busy, xfer not possiblexfer %lx freed while invoking timeout xfer %lx deactivated while invoking timeout %s: unknown type: %xunable to create kernel thread: error %d %scnfunable to create config thread: error %d %s: ata_xfer_start() unexpected rv %d%s: queue_freeze%s(%s:%d:%d): using PIO mode %d32-bit data port drive supports PIO mode %d%s DMA mode %d%s Ultra-DMA mode %d (Ultra/33) (Ultra/66) (Ultra/100) (Ultra/133)SATA port multiplier not supported atapibus at %s not configured ata_hlatabusatdrnqidlataactatafinatathinvalid checksum %x for READ LOG EXT page %x READ LOG EXT page %x failed to report error: slot %d err %x status %x couldn't create dma map. (error=%d) mmctaskqxfer 512xfer 1024xfer 2048xfer 4096xfer 8192xfer 16384xfer 32768xfer 65536xfer unalignedxfer error%s(manufacturer 0x%x%sproduct 0x%x%sstandard function interface code 0x%x%sat %s function %d "couldn't create task thread couldn't alloc memory (sdmmc function) sdmmcdelaysdmmc_set_relative_addr: SMC_CAPS_SPI_MODE setsdmmc_select_card: SMC_CAPS_SPI_MODE setsdmmc_select_card: error %dcouldn't supply bus power couldn't supply clock couldn't enable card: %d couldn't identify card no functions i/o init failed mem init failed bad CIS ptr %#x CIS parse error at %d, tuple code %#x, length %d CISTPL_FUNCE(common) found in function CISTPL_FUNCE(common) too short CISTPL_FUNCE(lan_nid) too short CISTPL_FUNCE(lan_nid) invalid CISTPL_FUNCE(function) found in common CISTPL_FUNCE(function) too short (v1.00) CISTPL_FUNCE(function) too short bad CISTPL_FUNCID length bad CISTPL_MANFID length CISTPL_VERS_1 too short SDIO function unknown tuple code %#x, length %d %s: CIS version %u.%u %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: extended I/O error %d, r=%d p=%p l=%d %s direct I/O error %d, r=%d p=%p %s couldn't supply voltage requested by card couldn't send I/O OCR couldn't set I/O RCA couldn't select I/O RCA %d can't change bus width couldn't read CIS can't change bus clock %u-bit width, %u.%03u MHz %u KHz error waiting for data ready after ext write : %d switch error error waiting for data ready after switch command: %d can't read EXT_CSD (error=%d) unrecognised future version (%d) unknown CARD_TYPE: 0x%x card failed to switch to timing mode %d, using %d can't re-read EXT_CSD HS_TIMING set failed can't switch signaling voltage DDR52HS200can't execute MMC tuning can't enable cache: %d HostHost/CardSD_SEND_SCR send failed. can't change bus width (%d bit) switch func mode 0 failed failed to recover UHS card switch func mode 1 failed: group 1 function %d(0x%2x) can't get SD status: %d SD card status: %d-bit unknown bus width, C%d, U%d, V%d, A%d, Cache, %s self-maintenancecan't execute SD tuning setting cache enable failed: %d cache enabled can't enable cache: %dunknown SD CSD structure version 0x%x unknown MMC CSD structure version 0x%x unknown MMC version %d couldn't set mem RCA mid=0x%02x oid=0x%04x pnm="%s" rev=0x%02x psn=0x%08x mdt=%03x write-protected cache flush failed Default/SDR12High-Speed/SDR25SDR50SDR104DDR50SD cardMMC: <0x%02x:0x%04x:%s:0x%02x:0x%08x:0x%03x> %s 0x%02x:0x%04x:%ssdmmc discard countsdmmc discard errorssdmmc discard busyldsdmmc%sattachcouldn't create thread (disabled)%d-bit width, %s, %s cache%s, Cache%s,blkno 0x%llu exceeds capacity %d , retrying ld_sdmmcconfig_hook: invalid hook typeconfig_hook: incompatible mode on type=%d/id=%ld != %dconfig_hook: type=%d/id=%ld is replacedconfig_hook: type=%d/id=%ld is already hooked(%p)config_connect: can't connect with shared hook, type=%d id=%ldUNKNOWNCASIOCompaqHPHP Jornada addr 0x%lx-0x%lx intr %dPXA270Kernel is configured for %s, but CPU is %s : Onchip Peripheral Bus pxaip_attach: failed to map CLKMANpxaip_attach: failed to map MEMCTLpxaip_measure_cpuclock: can't map RTC%s: CPU clock = %d.%03d MHz %s: kernel is configured for PXA250, cpu type is %s pxaintcpxaip_attach_critical: failed to attach INTC!pxagpiopxaip_attach_critical: failed to attach GPIO!pxa2x0_memctl_read: not bootstrappedpxa2x0_memctl_write: not bootstrappedpxa2x0_clkman_config: not bootstrappedpxaippxa2x0_io_bs_alloc(): not implemented pxa2x0_io_bs_free(): not implemented : Interrupt Controller stray interrupt %d intr_establish: bogus irq number %dintr_disestablish: bogus irq number %dpxagpio_reg_read: not bootstrappedpxagpio_reg_write: not bootstrapped: GPIO Controller Can't map registers! failed to hook main GPIO interrupt no GPIO configured in kernel unhandled GPIO interrupt. GPIO#%d pxa2x0_gpio_intr_disestablish: can't unhook GPIO#0pxa2x0_gpio_intr_disestablish: can't unhook GPIO#1pxa2x0_gpio_intr_establish: bad pin number: %dpxa2x0_gpio_intr_establish: Pin %d not GPIO_INpxa2x0_gpio_intr_establish: bad level: %dpxa2x0_gpio_intr_establish: illegal shared interruptpxa2x0_gpio_set_intr_level: bad level: %d: can't map registers pxauart%s: Cannot map registersSA-11x0 OS Timer clock: hz=%d stathz=%d saost_countsaostStray DMAC interrupt for unallocated channel %d : DMA Controller dmac_pxaip_attach: bus_dmamem_alloc faileddmac_pxaip_attach: bus_dmamem_map faileddmac_pxaip_attach: bus_dmamap_create faileddmac_pxaip_attach: bus_dmamap_load failedpxa2x0_dmac_abort_xfer: channel %d failed to abortpxadmacpxapcic_mem_map: bogus kindpcic_attach_card: already attached%s,%dunable to create event thread for %d pxapcicevpxapcicss: %d slot%s can't attach failed to map MEMCTL unable to map register %s: Bus Error Detected Interrupt not handled 0x%x : Real-time Clock %s: couldn't map registers %s: using wristwatch register pxartcpxamci_dmac_ointr: non-zero completion status %d pxamci_dmac_iintr: non-zero completion status %d mmclkclock stop timeout unsupported bus frequency of %d KHz data not a multiple of %u bytes too much data couldn't start dma xfer. (error=%d) mmcmd: MMC/SD Controller couldn't establish MMC interrupt using DMA transfer couldn't alloc rx dma xfer couldn't alloc tx dma xfer couldn't attach bus apmsuspendpower management disabledunknown error codeinterface not connected16-bit interface already connected16-bit interface not supported32-bit interface already connected32-bit interface not supportedunrecognized device IDparameter out of rangeinterface not engagedunable to enter requested stateno pending eventsno APM presentreal mode interface already connectedAPM reservedAPM: %s event code %x get eventapmstandbyapmevioctl get power statusapm at %sPower Management spec V%d.%dunable to create thread, kernel APM support disabled reserved systemreserved deviceOEM definedapmdevpcmcia_childdetached: %s not found %s: error %d detaching %s (function %d) (manufacturer 0x%04x, product 0x%04x) function %d: %s pcmcia_function_init: function is enabled%s: card appears to have bogus CIS pcmcia_function_enable: function not initialized%s: couldn't map the CCR pcmcia_io_map: function is enabled! pcmcia_io_unmap: function is enabled! pcmcia_intr_establish: function is enabled! pcmcia_intr_establish: already done interrupt establish failed pcmcia_intr_disestablish: function is enabled! pcmcia_intr_distestablish: already done Drats! I need a skew! CIS checksum failed %s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) unspecifiedmulti-functionserial portparallel portfixed disk(ata)video adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx-%lx; memspace@%lx; maxtwins %d mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS %s: using CIS quirks for SVECFD605 PCMCIA EtherNet CardNDCPCMCIA MBH10302can't alloc mem for enet addr can't map mem for enet addr configure failed, error=%d can't get subregion for asic can't match ethernet vendor code cannot set power mgmt handler unable to establish power handler PCMCIAAmbiCom IncAMB8002TAmbiCom,Inc.Fast Ethernet PC Card(AMB8110)PMX PE-200UE2212D-LinkDE-660DE-660+RPTI LTD.EP400RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212EN2216-PCMCIA-ETHERNETSeiko Epson Corp.P/N: EEN10B Rev. 00TAMARACKCNetCN40BC EthernetPCMCIA-ETHERNET-CARDUE2216ASIXAX88190DFE-670TXDMELCOLPC2-TXLINKSYSE-CARDDE-650I-O DATAPCLAcorega K.K.corega Ether CF-TD LAN Cardcorega Ether PCC-Tcorega Ether PCC-TDcorega Ether PCC-TLcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDcorega FEtherII PCC-TXD(CG-LAPCCTXD)(HardwareFirmwareVer.)SMC8041TX-10/100-PC-Card-V2LNT-10TNCF10Base-Ethernet1.0DYNALINKL10Cne_pcmciacouldn't establish interrupt MEGAHERTZMODEM XJ2288com_pcmciacan't subregion I/O space memory mapped mode i/o mapped mode wdcattachDigital Mobile Media CD-ROMPCMCIA Portable CD-ROM DriveNinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI AdapterFREECOMPCCARD-IDEIO DATACBIDE2 LOOKMEETIDE CARDwdc_pcmciawiinitcouldn't load firmware failed to attach controller SMC2632WNANOSPEEDHFA384x/IEEENECWireless Card CMZ-RT-WPNTT-ME11Mbps Wireless LAN PC CardWireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11WLCFL-11INTERSILIntersilPRISM 2_5 PCMCIA ADAPTERPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN Adapterwi_pcmciaunable to flush cache timeout draining buffers failed to flush cache i/o blocked while suspended lddrain; first aligned sector %u%s: not drained dk_subrLucent/Prism/Symbol 802.11 controls%s: sysctl_createv failed (rc = %d) timeout in wi_seek to %x/%x %s: failed in wi_seek to %x/%x detect auto increment bug, try again command timed out, cmd=0x%x, arg=0x%x command failed, cmd=0x%x, arg=0x%x wi_cmd: busy bit won't clear. xmit failed %s: %d tx cmds pending!!! %s: cleaning outstanding rssadapt descriptor for %s record read mismatch, rid=%x, got=%x record buffer is too small, rid=%x, size=%d, len=%d %s: invalid channel %d %s: tx rate %d -> %d (%d) %s write fid %x failed failed to allocate %d bytes on NIC timeout in alloc tx buffer allocation failed %s: interface not running %s: device timeout %s read fid %x failed %s: null node%s bad idx %02x %s null node, rssdesc %02x %s txpending[%i] wraparoundtx failed, retry limit exceeded, max transmit lifetime exceeded, port disconnected, invalid format (data len %u src %s), status=0x%xwi_scan_result: unknown firmware type %u LucentSymbol could not establish softint could not get mac address, attach failed 802.11 address %s %s: using Unknown PRISM2 chipUnknown Lucent chip %s: %s Firmware: Primary (%u.%u.%u), Station (%u.%u.%u) using default channel list no available channel no supported rate list Lucent Technologies, WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEERF:PRISM2 MAC:HFA3841RF:PRISM2 MAC:HFA3841 CARD:HWB3763 rev.BRF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.ARF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.BRF:PRISM2 MAC:HFA3842 CARD:HFA3842 EVALRF:PRISM1 MAC:HFA3841 CARD:HWB1153RF:PRISM2 MAC:HFA3841 CARD:HWB3163-SST-flashRF:PRISM2.5 MAC:ISL3873B(PCMCIA)RF:PRISM2.5 MAC:ISL3874A(Mini-PCI)RF:PRISM2.5 MAC:ISL3874A(PCI-bridge)RF:PRISM3 MAC:ISL3871(PCMCIA)RF:PRISM3 MAC:ISL3871(Mini-PCI): failed to clear NIC buffer at offset %x - check configuration Ethernet address %s %s: NIC memory corrupt - invalid packet length %d device enable failed %s: remote transmit DMA failed to complete ne2000_write_mbuf: negative lenwhere did the card go? setup failed %s: %d silo overflow%s, %d ibuf flood%s com: unsupported I/O width %dtimeout while waiting for BUSY interrupt acknowledge timeout while waiting for HALT update acknowledge 0x%x 0x%x 'ns16550ast16650, broken fifost16650ans16550, broken fifons8250 or ns16450, no fifotl16c750ns16750Au1X00 UARTns16650, no ERSOMAP UARTIngenic UARTTegra UARTBCM AUX UARTDesignWare APB UARTDesignWare APB UART, no fifois_consoleforce_consoleskip_attach_delaycan't re-init serial console @%lx fifolen: %s, %d-byte FIFO txfifo disabled 10base2, 10baseT, 10baseT-FDX, auto, default [0x%02x 0x%02x] auto 10base2 10baseT-FDX 10baseT atarst%s:%d: %s %s:%d:%d: %s __wdccommand_kill_xfer: unknown reason %d __wdccommand_kill_xfer%s channel %d: reset failed for drive 0 drive 1atapitimeout not expected without pending irqlost interrupt type: %s tc_bcount: %d tc_skip: %d atapollatadrdyatacnfatardl%s: dir offset too large on fs %s (mounted from %s) %s: dir offset too large for emulated program /usr/libexec/ld.elf_so%s-%scompat_utilinvalid AES nrounds: %uBearSSL aes_ctAES-CCM overflow%s: ctxt %u%s: tag %u%s: verify %u failed %s: ptxt %u%s: forgery %u succeeded %s: buffer overrun %s: tag overrun aes_ccm: self-test passed aes_ccmaescryptoselectedAES is bustedaes: self-test failed: %s AES self-tests failedaes: %s %s AES-%u enc: self-test failed wasexpected%s AES-%u dec: self-test failed %s AES overrun preceding: self-test failed %s AES overrun following: self-test failed %s AES-%u-CBC enc: self-test failed %s AES-%u-CBC dec: self-test failed %s AES-%u-CBC enc inc %u: self-test failed %s AES-%u-CBC dec inc %u: self-test failed %s AES-CBC overrun preceding: self-test failed %s AES-CBC overrun following: self-test failed %s AES-128 CCM encrypt auth/ctr (16): self-test failed %s AES-128 CCM encrypt auth/ctr (48): self-test failed %s AES-128 CCM ciphertext: self-test failed %s AES-128 CCM decrypt auth/ctr (16): self-test failed %s AES-128 CCM decrypt auth/ctr (48): self-test failed %s AES-128 CCM plaintext: self-test failed %s AES-%u-XTS enc: self-test failed %s AES-%u-XTS dec: self-test failed %s AES-%u-XTS enc incremental: self-test failed %s AES-%u-XTS dec incremental: self-test failed %s AES-XTS overrun preceding: self-test failed %s AES-XTS overrun following: self-test failed %s AES-128 CBC-MAC (16): self-test failed %s AES-128 CBC-MAC (48): self-test failed chacha: self-test failed: %s chacha: %s Portable C ChaChaxchacha_streamxchacha_stream_xorchacha core 1chacha core 2hchachacprng_fast reseed/usr/src/sys/crypto/blake2/blake2s.c0 < dlenkernel %sassertion "%s" failed: file "%s", line %d dlen <= 32keylen <= 32jA%AESŘOOLJ܈yLblake2s: self-test failedblake2s: self-test passed blake2ssysmonsysmon_envsyssysmon_wdogsysmon_powerWARNING: KERNEL TICKLE OF WATCHDOG %s FAILED! wdogrefWARNING: unable to register watchdog shutdown hook WARNING: unable to register watchdog critpoll hook %s: %d users remain WARNING: UNABLE TO DISARM WATCHDOG %s ON CLOSE! WARNING: FAILED TO SHUTDOWN WATCHDOG %s! software watchdog initialized unable to register software watchdog with sysmon swwdog%s: %d second timer expired watchdog timer expiredswwrebootfailed to create swwdog reboot wq%s: unable to attach cfattach invalid vap id %dvap id %d not allocatedinvalid channel freq %u flags %x invalid channel (NULL) %s: mode %u not supported (caps 0x%x) Unexpected mode %u%s: no channels found for mode %u Bad IBSS channel %ubad channel ignored; freq %u flags %x number %u vap table full.5%s: %s rates: %s%d%sMbps%s: no 802.11 instance! 11a11b11gFHturboAturboGAMRR increasing rate %d (txcnt=%d retrycnt=%d) AMRR decreasing rate %d (txcnt=%d retrycnt=%d) No cipher!%s: %s keyix %u flags 0x%x rsc %ju tsc %ju len %u %s: driver did not delete key index %u %s: cipher %s has an invalid cipher index %u %s: cipher %s registered with a different template %s: invalid cipher %u %s: unregistered cipher %u, load module %s %s: unable to load cipher %u, module %s %s: no h/w support for cipher %s, falling back to s/w %s: no h/w support for TKIP MIC, falling back to s/w %s: unable to attach cipher %s %s: no h/w resources for cipher %s, falling back to s/w %s: unable to setup cipher %s %s: %s keyix %u flags 0x%x mac %s rsc %ju tsc %ju len %u %s: cipher %s rejected key index %u len %u flags 0x%x %s: no key index; should not happen! [%s] no default transmit key (%s) deftxkey %u %s: control frame%s: WEP data frame too short, len %u wlan_wepwlan_tkipwlan_aes_ocbwlan_ccmpwlan_ckip%s: Invalid key length %u, expecting %u [%s] Missing ExtIV for AES-CCM cipher [%s] AES-CCM decrypt failed; MIC mismatch AES-CCM[%s] key id %u is not set (decap) [%s] key id %u is not set (encap) NONEout of buffers with data_len %zu [%s] Discard frame due to countermeasures (%s) [%s] missing ExtIV for TKIP cipher [%s] discard frame due to countermeasures (%s) [%s] TKIP ICV mismatch on decrypt TKIP[%s] out of data for WEP (data_len %zu) [%s] WEP ICV mismatch on decrypt WEP[%s:%s] discard %s frame, %s information element, too short, len %uWME[%s] discard %s frame, ssid mismatch: [%s] extended rate set too large; only using %u of %u rates [%s] shared key challenge alloc failed reassocWPARSN, protection, QoSie too shortbad len %uERPid %u, len %uunhandledno scan.sp_ratesbad scan.sp_rates len %dno scan.sp_ssidbad scan.sp_ssid len %dinvalid channel %ufor off-channel %ubogus beacon interval[%s] erp change: was 0x%x, now 0x%x [%s] capabilities change: before 0x%x, now 0x%x no ratesbad rates len %dno ssidbad ssid len %dno ssid with ssid suppression enabled[%s] recv probe req recv'd rate set invalid[%s] recv auth frame with algorithm %d seq %d disallowed by ACLTKIP countermeasures enabledshared key auth PRIVACY is disabledbad sta auth mode %uie %d/%d too longno challengebad challenge len %dbad operating mode %ubad state %u[%s] shared key %sauth request shared key responseunknown stationno challenge recordedchallenge mismatch[%s] station authenticated (shared key) bad seq %d[%s] shared key auth failed (reason %d) open auth[%s] station authenticated (open) [%s] open auth failed (reason %d) unsupported alg %dwrong bssid[%s] deny %s request, sta not authenticated [%s] no WPA/RSN IE in association request not WPA, flags 0x%xbad version %umcast cipher mismatch; got %u, expected %uucast cipher data too short; len %u, n %uucast cipher set emptykey mgmt alg data too short; len %u, n %uno acceptable key mgmt algnot RSN, flags 0x%x[%s] %s ie: mc %u/%u uc %u/%u key %u caps 0x%x [%s] deny %s request, capability mismatch 0x%x [%s] deny %s request, rate set mismatch [%s] %sassoc failed (reason %d) [%s] %sassoc failed (rate set mismatch) [%s] %sassoc success: %s preamble, %s slot time%s%s [%s] recv deauthenticate (reason %d) [%s] recv disassociate (reason %d) subtype 0x%x not handledmgttoo short (1): len %uwrong version %xnode %s, %snot to bssnot to cur sta: lladdr=%6D, addr1=%6Dtoo short (2): len %ubss %s, broadcast %s, %sseqno <%u,%u> fragno <%u,%u> tid %uduplicateunknown dir 0x%xmulticast echounknown srcunassoc src[%s] power save mode on, %u sta's in ps mode [%s] power save mode off, %u sta's in ps mode [%s] flush ps queue, %u packets queued multicast fragm?demic errordecap errorunauthorized port: ether type 0x%x len %utoo short: len %ureceived %s from %s rssi %d WEP set but not permittedWEP set but PRIVACY offps-pollunassociated stationaid mismatch: sta aid 0x%x poll aid 0x%x[%s] recv ps-poll, but queue empty [%s] recv ps-poll, send packet, %u still queued [%s] recv ps-poll, send packet, queue empty bad frame type 0x%x[%s] %s compat_20link-layer statistics and controlsIEEE 802.11 WLAN statistics and controlsieee80211%s: sysctl_createv failed, rc = %d client/peer stationsvap%uinact_runinact_probeinact_authinact_initdriver_capsbmiss_max%s: 802.11 mgt frame too large: %ubad beacon boundarybss %snode %s join %snode %s leave notify scan done [%s] %s replay detected [%s] michael MIC verification failed %s: load the %s module by hand for now. bogus aid %u, max %u%s %p<%s> in %s table %s: IEEE80211_LOCK not held%s: remove %p<%s> from %s table, refcnt %d %s: %p<%s> clear key map entry [%s] scan candidate purged from cache (refcnt %u) %p: mac %s refcnt %d scangen %u authmode %u flags 0x%x associd 0x%x txpower %u vlan %u txseq %u rxseq %u fragno %u rxfragstamp %u rstamp %u rssi %u intval %u capinfo 0x%x bssid %s essid "%.*s" channel %u:0x%x fails %u inact %u txrate %u %s: free all nodes in %s table %s %s table %s: %s[%u] still active %s: scan set:%s%u start chan %u ????ibss %c %s %s%c %3d%c %+4d %2dM%c %4s%c %3s%c passive%s: end %s scan ni != NULLrefcnt(ni) == %dic != NULL%s: fixed rate %d (%d.%d Mb/s) not in rate set%s %p<%s> %s: add key map entry %p<%s> refcnt %d [%s] no node, discard frame (%s) %s %p<%s> refcnt %d %s: %p<%s> clear key map entryneighbor%s: creating ibss %s: merge failed, capabilities mismatch %s: new bssid %s: %s preamble, %s slot time%s %s: no scan candidate macaddr bssid chan rssi rate flag wep essid %s %s: chan %d->%d begin %s scan in %s mode, scangen %u new [%s] %s%s on chan %u (bss chan %u) [%s] caps 0x%x bintval %u erp 0x%x country info %02xkey map out of sync, ni %p nikey %p%s: delete key map entry %p<%s> refcnt %d %s: scan aborted %u [%s] station with aid %d leaves unexpected operating mode %ubogus long slot station count %d[%s] long slot time station leaves, count now %d %s: re-enable use of short slot time bogus non-ERP station count %d[%s] non-ERP station leaves, count now %d %s: disable use of protection %s: re-enable use of short preamble %s: %s scangen %u [%s] discard frame, age %u [%s] discard %u frames for age probe station due to inactivitystation timed out due to inactivity (refcnt %u)[%s] station needs long slot time, count %d [%s] station is !ERP, %d non-ERP stations associated %s: enable use of protection [%s] station needs long preamble [%s] station %sassociated at aid %d: %s preamble, %s slot time%s%s unable to setup initial BSS node%s %s table, inact %u scanena[%s] send null data frame on channel %u, pwr mgt %s no ethernet header!not enough room, need %u got %lu [%s] enmic failed, discard frame mbuf already chained?pktlen %u mtu %ufragment size %u too big!%s: paylen < 0%s: npkt %d firstlen %d lastlen0 %d lastlen %d fraglen %d overlen %d len %d rate %d icflags %08x no WPA/RSN!RSN IE too big, %u > %zuWPA IE too big, %u > %zuieee80211_ref_node (%s:%u) %p<%s> refcnt %d [%s] send probe req on channel %u [%s] request encrypt frame (%s) [%s] send station deauthenticate (reason %d) [%s] send station disassociate (reason %d) [%s] invalid mgmt frame type %u [%s] encrypting frame (%s) [%s] send %s on channel %u %s: cannot get buf; size %u no space for 802.11 header?%s: traffic %u, disable aggressive mode %s: traffic %u, enable aggressive mode tim bitmap empty!%s: TIM updated, pending %u, off %u, len %u [%s] pwr save q overflow, drops %llu (size %d) [%s] save frame with age %d, %u now queued wlan: %s acl policy registered wlan: %s acl policy unregistered wlan_acl0x%s: %s -> %s no recent beacons from %s; rescanning %s: invalid transition %s: bogus xmit rate %u setup ostate %x nstate %x associated synchronized with %s ssid channel %d start %uMb NODS %s->%sTODS %sFRDS %sDSDS %s->%s) data type#%d WEP [IV %.02x KID %u] %dM +%d%s: %s [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s log2(cwmin) %u %s: WME params updated, cap_info 0x%x %s: %s chan [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s bss [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] beacon misswlan_internalwlan_xauthWME_AC_BEWME_AC_BKWME_AC_VIWME_AC_VOWME_UPSDINITSCANAUTHASSOCRUNreserved#0reserved#1reserved#2reserved#3reserved#5reserved#6reserved#7reserved#8reserved#9ps_pollrtscf_endcf_end_ackreassoc_reqreassoc_respprobe_reqprobe_respbeaconatimdisassocdeauthreserved#13reserved#14reserved#15rssadaptexpavgctl%s: dst %s threshold[%d, %d.%d] %d < %d %s: src %s rssi %d avg %d -> %d ieee80211_rssadapt_lower_rate: %s rate #%d > #%d out of bounds %s: dst %s rssi %d threshold[%d, %d.%d] %d -> %d %s: threshold[%d, %d.%d] decay %d %s: dst %s thresholds %d-byte, T[%d.%d] = %dexternal%hu.%hhu%s:%hhuigmpplinetigmplla_lookup: new lle malloc failed inmltplmulticastsubnetsarelocalhostzerobroadcastinvalid argument to in_lifaddr_ioctlin_controlin4pcbplin6pcbpl%d.%d.%d.%d%s:%huinterneticmpmaskreplreturndatabyteserrppslimitrediracceptredirtimeoutbmcastechodynamic_rt_msgICMP: redirect failed to register timeout for route to %s, code %d icmp_errorforwardingredirectttlforwsrcrtdirected-broadcastallowsrcrtmtudiscanonportminanonportmaxmtudisctimeoutlowportminlowportmaxcheckinterfacerandom_iddo_loopback_cksumdad_countanonportalgoavailablereserve%s: refusing to send from invalid address %s (pid %d) maxfragpacketsipfrenplrip_abortrip_acceptpcblisttcpipqepl(unknown)TCP: invalid wscale %d from %s, assuming %d tcp_pulloutofbandm_pulldown malfunctionConnection attempt to TCP %s:%d from %s:%d (unknown v6)Connection attempt to TCP [%s]:%d from [%s]:%d tcp_output REXMTtp->t_lastm == NULL%s: no template%s: %d < %dsackholepltcp_inittcpcbpltcp_new_iss: unreachable%s: impossible (1)%s: impossible (2)synplrfc1323sendspacerecvspacemssdfltminmssmslsyn_cache_limitsyn_bucket_limitinit_winmss_ifmtusackcongctlwin_scaletimestampscwmcwm_burstsizeack_on_pushkeepidlekeepintvlkeepcntslowhzlog_refusedrstppslimitdelack_ticksinit_win_localkeepinitrecvbuf_autorecvbuf_increcvbuf_maxsendbuf_autosendbuf_incsendbuf_maxecnmaxretriesglobalmaxholesglobalholeslocal_by_rttiss_hashabcaggressivemsltremoteremote_thresholdvtwtcp6inet6newrenocubicudp_abortudp_acceptudpchecksumrandom_startrandom_pickdoublehashrandinc(src=%s dst=%s tgt=%s)%s: sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d /usr/src/sys/netinet6/icmp6.c%s: source can't be determined: dst=%s, error=%d %s: ICMP6 redirect sent from %s rejected; must be from linklocal %s: ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) %s: ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s %s: ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s %s: ICMP6 redirect rejected; no route found for redirect dst: %s %s: ICMP6 redirect rejected; redirect dst must be unicast: %s %s: ICMP6 redirect rejected; neither router case nor onlink case: %s %s: invalid ND option, rejected: %s %s: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s %s: ICMP6 checksum error(%d|%x) %s %s: unknown type %d(src=%s, dst=%s, ifid=%d) icmp6nd6_prunend6_delaynd6_mmaxtriesnd6_umaxtriesnd6_maxnudhintmaxqueuelennd6_useloopbacknodeinfomtudisc_hiwatmtudisc_lowatnd6_debugreflect_pmtu%s: ENOBUFS in icmp6_error %d %s: in6_setscope failed IPv6 address: "%s" is not on the network %s: a destination can be specified for a p2p or a loopback IF only %s: prefixlen should be 128 when dstaddr is specified %s: valid lifetime is 0 for %s %s: addmulti failed for %s on %s (errno=%d) in6_prefixlen2mask: invalid prefix length(%d) invalid argument to in6_lifaddr_ioctl%s: %s marked tentative %s: %s marked detached in6_cksum: offset too short for IPv6 headerin6_cksum: mbuf too short for IPv6 header%s: %s has too small MTU, IPv6 not enabled %s: %s is not multicast capable, IPv6 not enabled %s: failed to configure the loopback address on %s (errno=%d) %s: %s: got interface identifier from itself %s: %s: got interface identifier from %s %s: %s: borrow interface identifier from %s %s: %s: interface identifier generated by random number %s: %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: failed to configure a link-local address on %s (errno=%d) %s: cannot assign link-local address ::ffff:%s[%s]:%huinternet6Cannot forward from %s@%s to %s@%s nxt %d (%s) unspec/srcbcast/mcastmcast/dstsrc[%s] inzone %d outzone %ddst[%s] inzone %d outzone %dip6keepfaithlog_intervalhdrnestlimitauto_flowlabeldefmcasthlimNetBSD-currentkame_versionuse_deprecatedv6onlyauto_linklocaladdctlpolicyprefer_tempaddrmaxfragsuse_defaultzonemcast_pmtuneighborgcthreshmaxdynroutesparam_rt_msgip6_init%s: packet to an unready address %s->%s %s: off < sizeof(struct ip6_hdr)%s: m == NULLpim6register_mifmultiple kernel entriesadd_m6fc: %s o %s g %s p %x dbx %p cannot forward from %s to %s nxt %d received on %s ip6_mforward: ip6_mrouter socket queue full assumption failed: hdr not splitmulticast_kludge%s: Cannot enable an interface with a link-local address marked duplicate. nd6_timer%s: workqueue_create failed (%d) %s: duplicated ND6 option found (type=%d) %s: nd6_options: unsupported option %d - option ignored %s: too many loop in nd opt %s: can't allocate llinfo for %s (ln=%p, rt=%p) %s: failed to set scope %s (errno=%d) %s.%d: sockaddr_dl_init(, %zu, ) failed on %s %s: rt_setgate failed on %s nd6_rtrequest: bad gateway value: %s %s: %s: failed to join %s (errno=%d) %s: detected a looped back NS message for %s %s: DAD duplicate address %s from %s %s: possible hardware address duplication detected, disable IPv6 %s: invalid hlim (%d) from %s to %s on %s %s: invalid target address %s %s: a solicited adv is multicasted %s: invalid ND option, ignored %s: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: duplicate IP6 address %s %s: ND packet from non-neighbor %s on %s nd6_dad_timer: called with duplicate address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: %s: could not run DAD, driver problem? %s: %s: DAD complete for %s - no duplicates found %s: bad DAD packet (wrong ip6 dst) %s: NS packet from non-neighbor %s on %s %s: bad NS target (multicast) %s: bad DAD packet (link-layer address option) %s: lladdrlen mismatch for %s (if %d, NS packet %d) %s: duplicate IP6 address %s %s: src=%s %s: dst=%s %s: tgt=%s nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: memory allocation failed for %s(%s) %s: %s: starting DAD for %s RA%s: src %s is not link-local %s: lladdrlen mismatch for %s (if %d, %s packet %d) raw6%s: assumption failure (non 0 ID): %s%%%d %s: no scope id for %s %s: can't set scope for not loopback interface %s and loopback address %s siteorganizationglobaludp6%s: control but no lwpudp6_output: IPV6_V6ONLY option was set for a connected socket addr 0x%x%s%s%s%s at %s addr 0x%02xi2c-indirect-device-permitlistinvalid property type (%d) for '%s'; must be array (%d) smbus-quick-writesmbus-receive-byteunknown probe strategy '%s'; defaulting to '%s' : I2C bus i2c-no-indirect-configi2c-child-devicescookiecookietypecompatibleWARNING: ignoring bad child device entry for address 0x%02x WARNING: ignoring bad device address @ 0x%02x i2cexec,i2c_bitbang,i2c_subri2cexeciic at %si2c_bitbangmii_attach: phyloc and offloc specifiedmii_attachmiimiiautomii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmiiverboseoui %6.6xmodel %4.4xOUI 0x%06x model 0x%04xmiiautmii_phy_setmedia: MASTER on wrong mediano media present HomePNA110baseT10baseT-FDX100baseTX100baseTX-FDX100baseT41000baseSX1000baseSX-FDX1000baseT1000baseT-FDX: Media interface : %s, rev. %d bgebnxphyflagsfailed to get phyflags chipidfailed to get chipid shared_hwcfgfailed to get shared_hwcfg port_hwcfgfailed to get port_hwcfg 2500baseSX-FDX BCM5400 1000BASE-T media interfaceBCM5401 1000BASE-T media interfaceBCM5402 1000BASE-T media interfaceBCM5404 1000BASE-T media interfaceBCM5411 1000BASE-T media interfaceBCM5421 1000BASE-T media interfaceBCM5424/BCM5234 1000BASE-T media interfaceBCM5461 1000BASE-T media interfaceBCM5462 1000BASE-T media interfaceBCM5464 1000BASE-T media interfaceBCM5466 1000BASE-T media interfaceBCM54K2 1000BASE-T media interfaceBCM5701 1000BASE-T media interfaceBCM5703 1000BASE-T media interfaceBCM5704 1000BASE-T media interfaceBCM5705 1000BASE-T media interfaceBCM5706 1000BASE-T/SX media interfaceBCM5714 1000BASE-T/X media interfaceBCM5750 1000BASE-T media interfaceBCM5752 1000BASE-T media interfaceBCM5780 1000BASE-T/X media interfaceBCM5708C 1000BASE-T media interfaceBCM5481 1000BASE-T media interfaceBCM5482 1000BASE-T media interfaceBCM5708S 1000/2500baseSX PHYBCM5709 10/100/1000baseT PHYBCM5709S 1000/2500baseSX PHYBCM5709CAX 10/100/1000baseT PHYBCM5722 1000BASE-T media interfaceBCM5754/5787 1000BASE-T media interfaceBCM5755 1000BASE-T media interfaceBCM5756 1000BASE-T media interface XXXBCM5761 10/100/1000baseT PHYBCM5784 10/100/1000baseT PHYBCM5785 1000BASE-T media interfaceBCM5717C 1000BASE-T media interfaceBCM5719C 1000BASE-T media interfaceBCM5720C 1000BASE-T media interfaceBCM57765 1000BASE-T media interfaceBCM57780 1000BASE-T media interfaceBCM54213PE 1000BASE-T media interfaceBCM5725C 1000BASE-T media interfaceBCM5906 10/100baseTX media interfacebrgphyDP83840 10/100 media interfacensphyDP83843 10/100 media interfaceDP83847 10/100 media interfaceDP83849 10/100 media interfaceDP83815/DP83846A 10/100 media interfacensphyterQS6612 10/100 media interfaceqsphyi82555 10/100 media interfacei82562EH HomePNA interfacei82562EM 10/100 media interfacei82562ET 10/100 media interfacei82562G 10/100 media interfaceinphyi82553 10/100 media interfaceiophy: 3Com internal media interface ignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYexphy100baseFX, 100baseFX-FDX LXT970 10/100 media interfaceLXT971/2 10/100 media interfacelxtphyICS1889 10/100 media interfaceICS1890 10/100 media interfaceICS1892 10/100 media interfaceICS1893 10/100 media interfaceICS1893C 10/100 media interfaceicsphyusing Seeq 84220 isolate/reset hack Seeq 80220 10/100 media interfaceSeeq 80225 10/100 media interfaceSeeq 84220 10/100 media interfacesqphyDM9101 (AMD Am79C873) 10/100 media interfaceDM9102 10/100 media interfaceDM9161 10/100 media interfaceDM9161A 10/100 media interfaceDM9161[BC] 10/100 media interfaceDM9601 internal 10/100 media interfacedmphyAm79C901 HomePNA 1.0 interfacepnaphy: %s (OUI 0x%06x, model 0x%04x), rev. %d : OUI 0x%06x, model 0x%04x, rev. %d ukphydmover_backend_unregisterdmoverdmreqdmsesdmover_session_destroy%s: emergency X server detach added (%s, %s emulationwsdisplaytty() on status devicewsdisplaytty() on ctl devicewsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch3: screen %d disappeared wsdisplay_switch3: giving up screen %d deleted kbdmux %d: console (%s, %s emulation), using %swsswwsdisplay at %swsdisplay: event queue overflow wswaitwsdisplay_noemulwsdisplay_emulEDIDdumb%s: ESC in kernel output ignored vt100[>24;20;0cP2$u%s%dP0!u%5\[?62;6c[8;%d;%dt[%d;%dR[?13n[?21n[?27;1nwsemul_vt100_handle_dcs: bad type %d[29~[28~OAOBODOCOoOnOmOlOkOjOMOI[2~[1~[8~[7~[6~[5~[4~[3~OpOqOrOsOtOuOvOwOxOyOPOQOROS[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[31~[32~[33~[34~wseventdefault_version%s: unknown version %dwsevent_read mux %dcannot load keymap: console keyboardattach error=%d couldn't register as input device connecting to %s wskdetwskbd_detach: %s didn't detach wskbd at %s%s: event queue overflow wskbdwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entrywsmux%s: disconnecting from %s wsbell at %swsbell%s: fontwidth assumptions botched%s: font stride assumptions botched%s: depth not supported %s: font table is empty %s: couldn't lock font %s: bits not aligned on 32-bit boundary %s: stride not aligned on 32-bit boundary ccwwsfont: font '%s' bito %d byteo %d copied to bito %d byteo %d wsfont_unlock: font not lockedBoldfacecd9660noplRRIP with incorrect NM flags? RRIP without PX field? RRIP with incorrect flags?IEEE_1282IEEE_P1282RRIP_1991ASPcd9660utf8_jolietfhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] %/@%/C%/Eroot_devicecd9660_strategy: spectag VT_ISOFS, isofs vnode msdosnoplmsdosfhplloadvnode(): pcbmap returned %d deextend: file too largedetrunc(): can't truncate root directory, clust %ld, offset %ld %s: copy FAT %d (error=%d) %s: write FAT (error=%d) . .. msdosfs_rename: updating .. in root directory?msdosfsmsdosfs_sync: rofs modRRaArrAamsdosmsdosfs_write(): bad file typemsdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %llu, %llu bind failed nfsvinvalnfs_doio: type %x unexpected nfsbioread: type %x unexpected ifupdown: socreate, error=%d ifupdown: GIFFLAGS, error=%d ifupdown: SIFFLAGS, error=%d nfsbifsetaddress: socreate, error=%d setaddress, error=%d nfsbtdnfs_boot: '%s' not found setmtu: socreate, error=%d setmtu: GIFMTU, error=%d setmtu: SIFMTU, error=%d deladdress: socreate, error=%d deladdress, error=%d nfs_boot: timeout... nfs_boot: sosend: %d nfs sndunlockshort receive (%lu/%lu) from nfs server %s impossible packet length%s (%d) from nfs server %s short receive (%lu/%d) from nfs server %s Egad!! receive error %d from nfs server %s nfsreply nilis alive againnfstrylatermtimectime%s: inaccurate wcc data (%s) detected, disabling wcc (ctime %u.%09u %u.%09u, mtime %u.%09u %u.%09u) %s: re-enabling wcc nfsiodnfsionfsiormnfsauth1nfsauth2nfskqpwnfskqpollnfskqdet%s: vp=%p error=%d nfsnodeplnfsvaplnfssillynfs_node_initnfs send error %d for %s nfsd send error %d timer starttimer stopnfscon sotypenfscn2nfs rcvunlockBad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad nfs server %s: %s not respondingnfsrvdescplbuild > MLENnfsumntnfsstatsiothreadsnfs_vfsops: nfs_statvfs would lose buffers nfs_args: retrying connect nfscn3nfsrcvnfssndnfsaionfsdisnfs%unfs_mountroot: mget soname for %snfs_mountroot: mount %s failed: %d root on %s nfs_mountroot: getattr for rootnfs_readdir: lost in spacenfs physio/asynctag VT_NFS, fileid %lld fsid 0x%llxwriterpc readonly vp %pnfsmblknfs: sillyrename dir.nfsAxxxx4.4nfs_remove: bad vrefcnt(vp)%s: map corrupted: start=%d, len=%d, fs = %s, offset=%d/%ld, cg %d%s: block not in map: bno=%d, fs=%s%s: map corrupted: cg=%d, irotor=%d, fs=%s%s: block not in map: fs=%suid %d, pid %d, command %s, on %s: %s %s: bad size: dev = 0x%llx, bno = %lld bsize = %d, size = %ld, fs = %s%s: bad block %lld, ino %llu bad blockifree: dev = 0x%llx, ino = %llu, fs = %s %s: freeing free inode%s: freeing free block: dev = 0x%llx, block = %lld, fs = %s%s: freeing free frag: dev = 0x%llx, block = %lld, fs = %sfile system full %s: write failed, file system is full out of inodes %s: create/symlink failed, no inodes free trimwqtrimwqcv%s: bad bprev: dev = 0x%llx, bsize = %d, bprev = %lld, fs = %s%s: bad blockno %#llx != %#llx%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE %s: bad optim: dev = 0x%llx, optim = %d, fs = %s%s: range: dev = 0x%llx, ino = %llu, fs = %sffs_balloc: blk too bigCould not unwind indirect block, error %dspec nodes went hereffs_indirtrunc: bad buffer sizeffs_truncate: partial trunc of extdataitrunc: newspacesnapblkfree: inconsistent block typeffs_snapshot_mount: vget failed %d ffs_snapshot_mount: non-snapshot inode %d ffs_snapshot_mount: read_1 failed %d ffs_snapshot_mount: read_2 failed %d ffs_snapshot_mount: %llu already on list%s: unknown fs_fragshift %d%s: ACLs requested but not supported by this fs WARNING: %s: POSIX.1e ACLs flag on fs but no ACLs support WARNING: %s: NFSv4 ACLs flag on fs but no ACLs support %s: "posix1eacls" and "nfsv4acls" options are mutually exclusive org.netbsd.kauth.systemffs_modcmd: can't listen on system scope. ffsdoclusterreaddoclusterwritedoreallocblkslog_changeopt%s: dup alloc ino=%lld on %s: mode %o/%o gen %x/%x size %llx blocks %llx%s: ino=%lld on %s: gen %x/%x has non zero blocks %llx or size %llx %s: dirty filesystem?ffsinoffsdino1ffsdino2appleufs, not mounting%s: dirty1%s: unknown ufs flags: 0x%08x%s %s: dirty2%s: options QUOTA2 not enabled%s %s: file system not clean (fs_clean=%#x); please fsck(8) %s: `-o softdep' is no longer supported, consider `-o log' %s: rofs mod, fs=%smfsidlmfs_rootmfs_open not VBLKtag VT_MFS, pid %d, base %p, size %ld mfs_inactive: not inactive (mfs_buflist %p)mfs_strategy: bad devwarning: mfs read during shutdown mfs_closemfs_initminiroot() called more than once%s: unlinked ino %lld on "%s" has non zero size %llx or blocks %llx with allerror %d %s: bad dir ino %ju at offset %d: %s not roundedmissing NUL in namenull entryi_size too small%s: too big%s: nospace%s: newblkhard-linked directoryufsdirufs_whiteout: unknown opufs_strategy: spectag VT_UFS, ino %llu, on dev %llu, %llu flags 0x%x, nlink %d mode 0%o, owner %d, group %d, size %qdinvalid uio rw: %damapplcownowcownowpageamapswpoanonpllkloanpguvm_anon_pageinuao_getuao_getpageuaoeltpluao_put: strange, got an out of range flush %#jx > %#jx (fixed) uao_put%s: impossibleuao_detubchashubc object hashubc_allocubc_faultubc_init: failed to allocate ubc_mapubc_init: failed to map ubc_objectudv_detachudv_attachflt_noram5flt_pmfail2flt_pmfail1anonget1anonget2flt_noram1fltamapcopyfltagain1flt_noram2pgo_faultfltagain2flt_noram4uvm_fault_unwire_locked: address not in mapuareauvmuvm_init: page size not setuvmfaultuvm_km_bootstrap: could not reserve space for kerneluvm_km_bootstrap: could not reserve kernel kmem%s: unable to allocate space in parent mapuvm_km_suballoc: submap allocation failedkm_pgrmkm_getwait2plpglivelockloanagainloanzeroloanuopguser_va0_disablevmmpeplvm_map%s: kernel object %p %p uvm_voaddr_release: bad typevmmeterloadavguvmexpuvmexp2maxslpuspaceminaddressmaxaddressthread_guard_sizeuobjwirepguvm_page_numa_lookup: failed, first pg=%p pa=%#lx uvm_setpagesize: page size %u (%#x) not a power of twouvm_page_physget: called _after_ bootstrapuvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocatedUVM: using NUMA allocation scheme UVM: using package allocation scheme, %d package(s) per bucket uvm_pagealloc_strat: bad strat %demergvapager_mapuvmpdlmtout of memory before the pagedaemon thread existspagedaemon: deadlock detected! fork pooldrainpgdaemonanonminfileminexecminanonmaxfilemaxexecmaxinactivepctpdpolicyreactanonreactfilereactexecpglac2pglallocTried to add RAM after uvm_page_inituvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX Boot time slabHotplug slab%s: unload attempted after uvm_page_init() uvm_page_physload: bad free list %duvm_page_physload: start[%lx] >= end[%lx]uvm_physseg_plug() failed at boot.%s: Tried to unplug from unknown offset %s: Tried to unplug oversized span %s: can't unplug() from the middle of a segment without UVM_HOTPLUG %s: swapdev not in listswap_encrypt%s: vnode type 0x%x%s: swap to sparse file%s: can't get vnode for swap device%s: can't lock swap device%s: can't open swap deviceswapmap%s: vmem_create failedswp vnxswp vndswapctl: miniroot copy failedswapctl: copystrswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap swapdrum_addswapiod%s: workqueue_create failedturning off swap...stopping swap on %s failed with error %d uvnfp1uvnfp2copy-cred-on-forkbufq_disksortbufq_fcfsNetBSD-CORE%s@%dELFexec_elf32#!exec_scriptvmcmdkillsextendscalls/dev/consolewarning: no /dev/console warning: lookup /dev/console: error %d init: couldn't allocate argument spaceinit path (default %s)use absolute path, "halt", or "reboot" /sbin/initinit: trying %s exec %s: error %d copyout %dDetecting hardware...fork initcannot mount root, error = %d fork pagedaemonioflushfork syncer%s %s (%s)total memory = %s avail memory = %s /sbin/oinit/sbin/init.bak/rescue/initmaxvnodesmaxprocmaxfilesargmaxhostidprofilingposix1versionngroupsjob_controlsaved_idsboothowtoboottimemaxpartitionstimexrtc_offsetipcsysvmsgsysvsemsysvshmsynchronized_ioiov_maxmapped_filesmemlockmemlock_rangememory_protectionlogin_name_maxdefcorenamelogsigexitfscaleccpucp_timemaxphysmonotonic_clocklabelsectorlabeloffsetlabelusesmbrforkfsleepposix_threadsposix_semaphoresposix_barriersposix_timersposix_spin_locksposix_reader_writer_locksdump_on_panicroot_partitiondriverscp_idcoredumpsetidownergroupno_sa_supportconfignamebuildinfomessagesusermemcnmagicusermem64ostypeosreleaseosrevisionhostnamedomainnamerawpartitionmodelmachinemachine_archncpubyteorderphysmempagesizealignbytesphysmem64ncpuonlinekernvfsddbvendorsecurityAccounting resumed Accounting suspended Accounting started Accounting terminated actwatacctwatchAccounting: write failed %d kcredplorg.netbsd.kauth.credorg.netbsd.kauth.genericorg.netbsd.kauth.processorg.netbsd.kauth.networkorg.netbsd.kauth.machdeporg.netbsd.kauth.deviceorg.netbsd.kauth.vnodehardscheddivclockratehardclock_tickshardclockstatclockclockinterruptpid %d (%s): %s write of %zu@%p at %lld failed: %d %.*sToo many CPUs. Increase MAXCPUS?cpu%dfdcloseincrease kern.maxfiles or MAXFILESfiledescfile2dup2entropy: ready entropy: best effort cpu0entropy intrdropentropy intrtruncWARNING: consolidating less than full entropy entropyentropy: pid %d (%s) waiting for entropy(7) WARNING: system needs entropy for security; see entropy(7) entropy: invalid seed length: %zu, expected sizeof(rndsave_t) = %zu entropy: invalid seed checksum entropy: double-seeded by bootloader entropy: entering seed from bootloader with %u bits of entropy entropy pool crypto self-test failedcollectiondepletionconsolidategathersamplesneededsamplespendingepochentsrclockentropy: no seed from bootloader unable to establish entropy softintentbutlerunable to create entropy housekeeping thread: %dnotifydepleterequestextract failpartialimmediatediscretionaryfilt_usertouch() - invalid type (%ld)%s: invalid type (%ld)EVFILT_READEVFILT_WRITEEVFILT_AIOEVFILT_VNODEEVFILT_PROCEVFILT_SIGNALEVFILT_TIMEREVFILT_FSEVFILT_USEREVFILT_EMPTY*fexecve*execargsshould not happensigcode kernel mapping failed %d pspawnlwpwaitnetbsdinit died (signal %d, exit %d)orphaned traced processexit1increase kern.maxproc or NPROCforkmxforkulimidle/%ucreate_idle_lwp: error %d%s: WARNING: powerhook_establish is deprecated dopowerhooks %s: %s (%p) dopowerhooks: %s done softresumesoftsuspendsoftstandbykthrwaitunnamedWARNING: kthread `%s' (%d) exits with status %d kthread_exitcurcpu holds : %18d wanted by: %#018lx pserialize%s: %s caller=%pKernel locklwpplmaxlwpsigwaitvfork(zombie)lwp_exitswapperlink_set_evcntsWARNING: module error: Built-in module `%s' can't find built-in dependency `%s'Built-in module `%s' prerequisite `%s' failed, error %dBuilt-in module `%s' failed its MODULE_CMD_INIT, error %d%s: builtin module "%s" init failed: %dlink_set_modules`link_set_modules' section not present, error %d`link_set_modules' section wrong size (%zu different MODULE declarations?)`link_set_modules' section wrong size (got %zu, wanted %zu)DEBUG: module: TRUEFALSEUnload requested for `%s' (requires_force %s)Module `%s' not foundModule `%s' busy (%d refs)Cannot unload built-in secmodel module `%s'Could not unload module `%s' error=%dUnloaded module `%s'Requesting autounload for`%s'Module `%s' declined to be auto-unloaded error=%dmod_unld/stand/%s/%s/modulesBuilt-in `%s' failed: %d moduleautounload_unsafeautotimemodunload%s: %dModule `%s' pushed by boot loader already existsDuplicate bootlist entry for module `%s'Unable to load `%s' pushed by boot loader, error %dUnable to fetch_info for `%s' pushed by boot loader, error %dDependentRequestedUse -f to reinstate builtin module `%s'module_do_builtin() returned %d%s module `%s' already loadedOut of memory for `%s'module_load_vfs_vec() failed for `%s', error %dCannot fetch info for `%s', error %dModule name `%s' longer than %dModule `%s' has invalid class %dModule `%s' built for `%d', system `%d'Forced load, system may be unstableIncompatible module class %d for `%s' (wanted %d)Dependency name mismatch (`%s' != `%s')Module with name `%s' already loadedCircular dependency detected for `%s'Required module name `%s' longer than %dSelf-dependency detected for `%s'Recursive load failed for `%s' (`%s' required), error %dUnable to affix module `%s', error %dModule properties failed for %slink_set_sysctl_funcsmodcmd(CMD_INIT) failed for `%s', error %dRecursive load causes duplicate module `%s'Module `%s' loaded successfullyLoad failed, error %dAutoload for `%s' requested by pid %d (%s)Autoload disabled for `%s' Autoload illegal path for `%s' Autoload not authorized for `%s' Autoload for `%s' status %dmod_hookLoading module from %s%s/%s/%s.kmodCannot %sload kernel object `%s' error=%d.plistplist load returned error %d for `%s'Loading plist from %snoautoloadautoloading is disallowed for `%s'kern.module.path=%s owner field : %#018lx wait/spin: %16d/%d locking against myselfMutexphysiodphysioDevices without power management support:%s: %s is suspended by %s (delegator %s) pmfsuspensortransition%s: %s-suspended by %s (delegator %s) already %s: %s assumes %s-suspension by %s (delegator %s) %s: newly %s-suspended by %s (delegator %s) resume failed %s: %s suspension %s (delegator %s) removed by %s classPowering devices:(failed)Shutting down devices: shutting down %s, skipped.failed.success.%s-self%s: suspend enter %s: class suspend %s: driver suspend %s: bus suspend %s: suspend exit Flushing disk caches: Suspending devices:%s: resume enter %s: bus resume %s: driver resume %s: class resume %s: resume exit Resuming devices:%s: PMF event %d dropped (no memory) %s: PMF event %d injected Input idle handler called pewplpmfeventcouldn't create pmfevent workqueuepmfsuspendcouldn't create pmfsuspend workqueuefailed to reserve PID 1 for init(8)procplexpose_addressproc2proc_args%s (pid %d) changing logname from %.*s to %s curprocpaxflagsrlimitcputimesofthardfilesizedatasizestacksizecoredumpsizememorylockeddescriptorssbsizevmemoryusestopforkstopexecstopexitcacheht_timeskim_intervalmin_catchtimesoftintskpreempt_prisched_enqueue: LWP %p has class %d owner/count : %#018lx flags : %#018x Reader / writer lock%s:%d: invoking "%s" (%s) crashme on %s failed! crashme plain old panic%s: locked once %s: locked twice %s: initialized %s: disabled kpreemption %s: raising ipl to %d %s: raised ipl to %d, s=%d crashme%s: failed to create sysctl debug.crashme: %d crashme_enable%s: failed to create sysctl debug.crashme_enable: %d %s: failed to create sysctl debug.crashme.%s %s: unable to remove %s from sysctl null_derefnull dereferencenull_jumpjump to nullmutex_recursionenter the same mutex twicespl_spinoutinfinite loop at raised splkpreempt_spinoutinfinite loop with kpreempt disabledsigactsksiginfotrapsignaleventswitchsorry, pid %d was killed: %s sigexit 1sigexit 2sendsig: bad version %d proc_stoptraceWARNING: softint_establish: table full, increase softint_bytes soft%s/%usoftint_init_isr: error %d%s block/%usoftint_init_cpu: cannot allocate memorybiosoftint_picklwpwedge:NAME=parsediskuse one of: %s[a-%c] none halt reboot %s%lluswap dumps on %smd0 (default %sdump device (default %sb)file system (default %s): use one of: genericroot on %scan't determine root device unknown device major 0x%llx device %s (0x%llx) not configured sched_unsleeplboltkpreemptdefer: critical sectiondefer: kernel_lockWARNING: lwp %ld (%s%s%s) flags 0x%x: timecounter went backwards from (%jd + 0x%016llx/2^64) sec to (%jd + 0x%016llx/2^64) sec in %s setrunnable: lwp %p state was %dWARNING: lwp %ld (%s%s%s): negative runtime: (%jd + 0x%016llx/2^64) sec WARNING: pid %ld (%s): negative runtime; monotonic clock has gone backwards pid %d, command %s, is killed: %s exceeded RLIMIT_CPU/usr/src/sys/kern/kern_sysctl.cp->sysctl_child == NULLsysctl_create: rnode %p wrong version sysctl_create: attempt to add node to aliased node %p sysctl_destroy: rnode %p wrong version %s: rnode %p wrong version sysctl_query: rnode %p wrong version sysctl_locate: pnode %p wrong version sysctl_dispatch: rnode %p wrong version sysctl_mmap: rnode %p wrong version sysctl_createv: rnode NULL sysctl_createv: sysctl_locate(%s) returned %d sysctl: log %p root mismatch (%p) sysctl_create succeeded but node not found?! sysctl_createv: sysctl_create(%s) returned %d sysctl_free: rnode %p wrong version root %p left %d size %d content len %d: end !!SYSCTL_NEEDFUNC!! timecounterchoicehardwaretimestepwarnings%s%s(q=%d, f=%lld Hz)timecounter: Timecounter "%s" frequency %ju Hz -- Insufficient hz, needs at least %u timecounter: Timecounter "%s" frequency %ju Hz quality %d tcdetachTime stepped from %lld.%09ld to %lld.%09ld timecounter: Timecounters tick every %d.%03u msec dummythreadpoolidle_msthreadpool job %p ran after destructionpooljobpoolthread%sthrdplcrpooldisppooldisp%sthplthrddeadjobnanoslppid %d attempted to set the (obsolete) kernel time zone calloutcallout_init_cpu (2)late/%uwait/%uturnstile_unsleeptodr_attach: TOD already configured WARNING: preposterous time in file system %s: cannot enable TODR writes %s: WARNING: cannot disable TODR writes WARNING: preposterous TOD clock time WARNING: no TOD clock present WARNING: clock lost %lld days WARNING: clock gained %lld days WARNING: using default initial time WARNING: using filesystem time WARNING: CHECK AND RESET THE DATE! Cannot set TOD clock time WARNING: Cannot set TOD clock time (busy) uihashuser info (uid->used proc) hashuidinfoproccntlwpcntlockcntsemcnt%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02xrtts%s: invalid tag (%u) acl_posix1e_mode_to_entry: invalid tag (%d) acl_posix1e_acl_to_mode: bad ae_tagacl_posix1e_acl_to_mode: missing base ae_tagsconfigure: `%s' driver %s failed: %dconfigure: attachment `%s' of `%s' driver %s failed: %d%s with registered handlerscfargs_canonicalize: unknown version %lu cfargs_canonicalize: submatch and search are mutually-exclusivedevice-attachdevice-detachlocationev: %s %s at %s in [%s] cfgmiscautoconfdetachallconfigintrconfigroot%s: thread %x joined with error %d config_devalloc: device name too longpmfsuspdevice-driverdevice-unitdevice-parentattribute-nameloc-namelocatorsinterface-attributesconfig_defer: can't defer config of a root deviceWARNING: power management not supported waiting for devices: done. WARNING: %d error%s while detecting hardware; check system log. config_attach: allocation of device softc failedFound %s (root)%s at %sconfig_detach: forced detach of %s failed (%d)root device %s not configured detaching %s, unable to detach instance init rollbackfiniconfig_cfdata fini rollback failedfini rollback unsupported blist_meta_alloc: allocation too largeblist_meta_fill: allocation too largeblst_meta_fill: filling unexpected rangeblst_radix_free: freeing free blockblst_meta_free: freeing already free blocks (%llu) %llu/%llublst_meta_free: freeing unexpected rangebufqstrategiesbufq_alloc: sort out of rangebufq_bufq_alloc: no strategycallbacknist_hash_drbg_instantiatecprng_strong reseednist_hash_drbg_destroynist_hash_drbg_reseedNIST Hash_DRBG failed self-testurandomarandomnist_hash_drbg_generateslowfastcpu_topology_init: asymmetric & SMT?? pkg1st%s has %d %s siblings:%s first in package: %s GAVE UPureadc: non-positive residureadc: non-positive iovcntdevice-enumerate-childrendevsw%s: block majors exhausted %s: character majors exhausted writ%s%d%c: %s %sing fsbn %lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)no raw partition and disk reports bad geometryno raw partition and partition table is fullsectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectordisk-info%s: can't alloc vnode for %s%s: can't open dev %s (%d) %s%d%cevcnt/dev/nullset{u,g}id pid %d (%s) was invoked by uid %d ppid %d (%s) with fd %s closed extent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags = 0x%x 0x%lx - 0x%lx extent_free: start 0x%lx, end 0x%lx extent_free: region not foundhashdone: invalid table typehashstat KMGTPE kMGTPE%qu%s%c%snointrdisknamesiostatnamesiostatsiostat_free: iostat_count == 0ipiWARNING: ipi_register: table full, increase IPI_MAXREG kcpuset(9): all early-use entries exhausted; increase KC_SAVE_NITEMS kmem-02048kmem-04096kmem-08192kmem-16384kmem-00008kmem-00016kmem-00024kmem-00032kmem-00040kmem-00048kmem-00056kmem-00064kmem-00080kmem-00096kmem-00112kmem-00128kmem-00160kmem-00192kmem-00224kmem-00256kmem-00320kmem-00384kmem-00448kmem-00512kmem-00768kmem-01024not modular%#018lx%s error: %s,%zu: %s lock address : %s current cpu : %18d current lwp : %#018lx lock error: %s: %s,%zu: %s: lock %p cpu %d lwp %pklogmsgbufsizemsgbufrunoncepercpupool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) %s: [%s] item %p not part of pool%s: [%s] item %p below item space%s: [%s] item %p poolid %u != %u page %p, nmissing %d, time %u %s: [%s] ph %p poolid %u != %upool item size %zu too large, use a custom allocator%s: [%s] too large itemsperpage(%d) for PR_USEBMAPpoolbusyphpool-%dpcgnormalpcglargepcachepcachecpu%s: [%s] page empty%s: [%s] page header missing%s: [%s] %u >= %u%s: [%s] %p already freedMust specify a pool to print. POOLCACHEPOOL %s:%p:%u:%u:%u:%u:%u:%u:%u:%u:%u:%u:%zu %s: itemsize %u, totalmem %zu align %u, ioff %u, roflags 0x%08x pool %p, alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p cpu layer hits %llu misses %llu cache layer hits %llu misses %llu cache layer full groups %u full cache groups: group %p: avail %d %p, 0x%llx %p (null)[% 4jd.%.*ld] %s: table is full - %s %s: table is full Skipping crash dump on recursive panic panic: autoconfiguration error: mismatching pserialize_read_exit()exclusive accessspecificdata_domain_delete: not implementedspecificdata_setspecificbtallocvmem%s-%zuvmem-vavmem-metavmembtvmem_sizevmem_rehash%s: workqueue_create %d static_bt_inusestatic_bt_countInvalid IPL: %dxclowxchighcrosscallunicastxcallxcall/%uaioworkaiodoneaio_process: invalid operation code posix_aioaio_listio_maxaio_maxaio_jobs_poolaio_lio_poolefdreadefdwriteeventfdfqabortfutexinvalid futex opWARNING: pid %jd (%s) lwp %jd: unmapped robust futex list head WARNING: pid %jd (%s) lwp %jd: exhausted robust futex limit sys_ioctl: _IO%s%s('%c', %lu, %lu) returned -1: pid=%d comm=%s memfdcompat_80posix_msgmqueuemq_open_maxmq_prio_maxmq_max_msgsizemq_def_maxmsgmq_max_maxmsgmqmsgplmqsendcvmqrecvcvmqparkedpsetpsets_max%d:1,%d:2direct_selectcompat_16posix_schedpri_minpri_maxsockettfdreadtimerfdttyrub: would panic c = %d, val = %d not a controlling terminal no foreground process group empty foreground process group found only zombie processes load: %d.%02d cmd: %s %d [%#lx/%d%ld.%02ldu %ld.%02lds %d%% %ldkttypausettyrawttyrawfttycanttycanfttyoutttyoutfttyreftkstatnincanccrawccqsizecompat_60compat_43ttyldisc_init: termios_discttyldisc_init: ntty_disctermiosnttytabletslippppstriphdlcincrease kern.maxptysputc: required clalloc b_to_q: required clalloc accfaccf_seqpacketdgram%s: source too long, %d < %d bytesunix: inet: inet6: link: atalk: (unknown socket family %d)bad family %hhumbuf %p already freedmsizemclbytesnmbclustersmblowatmcllowatnmbclusters_limitmbplmclplm_copydata: off %d, len %dm_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d)m_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d), len=%d (%d)%s: len > MHLEN%s: off %d, len %d%s: m == NULL, off %d%s: m == NULL, len %d [!COPYALL]%s: no header (m = %p)unixpsemposixsemmaxksemsomaxkvasofixedbufsbmaxsooptionssokvasopendfrbad initial sb_max value: %lusopendfreesoinit1 %dnetiosbappendaddrsbappendaddrchainsbappendcontrolsemi-panic: sbcompress sbdrop(%p,%d): cc=%lu%s: message too large %d mbsonamembcontrolmsghdrmbfreembdatambheadermbsoptsmbftablemboobdataunp_disconnect1uipc 1uipc 2unp_attachunp_connect1unp_threadinflightdeferredunpgcuipc_init %duipc_usrrequipc 4buf mem pool index %dbufhashbuffer hashforcing bufcache %d -> 5forcing bufcache %d -> 95needbufbufinit: cannot allocate submapbufplbioplbuf%ukbuf%ubbufcachebufmembufmem_lowaterbufmem_hiwaterbufinit2: can't establish soft interruptbiolockbiowaitbiodone2 alreadyallocbuf: buffer larger than MAXBSIZE requestednamecachenamecache_statsncpurgedirhpldirhepldirhashmemusedmaxmemdirhash_remove couldn't find entry in hash table vfs_op_descsoperation %s not listed in %s. vfs_opv_init: bad operationvfs_opv_init: operation vector without vop_defaultfstypesmagiclinkstimestamp_precisionlf_findoverlap: defaultchrooted pid %d uid %d (%s) detected outside of its chroot /../zauruskernel_identruidrgidInvalid nameiop relookup: null namerelookup: lookup on dot-dotnamei_simple_convert_flags: bogus sflags %s: failed to start extattr: error = %d syncing disks... vfs_mountroot: root device unknownvfs_mountroot: rootdev set for DV_IFNET (0x%llx -> %llu,%llu)vfs_mountroot: rootdev not set for DV_DISKvfs_mountroot: can't get vnode for rootdevvfs_mountroot: can't open root device %s: inappropriate for root file system root file system type: %s WARNING: No file system modules have been loaded. Supported file systems:no file system for %s (dev 0x%llx)cannot find root vnode, error=%dmount: lost mountUnmounting fresh file system faileddanglingunmount: dangling vnodeforcefully %sunmounted %s on %s type %s unmount of %s failed with error %d unmounting done WARNING: some file systems would not unmount unmounting file systems... filedelaydirdelaymetadelayinvalid specnode type: %dILLEGALvnode %p flags %s %stag %s(%d) type %s(%d) mount %p typedata %p %susecount %d writecount %d holdcount %d %ssize %llx writesize %llx numoutput %d %sdata %p lock %p %sstate %s key(%p %zd)%slrulisthd %p ROOTSYSTEMISTTYMAPPEDMPSAFE TEXT EXECMAP WRMAP PAGESONWORKLSTDEADCHECKDIROPvflushbuf: not dirty, bp %pvflushbuf: dirtyACTIVEMARKERLOADINGLOADEDBLOCKEDRECLAIMINGRECLAIMEDVNONVREGVDIRVCHRVLNKVSOCKVFIFOVBADVT_UFSVT_NFSVT_MFSVT_MSDOSFSVT_LFSVT_LOFSVT_FDESCVT_PORTALVT_NULLVT_UMAPVT_KERNFSVT_PROCFSVT_AFSVT_ISOFSVT_UNIONVT_ADOSFSVT_EXT2FSVT_CODAVT_FILECOREVT_NTFSVT_VFSVT_OVERLAYVT_SMBFSVT_PTYFSVT_TMPFSVT_UDFVT_SYSVBFSVT_PUFFSVT_HFSVT_EFSVT_ZFSVT_RUMPVT_NILFSVT_V7FSVT_CHFSVT_AUTOFSsymlink-target%s: failed to start extattr, error = %d%s: failed to stop extattr, error = %dsyncwaitfdesckernfsafsfstchgfstcntfstlwpvcachevnode cache hashvnfull%s: cannot reclaimdead but not clean%s: bad ref countvcacheplvdrainvrele%s: holdcnt vp %p%s: cannot lock%s: neg numoutput, vp %pxattr-listsystem.user.security.trusted.xattr-namexattr-valvop_setextattrvop_deleteextattrvop_openextattrvop_listextattrvop_getextattrvop_closeextattrvop_aclcheckvop_setaclvop_getaclvop_putpagesvop_getpagesvop_whiteoutvop_advlockvop_pathconfvop_islockedvop_printvop_strategyvop_bmapvop_unlockvop_lockvop_reclaimvop_inactivevop_abortopvop_readlinkvop_readdirvop_symlinkvop_rmdirvop_mkdirvop_renamevop_linkvop_removevop_seekvop_fsyncvop_mmapvop_revokevop_kqfiltervop_pollvop_fcntlvop_ioctlvop_fdiscardvop_fallocatevop_writevop_readvop_setattrvop_getattrvop_accessxvop_accessvop_closevop_openvop_mknodvop_createvop_lookupvop_parsepathvop_bwritedead fs operation useddeadtag VT_NON, dead vnode fifordfifowrtag VT_NON, fifo with %d readers and %d writers/usr/src/sys/miscfs/genfs/genfs_io.cgenput%s: bogus command %dgenfs: bad op%s: ACL_OTHER missing layerfs tag VT_LAYERFS, vp=%p, lowervp=%p spec_fdiscard: not a device dev %llu, %llu spec_close: spurious pgrp refspec_close: not specialspec_ioctlinvalid specfs vnode type: %dspec_read typespec_write typespeciofictitiousdefault labelWARNING: %s: total unit size in disklabel (%llu) != the size of %s (%llu) %s: %llu trailing sectors not covered by disklabel WARNING: %s: end of partition `%c' exceeds the size of %s (%llu) %s at %s (%s) deleted raidframecgd%s: blkno (%llu) + size / DEV_BSIZE (%zu) > p_size (%llu) %s%u: unable to attach pseudo-device %s at %s: "%s", %llu blocks at %lld, type: %s WARNING: double match for wedge name %s (%s, %s) wedge:%sdkwedge: unable to attach cfdriverdkwedge: unable to attach cfattachdk-method-%s: method "%s" already exists at priority %d %s: unable to compute pdev, error = %d %s: unable to find vnode for pdev, error = %d %s: unable to lock vnode for pdev, error = %d %s: unable to open device, error = %d %s: unable to close device, error = %d WARNING: double match for boot wedge (%s, %s) %s: WARNING: clamping number of blocks to 512 (was %u) APPLE_UNIX_SVR2APPLE_HFS%s: wedge named '%s' already exists, manual intervention required %s: error %d adding partition %s type %s APPLEsysvhfs%s: GPT GUID: %s %s: bogus GPT entry size: %u %s: WARNING: clamping number of GPT entries to 512 (was %u) %s: GPT block numbers out of range %s: unable to read GPT partition array, error = %d %s: bad GPT partition array CRC %s: wedge named '%s' already existed, using '%s' %s: error %d adding entry %u (%s), type %s GPTccdvmkcorevmfsvmwresvntfsext2fszfsmdidle%s: cfattach_attach failed /dev/randombpfmaxbufsizepeers%s: softint_establish() failed%s: no bpf_if found for %sbpf_mcpybpf_change_type%s: bpf_setdlt: ifpromisc failed (%d) bpf_filterbpfops%.*s/%hhu#link#%huif_%s: watchdog triggered ifnetifaiflnkstifwdogsdl%s: could not attach sysctl nodes sndqmaxlendrops%s: could not attach sysctl watchdog nodes watchdogtriggerrcvqif_detach: WARNING: AF %d not purged DOWN%s: lost link state change %s %s-lshktoo many interfaces%s: recursively called too many times(%d) %s: m_tag_get() failed, recursion calls are not prevented. invalid argument to %sinvalid ifnet multicast command: 0x%lx%s: can't handle af%d The multicast bit is set in the MAC address. It's wrong. %s-ether_ifdetachhooks33etherrps_hash%s: invalid ifp (sdl_index %d) llentrypllooutput: no header mbufif_looploifmedia_set: no match for 0x%x/0x%x ifmedia_set failed%s: invalid timer type pfilpktqsyncpktqrenqifqcurcputoeplitztoeplitz-othercpusMask for route not entered rn_addmask: mask impossibly already in tree Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: Orphaned Mask %p at %p rn_delete: couldn't find us radix already initializedrn_initrn_init 2delayed rn_inithead failedraw_usrreqrt_timer_timer: rtq_count reached 0 rtentryrt_freert_updatertentplrttmrplrt_timerrt_timer_queue_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 %s: unable to delete rtentry @ %p, error = %d mZV%[Ag%=C+ˮ{0w-0 jB;rtfree 2route_purgeifroute_abortroute_accept%s: message too long%s: queue full, dropped message %s: unknown command %drtableroutend_delaynd_bmaxtriesnd_umaxtriesnd_reachablend_retransnd_nudnd_maxnudhintlog_movementslog_permanent_modifylog_wrong_iface%s: source can't be determined: dst=%s %s: %s not ready %s: called with non-tentative address %s(%s) %s: memory allocation failed for %s(%s) %s: called with duplicate address %s(%s) %s: %s: ARP announcement complete for %s %s: arp_setgate failed %s: bad gateway value %s: failed to %s llentry for %s on %s arp from %s: addr len: new %d, i/f %d (ignored) %s: arp: link address is broadcast for IP address %s! duplicate IP address %s sent from link address %s %s: DAD defended address %s from %s %s: DAD ignoring duplicate address %s from %s %s: DAD defence failed for %s from %s %s tried to overwrite permanent arp info for %s %s on %s tried to overwrite arp info for %s on %s arp info overwritten for %s by %s arpintrrevarp%s: mbuf %d too short for IP header %zu%s: offset %d too short for IP header %zuencapelemip_encap cv%s_wqinput%s: could not create a sysctl node for %s inputqgpiobus at %sis-rootmodelsTraditional NetBSD: Superuserorg.netbsd.secmodel.susersuser_modcmd::init: secmodel_register returned %d suser_modcmd::fini: secmodel_deregister returned %d is-securelevel-aboveTraditional NetBSD: Securelevelorg.netbsd.secmodel.securelevelsecurelevel_modcmd::init: secmodel_register returned %d securelevel_modcmd::fini: secmodel_deregister returned %d curtainTraditional NetBSD: Extensionsuser_set_cpu_affinityorg.netbsd.secmodel.extensionsextensions_modcmd::init: secmodel_register returned %d extensions_modcmd::fini: secmodel_deregister returned %d usermounthardlink_check_uidhardlink_check_gidTraditional NetBSD: 4.4BSDorg.netbsd.secmodel.bsd44secmodel_bsd44_modcmd::init: secmodel_register returned %d secmodel_bsd44_modcmd::fini: secmodel_deregister returned %d secmodel_bsd44suser,securelevel,extensionsfssptmdrvctltapveriexecfwucycomutoppybthubamrlockstatputtersrtdrmaltmemtwacpuctlpadtprofisvvideohdaudiouhsorumpblknpfdtviscsitpmmfiseepromdtracespiflashluaspkrhdmicecnvmeqemufwcfgautofsgpioppsnvmmkcovspiipmivhcivio9pwwancacpismbiosefisht3xtempscmdviocongpioirqumcpmioemcfancttyphysconptcqmsofconstunvidcconsoleopmsiplofromscrfcomjoymidisequencervcodawsdisplaywsmouseusbuhidulptscsibusraidugenucomopenfirmbiconsdevsacommlywsfontagppciiopaltqmlxplcomclockctlirframecirradiokttcpixpcomdmoveriosscomksymsepcomtslcdtwewdcpxapcicpxamcisdmmcbuspcmciabuswsemuldisplaydevwskbddevapmdevifi2cbusdrivechannelgpiobuskbdmuxcontrollerindexdackintrbase%s: %zu bytes @ %p unusedv6v7v71kv8otherhpfsadosfilecorejfs2vinumudfsysvbfsefsnilfsminixfs3stringpropstng\u%04X<>&version="1.0"?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRtunneldeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"0xaddress:%s: getifaddrs%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLANvlanif vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersaveSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHAN%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %s%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsWARNING: -G may create file systems which cause kernel panics 2eaformatsector size `%s' is not a power of 2.fragment sizeunknown gname %sexpected files per directorybytes per inodefree space %number of inodesspaceuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imagebecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%dstatvfs %s%s: mount: %sabnormal termination-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount pointrdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sshutdown~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d ./canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! add%s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / xitverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s write: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumes%s%dSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s char%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptysystemwarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s LEAFbad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d writeL%d %d I%d %d ioctlatalkchangeexpirehosthopcountinet6lockrestnetnostaticproto1proto2recvpiperttrttvarsasendpipeshowssthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxyprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinleavemichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorSO_RERRORCannot allocate memoryassuming route to ifold usage of trailing 0%s, %sassuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u/%d%u.%u/%d%u.%u.%u.%u/%d(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswdppriority=nfsmntpt=blkempty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponat:usage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s-f%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciitenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20241129NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsSHELLCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD %sMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxypromptrpromptsslnoverifyaccountbellbyecdupdisconnecteditepsvepsv4epsv6featuresfgetformgateidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspagepassivepdirplspmlsdquoterecvregetremoptsrenameresetrestartrhelprmdirrstatusruniquesendportsitestructsuniquethrottletraceusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]:%u Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'URLInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. %c%c%c421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. Reading `%s'Writing to networkreceivedCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy cC%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgatehttpFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %s-TBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymous@FTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled - %02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. passwordmachineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384)%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru"%s" ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv disconnecting...unknown ACU typecall failedcan't open phone number fileunrecognizable host namemissing phone number call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenoddbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedescapephonelinehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filebrdu%s: missing device spec%s: missing phone numberraecbetbdchfesprrcdletdvcmcuiepndiexpausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.zeroone%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecremotescripttabexpandtabverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechoparhardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234RINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgidsetuid-i/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdmbrgptre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. untitledWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitMBRGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)noautoZeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesAllSomeNoneOnOffunchangedDelete?installreinstall sets forupgradeNetBSD/zaurus 10.99.14 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"headsmount point (or '-')cylsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6StartEndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsmount pointToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.99.14 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.99.14 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.99.14 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.99.14 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-10.99.14 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.99.14 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVDFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackSendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESNODONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionendavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: N, (C)lone(I)nstall, Guid Partition Table (GPT)LabelUUIDGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): Kernel (GENERIC)Kernel (C700)KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partitionad, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalogLC_CTYPE10.99.14zaurusxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orghttp hostnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/zaurus/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/zaurus/10.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X.old%s%s%s%s%s%s%s%s%s%s%s/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failed executing: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig. net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]tmpfsinvalid%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)-t xx -o /usr/src/usr.sbin/sysinst/arch/zaurus/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 %s /tmp mfs rw,-s=%llu swap /tmp mfs rw,-s=%llu /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s-rprogress -f %s -b 1m dd bs=1m of=%sdkxbdcd*fd*udf%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001%s%c/sbin/mount -rt cd9660 /dev/%s /mnt2/dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/TZ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'entropy-file/tmp/entr.%06xrndctl -S /tmp/entropy-file %s dd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %scp %s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfiglvmdkctl%s/%s%srm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/certctl rehash/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICkern-C700base32gamesgpufwmanhtmlrescueteststextxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %sFATNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%s %s/altroot/bin/mkdir -p %scd %s cd to %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /dev/r%saNetBSD10/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdatexdmraidframe/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/zaurus/../../disklabel.c:547: internal error/dev/%s%cr%s%c%s (%u)fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s %*s %s. %sUser answered no to destroy other data, aborting. %s [%s %s]%llu%s (%llu)%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%dK%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c -l %s --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %sraid%dvnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2d/%s%*s %spartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dmkdir -p %s dd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (%s, %s) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedgesgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%lli/dev/r%sStart:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1153: internal errorgpt -rq header %sgpt -r show -a %s 2>/dev/nullPri GPT tableSec GPT tableSec GPT headerv7sysvv71kv8otherhpfsadoshfsfilecorentfsjfs2appleufsefsnilfsminixfs3vmkcorevmfsvmwresvzfswindowsefibioslinux-dataapplevmcorevmreseredbiosbootbootmebootoncebootfailednoblockio%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxApple HFSapple-ufsBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD dataVMware VMkernel core dumpVMware reserved/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2068: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1774: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2194: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2199: internal errorNetBSDWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDOpenBSDLinux nativeNTFS volume setPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitiontc/etc/group: /etc/master.passwd: (malloc) Error in munmap(): JjPUPuVvXZ ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumalphablankcntrldigitgraphlowerprintpunctupperxdigit%s%s%s 646towlowertowupperASCIIUnknown error numberUnknown signal number%m[:<:]][:>:]]NULSOHSTXETXEOTENQACKBELalertBSbackspaceHTLFVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d 3A6m8?wCIILLjeNmN)P QQTU]Y]Ym\ ^&^,^@a2f8g~v~z>Q~~HNTՏ~an)t)~-IZaƵ>aʵ|ҵ-ܵ 6lQ*U^ f%a@@cLa h @@n%t  :m  |y  @@ҵ  @@%unblock and -DNO_CONV? t 0FpHp100 0Usage: %s [-] [-ESsx] [-p string] [name] usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp--mv/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverwrite %s? override %s%s%s/%s for %s? %s -> %s rename %s to %scan't remove %s%s => %s %llu/%llu bytes %d%% written %s: remove%s: error copying extended attributes%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too longusage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failedfts_read%s: is a directory/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidprimaryCan't read %s partition table%s partition table invalid, no magic in sector %llddecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOF gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1reallocarrOutside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyMalloc failedDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerunknownPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld DIOCWLABELCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s/%s%s: bootcode too large%s: bootcode too small%s: invalid magicInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %scannot open %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tablefatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console-sh/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbin/bin/shcan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedrootsetlogin() failed/dev-MMMAKEDEV exit status %dUnable to run MAKEDEV%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node realpath `%s'getargsrwuniongetmntinfopuffs|%s on %s type %.*s: %s already mountedroupdatemount_puffsrumprump_%smount_%s-oexec:Cannot create pipeCannot open fd to mount programexec %s for %sexec %s for %s: %sstatvfs %s%s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llu, [%s: %s]nfsOnly one -t option may be specified.Aadfo:rwt:uvrqnoautofrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@cannot open `%s'/usr/sbinasynchronousautomountednfs4aclsposix1eaclsdiscardextattrhiddennoatimenocoredumpnodevnodevmtimenoexecnosuidrelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mapping/posix1e ACLSnon-reserved portsWebNFS exportslocalwith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsv7fsmsdoscd9660adosfilecoreext2fsntfsudfsysvbfsefsnilfszfsstrdupmallocusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xmalloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular filegunzipgzcatusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREmoreVISUALEDITORviLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memory<%s>LESS_TERMCAP_%s$<liLESS_LINEScoLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000l LESS_TERMCAP_DEBUGhcxndadbNRpc@8MOUSE_STARTMOUSE_ENDticlcmsovbbc|^crsr[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE/dev/null.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) #[Press 'h' for instructions.]& There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%cSHELL-c%s%s%slessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completedownexpandforw-completehomeinsertkill-lineabortliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdebugdigitdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %s*s>rscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columns%d,%dheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifttildequotesmax-forw-scrollno-inittabshilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found/dev/ttyusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe%3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d: %02d:%02d ETAKiBMiBGiBTiBPiBEiB-%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host sendmsgping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) ...nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu \%03o --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmap??? truncated no address %s(TTL=infty)(TTL=%u)refusedunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> SuccessRefusedUnknownIPv6 addressIPv4 address.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interfaceSTOP%s: waiting for an %s addressexiting due to oneshottimed out%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.2--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.2 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dkillwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.2 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPv4IPv6/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUID%s: hardware address randomised to %sgetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid IP address: %sinvalid CIDR: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltuuidnoneptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typebyteunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatestabletemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentoption requires an argument -- %s%s: embedded config too bigprofilearpingscriptreconfigurereleaseleasetimerebindpersistentinforminform6timeoutvsiovsio6waitipallowinterfacesrebootnoarpnobackgroundnohooklastleasenogatewayxidhwaddrbroadcastnolinknoipv4llrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslog(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %schangingaddingif_route (CHG)if_route (DEL)if_route (ADD)pid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletinglink#%d - %s %s_%s/usr/bin:/usr/sbin:/bin:/sbinfalsePATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuerastatic6reasonifcarrierifmetricifwirelessifflagsinterface_order(none)localhostlocalhost. embed index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string uri rfc3361 rfc3442 request norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zulo0%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)%s: SIOCGIFALIASbridgeepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not found%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseviaNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink  EE(<EMZav# _^F<>?PATH= t4bfdscml r "p,4n@v Hb    EOF reading here (<<) documents(5 LNTY^agnk$i\}-+?=4 4 8 @ > H N T Z ` g q @abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'' 0 h& 1 T& 1 \' 8 ' 0 uD' 0 p' 0 H' 0 & 0$ )O  s    !j j> t 5D-  ώ]  $   P                   >>>+%z ` E?h?q?9:Q% ]] ?%U}%.A08yI=q@qJ݀HeNUUT- \b]%R %|?j#LpUw}} 'qlrx ZN } {  :xIGyEETiI E-LR Z@`@d5>l2C$6C=C$<CDM $* @X^g$+nv3@@  X@h x @~  #"3*#039283>3D#"/"?"p"""""""" # *#F$J$P$X$^$d$j$p$v$~$#$$T$#$$$$$P#`X#b#l#v#~############T######$$ $$&$2$B$F$J$P$X$^$d$j$p$v$~$#$$T$#$$$$$P#`X#b#l#v#~############T######$$ $$&$2$B$5=Ҳ8Kr   = Y {8ִ#H\q ׵!#$&12345689%9,:E;_<}=@ABC DGE]FrGrHrJLMNOͷPݷQRST'U/VGWa\kacd˸efghipqstu1vw7xKgxι%Eaκ/Kcƻ̻%-:Dgzɼۼ +=Wgܽ(E]{ ;V2Eu>[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]t&t((&P#`X#b#l#v#~############T######$$ $$&$2$B$returning to single-user after filesystem check returning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblockZZZY        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?in_addr_flagsin_statuscommit_addressQQRsetifprefixlensetifdstormasksetifbroadaddrclone_commandusagestatusYVkprintallmainziZyiPZRй(RP[Y'@8RpZE;X$Z;ZظZظZU;ZU;ZZZZ[ [[&[@2[>[J[R[ [[0d[@m[v[{[[[[ [[ [@YVkinit_current_mediaA]GL]A]W]^]f]Ymedia_statusmedia_constructor ])][,\2])][,\[)][)],8])]8] ]H7])]\[d3)]3L]f] A]f]`m]u]@m]u]L]f]W]^]paddr_matchM%VeQ%VQ?VR{VGL%VK%VKsettunnel^Xx^print_link_addressessetvlansetvlanif^___t__^&setifssidsetifnwkeysetifbssidReUeXe[eeegeeege ber* T0ee4eUgeмeeQr* eR`Peqddqdd5q``Eainvalid major numberinvalid minor numbertoo many fields for formatffs@ @#  R-:Pa @@',e29>GNSW_cibnorripbgensbextattbnojolietbnocasetransbrrcaseinshh`&hhhh hh hi i@ii i)i3i7i ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data7e:\ mfkete#{eeR#e&P#e&#ee#ee#ee#f ft#f.fQ#;f#Df&3#Mf&2#Wf&#`fhfT#ufƑ#|ff#f&#f&|#fmfS#ff(#fT#fP#fet#fes#fgr#"g-gs#>gq#Gg&#Pg&#Zge#fge#wg&#gg#g#g&#g&#collectiqiqqNAME=((twtP#`X#b#l#v#~############T######$$ $$&$2$B$>    "#$%   "#$%    "#$%&'()*+.   -2qYs1Lbr P#`X#b#l#v#~############T######$$ $$&$2$B$fgwDMMOaL PJGN{H9JyGMGXuLUEKICI7P}RmTCqUcHUHGGGP#`X#b#l#v#~############T######$$ $$&$2$B$P----------------------------------- - --------------------   "#$%@//tmp/usr/varX#8##t#2qz[ Details for index GPT part - P#`Ďǎ̎ю&t(ԎڎZ#ߎ(N#wt $ %.qIUQMIqXUCEe 9&`<<DDH( NY#$` g .!SFH0eCY SFU0eC#Hah!IdontNeedEFIH(s*K>;D(|nQn- q+3?|nQn- q+NX|nQn- q+en|nQn- q+|nQn- q+.B$=rGy=iG}N;Mt?mWC 3KOOƐyD<#*=(Ґܐ3Dh&<\ M}- @Mjy֬,-чH#=-чH$RZIчH&lIчH(IчH2IчH`L6 %?aS'@ )Ѹ`đ*1@ )Ѹ &$1x )ѸgޑPthm    y3} o!Ea aXm  K U m !)   ʓٓƐ#A*: M[      ***************************************************************************************************************************************************************************************************************************************control_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_reportssiddhcpcd_readdump2P$$$dhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2025 Roy Marplesmain duid_getif_discoversplitvadd_environparse_optiondefault_configread_config2b+cPde%f+g1&hW&ij+k+lF1m+no+pq62r+s++t&u++8#v+w!x+z,y,A,B",C$D),EF3,G=,H'IG,JQ,KX,L3Ma,Ng,Op,P},Q,S,T,U,V,W,X,Z1,4,6,,+|,~-} - --#-5-C-A-J-H-O-W-\-b-h-n-=)}--1!)-----------)(w.---- .*.+ .,.?.L.Z.f.{ { rt_new0 rt_buildrt_delete o-31O!:1D1M1X1`&+`1S,-Z,(1-+1make_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_opensockets_osp3w3}33333if_initrtif_ifa ( PT@P HEPT$ @CDHDdhcp_openbpfdhcp_initread_leaselog_dhcp<<< ==dhcp_bound =g;)=1==3:9=6 A=dhcp_start1dhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpipv4_deladdripv4_getstateipv4_addaddripv4_handleifa , , , , , , VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\BC C  D )D AD YD qD "D (D ,qD .D 4D BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~C NGdlPdt "( ,q@.4L`MM NOODP"P(lQ,qR.R4(S-o %s: option not supported sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU makech #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef5MS7) %p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      !1Aa  0@`@@ #+3;CScsM inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_cstringprop_string_create_nocopyprop_string_create_formatprop_string_append_cstring_prop_object_externalize_append_char_prop_object_externalize_append_encoded_cstring_prop_object_externalize_empty_tag_prop_object_externalize_end_tag_prop_object_externalize_start_tag _prop_object_internalize_find_tag_prop_object_internalize_decode_stringprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_number_externalize_prop_number_alloc_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dict_keysym_put_prop_dict_keysym_allocprop_dictionary_set_prop_dictionary_iterator_reset_locked_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equals_prop_dictionary_internalize_continue_prop_dictionary_remove_prop_data_externalizeABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_equals_prop_data_internalize_decodeprop_data_data_prop_data_internalizetruefalse_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_remove_prop_stack_push_prop_stack_pop_tcsetpgrp_tcgetpgrp_tcflush_tcdrain_cfsetospeed_cfsetispeed_cfmakeraw_cfgetospeed_cfgetispeedstrmode_unsetenv_int_strtouq_l_int__strtoull_l_int__strtou_l__strsuftollxpermute_args_getopt_longgetopt_internalunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s_getoptatolatofmemstream_seeksetbuffersetlinebufsetbufmkdtempfwidefsetposfpurgefgetposfgetc_regerror_inet6_rthdr_init_inet6_rthdr_add_inet6_rthdr_lasthop_inet6_rthdr_segments_inet6_rthdr_getaddr_inet6_rthdr_getflags_inet6_rth_init_inet6_rth_add_inet6_rth_reverse_inet6_rth_segments_inet6_rth_getaddrip6optleninet6_insert_padopt_inet6_option_space_inet6_option_init_inet6_option_append_inet6_option_alloc_inet6_option_next_inet6_option_find_inet6_opt_append__icheckhost__gethostlooprshrcmdrresvport_af_addrrresvportresrcmdorcmd_afrcmd_af__ivaliduser_sairuserok_saruseroklink_addr0123456789abcdef_ether_ntoa_ether_aton_ether_line %x:%x:%x:%x:%x:%x %256s _ether_ntohost_ether_hostton_MD5End0123456789abcdef_MD5File_MD5Data_SHA1End0123456789abcdef_SHA1Data_SHA1Transform_SHA1Init_SHA1Update_SHA1Final_RMD160End0123456789abcdef_RMD160Data_uname_ttyname_r_timesaddcmd_getmodecompress_mode_sethostname_popenpopenve_pclose_initgroupskMGTPEBKMGTPEKMGTPEBkMGTPEhumanize_numbermatchcompareg_Ctocg_lstatglobextendglob3g_opendirglob2g_statglob0globtildeglobexp1globexp2_glob_globfree_getpassfd_getmntinfo: _getfsspec_getfsfilefnmatchxgettype_getdiskbynamecreatTLS allocation failed, terminating ;Zx0Nm<[y1OnSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec_tcsetattrwcscmp_stresep_setenv_vdprintf_lsetvbuf_regfree_inet_networkunvisAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~fts_pallocfts_sortfts_statfts_allocfts_build_fts_openfts_maxarglen_fts_close_fts_read_fts_set_fts_children_closedirkhwcschr_strcoll_l_int__strtoumax_l_opendir_initdir_alphasortinsertionsort_mergesort_rsetup_seekdir_unlocked_getdomainname @_strncasecmp_initstate_setstate?getenv_getenv_r__freeenvvar__canoverwriteenvvarauthunix_destroyauthunix_marshalmarshal_new_authauthunix_validate_authunix_create_xdr_authunix_parms_xdr_array_xdr_rejected_reply_xdr_opaque_auth_xdr_accepted_reply_xdr_des_block_xdr_replymsg_xdr_callhdr_seterr_replyacceptedrejected_strtok_rip6_parsenumeric_filenostr2numberget_portget_canonnameres_queryNres_querydomainNget_aigetanswergethostby*.getanswer: asked for "%s", got "%s"res_searchN_freeaddrinfo_getaddrinfoaddrconfigip6_str2scopeid)&_yphostent_gethtent_getservbyname_r_MD5Init_MD5Update_MD5Final @_vasprintf_l_getifaddrs"_freeifaddrsNBCDB atoi d'@Bʚ;__dn_count_labelscharstraddname0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuv__ns_sprintrrf__ns_skiprr__b64_ntopABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/__b64_pton_inet_nsap_addr_inet_nsap_ntoa__ns_format_ttl54ؗҜ<3#I9=D2[%Cod(h_posix1e_acl_entry_compare_acl_differs_acl_brand_as_sl_add_sl_find5_strsep_int_strtoul_l_int__strtoll_lfgetsrewindmap_v4v6_addressmap_v4v6_hostentgethostbyname_internalgetanswergethostby*.getanswer: asked for "%s", got "%s"_dns_gethtbyname_dns_gethtbyaddr_yp_hostent_yp_gethtbyaddr_yp_gethtbynamegethostbyname_rgethostbyaddr_rinet_pton40123456789abcdef0123456789ABCDEF_inet_ptoninet_pton6inet_ntop4_inet_ntopinet_ntop6_fseekoisescaped_fparseln__fgetstr_xdr_int_xdr_u_int_xdr_long_xdr_u_long_xdr_int32_t_xdr_u_int32_t_xdr_short_xdr_u_short_xdr_int16_t_xdr_u_int16_t_xdr_char_xdr_u_char_xdr_bool_xdr_enum_xdr_opaque_xdr_bytes_xdr_netobj_xdr_union_xdr_string_xdr_wrapstring_xdr_int64_t_xdr_u_int64_t_xdr_hyper_xdr_u_hyper_xdr_longlong_t_xdr_u_longlong_t__dn_skipname0123456789__ns_name_ntop  __ns_name_ntol__ns_name_unpack2dn_find__ns_name_pack_int_strtol_l_vsprintf_l__getdelim_nsdbtaddsrc_nsdbtdump_nsdbtput_nsdispatch%02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04dmn-00Etc/UTC _strcasecmpbsearch__cxa_atexit_internal__cxa_atexit_vsnprintf_lfreadfopenferror__swbuf__sprint0123456789abcdef0123456789ABCDEF__vfprintf_unlocked_l__sbprintfexponentQ_strndup_strdup_gethostname !#&(*-/14}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDؗҜ<3#I9=D2[%Cod( 7yACnF?O8M20HwZm1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG_getpagesizeqsort_r__sfvwrite__sflush__swsetup__swhatbuf__smakebuf_tcgetattr_int__strtoi_l__sread__swrite__sseek__sclose_int__strtoimax_lCisalnumisalnum_lisalphaisalpha_lisblankisblank_liscntrliscntrl_lisdigitisdigit_lisgraphisgraph_lislowerislower_lisprintisprint_lispunctispunct_lisspaceisspace_lisupperisupper_lisxdigitisxdigit_ltouppertoupper_ltolowertolower_lc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB _citrus_NONE_stdenc_mbtowc_citrus_NONE_stdenc_mbtocsdl_iterate_phdr_setup0123456789ABCDEF0123456789abcdef_vsnprintf_ss_fwalk__res_nmkquery__res_nopt__res_nopt_rdata/&_hf_gethtbyname2_hf_gethtbyname_hf_gethtbyaddr_nsaddsrctomap ]:[=                       DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::clearerr__rec_dleafNEXTINDEXNEXTINDEXputpair__delpair__get_page__add_ovflpagesqueeze_key__free_ovflpageugly_split__split_page__big_insert__big_delete__big_splitNEXTINDEXH2~!~YՃ84<4@4D4H4P4T4X4\4P4`4d4h4d4p4P4x4|45L3t956d 66!UL    <  < <  < < < <= ==(=4=H=X=kgpkljhpH H |0h?h?gntsG |I @H @h@ X~ rbmn| { { { { tcid   8 , ~h?h?yekd `@|CCX@atadT L loobp  x F̞NNOO0O@O\OhOOOOOOOOP P,P @PLP hPtP Po PPPPPPQ(QLQXQpQ04,^0^8^@^H^P^X^`^h^p^h2x^|^]^]22^^^^110]<]H]T]\]l]t]|]04]],2]]]]]]h2]]2]]]]2]] ^^(^_ _$_(_( ____(aaaaaaaaaaabb bb3b b(b0b8b@bHbPbTb\bdblbtb5|bbbbbbbbbbbbbbbbbbbbbbcccc c(c0c8c@cHcPcXca`chctc|ccccccccc dd$d0dHd\dhdtddddddd e$e8eLede|eeeeeeeff0fDfXflffffffff g g4gHg\gpggggggg`|4/..<.-$------.<.-$-X---p1/l\|XUqssDslsssss t H@ P@ X@P `@ h@̍ |0T ss ssxs sܑlllp/M4S&h&&̊R&P̊0S&[&tHR&R&l@lh(<& 84|$PX&K($wXG&,q&̍ ?<(BR&NN8S&R&:S&L D&|L84\&؋.$R&R&h&?,S&GMF&&jrܡ&&fDG& E [& dKT R&}&dF4@G&0\&x&HR& R&@K3&@R&NpW@IG&GK&8{R&R&R&D G&C R&tD?R&GM\ 8&8@K&\&&R&XN&NnXc dH4P.~   nbyjjc4bfhklmooppp qruTt&vw.w;xlxzzDBCJUO_PnSuTVVXZZ   ʵ(G9a(%G!9am/dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbin\ }-+?=###%%%}8! r>P/,,,0i3wQnQh\AabCdhlNsuvW:w:zش(iY iY0L i9ͪLHi8sZjHi >jZj iYLHiC]Zj(iY̵(iY(iY(iYD0iY]|0i:Sx]0i5 Q RdԶ0i5:SS0a@0iY 80iYl d(iYܶXd@@l@i=8XXiY7ZPRPi 7#ZR'Ri:CZ'P'0iY и@i7ZZiY7ZPi6PR8i[Y [Y8im68R 8R8i56(R (R8i5R R0i]0g$@i9G[[@iF8]8]@iiF7]\8iG,\ ,\@iE\\0ix^`ii]]iV]]0i^_jl i^__8i}^_ _0i^e(n0ipej@icee@iYbee8ibR` R`@iaee8ire* e8iQre* e8ige e0ieTmTtKgwgwgxgwhxYw hwvh1whxhw"h]x*hw0hw5h]x:hw/v  '@@hh`&hhhh hh hi8 @ i@bj......dA..##6;<ĂZP l R 1 l  ͪ+QOBP jX(R&P*8R 3!:"A#$J%N&V'Y(b)g*,+p,t-x/112345668s8:2L"BLVbnxL!oLLvLA\L][LaeL9[Lu$iLw LiL|LMtLuLw[LQhZL=jeL lLuL}eLIz¾LyȾLzz LuξLؾLcݾL[LL1glLasLh8LeLiLtsL9[LiLLALqLjL lLY}LjLmLaL1rLmYL lL3L[LQL"LM]La'LM]-LL l3L]x8LwVL@LFL!yNL lTL lXL lL5hҵLfxLgLuvLA\LuqLu^LsL|ĹdLajLapLQxLkLL|L=uLrLLyzLA\LfLтL t L~ĹLdL \L]z<L%}L[ȿL|ҿLejL9ZwLtL9ؿLi;LQp&LfĹ>Li@$!R #b0 `z  * . ` d f o 04?4sz _##)#*#######%%&&H&S&&&&&&&&&&&&&&&&&&&&&&&&&&&'' ' '('('L'L'N'N'S'U'W'W'''''''++P+P+U+U+....////000>0A00001/11111112 2G2P2MNƤ`|0RTfhk`oooopՌ"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp| ( ( ) ) oK_pp0J#%')-Y[ : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----*0-000ooprt} %&,,ĨŨ&-GQ).1256CCLL|| /vz      8 : ? ?   $ ' FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB@4@4G4U4jj0k6kOoOooooo-0Fgi{BD6;luu!#$&*06DJ22$/6=HQ\gny: "+292@LWbgpu}}2"/gyIm2Lb2:pV:m}"' ""       l h b  w  i x X       0  $  k  j [< e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ is a directory is not a regular file (use -f to see it)XX (~-  f   $!+-9"E>PV\i-x; 7   #28  (!(19CMW&fb)nx5e:%684 +,-. *!?1E8/D/R'^Fk WmkRkRkYcWbkCkc kG ky wb YMYrWca`#Yzb@$#EB(#$c\#OzzdD#AP#D(eL#*>f#^vFH#g|"*h8#\ui0#]jxuJp!"1khH1`HUKX"InLP"mHX#n@",#o8y1O0-<p(HaP Gqh#Pxr" #s!@#OgS!#tyTuT#Viw""4ex(=XA#y4#z#/D"c~!#l?#mA#"x"7Yp"uh(i`"X"8KgP"5H"@$"Q 8$"}=S0"s(!" !"!"%(R!"au"""%Ld#m"! #",["" 6"G~ .=Oamw>+38FXaq'7EXdiv# (press RETURN);$tags643{}abcdDgGhHilnNpPqrs tw xy !:#=L #( #YY%[<<T[b!60<g!?>A@t?p@|5$E9Cq:+q:c#2.4242B=]=svQ<?]M#Y=P/#E~FPcalshT/# !"$'(+-.03569:r?r!5^HI^Q]^q`Y`5`hgEs]s^Pqa```hh`d]Q ^]]]!]H]Q]q9q_qq qqaYaAa)aqaaas-sqsqarrrjqkqarrqt}]&] qqqu]qq bassssrqbbbub]b9b9ieh!bdrqeeee-ff feeee]]e]m]O]rU]fqfUf;fwqq\]%f&f'f(ff9gd#gg$fcgYgOg gCgs1\8 I\u_\ uw\u\j\$u\\K`f  kr$  & \&p s& `  ](  ]z I] `   _&F ` Yen&F =euo    p &F _o&F uep&FP !eYp&F ep "  P&F I}_l&F Kq_em# ;  u&2$%d&2$&2$p& 0& & & p& SR[r&FPbp&F^n&Fba_5q(7o<@Ej$I&JNR\dl3P=Wp;dt )SY/:IfQ6]~ )nN2Yj% 0 D m -      v>M!2j0c f /<MZY,ANzQRE    !"#5$N$$$W%o%%%&'K'''''(!(B(H(a(n((((((((() ))()>)M)Z)h)t)))))))****+M++$,B,-6-../"001'1I1S1[1e1co1x111111 272K2X2d2v2222222223)3D3c33333ů3Y3334444(484Q4c4|44444444455$5-535D59M5e5o5|5555'55555666*696G6V67;8999:8:V:h:Z:::::::::: ;;+;H;S;^;i;z;;;;;<<=<===>>>>>>t8>??1?P?i?????``@@@@@OAAB*B/B?B\BdBBBBBBBBBCCj}  D&pDDJKJ8JFJdJJJJKK`)K6KBKQKmKKKKKKL.L_L  LL3MDMRMWM]MMMNgOOPf]@PXPPPPPPQbQQQRRRRR S4SkSSST)TITfT|TTTTTTTTTTU(U8UIUfUVVVVVVVVVVVV*W2W:WDWOWaWrWWWWWYWWWWW3 XX!X3XFX[XfXxXXXXXXXXXXXX Y Y&Y9YMYaYXYWpY{YYYYYYYYY YX Z#Z1Z:ZOZaZjZ>ZZZZZZZZZ[[$[E]f]]]]]__``%`4`J`|`````aa b9bbbqqqqqrr rwwwww]۶r/ ftpM~@+up)U~!`~h~Fy@wx u~~~~~~~( ~ ,u~~~Y~~~0~  10&*'%(.)5*[+:,B.1/>3;?"@<M@4=?Nu>><<?;<@B<A Z=B J<C $<D |<E N<F+<&Q!<&}a ed Z1rZ1bIhrZZYZY].dA)$3,  &&&&&&&&&CėǗї  ԗ  ח ڗ   R  Z$y #'*.269=@DGK,q N!_"n#z$%&'()˘*Ԙ+ޘ,--..//^0d1 234567$8*93:/;9<H=T>f?t@[\\]ř^Й^__`{{!|/};}O~U  . .@.@.`./ /%%%%#&# &#&#&# &$,&$4&$<&$@&$H&%P&%X&%)%d&%l&&t&&&&&'&'&'&(&(&(&)&)&)&*&*'* '+'+$'+,',8',D',H',P'-\'-h'-l'-t'.'.'.'/'/'/'6';';'0'0'0'1(1(<(<((=4(=@(>L(>X(?`(2h(2t(2|(3(3(3(9(7(8(:(4(4(4(5)5) )! ()" 4)# @)$ L)% X)& d)' p)( |)) )* ). )+ ), )- )/ )0 )1 )2 )3 *4 *5 *6 (*7 4*8 @*9 L*: X*; d*< p*= |*> *? * @*!@*"@*#@*$@*%@*&@*'@*)@+*@ ++@+&`$+'`4+,@D+-@T+.@d+/@t+0@+(`+1@+2@+3@+)`+4@+5@+6@+7@,8@,9@(,:@8,*`H,;@X,<@h,=@x,>@,?@, `,!`,+`,,`,"`,#`,-`-$`-.`(-/`8-%`H-CX-Cd-Dl-Dx-E-E-F-F-c-c-d-d-e&e-#-#-&-&-0 .. .$.(.,.0.8.@.H.P.X.`.h.p.x.........%%/// /$/,/4/$$ $ $@$@t%%% %,%8% @% H% P%@X%@l%@p%@%@%@%`%`%%%%%% %@%D 0433333333MNN0NHN3333<\@\D\H\L\H3 ]UTC33ȏȐ* + & ' + -' * ' 33 &$8339㼥ͤtgQ>PNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[SždApAdAA Б 33UU33UU33UUFGtDFEPBFGtDFEC 8GGtDFE EGF& 8]D]3L./T. $0x   @ 8333333333333333333333333333333333333 33 33q@?<iS3yUmW4g/\Q,SEUg_i=?N[EQ 1 Dso 747d ̼qpvp-M}qy!p[\+HU h8gl{x 6 j;#!r]x:F|f1ɠɇ&ndDJPj,r!, Ur>vU+R0.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf /B"H##.PV$b̊gЊtTT`yNNh &p+z^MSGTXTS619 4968 4993 5010 5032 5035 5040 5048 5055 5063 5071 5074 5077 5080 5084 5096 5105 5118 5147 5162 5706 5740 6423 6711 7419 7475 7549 7645 7692 7715 7738 7744 7753 7775 7779 7783 7786 7789 7894 8097 8336 8777 9215 9250 9265 9277 9283 9295 9314 9334 9374 9391 9408 9423 9470 9508 9556 9638 9762 9898 9939 9977 10014 10049 10059 10108 10258 10264 10269 10273 10293 10403 10423 10429 10443 10455 10466 10503 10537 10561 10663 10700 10722 10821 10876 10934 10945 10961 11013 11181 11388 11559 11623 11675 11947 12497 13026 13458 13796 14129 14242 14257 14266 14426 14597 14747 14911 14934 14958 14973 15048 15188 15365 15520 15532 15612 15713 15759 15785 15855 15866 15875 15888 15914 15929 15945 15958 16013 16024 16039 16243 16476 16505 16520 16589 16663 16736 16766 16804 16858 17312 17338 17367 17471 17577 17762 17874 17989 18093 18780 19039 19179 19215 19385 19426 19562 19585 19622 19667 19918 20014 20068 20167 20178 20215 20252 20279 20288 20322 20329 20354 20381 20416 20430 20444 20473 20487 20504 20513 20535 20553 20570 20581 20600 20626 20644 20667 20684 20699 20714 20732 20759 20786 20808 20847 20865 20897 21125 21199 21242 21288 21435 21591 21635 21914 21941 22300 22484 22636 22817 22964 23122 23143 23191 23201 23209 23220 23231 23241 23248 23263 23275 23313 23343 23382 23435 23493 23514 23521 23540 23561 23568 23591 23613 23633 23655 23686 23723 23745 23759 23805 23834 23868 23908 23943 23971 24019 24028 24037 24042 24051 24060 24077 24081 24086 24090 24103 24112 24139 24159 24182 24201 24228 24250 24282 24298 24303 24313 24336 24358 24375 24392 24405 24414 24423 24429 24456 24463 24487 24508 24532 24545 24564 24589 24612 24628 24634 24646 24676 24684 24724 24735 24746 24757 24774 24791 24805 24822 25270 25486 25750 26022 26074 26110 26146 26197 26214 26252 26266 26273 26290 26293 26298 26307 26319 26330 26339 26360 26402 26418 26434 26465 26482 26497 26512 26527 26548 26568 26609 26638 26686 26919 26954 27161 27180 27217 27278 27316 27355 27511 27526 27572 27599 27622 27658 27668 27678 27689 27694 27757 27805 27849 27910 27943 27990 28008 28147 28169 28292 28306 28316 28339 28444 28500 28616 28647 28652 28678 28717 28727 28770 28780 28796 28811 28829 28852 28882 28903 28929 29126 29169 29173 29179 29185 29190 29201 29215 29244 29276 29288 29335 29385 29425 29452 29468 29477 29520 29526 29534 29538 29558 29575 29587 29618 29874 29923 30499 30526 30558 30586 30638 30644 30650 30655 30676 30692 30714 30743 30884 31018 31031 31167 31169 31171 31173 31190 31203 31221 31248 31252 31258 31263 31271 31277 31317 31319 31329 31344 31361 31395 31427 31465 31494 31523 31545 31588 31614 31658 31794 31796 31798 31837 31904 31921 31935 31939 31946 32068 32137 32425 32563 32704 32785 32832 32838 32861 32907 32910 32936 32979 33044 33106 33176 33244 33337 33556 33581 33585 33621 33639 33667 33709 33753 33817 33867 33943 33965 34017 34061 34100 34134 34164 34195 34220 34229 34241 34249 34260 34272 34291 34315 34364 34381 34405 34448 34770 34773 34787 34800 34812 34819 34830 34837 34844 34853 34863 34880 34896 34946 34954 34962 34972 34983 35001 35018 35039 35061 35070 35080 35107 35113 35123 35142 35158 35176 35196 35205 35216 35223 35240 35259 35280 35290 35307 35313 35329 35344 35359 35380 35402 35421 35431 35436 35441 35459 35478 35497 35503 35522 35542 35562 35580 35585 35591 35608 35624 35645 35658 35666 35686 35710 35727 35735 35746 35767 35773 35785 35807 35821 35830 35851 35869 35878 35912 35935 35962 35994 36017 36037 36048 36080 36096 36107 36120 36143 36165 36673 36703 36734 36762 36776 36977 37199 37366 37453 37470 37488 37505 37534 37581 37592 37611 37633 37712 37904 37932 38050 38072 38213 38232 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-10.99.14. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-10.99.14 ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-10.99.14 ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-10.99.14 ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-10.99.14 ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Die Installation wird abgebrochen. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-10.99.14 InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-10.99.14 ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPNFSCD-ROM / DVDDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzSendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd aktivierenntpd aktivierenntpdate beim Starten ausfhrenmdnsd aktivierenxdm aktivierencgd aktivierenlvm aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte PartitionierungPartitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen?Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden? Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): Kernel (GENERIC)Kernel (C700)TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist.seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.th and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm sh stty syncMSGTXTS619 4968 5006 5023 5038 5041 5044 5049 5057 5065 5073 5076 5079 5088 5100 5112 5121 5130 5156 5167 5703 5730 6296 6596 7237 7284 7397 7490 7524 7543 7561 7569 7578 7603 7607 7611 7614 7617 7739 7924 8152 8672 9023 9052 9065 9078 9083 9103 9122 9143 9202 9219 9233 9255 9300 9326 9367 9445 9563 9677 9731 9760 9792 9831 9837 9870 9993 10000 10004 10012 10036 10118 10124 10131 10143 10157 10166 10199 10218 10230 10340 10402 10421 10540 10591 10643 10655 10674 10726 10930 11138 11329 11389 11438 11705 12164 12830 13253 13575 14000 14132 14164 14176 14354 14551 14712 14846 14866 14899 14913 14982 15095 15267 15402 15422 15534 15626 15649 15672 15731 15746 15767 15782 15803 15823 15848 15862 15886 15898 15916 16126 16376 16397 16413 16466 16534 16607 16644 16670 16746 17241 17267 17289 17396 17503 17704 17777 17861 17961 18456 18694 18845 18879 19014 19058 19197 19238 19283 19330 19574 19707 19769 19863 19868 19902 19936 19951 19979 20012 20019 20044 20062 20088 20095 20110 20125 20145 20185 20202 20222 20243 20265 20280 20300 20322 20337 20350 20364 20376 20388 20402 20425 20448 20466 20509 20560 20597 20782 20845 20881 20930 21021 21151 21204 21464 21511 21872 22022 22191 22331 22451 22583 22623 22670 22680 22688 22698 22706 22717 22728 22742 22767 22809 22842 22875 22910 22964 22989 23008 23030 23035 23041 23071 23088 23115 23133 23154 23176 23195 23205 23235 23261 23288 23337 23365 23392 23445 23455 23465 23471 23481 23490 23510 23514 23519 23523 23536 23545 23576 23593 23620 23641 23661 23680 23706 23719 23727 23743 23774 23805 23826 23852 23865 23873 23884 23890 23914 23924 23936 23954 23965 23985 24001 24027 24049 24065 24077 24097 24123 24129 24159 24173 24187 24210 24229 24248 24266 24284 24702 24903 25143 25327 25405 25460 25527 25567 25590 25624 25635 25643 25666 25669 25672 25678 25689 25701 25714 25744 25788 25801 25814 25851 25865 25876 25887 25898 25915 25926 25973 25996 26045 26286 26319 26574 26595 26628 26681 26707 26734 26890 26896 26939 26959 26978 27007 27014 27021 27028 27033 27082 27120 27154 27211 27239 27284 27301 27402 27407 27484 27498 27508 27532 27655 27736 27846 27874 27879 27895 27924 27932 27973 27980 27994 28007 28015 28034 28067 28087 28107 28323 28354 28359 28366 28373 28377 28391 28403 28418 28451 28464 28519 28577 28613 28631 28649 28667 28704 28710 28718 28722 28743 28760 28771 28793 28971 29015 29717 29741 29775 29794 29839 29846 29853 29857 29881 29892 29897 29960 30081 30204 30217 30351 30353 30355 30357 30367 30376 30389 30416 30420 30426 30431 30440 30445 30472 30474 30487 30499 30514 30542 30586 30633 30649 30671 30682 30715 30735 30784 30884 30886 30888 30929 31020 31037 31051 31056 31062 31171 31230 31481 31622 31749 31817 31854 31861 31888 31934 31937 31958 32003 32054 32113 32182 32229 32334 32477 32502 32506 32540 32557 32581 32633 32684 32756 32822 32920 32937 32968 33004 33038 33062 33086 33119 33139 33149 33157 33165 33175 33186 33200 33226 33274 33297 33317 33358 33657 33660 33674 33686 33693 33712 33726 33733 33740 33749 33759 33776 33792 33840 33848 33856 33866 33877 33895 33912 33931 33951 33958 33975 33992 33999 34012 34047 34064 34083 34103 34113 34129 34142 34160 34180 34201 34211 34231 34251 34264 34283 34296 34320 34343 34356 34367 34372 34379 34397 34416 34435 34443 34462 34482 34507 34525 34532 34539 34552 34561 34582 34595 34603 34623 34651 34668 34674 34685 34716 34724 34737 34759 34781 34790 34811 34829 34836 34859 34878 34905 34923 34943 34956 34971 34992 35006 35013 35027 35042 35061 35606 35639 35667 35696 35704 35741 36053 36230 36307 36324 36342 36357 36379 36429 36439 36456 36478 36537 36695 36719 36849 36874 37000 37018 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-10.99.14. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-10.99.14 ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-10.99.14 ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-10.99.14 completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-10.99.14. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. La instalacin ha sido interrumpida. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-10.99.14Salir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-10.99.14Ejecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPNFSCD-ROM / DVDDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroSendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): Ncleo (GENERIC)Ncleo (C700)TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy MSGTXTS619 4968 5004 5021 5036 5040 5044 5049 5060 5066 5072 5075 5078 5081 5085 5097 5109 5119 5149 5161 5591 5618 6194 6554 7239 7300 7378 7473 7513 7535 7553 7559 7568 7594 7598 7602 7605 7608 7730 7915 8143 8672 9090 9119 9132 9145 9152 9172 9191 9214 9257 9277 9296 9319 9363 9392 9433 9499 9611 9725 9779 9808 9840 9879 9885 9918 9996 10002 10006 10011 10052 10189 10199 10207 10226 10240 10249 10281 10322 10335 10460 10518 10537 10656 10712 10764 10775 10791 10830 11080 11252 11424 11479 11514 11764 12168 12467 12735 13096 13276 13595 13615 13628 13817 13961 14157 14291 14311 14344 14363 14464 14619 14807 14994 15014 15093 15191 15229 15252 15342 15363 15386 15405 15429 15459 15503 15536 15559 15571 15589 15857 16176 16207 16242 16306 16381 16451 16482 16512 16604 17095 17125 17142 17282 17423 17620 17739 17886 18053 18611 18907 19088 19133 19296 19350 19485 19521 19581 19631 19922 20031 20088 20185 20190 20225 20260 20275 20299 20332 20337 20362 20378 20401 20408 20425 20440 20459 20491 20495 20515 20533 20545 20558 20576 20600 20618 20637 20664 20691 20703 20724 20754 20784 20809 20842 20877 20915 21168 21237 21292 21353 21471 21630 21684 21945 21996 22372 22527 22671 22811 22919 23104 23134 23177 23187 23195 23205 23217 23238 23247 23253 23285 23326 23362 23400 23437 23485 23509 23521 23535 23543 23551 23579 23596 23625 23646 23669 23678 23697 23709 23753 23791 23818 23862 23890 23917 23970 23981 23992 23999 24009 24018 24052 24056 24061 24065 24078 24088 24118 24141 24170 24192 24214 24236 24263 24275 24287 24306 24340 24373 24394 24418 24431 24443 24456 24462 24488 24498 24509 24533 24543 24563 24583 24600 24626 24650 24663 24683 24717 24724 24753 24776 24799 24815 24830 24845 24860 24874 25305 25496 25731 25919 25961 26011 26065 26113 26135 26176 26187 26195 26219 26223 26227 26236 26247 26258 26273 26304 26350 26363 26376 26406 26420 26432 26444 26456 26474 26497 26542 26565 26625 26877 26904 27166 27184 27211 27260 27290 27321 27453 27460 27509 27532 27556 27585 27593 27603 27611 27616 27669 27718 27758 27824 27857 27901 27924 28025 28030 28107 28121 28131 28155 28278 28359 28469 28497 28502 28518 28547 28555 28596 28604 28618 28631 28639 28658 28691 28711 28731 28947 28978 28998 29004 29011 29015 29030 29049 29075 29084 29096 29150 29208 29243 29262 29279 29291 29326 29332 29340 29344 29365 29382 29393 29418 29596 29650 30341 30360 30395 30425 30471 30477 30484 30488 30512 30528 30534 30609 30759 30878 30891 30959 30961 30963 30965 30975 30988 31005 31032 31036 31042 31047 31056 31061 31088 31090 31103 31115 31130 31158 31202 31249 31265 31287 31298 31331 31351 31400 31500 31502 31504 31552 31642 31659 31673 31678 31684 31787 31839 32085 32246 32401 32472 32525 32532 32559 32609 32612 32633 32679 32734 32793 32862 32909 33014 33157 33182 33186 33220 33237 33275 33328 33368 33444 33509 33603 33624 33662 33702 33738 33762 33785 33824 33854 33861 33870 33878 33886 33900 33916 33944 33996 34013 34034 34078 34420 34424 34439 34450 34458 34477 34489 34496 34503 34512 34522 34539 34555 34609 34617 34625 34635 34646 34664 34681 34697 34715 34722 34740 34757 34764 34774 34805 34824 34843 34863 34873 34892 34905 34925 34945 34966 34976 34995 35014 35024 35041 35055 35078 35102 35115 35125 35130 35134 35152 35171 35190 35195 35214 35234 35259 35274 35278 35285 35295 35304 35325 35339 35347 35367 35393 35410 35418 35429 35460 35465 35478 35500 35515 35524 35545 35563 35572 35616 35640 35667 35682 35699 35713 35744 35768 35799 35806 35820 35835 35854 36399 36432 36460 36489 36497 36534 36846 37023 37100 37117 37135 37150 37172 37222 37232 37249 37271 37330 37488 37512 37642 37667 37793 37811 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-10.99.14. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-10.99.14 est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-10.99.14 est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-10.99.14 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-10.99.14 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-10.99.14 Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-10.99.14Excuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPNFSCD-ROM / DVDDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : Kernel (GENERIC)Kernel (C700)TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationditerGroupe umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any lengMSGTXTS619 4968 5009 5025 5043 5047 5051 5061 5070 5076 5082 5085 5088 5097 5107 5120 5128 5139 5164 5176 5685 5717 6209 6498 7043 7089 7193 7279 7315 7330 7348 7356 7364 7391 7395 7399 7402 7405 7516 7701 7929 8405 8739 8768 8783 8798 8806 8820 8838 8859 8910 8926 8936 8956 9002 9032 9085 9142 9253 9374 9418 9451 9490 9524 9531 9564 9641 9647 9654 9661 9690 9802 9808 9819 9836 9853 9862 9891 9903 9913 10014 10076 10096 10216 10253 10309 10323 10344 10381 10591 10766 10915 10950 11002 11219 11533 12057 12419 12709 13102 13237 13250 13261 13407 13586 13717 13851 13871 13904 13923 14006 14121 14262 14387 14401 14509 14602 14631 14651 14727 14744 14762 14778 14797 14817 14834 14846 14872 14884 14902 15103 15342 15369 15386 15442 15504 15564 15595 15619 15678 16054 16084 16101 16209 16319 16459 16533 16609 16687 17179 17399 17510 17541 17668 17704 17832 17859 17899 17945 18161 18285 18353 18453 18458 18494 18530 18544 18567 18600 18604 18629 18648 18674 18679 18694 18709 18728 18753 18765 18787 18804 18817 18829 18847 18871 18886 18903 18916 18927 18938 18958 18987 19016 19040 19075 19110 19137 19324 19373 19405 19453 19550 19683 19729 19921 19951 20273 20402 20542 20682 20799 20934 20978 21021 21029 21039 21051 21063 21071 21082 21109 21143 21179 21210 21245 21281 21328 21348 21365 21383 21388 21395 21421 21437 21458 21475 21492 21510 21527 21540 21571 21596 21627 21658 21693 21720 21773 21783 21793 21799 21808 21816 21831 21835 21840 21844 21857 21867 21896 21912 21938 21955 21974 21995 22011 22024 22029 22037 22052 22078 22097 22125 22143 22154 22160 22166 22187 22197 22208 22226 22248 22265 22278 22299 22319 22339 22350 22363 22385 22392 22417 22432 22452 22464 22481 22498 22518 22537 22847 23027 23238 23426 23492 23539 23594 23638 23658 23687 23699 23705 23721 23725 23729 23737 23747 23759 23774 23793 23829 23840 23851 23890 23902 23912 23922 23932 23948 23966 24015 24036 24081 24325 24351 24605 24620 24646 24703 24737 24772 24914 24931 24980 25001 25017 25046 25051 25056 25062 25067 25106 25141 25171 25226 25259 25305 25319 25398 25403 25457 25471 25481 25505 25591 25639 25745 25779 25786 25801 25828 25837 25876 25883 25905 25924 25940 25958 25990 26009 26026 26183 26214 26221 26230 26238 26245 26259 26277 26296 26306 26318 26359 26404 26433 26454 26477 26496 26534 26540 26548 26552 26573 26590 26599 26618 26764 26806 27316 27324 27348 27366 27410 27415 27420 27424 27455 27468 27477 27523 27649 27740 27752 27816 27818 27820 27822 27832 27846 27861 27888 27892 27898 27903 27912 27917 27944 27946 27961 27972 27987 28015 28059 28106 28122 28144 28155 28188 28208 28257 28357 28359 28361 28396 28472 28489 28503 28510 28516 28615 28671 28947 29071 29182 29244 29282 29290 29312 29361 29364 29385 29430 29485 29544 29613 29660 29765 29908 29933 29937 29971 29987 30012 30060 30096 30157 30211 30292 30314 30353 30390 30422 30446 30473 30499 30513 30521 30531 30539 30553 30566 30578 30602 30643 30669 30686 30715 31039 31042 31056 31068 31074 31090 31102 31109 31116 31125 31135 31152 31168 31211 31219 31227 31237 31248 31266 31283 31296 31322 31329 31337 31354 31362 31379 31403 31422 31441 31460 31470 31481 31495 31513 31533 31553 31562 31585 31605 31616 31631 31643 31662 31681 31692 31702 31707 31713 31731 31750 31769 31776 31795 31815 31840 31857 31863 31871 31881 31893 31914 31930 31938 31958 31978 32000 32008 32019 32042 32049 32063 32085 32102 32111 32132 32150 32159 32190 32206 32233 32252 32272 32290 32311 32325 32345 32352 32371 32386 32405 32950 32983 33011 33040 33048 33085 33397 33574 33651 33668 33686 33701 33723 33773 33783 33800 33822 33881 34039 34063 34193 34218 34344 34362 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-10.99.14. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-10.99.14 zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-10.99.14 zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-10.99.14 zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-10.99.14 zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Instalacja zostala przerwana. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-10.99.14Wyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-10.99.14Uruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPNFSCD-ROM / DVDDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymSendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Instalowanie bootblokow na %s.... Twoje partycje NetBSD na %s wygladaja nastepujaco (Rozmiar i offset w %s): Kernel (GENERIC)Kernel (C700)RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # Rapid commit support. # Safe to enable by default because it requires the equivalent option set # on the server to actually work. option rapid_commit # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private  ... . ..zero wsmuxctl3 wsmuxctl2 wsmuxctl1 wsmuxctl0wsmux3wsmux2wsmux1wsmux0wsmouse3wsmouse2 wsmouse1!wsmouse0"wsmouse#wskbd3$wskbd2%wskbd1&wskbd0'wskbd(wsfont)wd3p*wd3o+wd3n,wd3m-wd3l.wd3k/wd3j0wd3i1wd3h2wd3g3wd3f4wd3e5wd3d6wd3c7wd3b8wd3a9 wd3:wd2p;wd2o<wd2n=wd2m>wd2l?wd2k@wd2jAwd2iBwd2hCwd2gDwd2fEwd2eFwd2dGwd2cHwd2bIwd2aJ wd2Kwd1pLwd1oMwd1nNwd1mOwd1lPwd1kQwd1jRwd1iSwd1hTwd1gUwd1fVwd1eWwd1dXwd1cYwd1bZwd1a[ wd1\wd0p]wd0o^wd0n_wd0m`wd0lawd0kbwd0jcwd0idwd0hewd0gfwd0fgwd0ehwd0diwd0cjwd0bkwd0al wd0murandomnttypfottypepttypdqttypcrttypbsttypatttyp9uttyp8vttyp7wttyp6xttyp5yttyp4zttyp3{ttyp2|ttyp1}ttyp0~ttyHstatttyHcfgttyH7ttyH6ttyH5ttyH4ttyH3ttyH2ttyH1ttyH0ttyGstatttyGcfgttyG7ttyG6ttyG5ttyG4ttyG3ttyG2ttyG1ttyG0ttyFstatttyFcfgttyF7ttyF6ttyF5ttyF4ttyF3ttyF2ttyF1ttyF0ttyEstatttyEcfgttyE7ttyE6ttyE5ttyE4ttyE3ttyE2ttyE1ttyE0tty01tty00 ttystdoutstdinstderr st1 st0sd3psd3osd3nsd3msd3lsd3ksd3jsd3isd3hsd3gsd3fsd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2asd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2k rwd2j rwd2i rwd2h rwd2g rwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1e rwd1d!rwd1c"rwd1b#rwd1a$rwd1%rwd0p&rwd0o'rwd0n(rwd0m)rwd0l*rwd0k+rwd0j,rwd0i-rwd0h.rwd0g/rwd0f0rwd0e1rwd0d2rwd0c3rwd0b4rwd0a5rwd06rst17rst08rsd3p9rsd3o:rsd3n;rsd3m<rsd3l=rsd3k>rsd3j?rsd3i@rsd3hArsd3gBrsd3fCrsd3eDrsd3dErsd3cFrsd3bGrsd3aHrsd3Irsd2pJrsd2oKrsd2nLrsd2mMrsd2lNrsd2kOrsd2jPrsd2iQrsd2hRrsd2gSrsd2fTrsd2eUrsd2dVrsd2cWrsd2bXrsd2aYrsd2Zrsd1p[rsd1o\rsd1n]rsd1m^rsd1l_rsd1k`rsd1jarsd1ibrsd1hcrsd1gdrsd1fersd1efrsd1dgrsd1chrsd1birsd1ajrsd1krsd0plrsd0omrsd0nnrsd0morsd0lprsd0kqrsd0jrrsd0isrsd0htrsd0gursd0fvrsd0ewrsd0dxrsd0cyrsd0bzrsd0a{rsd0|rmd1d}rmd1a~rmd1rmd0drmd0armd0rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rcd1drcd1arcd1rcd0drcd0arcd0randomptypfptypeptypdptypcptypbptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0memmd1dmd1a md1md0dmd0a md0ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullest1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drumconsttyconsolecd1dcd1a cd1cd0dcd0a cd0 bpf0bpf . .. dhcpcd.confgroup master.passwd netconfig protocolsserviceswheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766: root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin # $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  . .. dhcpcd-hooksdhcpcd-run-hooks#!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook" fi done  . ..20-resolv.conf 30-hostname else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi ...# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime [ -z "$rdnsstime" ] && return 1 ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers [ -n "$rdnss" ] && new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime [ -z "$dnssltime" ] && return 1 ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search [ -n "$dnssl" ] && new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf return $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" # Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... . .. chown dhcpcd  disklabel dmesg fdisk fsck fsck_ffs halt ifconfig init mknod mount  mount_cd9660  mount_ffs  mount_mfs  mount_msdos  mount_nfs newfs ping ping6 reboot restore route rrestore swapctl 0umount ... ... . .. binmdecsbinshare . .. ftp gunzip gzcat gzip less more progress sed tar `tip ... . .. chroot . ..misc ... . .. db log runspool ... ... ... . ..lock ...0U^%K4"#'(),-@V^T8@@V^x@ @+@-@-@L(@,@,@cW^|D(@(@W^8<.@L/@L8@XC@A@B@ 8@,X^[$X^(7@:@lX^C@D@ \[hO@L@H@H@H@7Y^pG@H@,P@0P@HP@W@(Y@Q@Q@4P@^Y^ P@tU@Y^[@[@Z^i@dj@k@dk@hk@Pl@`l@|k@k@pl@xl@l@@X@l@@@@0@H@`@l@l@l@D@l@l@@@x@@@@؁@@@ @8@P@h@@@@@Ԃ@Z^l@Hm@@@oP@earmzaurus#_^5_^?_^K_^`_^m_^{_^@@@@@@ @P@@X@X@d@p@x@@|@@8@8@@@@x@t@@x@@@p@@@`@@د@@@i^@t@@@ʏRT^xcA\WAdA~^ tA܆AdyAuAtAr^@,AAAo^8XABpAPo^Hu^@|^8^^BTBhBlBHBLB\B`B@\Bz@z@z@@{@<{@{@@|@|@X}@`@z@z@ {@D@{@ |@t|@@}@}@<~@@؁@@@ @~@~@h@@@$@@Ԃ@@t@@,@H@@D@`@@@@h@\@@@@^BB01236789 ./"'*+^8  B"B^,B+BhBlBHBLB\B`B@\B@.BH.Bl.B@.B.B@@@0@H@`@.B.B.BD@.B.B@@x@@@@؁@@@ @8@P@h@@@@@Ԃ@L3B@8ܐ^d^/B/B^6B@=BKBDFB0GBHFBJBlFBFBFBFBFBhIBFBLB`^@|fBxeBlBiBiBiBiBiBkBlB iBnBnB(iB\^ttmk%Czټ|Ff梂&Sk@5LEDJD(KD<^XMDLNDND^ ^^^^^#^ ^^^^^^^^^^^Y^d^^^^^^^^^^^^^^"^-^8^C^C^N^Y^d^o^z^^^I_^^^X ^]ȉ]`Z $HEEE,E4EE|E]XdX@d@ h h 8"'-T39?? < ddi(`cG`G>??  ` ~ ^AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy((((((())((((((())SZZys[zzRTAL9CEINCOUYrUal:ceinDouyAa L= S` Td Z} l> sa te z~ C  E D NG RX c  e d nH rY'S^'s_'C'Tb'c'tcAIOaioAEOUaeouZ{z| OP Up oQ uq(A(a(E(e Un uo7LA7lBJJ">""""&n@T((T`px|~~|xp`>~~>8|8888|8fffffffff~t0xs; x8|8888|88|8888888888888888|8 003f$ff$<~~<wfllllllll||| 0 `F8ll8vv0 000000 0 0f<ffff<~~~~`0``|```0||~~0  0~ 0`0 ~p~vv8ll8 Pp lllllx0`||||||| _KJJhJRJJJ|JJJ\JJJKR|YXXtXXR]_0kK8\KL`K`KRP]K]K\K"K^K_K!K`"Kd"KjKR|YXXtXXR]@y_HML6L<7L8LR@L8L6LKl;L6LRG_G_GR:I_EI_(FRVI_`I_8FRmI_}I_GRI_I_DHRI_I_$HRq (root)`%n.core~~~{|p|| }x}}(~~~h{ R@BQ_0uWS4@HPXRhpQTQTQTQTQTQT QTQT@QTQTQTQTQTQTQTQTQTQTQTQTQTQT QTQT@QTQTQTQTNTNT e@@g@g_g_g_g_TT  @ RĂ̂l_UUUxUUULUhU U l_UUUxUUULUhU Udr|_]]PYVhn_\VVV0]] @WWlockf2  }_{X{X{X{X{XR{X{X{X,{X{XR{X{X{X{X{X{X{X{X{XR ^rk_rk_p Y( Y Y@_)Y_/Yb^9Y(9YbY\YUY`Y_YxbYaYaYSYLYEYFY8~Y$}Y }Y Y Y Y Y Y }Y Y(_ YY"""_Z^^Zm0u`܎ZZZZ8ZZZ)_L^x^^_1__5_~^9_rk_@_D_M_P_^W_^_d_h_q_x_|_K_________\^____^_V^Ó_ɓ_͓_ѓ_ٓ_____T_U_V _W_X_Y_Z"_[&_b+_c0_d)w^e6_f<_gA_hH_iL_jV_k[_lb_mj_nr_op_nK__y_~_a__o___ I _ "_ _RT^i_b^h*__._ 7_[__V_p_C___ _!2_" ^$_%_(_._1_2<^^4_5_6_8_9Ɣ_:Д_;֔_<G _=_>_@_A_B_F_GG_H _I_J _M_N _T&_U*_V1_W5_X9_Y=_ZB_[d^\\F_]L_^U__]_`a_ag_cm_d^et_f\^g}_h_i_k_l_mpt^],\]L]l]0]PO]\ ^^h]^]̞]]L]r] \](\^,]]ܞ]\H^L]^V^V^#^d^o^ #^^^Ч8#^^^ԧ8#^N_N_ا8#^u_u_ܧ8#^__ী8#^7_7_䧀8#^__觀8#^__지8#^__8#^=_=_8#^__8#^9_9_8#^__8#^\^^\#^s0_2^\#^"_^#^"_^Ȧ#^"_^ئ#^"_q^ \#^_^\#^~^~^P#^֔_r_#^G _G _#^Z^Z^._Z^#^RT^RT^D#^r^r^,#^^^#^^^覀#^^^#^^^#^^^#^_cW^(#^`^`^8#^_Y^H#^T^V^X#^V^V^h#^W^W^x#^$X^$X^#^X^X^t#^7Y^7Y^#^\^\^#^^Y^^Y^#^^^ȧh#^@ @p@@ @@AH^$^^Y^$^\^7Y^$^X^$X^$^W^$^V^T^$^_$^`^_$^^^^$^^^$^r^$^RT^._$^Z^$^b^G _֔_~^$^_$^"_$^s0_%^\^_9__=____7__u_N_^^d^V^ %^<^[e^l^]8_1g_,@NetBSD8nAA(aeabi5TE  $NetBSD: locore.S,v 1.44 2022/04/02 11:16:07 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/locore.S D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: md_root.c,v 1.19 2015/08/30 05:24:03 uebayasi Exp $$NetBSD: /usr/src/sys/dev/md_root.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: autoconf.c,v 1.17 2023/12/20 15:34:46 thorpej Exp $$NetBSD: /usr/src/sys/arch/zaurus/zaurus/autoconf.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: machdep.c,v 1.55 2024/05/13 00:08:06 msaitoh Exp $$NetBSD: /usr/src/sys/arch/zaurus/zaurus/machdep.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_disk_mbr.c,v 1.59 2025/02/08 10:49:45 mlelstv Exp $$NetBSD: /usr/src/sys/kern/subr_disk_mbr.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ziic.c,v 1.6 2021/08/07 16:19:08 thorpej Exp $$NetBSD: /usr/src/sys/arch/zaurus/dev/ziic.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: scoop.c,v 1.13 2014/09/23 14:49:46 nonaka Exp $$NetBSD: /usr/src/sys/arch/zaurus/dev/scoop.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: scoop_pcic.c,v 1.4 2011/06/19 16:20:09 nonaka Exp $$NetBSD: /usr/src/sys/arch/zaurus/dev/scoop_pcic.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: zssp.c,v 1.15 2021/08/07 16:19:08 thorpej Exp $$NetBSD: /usr/src/sys/arch/zaurus/dev/zssp.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: w100lcd.c,v 1.6 2022/05/28 10:36:23 andvar Exp $$NetBSD: /usr/src/sys/arch/zaurus/dev/w100lcd.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: w100.c,v 1.4 2021/11/20 00:17:10 rin Exp $$NetBSD: /usr/src/sys/arch/zaurus/dev/w100.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: lcdctl.c,v 1.3 2012/01/29 10:12:41 tsutsui Exp $$NetBSD: /usr/src/sys/arch/zaurus/dev/lcdctl.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: zkbd.c,v 1.22 2021/08/07 16:19:08 thorpej Exp $$NetBSD: /usr/src/sys/arch/zaurus/dev/zkbd.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: zapm.c,v 1.14 2021/08/07 16:19:08 thorpej Exp $$NetBSD: /usr/src/sys/arch/zaurus/dev/zapm.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: zmci.c,v 1.5 2012/01/29 10:12:42 tsutsui Exp $$NetBSD: /usr/src/sys/arch/zaurus/dev/zmci.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: vfp_init.c,v 1.78 2022/08/20 11:34:08 riastradh Exp $$NetBSD: /usr/src/sys/arch/arm/vfp/vfp_init.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: cons.c,v 1.95 2023/09/02 17:44:59 riastradh Exp $$NetBSD: /usr/src/sys/dev/cons.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: fiq.c,v 1.10 2020/02/24 12:08:08 rin Exp $$NetBSD: /usr/src/sys/arch/arm/arm/fiq.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: mainbus.c,v 1.24 2022/09/27 06:36:42 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/mainbus/mainbus.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: mainbus_io.c,v 1.24 2018/03/16 17:56:32 ryo Exp $$NetBSD: /usr/src/sys/arch/arm/mainbus/mainbus_io.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: cpu_mainbus.c,v 1.19 2024/05/09 12:41:08 pho Exp $$NetBSD: /usr/src/sys/arch/arm/mainbus/cpu_mainbus.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: disassem.c,v 1.42 2020/12/01 02:48:28 rin Exp $$NetBSD: /usr/src/sys/arch/arm/arm/disassem.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: bus_stubs.c,v 1.3 2021/09/18 09:49:57 jmcneill Exp $$NetBSD: /usr/src/sys/arch/arm/arm/bus_stubs.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: arm_cpu_topology.c,v 1.9 2024/12/10 11:27:29 jmcneill Exp $$NetBSD: /usr/src/sys/arch/arm/arm/arm_cpu_topology.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: arm_machdep.c,v 1.68 2023/10/04 20:28:05 ad Exp $$NetBSD: /usr/src/sys/arch/arm/arm/arm_machdep.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ast.c,v 1.32 2021/02/01 19:31:34 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm/ast.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: bcopyinout_xscale.S,v 1.12 2022/10/20 06:58:38 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm/bcopyinout_xscale.S D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: blockio.S,v 1.9 2022/10/20 06:58:38 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm/blockio.S D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: bootconfig.c,v 1.13 2020/10/18 16:28:57 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm/bootconfig.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: copystr.S,v 1.14 2022/10/20 06:58:38 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm/copystr.S D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: core_machdep.c,v 1.10 2020/11/10 21:38:03 rin Exp $$NetBSD: /usr/src/sys/arch/arm/arm/core_machdep.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: cpufunc.c,v 1.185 2022/12/22 06:58:07 ryo Exp $$NetBSD: /usr/src/sys/arch/arm/arm/cpufunc.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: cpu_exec.c,v 1.13 2020/12/01 02:43:13 rin Exp $$NetBSD: /usr/src/sys/arch/arm/arm/cpu_exec.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: cpu_in_cksum.S,v 1.13 2022/10/20 06:58:38 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm/cpu_in_cksum.S D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: cpu_subr.c,v 1.5 2021/11/14 16:56:32 riastradh Exp $$NetBSD: /usr/src/sys/arch/arm/arm/cpu_subr.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: idle_machdep.c,v 1.6 2021/02/17 06:54:23 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm/idle_machdep.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: process_machdep.c,v 1.35 2021/02/01 19:31:34 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm/process_machdep.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: sig_machdep.c,v 1.53 2024/04/14 07:56:13 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm/sig_machdep.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: sigcode.S,v 1.8 2005/12/11 12:16:41 christos Exp $$NetBSD: /usr/src/sys/arch/arm/arm/sigcode.S D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: syscall.c,v 1.69 2023/10/05 19:41:03 ad Exp $$NetBSD: /usr/src/sys/arch/arm/arm/syscall.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: trap.c,v 1.1 2022/04/02 11:16:06 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm/trap.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: undefined.c,v 1.75 2023/10/05 19:41:03 ad Exp $$NetBSD: /usr/src/sys/arch/arm/arm/undefined.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: arm32_machdep.c,v 1.147 2024/03/05 14:15:29 thorpej Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/arm32_machdep.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: bus_dma.c,v 1.149 2025/03/08 21:00:45 jmcneill Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/bus_dma.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: cpu.c,v 1.154 2024/05/09 12:41:08 pho Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/cpu.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: cpuswitch.S,v 1.107 2023/03/01 08:17:53 riastradh Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/cpuswitch.S D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: exception.S,v 1.26 2020/11/21 19:46:13 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/exception.S D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: fault.c,v 1.119 2024/02/02 22:00:32 andvar Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/fault.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: pmap.c,v 1.443 2024/04/13 12:28:01 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/pmap.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: setstack.S,v 1.6 2013/08/18 06:29:29 matt Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/setstack.S D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: stubs.c,v 1.27 2020/07/03 15:31:25 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/stubs.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: sys_machdep.c,v 1.26 2020/06/20 15:45:22 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/sys_machdep.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: vm_machdep.c,v 1.79 2024/01/15 20:35:22 andvar Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/vm_machdep.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: pmap_devmap.c,v 1.2 2023/04/27 06:23:31 skrll Exp $$NetBSD: /usr/src/sys/uvm/pmap/pmap_devmap.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: pmap_pvt.c,v 1.15 2022/05/08 22:03:02 rin Exp $$NetBSD: /usr/src/sys/uvm/pmap/pmap_pvt.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: wd.c,v 1.474 2025/04/13 14:00:59 jakllsch Exp $$NetBSD: /usr/src/sys/dev/ata/wd.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ata_wdc.c,v 1.120 2021/10/05 08:01:05 rin Exp $$NetBSD: /usr/src/sys/dev/ata/ata_wdc.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ata.c,v 1.171 2025/02/17 19:01:04 jakllsch Exp $$NetBSD: /usr/src/sys/dev/ata/ata.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ata_subr.c,v 1.13 2020/12/23 08:17:01 skrll Exp $$NetBSD: /usr/src/sys/dev/ata/ata_subr.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ata_recovery.c,v 1.4 2020/04/13 10:49:34 jdolecek Exp $$NetBSD: /usr/src/sys/dev/ata/ata_recovery.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: sdmmc.c,v 1.43 2021/08/07 16:19:16 thorpej Exp $$NetBSD: /usr/src/sys/dev/sdmmc/sdmmc.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: sdmmc_cis.c,v 1.10 2025/01/17 11:54:50 jmcneill Exp $$NetBSD: /usr/src/sys/dev/sdmmc/sdmmc_cis.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: sdmmc_io.c,v 1.21 2020/10/17 09:36:45 mlelstv Exp $$NetBSD: /usr/src/sys/dev/sdmmc/sdmmc_io.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: sdmmc_mem.c,v 1.77 2024/10/24 10:50:31 skrll Exp $$NetBSD: /usr/src/sys/dev/sdmmc/sdmmc_mem.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ld_sdmmc.c,v 1.45 2025/04/13 02:34:03 rin Exp $$NetBSD: /usr/src/sys/dev/sdmmc/ld_sdmmc.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: config_hook.c,v 1.12 2020/11/21 21:08:32 thorpej Exp $$NetBSD: /usr/src/sys/arch/hpc/hpc/config_hook.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: platid.c,v 1.11 2006/05/10 06:24:02 skrll Exp $$NetBSD: /usr/src/sys/arch/hpc/hpc/platid.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: pxa2x0.c,v 1.24 2021/08/07 16:18:46 thorpej Exp $$NetBSD: /usr/src/sys/arch/arm/xscale/pxa2x0.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: pxa2x0_space.c,v 1.14 2023/04/21 15:00:48 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/xscale/pxa2x0_space.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: pxa2x0_dma.c,v 1.7 2022/09/27 06:36:43 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/xscale/pxa2x0_dma.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: pxa2x0_intr.c,v 1.26 2023/07/13 19:42:24 riastradh Exp $$NetBSD: /usr/src/sys/arch/arm/xscale/pxa2x0_intr.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: pxa2x0_gpio.c,v 1.21 2021/08/07 16:18:46 thorpej Exp $$NetBSD: /usr/src/sys/arch/arm/xscale/pxa2x0_gpio.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: pxa2x0_com.c,v 1.14 2018/12/08 17:46:10 thorpej Exp $$NetBSD: /usr/src/sys/arch/arm/xscale/pxa2x0_com.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: pxa2x0_a4x_space.c,v 1.6 2018/03/16 17:56:32 ryo Exp $$NetBSD: /usr/src/sys/arch/arm/xscale/pxa2x0_a4x_space.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: bus_space_a4x.S,v 1.4 2013/10/28 22:50:25 matt Exp $$NetBSD: /usr/src/sys/arch/arm/arm/bus_space_a4x.S D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: sa11x0_ost.c,v 1.33 2019/11/13 17:52:12 tsutsui Exp $$NetBSD: /usr/src/sys/arch/arm/sa11x0/sa11x0_ost.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: pxa2x0_pcic.c,v 1.15 2022/09/27 06:36:43 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/xscale/pxa2x0_pcic.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: pxa2x0_i2c.c,v 1.9 2021/12/12 08:49:57 andvar Exp $$NetBSD: /usr/src/sys/arch/arm/xscale/pxa2x0_i2c.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: pxa2x0_rtc.c,v 1.8 2024/02/24 12:04:16 andvar Exp $$NetBSD: /usr/src/sys/arch/arm/xscale/pxa2x0_rtc.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: pxa2x0_mci.c,v 1.14 2023/03/28 20:01:57 andvar Exp $$NetBSD: /usr/src/sys/arch/arm/xscale/pxa2x0_mci.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: apmdev.c,v 1.34 2021/09/26 01:16:08 thorpej Exp $$NetBSD: /usr/src/sys/dev/hpc/apm/apmdev.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: pcmcia.c,v 1.96 2021/08/07 16:19:15 thorpej Exp $$NetBSD: /usr/src/sys/dev/pcmcia/pcmcia.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: pcmcia_cis.c,v 1.57 2019/11/10 21:16:36 chs Exp $$NetBSD: /usr/src/sys/dev/pcmcia/pcmcia_cis.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: pcmcia_cis_quirks.c,v 1.36 2019/11/10 21:16:36 chs Exp $$NetBSD: /usr/src/sys/dev/pcmcia/pcmcia_cis_quirks.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: if_ne_pcmcia.c,v 1.161 2019/12/27 08:01:58 msaitoh Exp $$NetBSD: /usr/src/sys/dev/pcmcia/if_ne_pcmcia.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: com_pcmcia.c,v 1.62 2018/12/08 17:46:14 thorpej Exp $$NetBSD: /usr/src/sys/dev/pcmcia/com_pcmcia.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: wdc_pcmcia.c,v 1.130 2022/09/25 21:53:54 thorpej Exp $$NetBSD: /usr/src/sys/dev/pcmcia/wdc_pcmcia.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: if_wi_pcmcia.c,v 1.93 2019/01/08 08:47:21 msaitoh Exp $$NetBSD: /usr/src/sys/dev/pcmcia/if_wi_pcmcia.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: dev_verbose.c,v 1.4 2021/06/29 21:03:36 pgoyette Exp $$NetBSD: /usr/src/sys/dev/dev_verbose.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ld.c,v 1.117 2025/04/13 14:00:59 jakllsch Exp $$NetBSD: /usr/src/sys/dev/ld.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: wi.c,v 1.258 2023/08/01 07:04:15 mrg Exp $$NetBSD: /usr/src/sys/dev/ic/wi.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: dp8390.c,v 1.101 2024/06/29 12:11:11 riastradh Exp $$NetBSD: /usr/src/sys/dev/ic/dp8390.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ne2000.c,v 1.79 2024/05/21 08:04:20 andvar Exp $$NetBSD: /usr/src/sys/dev/ic/ne2000.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: com.c,v 1.388 2025/02/12 05:15:39 imil Exp $$NetBSD: /usr/src/sys/dev/ic/com.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: rtl80x9.c,v 1.19 2023/12/31 03:19:22 isaki Exp $$NetBSD: /usr/src/sys/dev/ic/rtl80x9.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: wdc.c,v 1.310 2022/05/31 08:43:15 andvar Exp $$NetBSD: /usr/src/sys/dev/ic/wdc.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: dl10019.c,v 1.17 2021/07/01 20:39:15 thorpej Exp $$NetBSD: /usr/src/sys/dev/ic/dl10019.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ax88190.c,v 1.18 2021/07/01 20:39:15 thorpej Exp $$NetBSD: /usr/src/sys/dev/ic/ax88190.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: compat_exec.c,v 1.18 2019/01/27 02:08:39 pgoyette Exp $$NetBSD: /usr/src/sys/compat/common/compat_exec.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: compat_util.c,v 1.47 2019/01/27 02:08:39 pgoyette Exp $$NetBSD: /usr/src/sys/compat/common/compat_util.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: aes_bear.c,v 1.4 2020/07/25 22:28:27 riastradh Exp $$NetBSD: /usr/src/sys/crypto/aes/aes_bear.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: aes_ccm.c,v 1.6 2021/10/17 14:45:45 jmcneill Exp $$NetBSD: /usr/src/sys/crypto/aes/aes_ccm.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: aes_ccm_mbuf.c,v 1.1 2020/07/25 22:15:55 riastradh Exp $$NetBSD: /usr/src/sys/crypto/aes/aes_ccm_mbuf.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: aes_ct.c,v 1.3 2020/06/30 20:32:11 riastradh Exp $$NetBSD: /usr/src/sys/crypto/aes/aes_ct.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: aes_ct_dec.c,v 1.2 2020/06/29 23:36:59 riastradh Exp $$NetBSD: /usr/src/sys/crypto/aes/aes_ct_dec.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: aes_ct_enc.c,v 1.1 2020/06/29 23:27:52 riastradh Exp $$NetBSD: /usr/src/sys/crypto/aes/aes_ct_enc.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: aes_impl.c,v 1.10 2022/11/05 17:36:33 jmcneill Exp $$NetBSD: /usr/src/sys/crypto/aes/aes_impl.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: aes_selftest.c,v 1.7 2021/12/05 04:48:35 msaitoh Exp $$NetBSD: /usr/src/sys/crypto/aes/aes_selftest.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: nist_hash_drbg.c,v 1.3 2019/09/19 18:29:55 riastradh Exp $$NetBSD: /usr/src/sys/crypto/nist_hash_drbg/nist_hash_drbg.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: cprng_fast.c,v 1.20 2024/10/15 17:34:06 riastradh Exp $$NetBSD: /usr/src/sys/crypto/cprng_fast/cprng_fast.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: blake2s.c,v 1.2 2021/10/17 14:45:45 jmcneill Exp $$NetBSD: /usr/src/sys/crypto/blake2/blake2s.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: sysmon.c,v 1.32 2022/03/28 12:33:21 riastradh Exp $$NetBSD: /usr/src/sys/dev/sysmon/sysmon.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: sysmon_wdog.c,v 1.30 2021/12/31 11:05:41 riastradh Exp $$NetBSD: /usr/src/sys/dev/sysmon/sysmon_wdog.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: swwdog.c,v 1.24 2024/11/07 09:47:40 rin Exp $$NetBSD: /usr/src/sys/dev/sysmon/swwdog.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ieee80211.c,v 1.61 2021/08/21 11:55:25 andvar Exp $$NetBSD: /usr/src/sys/net80211/ieee80211.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ieee80211_amrr.c,v 1.3 2015/08/24 20:58:47 pooka Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_amrr.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ieee80211_crypto.c,v 1.23 2018/05/08 07:02:07 maxv Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_crypto.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ieee80211_crypto_ccmp.c,v 1.20 2023/06/24 05:12:03 msaitoh Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_crypto_ccmp.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ieee80211_crypto_none.c,v 1.8 2018/01/19 07:53:46 maxv Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_crypto_none.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ieee80211_crypto_tkip.c,v 1.18 2023/06/24 05:12:03 msaitoh Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_crypto_tkip.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ieee80211_crypto_wep.c,v 1.14 2023/06/24 05:12:03 msaitoh Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_crypto_wep.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ieee80211_input.c,v 1.117 2022/11/19 07:57:51 yamt Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_input.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ieee80211_ioctl.c,v 1.69 2021/09/21 15:00:34 christos Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_ioctl.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ieee80211_netbsd.c,v 1.34 2018/12/22 14:28:56 maxv Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_netbsd.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ieee80211_node.c,v 1.84 2024/07/05 04:31:53 rin Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_node.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ieee80211_output.c,v 1.68 2024/07/05 04:31:53 rin Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_output.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ieee80211_proto.c,v 1.37 2021/07/24 21:31:38 andvar Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_proto.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ieee80211_rssadapt.c,v 1.21 2016/09/27 20:20:06 christos Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_rssadapt.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ieee80211_xauth.c,v 1.5 2006/02/27 01:08:28 dyoung Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_xauth.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: at_print.c,v 1.2 2021/07/21 06:35:45 skrll Exp $$NetBSD: /usr/src/sys/netatalk/at_print.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: igmp.c,v 1.70 2020/05/15 06:34:34 maxv Exp $$NetBSD: /usr/src/sys/netinet/igmp.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: in.c,v 1.248 2024/08/20 08:22:35 ozaki-r Exp $$NetBSD: /usr/src/sys/netinet/in.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: in_offload.c,v 1.15 2024/07/05 04:31:54 rin Exp $$NetBSD: /usr/src/sys/netinet/in_offload.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: in_pcb.c,v 1.202 2022/11/04 09:05:41 ozaki-r Exp $$NetBSD: /usr/src/sys/netinet/in_pcb.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: in_print.c,v 1.1 2014/12/02 19:35:27 christos Exp $$NetBSD: /usr/src/sys/netinet/in_print.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: in_proto.c,v 1.131 2022/09/03 02:53:18 thorpej Exp $$NetBSD: /usr/src/sys/netinet/in_proto.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ip_icmp.c,v 1.179 2025/02/22 09:10:27 mlelstv Exp $$NetBSD: /usr/src/sys/netinet/ip_icmp.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ip_input.c,v 1.404 2024/07/05 04:31:54 rin Exp $$NetBSD: /usr/src/sys/netinet/ip_input.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ip_output.c,v 1.326 2023/04/19 22:00:18 mlelstv Exp $$NetBSD: /usr/src/sys/netinet/ip_output.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ip_reass.c,v 1.23 2022/05/31 08:43:16 andvar Exp $$NetBSD: /usr/src/sys/netinet/ip_reass.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: raw_ip.c,v 1.186 2024/07/05 04:31:54 rin Exp $$NetBSD: /usr/src/sys/netinet/raw_ip.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: tcp_input.c,v 1.441 2024/10/08 06:17:14 rin Exp $$NetBSD: /usr/src/sys/netinet/tcp_input.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: tcp_output.c,v 1.222 2024/09/08 09:36:52 rillig Exp $$NetBSD: /usr/src/sys/netinet/tcp_output.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: tcp_sack.c,v 1.36 2018/05/18 18:58:51 maxv Exp $$NetBSD: /usr/src/sys/netinet/tcp_sack.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: tcp_subr.c,v 1.298 2025/02/26 04:49:45 andvar Exp $$NetBSD: /usr/src/sys/netinet/tcp_subr.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: tcp_syncache.c,v 1.7 2024/06/29 12:59:08 riastradh Exp $$NetBSD: /usr/src/sys/netinet/tcp_syncache.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: tcp_timer.c,v 1.99 2022/11/04 09:00:58 ozaki-r Exp $$NetBSD: /usr/src/sys/netinet/tcp_timer.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: tcp_usrreq.c,v 1.238 2022/11/04 09:01:53 ozaki-r Exp $$NetBSD: /usr/src/sys/netinet/tcp_usrreq.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: tcp_congctl.c,v 1.29 2024/05/14 19:00:44 andvar Exp $$NetBSD: /usr/src/sys/netinet/tcp_congctl.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: tcp_vtw.c,v 1.25 2024/10/07 23:17:00 jakllsch Exp $$NetBSD: /usr/src/sys/netinet/tcp_vtw.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: udp_usrreq.c,v 1.266 2024/10/08 02:30:04 riastradh Exp $$NetBSD: /usr/src/sys/netinet/udp_usrreq.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: portalgo.c,v 1.15 2022/11/04 09:01:53 ozaki-r Exp $$NetBSD: /usr/src/sys/netinet/portalgo.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: dest6.c,v 1.22 2018/04/13 11:01:14 maxv Exp $$NetBSD: /usr/src/sys/netinet6/dest6.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: frag6.c,v 1.78 2024/04/19 05:04:06 ozaki-r Exp $$NetBSD: /usr/src/sys/netinet6/frag6.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: icmp6.c,v 1.258 2024/07/05 04:31:54 rin Exp $$NetBSD: /usr/src/sys/netinet6/icmp6.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: in6.c,v 1.292 2024/03/01 23:50:27 riastradh Exp $$NetBSD: /usr/src/sys/netinet6/in6.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: in6_cksum.c,v 1.28 2011/04/25 22:05:05 yamt Exp $$NetBSD: /usr/src/sys/netinet6/in6_cksum.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: in6_ifattach.c,v 1.122 2024/04/11 07:34:37 knakahara Exp $$NetBSD: /usr/src/sys/netinet6/in6_ifattach.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: in6_offload.c,v 1.13 2024/07/05 04:31:54 rin Exp $$NetBSD: /usr/src/sys/netinet6/in6_offload.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: in6_pcb.c,v 1.177 2022/11/04 09:04:27 ozaki-r Exp $$NetBSD: /usr/src/sys/netinet6/in6_pcb.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: in6_print.c,v 1.1 2014/12/02 19:36:58 christos Exp $$NetBSD: /usr/src/sys/netinet6/in6_print.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: in6_proto.c,v 1.131 2024/02/09 22:08:37 andvar Exp $$NetBSD: /usr/src/sys/netinet6/in6_proto.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: in6_src.c,v 1.92 2023/08/03 04:24:55 ozaki-r Exp $$NetBSD: /usr/src/sys/netinet6/in6_src.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ip6_forward.c,v 1.103 2024/06/29 13:00:44 riastradh Exp $$NetBSD: /usr/src/sys/netinet6/ip6_forward.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ip6_input.c,v 1.228 2024/06/29 13:00:44 riastradh Exp $$NetBSD: /usr/src/sys/netinet6/ip6_input.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ip6_mroute.c,v 1.133 2025/01/02 16:10:22 andvar Exp $$NetBSD: /usr/src/sys/netinet6/ip6_mroute.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ip6_output.c,v 1.235 2024/04/19 00:55:35 riastradh Exp $$NetBSD: /usr/src/sys/netinet6/ip6_output.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: mld6.c,v 1.101 2019/09/25 09:53:38 ozaki-r Exp $$NetBSD: /usr/src/sys/netinet6/mld6.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: nd6.c,v 1.283 2025/03/31 05:55:43 ozaki-r Exp $$NetBSD: /usr/src/sys/netinet6/nd6.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: nd6_nbr.c,v 1.186 2025/04/28 11:39:10 joe Exp $$NetBSD: /usr/src/sys/netinet6/nd6_nbr.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: nd6_rtr.c,v 1.149 2020/06/12 11:04:45 roy Exp $$NetBSD: /usr/src/sys/netinet6/nd6_rtr.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: raw_ip6.c,v 1.185 2024/07/05 04:31:54 rin Exp $$NetBSD: /usr/src/sys/netinet6/raw_ip6.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: route6.c,v 1.25 2018/02/01 16:23:28 maxv Exp $$NetBSD: /usr/src/sys/netinet6/route6.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: scope6.c,v 1.23 2020/06/16 17:12:18 maxv Exp $$NetBSD: /usr/src/sys/netinet6/scope6.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: udp6_usrreq.c,v 1.156 2024/10/08 02:30:05 riastradh Exp $$NetBSD: /usr/src/sys/netinet6/udp6_usrreq.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: i2c.c,v 1.92 2025/01/27 17:01:53 riastradh Exp $$NetBSD: /usr/src/sys/dev/i2c/i2c.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: i2c_exec.c,v 1.18 2022/10/24 10:17:27 riastradh Exp $$NetBSD: /usr/src/sys/dev/i2c/i2c_exec.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: i2c_subr.c,v 1.2 2022/04/01 15:49:12 pgoyette Exp $$NetBSD: /usr/src/sys/dev/i2c/i2c_subr.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: i2c_bitbang.c,v 1.14 2016/06/07 01:06:27 pgoyette Exp $$NetBSD: /usr/src/sys/dev/i2c/i2c_bitbang.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: mii.c,v 1.59 2024/02/08 20:11:55 andvar Exp $$NetBSD: /usr/src/sys/dev/mii/mii.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: mii_bitbang.c,v 1.14 2019/01/22 03:42:27 msaitoh Exp $$NetBSD: /usr/src/sys/dev/mii/mii_bitbang.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: mii_physubr.c,v 1.103 2023/05/22 02:12:13 msaitoh Exp $$NetBSD: /usr/src/sys/dev/mii/mii_physubr.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: mii_ethersubr.c,v 1.3 2020/03/15 23:04:50 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/mii_ethersubr.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ukphy_subr.c,v 1.17 2020/03/15 23:04:50 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/ukphy_subr.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: brgphy.c,v 1.91 2023/02/22 08:09:09 msaitoh Exp $$NetBSD: /usr/src/sys/dev/mii/brgphy.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: nsphy.c,v 1.66 2020/03/15 23:04:50 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/nsphy.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: nsphyter.c,v 1.46 2020/03/28 18:37:18 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/nsphyter.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: qsphy.c,v 1.55 2020/03/15 23:04:50 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/qsphy.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: inphy.c,v 1.60 2020/03/15 23:04:50 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/inphy.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: iophy.c,v 1.43 2020/03/15 23:04:50 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/iophy.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: exphy.c,v 1.58 2020/03/15 23:04:50 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/exphy.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: lxtphy.c,v 1.56 2021/08/20 20:25:28 andvar Exp $$NetBSD: /usr/src/sys/dev/mii/lxtphy.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: icsphy.c,v 1.56 2020/03/15 23:04:50 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/icsphy.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: sqphy.c,v 1.56 2020/03/15 23:04:50 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/sqphy.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: dmphy.c,v 1.47 2020/03/15 23:04:50 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/dmphy.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: pnaphy.c,v 1.26 2020/03/15 23:04:50 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/pnaphy.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ukphy.c,v 1.55 2021/06/29 21:03:36 pgoyette Exp $$NetBSD: /usr/src/sys/dev/mii/ukphy.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: dmover_backend.c,v 1.9 2011/05/14 18:24:47 jakllsch Exp $$NetBSD: /usr/src/sys/dev/dmover/dmover_backend.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: dmover_process.c,v 1.5 2011/05/14 14:49:19 jakllsch Exp $$NetBSD: /usr/src/sys/dev/dmover/dmover_process.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: dmover_request.c,v 1.8 2011/05/14 18:24:47 jakllsch Exp $$NetBSD: /usr/src/sys/dev/dmover/dmover_request.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: dmover_session.c,v 1.6 2011/05/14 18:24:47 jakllsch Exp $$NetBSD: /usr/src/sys/dev/dmover/dmover_session.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: dmover_util.c,v 1.5 2005/12/11 12:21:20 christos Exp $$NetBSD: /usr/src/sys/dev/dmover/dmover_util.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: drm_stub.c,v 1.1 2019/11/16 04:10:33 christos Exp $$NetBSD: /usr/src/sys/external/bsd/drm2/drm/drm_stub.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: wsdisplay.c,v 1.166 2023/03/01 08:42:33 riastradh Exp $$NetBSD: /usr/src/sys/dev/wscons/wsdisplay.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: wsemulconf.c,v 1.8 2010/02/02 16:18:29 drochner Exp $$NetBSD: /usr/src/sys/dev/wscons/wsemulconf.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: wsemul_dumb.c,v 1.18 2018/09/03 16:29:34 riastradh Exp $$NetBSD: /usr/src/sys/dev/wscons/wsemul_dumb.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: wsemul_vt100.c,v 1.52 2023/08/02 22:37:02 uwe Exp $$NetBSD: /usr/src/sys/dev/wscons/wsemul_vt100.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: wsemul_vt100_subr.c,v 1.34 2023/08/03 22:11:41 uwe Exp $$NetBSD: /usr/src/sys/dev/wscons/wsemul_vt100_subr.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: wsemul_vt100_chars.c,v 1.15 2017/11/03 19:20:27 maya Exp $$NetBSD: /usr/src/sys/dev/wscons/wsemul_vt100_chars.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: wsemul_vt100_keys.c,v 1.11 2010/02/10 19:39:39 drochner Exp $$NetBSD: /usr/src/sys/dev/wscons/wsemul_vt100_keys.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: wsevent.c,v 1.47 2021/09/26 01:16:10 thorpej Exp $$NetBSD: /usr/src/sys/dev/wscons/wsevent.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: wskbd.c,v 1.146 2025/04/07 11:25:42 hans Exp $$NetBSD: /usr/src/sys/dev/wscons/wskbd.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: wskbdutil.c,v 1.19 2017/11/03 19:20:27 maya Exp $$NetBSD: /usr/src/sys/dev/wscons/wskbdutil.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: wsmux.c,v 1.68 2025/04/07 11:18:44 hans Exp $$NetBSD: /usr/src/sys/dev/wscons/wsmux.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: wsbellmux.c,v 1.1 2017/06/11 03:55:56 nat Exp $$NetBSD: /usr/src/sys/dev/wscons/wsbellmux.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: rasops.c,v 1.128 2022/05/15 16:43:39 uwe Exp $$NetBSD: /usr/src/sys/dev/rasops/rasops.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: rasops_masks.c,v 1.10 2019/08/10 01:24:17 rin Exp $$NetBSD: /usr/src/sys/dev/rasops/rasops_masks.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: rasops4.c,v 1.28 2019/08/14 00:51:10 rin Exp $$NetBSD: /usr/src/sys/dev/rasops/rasops4.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: rasops8.c,v 1.51 2019/08/14 00:51:10 rin Exp $$NetBSD: /usr/src/sys/dev/rasops/rasops8.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: rasops15.c,v 1.39 2019/08/14 00:51:10 rin Exp $$NetBSD: /usr/src/sys/dev/rasops/rasops15.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: wsfont.c,v 1.83 2025/03/25 10:50:12 macallan Exp $$NetBSD: /usr/src/sys/dev/wsfont/wsfont.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: cd9660_bmap.c,v 1.5 2014/06/14 07:39:28 hannken Exp $$NetBSD: /usr/src/sys/fs/cd9660/cd9660_bmap.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: cd9660_lookup.c,v 1.33 2024/09/08 09:36:51 rillig Exp $$NetBSD: /usr/src/sys/fs/cd9660/cd9660_lookup.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: cd9660_node.c,v 1.38 2017/05/26 14:34:19 riastradh Exp $$NetBSD: /usr/src/sys/fs/cd9660/cd9660_node.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: cd9660_rrip.c,v 1.18 2015/03/28 19:24:05 maxv Exp $$NetBSD: /usr/src/sys/fs/cd9660/cd9660_rrip.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: cd9660_util.c,v 1.16 2024/05/25 06:27:57 tsutsui Exp $$NetBSD: /usr/src/sys/fs/cd9660/cd9660_util.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: cd9660_vfsops.c,v 1.105 2025/02/16 18:38:58 joe Exp $$NetBSD: /usr/src/sys/fs/cd9660/cd9660_vfsops.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: cd9660_vnops.c,v 1.63 2024/02/02 20:27:26 christos Exp $$NetBSD: /usr/src/sys/fs/cd9660/cd9660_vnops.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: msdosfs_conv.c,v 1.20 2023/06/02 08:51:47 andvar Exp $$NetBSD: /usr/src/sys/fs/msdosfs/msdosfs_conv.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: msdosfs_denode.c,v 1.60 2021/10/23 16:58:17 thorpej Exp $$NetBSD: /usr/src/sys/fs/msdosfs/msdosfs_denode.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: msdosfs_fat.c,v 1.37 2024/05/13 00:24:19 msaitoh Exp $$NetBSD: /usr/src/sys/fs/msdosfs/msdosfs_fat.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: msdosfs_lookup.c,v 1.41 2022/08/06 18:26:42 andvar Exp $$NetBSD: /usr/src/sys/fs/msdosfs/msdosfs_lookup.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: msdosfs_rename.c,v 1.4 2024/05/04 05:49:39 mlelstv Exp $$NetBSD: /usr/src/sys/fs/msdosfs/msdosfs_rename.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: msdosfs_vfsops.c,v 1.138 2022/04/16 07:58:21 hannken Exp $$NetBSD: /usr/src/sys/fs/msdosfs/msdosfs_vfsops.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: msdosfs_vnops.c,v 1.113 2024/09/11 00:27:54 perseant Exp $$NetBSD: /usr/src/sys/fs/msdosfs/msdosfs_vnops.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: krpc_subr.c,v 1.44 2024/10/20 14:01:52 mlelstv Exp $$NetBSD: /usr/src/sys/nfs/krpc_subr.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: nfs_bio.c,v 1.202 2024/02/13 21:40:02 andvar Exp $$NetBSD: /usr/src/sys/nfs/nfs_bio.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: nfs_boot.c,v 1.90 2024/07/05 04:31:54 rin Exp $$NetBSD: /usr/src/sys/nfs/nfs_boot.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: nfs_clntsocket.c,v 1.7 2024/07/05 04:31:54 rin Exp $$NetBSD: /usr/src/sys/nfs/nfs_clntsocket.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: nfs_clntsubs.c,v 1.7 2023/03/21 15:47:46 christos Exp $$NetBSD: /usr/src/sys/nfs/nfs_clntsubs.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: nfs_iod.c,v 1.9 2023/03/21 15:47:46 christos Exp $$NetBSD: /usr/src/sys/nfs/nfs_iod.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: nfs_kq.c,v 1.32 2021/10/20 03:08:18 thorpej Exp $$NetBSD: /usr/src/sys/nfs/nfs_kq.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: nfs_node.c,v 1.126 2020/05/01 08:43:00 hannken Exp $$NetBSD: /usr/src/sys/nfs/nfs_node.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: nfs_socket.c,v 1.203 2025/02/22 09:27:05 mlelstv Exp $$NetBSD: /usr/src/sys/nfs/nfs_socket.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: nfs_subs.c,v 1.242 2022/02/09 21:50:24 andvar Exp $$NetBSD: /usr/src/sys/nfs/nfs_subs.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: nfs_vfsops.c,v 1.246 2024/05/13 00:11:22 msaitoh Exp $$NetBSD: /usr/src/sys/nfs/nfs_vfsops.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: nfs_vnops.c,v 1.325 2023/12/10 18:16:08 schmonz Exp $$NetBSD: /usr/src/sys/nfs/nfs_vnops.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ffs_alloc.c,v 1.173 2024/05/13 00:24:19 msaitoh Exp $$NetBSD: /usr/src/sys/ufs/ffs/ffs_alloc.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ffs_balloc.c,v 1.66 2022/11/17 06:40:40 chs Exp $$NetBSD: /usr/src/sys/ufs/ffs/ffs_balloc.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ffs_extattr.c,v 1.10 2022/11/28 04:52:04 chs Exp $$NetBSD: /usr/src/sys/ufs/ffs/ffs_extattr.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ffs_inode.c,v 1.131 2020/07/31 04:07:30 chs Exp $$NetBSD: /usr/src/sys/ufs/ffs/ffs_inode.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ffs_snapshot.c,v 1.155 2023/05/11 23:11:25 chs Exp $$NetBSD: /usr/src/sys/ufs/ffs/ffs_snapshot.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ffs_subr.c,v 1.54 2023/01/07 19:41:30 chs Exp $$NetBSD: /usr/src/sys/ufs/ffs/ffs_subr.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ffs_tables.c,v 1.9 2005/12/11 12:25:25 christos Exp $$NetBSD: /usr/src/sys/ufs/ffs/ffs_tables.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ffs_vfsops.c,v 1.384 2024/12/30 09:03:07 hannken Exp $$NetBSD: /usr/src/sys/ufs/ffs/ffs_vfsops.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ffs_vnops.c,v 1.138 2021/12/14 11:06:12 chs Exp $$NetBSD: /usr/src/sys/ufs/ffs/ffs_vnops.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ufs_readwrite.c,v 1.129 2024/10/19 14:13:44 jakllsch Exp $$NetBSD: /usr/src/sys/ufs/ufs/ufs_readwrite.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: mfs_vfsops.c,v 1.117 2025/02/16 18:38:59 joe Exp $$NetBSD: /usr/src/sys/ufs/mfs/mfs_vfsops.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: mfs_vnops.c,v 1.64 2022/03/19 13:48:42 hannken Exp $$NetBSD: /usr/src/sys/ufs/mfs/mfs_vnops.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: mfs_miniroot.c,v 1.1 2010/03/02 17:20:02 pooka Exp $$NetBSD: /usr/src/sys/ufs/mfs/mfs_miniroot.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ufs_acl.c,v 1.5 2023/02/22 21:49:45 riastradh Exp $$NetBSD: /usr/src/sys/ufs/ufs/ufs_acl.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ufs_bmap.c,v 1.54 2022/11/17 06:40:40 chs Exp $$NetBSD: /usr/src/sys/ufs/ufs/ufs_bmap.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ufs_inode.c,v 1.112 2020/09/05 16:30:13 riastradh Exp $$NetBSD: /usr/src/sys/ufs/ufs/ufs_inode.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ufs_lookup.c,v 1.159 2024/09/08 09:36:52 rillig Exp $$NetBSD: /usr/src/sys/ufs/ufs/ufs_lookup.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ufs_rename.c,v 1.14 2021/10/20 03:08:19 thorpej Exp $$NetBSD: /usr/src/sys/ufs/ufs/ufs_rename.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ufs_vfsops.c,v 1.61 2023/02/22 21:49:45 riastradh Exp $$NetBSD: /usr/src/sys/ufs/ufs/ufs_vfsops.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ufs_vnops.c,v 1.262 2022/03/27 16:24:59 christos Exp $$NetBSD: /usr/src/sys/ufs/ufs/ufs_vnops.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uvm_amap.c,v 1.129 2023/09/10 14:54:34 ad Exp $$NetBSD: /usr/src/sys/uvm/uvm_amap.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uvm_anon.c,v 1.80 2020/10/25 00:05:26 chs Exp $$NetBSD: /usr/src/sys/uvm/uvm_anon.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uvm_aobj.c,v 1.157 2023/02/24 11:03:13 riastradh Exp $$NetBSD: /usr/src/sys/uvm/uvm_aobj.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uvm_bio.c,v 1.128 2023/04/09 09:00:56 riastradh Exp $$NetBSD: /usr/src/sys/uvm/uvm_bio.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uvm_coredump.c,v 1.8 2020/02/23 15:46:43 ad Exp $$NetBSD: /usr/src/sys/uvm/uvm_coredump.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uvm_device.c,v 1.80 2022/07/07 13:27:02 riastradh Exp $$NetBSD: /usr/src/sys/uvm/uvm_device.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uvm_fault.c,v 1.237 2024/03/15 07:09:37 andvar Exp $$NetBSD: /usr/src/sys/uvm/uvm_fault.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uvm_glue.c,v 1.182 2023/10/04 20:34:19 ad Exp $$NetBSD: /usr/src/sys/uvm/uvm_glue.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uvm_init.c,v 1.59 2023/09/23 18:21:12 ad Exp $$NetBSD: /usr/src/sys/uvm/uvm_init.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uvm_io.c,v 1.30 2024/05/03 07:09:20 skrll Exp $$NetBSD: /usr/src/sys/uvm/uvm_io.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uvm_km.c,v 1.166 2024/12/07 23:19:07 chs Exp $$NetBSD: /usr/src/sys/uvm/uvm_km.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uvm_loan.c,v 1.104 2020/06/11 22:21:05 ad Exp $$NetBSD: /usr/src/sys/uvm/uvm_loan.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uvm_map.c,v 1.427 2025/04/27 17:40:55 riastradh Exp $$NetBSD: /usr/src/sys/uvm/uvm_map.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uvm_meter.c,v 1.80 2020/06/14 21:41:42 ad Exp $$NetBSD: /usr/src/sys/uvm/uvm_meter.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uvm_mmap.c,v 1.186 2025/02/24 21:32:26 andvar Exp $$NetBSD: /usr/src/sys/uvm/uvm_mmap.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uvm_mremap.c,v 1.22 2025/02/24 21:32:26 andvar Exp $$NetBSD: /usr/src/sys/uvm/uvm_mremap.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uvm_object.c,v 1.25 2020/08/15 07:24:09 chs Exp $$NetBSD: /usr/src/sys/uvm/uvm_object.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uvm_page.c,v 1.256 2024/03/05 14:33:50 thorpej Exp $$NetBSD: /usr/src/sys/uvm/uvm_page.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uvm_page_array.c,v 1.9 2020/05/26 21:52:12 ad Exp $$NetBSD: /usr/src/sys/uvm/uvm_page_array.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uvm_page_status.c,v 1.6 2020/08/14 09:06:15 chs Exp $$NetBSD: /usr/src/sys/uvm/uvm_page_status.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uvm_pager.c,v 1.131 2024/03/15 07:09:37 andvar Exp $$NetBSD: /usr/src/sys/uvm/uvm_pager.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uvm_pdaemon.c,v 1.134 2023/09/10 15:01:11 ad Exp $$NetBSD: /usr/src/sys/uvm/uvm_pdaemon.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uvm_pdpolicy_clock.c,v 1.40 2022/04/12 20:27:56 andvar Exp $$NetBSD: /usr/src/sys/uvm/uvm_pdpolicy_clock.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uvm_pgflcache.c,v 1.6 2020/10/18 18:31:31 chs Exp $$NetBSD: /usr/src/sys/uvm/uvm_pgflcache.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uvm_pglist.c,v 1.92 2024/01/14 10:38:47 tnn Exp $$NetBSD: /usr/src/sys/uvm/uvm_pglist.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uvm_readahead.c,v 1.16 2023/09/23 18:21:12 ad Exp $$NetBSD: /usr/src/sys/uvm/uvm_readahead.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uvm_stat.c,v 1.46 2020/06/14 21:41:42 ad Exp $$NetBSD: /usr/src/sys/uvm/uvm_stat.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uvm_swap.c,v 1.209 2025/02/22 09:36:29 mlelstv Exp $$NetBSD: /usr/src/sys/uvm/uvm_swap.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uvm_unix.c,v 1.51 2022/01/10 18:04:20 christos Exp $$NetBSD: /usr/src/sys/uvm/uvm_unix.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uvm_user.c,v 1.14 2011/02/02 15:13:34 chuck Exp $$NetBSD: /usr/src/sys/uvm/uvm_user.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uvm_vnode.c,v 1.121 2024/04/05 13:05:41 riastradh Exp $$NetBSD: /usr/src/sys/uvm/uvm_vnode.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: debugsyms.c,v 1.4 2015/10/06 22:13:39 christos Exp $$NetBSD: /usr/src/sys/conf/debugsyms.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: param.c,v 1.70 2022/07/23 19:15:29 mrg Exp $$NetBSD: /usr/src/sys/conf/param.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: bufq_disksort.c,v 1.14 2017/05/04 11:03:27 kamil Exp $$NetBSD: /usr/src/sys/kern/bufq_disksort.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: bufq_fcfs.c,v 1.13 2017/05/04 11:03:27 kamil Exp $$NetBSD: /usr/src/sys/kern/bufq_fcfs.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: core_elf32.c,v 1.67 2021/01/02 02:13:42 rin Exp $$NetBSD: /usr/src/sys/kern/core_elf32.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: core_netbsd.c,v 1.24 2019/11/20 19:37:53 pgoyette Exp $$NetBSD: /usr/src/sys/kern/core_netbsd.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: cnmagic.c,v 1.14 2017/05/04 11:01:16 kamil Exp $$NetBSD: /usr/src/sys/kern/cnmagic.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: exec_elf32.c,v 1.144 2024/12/06 16:19:41 riastradh Exp $$NetBSD: /usr/src/sys/kern/exec_elf32.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: exec_elf.c,v 1.107 2024/12/06 16:19:41 riastradh Exp $$NetBSD: /usr/src/sys/kern/exec_elf.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: exec_script.c,v 1.85 2024/12/06 16:19:41 riastradh Exp $$NetBSD: /usr/src/sys/kern/exec_script.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: exec_subr.c,v 1.91 2024/12/06 16:48:13 riastradh Exp $$NetBSD: /usr/src/sys/kern/exec_subr.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: init_main.c,v 1.550 2024/12/29 07:28:38 jmmv Exp $$NetBSD: /usr/src/sys/kern/init_main.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: init_sysctl.c,v 1.228 2023/09/09 16:01:09 christos Exp $$NetBSD: /usr/src/sys/kern/init_sysctl.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: init_sysctl_base.c,v 1.9 2023/12/20 20:35:37 andvar Exp $$NetBSD: /usr/src/sys/kern/init_sysctl_base.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: init_sysent.c,v 1.346 2024/10/09 16:29:10 christos Exp $$NetBSD: /usr/src/sys/kern/init_sysent.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_acct.c,v 1.99 2021/12/05 04:35:38 msaitoh Exp $$NetBSD: /usr/src/sys/kern/kern_acct.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_auth.c,v 1.84 2023/10/04 22:17:09 ad Exp $$NetBSD: /usr/src/sys/kern/kern_auth.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_cfglock.c,v 1.1 2010/08/21 13:17:31 pgoyette Exp $$NetBSD: /usr/src/sys/kern/kern_cfglock.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_clock.c,v 1.151 2023/09/02 17:44:59 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_clock.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_condvar.c,v 1.63 2023/11/02 10:31:55 martin Exp $$NetBSD: /usr/src/sys/kern/kern_condvar.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_core.c,v 1.39 2023/10/04 22:17:09 ad Exp $$NetBSD: /usr/src/sys/kern/kern_core.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_cpu.c,v 1.98 2025/01/17 04:11:33 mrg Exp $$NetBSD: /usr/src/sys/kern/kern_cpu.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_descrip.c,v 1.265 2024/12/21 19:02:31 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_descrip.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_entropy.c,v 1.73 2025/03/11 14:30:28 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_entropy.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_event.c,v 1.150 2023/09/21 09:31:50 msaitoh Exp $$NetBSD: /usr/src/sys/kern/kern_event.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_exec.c,v 1.528 2025/04/27 17:40:55 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_exec.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_exit.c,v 1.300 2025/03/16 15:52:18 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_exit.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_fork.c,v 1.231 2024/05/14 19:00:44 andvar Exp $$NetBSD: /usr/src/sys/kern/kern_fork.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_idle.c,v 1.36 2024/03/01 04:32:38 mrg Exp $$NetBSD: /usr/src/sys/kern/kern_idle.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_hook.c,v 1.15 2024/01/17 10:18:41 hannken Exp $$NetBSD: /usr/src/sys/kern/kern_hook.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_kthread.c,v 1.49 2023/09/23 14:40:42 ad Exp $$NetBSD: /usr/src/sys/kern/kern_kthread.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_lock.c,v 1.188 2024/01/14 11:46:05 andvar Exp $$NetBSD: /usr/src/sys/kern/kern_lock.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_lwp.c,v 1.270 2025/04/11 16:04:43 andvar Exp $$NetBSD: /usr/src/sys/kern/kern_lwp.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_malloc.c,v 1.158 2019/11/14 16:23:52 maxv Exp $$NetBSD: /usr/src/sys/kern/kern_malloc.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_module.c,v 1.172 2025/04/02 22:49:24 pgoyette Exp $$NetBSD: /usr/src/sys/kern/kern_module.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_module_hook.c,v 1.4 2019/12/13 08:02:53 skrll Exp $$NetBSD: /usr/src/sys/kern/kern_module_hook.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_module_vfs.c,v 1.19 2025/03/20 13:26:54 pgoyette Exp $$NetBSD: /usr/src/sys/kern/kern_module_vfs.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_mutex.c,v 1.112 2023/10/15 10:28:23 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_mutex.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_mutex_obj.c,v 1.15 2023/10/02 21:03:55 ad Exp $$NetBSD: /usr/src/sys/kern/kern_mutex_obj.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_ntptime.c,v 1.64 2022/10/26 23:23:52 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_ntptime.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_physio.c,v 1.102 2022/07/10 23:11:55 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_physio.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_pmf.c,v 1.51 2022/08/24 11:41:39 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_pmf.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_proc.c,v 1.279 2025/03/17 19:02:49 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_proc.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_prot.c,v 1.122 2020/05/23 23:42:43 ad Exp $$NetBSD: /usr/src/sys/kern/kern_prot.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_ras.c,v 1.42 2022/08/08 22:31:45 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_ras.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_rate.c,v 1.2 2012/12/12 11:10:56 pooka Exp $$NetBSD: /usr/src/sys/kern/kern_rate.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_reboot.c,v 1.5 2024/03/05 14:15:36 thorpej Exp $$NetBSD: /usr/src/sys/kern/kern_reboot.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_resource.c,v 1.195 2023/10/04 20:28:06 ad Exp $$NetBSD: /usr/src/sys/kern/kern_resource.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_runq.c,v 1.71 2025/01/17 04:11:33 mrg Exp $$NetBSD: /usr/src/sys/kern/kern_runq.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_rwlock.c,v 1.76 2023/10/15 10:28:48 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_rwlock.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_rwlock_obj.c,v 1.13 2023/10/02 21:03:55 ad Exp $$NetBSD: /usr/src/sys/kern/kern_rwlock_obj.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_scdebug.c,v 1.2 2019/03/14 19:51:49 palle Exp $$NetBSD: /usr/src/sys/kern/kern_scdebug.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: sys_syscall.c,v 1.15 2022/06/29 16:33:09 hannken Exp $$NetBSD: /usr/src/sys/kern/sys_syscall.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_sig.c,v 1.410 2025/03/13 12:48:21 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_sig.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_sleepq.c,v 1.87 2023/11/02 10:31:55 martin Exp $$NetBSD: /usr/src/sys/kern/kern_sleepq.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_softint.c,v 1.76 2024/03/01 04:32:38 mrg Exp $$NetBSD: /usr/src/sys/kern/kern_softint.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_ssp.c,v 1.7 2016/12/06 02:55:42 christos Exp $$NetBSD: /usr/src/sys/kern/kern_ssp.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_stub.c,v 1.50 2020/08/01 02:04:55 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_stub.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_subr.c,v 1.231 2023/01/19 07:40:58 mlelstv Exp $$NetBSD: /usr/src/sys/kern/kern_subr.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_synch.c,v 1.366 2023/11/22 13:18:48 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_synch.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_syscall.c,v 1.21 2020/08/31 19:51:30 christos Exp $$NetBSD: /usr/src/sys/kern/kern_syscall.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_sysctl.c,v 1.271 2024/09/08 09:36:51 rillig Exp $$NetBSD: /usr/src/sys/kern/kern_sysctl.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_tc.c,v 1.77 2024/05/11 06:34:45 andvar Exp $$NetBSD: /usr/src/sys/kern/kern_tc.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_threadpool.c,v 1.23 2021/01/23 16:33:49 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_threadpool.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_time.c,v 1.228 2025/03/19 14:27:05 pho Exp $$NetBSD: /usr/src/sys/kern/kern_time.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_timeout.c,v 1.79 2023/10/08 13:23:05 ad Exp $$NetBSD: /usr/src/sys/kern/kern_timeout.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_turnstile.c,v 1.55 2023/10/15 10:30:20 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_turnstile.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_todr.c,v 1.47 2021/04/03 12:06:53 simonb Exp $$NetBSD: /usr/src/sys/kern/kern_todr.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_uidinfo.c,v 1.13 2021/12/28 13:28:24 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_uidinfo.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: kern_uuid.c,v 1.20 2014/10/05 10:00:03 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_uuid.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: sched_4bsd.c,v 1.47 2025/01/17 04:11:33 mrg Exp $$NetBSD: /usr/src/sys/kern/sched_4bsd.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_acl_posix1e.c,v 1.1 2020/05/16 18:31:50 christos Exp $$NetBSD: /usr/src/sys/kern/subr_acl_posix1e.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_acl_nfs4.c,v 1.2 2024/01/19 19:07:38 christos Exp $$NetBSD: /usr/src/sys/kern/subr_acl_nfs4.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_autoconf.c,v 1.314 2023/07/18 11:57:37 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_autoconf.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_blist.c,v 1.16 2024/09/08 17:28:36 rillig Exp $$NetBSD: /usr/src/sys/kern/subr_blist.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_bufq.c,v 1.27 2019/02/17 23:17:41 bad Exp $$NetBSD: /usr/src/sys/kern/subr_bufq.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_callback.c,v 1.7 2009/11/24 20:11:50 rmind Exp $$NetBSD: /usr/src/sys/kern/subr_callback.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_cprng.c,v 1.44 2023/08/05 11:21:24 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_cprng.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_cpu.c,v 1.22 2024/03/05 20:59:41 thorpej Exp $$NetBSD: /usr/src/sys/kern/subr_cpu.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_cpufreq.c,v 1.10 2023/04/09 09:18:09 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_cpufreq.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_copy.c,v 1.19 2023/05/22 14:07:24 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_copy.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_device.c,v 1.14 2024/08/27 13:44:55 thorpej Exp $$NetBSD: /usr/src/sys/kern/subr_device.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_devsw.c,v 1.53 2024/10/13 22:25:38 chs Exp $$NetBSD: /usr/src/sys/kern/subr_devsw.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_disk.c,v 1.138 2025/04/13 14:00:59 jakllsch Exp $$NetBSD: /usr/src/sys/kern/subr_disk.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_disklabel.c,v 1.3 2019/04/07 02:58:02 rin Exp $$NetBSD: /usr/src/sys/kern/subr_disklabel.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_disk_open.c,v 1.15 2020/02/29 14:44:44 mlelstv Exp $$NetBSD: /usr/src/sys/kern/subr_disk_open.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_emul.c,v 1.2 2019/01/27 02:08:43 pgoyette Exp $$NetBSD: /usr/src/sys/kern/subr_emul.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_evcnt.c,v 1.17 2021/04/17 00:05:31 mrg Exp $$NetBSD: /usr/src/sys/kern/subr_evcnt.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_exec_fd.c,v 1.12 2021/06/29 22:40:53 dholland Exp $$NetBSD: /usr/src/sys/kern/subr_exec_fd.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_extent.c,v 1.89 2019/08/15 09:04:22 skrll Exp $$NetBSD: /usr/src/sys/kern/subr_extent.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_hash.c,v 1.12 2021/06/13 14:58:49 simonb Exp $$NetBSD: /usr/src/sys/kern/subr_hash.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_humanize.c,v 1.2 2019/03/12 00:25:44 kre Exp $$NetBSD: /usr/src/sys/kern/subr_humanize.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_interrupt.c,v 1.5 2021/12/10 20:36:04 andvar Exp $$NetBSD: /usr/src/sys/kern/subr_interrupt.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_iostat.c,v 1.26 2024/05/04 13:33:18 mlelstv Exp $$NetBSD: /usr/src/sys/kern/subr_iostat.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_ipi.c,v 1.11 2023/02/24 11:02:27 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_ipi.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_kcpuset.c,v 1.20 2023/09/23 18:21:11 ad Exp $$NetBSD: /usr/src/sys/kern/subr_kcpuset.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_kmem.c,v 1.89 2023/09/10 14:29:13 ad Exp $$NetBSD: /usr/src/sys/kern/subr_kmem.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_kobj.c,v 1.78 2023/04/28 07:33:57 skrll Exp $$NetBSD: /usr/src/sys/kern/subr_kobj.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_localcount.c,v 1.8 2024/08/16 21:54:17 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_localcount.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_lockdebug.c,v 1.83 2022/09/02 06:01:38 nakayama Exp $$NetBSD: /usr/src/sys/kern/subr_lockdebug.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_log.c,v 1.66 2025/04/09 05:38:01 rin Exp $$NetBSD: /usr/src/sys/kern/subr_log.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_lwp_specificdata.c,v 1.5 2024/09/01 19:56:18 andvar Exp $$NetBSD: /usr/src/sys/kern/subr_lwp_specificdata.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_once.c,v 1.7 2019/03/19 08:16:51 ryo Exp $$NetBSD: /usr/src/sys/kern/subr_once.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_optstr.c,v 1.8 2023/04/20 09:04:45 skrll Exp $$NetBSD: /usr/src/sys/kern/subr_optstr.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_pcq.c,v 1.20 2023/02/24 11:02:27 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_pcq.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_pcu.c,v 1.28 2023/04/09 09:18:09 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_pcu.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_percpu.c,v 1.25 2020/05/11 21:37:31 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_percpu.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_pool.c,v 1.292 2024/12/07 23:23:25 chs Exp $$NetBSD: /usr/src/sys/kern/subr_pool.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_prf.c,v 1.203 2023/08/29 21:23:14 andvar Exp $$NetBSD: /usr/src/sys/kern/subr_prf.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_prof.c,v 1.50 2021/08/14 17:51:20 ryo Exp $$NetBSD: /usr/src/sys/kern/subr_prof.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_pserialize.c,v 1.24 2023/10/04 20:28:06 ad Exp $$NetBSD: /usr/src/sys/kern/subr_pserialize.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_psref.c,v 1.18 2022/02/12 16:31:06 macallan Exp $$NetBSD: /usr/src/sys/kern/subr_psref.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_specificdata.c,v 1.14 2017/06/01 02:45:13 chs Exp $$NetBSD: /usr/src/sys/kern/subr_specificdata.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_time.c,v 1.41 2024/12/22 23:24:20 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_time.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_time_arith.c,v 1.3 2025/04/01 23:14:23 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_time_arith.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_thmap.c,v 1.15 2023/10/17 11:57:20 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_thmap.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_vmem.c,v 1.118 2024/12/06 19:17:59 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_vmem.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_workqueue.c,v 1.48 2024/03/01 04:32:38 mrg Exp $$NetBSD: /usr/src/sys/kern/subr_workqueue.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: subr_xcall.c,v 1.39 2025/04/01 03:16:41 ozaki-r Exp $$NetBSD: /usr/src/sys/kern/subr_xcall.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: sys_aio.c,v 1.50 2024/12/07 02:38:51 riastradh Exp $$NetBSD: /usr/src/sys/kern/sys_aio.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: sys_descrip.c,v 1.51 2024/05/20 09:37:34 martin Exp $$NetBSD: /usr/src/sys/kern/sys_descrip.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: sys_epoll.c,v 1.4 2023/07/30 18:31:13 christos Exp $$NetBSD: /usr/src/sys/kern/sys_epoll.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: sys_eventfd.c,v 1.11 2023/11/19 17:16:00 riastradh Exp $$NetBSD: /usr/src/sys/kern/sys_eventfd.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: sys_futex.c,v 1.26 2025/03/05 14:01:55 riastradh Exp $$NetBSD: /usr/src/sys/kern/sys_futex.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: sys_generic.c,v 1.134 2022/07/10 23:12:12 riastradh Exp $$NetBSD: /usr/src/sys/kern/sys_generic.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: sys_getrandom.c,v 1.2 2021/12/28 13:22:43 riastradh Exp $$NetBSD: /usr/src/sys/kern/sys_getrandom.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: sys_memfd.c,v 1.11 2023/08/12 23:22:49 christos Exp $$NetBSD: /usr/src/sys/kern/sys_memfd.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: sys_module.c,v 1.30 2022/05/24 06:20:05 andvar Exp $$NetBSD: /usr/src/sys/kern/sys_module.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: sys_mqueue.c,v 1.49 2024/07/01 01:35:53 christos Exp $$NetBSD: /usr/src/sys/kern/sys_mqueue.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: sys_lwp.c,v 1.89 2023/10/15 10:29:24 riastradh Exp $$NetBSD: /usr/src/sys/kern/sys_lwp.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: sys_process.c,v 1.180 2020/05/26 00:50:53 kamil Exp $$NetBSD: /usr/src/sys/kern/sys_process.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: sys_process_lwpstatus.c,v 1.5 2025/01/11 19:42:04 christos Exp $$NetBSD: /usr/src/sys/kern/sys_process_lwpstatus.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: sys_pset.c,v 1.24 2020/05/23 23:42:43 ad Exp $$NetBSD: /usr/src/sys/kern/sys_pset.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: sys_select.c,v 1.68 2024/11/26 23:10:15 khorben Exp $$NetBSD: /usr/src/sys/kern/sys_select.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: sys_sig.c,v 1.58 2024/07/14 05:10:40 kre Exp $$NetBSD: /usr/src/sys/kern/sys_sig.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: sys_sched.c,v 1.50 2023/04/09 09:18:09 riastradh Exp $$NetBSD: /usr/src/sys/kern/sys_sched.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: sys_socket.c,v 1.84 2024/12/06 18:44:00 riastradh Exp $$NetBSD: /usr/src/sys/kern/sys_socket.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: sys_timerfd.c,v 1.11 2024/12/19 23:50:22 riastradh Exp $$NetBSD: /usr/src/sys/kern/sys_timerfd.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: tty.c,v 1.313 2024/07/14 05:10:40 kre Exp $$NetBSD: /usr/src/sys/kern/tty.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: tty_conf.c,v 1.57 2021/08/09 20:49:10 andvar Exp $$NetBSD: /usr/src/sys/kern/tty_conf.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: tty_bsdpty.c,v 1.20 2014/04/04 18:11:58 christos Exp $$NetBSD: /usr/src/sys/kern/tty_bsdpty.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: tty_pty.c,v 1.149 2021/10/11 01:07:36 thorpej Exp $$NetBSD: /usr/src/sys/kern/tty_pty.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: tty_ptm.c,v 1.46 2023/04/09 09:18:09 riastradh Exp $$NetBSD: /usr/src/sys/kern/tty_ptm.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: tty_subr.c,v 1.43 2019/12/27 09:41:51 msaitoh Exp $$NetBSD: /usr/src/sys/kern/tty_subr.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: tty_tty.c,v 1.41 2020/05/23 23:42:43 ad Exp $$NetBSD: /usr/src/sys/kern/tty_tty.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uipc_accf.c,v 1.16 2024/12/06 18:44:00 riastradh Exp $$NetBSD: /usr/src/sys/kern/uipc_accf.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uipc_domain.c,v 1.112 2024/12/07 02:31:14 riastradh Exp $$NetBSD: /usr/src/sys/kern/uipc_domain.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uipc_mbuf.c,v 1.255 2024/12/15 11:07:10 skrll Exp $$NetBSD: /usr/src/sys/kern/uipc_mbuf.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: link_proto.c,v 1.40 2021/12/31 14:25:24 riastradh Exp $$NetBSD: /usr/src/sys/net/link_proto.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uipc_proto.c,v 1.24 2024/12/06 18:36:31 riastradh Exp $$NetBSD: /usr/src/sys/kern/uipc_proto.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uipc_sem.c,v 1.62 2024/12/06 18:44:00 riastradh Exp $$NetBSD: /usr/src/sys/kern/uipc_sem.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uipc_socket.c,v 1.313 2024/12/06 18:44:00 riastradh Exp $$NetBSD: /usr/src/sys/kern/uipc_socket.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uipc_socket2.c,v 1.147 2024/12/07 02:31:14 riastradh Exp $$NetBSD: /usr/src/sys/kern/uipc_socket2.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uipc_syscalls.c,v 1.214 2024/12/06 18:44:00 riastradh Exp $$NetBSD: /usr/src/sys/kern/uipc_syscalls.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: uipc_usrreq.c,v 1.208 2025/03/27 11:00:50 riastradh Exp $$NetBSD: /usr/src/sys/kern/uipc_usrreq.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: vfs_acl.c,v 1.3 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_acl.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: vfs_bio.c,v 1.306 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_bio.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: vfs_cache.c,v 1.159 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_cache.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: vfs_cwd.c,v 1.12 2024/12/07 02:11:42 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_cwd.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: vfs_dirhash.c,v 1.16 2024/12/07 02:11:42 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_dirhash.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: vfs_getcwd.c,v 1.63 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_getcwd.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: vfs_hooks.c,v 1.9 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_hooks.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: vfs_init.c,v 1.67 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_init.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: vfs_lockf.c,v 1.83 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_lockf.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: vfs_lookup.c,v 1.238 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_lookup.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: vfs_mount.c,v 1.110 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_mount.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: vfs_quotactl.c,v 1.40 2014/06/28 22:27:50 dholland Exp $$$NetBSD: /usr/src/sys/kern/vfs_quotactl.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: vfs_subr.c,v 1.502 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_subr.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: vfs_syscalls.c,v 1.570 2024/12/07 02:23:09 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_syscalls.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: vfs_trans.c,v 1.73 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_trans.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: vfs_vnode.c,v 1.156 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_vnode.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: vfs_vnops.c,v 1.244 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_vnops.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: vfs_xattr.c,v 1.41 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_xattr.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: vnode_if.c,v 1.119 2023/06/15 09:15:13 hannken Exp $$NetBSD: /usr/src/sys/kern/vnode_if.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: dead_vfsops.c,v 1.13 2022/10/26 23:39:43 riastradh Exp $$NetBSD: /usr/src/sys/miscfs/deadfs/dead_vfsops.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: dead_vnops.c,v 1.67 2022/10/26 23:39:43 riastradh Exp $$NetBSD: /usr/src/sys/miscfs/deadfs/dead_vnops.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: fifo_vnops.c,v 1.91 2021/10/11 01:07:36 thorpej Exp $$NetBSD: /usr/src/sys/miscfs/fifofs/fifo_vnops.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: genfs_io.c,v 1.104 2024/04/05 13:05:40 riastradh Exp $$NetBSD: /usr/src/sys/miscfs/genfs/genfs_io.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: genfs_rename.c,v 1.7 2021/10/20 13:29:06 thorpej Exp $$NetBSD: /usr/src/sys/miscfs/genfs/genfs_rename.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: genfs_vfsops.c,v 1.11 2022/07/08 07:42:06 hannken Exp $$NetBSD: /usr/src/sys/miscfs/genfs/genfs_vfsops.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: genfs_vnops.c,v 1.220 2023/03/03 10:02:51 hannken Exp $$NetBSD: /usr/src/sys/miscfs/genfs/genfs_vnops.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: layer_subr.c,v 1.39 2022/04/10 09:50:46 andvar Exp $$NetBSD: /usr/src/sys/miscfs/genfs/layer_subr.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: layer_vfsops.c,v 1.56 2022/12/09 10:33:18 hannken Exp $$NetBSD: /usr/src/sys/miscfs/genfs/layer_vfsops.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: layer_vnops.c,v 1.72 2021/10/20 03:08:18 thorpej Exp $$NetBSD: /usr/src/sys/miscfs/genfs/layer_vnops.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: spec_vnops.c,v 1.219 2025/01/06 09:45:49 mlelstv Exp $$NetBSD: /usr/src/sys/miscfs/specfs/spec_vnops.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: clock_subr.c,v 1.27 2016/08/15 15:51:39 jakllsch Exp $$NetBSD: /usr/src/sys/dev/clock_subr.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: dksubr.c,v 1.118 2025/02/18 17:09:34 mlelstv Exp $$NetBSD: /usr/src/sys/dev/dksubr.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: dk.c,v 1.173 2025/04/13 14:01:00 jakllsch Exp $$NetBSD: /usr/src/sys/dev/dkwedge/dk.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: dkwedge_apple.c,v 1.6 2020/04/11 16:00:34 jdolecek Exp $$NetBSD: /usr/src/sys/dev/dkwedge/dkwedge_apple.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: dkwedge_gpt.c,v 1.26 2020/04/11 16:00:34 jdolecek Exp $$NetBSD: /usr/src/sys/dev/dkwedge/dkwedge_gpt.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: md.c,v 1.87 2023/01/13 15:46:40 hannken Exp $$NetBSD: /usr/src/sys/dev/md.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: mm.c,v 1.25 2024/08/25 11:29:38 uwe Exp $$NetBSD: /usr/src/sys/dev/mm.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: random.c,v 1.12 2024/08/27 00:56:47 riastradh Exp $$NetBSD: /usr/src/sys/dev/random.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: bpf.c,v 1.258 2024/10/20 14:03:51 mlelstv Exp $$NetBSD: /usr/src/sys/net/bpf.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: bpf_filter.c,v 1.73 2024/09/02 15:34:08 christos Exp $$NetBSD: /usr/src/sys/net/bpf_filter.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: bpf_stub.c,v 1.8 2018/06/25 03:22:14 msaitoh Exp $$NetBSD: /usr/src/sys/net/bpf_stub.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: dl_print.c,v 1.8 2021/05/27 13:40:38 christos Exp $$NetBSD: /usr/src/sys/net/dl_print.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: if.c,v 1.531 2024/12/16 05:18:37 ozaki-r Exp $$NetBSD: /usr/src/sys/net/if.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: if_ethersubr.c,v 1.330 2025/04/23 12:17:05 joe Exp $$NetBSD: /usr/src/sys/net/if_ethersubr.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: if_loop.c,v 1.118 2022/09/04 23:34:51 thorpej Exp $$NetBSD: /usr/src/sys/net/if_loop.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: if_media.c,v 1.54 2022/09/03 02:47:59 thorpej Exp $$NetBSD: /usr/src/sys/net/if_media.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: if_stats.c,v 1.5 2024/06/29 02:18:35 riastradh Exp $$NetBSD: /usr/src/sys/net/if_stats.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: nd.c,v 1.7 2024/05/30 23:00:39 riastradh Exp $$NetBSD: /usr/src/sys/net/nd.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: pfil.c,v 1.42 2022/08/16 04:35:57 knakahara Exp $$NetBSD: /usr/src/sys/net/pfil.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: pktqueue.c,v 1.22 2023/05/28 08:09:34 andvar Exp $$NetBSD: /usr/src/sys/net/pktqueue.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: net_stats.c,v 1.6 2020/02/07 12:35:33 thorpej Exp $$NetBSD: /usr/src/sys/net/net_stats.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: radix.c,v 1.49 2020/10/18 13:07:31 gson Exp $$NetBSD: /usr/src/sys/net/radix.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: raw_cb.c,v 1.24 2017/09/25 01:56:22 ozaki-r Exp $$NetBSD: /usr/src/sys/net/raw_cb.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: raw_usrreq.c,v 1.66 2024/07/05 04:31:53 rin Exp $$NetBSD: /usr/src/sys/net/raw_usrreq.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: route.c,v 1.237 2023/06/05 03:51:45 ozaki-r Exp $$NetBSD: /usr/src/sys/net/route.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: rss_config.c,v 1.3 2021/09/24 04:11:02 knakahara Exp $$NetBSD: /usr/src/sys/net/rss_config.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: rtbl.c,v 1.7 2017/06/01 02:45:14 chs Exp $$NetBSD: /usr/src/sys/net/rtbl.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: rtsock.c,v 1.256 2022/08/27 08:36:41 skrll Exp $$NetBSD: /usr/src/sys/net/rtsock.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: rtsock_shared.c,v 1.23 2022/10/04 07:06:31 msaitoh Exp $$NetBSD: /usr/src/sys/net/rtsock_shared.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: if_arp.c,v 1.317 2024/11/13 09:25:52 roy Exp $$NetBSD: /usr/src/sys/netinet/if_arp.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: in4_cksum.c,v 1.20 2014/11/30 18:15:41 christos Exp $$NetBSD: /usr/src/sys/netinet/in4_cksum.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: in_cksum.c,v 1.22 2008/01/25 21:12:15 joerg Exp $$NetBSD: /usr/src/sys/netinet/in_cksum.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: ip_encap.c,v 1.78 2025/02/26 04:49:45 andvar Exp $$NetBSD: /usr/src/sys/netinet/ip_encap.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: gpiolib.c,v 1.1 2024/12/17 12:44:33 martin Exp $$NetBSD: /usr/src/sys/dev/gpio/gpiolib.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: secmodel_suser.c,v 1.58 2024/03/01 22:01:03 andvar Exp $$NetBSD: /usr/src/sys/secmodel/suser/secmodel_suser.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: secmodel_securelevel.c,v 1.37 2020/12/05 17:33:53 thorpej Exp $$NetBSD: /usr/src/sys/secmodel/securelevel/secmodel_securelevel.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: secmodel_extensions.c,v 1.16 2023/04/22 13:54:19 riastradh Exp $$NetBSD: /usr/src/sys/secmodel/extensions/secmodel_extensions.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: secmodel_extensions_vfs.c,v 1.1 2023/04/22 13:54:19 riastradh Exp $$NetBSD: /usr/src/sys/secmodel/extensions/secmodel_extensions_vfs.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: secmodel_bsd44.c,v 1.17 2020/03/16 21:20:12 pgoyette Exp $$NetBSD: /usr/src/sys/secmodel/bsd44/secmodel_bsd44.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: dkcksum.c,v 1.1 2021/05/17 08:50:36 mrg Exp $$NetBSD: /usr/src/sys/lib/libkern/dkcksum.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: entpool.c,v 1.1 2020/04/30 03:28:19 riastradh Exp $$NetBSD: /usr/src/sys/lib/libkern/entpool.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: hexdump.c,v 1.4 2017/12/09 00:51:52 christos Exp $$NetBSD: /usr/src/sys/lib/libkern/hexdump.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: radixtree.c,v 1.34 2024/05/04 17:58:24 chs Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/gen/radixtree.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: xlat_mbr_fstype.c,v 1.10 2025/03/02 22:04:07 jakllsch Exp $$NetBSD: /usr/src/sys/lib/libkern/xlat_mbr_fstype.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: strcpy_arm.S,v 1.7 2024/02/08 20:51:24 andvar Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/arch/arm/string/strcpy_arm.S D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: popcount32.c,v 1.5 2015/05/29 19:39:41 matt Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/string/popcount32.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: strrchr_arm.S,v 1.6 2013/08/25 06:15:06 matt Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/arch/arm/string/strrchr_arm.S D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: strlcat_arm.S,v 1.6 2014/05/06 16:02:11 joerg Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/arch/arm/string/strlcat_arm.S D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: murmurhash.c,v 1.8 2019/08/20 15:17:02 para Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/hash/murmurhash/murmurhash.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: sha2.c,v 1.26 2024/01/20 14:55:02 christos Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/hash/sha2/sha2.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: sha1.c,v 1.7 2021/10/28 15:09:08 christos Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/hash/sha1/sha1.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: getfstypename.c,v 1.11 2021/07/22 13:54:38 skrll Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libutil/getfstypename.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: proc_compare.c,v 1.3 2020/01/06 13:21:18 skrll Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libutil/proc_compare.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: snprintb.c,v 1.49 2024/06/16 19:41:39 rillig Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libutil/snprintb.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: strlen_arm.S,v 1.11 2023/01/15 08:43:03 skrll Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/arch/arm/string/strlen_arm.S D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: keccak.c,v 1.1 2017/11/30 05:47:24 riastradh Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/hash/sha3/keccak.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: strncmp.S,v 1.2 2013/08/19 00:57:25 matt Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/arch/arm/string/strncmp.S D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: rb.c,v 1.16 2021/09/16 21:29:41 andvar Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/gen/rb.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: strtoull.c,v 1.6 2013/04/16 21:44:06 joerg Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/stdlib/strtoull.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: strtoll.c,v 1.7 2013/04/16 21:44:06 joerg Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/stdlib/strtoll.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: strtoul.c,v 1.3 2008/08/20 19:58:34 oster Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/stdlib/strtoul.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: strchr_arm.S,v 1.8 2013/08/19 17:50:04 matt Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/arch/arm/string/strchr_arm.S D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: strcmp.S,v 1.2 2013/08/19 00:56:12 matt Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/arch/arm/string/strcmp.S D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: memcmp.S,v 1.5 2015/03/26 13:34:51 justin Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/arch/arm/string/memcmp.S D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $$NetBSD: __aeabi_idiv0.c,v 1.3 2014/01/29 22:29:43 joerg Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/arch/arm/gen/__aeabi_idiv0.c D2025.05.03.22.20.00-src:20250503213409-xsrc:20250331113646 $GCC: (NetBSD nb1 20240630) 12.4.0/$<x{]Uu8ys﹏GZgrGJV $& NTI| VbU D20B(o#BPq*!E",>:o:{;373ُ^%1E/VzIj]ŷj~S+β߭n,(U/kkW/Sf;|!$ڢSzzzj;@6߫ɷskB|FPgKmVUW|+XMs^ q]M5a]X"Rr+>V'%]E;j ʌ!kٵeY$ e߻jdɾ˙ /߃ j^q_8r保/ops~\|{y1;/ThOY;vZ;kx@58/JϫޫF81G@^A)-ɮB>=^kjKodĄG?ތ}g{`f g"/iۃ^1O|2T@vPGRFM_=pmwpDڶW b5oS9nR[m#˛3kp|q{!> Lwkk9zDU9w"FZ Pc h;8;fʸ{gw/o=o#o/".u|tߔē'/Pkn-Jpy]ZQ}o}Gq+ʟTo*S "XBXf*wJgO-)۠>ʄ |{pJW[SGPd}JS3 K9bU`ymIŵ k]\[~/}]?Qvw.-Wώp{6(1pem{] w|7g5g7z"nS3׉)RmWoPy;JB ,hUFڰ/,`9wG;<}BzpR\bT >9ܗJnj_s.{p s>jk5m!{dg}ݵ @IrZ'a^}T'NglnƵָSf۫zc)bdF:rUS޽G&uq6>;;// >Hn?{td0:-8U^OC}?(`zp >FLS;_A`_OmUswGϪߒr;Ƌ5sT/l{i7){z0O8'G8Sa,*V[=:|rY?<;IsIyzgTWmv ٛc^(6`xpں{5Cuetd5csqf}&`mZt'H|w jn;SDz-.Tu_"F8IJq\[h6RTV{dk'5=0B_RyB})Ot av]ǩ-Rշ;'ٳ[фbo5jf?o@{c^Є?S6h|F(5ވDj8MY85W{˥Aob=NYqg Jr*I/;*=uRwhtRe_Z'U[sN^1}]Z&$.^$^ty\z萿F`? 7[Yģ vIa|B[-ĺy,3޸?A!qzg3 !Rtt%7z|dӒabD9x?ZzTsd-PޞK#CjUK # +iV*7SH!G%W{WuȆ-u`LK5G3x=]_Yg):5B3xaA$`QWĘ̬[/w6aKhn񨎛4DSQ _ЍG KtwSb* ZT?`Vl3SVuߏr~4NߦiJ8&qJ`1ʊDIbwFQ7ᗯk 6sP}4.Pr6aB- #=lɧzkkyV`|ܗZiйɫ_G^~Kky}oVxP):zʔHK*EJ+}`RrL}ŽJ~|5po=%\ao]]/(CDr/B=T#5r&=En9=,Gkr).}k?_$ꘞ3Qk1̊rojqB^.脢 h7e@ u@WW/ts w3ȠP!~tHt|Wӡ43߯ _.@@34]IգxN5 GsD^YU]_yk_>^TZ7.|Gc@G>1v:nI5~TJ;9jOs^3W 8,sT{}Ӳx㼂p \5j2)<ڧ0quqN?W=G5?zrOz~@$D\B fVީ՚5HIL5NbL`U>abҞC W߉1LP "ۘ:/Q{`?T/~6Vkӏ{.l]Ϯٵ/UNaI9ceZe=7K]rֻff4Ue~~'9gM$yy?qU?D p_?˿+ {SZK;/Y>sK?Z1kgOE~' {PらeEj13K$m?*L!+hB\j\5x їx۸gύגV9sΫOFXr VnJ^i73otmҾ2޻3>t%S 2^/pX/I:#{[fjuZ5 sB[ Y/#NZqY ׾5[O!x+:E}=5.K`#.*Q[wDvXsD5afٴ:{*}]# hja k^"Q^cFߕ3䗑#-@<t#)Dw6;xoCȣh^utw4w^r 3V|'i#J?\гpRz޼])ݝbz<ݭbݎn=&MT8SDt;1s8&ԲgNϡn_*_W6B[m E1A#0]`yv+&:W>|_2<24kGmݘ23׿|A>?KM׫#x-Dύ?, GK\TYTW,՝GJ*NwƷCLX7Rd+&'(ү= F ,ҫ S2Czr~uL#]w̍@Ng@pI{Mṧ}l, ٩mXu.HR63wrww>?:_2:{w˱E݉ :4\rs)YYfJW|/Svmj #o=2-~=נM{\-yte\Ǘ+e5m ccOȾ RF[e"u?C yK:8\30a0KopHL]vT2\],[Ac)t˜>눞K2%ž~}]eOȹοLZ5qnS։ʇwZp:oSp@9uCeVK+\_Zo'-C{`+n1wZZ]Oo ;"!!0909~3ٞ@5Ø!@ =?;^dyS{S3aw1_wNc/SK21a4`%n^stdJ]l-KȤ2!03(Ze.%A+/Րn➎6S Ic/4F]_91N18AVI8JBh KlO.3T#ثV.C=Jo ;dτacUϡZHkdn#ag@/'RwϷpYM5blP%\L;WЯ͟ΆH3>yOa0%s@8h}F RGϧMC [= vÕWү#+#׃Nk W%ĩsx:=Я0j{9jw0#`TrO:uoӵuC ]% sb~ A^qy=:* 5.ubud:/ay,+VmPqâxyʼnz7Ү%ݫN^\759Vm]DON?m47^?IyO҉utk&j9:E*͒8Gʛp2[T@ϰ(֘uvT2yy ȹRUXN˽e;g z +#=>Iezt׭emaʴ,kI%eH&Se:Z^[ &~|Iw؊$y65{JfeSWojOɶ5YY/]^=)+ϩ>L]xYV~ &+#ڞD6o_6u=9y8wm^әiegiUZ[޳ff/{zmUGJ=sgTLWtӊ˚űa;q y~ xOTwQΨ͍,5K:5+Hk1l`.Ƿ*]raVbޡSL;i;购މ ^!I˻OT-k+OIkZjUzt:ڕtCS}ΩקGl6MbNL'6u投=gJ.YFY/:ޢado<-Kp"BwiP!+SGۣʆ-*ޥU|֘H*lBS3aZ|$z=; !UnjL$Ѵʞ= s*^^1Nlc4 gz]3_T[sBK!=7ۖe(%N']+V+XִO_W z[@{+4^ensЪ~٦ NMF8Dh=ЂcOW}_YW&nYSz/N ` 7g)ݜ(G衛1\t;TA=3}WJq${:u^+VZU@tH,şM!=ʮPp[)7۹Zz5ZnjGsuY)\UHOw[MtN4֐\/D`mn&96ܧ9/}.ex3* VO68D3ds̢18*tRwx_VN{_57z(ܚ*47:>/es_*~O$+K¾1< }BvxV5RIcޟMՎLN~PoBϧ ~=YQ0f٩춹&*N5^ߜk2p(kgz:s2DZ4ۍRƯ']WT_Ȥ/g˻o3? )[۸.u}jrs8Qv@U}M^ܞ_7^iMHZ#{_kj盥))miS:ݣhn <}wg>Z;)}d4衃m p89ƨ+kD)b-`ުhu(o@+_kNq0#]=z⍮"m-̋je/eS9Q>Jmяp QS'hi#2a5mBj>D<9+wq]c6cS|uz<ȊmMpޯ 7k݈u#NO+AO@D냔j`mKqruh+:oi=y-"lG(`qaE{hFO *ȟVП ^ωZxY!ֆ}RZ7:M1]϶l㷉H}v]u9wYo 1l$a# nw*IoQ2I!ߺTQ[?ȡ `D1W^9o h]阖&xja1/q<|7q7[/Ϡo<԰ёsq5}V!'Yӛ.j]^9si-zkLt>[;%9F.O׳V,3S$EhʌK<ۓV\`Hȯy,sr%M7rpW$)F3hz4pNKٴm7QM C'X4zf";W]ZT^n|=+9Wmw&8Xtca'@M&Q.?c/qv< n퉭'3d(RGm'Aa$b[DN[S]G<}P뚻$!.\v#i AVR޺PBw^Ă y5?Ϻ|uDP f[` rs5+zyWXa!ӍHt ~G ÎRXmFb2kȒbW T{_R¶x)X7&l9v G 07#.VW(oԵQm 8IOxS3dQ!f4 NUm1lPuhMeц0ZЯODg5R6lηʭd6يkT<۔ hʙWΦ;3d|S)=PzC:4ڨӾ1cT-vWz2,ј8{M J˘꽭,ն~U_Vߋ$~Cm-l|Cqޗy_`N9lNqW+(* u,{TCٱe7_(1V뢽6&04۱0-gWf"}`G{ }GZ>1׉WFEq`^|O{hՓlw-nqW[S'~.Î_ *m;[~ڶ۠ٴaĴFIl[$Vm ~hfRmlkڟ{ +)9<KV~ٱ _el/.p~]`h!h'JifnD4pi?4~8q?8r)" Ri]eSLe}bSbflHR9vO8G _JmAs8x.;l'C`j5YrA漮殇ɿ䕃Υ:6+"HC"sa majVbea i8QFv 5LkJx60Fڰ|xlO{{{ =K\ȠCq4u ВZKϏrUq*ޠs OGœy Ӡ,@g$]a,O4aX #k+{ƺ)W '&47o!=K&k3y5vؗ`kU\Գ,|C7݉f]PP여e_nGǚ1k{%Cr<~U}@%UC-Շ33>{ОE-*-UB%[ @쉕Y[-/+&GFɩ:S򜪹edJ3.>3ĭK)ʥvr FOV@ϓUxzqϳf_;rzeb ԝ+poT2(Ǘv֗gC?"(EygbSk S/\VhY@jeE(!K_kK%%$̮1Exg>KW\Ln/mLVOj}T"of836h+*M"ynצ CfNj~q ~M-tG,@1+۴O|Bɹ!>ɤG~axcg6^uIJTܩ[L!_p>1|$)7J\;U w G_ѳm t֘!-v|w?ndOG"D}\,5b/記B_e$#YiYsqǫ4ͅyy^}ۃh(rc=ćXp4 ,7?($UX" sb#P^>Nr[}.dܭu3;@.\&g0eV ?q|wn >Pѝƻ,;ƞ%9ƜZ; ^ PS/4 FŽ2#ܬ-"<>h|^(ާpAVaցAh|qCidcRG s\W[}xU65 !Zə^w3&}ɱ~v*fbY;A1eq9!Wr'xN,@l3$#zv" ibtg9I[/DCk0Y+x/hbk`\Zqc{:3SO;NiS%CVÎub9g4ƹ1-xFv/jf9e'!_~-#<š`|Qg.EҨTp#ˤ^'br+hןE%jbK+P?2rM3HTfaƖG\*fO^YK=x%B!6e67ߙ*L㣊Eh z/Yd>;s4ק̍djUYK""iZ*Au h.5y/ȶ>Et$L@@LtQWv$38>7%>D染4=RGw !Swx~3A?0ŭ~kduC0ʊ`*`=[06E LV4XiQv^9i>x*eՇ4SKZ‘< iG57DL7) ތ `p@ '^k<|H|Hc4}'VOV9j(x穞WV3>sЮ=복eoA"VJĝs Yl|OUeun}G+qbu{ eŃC. +,nw:^(Rj3:a"}̺ NSgXC h .v|TlKz}Nj^#՞Wevؚqw3{{WAtBngl&a>7m˙+FP)!eh!<=?olŔoŕyN< j> I.%S̥_4E/ȾfCv'EkVWu K6oqr*W%Pc[0#>זH6r>WU̦i˪g#fU:L|ؗnMW'! |[W(DRw4o=Mqi/B^bŶg|(P5~2y6U(_Hy-Gd= ɩ6-sU(8^)`(J7z=_;a一Z\sL΂8ؔfNĸN.拭 f#!y>kpXC#Aɾy4ڳoPKgX0iC?$u#ӫp1&I~mBf8Z0[9} <ԺI$h0z7G7iMŚ*۾ˤ2mѭ,9\_u4x'CD=EyNH Li])gsJqr$ܰ[Z|St^E+/hG"#Uq}KA?ufZ&<&"C@R#ZgӚ&NT VYiOh1V}({ yGXH"DUk|s, ^ ~ڱ)RX<%`gNc,<|4M{~]u98hc PCGa~i0SɈ^+9ց3Ҽg1f<6ʘϫDRYWo_5U#g5z7w=4z Y(_3I8>rFV\ rcT%ײ1 j8%,Z)z};o3D"-߹^!J3ͰiG!6a*n'};>\%mtl^zܡ$tHڿ$Ow;7wpFR<+.胸Τ:-52 *f j[ [?Dˑ=Vi-38 ]_:ZCMqoiX)BOcx*lm p˜?KF]Q vMi!x2\M{,jH=9幚3[p7IǤo,rwxUl٧ +r:JV Ā/nԍi QhMKchEW{4?WWF[按H18ױC%I\ dEs.q:okNGy*:7Ry&fy^ZI:cԗ©X`Ǩ~Tj#ol.S( STދ$k4VIx>Ίsp}xlF b8m| h$+ZZ]jme))e՜fHRmf})iؙ\_Pul)-W:Oc|$[qddFQ=oMEɊ}_ 9iQYRb}~Җ[k`Vݏf!k{#Z!#xeXɖ9MV zIVO%Qlm͠ag:B!ȅ}%d@=g&݋TȝeQB77=0vg7ؾxX6[2'"[2vykf,B 1 ;Ywnk7h)y*RUh4X=0 Y#aPܿS]{'7_W.-8]ٝHXB~j~[wIɧl#LvyƓeqsWq #Vqg%h(Rf'֦bBRp)渮ÐYȯ~HN]$MPiTT zݤ9i|YWEb$9 +v^IӞtopZڜZcmP"oŒX\ؗb d"^e!ڒ2QMˌi[%m3z-)~I[+ƥe Yaӂvr[?_}ղ LoNptq$ i,J~Ya4yPNmnXZl6 ~*v= F4UZ>QVJ"c=W3-"}ln`Iu:'ys;9ߥ҆q9L!s6VHπ O싵jik\1b}qlnl pabM/q4ҫjO-YVsD0HztؽXozVvo,b40=ɻ|=ƮcVtꕹ(#č=c=hӰLr!XG3yU:m0۰rXWڊ/)A)cSd;ĥ+"O78F|K<_|ݲqux $Z"<$$+/􁷢) e[-GM:^UX>xF?UȐ~hYx x!?Tab  `~)jΠ;}bGgl2׺U+򴴀u[/ޗr:kQd۵5h<.{Sù uf}$)a0nILGt}dS+]x π|CLaOX3<8'G|H+2o˙^ZIr+* |HSq`.g<9ӲW\[Ld5 >Q9A%C+]k ?Qk Nm|Qx/н:I,Mƅfnp68ϫun.)  ɤ_\$}'H4 cVDXJ^eL2TpD[_oن fu4zGg"pS׬A% $O}_IdJ֭Sx =|5v3;T\ekzQ̽pMrdǰ.5\Kncr];dLJ N}3R$nݖxW])ƖסNyLfi<0Zm֢gH͌ --M.>Śdo, -h<Ff~p&d9\?[QN\D%釓l f%aӰP(iw.Џ%CIzx^q:^9eHv@7%㞲n){LOPt0/4˼c*d鼚u/~=E_@Y3)rX v<|-ǘ&d(Pܖ xE U?CmmRbqiY+N8yU+k~NU^i}nU.'OYcB 8Y;~1ANߜ %$ ^ >P1嚺93Xl3DWl%YLYJ:(?Rg#yAbk']Y #C1E -vv"Yճ0\ ȎIk*ۦHړ;ik.ߍ-=My %'UHacOz cC02Z).~3OǞzVB?xqCq+;|] &ҀQ4gt!e|$086+dovqm,oItu;H_=cÐ#:B9_^ⵥkKƧ"?ueg0hy@([q9oM e\K\W@"uDZWщƖ~u4 ~&VEV+6wόا==0潮yx隆>97i 3k+FiEx@01"E:<"?Z^F0-`Lm}2S硸RR-vyYr ,W^cA]S:ƚ`1`\E5WEIo7+tpEwE(SD2F-_`D ~BWɟ@~UƴfchzŴEiR{'O{FJXIQk2]2oz.[ܵWd}}ialE]T06?1DR> g۹#GJD)1Bg+tC:O9z{miVD,$FCI7>WKs_t]KUxG.*˥>P1_rwPp؞fFB=6D@U$i8#Я c rئ'WkKZt)s:sފ(Dߎl,u[$getna, D=pFz̲a>`WJB =C:)~H-K⬐>@J=$)-~Q_ľ8eQ4(ViGpH4h"RR_#BQrӂ&i8A,3gaqFm}LgRC[oнJW {L!: KYVb YS%4Zǯ:ZLoAh[u}3ɬ%ZyhAk,aS61OaO-־m5$i*IڂPg-`(c`}xU{7g?&8!LǑqzUs,3_kD"ق2]99"`yɲna|4A-gtιvj3eIVFѿ'iE>dYXaĨ2ąZnpD6{% j|:8.\[/g.FLNNEhќZhD'KZ`7@d qӌ. $̴NlzjHѭP7h,¨.zk_ e.}WWct =U%fJOsxr}>96|?W{Qcb|Fƥb\:݉bT1v/9$aJWEIBz2'L56)>ox3=PSGQ35&f3-FuӫO*~~ ؃k*Wt~ X1sʍ*Δte}[R]ͱh`ކ/ D]3lUvI>3k8͚|5Ǚ G;ē%WWq|r14&_洎9OpxŎCk+YGCv7%\u MC'8#ᗩD-J qgͼ藿 /Z1 ͭdzt8Bqd޴މ[Jfoj?L_0gs"hroH!# ͙\$4c#` ʐr#o DPtŤ nFg.Ж& XSVqOkڢGpd6bDW62cUT3x8 jZwGs~;Rñ[bQ[Gɲv!,樗Qf[#Y Ͽ&"K:B+2T81È龓|Ʈ.WZO\8Y&bKъ K}MJ^ ">j-ˁ8v,Xl e r_:Q旛c1jپ$_$)+e?6LEe*`ۙJVR wS ,=Z)ʃKB Q]+{.Ւ3dlOhOQzj++geñV߸9E0 zjeU ܲ Y B@/C/ґWQQuQP숊D!W ͒bJ=^I64&:+j)HQ1 G/sFE r幙xu3\t9Zu~3uugu*6VB͙~:EescܓsA}{WF7-6BZEWz+jԒ<䷊)ejp|L;]ǦHp=inF6ucb ^tʃ7˓2wMJ݈24j*fw:ve78ޟωYH;5MOJR UbmSNIhMGap,tm)YcPx/fa:J&gmk]jOu<򫔿Gm{UrJQi4_xΐ$]_} 9zή$iΉ~t}m9-pdoi6Jm\mfOWx׿iR9wp% G-WCըDY#k}Ѻg`ĽGaʪe%]' !\"UxȜ Ŵ=-}jYa=rZ/%yo:kmaɥ374SW)SaN%)@G7S{vVs\Qx;$:}3>ZGG mAʳws?p=sU= 1 F!N Oǧ "Bݍ. ~'"ִh?B?)ر#a7юWakd&)+)iqV;:<% j+hio*-3{\Ԏ+$lG(}вh!K!4n f}j2/L[gS~;VIwһÉW(qJHxޘmrk peKQi;Yc[2v y^ZY8<#;w"yBeњFk%',/djO"մcPN̰q⦑q擆A U^l8JJF{vY3]Ei٤8|i2R# p8b{z5 ʺ|~>ɰ% gKF+> 1Uy@w/qB0{ ΍lP1DIZ2Uó+ujA5 q?SsyZ/'Chfw~ȑ#M/VIm?[crTO|CtLq# M4 'S~Lᝊׯ0كAdͣ2׉K^SP*זWX7&賻A SKCߥ7jҽQpFfے5KGweoh3a0Ab47]ZPBROҗ"ry8hh-=[GCOP*'1}fO{,NvÈO>A͎_lGm7]V+'=sunPmc+mujPe=W:%I3H0e&+͡&FrQ+գE2BIeb 7~MzwVvfõA{}k">7br1/͉TMz)\l% }KsY^K %aGÊcĠkM~_Gu [\^ifnRڦ jBY:R~\It~ѲO W=<fg\X{$fjg~/]Zx-ߴ3N԰<.܆7h+Q*<~ HxMq4sݠ>>u>QO'oۺ] *|l_kzJзTM~N{p}ݓn4V|I9تm3v(5ύ]]{Cm<ÆaTE+3׉j;HttӍ1ff99>1}Z3~JگKGIٓ;)ccr{E SuL\v/x&w$VÂeRȵSp_{< _#Y*4ׄt\݂ oh Ix"'Z3Mvqc%| }lSEǣsOeR${b%謿if%Y|ZN;S;4N R]mܒ:f!%h|J*R $Ttc(ޑ]]{.,y#rcJKcFp} UŚ>rd赢2dom0Qt꜐Yp5̥Ǫ;o,{M#&vܷ`iWgh  :Q]j-Gmz,mdAq“&i-IP}odf*)d_J]xQpZ); -(*~_LoĈD=Mȴ7WnAG)O: Rӭ_gmmybݡ~ba79Q+k%ק$ZMe3H'?S1Kꀔ}Z{-#z=JihA(ǂTWv^ˤ;?W&ZحN)KQ}[kD tcTk.#דĈфjRMn;_i=` ר.-I?4ۿVZlވGpgagwӬ,nWEJ7B'h?Um[n.uwyUMW3w '<m>N˵M2Zݚz,0N߿drr%9jiE/>ENS>KוM^F-JrD9$_.ҡfV<{oε_Q*>?̕C\)W$5Оօe¡jc]p֪=F7ڷ˝0i_8L2 %]?EƓr΂yulw|:<ڒ9i?ug˔7SRD9OY:(1זLj\/hz랉[ڲOpg{SX_Slol@P/PfDu N,e׊rSOfi:ΚAetK.^MGZpB΃)"$NxnzGưEix@'-[P䶴}ŨՇrҿ(ѻK z:\ϱ|ӋUb85g^x r8i~/6aDޟc$eQ3kh \Gt-?E$wbGC+a.xuoQ0Mq+lx粅Ҕ:R>*s9tY/_RH{'.$wMj9%&|5).jQl*E~NM)$?js߯s%YECtUh,m RūZ GګW 9[W{8*=lȜ k\{D=%ZZz`[xj1XrfZ<8ڎp"i"'-(B$ə0N_N ڎj[ &Xk;QD `.$ #u1j۩lMi˭ QQOuG 3 o A)/[#?eP+D a=CX;B<ߍ)=@~†Unq_@\s @ K\ 7SMT;5-2q|DZƀ:[C_B >؂z׌JK?>.i`>K}yU=֐'  ˆ0>¸H#20(!ل0,#0*;+}o 1WskXFX*="M\XIQcv#`Ù.EX.GLEx?o|/7o(Ӧzl_W0E}MEW8[Dy f.nD`N%OmD|M!L4>bWswޝ¿ͻm\Ӽ_g^AgNK:e>b#<0}JЛ`<@: J~fZ*H+r;#8]BXg.> X؇},u\"z%Bp 7y͸S}G\V}r6ڐ݌ P;o/PyC!0/}ù?p SM D*F݃0 j:]Q'$%Z颐w#JWzݺW֥v"ρMw!'S7D)f1$ф7t~_ Q(F#I&jpـWX^t0qwsc+@n*@I? uq; /C>^#1[p _@) w(s Nf,L7_~cz#~w0`"87qu #b:zL˜Xx%By[`?؏k$"Wn m0& ;P/x[h-#y σ~qmŧC]1k~P^gC[Ʉ+/=j5I}e2끽6ʷ*qVoakB)a{6a^LϦbE}]OݞLkW宅sRGWx*yNcSL_W. 1ߓ].{(=GIQy5Ia~H_Bv)T]~ʢR2PW)ܮOwUcz =1=p}$3*p/ _΀B={b=bxxJ9*S~\Z%Rz?uxRq-y#+xÙ:myKܐ|T7Tҟ<c!"~L[iiiN"? iܖi{|c8g2p}>H8}p@}F! i|f SyzOJvԈi܎oC ewWmI߻- bqw*!= ~z?*^KCGӐU{>lqui t+WiJa}1y{2뽬ogjo?3T<תr EHMA(x^Y|;]b)N:uA\t O>/$۽iG j2yQYbT@)C"'T >|G6!-r HxoʿB~Ȅ i-*a` J:) L :/$ ["fGeGm-UG{s3/WPL͙x N3#%Lud9CtZ\ٯ;9MBib,FἮ#]ꬂwzA~YX&L^'3.$ɰHmˈh$0CD,{90(eHɰ\ ʋɘ* q)4¹2a`g跏pFc?vqÂdOif/fWz3g$ДESɺg|Fr$5ƽ5$Zf4PN1ia7A8XSimL]'5CR#t.C|daжY#`l] 8Fj:=6 F%_@_ zP̀9q9fKc>ʪ0?OlaQ4y̙gA k.g͏͑/䰌/,8z/$qD`>edzO*A ?TYY_8 \2p̟bu9Kd'xGAR ?8фQ  8ڷ0 tE.|_Z &t}.[\3~! ° ax0jE~%f|og|C7\3<:ۙ<q zcf0`zQX?0lFQka;fC.#^׾0hߐGk FXW9fz-sp6ј$H0GuIلh[֣uoW]_ [)= GFc'ʘr=jT)Naœ/&)գ zxJp exy||ʁD֞zQBY/.am;e$z?%` gP59s( _*~Ԡ!Y@F}^_Tm볌[}[XT\tn |#u.O3Uj3ߵ>guxX}^:IBE"{(xIbkwȻyvEԸѮ>bo} gB}>}'\oy -o㼋ȟ q3|ϨN3ƍf,% ]f@gF Qs.a\I7/gyUۭ^#CavƬW+a|{zN/_}`%pL~"nt % G*_Dp~ĒhK8|zW_~:f`~}gwɯs,xǀgI##9 $7yIn@t(Ib)% =I xo/E z?vf\M`tO͏4 zyG gHe4c 0yT_†L2}# g4D^5բ!ݛeiHt.sCܑܾK7!׼ٔ[FDmFnT@Հju7_N@˄EvdAzO:-RN?p܉s Y x!ˣ xCsC وG6 /޻e#^xF37b9F90h.Cyasm#i^%#|?],ϳKԹ )9zYѫ록75@#ڗTp"56+k݇gG&gMxxsک gv~r6}0l&m74r&DN¸3[?;%Z/񽧚NxwM]<D[¸F(Ц7`y5r`HFq]Fhx+m2t&masoFߔHMi69Alr:jwH07H$ؐ0lN R} 6kVCn60 mp5DYJ\N4OwD .Vx0^Rf#,JOͰPEsN=Q}' wA:05 [ ~r}﵀M.fqaX<֌>izhY @ltٜԴDZswQqHR2MOz^[d'=_ 7wefe})@9+3%,w^F8Hܕg߽XR'۰>ʩ6UFrN5/ʘ'XP{28j~@/爸0*6QzLl4`ު..uzpwU T'Ue4/1"R2=mzmRנr}+9J7-[ߙZ<ҏCy+bym~a][n,--o8,`{Tזǥn}O-'h>_k__sX;쇿R wL|Hv|_nomr⿽P;?{zkmTЎ[P9.|-Ӄ<_i~9'hVr.X)Z=y,uTÕ'=(GDT=0s;V%j3|\QާS<|gdhOYy{9yro3+G> cy95r>,g|C ?"U@yJܹs7y)*yi eI[Ԛ^ywꋕCb]YuQTtom8mX{֛ߞ6p1m`-eˀ>p>xFȑ/=lxj{۳'e2|ll{W^~q"CIl .F~ʿ=UkOr3anD.0tu1o=Q}av6W}wuk rK;n YQ#BX G3:`_|KV/\ cp:О+:̷t`~w} aa#nຄ3fu&Ĩ?u4XWv. . StNՙnmes<Ý2Zᬫ-GU;ym=N9;)Thspϖ:T"#ϵ܎<wdV1p7511+IX㙄A;vaG- M֑Gu{3r?FD|΄{1-p&Q7V{`3 z?e4Jx]kLޣlm1B KudowAӝ'GSS yoqrb$>j2=Uv8U0ƫLj.Wcq%V+PVZ򾈼7oO%>(ߤrb >Q?T ctF#d|~c1[~~9Fxx轐50l- UyND3>a.PҵO;cF4io'wӀ:Q C/3"齨L: xpI/LrXzoxB131QX ͸#3x ixf>B/n3w"#4y33OwFZ肴Td4BY-4YH@w(oX923oLsE~1g_O,aOLyqs]'+huwa5]Xu?ݸ VsX0oR>ՅyՏ09օΏ]OҺ_xh nj?72R*Q>T$r*YR>7ĺMGa/,a/$]+{_>^mޜ1{#1_YgTSJV3`U%Ҫ\]IzJ7ɛ+yx+YJ[|ǀ?!`/C#u°BѕE}#0&M.rIWJcPӕg~ <g7\\sD%(oˡ1{WIgٳo7vue;m8ҕmRqוuTHk~°6([q EAƿWЍiqQ7ǗvsBg敵{@Q8`/#FZfPL@4S3݈/PXHS{ -lS<:8ή։ӗuõucE)_lq=aXN8Oj֊L3cuc+׺x{\W3y,ϐP; "*?L#KwgYg!ZeUSwnO{s{u;ݹݹwgk;Xlݠ޻KzYMwѝe9=~mz,gŎY=tVŮ{,,}b`Yg=Xs&dYlAO>۴ڿ'b'dY켞,='bɲhO>ғe/dY쑞,_O^,ŲֽXۣbG_셺@zzb3{{#hڋeިC uDHkrG\XBj#w'ܷz۟W_c_\^޸^y?Hz93{әy,|97,荿{3]֛;1qo⎝F͵?B]ОXo/qg ZG{zXg߇;n$)HB焘yˍn!XwT}g`fPу}0*!l?-` :C#Jb]C,Ԍ]!/COcx{#@~[CLmOWfHr#k 8##DGnX;6-d>HGDE'`%c`gh>^[.ʝڇk6ruy6|2M\ ]n2ޛءQ=^gx .=L֑yʀ>L>>> c/Ηi})_6 f1Yڗ|]Єu>Tf0q}{ӑtC{;ta T}ƥ/)}Yg`_%MpP 2}Z,"lnꋿ4p 4^nJ8'RG"?x 'e<f_|Ѿ|/Սy*lּ֗9Y̘a#v~X~IC>5n畠o,p3pϙy1Igr,q^?p$XNҢ,p3mЂ,YbYp`ڗ#K<叅|;80ik p<҂~S~W%?׷^o33KgyvW 09&Fg=~{gSk Cb3$7jpSg?Or_yMM=~w?f#(p"̇o ˆaN΄qo 8ٌub|`#Ic cIg΀!X6d<gk}$ d=zw@>O7-b=] ʯ\u? \+aVJz;<qBX<_aL|Hkoq?j`ثa~gf{FPˆAU/gr\r8ƓoWoل9a̬ [9 s oo?79w}p/{(}} #IՄ9?y&$̗]|Y@_*r>eCMgC֡8nY" qkG*{2ϰ2tu:uZc>;UoW/@ x!̅/PO4d֜5LK̐N6 C>2b4ƺÈV87a90h%,7{9Z.bCKaUp-1l6e=\ZsK5wt0Lݏ3ʿґk_UFyaLcyɏ0ipgV8ӴBJk=ּڠ#WRLt-*osፁZXDʻEݚxY@=(yuBy;(=Qw;\cW<r?ϛ./.ϨN#+LڏfG;Uw0eSx+3 yxCK C|Ю5/B=cyf,U5RX ކ8iO`]CR~5()}0nf1lG5{Y5߉wXyBgˆ%1g܉|d' Gqj㷪,^iRSp0uaC5OZr;yU>`}Lo˜8#YH{>eO !atRSjj݊T_aZ&yJk/KP[ c>ߡr8>GaX~ 'д_OM=}L6V\v" @ 52G6[c`36͸q3`! +=TKp ݯօ(:=z|>;XZnz}޵w'_M`τU4`7F,o.`Y ֐](&eK!BwUIK1ʔDKEW]-0t уLBrA 5{X![By>a\^J( !#Z4*llsQc_ 4a7{Pbs+[ j5։쉼_gNd Zh"QG:$O>}"v4}u׉)³G Zq[00X+C'q q4e&t0/z3{LxDIr}[&G&剮n3ṨF~1YȾXOLy֊I$"'.h8E\$qQ1S?JXOC#r$`7X?T0f rlqaq9aظarN"uc'`w ߞII_9`+ +$_'y9ml)WY (+;u#).ᾧ:ƫD?'NV{\xN{0ʾx~*׽&PX`x3&yd `<;DMm~Pe;>m5YG<6OVgyp KB8 *5Aѽ+ϮgydD7ϰ" ͧ jpiC$ 9w!:l^αطxw q,*K_|=E/;̲VZxGۍ?9ү"( T k.tEVYNBcs~;Z=a0:@7rTcr} wb&=o1(\ ?x!Me^SY槩?VA4č"0* M c4'hxu1c4^}}p?iqc1:lc?rz'8>. [-j߸ iPQy;@Q{Xoj3x2iʧ4o_Lvb19|GtLpx}?_ڱj7iMPT^gPkCD$M͜r߅[J[py>P 0$ζpw?@ʋѳN~ wݑ4ӑOgSy>ü¬4r0߹v#BN" a{6/?oSX͙Yҙ3[=s;nS:nc%]ɡazk?na\CQ-ЏЏ{o~/Џ/n}9,#c0Z zr*c1k 3xkS\}H͛k(ƪ;kէ|rmkaOL LPv3\x_39SƴϊvB+#h+fn꽛g08#3VyV^ e qyDU7bz@ ?X3xs_+s&41EHh:h x?.BnXU()1şB5Q<Nל%ij|q [fz+%|2ڱsVOfX1,^w\.(g\k*ݺpu5-zK8hmgb{o<m7_{[P,Kg1,i>وACX,|6] w,mټf ~WFL3g?y=- 9 8 ߅%fsAsOg|D3g~6leƬlg\Q}t\{W_g ~`uU@~{Qo1}.,Ι.:WeYɍsYVc. WV;5!'͹7|ң3x܊%? Vg8t~"|ID,&b|ϞOvr1SVg[d>.# [#Ǝ,3y0fD7I4f:alH5/`?b>N&pE 倶ng6೵ ژ6$at@~pKx|+^^4m!찌/x_&1'.0ĻE8If F#aA1LqgrLL31yJ>l:׹̰.,;$̱#<;"~̷\(D;&2q1q+vPv[HHj?ok N7JKi5Tj/BƗfmtڮ.Y| ,dZd!ː_w{*7\{㞅7l`kC;i.znGe:`{[{Tj 9">6[ĺ~ʗPoc(:uQ΄:¬#yTb0a&S!,,b`)`'^e=ZǺ{Wi_q /ܹo~'m':$җie:͖z!gnt̵v1=~4[:m7f< /'-4{)ƽv)υ9$.BlgqdKU,}yRڻ~LRLR^cO-5p b8Ԏ 0g"2e,knelwWLe~9|xyx.졧x$ϳe ̱9l p:*6ئ' i:`9,՗VXchX+x}l^41$ycWü > x1{Ӫc< \I6R2c%&Jѡb@{[$^D_n[ɶ.V xJqud/W:k{v~Q{sx\{GZQ+*$U)6{x*ePȳU4FoXI<ɘk~7yži%xm$fc ,y;_0ZI{rKأLޫ"&2`]=c|p7XII]Mv:Y)vinTޛ+H7VJ}ףGӰgԾ,|̱<ו({NmwƫءyN6YVyv?+eG,ϱYVYb7 }w|a [cr'o2gw<07Qgc aHpGVwsrK]Ȋ (FYT(h(JQ:D;^wEz{;enB|><̝>s̙3g5}y>n5>XZK-XPPKh|.ٯK݂llwy%9d;߷vhے kvdPKsp%(j2播7AVl`D+s98ڊXZ­'y4j7]Z1YaEknz%w[,mmX>_M{]rPZخmPF!D1 kr9uoMn2YmXV Wam86_'p]m鋋vrr_ܞk KR~!8PO5Lw_U_ݢ&4W(E M𺹎|8W!:=':0 m LG!4_; 64[QS+Vzt>A3:pO<xO9Exqr|eWq| Ww H>d" (|_ceEݖ||߾.Ƿ4&ڂ[q|k*Ƿv~:[q|tom+8omAom9'ŷz9܄>+~{I #BVjuՆ_8ڍ}96k~Ml-?_}_?__nё&f" ꉄG6z] ߨC{o:<+E|1ha9ʴ0 yGQ.{5k@;:K{[+I=iG狰ȲЭ)^i]￥wDx#Iy#dE"XNusF"royԑe Z*[ Z27(u}J}[XW$vPMS+mT3Vj=qRM#yw*_MECx;G=TRѾ{@| jX/J/ҜݖvK5ǚ 0Y g4cym2c9EͰzwo& WB5[#o(e 鮽xZ~;BO<YCu1v؟z~q0ݼG&j~DU>$_F5! IJl9 Ry_v;=|xf"O,E>7Հx -5(RQ,OK+T-O#կ4,NԠlF5a@:7 Sۉ;>F`p~.RwN_:NIݒ/[Q'ҭVy|g3ݿ@{ 9Bdjg $k{iҝ#τQ+Dke?}U|3~o4#f;w$&[vy{gX֙܍gݏj$NWWV'l>n錺Hŝy|3Ѻ[1:;=)rgz niϖ .Hb]?B$F7.d8[BO|=vK~~Yq~-#?wO5C~Ks|<4P8o6.܇<Ӆீ7>lmڿla@2ܕ߼ 1Љ8(Љ׻b<]^|W3_+۸AWƀ-ByvԺEWW,7P]y,Jr8Ioʵh-]|-6w5{/+GCz(~'<lKp}J/mU7t?U+rz]nj7\%AH'q =qMaq}/G7|ؓ00U&xKor,ƺ:k<֍u#GH+"Ļ,Kh>Vt7>c{t#9"7`75e]5_;ܝr%[|" :y~XOtBK|YڝRtl'aow~Hw~[\!L|ɱ9 SH~&0\5m9nwuGGA̮(Y{|"RU[?V@moiP[ PЃA]{>O р?+B{Z- c=@ 8X:S}#TRCރl:^szI'++ǕD^W^0w ?ɞ^zo_'1O򤣣ޫ-ǨƷ|c?.jғ>N ˏ:ADG$/o&K)ji!7|oGOM߶mA1 3U n:g>5^l5zsכAפں8X,y&gL[o.w*B^]E;"bϙT?ϮQͼLCʃg^ !yU|_}hp>/6>;m UA[dAa3LvSi} t[RQ]0yvP|E]Cn#׮a|i=w Sa_S#a@=rE%-O}(y>D?^G L Me3ig5.Ҧa37NcIgH0zoÔtukD߿N۔4i/˕T ZHxQ}U \$, ,On qvITL/Dϑlkה iG-(xPwG]G侨k_ރzHv~hIv/׀a-M(:C1|րϾF׾_ҟӗTJx5i6Qs&??x8&DŽE HqPHLD3}>VCc`?F }}bE_by݀6-rT}YE\Op2ir-r+o<~ _ׯ`_i~Uz&L^{k3oK3d9o'A=pfP܀N ,`/@[G>Q0fk*X[G0v[zE7Bя0(65A(SY4mڥ~Qvk^ݣl.W^[GuV_GuUO vsjr6 ['IqaI BMY~[Q>QfӼO jsEeu<<hnM|QY?|I[ o[3ii;ט.x|>.N`]qO3B kGad+Z|?0?NrY8yXm~`a i ZX /n Ok  ˥dݟdY$|MK;r{nDa}gCc l}3F:27Bs_kSv>?1eph%$ObH|/ޓ.|zRR&Y:*d&U P 跏SV8yd`0Y8eCx,]x!s)_y' Y޻C&gCXw!Xf=݆۠lS|F9_EL²tO90~mq[ AF-//$9wwR^*Dʚϒ4ҕh{/BszTe_A{%⻃Bv 6i S-*\ꔖؖ'w[("/UuJǯhFm4H34{-㛿CzINP>}(vCQm,=IosP 3CY%CY"ECYƹj(MCysjsishоcV)/9[ix"Dp(YD觫 4)|GTCt;#0ǑH>{w:G2 *%{ a36κNzp5Ys{vMjBJٝGa8~ц~22q⿇Na<5Λug7m~o4-[pe5Ƿl6 K,^BՒom 1`=HABa;G]Ç;TrmM>mهפֿJDnVУ=ʣmp!1a@ƒ杬SBJ6"_^m4ly==8 ?n8ݜ~*aspSDo1sp/עᔿkp6P= a "?p)A"/ ?-@|`|Tjz^0&qx<ϴ3mLG8<%|3GRy2g&gv2"YR?˛e,דּYIwIo gfF`WV7!%Q\s532Dx6<ԑxFvWF|f;i$fQks51.CF=/^f5Wk%wk;ަ>_[mH~h ^v@d#=9$הZLl3 .ĵLHP]ďb~/aXI3;mE|( / 9eFa>ڦ[Ϩ]M|j^n0%3fB,!*׼}6/^l,W_92? տz˴7yΌB~- @^~C(^c-[8Fc{hѬGQp$%FC᡽3BʵF2Zj4J:2Ƅn h^5ih^ƍ5)}_fs76Fd;\5eh ?Qc8;/AGM(~2Y,n .B)N8u|g5ܿ[ {31~n<?]3,m_\|g}'wO 8)cX6p3cnBsO1W3RJ-*h`h1޽oqޤ]/kbwVtQv[ФUKȱ,Xcl,cc16F1<6Bcc5g WxGc`.1l!H6r[&s3o,B%>)&B|LuZݱaٱ=9Y4E/o7WSykקcQ+ǢCucylKvľ( zna|~OʄC~ΕN]O=]O*$UXGO~54_Q?뒾Myf˴)x'-OGF/seQdY7Gg(CN)ڶL` -=RN.ӗk3.ijRmBEʺ9K[SglT󉒀_?|O7u{?C#TU?kL6\*zs,Go*&Ġ5~x~_2藏e|a^dN|&ө!1ַ1ַ2*3Z)QO^?5R_Os*3}>>')C^ a?ߣ?ߣ-`0YMcX 4pOC(8ĊMmtj,m65e|c1k[5 XHT<*ւ:~9 4Pp5lNhl;zz};L=c=]ht"t;m(}G 0.2O`:=;u:{y:οy-7my7yky=7G z&uoB *]zg<*2@3fzG|8eM_6i6d n3Ml)N5~11cFb(>YHLw'f{d <$?މ3=ei߁ř'xUg:u~(>3|v&qI&׀sIK%gĢ;z&:rd;5O+H szEv5hw?6?Ig=F̷-c>1s}Y?l+e:kXO~?<=c/wOgsJG>?I!uH `觫>w?gIMϤM:Gr{{U)L8W۾򕟴om@{o*"|5wx2KIOq&u_V_2OX~hG'-<12Agqb{Y|ݔA45%Q[$J[VPG(3FAz8xÌ 4d#+L}bķtSn;2n-X_]8~MPJNJYG {ꀳuRpWJ#zPiX6Ku%pp?,)oG4\ "5\{8uǷcz^mw9SߦbQrn[A ^pa(c]?'٫١םCvfsΤU9 ӃocP9ny9~}_e{gGDۯ8'cC ,a~ xI 3ٮ]R/2<;l_cO~|iMoc"!ohMtBJ?d<1bgVaKkc5ނq6SwBM<~FX/Ek:oo_|EWԘ|E̗/*yn>UNWɵ*o/ ~Y{n x2yU.` X'־ub /d}Nlㅬc!kU Ʌlkкm YĶ,b[?.b[=Y\Ab5b>lBL·ݖ0_.hC5' XpϷytqX_X(WK{8/Vz!粥|1<džCro- E(MU緥gi͗r:v^h9Le2z, ._sKYʼ败2w)?򥬗qteo=Mrk6ekd[߼^u+ۖج[#?^eB]Ig@`]ly RomH%H|]t╌<',vh3B(z"i`%ːn뗱m݀o>q>ev2k?t/rir9uy XErryg!p:QUZ|)|>nra훷&.~ы0 /'9E er>gXQ617.?x뗇r=ݒޖclFߡ]e;M[<[\\>C[xi4~c9]Eq3UYA" ;a9V}D,`;hk_$نG0N㷢^} ~|l֊p9 ʷ YQPmѿ>:d|#nWWz׫a+x׫9+x SJr#R]XΚW>u@>dt!Ӏ-^ _}Pќڃ`{pђhЧf?}XzMo ^/@N*@Fj n׬ۢ(. 00:R')oL 擄^q)*u%7 +qĕl,Zݶ+цJԩ*^$_V}v+y}mX6md?ij497o[SՍ ^h]{=!L?=#ҎL)!F&iNd.Vɀu ]zFP,'Z60< ,khx=O9W&c qj%1ˡ핸Fz+.O;AJdEte1ߪۼ;.}WyU~N_zGaXEjؖIхeĸhgzJūXWm5`+v*^/q o'ZL{mȲ3ͤ&wQonKu$d_>?yүIW;B9W;BV;Bw>\UYy W _i_Y__-oE#ZJ, k~5|w(Ƿ5ߺ[q|oM$ Z !tzl_zmu}f~[Gom8}&Ƿ8}+Ƿk]k)=Pj BZЫ~ASզO8rmQ]ceZGnmB^ЫE?aPS߸ zo& E F)BHvT#8zM}vѝ;r|Dp\O9ώD9c匁[t5L! cz>7ڷέuz^xOL4´agB@{^=oN!*b݀B4 OyeoDcol3Fݭ3ly7gB'NtF=!~߀gb% uC>on: nm7z}gl_7F*,x pᵿQOlklF%2|Fӎody։IMMǛ8{R$BotDs|mtP M~YaMKb&K6Z0Q t넅Bo5N7 f79EfN''17T(&63?Wc3snf'g0P,#nL8z0oƱEy9cܛ ˜Pyx/4s֐ݜQ9Ըdpla)S+[Nola;uTpTp JuԈУ4'Jmn G=p ۈ-<_'Ά910Y,s#ݸ (GΩbD_94l 9E ?FN1n]caq~ p'*b+߹+ĭTí\kxtzë Cr fVV[qp~q6Ǔv%GQ&qgIswޭ,S8BuS[c@nl3x{#'˾߸%76.{!]P>.!'O-F`<$m]=e0 ^x `*3usu-F+Gd\{AבmWv3h%cXp|oy-A>(yJ}P=~XO]gm]8udz9m,v.r|oߋuK{8QK)ǀem_~SjHV&+m =J8J߽8}pBh? 3 [^Kه`_^~#9}7jwF=…F#NۍN~h~ѽ?x\w;#zXI"GL?1vd9>>\/[g^~]_DئH5.o(n.u~ϺG?^qt?Wjtua(=ΫP!U~˻Hw,op?nrO:O> BgK Vl؊v, o,ER6x&O~/j{ ~}WL`=6^KB' EIOхs:=5:ۖ|bmI08G".DAD]<S0?D+=M8rCGJ5٦#$qŅld{%N =-6WvWw;m-]ٶVA\K<"A|_^y9=APď =JUB% 1,l?AWC&gq9}ۃ|N J ;q2:9B1 Ch0(fvUAe zk=9G--!Lg zs.tD*B+һ*Xwq9D iꕔ^/xyVyq];+ɳ·xtC0߉Y^PĹ[+HpoRB٪|~B~ zPh7ZVєÔoX40{ht^a8L%FBQ0(IͨH9 ӊ(Z"ikЛZH ]ȳ +5Au_8~W.hylL? Ɏ]>ʞ0/%XtF XJMn8z0~0 PﮉK#ERaOoy[d佐!YHPQtݴGROُp|G.o3*!^P<^.U{bb!.")_KD90*v[v[Ee#lw Zƫt$B0ja#/3|C.xnQpK%4xR+Crfg* m=_8|}Q_i_ 694"W= AW?:#le` QįH 0=[}ٶ#L2 -íGJ8o l:"Q~#QY&^;vae͔ jDWSaBٟC:C(=6yk9?秓*\7Xc ;C}:|A1}e "pe1ￛ8tegkp/w X"+aPD(nGy ͨW}SsJT;_?c{,q_ٮB6[_Ao /4vxE 24cO3?y A+B~q8{3A\LsUw;A9GϋX̢O?%Ed_N|I'qi8z98s.3]d ="89)Ժ8NreUm7nx8_ XcN0v3'P,d(r"nxN] {CO(Vڞ~?N; m593>FL3p K'{ ߬b?`6/4YBr|`;I\NSYNrzyO"] w'?dŏϒ +okE6Lp x$+I/W>{e1mʣގ;s!َ_O>{8=}2e"ua-g ?k; d~Ei+87NmIN\vy{xH@OSl,=sMAm{vv}+_;>xf >c6j/VVC9kNq[w:}טkc?Q{еk}ilT='o 8<;h&BC6qc3ͱ>TŲ p?|p#p"CBw&42nvx3xϔp#G0ӻ"s9}w=S|ofy&4w]lNx4ӷy>cYڷmocwOG8gC33)-f:4ݧy<2 /{N^zCRTa3.<[9gfh6ŝI 6[ xL3ho׼tr]pt5 SgwYەc1/WCJ'e݁3,{(qx ķe{=:M(_-o;~_?Z,˽^;T>1yt/jݏQ1@!`ų4Zڵ>?|޿D1]1!="A;7ە`>7t#M_6韱6'oLoT-vf=,hb/n4%Sg],{+_#WLp\Kx)|o|Jń3}۔-yfrUa~^5?c=f ]ɷ19>S 3L9>S9L3(p r{e|\]?=|wtynsnј~Klv%9Ndsfwb/ΰ^PB"+HݓϳGI?.MўW<ך|5€x 3(/QPrv€nQg Ƈ_]=A "|;21|{oq4s;/<# sm/S5T&"ӼjPbNsΠA]~C3R?\Kqrg{ȳHJ [l߳{`w޲,.lwG6o96ۓc'+No#7I/%n9|BEs&s$/l_|0Bϋ Xbr_ڋ E.lӆJB6'ՙJX)_s3=;7w Q<<8~%'{ ӗGwr#.a|~ - Cny^"ݹ.1Dݦ/HGz]"y7?yFOm^KaN:y]{22-1 anWM.%xVY@{ݾynb}Qw$2y_2ZP2?pzU.}ʚGP*хGXF˔# 9[14;o'٦FqE ϜCCRD\VqK:ͻ/lP_FēU 32Bmo>}YoB|(ZNs" c)8a,NcbW0V[ X 5]k+^%Χi:_B{~eߚl$.Q_1>j8 WHBg}A9C9Ƙ+8w<ʌ+L[gց.]qt!UWXEuiYX^ _h0냸E<'޼s+J_9Q,=Y*eWcݣԽJsTit樥gz2g{he2,vй*(^FNs}ݟ +:O^/xNmz},>du޾]7 [,K Nsk|>5] \;K*^RUN[| Ӕ{p6[@:Yb@ ~5|稐8no1cZƤS=K\s^sjs{97:?03:A*k^r5Wy ui/1Ub쓪Đt:kxݡe^Q>Y.}8~㪥,J|>Ss=9w#{)?Y ? !vz7yܔ)syx>_R^~Yqٽxg;PɎ7Y&g'<[j̬-Od=7.稛,K;ei'ޢ8;-*&ω7 e_,`QD\ȎomWDܯlo nr&aқфnTߊwy8>Tg$m9d3r韑]twX#y>[ˉE>,xzxkw8AKAY[|t'ZoRwyp_7w#xJ3g4kyZpXms'. aYRmFdsl[!wȎfTy1mQ;c{FW;;׾|כ~q!KI "]ևu}86:a~w&_թ#"eu-agl=~z7z|?do}K|#F/Q? e=M܎NnGAngIYw~.wc~=i׹'a9{-bQ0g=Qk+8txls_3\κKH:>jsSF><6C¡ X~=ϓX~˯wc{ wncaO0}z9sߏ1syyέ9QȿjZYϡիToEX*o8tVZc ybk}/˸q\x{H>*r>xCDW~^zn }߁e,|gQ|,$?xJ}avjq8WG=2Ay2Kpd#2|bG{s.<`c'/QwUg"|LCC.y~U}0j?Czq#qrRL+w%ĤLO?dzCֳ qK~-_?x91}M+%[D#l_?b>OG8_l8)q;eyy#{;ϒ?Ai?>9o<~"1ғ| ]^3}A~VQ1"Tz̺_rEmBhHXO4ycc֩1u{̺}3=Nmcnŀ`o\cu==al慄c8@GJeBB*]UykR5Uĵɳ|lo]}"uPp?")oLEiS#Sev)˴p`Y_;,߯i~i -X|U)G"1Eα!ޤ=tM[>7|4+;08M~c'7RfB::[Qu0O babkAZQN:["?~ucԯ_}r<; #*g-)x% Y<򄝡.)IO5$Gy%Ꞇ/cAX^nطcD[S|Fb{@}Z*yN)l׉Zolq`azk?oU)hV%$ 4t}ƅ䍾3gibw]Cu }Ut~]\^NWZ7L(~-+'3OJ'Q0 `*_HA`L GOn>e9+lnK)Bs.>Қomx8.hYLnaF'XoۨVîg hv Z?/>8cKQn~dv! 3Ŏw@9uޗxvE-Jx 0 ޯ6]ɉ!,_?/՝PIqUCUOhh8$Jk%-fKtX6'L]ơI]ۡ>hl?p= Np*5Mae%q0N~%VNזЫ Iޮ6>7xO렦Й)߭z.qVKqO%Cο3\of:u%J́㺗Hѣˌ/ 뽖ӣcQI?~Hq窣("=1|k#nV{̋>=Odj󓑇[@!L!B!(ey33Co^1T'I a89K]z/& imЙ~y>8F;az4xJa:QΜyRx%ЦBh_]ϔﭤha(T^F; 헷vl0C8^M) baD~V~g~wHc22nt(tτׇpK>L~/;"+eрKnnp PVlg]nsx 8N^*y}bC GMqqQʡ^fBoβd|1}>򈳔Kr=n,+ZRsB[@+]3ջL !Őr֙jNe]󥹢i7J&p=ƞz= 5c~ I^1O YIa mgF}P"y_݂cy_恙cTKᑶDbvkR_S{a}±?SaYEQ|?e,?[1=;cjZa;k@)@X,qJԙD%J[Q,aҐynV~kcķ/O gȗ`$vDžxn[^ԣt6>dlC[yA,+82]9.1{{GUmkϙI#SC!@ Pi"L iҋ =4 Vر!* "^*z>/^^{v+n*n+8_:I1?w߯8Jn8SW)L,k/+HyRF7 A˺ZyY+/e]K?u/+p2UguݒJ:Ju+{%_WIN3aD_r]ںR1O:abl)Lt>PҶ!^i^H%}X\m/KRۯ` ]yFS~;w_\m{fPXDOsS=jv(Aĭ܀x#Nh]Ưg_^"<e^fz=/>r+\7j_د^+h t >0b01 `%ld:v1Rq3Nl3l/ K ސl3Dsl0020ʔneoT|yweeiR;4 Gceinen!.q&_ùIT~WYW`>+*~uMeRwV*˸G+^|Zuо rUqw{U}gۜ}H+=0 YL\OUzLd$ii[_=C87!u|. 8*gPE=үg<6{`."0B+۪=woJ {^Dv?!:3@ 3۷a{;D,I| TAgrgw;]i=l~Y/yLX_N: ?=bv%=4ϳ)^/OϙI{UߵUEw?[oa\+=T0zCyRU'!2MUot%w㌏w9{:jQ:*c:ǫJ~#~ Tg|6S;09?*|7s: ~4 gj5\'<ʍHm'n.2!V71A(tF1]ajP5/F1TCFưZ\$0S[%=`5:?g{p>C¶o;A:Qq!IS;@r#O`5YOXl '0Fg"JHY)o~{c!ޙnOfx ANNZuA܆rp~?ňd?~Q ;=q- nUgϝQu]@ѡWb~c03yLG`-1 |^_h݊AYw1A({?c gcjD W&%^l6x' ## zUQkGpP|8 24IOMS2<9c$i-ƿ4Ur.s{֙SCk\{̧Gc5?;M{_p_ a/Ԑ35L7^tZ˹~s:;ͻ\wgzMOy^Zs(\QT?c!}w X*cMFkMZo 1 H]SKk^|SMwFG_Q18"Ny5߸Fhw#ʝ񵽳Õ;C!5jVJi|4̢}h+X,\ pW&s~!<ưmo=F1`d G!d|6H|Oof+HuŌ{l7!{n6񍰽{OP6}c11E~J\353%li]2Ζq2}/rc튏C˜]]ai.Ms0D/eJ-c̻]Z'k g=D/X)]vOZ$BJ;JzԢkɘ]Kf :1\aX[KZ$#WH-Y-ۅL_%ז5h Ln4WkK߽[[wԖzMl5D^RmHÎuϫ1c:Iw:I:9 !(\zƕh~tKud-xNV'9l ?$b: ߟ3]Y# p͂_k5,̰\تT!m-+Ќ|!/j#-GPWYB6~#<$%4Gx]CΠq3~vin\,cab3v61f\2ach}qLGLnj͜cy Fby_3251n4 dg ;"KKc݌g".ccu 9`,t\uT`y%MK#Ɉ\Q\k\=Y'.K9\4u.HJoΤ8ܙd˟I V* IczmZZW$b$(K,}qLg1,U[C=D[ޗqBkU?˱_y>q~}G=qF¯}\iHʃx+@_WՆ"[~4Hkt58$\mH ;ުco\uLUܐ"Mo(k׼V"m e_ X7"OCȣC<`$ߑD稹{\ZK:@ W֒¯[n3H 'W/\01 3Ga/Εs͹r.1p4cLG^CڛWj+C,|N&gt~#vRшWLe6e1l \A[k1XrFπF?HC))7!O^.SzF2ͭdm5U{)~ׇ5ҋ4a>u{:@S2_h CI4\dғ%ғL2f:tAw3L/Ƅqg 3;rW ST6Ú*{ Ȫ?Vl5Io,6UPhXdڵx:[4VpyƢXlJK8q>Οe \QΥkMw ]or-b"Y_UR' K|/K~W5q0kG\ c"D~xq5M̛]v4DڹMiMd4&4=MMdv7=҃Md"麏4/(>{u)TDE")~ 3"=/OΕ#*ZP^&*7呮]eO^ԛ|iIϓr \w-y<'{"umͮD>)tMɡ)H~a(($^?v8mg1  RMvXQ"r3*_TD{fִ]tGb?BCC0a<NjOsw-73FƨMnF+h{1d{1l{q7R=zOMr&4~9Lş7;ɞw.W B܋ќǝJCmNR/US;ܪvW >uV )zNWazw!?k.||+afڧdOb:9{](;:5}Gd=^r/~Ds9qFs"$Cȷ3#v}Գ{@mBcH}8I($]ݯO?ןǰHGO|'-_}<_b2XV>c֞2zx\?y|H/'< ?FT[ƨS]A3JQ촷O ;r8!_%g勽bg|I7W䀐ځ3HG.&cw>T,jD3Mzo8{H%+bg_i/3Pl;Ez4_sr~w0?ˁ- K~Ӝetj!LH _KoX2'e.;T1b;lqnfy]1;? = riA:xGjK"BKc.]e'z|S$+n)I][ 60kI,Җ*Xs --Iw F|sZꭖwSo!3݊ Vo2”>ZQ{{wrNcv|>t˄b;)yиnm5PJV·M]h~r}?s3. ~rJ=g1䍭e0]D7VlI+kh%gC+9l%:d:cg8JY6^Gdi~ULe0UMi7yEv ndNdn67;awd7ND|pa^h}T k@b9îha5 d t^d[u;Q8/ɝ8&<4&Q$p4GʹɁi pb %Ș&Tj d.ac@ӹJ'zXܡ߭r$6ߡF|g#<м3 HMi@.tC:=AM_t}yax@G Ht[R@cZF!1FPub; ?vA-}Z^ϫͱrJ܏4E*1jM#~"lUu漺ڝ(CE2T]͋(lZ8W"DN6{{Q}I1[{bzDQzWoksC;g:c7ᚸMy嫧;Q3Wz{拢AYo+"6w|ZPEtrcy R:!y((ggC[0*HǕ'X[!6M9/C낼t@aǝA_Iz<(U`k?oG $hc0aR.̳ya$@{:Cʴ$ѱwf6.&Q\'Z\.M\(rP6rl WͷG YftcXL0𼐣f'gn'gA'g']N"$2I'uW7K|];;RK|WQJ|ķ}.m?H|o*KtcV1jqg Fwģ*dxF5T1V3$}ijx=!~?*_xCqL9>x%ゔבԙux;s?1GuDIWu3pRlCt5k:35:ĥHPe`;ޠN'\q_q1b;Zq3#.w*E\W~gD*?ᣕ_rT>@S8 (| O׸c5O2cօ.\Zע֪t-Qۈ1Xcnopk9ߺt Wo1\oϵϑzw1BM>c^b ײP=ŵGΊ+b2!!.Emb/J4rFՕT#+ТcW#nv7 [g[wZE]l,fte*iIr(-WY#nCtg-:Y:%=zHC@^w|tΓWݦWIt_rIɝi=se>UžZT3eeD(-ZM9p|#=el>SVOo~Г^xO+]HUݎ(/d6=8ݥ0;(a^XW;},rǰ6^boOM]'ݹ=>s7}S<,جGeG,!]|澷PtHcg?D_k'>lGLsCEϱwıQN?ׇhÌgs$֡>qsݛ}Ė>>a >̇gp@oE Jsw]֨EM:j9w]JkZfjnY؇u-]"L)]"#p̓E҇K|WI|NuêcD`15:K:Kr+cķ#m]Gnp:=} /Wxvf_;tt vR\ ʝ}Ώ۩G0K<;mq_^ߗL!` ⾴gYIZ سā/ҏ$aK#HtyHӟc{&7![b~H㇑vWqe {@C 4 tBtIPtIy8tN( Ry-Đ?@YV\@ZtH4d -"M8A?hLr׵@:J/}d_}Vҷr5}ڶK⁴c o Be~qVr쥁r쵁+fjG6D%~a"@}l[)~jvr i1Zdm@Kϥpvx\(A *{Dw:[gI68lԃ`тCnx-u {!GaGiQ-Ggz}.j=SQcy%$ ˤ퉧;)[㶍 ge$nAAb; 87HzK9ep?X Lw"P ;{)=pԷ54 0zsu`NO2r 5(vM=x^Lsԅ{Drp0b ,{_Ĩ? V\ޅΖeOuq}|C>K?ePsF{GO#:C= jghJ8<$2V/=iWa6C9'2!7!"~)~v0&,GH / yoXS!Dr@7MBbR҉1 CǨآLa7hFZX"d+-zPS0k]XjH`d;{9=gCRbC<0疄yR%$g\0 Y,gbE׮Xt~Ţo0.f??t?Ob9܈8[}!yvRYQ,l}7c(`4(HWObW,:Ų/X}9˸.yp:kk+ }x?}r~cA`b %cclt#}d3^g}w}$_L'cduXθb{N{˿6}k{OSkkb?Bl>^M@ZV8B&3#}Kb%1Ζ2=ky6u <zsV)ǔnAk~B1d=xqI}=n\0 CAjٮ/FzzS;Dt/+]g֑:%Q}kQ"~2Fi#9pA'/ WqhcIi:e%~KH Au7/JO%8%?KzߒQn؝Gp6,OIvA;lO0Hj1I=䯔1'ta#[ьF{{,qx$Kel)G2S7x3F=# :()yb7FY0ۚ/][iٚ9$TInH?".sUN_Q8G٬(9%.󞆺X#2 1\|֨hXz7 2@hbN G]:JkcueH6LV{.*7aQXQ}~Qy^j9k{mwz%F?|18GSvʏ~heV1])p<߁i=qCdE{Pn'G˶O>-~gv,-Xi-|`hF˙-pOt"-Nˣ()Mҋǿ9睷S%GM>B7cDǰƨ6FGM?;;c c0YHC/y<$d&/d%Cg1Gt(!pʓ%~AH=ɘzѓ+?ո߷Iu3VaM˘Lm9 caj!cԡԑcR3NJ8+&pbԕkS73nMIq_cS}gЩ/]ԣ@ڻH>JYtXx=gaƵg~'d81\c:0VQ#1fctO.UEvcwAKptfEc/teۣw[1s{{ț?Ȃq#/SG/{ݦ|X'<o.E> =q2Ǒ_1'=`жGõ|8w> tg:!n6.~VFv6tV;\8j6h߸Q<);f/y;V#蝀WWż)䃹K npwxWU:֍z8_>5N¿:N;8Zw 3|ʂRnbܥEGd[a|c4#>z?Oy7!NxӶ/{n=pG'߽!2}?tgh{cD{ .G^;yӻMwc)<2{oc'=]]Tw\؉+_3e-5-~Nx'N;DgxQB &#Ox1=&>p!'hN3A 8AۧO X:A5~UD&t՞B|% <>~P.w[K_~'n52m&`q;LL'KqgOˤc;Й}e0Yf"FtND-AuDy3^soL"74dD5|3D#?9Qȿ(v?J|W7и8yO-jYj|0`"ku4>@grAh"ͺ*h#'U֚Gmo rwG!Lư}5cľG}@|8 ~%<+U\𜩐诔D{1WtfU2mlrtAuL"aKED|,${&Lߋ{di_w_iN"՚L6h=Y2YMwdq! m=Y,:&b$}]IX7,2E9?YdޘQnةK=fz*N2߀66zS] bw&ӓ1*PçnUM)تNt kq?%|7~qz7N̛8>;E)NpH"_JyTթrWִ;?UfS.TyTi{*ɪ~=U։I^oM[USG6S?>EᕩT *2ɩ"S|5U˿O7lh4WJQ1dG _L#[!,&4wiRaӤc]ӄ.&|t4᣻;ķE%i1u ǦI|:),׊^ٻF%Z/Lu6]کb%oTdxT.|3s:+ ?i>| x.g/=7 7Jgt1GsLo)0clJp-SOqiS@,V\rqvcF\_=#Ǖ3ؿ=׵3]Gp5sPua %3f5dL4#CgDAX2ClVϐ7{ǖ=+C 3H֖;y~EQ4jAw?6L3DΛ"!:o=:o{HEMH㍨1~]ob}o$]HEѱG}4tj|>C֝SWy36gަq 9wU 3)^#oDz-0?+n[o5b~o5Oyy tJom4Ҿ-H]f!}.3e##gϙe~'̙?SՖ536~3cv16H|L3SXc 2y54{Ûi‹5;5eιgJūϜ M~S8<&"vwQ@Hs;sMÒY/1oX7P[FH;$!ga%Eg,O͒Y3K䯓d>7K֟ h~;ٲg˺5@r}nj]ه3}z[̾^y3>c띬>"7 6iT:-ooMm0 n-|-|^84[ѱ͖68=[٢so} ToDCü//6=n{q7cobIÌNL;x/ֿc2ڻ2q\w{ߍKnxؚ?s|1lK7/9+[d= sM<_[2)o*o˜]2/FkcbfiCM 0:,tA=xE!g<CC;x$dYs)~&<2b #C#nc'_&%>kzU[P(9;i-v=&َ̍D\ybO\{.<>GyKŃQ]ސeƈ)nͦ|NodV8Ol+E(^[ueA䡧W]݇Η>O 9zâת& MVais iFẰV]Ql]Y&_PA؁6 cg?cBX|hGr7@?&,w1<'/3 k%-۱O6t[9+^qB(@֔|D_J,Hvl[ vw,ӈ3d~_};A.Pwq!f'C߿9hY핺3>c>溑3R8^RyPȕo9}f/y wby<[p"vC| Gp0⫈!7i&b)!o#ֿ߃xd!w^(6X/Y]oٷ NX71Qt}oOM*^Q"c|  eo*{Q._)p|[$2XE$cghxՈa?\Dl#0dc,d;iŋdȭ[,[n 4G$/B|?E-o\${ȿ6AvK7dܵen\,fτkƓΛ^p:dWg?z?^,Ųa_Z"_Dѷ,]B|;zD ZBaB'kW_IKo@-@CzXKh\wL|&]є%`^".m+Wzv@ۤ3}s.x=9ki"\eiQ:|t`؁[wc *co^}D%!j?>yL(_~Gl?P_̖w%Y҅4fA:bRjנqb/d-[33g@>/߲ߛm>$Ӻ ~E%1qQ/ - 0Ќ[g>1Ҭj "ck]N== CBB, X}Qx/:ӷai[ ?طTU1Gʼ.yRǖsij]@u_%0}7{̈́vNkò|iyLxgYy!G}]_2͖7rI}{.> L;yWlӼ2ϪX}0!luo2y[lH~\C`?nF gMȖH_$b.+}3y—.Eb3e{ynZLy0ߗS2&2-[R!W|My-tjT*~!"NJ)ӖQ߱r=0є>'R}x5sb[ϜzU$}W/sӬ w 沭T\'DSV1ŗ6asxy 4^/Ke#9ᖥre9.388_*or9ϖv,/ؼ[[^.-ss c}9c֛`ot+iE3OߣY>i1ߥs5CK{j'b7)cz;KO0F/ vEo.`qPҗ3ߤIjIb[u^3;"H0hX<Rͻs=vBO_Dr9gS'~o]d;d#V7ɇ]XAu +3wey+dBЅc(TƐRPJi3Vʜ3g(Zm*Ʃ@Օx%+%+%+#P8qN[)rЂ|Vf[&lk$mJyvJEmw0x(1۳1+l\ƇE7 *z#F*n "#سV+W櫨!{{ưq?)#f%͖tR qs3l_Ec@UbK.|/!=gt'02"﯒nb?5бZ}d7f-6J_|Gw%8ʯ0AbsǖXotɾ$k~scȟ _77?Fz__ ů?K|'a+\tm{E?|֫EZiE3]luO6ЈgʵԞ$R{oMl_Zf,_٠2t%e4af=蝈9=L:YmŶ\>­ު ލ7}@Gj}s}>{ ˧W߬Y3=b3L{K;jo [\抦ipZz*gUlSRq/Z%f-҂1PUtMh9`֢6?k%㘬7^/kԞ,'w$'G`E ڂb[;$"wk}X"9w/Ҽ{9oR,1Hx#K۫||3r2/c9ZAgΫ 7˸IY` .rj_5_}t5j!F5"}5a<Ag]k-5ğB915_ꨤgln[V;]+|\憹= oe% J|[w/.| =S"wq 6$hJhE Жqu'Ї (U#LBJ<K? x#ay0!p)! ΫQZOa+a݄(HF݄~'(!2u/3 ݸO'p[CšZ}ond {3gkﳵ§ nP n}NuV5:tmx5+ cw[ם^b}nuR6Sb:)<=V"d.+:D}]'k>U=ys=1cy3mFQkf\G;}x}].z{QfF`=Achx/ftB&빼I {0ic()Nv_$IO|+>_ L>%C\d3/,WMrEOM ~bT}!/Z D c~9KS$϶A$4vPޏ C8rLA(E|µH?3ϳeA "GA|&m {uwbuċj{u+0>Վ}Wn{DY1 t717: 4Xs݊?bYQwl=ϴ|'Zō $b;4ƟBm9_#ă~Fyߢ⫾꾑Q%s"?7[,8d~7ʜXxΫ3_re!_QX˶"G(rEo=Q}fF9'{kFy7Q|Y}Q䵟69͟EMOE&y7c[}$on4Fe$v}`Drz; C$tD\6`"_XOxt&u"Iy&$ vzor+oaAi?@MO l0$sRoӴr߷Yt l7kmfUY.Q}{T3TǴ^ϴ3W7oy{㸻wo,}iSG,/!g#76>=i ,o7)?3-7I?yF<UHC0m۠4zn!rk},%?~OXm&7HmAޯA[h?So'o+9YJ K,Oɖ(̷vgn;0-ҮkQ9Iqڷm%~ 6=[?t[gψa?Y\|4UM*o64f[TDA;11T0=[e*ivjVۄ?u&i&^ 3lmq`Qɔmq=[1nLۙۤ &m6ic\Bviucۥ9}.uLGa81]/.}e;G4 l3QCS~[S۩mEyNiȼ8Ga{dMM/ > Gdt`L^81S9b!(oY ܏7ô5vQ]ͻI;7,I2>moCb;Gii߫2NĦ3  ܟ_a7Quo$i&YQU2`)(* hTDDp@+2W{aw(ʆIR>~[xsssǹ{ιCB|3ØSooj?שd?WoB'maCS*wxtQu*]nș!_ "!"˒!l"CdO<7D]Q9D&UnXk9CEgPC/ ]׆Jo{s\o2|X:S,yP᝖ų{"nV`3K0p {#-Mx9 }6ه7@arm߼io8P ^Tmah~ODiY2 |1[>`u[zHٻ;*HJ7G ;۪$_̏TwР#[H=HG}=RQퟑ"8RP %^kԣ_zt(G=}ϸcϨKwcؑҮޔѯ%oFɽgoeDo\Ɛi0#3晌>qc+7H*Q2oHDN+~R4o#+1+2΍:+2Bw.Le+qm߃|Y@hEnq1||2ph+ BDC8b0IQ4xdVF\saħ:#6l_v!}pٻw>0F)#:#> -[iƐώ\xqsF!Q4+ECcd=~;&ǜ~$iEЮ?8WÞ,ƟԓQ~n_HN?c\9FhFġgl(¾1~d49=FtܑT6ѱ.s,{Xkh~Tűw9Xu.jĆXG{cأug @/ƮsljcroyQ[Ww;c8XƊϴXmcc.6Ɗ=Mf_eXDZRqB~Oݏq4FG-kԽdP[Y}fWQ5ǑÀqt [; GP]ů]2-!ߴ;=;M ƩAQպ>,טm^JZ|=m1Gazo('~sxK`cH;4N|'zm7px.5^/'{4c >r_Fo}ƈ}4bY1-CFm9h0^Κ}̝ܙ?>w%}N,7ϡj<KjH%Vp>itT3]D|4iS8ɍX 2SDok)DX`7d^ռ0Sj>s4BGVSDnls.S_mOaπ)?O9|w0nжqvPG?9EX5ݔrM y'kȋӃV)z_Ng*) bm^̿FyB^z"Oѫy;>/.xyHѷۗb<7g=DxGDȓs0KE]*Q{&khdP߻8OdzSezݗ? j U`޿.'+yrNBPk^PtlZ"͘*Ϝ*JodS\Gp6__VS(\PixgMpw8$A7zR =y1`(;y&7*Knw/s>`l}6ƳxďS#6^ѲTmՏUuWd{UxRWA-ۚ> Ը,UW_.DZs*ѓP0UT9\*g4{&o3M&o<:Mހyz49ӴD^ m{W4ޮg%v5=Di%HQ8:;b/c*{'/Sk }"}Xi4Cxҧ]6ÿsӄ7]ό>p||{Tʧp>x*ej\+VLj/>_ƥs{|/1?f{k[;3η935|WnL|`hk&~;󉎉,ar{/g{#DWoL^VGg"9+_L coCV?|Z[K>#cg>;D_}B\>FK{0Pto ˸S9%Dk۠Wc|2Xe??]YxtNSķ Qߋ8P_Ny=_X^?星oD!{+ޡtvøt&O3tV âr&` ӯ!Πa"%Q QK-e<1L15j3P--r(盪T ѸL3XL 1a =ϛdӌg8f j4S3gX蝙ԮD`&MgJ~3S?c$0Lf}>lߴl&Mg W$`4'%}xE̢gQASYT^h,2Z-,=kưg +. I!y؟"=ۧo؟f==@\eY,{ܞl%>-ħYFv} kܟZl>k^B-󑏯x4~=g65yZ=K{ZJkJ8^n"?[n^)(Dr(Cqa ٢OF\ BvΖ.|~s:zҥa#dH!.s*8k'R\WQ{2?tAy,v֛'g8hIgG?4xW0kZsu4x7"tĕ[jwL/l/d͎'soݟ>*B#f [EM/w%H:w 6m#^c+Y/y'9v3`;<֎~ q_Dċΐ%ga^)I hR2+7DydEj^Z|vH h:ǏB;H<@lc, .c\Tw+[jc5᭞h `kx h:3|Y*XQPr7?m \3p}NX>Y7/\@ 6@  8>hJ S8dr#\wr6f\),܋,Uì?fy:Y^B^G4‰%`0˸cL >5+:K2l\Oɹ $Y5vg$(z3Z3l.&yUy܎P~p)H%F2b+mbyBNgg/ds[2V6W?ALuOZ%Wt1?#%/˩azm(wH}<brClaG^)s))rJY9e`AIl +{/"z\${u9D+ JrLEl 5]ļ"ӫv YY--/ :șEr]gdd xfEe\7e1t7.|}iI)}Ehjy8LO"ڐhM) >"ƊP[둨>s%6w!XD{ݮ,Q4˹X?z^UQcyӫʪ*#V9E^b_!a߬JWhKl*D}tuC;A[=|?d3T/b'b_C?#W:RAHZA'/OW<+;9Ӛ3{]\ !|Bd+L4x"8tʗE+dY RcTk b Q~s~錄8$}Q0 xڷ0ߠt~F+Ef_λR]b%T~_gJO=ƈscqV}+crK7oJ7d\FbXu4L8:LRWD+^|8Tg0JAYHjT5O7=[WxSg)%\S; 8Rk+ӴJ7'`tĉ83W qοViV*i< qX]2) ;6pT:4/r vdY%:Wɽ竄^|g՞^nbݧY%j*W{۰J;%VS@?ϯ?VVi萧?VwEoբY{m>Sjl+泹cƠ7{FWS,S%e>b+`Y8ZMRjꟈXKл5ΔҌ{PpCkxL}Szg|/H^#q6;!N?^a9Cx?j3<劝Ut~_@5¿5$5w~/ z<\Eq~ )?քE}Z˰ak%{d?%R x JAu11dh | ki42 q?jWkkxk荳GkyG%z=iu7tF6a8FѨF+Z9kZ+v Y]׊J*=V=2QԷvD[]׊fT{x1=7qݹkLOݡNW70q7ǯ0}msaoN/\+>V"9Ev9zǍ{fؼVxk罵Vx^:y+u6['mŗJ~(8!kMİDLp YQziFY7Yi}z.7m̔6 糫qd1ĪS>ͭ|Ǩ|nw͛ .ou ;I޹08,;~>Q9OեJ9I΃AMc= 4BД1 &[,u$7&u}Id]lJg2tyҪ?Go"VMO-$p&pgX"#]c6owbä>ۯYQ$68Vg;8Ԋyrd-S":uSN5,q˹^wn(oWTT"}%>/j֚c~^*;m:}?9ަ2mYۈ=!w G {2Ø>1wxj%E띒fK0_ 7`Q>WڱYd֑qoM c*wxH&Yp_E\l0Yu,&j-q2(_Mi9&$k[-"}C]wn7Pmue8YHaLsgfnD}>, ^Me<<_Dl ҁv!xgkE(w7m+7ҽaVyG| G_vMOr:sV7%bwĖpb;߷>h+y:g+Y.F|KZ''AܕL*B|Jm!՟x^~XAQ7T%]G5N&u+>wPvUM95}P[ b ġ G fhyﺥJ/Kt3GIĺYwbgGcd~~At~~#bw>>~k8a~6'ϊ ۈ%ҝ4%|uZ ;֠{6;Udo:^&4Z߮SC]6mvs޶6UF}$~z|s zNۥ>.~;.@~]h/c4qkؔ݀}q}M|ߩ98kԹO ˙B`{ş1qVCAWL[n]^D:5~mrf˯A_mT?/ΉKǁvs|b7Qf܍e }C\"`O!v0- ; gy/|22~wWdA_{ J`41MiMiyL;3ƹ>6tAE wX;DFq'Q8v#07hw>i]C V;͈b)~ ,Gv0?k9 KND,EҌpN:%owG~N!ޙHƂ wRg$60X[0Fci'Zs8d J~\Xp9OʕI%ҟ\N(ic8iNsKZk}$v01|.*'2js۲v.~V1V];`{1`iqm$_nOEE/Ų]fGq(FwXvACJYnG!"#nOyy7Lt73;S~"e4cQ,I]8K];CRNjc(j㒚%K+Ϩ|4e-LTі{HdB7CM7V{&=E=!ԛoq;`72o X{CMjٺX2Y!МKܗPq[|dM(qh }߽{v-q^g؞~;1{ K|ECg-oq{{eO "kؖfM+ў|՞ A%>{?'~-I?s~/b{HHDgx|_58SC#{99du&t;U?Nrcc>Ӽ#I?wR.l>5/S<>g\'6J1uTpΝ_-w$A~ o./glJWb1./qK\eUލ4WM&yMen_x_l{k~_blZ ^9qe?;php DRDDFDB,2J#A4kAA&aYzHh2}׻#'| CuKH!3yˈKmFL+"F=Z٣t=Ods8ٜճ3"2߃Lo &aI4NTc óx𧑬a+6vlGbk@;ţQHܯdrtgb9K0W{8 J^^| ޏld2.2q> l15hĿ{@;yI>JcGɯх dĽ3KVI^e<%qH }rgX@I6?U ?+hrTo޶@-ΟNp'm0G~3aH=,48a/pElI臌7&P<1A,Gwb?C.?,ԹoK]ϰ?Z1zi0@1) K ^sKg` No=iC$P\IRE~HoSj{ڊ.= Ԁ5%, 1q͛'^\Rog!z7H=]Aq A ROWzc7zFunZɇ5/7e߭ZWԪ3О@hemDa٪=YjxnwfyD TC~wJ 9,tw$OX{ֿ:,Sa ͟SJTP;6cs* |)1~dCǎbB|BkGb~(XqǰK jK?A+푣Bb 8/'N 9=~;Æg~[_8!'ޑ)> o 'dDG }GXgS= !N؟N'd;!Eɧii8'>>z+%1ho/r֨r?~J{ix8<>q]TnѩNU?J_τqvV*Ύ8ھX^-/7+NI/PJVUP~wp@2{CCh Aѧe%2]孆<״1`(L{%k:1ݔfod+0Uf?c kn~KWIg\Y?C[BXH[=ەKG \n0N^-zmwaƀIƠ1cJBغr8*k2χGcc>[pJ:RUD㒞yQ_ |^FKڭzCIgzIҙڞ{%7>YC,!d6|e>E"o|Z*q[d#H'd 2HyL%ds2!.˸Cw<~p<;d!Eߗ"OS&=ۑj @܅815ůΚĿAZ2j =ZKɚ2%Njxiɵx4cPQK=5e}W%O-YYCY%:O' R]ASMĻS ~(`b>‰y.ۿgjMr4iW0H{#vk^Fg5԰jI#`~ B&igش;Ш`8<&Wث[X$=#nzY?-}hz7R^bY=k+4YOU8[?PAb gOD AUCoT?+6b =w[{{J]#_Yz~>7z3l.Kq/SK/ۊ=qv>Wh1A ;+ʼng1,cgeoviy(q^<䴰wc[#x|iϱߎx#}`ڳ!2NkI韜c/ɗޟ1b G<` 3H_!}9H6DJΜc~E4J5W-=NG""7zc b^$̰EzQ'J;L3!]\4ɛ[a%d7z }+n~>@1tcioDeVȄ+Vt1?7]wQ v!^Ŝ{䍲x^>|90kXE?eRo]XPA(sfbX~XKqNKTIeWorF|R,`{Ӽ @!F(_r~M#οZ#+y6I;U;S;O}"+ݾ-fFJyYEAex%}1nعtןW~{~|O58&GWOb|霊b%-K$e^0sA{VZoӗooԋoTK7MF$S|I=>$~z]Q?^.⟗d$:^i&4GLkxgW7Wsa.Kt/A+$O"p x#~YeqᐣvԽL})MwSZ\~T;{_7ܦ*|K%G-$=^*,c降Q՛Ϻ,,bbSFPxYl\Kw{ [nOu?5dUORAa1+a㊼Mq@i/L1fZr~imȘ MȂa"ޏ4:".ǵ)@[Ǜe7O̷YȚtCp5'#~D5JC&=]uhQ/$Wr p7`WEUy;D~5fxU{Um2hGˮ]4.-]rĺ^c}Ѻj]*d?xU]q2|xگQyݠ5Ex^u-F뾍g?mt-vW/'OўX:\Sw'_!6_H_;)Md]5`>Z؇d_k>k0R-FoMJp| @|3_;OjAu֥D|H IO]gg965oK[3!;p?uL:Ӵo \g_| 3*7ޗƝ^Y%rQ-:\/$.).uWl-7$sCgrP oq/j;~RW7Tyݠ^8n8L!=56ߠ;'v1i7 EKR1Ki@&ͧpMM=Oߔy| Gyj^7cv=Oގ\_6-Bzܤ|7p& [ހMOӇ#.cY<&@5aMckwPQQxSƥ&8.- ='^MnN:f BOop.BZ.35ư'}n*4 E a1?sø?xjRtDZ0r)Ĺgu.Ef ;t=/^_{%~c~=ί^xA ͥc$5fj}.Hnnܡut=}߽T~@$ {Ö&tORWsS" ?d AODqHP~ ѥtt=}olt=CDx;Wdz~qN?i(j^Qr6Iw!{D})lVyUۤflwRXeU58ho&880[YߓF01 $^wHN{ $^%Fɯi9t"K96Uxsm77a [I[h]c%[2-%>=ɟO\'$>''o͗xo]*6I|RDNJ|O.'?(K~Tڗ#K%.o@=%GHww$1Fy2[SJ|O.]RJ|O$iЋ%1i^FHGӫH| DR?R~)_j̏&?'H;e;xwNxwxfwxDCmnӏcݦMvSݔ~l7F6?` TN'UǭI٬^F(h7Enĩݏ(bfEzU@)=nJO p7' jh]',3Z{š|OD}O yyHO_F1kYh\ьp98.zD_+B$F+1,8P$d& , K{[Z :72~vp9"Mr;G1Oú! We,G}l-1>,|a>A]Ds;ОZY"ڻ˽?9@Fo!ψqO 1% ϰc鍅0~ܛ0`-cv"Fot#} 9y -%^~7*6djϴytVߛ8$: :~6A$Vt^ 1bfT>qJV^R%& {bn.` mno& or ֶ.ѸXt~ks*S[7: ^7?yS3ِ![EPAKG̯ۑ7QgVUȃ+/aFwO"BB.3\^C|7O|dײ:MnHR^G<]'fOQ+bk? /_'7-`?(MՑ$Gݿ'qjb7g$ñO0I[:4)VJD/Swv -jVt5)}sYqwK/vw[6s}C$?HL'T91 Q}!kZ.cXq_Z<E)~=GM茉׍-&\k>0LeGm2Ds˦Gvq}ے5@w=n'&2kEG=qvu3ة=T{ 'f{j}jh"\c_6!_}.U3_mX.(^_jCj~=.ʐt-[TP]/!10u9?4lHA{,Лňwbs op9K4o'!&f2m2E:ѱ|-Cj#j1iGƨ F~9=]m3Ne?E߲qaST6|ݘGEtAsU揊vr|}OVxmmZ11}ǩ 5/KS\wٙBhܣP@ b.Vy1 32c6`F d0(ڃ>:_K~yw6K+:so9Tm>E|_ @TrSu~K|#0 Tӯc  OW&.eKo$d>8H:sIgΜ\JP IݿP;HJ?]_?II7 %M+ 0b:Mizԏ:x+')5% =ȶosNyŘ4bL5^ؕ&ȱ4ŋ #/Nt9ܙ.|S=]7O o,]xA{7]$׆H~mVI~mNH~׭8d zcH17g>SJ~`o%M$i7C3 fG}XJ5Ӄј{Y tjŦb-F<]YsVaR1k$^˒xBgI;%^վ4œA|GeHZXMGj]I옓?.4҃L+ߟNP3k|lC-'̶a|񶲙6legd>legfin+Tegq>syK֡VRgEf} Gr*nEl/DCouIwt"&;/'D#a cǥDkZO2>>0Q~͈~WrЯ+_7PPʼ ֯Z`9%G]ɼZպXݥSuntۭn_ᶪHo[7D>q58+|[4Pc*soDTO@Jy@視5p~ߙ/;y-gnGnGe}t(Z6d'GğӺII5_hZXn9Xx"3faDgNP?}  B21q}c~.c@k,Vi։' `_[eg&g$>C閺yhk"WOYwؓ)&e3^F?Y$9A7+64S뎺63v.[L'-L>|^_M$jGze| 2| ̔L9eyua܋gu0Lyp1:fD~ѯ(^^4İ ͈́7-Tw#JtiJQkְbF聾]ZYeYUZ<]Z@VFS22*>z,#|`2+#|{_-2>HYr8`/3%uvJ}IG%_9/)!Kb %Uc 'e$ɝ}_2}߬v%t,1Y2Ӳddxoʒ>]jJZRQhtJSfucVwtQ1g)t'+rwH OT$aٙOǜc@j*$˒C( Em&쿄2]GUlq嶑0X6oK WqԹ,w"We噢rkN^eş۶.LTc9$\hga4nUCDqveӟzyG_р֥VͿY=Yu7 UuJ .F"9r$|q]CI**(MzTU;72 m{B&;HIq%<ʻR4f+YΥF!FA`ԏ.g%<^;Ty APIX͆N`;Xk2C}zG_$l;DlmfAKPz{MH됱]MrN*$zC|LHĉQ~RjRSI/:V4_: N;97U08/҆^dS1&;|п 1H',S Q:}C۵`ӹu ԍqDe\ѕ>t@k߇ q oE!ҭ{$m[)\Z e HJlsuQ:YR$+_4!v'#v6H3u~d /,^3֑ɀy߷P˧;W|&}0NF8?爤]Y!ivke!!O`#[q1b4AI>+J!%ObJ$ھxSh'[ef!oN6\|)eA&L"}N|B%H@F,^ͣV')R\fuAMiI[:Y٦1p3tͫߘcm!e* |-Wv~s3<(,Ā*M:~ʇ[{l4,YpeY&6mgD`XʢLD9#Dr0YbxcHK2l8j fVEd.lAl%5x6 E'X;V;xPJWJ Ôm*L=(‘j(_:< FpX c6j P|@WdY eH1$G8ISZ'3M.WAhq^V׼/,Va8U|%YJPY+nJ6 Y>hqdJ#\#~LE${ؘ(㋵X7(فQ&瘗+)HW#TplzB[>Q m98tsBl&͸ n AUʯZ'?lU’||пV6]> }!UI%K % ) !ڤP<;U1epe@TjٲjUž :qʺ|XOh K9V:Va1H_$D^lQa_4TQH߈!CԔ|V忕NӒyl]֭CU,.C\Emylx`ac:pE%Sj7pRACCePHb>x9zVZOKDbhRVgsOI1ɺmh꺠>i^2B#Y9Mu_. XD|„ >T^1{R8_b%Mu !ʖ(+n_؇I^~cq2AiUKӥl!4lsc&5)W酼N@hsa)!EL+`_cˀ-c +fDǮ<5Nq)~nMؒTeVٮ0˦Tw#N49hʵA5],z˟"u4?-dZm2 5,vẓɧA>{A`h{_? MRF~06v*OЭT rc[rhQ ">~=*۱bR*)A2t}{㛓}v$W7Ë0WYNfd'dDKӔE)}dXR,n~j`iO;/{~(g(<{]0_v-;\KGK(\ ~(Xk!s|"@ %1[lSDl vX(>üxũˌIڭ"/`PMd pKu˚C.>8VD6ڣ >y`;z\'xq}/Jj2qrw洉'7,Nk#Dl m3\ Pni(# { xdPx8Z^FGX79 ]EԌș(|ӌ90E;d+-l  Z6.^*hDeۻC͟˯nn.; ڬc5Y[VC٪ÂS[ZչyNH΃ԃM;3x)z |ĝ{OCY-}RTtڒy_xﺾY]=G Oǟ [0w鋂RuWo,[,# B#;k8!!c;،ZdSH4B=ʲΏ=vR{I#NfݘAsv[D8/0v؆dƄivl8I)7x#O46荾CվA>9z&O1&NKMB/yT5o{ET+hFz/^Blt0\Wpȋ|nb+a^cj1GiéqPgar0nv6BLS3WM8mez?.V@?=C<,ɉ4+yE¡T2Jf+g!|@x EIؼ/SMc y<7a b2Hkr$ euN_23mǁM^lg0rXhW j郋Ғݘe:zn,wƐ#r>,>ډk$O\AXx$>)vvNA/s}>7\K6 QeMdVKeEnh D"nQBSL# h\_vA1-LbU Ќ8L &&ƻGk-J.Cv"Ĭi`yu1ZǕ!*l[?M}2)z8C-}( yz@3]Y`j; [*z fI]V;SoB+,\S#sNcrl (aE@:[/8%p馏`mEhX]@oh_=t|37ɘozu333C@p m"eb]hgD#4KNНb* }ħ 㦬ʡd_u=# , mvBOBRXR+>nMfGEnm["V[_W`2NpؗK覛1N +-]x \_^IsP}y=>?.D_/V߿w7w_QIv?>WW%6$/w?N}(wHw§yx9I>qJpnI?'˻oz[/xqz|8&ŷ7mn.~Ռnq{BY]Ү%Y}œA;}zi[[y];2H]ʮPP^IFcFNWv{BvE(C86NG❩ m#ڛ Ӡ@T df? qi# Q&Pd(!.aש0`KDbA66m8Vcj((RG܎Ƨ `hܷ GjJ'BkF!Ge\G-oc PzM&jls;*lBR}D-M,ol\v?pw.zpc8(ܺF;```r=֔9Jll- fjOCBZ8JEG]`VXcBUKhZI'1TO/L(kC6-٩`kpf*QOLF󓸔<9 t9D[kۨ c>e"Ǚ)s]#ĢWe1|͉X9 {hab\]).%Ut*.b)8AREN !6˼܋#K4s)g}t'bmBÍ%J ':([/c- P nTZ%[dBjvv&_Z,2$Υa e Hf*/LpiK5zX<;H.U7; EB-+7wu3eF OJY豢者sCJ>z A-2fwT΂C%eZw0a{' 4vt5R*HVrhKSȢ$< ݔwvk.{VeZ'$;Dl`aӾ'eؑNjd_=>p~Ϭ=7Tm͜h'UGҲPy7=ީ<P߭y*d},(J4bcӉ~~yT')‚ 'R~Jz7dЇ+'*:oTtp m,986%Vܦ.fweH i9!c,rzzT{0G(cU%<#J Ym!Mz`R}.M\D/Z8 H c󆄽-hx|XR#Y֝duRpY*Њh-f^)JTIu-Iߔme>{dI]v%< erɕ<ͳgE1".;zUEJA,TFEvPex\VwuΧ_dF#r9sS7ͣ Yzǹ_ۅw%R~ RxύkDE$ȔnouO{KKLf =oQjEqx}}kʼW+ABs{w}V-ߙَQrA,teQt9|3Ãh4%vx~D1USh>#vKOb/5;9~:0%)I<@Pf@ɜC!R%X4;Bd0'KO)!<iLI]s"t9{[ LH=lEK]E,3aRU<{,LbMj~ABJ'1+ [t%ᴼ$'kCVEQ9ŕ|QIu+jJH- pχcN]2;`6]5(@hӲU0=Y)ۍ`#@G:r,ePܧT pԍ=B|L:̘a^S&ME96(颕S-x[\~b_ozo]y#҆8,%@:T|Hm9,RgNllc GvF(;FOwԮ%r-B*1'낱4>K-h oEIlwgD83 颂m߾O)0w)7DSg[~õY~.A O3_˟\ G ^ߩ5Cuz#.6+ _2c )AASkcY V[cȊ+̅,am|p^#M/ ΛXT7 mCsj+ s8× j# ߡC/ ~9;?GɄ5%,x72ɷ/9yP7Vu4-:Зh)f_\%rIsNs6uR%ӗ{7Uw=3f-5H3;wYEnܨh@MYZU*!: 3& FUuV26ԓ͕h'#Ȋ;v<| ]2j0W fak]-,"|\uZQmf:-%>΂iHdb[ A Ľz'/GNjǟp.+7?͇F^Hr^.XssHu8ugTg'[\c`x@lU'Ġk.ColBF)8R q^fя&6o(aTڔ>@]oiƎW תTsCi!- ^&'盽$ԤCt2U`5͍|ƒ&o,oWEsb_O7w"HT{,t ]0 ~R U7νHJ7Qv2SB&?n6uf3q FϜwM-?siqXۖ)nܘ[8sA"ZL_ю|Oqh<Îm`Dke\>b}o >k=C*\%L^[Ɗ<C 4Ny@jwyt:~s^^IzyV|qy}Jr|wxJc*'d_ҙʱEL=W^p렛 68ܜb D˷$5_3F4{{g9KM Tַ;M?}QN"e v+PS<Ơe-)ZDmUޓ]١ͦQ)S@l:yjgUn_Gy~-8ѹ\o#~-ZUƇ)Go~ 2fm'$iK%Q'ܦ)[Ԕ(-j v۰z) b$( UBWju[@Lit@X go^%晟o2zIsU3 ѫFG+N8NeB$ :0 lv4]Ga֕)וilF]! /hZ!Hw ,TunY4 A\~Z\eCǁTWb/\:ڰ('%Q]qd^q_}4jW!^v!5 ̢Uex 8Q#p| * ҧ@7&&Fƌ0 ±05oK6ڜM볹țn z.s"YOTo%U BxȤHH+!pJl'zp@TT%D9Ye$ ~K%2)/b:OGl}5`;ήзK22Bo5HH_dnuH2i:vu2UaiF{ʴps3 TfD<)_Z` n~.+8ܹh#%f\ dVUP-j+YW{KᙎΟV֜N+uM]u)#`QمI׬c}t= _fgKh,T6"t˔tqȒ;X 78mDtՃδ=f>$a޷VvY~Rwej.?ZüH_.oo>8A;%=\^J%)l?X: Teu2{5τ7:_+U+-xV^?!}i٧QӇR\F:馶5zkYWu^BPCo/^Hyca!@Yf-.+&%s'FF/w l1,^%MSEix넣=L2O7X51pJ;ɫiC[W#8w  *;Gpt/~x@\&RDS}v+Ι&{7LWEӧT<1u%0N/bdQMD\GaAWKO U?|΄tTZSr03eq[mEK % knnBܜxGK*/W*FBTP(K{U*I>.wC7ئN@cI65*ºpz̛%SWB;sQݪt Jq?wg*@"8$pΏN:2OE.#"q׍?@JĨo_V ifVyPHFzjh>Ph" za@J%ƠWuG6PYtsb>#=OTAe}!N_ŏ! l J%g k]n @b :J~7Yfq$.2Cm"d)^r%O񩥵Sɤ_4vZRwb J{ cqn;}3X(, `;NWNݠ` 9;EQx8[uz [|\oXUq5ijn] i5P>?9Pa|%^Ni+L6bSњT*ul UA݆RYq"MnGRLLjzEj(w6 ~1M NXb}VW7aǬ3+Ѯ\N ifu(@ޗ<^dqJCj77?lqzXYEz/泶oqٕnΕkW6=̘nԕEƨzEa/͐//=Et?ڇ!´ G}$0')} A5dym::6B-]]pyʮRplt2})ZZ*tG^-%p>ZCJd;d^iٱWqBCc^Qk|)XO}dGZ UsbϽc[Hi>i2㥛5gv\iVRRmVҮCL;ZШ"5zWݕf[ /'^+$ٮ* zHԖHipRbqAȏic إmSŧj [[ 0nqm\qtKN:dȳ:%u-paa8܃w $0swt"lbD~gdkOpؠLVWB |) Xֆ̷X3%3KqΞd;&Gu||:6+{-֤ ՏoT3 М)ǩˡ0Qak 67hV5ī/bev=jUc-ZUm&g~ af)o$ַx0 `ȜfrUa ,FU@Ь2b.P0QɮDݰ*]&JdJw4S % S5KO 0e*omuTyhkE׾S%8o]v~A(k[z/v%K8.KHޘ>= Pg񞣆4BZw0ktVm"dZ3Xq-c cXח0e :yC k*Л`iai24t F(t-+E.0Xswm'<[.L[ص V2t[0x[o{pY1#7mwQSm(3 Yo<: GvbE;e& -=b_ѳp!9ds4(d)@r]2u0y\[Aw[#%~WByhT'xm~VJ#WO,f,I1fftH$rQ%:`r[&0s|k_a͂p54Xw73jo)܂sޒ!".M]Z>&u!ü%n~svi1C-DKo6@$116ƾ0qPC~XMIm>çp T\dP`: H<|*‹{v]Ml3 8,tFXyH *ЋsǼ;ح~CJ=y\gec I_RڅgtC v 64!2Uy@J.b7{\_ŗ7ww8ɢԇ rbwݏWjIzpxW(50Q\|',{U^TB-8/H BSl&)\ y1Lj7Iz2`\dUOF\m.h4Pgh [BӡkJΞ0;n/U#8c%/b7G.@Ӛc{P3;tTt9%wvz%~L$,|@uyF9Q[_5ڲ5)n`x^ lyKsFY/G쩣@Kbwk^uxã\u$ee}ă8F,c/ΣncȔO` )qy6RRLj,Xlsrc!Yٺ氳JZzob-]gІ2.tZ VBס㜃Q=i#G|U.1 p{D *MS*W9=Iи:\ڇ**I fFћlHOAj8k ޓ˓.=H7ua8$.R62se7vODD 0HI7iUރGXx/<.{:-gׂCbst7 y^sMdU~Uq\oCDO}Z) $'٦;*4qt/ P>O0%W1OlBBx2ƒɦV>SO]P`Xc'Z8 XI ̴{2dEcIT!1UmN-6wbXʔљKkK_ay&vcqhG5yPƘhPw&a7EY>H']t9yz7<%#TcLCK2S6ө$)S'2/`cKJ,#|6}bq`Di sJ)㑇j6NrkK!°Z$ Ce09lJ]5}=t< ʋ~4WW"懺AgK>W?5(!߻ە>ν> {%* VQ=0XpOލ6;ԪлRbW L`O,Dڕ 83^0Sd58gBX NET_77^ ;ÇB6noZq5S#wD!9 9UΠՐGG 5+gV⢉Sq7.1r28OeJoaF&jN[`|Z+?j+Vas-H?&57:7o -E"(`IKK 1ήw:T蠠"\m@;xS4d(|ˣ0叔8/}B Si֠˦O\7HƩvZ?] q "<-^ŷɁ7w||qu^_jзub㤓 A,_DEkE uZGKhi;{Ξw=ygϧjh)w9JMw槢拝,3'u5\u8>Fo!)_|x ]w`pQCJYV EzCΒ;hx{,Dxڱd?Q\ WX9 /+z^$_>)ѶK>@r|qsϥea`4ˑ\  yK%}j#߹7=y`3Gգnc|*Lzy$_=?T)7N\"=>b=>~yϯiJnQ"׫w,2?w׷񷧛ˋ7oS(oẹ|$$秜JFO)ߦGhyIׂoGhK5~*O|qՃCEpz א2XmnN?'n&c>z[\i"(*5m~KWJǹ~>&cz@;[iS=)6$Po7Km\ž?jBh:n9O>.Ӑ78˚0#RQEԣ]3X?=LK52V;\Pd/k={/l YS|e-:xf/P#+0mZ`5xUB^RkgV^0KY"`8避Ӯ:Vڅ0?$= VJG~_{Y ?<CghQfQ'Ad%q(HI]@Տl z&CPC #nޘ%T5V 3kː@mR尃سg.7ʎJ#43 ãCD^Cp􀛊S=@X n&K QOZ,Qbbhek-%q14]5d'媸ive+;-dbe8 ܥCP;p:4^B 4Y#"yig!Dzv?]'9N|#^]TYcֳzãft` @_]o\*z6vd z3M;$εi!?^ n?[!`JIrKVzB%#6 9-\k~e~ykvKͱqc$JT=7|Vh<} aI坾jC'd.)PĤQK5|1./>vMdzf0eeaFKa_.ヰ2~)uվXQ{+K3̊L)G=`I6s ;P҇݌@ k%vaYBwhx'޼*䣽tRJW'8xKzZY%aQi oHz(c6NDI$ iBS:ȈC7 my;wBL͛vT6y?3b%5G(#&9_VXA:`.m`ȕ#R=q~iKCK HLkפjAm/}}WJ4*{CZ߸\ã!`x'gL$jj5?$=zuX'Pkiٖp9D}lxEZOLV*12<ڵE5:і2Nxu惪WjdN.RBIgل6#AۖN m҃m^ɏ%=Fq6k l?/D\^绀Df^C 8MU@J[*;t{?L>mҰP?:&[8ny>xu1 C!oوwy_Yqy Bv# T~IiU@M`Q@JeeQ2e2킰zozz1%C |h7crXsT4L/*Ӑ}2׵G }gA3Po!#]0nB}MU '? >]y_?"x6pe3r3WN'O /lw۬8+ M#}tK 82uit!KId}e1fXckf cerHѣI., /Kf&a6˅z3_7 fnb.;}ìììC(yP%͠?|ap:!ؗ}P ΃CeV93L-dXg~QҘ E20 -SjU/@NƢW%@¿)^\̄Pw/c'()D0 Ncu8[B,ؐ5:('t0eǼ!t0Ug<:RANssHmӈ0쟉mx,?GuGgݽ]p񫬪=U/瞷q$$g Z2s߱i9ih‰s\uU)u,K Oۜv$tvJXvv]?7>=<~;Δ^xO & ˱i%51E)(aL1a^34VLj8䣺d|cEOuY\Rrνs6XjUiʙ1Qz9\ B#+f@YiYp AmR&)hXslcԻIm(ݓRz>v?Tt&ĄZ9 n<Z& -pn^yJ/9a 4tGG䩫rLh|,Zy̧x햙\< BNZΫH/k<wQ? =.nqx}\<~V0ĭQ z}YYS"Hi<Ǻ'vlG56&4FVݲ~( =bCa S壎DTʳdBQd mJypŁ7U(maf>:H.04 MV҅eo"uS4?vJ^LS2"HogdwCӠg B3hؖ1ӎ*$0B/z+2X^|/i} @2 L}Nx(,SE >O6c^VkGT!jRr 6@t$U.D& M ʂvc/\<: 3z(oB޺UFK@8:]ᄾ8ye}ܨҪ NP0$Z&s0s ]}kvIИead,QR@o aGo!(dMECg0H~p]ScZ}w_W([a9z* ~ԀOɧ:-*bE3^XI/сwkޟp&n|!$cf#oϦS^5~Nhv+gr\ 3QƧkDJI~dn5u`2]fDּқ4M0Mܤ@HG7?{Jjˁ7K縗# mD2(p4J8-X~/e/EA͛9i,oӏ {(XY/R{=wJ 6Pso2̼Ԅ3uKl ~gfM*iɦJVݔ'I,GRSU04(, ԈdpHf:H|d8NV( ɲv.`bE1/GjS)}+ R& :;X1 =G:zc6z`aÒZ%JIxgq[HZٱ omLzȁ#+0I ⓰&h"ՍiS(m=#ĺ}>vCja ۤx\o6L$:FpgkCѷU HA㼒V{^mG[ >S g92G"?jRjU|YdߓO.ޒ>%qJZ5}ڜ{9og, 2"^ʂޫ Qԟ1{#'ɷX1>@4[wN vzآ@7si/Gn1h j/xm̓N_Zκg{כj-LMX~MAQ5p^tv0X ph,8io|XPF[S 'I,{y^6p$44sqC|T{ޱWj~qcRk &)sH&ƾ>Y4SנXry|xkRo^WW3yt0[B}_ԲalwQi~si>:G8ŏjH$ v]-F`mʭ2w28\ztl[Y}g%N yps3kd/|xS^eN倸% vvvA5S|CP_haQm\Rf+^8,&kZOW4?B}nbY!?fc nyLxXIDp :8]-- Q2h-Eש l yqTR.c׭pNT\53&+ 0X-[)Svp4ִʎy vfz#J!-]f5 +Qc.V&idFMKԲ) $ *xRYuPeXVylz*n\Z Sm6x19a6= (nl+Ysb m6_U ֍^g>qX&`RƁa0fm53_\sUw'̖eF@V%!wsDu?-=aj'QoR1UxB>zVO! #^+ sgA`HLSg<4ݾg u2 Q 51{Al0GvpvZS1=(}-DC2eޜ",OFkI8X{u`k6hm4{E\4?T(Hv*H$*Dr^/nI=6BQjW gqN[,)p9w$eilZA;UTm= i׎f"PP jcӿ7 ZZoawc ma_?:IwIm`](՚D׵6,ul77ز9Y+şӰ9uY'Y^Ow}gwyC߽&o[Sq{3n n/ްMyl~S0(Ž&T|1Whem:h+?m,7i>51[B'!@涗L6[&s9!K/hp5Zf.;l(5jT]%H`0Ukii'^zhX' K ĉ!K.d mΫը +4&[Yi!=-.D0(7( f;Kv˙.$aǨc g18n]0} r~n% ㇴ :٤9m*\RdѵtlP5tkyIl\nH7YQn6s&L` |vhh70eЖZ3W䐶6ˌloe1ûXD\  ABg%alO.q䥕xEy.fiP2}L@K*dd%mLYj4tehLh!=P=!XڂfLI9.5spv%HlUTbUyO[Uw\Ugo޿q~V/'VP(E^yR^fˮ7zHߨ1/a;D:Yn1 ˚<q8_g<23u:FJ;c4O8<Ѳd1F#,!|3JcrBɽh Na9QN3K=OlWP]'@(Hwԁ!f{l;fe̜ ײ"$_B.Ա7+NLrL4HeeVi0ίol2HȘS5ǭ*7mOdec4Ǒ>" eU* fʷ xFjQj?Sm*J$F|.o.Qvƚapm7OO9Df5l.C$;tmi] TE wӭ4=N[JEgzEm.;&  F`Zmcio4af+j["cd!dqd*Z!ǧG]}`pVp5,J@z Ъi^ֹHvO*| K1_ Cj]ҐR}Yg@mi%5VŦjoE=(/h`Z]"QYH67PS1h_49}虝J2.T(|@A4Z@`vy,4> m8[#7-9(NUg^U3WyDIK/#S֬=uATX 01\M71 QVqn:I3^TH4nEF).jE ^ZyKۭ,Wov.2dƝAX]m3k*N>n%((4L7ˍ,;ehADYb1`uy"6^gPOkFW>܋M>l&@Sp|Q  Nj-EA2ߦq3ZD%Ε%zmhǥlIw#Fɠ@2@E)fN0~c2t{r5Yv!;*~XQZj^OmnOuoOp68F 1+<<ǜǨtFZọ0l R66BJZ{I;Jl$}iWJk@aPW^:Xfµʖ9]OnOP3 FbGEQibPۉХ3]>CD(X0;b]CpCxdU~Q;IT;߹xkQ34(,CV^-Ɋ,csOL;3 =qC+&fE!D;|2S1^}|,E HgAO2j;Yq _&2Qer d̑ə 8P@G̺U1`{?(Jڮ=*ԭ>>~%"ԩ{Ey&V ^G(bК:Ck:83!-BAPX>ƯcL^14āU~E6"Ni]gV ^c3-7K{!P$-\qUL%PH 35y^{P plB@ p#l .F  ǐb~6I"suIo(qBNzV\`]46RQ[}5$g?ɱltZ8J7pRt\.AYrh0oG]]$%9N LxU_.ZJkτ$]waeoʍ+/X`bnx :\#dӇe6! Pme ./e4?nm^LѢ${ =T 188 iENPT?TjdAm\ ZIa{wMѲU.iCdQJM[}WyḀ( ucV`>s_Z<Hw!ìDlw\169\ľBfxOڙ,Ü 81wC@DQTz,qM@%a} C(rE;. d{bc!`!2 cw.2ES\D/>㟷SY}s8w6OqM>!TjcG_%!6 @\_FPE뺡"gNw0wGEa"p,N=xjhGyL؆k0IY@/{9C 1| |O$xy;2L.evpWp"*qOd$/wOpMǧ?GMX*tmq O?k$//fm<Ɩ){ ʭ w񲭜b׬a7CErZw4p'( fcAvRHX$3^ϽvxAm'OM_N}(͞ z>#\afIK+#<ězJd0V]!! 9ݐ"'`ζ5A*~"Uv {lpNAXb$=䮯n!$e2d.t䠪C-.tPUv~g`l8~j(cS}쭛mVNm^G#.#f#u}7D,>&poI;IW!F4ƪ@Oz^_@\Gne3rxMC.*!_ї{k }٨<0"PzK`*- 翬;T%:i<\0Jf!XeBNwӔ =f|~_ƶYW3mzѭ;X"qːK@SOFs q\eU|`tঌ=黃f.'$,,V :M#`ᐩbލ e[H:ljn@E#MQ/ k87#QBh0"%3ʹbr޳aLhϰ%F}d %^@GdלY`9̀#ךc+@zHv?O@El}aU.Tz-/UrnU]͜mj,,)bh1 (7چ\PDryo~I*kYnʫC%N̍{p;m<ϢKΜrαG}NJ7'G^Đ#f7ڵ{x}=z(zvy^=+sgӧo7~lyſj.~ZPI W~_cRqMqGI FZ84w ؈gU zw 6 oienT#Xǻ3tPiקIͿ>|i>2Ѩ4:ia庼J|_K0 lxj|Vj!,lՆ +@*).H! *hgi缺]Ox}/U@[tNv2mWX xg*]\ Dp*vK. 697B㱮u) pExDPBc*Vt DOyQ]搤}V-Z;CU$lδԪxXuF3QU:+|[C ƌ(AH :A"g-aZ.\Z+*|&eYȾj,ȱ dg:N"GŲ"p('QFT3cثu;HSYO:5 ;$pa;-=zmYX聁j{o:`= ;f3l҉KbFlV%S <ҖɵtV&RXp.}$# 5" {~ \ "sk\]}@˲3ߋT\ToJQYrkwErjD-vCgXv9GeΖC*32`QMhY%Uajw^Һq [QTFP$jw6[2'-N;w|w<}Z_~:x~ ؤӟg8rDzX{N(#|=-^\Հ?hC+F@-{Ll1p({de~ឱ;)AGE>d"ګJ^a.EFA`_p WNx`)|WƾОc@t4Ι%T^׀Ԧ 6)T&4fWacN6gLK O A Um`1=ѹBX + kNF8"G 6ً1|pxX5>um­V ڟ<9k u;$yD="\_SD!}g5+gp 0\q#*51lZ6 21 m<(MkcA0/^2 X"'i{9$8 ShQp|UxP%ǃSV0ұFCzۜdm! eB/&xqYٹ8T\^jzi -25?<$nHtty20JWʻ\cuUS2[!W$rTEh ֗|+$50:{g!@U!J=J#{;2^|Ű|?kfo,pU\KqmȲ][MZ/@C CSWs HݴЍoW[% -UMfMX呗+$>t _Ϻr9wrPn? H56w y:wF*M޷۸z61?v9(<_;3/R*94.>WyDnN,a9 1lXq;!(J,\qWLoщs-y!Zg?tYll)[KayF~2,0+SȨDxIςBz{Ut{Um $=V^dl'+&M~l9dzd.e5L=37c+ 1QC}Յclc#/Gd4".) qk nz^)(zjq=`YtK^}d!yF6DA0HZli ضXnǧw)(lLT=# գ=떅T^@HdDkTYH0dFalSz,; /yrm<ʳz|,B|sFMQ"Ul̴*#b 96m9nG#nF+Iv |<*eFF$ *#(O^" &9=r~ԺcLVB-pzG%d5y@ޥ$;]}PX;sѝ5ߗa]AIfgU u<{緤;NxASBrƍv}HHHNABKq2a+\m<F 8v'jπ P^țz:85S©,mrDBB0vؼ^άwg;.zWu#Ѹ2& pWsz}JS~r, k \qhEBN|X$)܃nB7Vq@Xgw\斪=2b+^Ao뗌_|{g(%!dE*S5{`!Cb]H;yb4L%tVBVwmiEo՘\[xqE=`Wא[,K5ͧVmyeibzuV5dwѽ|.B(NT95i~_㹳JO*V ,o'85Acto?Fw[ѽ87S\`!ؙw#\7}q0mvL5 %;U#PH$c'zQ6$h6Lި5r ,E7:dF?QIv$~ 2 ~t666$јpѮPt`hd͝X+ITHO-Ѿژ@},j?Եy%(RY|/dJ7Cn"2գSDjц~TR%s vW1$k2;9}l R}Ƌ*5`*^m`C=|B}/2/BIB@[l Neѷ-"{qdA oo$AGȳ =䠣17ܓ6(|?Ouec^ȺVs kPvlq KmD43ji"En"%R ٬w$o ې[GUڝ 50~§0rL :IO0UˆcfPΆOjUeGlu  خ&ʵU\G}vUP~^dAEα~|[D|w 7 Ԩ­3DafƢb;ي5m湄SVX\x@X; 7q"|!B|} Uj: u@W*\:BդD]a9X5,u0d:vyEh(=UM4'(ZM?}zB_4}jmʡhځ@#h@ `XLc|[9[~q<,B7Pf.M*i$@`auq' w9BB!b+QQb\1PТ1U\<+4e.〈_FH 3vQ;!Cnvu '[? @6atO׆ lÁkue9 H4q Q њ0pn Ӫ1!!'uj˸SeYzHw7XFm@\@T$z•P W|W(О_EU!(1BYs niHF#4(7|0[ }@_xHu^t_WXi/1w-˭di8SPLeּ (jRehqtKpoԻVO~n1Y0aCT܄PlKF` I!e┿ 핕"x3*m)^a@}xUlzO;M'<ꪓʫ'V#{5%!jM#E]$Ad tF3qr]: AOieO]4 vS ^s&Dc2ZsHh:k$zy*# (HBUV3˭`C;$p|tঋ/'Pc2hnn^'r~g3>հj%mtlA9u?9Po)ּ JE4Jo*Yas &(CNԘQ>82w3%'c@F(dނ*_U ݷ&؝D2LX58tV@6%3$лl4\xZ &j m7LFw.r*&|TFU%vd^m Zyq1b+I <ʷbFC_nVJoFs'|`vm J=,xzX|![8?&@Nr:|nyh9RL.#^ _1#iq )E-&A/CIۛ}3341`ѐirPˆ'Js. |]rX|:x{ofH!/yAe~0u$R¹rAEd#c+PKrNZC49cqu-eU,9 jhfL:1 6Z57j]K1@:2 B 1NӾvzY` (+nUŴhL˸VpY֔jUsM8g$Uiac>u٤0 yiQiܯ K,ىyDs9-+͆gSގ/O<($J0hrp*= 2ՠf: P=" RQ\P(0\*q^j̮m|.|,yY+c\1|o|?㫐QK<"ܪ/q6MD $hǬ ~Cc,H'D~bO"|} {#;/)9Qy05/H#VW'-?A` ¦u8.5a<DGGGFT!',X!7p 1e ӤJ튈>Ax+0ssZ+&}&_a}Y9DlA0AL6s>%w?#( 16 Cnئo37,?ݧ 1ۻo'5N>.&Op+>]=]MЫ?onn+_>MTNom# 䞰0Yր dݪ:Hi6xhz ;龑3: PP(&,2F;ǧo݄~OO=CRX2ýik.pLjf*'//dٷ,6gaOa+HojԄ<>(7194t`f#5PਐŃU0[x?_-0 d穀a퐌X(y`WR.'I2.gir;ފ2.ڮt=so=ZA>}Y(JCF'Eh \!̐E.vz^% zP).@lmz6[+or)"I$&>{a燅;aq#n.>!(h b3R>|:xwG*2)w4'mSM@ILͨ;Ҭۋ~:Quwv@fWveƮ8 '`>(4Շ :\T\%CjVXJQxVc3M@i"_H-&ђGՎQdce(mpU;E\/ҠL$\mƀWekmt9^~gm6z9+dE [CyUi ئu^J \|XL^8X@y&6 apY>GP6PLB+ۻw wѼ9!`M FKL*?`&hO0.® JKP#*qـ>ܜqN!׫9tUvutK{d6Ǻx.O[EO-bt ́,u~6w?}N?>gCŇ]&ZL\PƷ})!,&BvϘAGf?I6/쟐k}sg#m[^u;é`ybxppp-)$g?,Y-ST0gVkd0؆KOEKh\ "apnDžЀ_4˖Ǭc۟{Tm|Fr f uOgTam/A3Ĭ"Do쪶.>-R,"'`#]Wm26Dɿ?.}QAJP9~uqxmT䡍YAvv:ǖ։sj2V[GzYXc2\M1>~=kdJWsn#2$FQ[&|jn bK?&2+~~SK"匫:3[ڕ[Ǥq)4#*.JDVݧlYp>~6?"/`KlTl:mScP.G7< /7=2c;E| ·C^MF0v]0{CS/)2MgtcW ؖzT`8~X!8+[({kdb1t-&*(p*g:Djo@UC14c:dxW>(1X8kFсYUKG@K/mn<̐sV+e[nEzd)BŸpsb'O/#h | In,@zv4՚ȅF  0&̀Xg<(̈Ag߱.C_~}߯Wlʖ=>/ ~a3O[Uʑ$z'KdQy E23BqZUpRg` CL;~1GRL`M6Ҥʵv2yPqnoz nZ@")ŞY($DRk M/hpuԱ|3Ac^?u'[YA|+%UX^s(JbN(qҎI؁(tctU4PN4s`\Uq.4Ҁ^DօB.sWd1KF:i8x2|g<1@@ڲ6~$ ޝݏX%gzmK'>?ڦn'@_ݣɺ?'v+˟Ϗ=~{{b_UqxǸhuwo.\I w}ߟ/yjo|OC?/v㽻Wfo/wWaͷ?Lb% ȈY+~w90Ye"mM,yEءS=UHws&x1g&Ǽ2~DAPQK!AzjNJڂkv'*,7* XpĮЗ:3R8= ]r\_Ch 42H`/O/Xn A**JɘUm@B :VJо`G h~4FxM JbN%d+FKţS{C.|wL千_n?}]<b jR2j< < *%Pp!C"Xضا,W#HOWJ3U7\4!u~)l>sX^[ **Ge7A\ G86UoLk;q!B'4o?P?bK^4~/Y^𽤭q|Kj?"=6]'ʞ~hچ UIIspq!4HL{ p_;-LeNpXBsb -9YeQ_}]f:Ugn~E =,|y}ǜGͭ}_ҕ>+ úoBK,mC ]%k$TrL{8&63H>L ~W<%Dx*)^fmH6|Uļc[Pn/e_( T+Y7`N@;'v $| (W5`-y1`:1^% ӽ@lHELjŵgxʬF >]|)<%#čPJ)ƯԽcr$I K?$v"[5!,aQdI2: D{-^Cc<:{2’т`sh&[yog$ș[s~'Hyu_f1FTKo_ `]INVD\(赏t[*5iivju8wr5v{X-(xϫn#qq5ѸQie/nU6oU[A0g\htddV !CdZ>ʅ!8k~wڝ9qU Πَ<3{]$q[vmu* 0~txO;z+ b ƃl=|7'o1&b2}ɐ\_\ׅ+>g5ߌ|L8iEbNl<| fuU୛Ci[']B4CǙmSϓʼS xBRbN'ٵr̽q0<[_mZHÿ3رeL@g(ˠpY@Ε HYZ< V)l{֧n&Nm KB馇wa(IG0F INHY("wA 2 晦J=^Xi=AD$-4g$d_m%B|мc]01.}Ku |'7.3!bABjο34J+!`YPubJuQ]'FK^ni /+C_MU{tJLV4IZ!xo cL( Qxd4ӧ?#Ճ4. ?\}{C秷WO꯿\.y/o^o/W_Gۻ7Fpnq 7ݘ7[WO?"DZ'?=,u2!⊊HZ)QRζ-ݛNbl|O Hr U`BÀ8Sgи~oocQEeg~~u| Ȍ$S-%TM6 oǽ6\ӭj=Lt ϧMrFg[iZل_IM1{iE|i-/HOE[|E)+`y2pMvpX B_ߤ}߾o'nlQJ҈x;[!I}3O+]# Ë`ɁLbw~l}? z :86'Hƍ:lT"+mؕNPOAw0߭ )jN[|z/pcBd+b]̰Ϩ2b<0qA#j`h7g`*Yr4v Hp{ Nx|ф+r4N'r/ʊ\Fdǭ6}% x9:>fТDr@JI xlx6Q:4n&3b4B5d{1 Zv!<߷BG&¢(t!wv{S )x|~?+ȓ\{H[>!$\Y;T*9%\#ݖ9!!_aj7 Ɖ j_,Z絢8(kup >K%S&Er4` ز{U}BJx~!'>U%ä+? =b&$וVR%\689[$ӡ4LUp jL 䁻9^<&sw;Ѕ0yE\zLUXbJVeH>_{)v&w8oL/m7FeG9 !D4@fLǟ"i%`{ `2nnaE8_頇1jr|./pjƗڈiQ ^&*9ddVh%V B*X17^q"QB4&ŏm]fԚ"rf0W}w p=8*}8`W C6%'ipyc~ao9+w]ٲ,c-^\, E” Y+J'Ui砢IS5dlMV@oуBm"?VFW[@BtI*yk u݆p9TL>OtX>Ɯ<#h.M:>Ըߤ}^Ү=hI篭}qKFϳ9[8쿌ܛ bE"4|apEyy/ M_]>AFJ O9"\W=Xz/)W/܀9Iʟؽٕkmle6E{tXTi4o jL<̎!edDX(կhLb8e?*}"NK S4*ixu;fQCc+p`9FvvJ{mA(a2ߨC]c@* (Au1ϟbS OZW.3`2>%*(Jz[ǎ!@ҽ 3.J@e"67NCf 1{ykc# `؞Qc4tRdG#k(mt,}Ex,nwA#@z \ҫpe^o\ F{^}^i1)y_o>UC{<,>?kt󉞑߯UCͷ}~cxx.->=_]x=]{o7gg [<,X\ov{.puvgp7?.xbP۫/#|s{۫O<; 0hT`+hFU>fYS])r C+ avwN6 i~ pBaؖCB>gfxk M|5T`鳲F\:0^tP &]@2rZVlu3^~j.1ڲnfUXxn* ͝/?\$NCAв9AC&Dd?R;Iiyr +{y yҙP͓UA&<\AݘqtnװJgL2G-8Þ-zxh '4h FEDIq t&gqJt$rNK==P+D[ZDD/Q8R1>y6TͲgה{K,=2l"M^}!De4<̓S}Ż#jBjt`VSo0촫 ,clhz`#}/]Nl_q{Gn|,`<=bnt~24|=FN5Psi!qV4ŚxK$ѡi(Qg)(@RZcd<Ueѫ_()cѬ~wth7 $ D,=J F@0!Gb.9~yO磴ys%J-lLD<'Cʃ(TfPBN6ZL p!6} lxQJ痒܋>4@l +r48߂Vr$5f- H-G,^*>qIǘ% 4+>+һ2s@>5/a= AY2$=vktlQm CYCĤ7 n; .?~ 5fi@1hX.( h`hk wƤdd*"Dl( ylbHy#4}lH<42^*+wj=Fl06~_Ïc0״=+ UwƄtTT]ZPmytAI&wd"hΘ=9KY>{trl0H▞αx0֫;##Y51}z0r!HI]ySbj <3DϏAaЃL.Z۩"`G `byM)T.?IðO!ǯdL SB>iP 2DQ K? iscMOz;KC7h.|Ʋs^B1qa MAR  ,n 7漦$;C.@C{+6 ~πڅr1}KqL:lC .͈g<A ֛ 0b knfοZcWbAK>,'eTJI Ձ.:dwUAL%1F=Ii4 9 ܰEg mEʣ11i7emئPCj6q] P=_Ё}{@wnDA|u^mo@%BE1<ƃEÕEBڍD8Sl3 *κ%m"߰"\woHh $G?bbjAvci^$t2JP7$W[e$!7R]ƥph"$gEdͭ,p>2?kzx AW1HEpmx>?qFLߠ&^'jN 秴u ~GQoJe듀z_tZȈGl[O 2%8 3Ye}9!=Iy!l#z )]VG64Z~y Fˀl Ck@рw2?+_tϓ/6V^j@`eoDqbt44!*fac"ʶ}1z(1zI`ös e]s^ _Uw/!ҁzɨ/ە~| hG 4.Gp5;X *Mmɲ~bf n2 %m_DlD1#`hEKSeK2@F5ےػ>܉m;FB@$[a{ 2=O_&޾ѡ)B!RtsLt1](U"N^V 1pW&hq V9-Q ĘИq̡U2PL*#3[篫CľdrR"Yr'ή];uMm E~)]DH{w hS \;nګw^ݬWb `7@hTV@ܙЄ+-#+-#j y$FAܟ=Ũf^5#W!p>O:HJՎaJqc!G9u"j F _bTZO}t.n&ҚbWAD]>kH)m-v-nIqvZ;+a-fAƲ vB 1ocݺP= KZB!+AN xjp]׶W{f>VۂNnprV+7Xh}&m!(d֩ݖ#`k sS`6͗F=j?mxWtB#+UQȂ/b hPmt8guVۣOw+y'""JZ`+,4<\]P{8AP`}B)QeϧωTe(=jB[wm+ȈҮu 2g(͐SccFR/$lOV65>5\8 ?-~k[Oh;,OheӎZflx|K\p~?ߔZ-%(,!9058] 0Z\pSQ/N \@̚Aѩ:T('Oy-I*8f;9\8D+b\yGSA>V _o3K%#R1w" j6aN:ƾL\v~I,"؍m8FCfK[}yDO.Ǡ<b&q~-㰏'~Z=ahUGz.K;F~gSĊ;n7Ykmm}ξD-ا&:&NKQՠjX`Y N:AF:`aBr?TSgɰ"qh+Cz5@,$t8+i42쑽/+p)18%uf4*w%Ä0B#*'(.qkv 2v}m;]5ۋz"i䬲%F]0l)j.>Xc q<ata{d?kXpv$Z$)Sϫjd~45a U%:GxIƆJ6mwvmˍ"1_{65}06c*8:GRI[jl0պTŴ.s؃4Vlb$HGLҩXN(9,*o--WQi@X]bɧBEo447zj95i*"U{GEWkE, ]ӻ-D$Zb>F77b}\[.y4%gs|'{'1;`Еi,xS?& t5~vuOvNHtO#NrsFѼ ƘܱH$B!L +4D)1n~ MƷ9{d:a{4- CԈ-PsS؜V w7 }nBA f%Ssw;04([[ 0좆SEd#q5ixW''OUZ,~ (R)&<}A]<|mD=Q0a ²\Ҁ~qH]/rszj/fWVl yCRYDj'BfCl -|^^-'ū{1i <_f'@:e`[<^ĶTc\/GCbG 4%maC,MLѬYxH"U |O7ϝl}PiVrBT QzZj+ |EA7}F-6VhBT^K |FnF Mm(OB:ZD8E2q|f\Ц90r vG8"]J3VA0]7'|3w}F>: Ye1zIc@dXg5̲Pw_,]rSWz'k}d׈k^}F[]Lg̵ Zë!ڠ9N:mm56ZRP!~xRڐLWG J_$N9)vEHdE/bfst`O:A5LݾBi9Uv˟{7tX(s([~# W\'g6;$HYQhWEMAjY2w-Y%#@v6„MGkijQg$8netbsd-INSTALL_C700.debugJd@h@#`@*] 5M <l@Kt@tn[|   4@ p@0@p@@@@82@@(@S$@f @x@@@@8@@x@8@d @T  @D - ?t_ LD(@]L(@`s(@p)@ +@p,@,@$,,@d,@t -@-@2 G<.@RT.@]\.@Ti.@sL/@1@ 0@d@1@t`[ j[x[ [[x_ 7@$ 8@,L8@:@ ;@;@$([< Nl( a <@s>@,>@ 8>@P>@h>@>@>@>@>@pC@ C@P D@D@ $E@9E@P@F@4bF@0[u[T_ G@H@H@H@H@L`H@dH@< L@HL@O@ L@O@("L@/hO@l;H[ Qh[0h[y[ <[0l[[ ,\ \ \|  #  0   ?_ G P@ R,P@b0P@n4P@HP@0xP@DP@Q@Q@Q@dQ@|tU@W@0 W@W@W@+Y@5W@X@tF(Y@U(\f8\D  [@[@[@`]@ D]@,]@]@^@ `@ xa@  c@@S \)  4 _ < d_` g@Ps i@ i@ dj@` j@ l@T Hm@  Tm@ \m@ lm@ m@H, h\6 x\ > \@T \@k \@} X\ h\  \ \ \  0@d د@ @     @! @> @[ @s @  _ @D @ x@p\\ @' \@/ \\@A \@Q \@b \\@s \@ \@ \@ \\@ \@ \@ \@ \\@ \@ @| 8@  D@`( @8 \\/\ D @@T @@g @Lx l@ @@ l@\ @@ @4 <@x @d @@@@.@lK,@f@(|@4<@8@4l@@hA( A' A5ABAL\At<\@|\ 0   $ ($ b d f f  f $f #(f )0f 6(g >@g I`i bdi xhi i( i@  @ _x x @  8AAAA$BAD1CA<DAEEASGA,]HGA fhIAsLJAD~JADJAd8KALAdhLALAPAPALSAhTAUAVAVA\WAfAX(XfAT3^Ah=^AlD^A@L0_A<Sl_A[cAbcAPjcA|dA\\\\ \ $\ 0\ P\,|\ ` d gA gA gA\pgA/hAh@hApXhAjqA<{sA8\ tA,8tAtAuAvAdwA|wAdwAtdyAĄA\܆AH,`AD:ЈAGДA\  \\[ ix vx y y z AAH`A`HALA,A,AA0دAXA!d\@-\:\!FlA\Aq,AAA$AA8<B`Npz tz _t{ l B<l B<z B8!B8T!BT!BX"B%B8#B4#B4#B{ { +B$,Bp/B /B/Bd\0Bt,0B61B ?2BTGL3B^ g( r<6B$`6B(6B@6B9Bt:B0@=B0@B@BdPABt| DFBHFB$lFB((FB7FBHFB$_FB yFB4GB0GBGBl@HB(0KBlhIB$JBtKB0!LB8x8  \QeB8eLeB,yxeBthBgB|fB<fBdgBtiB iB(iB,iB`iB&iB7iBLiB_iBojBkBdlkBtkBlB,lB@mBDmB8mBDnBnB,qBp%@ ;xB$H${B0XT{Bi{B|Bt}B~BPBB\"8BS"B4c" B|"B"B"`<\"Bl"B"Bh"Bd"B"xB"4BD"xBd#B#\B@#BP#B< #B *#HBX8#BM#B`V#B(b#3(OD`M3QD,[3hPD|h3OD3ODq3PD,3r]Gh} 3l} 3p} 3t} 3_3_3 RD4(RD0XRDdRDt40SD@s]44s]@40s]t]H4 t]P4ET(>E@5>TEPH> V> _> n>İ ~>DE >dE >E >E >ĮE>خEH> E0?PEl,?E 8?ȯE0J?E8\?0E r?PE(?xE?$E?سE ?EH?@E?E@ED"@XE<@EhT@ Ea@\Em@ }@ @~ @  @ @ @ @  E>E @E@EhEd|EtAElG A$ "A( 4AdEJAhE_AlEuApEAtEAxEA_AE\AxEtBETB@EBBEdB FpBȉ]{B؉]8RBd Bh Bp Bt B B4 B8 B B(FTC|F*CLFGCFRCF\C|FcCL rC@ CL ~>9F >9F ,?9F C9FlCP:F|?:F 5>:FP?<;F<Cx;FChGIX?GLJ?GJ(@G+J@G?JCGPJCGcJdDGdnJDGJDGJDGdJ4EG@JtEGJtFGJG >0G >PG >pG wSGSG SG<SGSG(SGSGx T(Gh TG83TG0FTGpYThG`GdpT,GHGtT4GTGTLHp TH4]Y&] ]TX]`]o] ] ]/] 8]TX T` >9H TEHTYHUYHUZH6UZH4A ZH@U$ZHVU(ZHmU,ZHU0ZHU4ZHU`]U_U8ZHUjHdVrHTVrH,VH<] ]Ґ] 4VLHTPVH,_V̞Hl8HdHtkVHsVHV]V  V  Vpځ V߁( V ( >H V0H|VH@H VLH(VHlVH] >H WHWH*WHD8WHDWHXWH`bWHdwWH\WP W W@ W IHWd IWx IW IW IX I X I0X IH*X4 I:X ICX IUXIdXI] $] 0] <]sX X X( X( X%ILQ8'I XD'I4Xx'I X'IX4IX5IJ] W]e]s]Y&] ] Y8 Y@ ]Y II2Y(IIHJYpII\YxIInYIIYIITYII YIIYJIYKIYKIZKIHZ`KI$Z|KI8ZKINZKIdZKIPyZKIZLIMIdZhMIZT\IZ_IZD Z]]] Z]8Zp@ >eI  [eI[eI/[eIA[fIV[ fITr[`fI [fI[fI[fIFfI[fI8[fI[gI[gIP \@hIHhIdhIt\ iIh1\iI0D\iIY\@jI<k\|jI\kI(\0kI$\8IPT] \  \  \ȀIЀI\؀I0\Il\tI@]IT]`IT&]I40]aIMaI\aIPlaI}a@]<a|] aI$aIaIaI4aIa]a] aI$aI aIp bLI#]Hb] %bDI$0bhI<=bIIbIWb]$^b$] jb|IvbdI4bIbLITb0] bI$bI0bI`bTI`bIb<]$b`] cl] c@I$cdI )cpI6c`ICcIRcx]HZc] gcI$rcI4cJ\h(?JDhl?JiXCJi@DJdT]|hp]0.i4 LiDJaiEJ0wiȚ] i]0i]i]i]Pih]ix]("-H i|[JhVj[Ji\J8i\J]Jd]Jti`^J,]j]"j $ :j_kjbJ0wjbJhjcJ j8cJ jXcJjdJjeJPj(zJjdgJjlJ(knJPkXnJ$oJd!koJ80k(pJ@kxJyJtRkzJD_k($ wkD$ }kL$ kp kt kx kXJDkJk]kt$ kx$: lpJ@lJ$'lԅJD6lJFl0Jt\lm4JxRmJxbm$JsmJmPJmPJmJ`mPJmJmJm$JnܜJ`Jd1nD]?nT]Nnh]|]] ]nDJtonJd nJnJnJDnJnJDnLJnJ8nJd]o]0 o* o8+ &o* 2oе]Eo]Ro]ao]oo]}o]oo]o]oH]o]oX]oY]oh]ok]apx]p̺]))p]9p]2Hp]Xp']gp]wp(]p)0 p+( p+ f4| p w& p4J(pJpJ8pJk*J pJD qHJqJ`/q,JPBq|J XqJXkqJ4qJ,q@Jq\JqJqJq(]pq]r]Prh]@+r]@rJk*J 8rJ,FrJXrXJdr]r ]tr_r_r8KdrK,rK@sK0s]!s]%s].sp!K 6s!K0Is!KZs]hs]ys sp s s s -Ks-K0s-K,k*-K .s.K ] sAKs`TK@sTKtTK"tTKx5t(UK0HtXUK@ktUKxtVKt(VK<tdVKt4XK@t]( u@\KXwu\Kp.s]K k*0]K u `K,,uDaKMu]6u_[u _s yKu ]@KuKlu< u$K4KuLK,uxK@KdKtKKuKuK8uK$uK| vhKvK]](v< 0v ;v  Hv Qv cvK,pvHK~vPKK`]v]v Kv,KLvxKvd] v( v0  vP vX  wx  w %w LL6wdLOwlL|bw]0hw]Xww]w] w]w]w] w]wx]w^]wB]x&]x ]&x]5x]Ex]Tx](dxn]"rxZ]xD]x8] x.] x$] x] xX]bx x y 6Ly6L}y9L,y:L3yty_ay$_|RLytVLyLeLy sLPutL8yx]R;R]Y&e] r] 4~]]] ]zMzԜMxzLMz4MzM0{ M,z8M${\M${M{0M){M2{ MT] ]] ] B{MK{MV{M8V|Mf{Mu{$M{Mh{HM{M{XM<{`]t] ] {]{]] .|]|D |_:|(_g|Nd||$N|'Np|*N,|\]|= |d |_|,_}<> }x2N<] }QN]] 8}UN@H}](]}taN0} ]h}H> v}_}aN0}4]} N0}PND}N|}N(}8N@}܎N`~ ~ '~@ 6~0ND~ S~N,[~ Nc~$Nh]s~H ~  ~  ~ ~ ~ ~4NX~N~NN 0 Q:N*N,8NCN LNH_Ni@  r {N\\N0LN<NtNRN$gP>$ {D  ]x" #P h#P π# & {NXN NN`L@N@]") 6 HhN,^N,rN N NN-OlNсN4N0N&N3NpANRN`O|p]]* 0_'BOłKOՂHPO@FOHtMO 4_7PO@dSOtP iObjOukODlO mOLXmOdmOtnODă> ҃, , ,  , $, .(, B( Q0, Y4, g=, rOOO|> @, ЄL, @ P، EPL] <_2@_эIP`PPnLPMPD_H_(UP\UP8VP\ WP2 2 )2 33 B\Pb]P@sR ͣ>R֣>RL](FR8FR XFR()GR7GRO$HR hDHR̤JRhY&]]]]],]|Pv Tv JXvx E E T_ޤ$ N( ], k< ~= @ H P İX ٰH H H( I I  ) I =I ZI rI *I  < SS`SñēSXӱSSHSșSX S`HS-` =I 9I S<HXSW@SH'SLԤS4fSzS(S< S\DSdѲI ۲K < < ȱS4%S@5]qK zK L L]M] SxtSL ճL  @= _d_S6ST`S8{0L T4˴TT M h_Tݴ, T TdT8.TF T|\ TsTxH l_õT̵(T޵T$$T8 \T4 Tp4\TTLd Tg,M v= >  > p#TP#Td$$Tt  ɶ0M  ׶PM  > > >  +T&X]7](L> W@  f@ x@ l/Td/TtD0TD0Th3T3T8ķ3Tl̷44T4طh4T44TX4T5T,$7TTx7T8]#|M ,M 5M ?M( HM OM WM oM wM ~>TBT`CT4HCTdCTt DTGT GTѸHTTXKTpVPTXfTu@TT@lTLP]H]m x py xy hz З_t_%8 U: US UliD U  ULd U UTUDUdUlhU| UtXU08U0QULcUtU0UhUD]]]@U,$U 0UL|Uh2U8FU(UDU0`tU@rUU\U\pUtUxUL#U X#U@$U%U%U|,$]94]MC$ W=Uc=U,o=UzX>Ut?U@?Ut@U0AUAUBUD]L]@hJU4JU@KUKULLUP(`NU$7NUF OUtSPU0a]Xq]@$]w lz D @D DD ԗ_x_^Ut8]  |kU<2kU\@lUlU0RoUdcnUYpz utz {xz |_ vUHhvU\vU{Uxt] HD LD _#|z /UT:ؘULz ]lUkUvUL}ԥU4UX`UUPHU(pUHUhU4U U9ĨUJܩUP[]r] ]]@(U,TUخUpHU4|U4ULU@UdUt:UBlU@JpUDXUcUpULxU|T]h]Ă z z z U@FQ]@؂ ܂8 8 @UlV4.V4>VK][]lL T $VdVtuz V@V@8VV|lV|VlTVv4VLX \ z 9z  V"$V\5 ]8]?0{ L{ t{ ]_h/V</V,/V40Vpt1V$2V(3Vd3Vt4VhCVDVPV&F]?] ]] ] 6X| @|~ N~ ]tXVgxXVsXV}XVXVXVXVXVXV XVXVXVlPYV8ZV@ZVHZVPZV,XZV:`ZVGhZVUpZV`[Vhk]Lx__h_Vl_Vl`Vx`VaVPbVPPcV,*|cV4 dVdApdVdPdVH\eV4fPeVohV{iVP]X ]@$L]~ E E F @F F F F ؗ_1qV<9xXlQX^XjXv@XXhlXLX X$XT%Xl/Xt(X'Xx`(XDD.XPh^w^~^ ^^! + : J0 T쉂 _0 j  v$ @J J K 8X,9XT\:Xd:X8:X>X ?XDd?X|?XAXDX<*DXP3@GX <`HX\DTMXQTXaUXnVX8}TVX4WXxXXhXu4iX8liX8{X ^ ^ }X@L}X`}X!h}XX+}Xpv0~XLv|~X9~XGX<XXXfX<wXhXX<XtcXXXXX$|X XT܇X ^ ^X<ЈXDXuX8(X1Xp(^OX|_pX\o̽X~tX <^P^d^x^^x|X&Xt^ܗ_ _$^ ?Y`>Y@K DK HK AY$, BY9(BYdIBY<UBY(bBYHo8DYD{p DY<DY(DYEYDEYXFYTFY,FYGYHYTIY%pJYD38JY8>TY0KLYl]tLYhiLYJNYr SY8RYDPYWYxSYVYppTYdUYx|UY'VYL\VY4 xWY\YL"T]Y._Y`Y9aYlJaYZxbYLgbYrtcYh~@dY<|dYfY ^<^@|^"^}h       LK _.__qY*qY4qY0^q_ }Y$}Y8~Y Y    ÝY<~>Y >(Y >HY >hY  Y4Y$-YG Y[ Y o@YtYTY@\Y,k$Y<ąYYLY(tY$ <YYD'YL8Y4*lY(CYT@YleYv Z @ ZL Z ZZ`ZL L L @ZHZ%XZ3tZ AZ TZ]Z<lZX\ZLZ,ZHZ@Z@ZdlZtZLpZ^ ( L 6L IL a|!ZT|"Z#ZDX#Z#Z8^       Fx6Z9Z,-H9Z|;9ZLP:ZLW:Zf:Ztp$;Z~ bZ ,bZ@bZbZcZcZcZcZ cZ/(cZE8cZYHcZnXcZ xcZ@cZhdZdZfZ(fZ(fZP,hZ iZX8jZd%kZ;kZkZdPlZHdXmZh vZtq4wZ}Z~ZHZ44Z(\Z\DZt0Z Z\@^ M^Q^a^o^ #|^L1^,? H_kZ8~  PZxȎZ܎ZZZZ4HZD,Z$3ZTMZYZ8kZ(rZP?dZ {ZZZ(ȘZp8Z XZx؛Z(lZZ$ ZpZ Y&^ ^ ^$^2^@^ $L^,*  : H T< bT pX \ h l p   Y    Ę_x^ Z@*ԻZ8 ~ J TM  ]@M iZ(wZZZL^^ZZ8WZZ-^m ԟ    ē ȓ ̓ _;_sZHZ\Z^Г ԟԓ ؓ ܓ  䓂 蓂 쓂 __XZ:Z ZYZ{ZZ4^     __AZ^LZ|   ԟ  |ZZ^ __#^6#^F#^Z#^m"^"^"^"^"^"^"^"^ "^"^1"^D"^T"^d"^ u"^|"^t"^l"^d"^\"^T"^L"^ D"^ <"^54"^J,"^]$"^r"^"^ "^"^!^!^!^!^!^!!^5!^G!^[ #^ c,#^ k8#^ sD#^ {P#^ \#^ h#^ t#^ #^ #^ #^ #^ #^ #^ $^x%^$^&^$^&^ &$^4%^ Q$^\h&^m$^x%^$^%^$^&^ $^d%^$^0&^8$^|&^/$^9%^I$^W&^Pk$^ x(%^%^$^P%^$^%^%^%^n %^<%^ !DZ'^Z(Z|*pZ,@ZP0Z@fpZ|'^ @ [T [p [(^ L[0\[8[H^ (H^(I^  HI^@'I^,L^@F7[DMD7[ ZJL^@W bC[{J[,E`=TdLWJyO,yW`T(`P F[ St7@T  TS|d X[T J"t[dI]U *@Pp&*$T2*`Y<J*<, P*xOf*ɀ q`[(z*8Z*Mn*H@*R\u *&T$*@`*LL*Q0+$Z+(S +K[6+MnO+< Z+0T j+ X0XFw+gPx($  +B$+M0+Z +@+Id+SV+,R4+1J$,J ,U,"S<-,P7D:,XNlF,A_,C<k,rL\x,hZ(,_I ,9E,h.N(,8#, ,Mn,R,l[h-<  -Y-Wԧ@8-ܫ  B-T0S-Mnk-p]-E-xHD@[R-|Q-L]-@-t ^-ЋK-3O< .\Q\Wd'.R `R4.̂YA.@WL.( U.? k.<`Nv.Mn.P .P<.`xO.cSB~ԧ@.P $[.( 6`# 6u]07+X7 YD.7@"[D:7\v N7z@]7S k7^ {7S@7Mn7T7N`7WP70L7Y7,S 7R"3V<8ĹU(8Mn8|N-8:HPC8", L8;CX8\G g8XG s8-V08zN8^8PM 8K8Mn8؂Sl8NO`9K9Ml T[$9,O79 SD9[M90XZ9DYx9KH ȿP49 Z9^9D]Q90| 9tH9^Jt92E9L.J898I:I$:pcQ(/:0U8:JD:hN(\:,S$K`@$m:`P4:^:(cX:j;: ^:6U$:H.B :li :$PP;(T ;IkQL;8, >8]*>.TD7>xP C>TT8M>tA_>Fj>8[q>XS`>LD>IH>P'T >T[>l.B>h2A> O0> >+N8>Mn(`T[,?< .?cJ|8?(U[J?8uPU?I f?0^u?0A ?<0R? ?̼E4?.U_Q8?T D ?Vl?hED?=W0?@ɀ ? ] @GJ@KV<(@l;L3@ >@H$J@XKQ@Z@@Ng@ȨOH(U[|@0](xo @< @L4QD@DR@Wd@S(@AVP@ЦT@X@H~TADjUA D 0ApOxEA XA S eALSXAԡ@ AD8 A\xAlA`@L@A|WhAhOA(QAd GAH BE|BLE,BMnFFDF F`O4FT@ FXWFMnGVC)G"E?G^FGCZGMnoG@THG@G`3ZGZtW4MW4KQW$OdWMnWl^WЎAWR^ WxP`WPLX|]< XX=Xl]JXLVXT U[eX]0zXxQX| Xl)J8XMnX X AX`J[X R Y YBVL+Y@ZL4YHY\T[UYVR^Y,]<lYHNXzYA@Y\T[YxZVYV$YYLEYآUYS<Z8J0 Z` ,Z AZMnaZ[F(^(qZﾭZd@ Z\T[ZQLZJ,Z.BZQZpOHZa@\[8eOp[H~A#[7[MnM[Y(\[6 m[dk@~[P[LXd[T,4K'@[\a Sz Y\Z}\U\N\0Hd\+V4\wS<\u]0\Mn]؜T0] ']T\S>]tS8K]D> R] @g]E[,]Mn]Z<]Mn]TXBtW]"A] @ ^ yT^`ZD&^|3A3^ N^ @(V^Bto^ ^LQ^, Q ^@ZR^@tOT^[L^Mn^] ^h8 _dW _8 _-SH,_=V|4_lZ@N_Mne_Y\DS_E,_?C,_]_tZ_ _H;HT_SD_H$, _PM ` `8QQ\,`U@6`[4I`5AS`h`>V<r`%XԧV`Mn`N$`[4``Vh`ə]`? ` ^` `YD a,SU`aO(aH @aMnWaQiaJwa Rpa[aUtTlRXa@aLv a[h%% VaX8F@La\atgRHbOPBS\bXT'bS\T[5bW$Mb0G\b(Y hb  nbMnbT[4b^PbMnbXTb GB$bBbMnc4B[| cU|cxPcMn fUtflWfClf7F(fYfGfx g@ g@KVgY(%gZ:gdKdMgذYTgXx^g0kKplgTWxL? wg@g< g4Kg8wX,gMngMnbtKg,Tg@ hThpZ$hT0,hM,?hN0JhYG]htAHvh :OLU[h4^h RhLA|hMnhxPh`l@h  iр iQ(i` 5iX Hi4 Ri`4A$_i0@\mi< ioIiMni؇JiCSpiMniELiR$iLSj=W$ jMn jH 4jDeI,EjhJOjIX4Wj|cI,pĵT }j,tFjY]TYj0 jDQhj @jP jnDjHSt= jLADk kY0$k ]/k|> :kAWHkW05AvRPSkS^kIokjDkTxXDkCkJ8k$AdkE[ kdWk:UTkSk v ltWP*lx[pBl^Q,PlS,\l2SklMnlpWNl@ lA4lXXHlK|lt[K;@lOllSP mW4mPO@.mO|>m) Kmr _mpSjmh$HymEHmļS8mQmU 0[0m0 mTPmTmlSpm`}R4mHBXn_@n%A/n'N vhO8 wpCDLwQ"w`aQ0wl@?wLQKwMnawg@kwu w!] w\ ^wwVLRw[TRXUb^h[ }T:W\G@d+V nEXɂLDW؂RMnfHT@&0X3@#@`E YTR ]@4q#OtlUC(@TS`Ń@0ك\S TV l@$ (YH7((TPN WH[qWp{L]HiPiPK,ʋRKdދ VZ  MnMn5IFLOUDVapXvl@tSLX@(X(hZ4ЌYތB4YPC[LZA/LtA4;WTN~ X@ǀ nMn9A@[4L;XDJTJH\pQ@ɍ\Q׍8F@F\TDx]BDu H$N|Mn/h]<?8[N8XM4X2T j UPuz@ Mn,JV(? Ŏ+Adӎ0", ܎L_Q ZGP(ZDQXH2QT@.AT6R F,ET`VWc`R4V<j$NPtX  @V|  HJ[0PKHɏ@$FT@ pQ` ^>V0[ +MnBMn^T iԥO({OX RpWN0P3Bd̐Nؐ\Dl[$Y$^{X hMQ,0?DA, R~ j? zLcULT[8[dAtjܚ[DVlKMn’@Ӓ  ݒ|QBMn^!$GQ,/فH AT=p L@ fDN`u,K,XT4ȆU ΀8 hgW$T E@ד  VTMnMn)GC{KST$u MdKP̓O8:WȔ4Ndq8A%WXKW,H[ڕ̡PHQH̨OlB,M!YL:)HDOTrThkl@J v ܍B0[ –]$ɖB8\MQ vT8I@$ 1D IdKTWXmV0uX `I(X-R(C@  ƗHԗS,$hX (L&LJ$8 I[ YR e=R$V@wS0MnȿQ|ԘT[8T]v aITS4(yVP 2LEGXk S<[`sY|$CXtA8hQRHʙMnk@HMnR"8Mn] GgPJ{H^,J4X,yO(hC$ǚ, ՚WݚPxRB\ K.D$3X7l]<GRB.HOdLW$] gEZxqtX`}R|4@ fPH ÛMnMnHWh@ K#@/S$3ZRTJd_u us[hXpD^PL\>R0VL:H\hB¬wL{S RS ETl[ܨ1C4!J44zXLL\X')T@6< ALF)K4P,UeStS h Y0Y0|PʩеKک,J$UX\VBTLHD  (PW4@)RG2S@-zxPWL$bxA(u^C Mn8HӪXzA9Q^w@ fH`@?F$R.\RX:{( H@RxYT,S\iMnH[HTyXh zT@ī> ӫS8K'@xtU Q*H 7R@t!ApRĖ \}XfDvI|NX@cQ7S,R4 UX@Ϭ0A$( Mn*V8 ?Hh/dRDNd ^`?YP{SDf8XDxHjU`<   Ӏ TŭOխddPXСN Ghx  Y"Ș_: ^R.B ]hZtj|BT uTE,S"TL8^` ĮXPͮ8SHݮ`OW|Jh L `S8`V!Yd2ف BhVO?V\d~@8qXN"[Y`eH4@m[@կUPޯW4LNWPh, D*X0 Mn.XZ4Hu N ]Mr@@ Q@V0WpǰWְMnE(r  TSXO,KD;X.ZFJR$KZL_](nZRzpXd `@MHa pWp̱MnݱT,P4? x c Khoh y<_X\d"K(d>X$SA` &4 Rʲ8T[$ӲRPK[,^$JMn7Z4UTHfR tĀ R,ó ٳ 0  I)B(LJ%(X`7 AG JU[@aMnx  gXJPpAYӴ-F` /E ʹ7Zڴ Y gXgCd T,8UWd#J8DSBSRJ[(kMn`R.b h \c0[0$LDY@8W,ε0+VG ]VS0.Kh)Z@; -OIW$V``Xc8SLo!K| 3ZL@MnJYTͶHaN,ֶEhtAS  |[@PmP  4JZ5TXT@$EaMn|8RYQ(FpLSȷ,VҷKS!B$ HShQX (Bh  ^;X@KY4UUd,[$T~ ^[Dd@0L ѸMnC, (X@hCR0l@$#"K5(]hL(Y4VMnvԧ@  ]P JHƹRѹ]عP 8 pUT8U!,i[H3DIgDt _KQ0oOPVH&Y30bKC@XX8cp@t4C(T[(tH[dnX8 F\LLQ <]ȇB_BpUD@P'Mn>dQdOMn5BuMn Zxf ԧ@O A^BK@]&VtR(ZUX/dC@^PԓKdb>H@rxPHy_VLR,"=k$DFtJ `I@aSpQXtp[l'EXE@"MnD|-TPN-H@SY Z,U\n\C4uXNPXOZ [` ER"R|_  W #ĀS >X^EdQI(c3EuA^|YX T;THLp 1WQ4ԧ@ ^ SАC<&Y4MnPLI`YnJzMn|ZX6E]bHY(|XȜ@$[p\B.TH<yOO@aUj`UxtIhEPșNjPpMn{@(  @TtMn2MnMN]$W`dHJ\vMW*XMT0VB$U@gW(\YpX[$DPBY4Mn1@GMnb4bPwx4  HYLv( @<Ta ,CS [D~RXO`@ W,Mnb"P&4[V8NHL UT[,qy[8H]&ZL4OMn4RoPD LBą   28[KKZtShlDxjU^@DUPd؛A l o  UQD!P V(,U`رU%cD8:XE?FTQMneSPqmJ@VxMnZcE[hUԒI8aT | ^ ԗ( 'G4H|JTCN V, `x]XtPH}8RHQWTE*JDR4A0{*oFdV  rShAPaZDMn MnSL)4 SD?2@fP΅>  LgO b8v r̾ZT} K( O,hE(WK|]<$ ^~ \{G W\(A48CBJ|QMnn4C$(J,XZhWl@DRP %KZhD{OMn'c@P2W <6 G@NVWpBoDST,OIlStT 9T[] WLaUTTN,X.M`9NB`J=Ta$ kF(vUN]P@ LHlRC00F$XLԊ[0S4#SP-rV@8cT LdBSXZ0eUr(T@Zd$ ]\, @^I@@R\jXT)VPHK 8O[G4, ,LDMn^Ri_P]]Q\VaQSP O@  vQ$  Au[ :\[dIDaNTODc$@rV|ԧ@Z@W(F$@xhVPT[lف +H IpMnTI< QMn3B[9@KSTZxe0At$ ^Mn OPID tX̳XXha pO-8Z>RIQXWhkCd {YT`ZlJP@3AH8X8]@Mn] hA40S%pUx4,XEdVYpWg\UTq`  Mn;p ,R4[tgO8`NCLMnDC Mn3 CjDX]I0tMnԧ@MnNܩ  xC0dYh]RKOVp @T .LT|L(+X<OO,T<]'Yt_N #Th|@8 GGd\P@WtMn Jx ,Ol!Mn@d^RPOPo|XRB@`GjUMnhr CMn@xW)2Z;SQ8QZ\nO,jXyf U[0ABˀ <"SdSJV0 ,JH 0fN^Z$xnN-]C`B\ wQti7Px  X$Њ[G MnSTyT[( RRM 4a CN`P\# ?N\4\S@TH`I`Z|[@À o w,AH|QU(XN@HQ `DȀ /]PA|,U,]ȣVmHD`~dW8TH[OdH W$]v^0(Rd;tmP0 S@*XXOl \Mn)H8IZ,U[4D'Z @ ZHQP/S$0]x!X1$W8x ZCNQgĠYqMn@زOLB hO0Z,R"[)D ^=\~T Z3Ac5MxnpYD| ||T,K,v 0Z0qR X΀  |L0G,ֲR$-UT2`Z,= H@IXhO0btA;#rSp)H4F(x @(^@@$S  L G O 'V1G[IVT9T\HKShtI(u1E@ AXDC0RD,~JPJH(v , |W LT0SFx,$ @P8VH4-WM.R<_MnzؾXMn@\MOxW8.S@S o[<B0F9Mn\dWP gMnB\:HPwXd  T0 F,LTSHYЖQ+CR8MnX{XfPsA0KHL= Up,[XxSėTlL\SWD pC  YX\X@X,8OWH^XxQjE4/ [9 E(G(M W<Ji4WDw@ `QJUH>  ,BPO,]SHKB؞ <]$aXMnu0[0)[:ZZJH [MnqS^xMnP 8 Np HH]\|AlCDPpJX <~@(`XT'ȓB`@YLPW(Y:E$wh\QhQ WddJP|QX ^MrXTEU  4 [(xOtCMKDWMn|PA\@0UDx ԁNLJMndxUlWE֞ԧ@MnO,U[4@@`E p](`CD`X(hS\ITܸ[\&,R43U0<!LE{LQ`JTbW\nK]pDA0,:H |@XMnWShNXK0 S\1](=< F^Bx_u[WWP \Ed)J@UMn[D ,c@\'WP 1KT$?  OаI8^Mnq~@$, wxe@Xi MnT8@<IH6 D[Xtr vX0PSX-6S=܍]ZA@lP]K|6@  XH"YTlT 8a pS$]J!hW@8 ^M [  dL@rN{EMn]Xp\|]0xB0S GZ( PS`!V@*h,J A0CILW@T`pTu`8 {|E,pW\W8|V LN,Mn#QbZ Kh lVNt)N6"[LCY<QZ`[^C@dX\t  |C$K]EHQlB|@3 $`PRz xFD x(TL,PJS@=X4Gt UQp0? IT bPTP@bJ@@4]DGPvQx lHpFJx[,'A8|QFMnX8)HHl,T(}hW R[0S  ԧ@_DSWR<EW<܄RhvPL,@Vd5~JTCtBV(ThHCh{ ZBRR"SĐSC  ^G[!  +{El=طO(Qp^hCuR t/D8Mn YXHMntC  D ԧ@ `P % z( 3 p+D@C IR ^ a Mnu ǀ BD  2 cR DO ,nI ETSY L^Xx  @Cl \E(  ;  BI < T Xe X}  C$ (S  jV ED ^ R(  [  yX, (2T Q& BL8 JDtI #@T\ v p  D  @8 ] WT |uPH G[ S (M4 V8  W S`X<]@i ^MndP`[(   Uh(DMn LSK -\ HMndSUsTX |A Mn 4ZLtJX[$ H%V)X'S5h;QADMQX WpZQPh[~|W|xdN8E\yB tfRPxvx P? MnIZXP El*LxpIlR^Cx9 S %dI<:MnMlX,Y}@8n]x@X5ZlYXt  XsLLuL  @ 6HY8;LEDK V #, `pOu](zQD tSD@ peI\TAVZ`v TYR$I Rd1P 9A@J_ Q"[T_PVn\kU`T[,O RCUIQ[h #B| W6MnOPS$e9RuMnxXEJaJSMn Wh tN+ N|<  H Wd^  s !TCXd J ^< kXD H*T@ W   T8 LK _E !dC, !#4RHL#܃WT`#Mn#MSD#V#tGh#Y #i@ #̝I#OU@#oS#LT$PO]<$< U!$6 0$,YD$S\$Ho$Wy$LkU$@>SD$8\K$E$AS$=RT$|NH$uX0$ܲO%O4"%Vl1%MnS%@Pe%]Py%DL%LJZD%$[%PE(% W %}Y%,P%^&R&L &^,&xUt9&TG&_&@}Cg&`T[,y&,W&\ER&Mn& &6L&|pUT&Q& &xKR&Mn'Nd'UT  $'S:',R4E'TPXT'4Ba' T\o'@DR{'l`, 'fU'Mn'X['&@ 'pU'I(':Sh(RUd(,"E,#(Mn9(Ą B(OW(  `(q(Mn(TTl(( B(.S (ĨO(C((hO0(@)S)X)]6)"T<D)A\3X 3H 3 3 Ud3V@3 TP3 3 3S@4O )4R064RA4L`KQ4@d4Zdl 4.N04KL4MDD4TRQ,4| 4P4Sd4XU`5Q5Wh5РW 35 E5,KtY5tF g5$^P{5/J`5@eX5L]<5?TH5xB5FE$5d6Z58P8ȃRb8W,q8ВTP{8Mn8 G8p[48pGY,, 8A88Q8N(9\T$9X,$9Wd19ˀ O98WW9hPo9Mn9|Tp9X98Z$9X94[$9V,9$'X9T[9PC94(N9,Ud :K :%J<:P3 :Mn:$VD;lBD;.K";0pQ,5;TxE; ^];Uh;pW8q;Q0};X_QT;3BT;0 ;|S;H0;;{X;<T<]$<MnB<ЧT]<pvMj<\_ x<|  <aZ<@v <l <pC<P<_<Z@B=C(= D+=ԷK<@=EX=8W b= Rq=X8= Ap- $hRfV=0]= =DS`=U =X=Q= ^=Et>Mn/>[hO>h4K`>thWs>4HH@р@ >B>J>,ZP>~ >E>|G >V>\Z ?x^Q0??PI?yChQ?Cd?Mn?@B0?,]?܂Y?譀 ?X|?`Yp?M?Sp?Qd@$ (@dG(:@LZ<D@0V T@ j@.Bz@LQ@pC@؄@ @dD\@Z@R,Pp@RW0@8R8@xTQ@ 0A A;@0jRAU*A8@=A ZKA UA,@`iAE}AdS,AXAM0AMnAEHAf[VI4AH AiX`Bt-TBGT B@3BLXD@BQ[BRXgBh@wBd@BlXTB^ B@P\B BR B|UB|KB SB@g@(B0UC@G@CR"/CQE'HEh2U$E NE,](E? FA@ F[0F'T8?F`?R\HF]jSFطVlZFԀ fF;NprFUx~FxOFcBpF HFX\Fʀ FOBFMn GB$"GSP1GTS4;GlpVJG*L(ZG![LgGMn~G@9 G0"TPG^O GMnGz@GܗA0GZGMnH HfMp*HĘQ;HzYLHU SHYT`HV$lH<`PHM`H(U[H4rYHWH[HR"* T(H\<H%KlHX I^P8&IR-IR";I ]SI|N@aI0[$TUqIR^{IMnIΙ]I$HIOIMnI܍SIĩWhJ JT!, (JI(1JhJ KnDP]KYjKlgM{KV<KP0KT|KԖHKW$KX@ KhSKKMn L(rY LW#LU|,L X9LT]CL@QLfPl8U0[0aL|0E`wL],L](LMnLZL4XLWLcQ0LWTL^ @ LMnM0uPM](MY;M`RXJMJ^M(WlMMnM T,M{LtMS$MR"MVdM`U[8MT MXDM|I0NAPN0Y&N< /NEhGNtkUXNT gN, rNXD,? N0nO,NdT NN|o[XNXEHNTP4NPO08F(OUh Oﾭ3OA8CO@UhSOd/S$cO]xOmNOhP8O`PO̬EO,R4O$ZOXYROMnOXS@ P(QPZDC  +P  qH? DPT,QPP@cPMnPZPpl@PD=QlbQt~RqQ] {QXUQ@DQ4XQ_Xd|@XQMnQ QMn RG4RPM 'R} 8R;QFR8[]RPXUfRpKZvRMnR6F$R$RӀ R^RMnR RMnRX$R[DSpS4SMn2SIS?S@a @lIS PS]eSJqS,\<}SMQSDJtSмVHS`H SIhSF[S0ULS<,R<Sx [4 T{XTLOH'TPLQ3TdWST-QYT OkT(P{T*V8TU$ T$RTpHTXT~@4 U, TJU, UWT!UI<7U0[0IU", RUVYU`NhbUMn|UFUfS|UQUE8IY\T[UвMdU`IUL@UJTU06 U8I8VK Vd{@4.V]$6V,VAV"HPVtI _V^mV@^VCLVMnVpG8R$V/LTVhPV\-U4WXK WU`W N T[("WW-Wx?D85W  EWMnsW MU[WT|R WyTW \<WlWWWW WRTWELWp XT.BX$@X)X8)J,>XXSLXC,\X|@(rXMnX ^PXDPX AXJXK,X[|X X,A,A hQHYWYzO,&Y0W 7YAKFYWDOY9KdYNTuY.BY  YP Y TxY YHxY؁@ ث[TY,TY0S,Y ZI(ZCZԭV,Z]@ZVIZ|(HdYZpK[sZYZOZT+NlZPIZIE l[TZ(Q Z  ZZT[([PX[W((["A;[XG[R$\[(Yԛ\T[m[TNw[][R[>T[\SL[Y`[W[W0[FL[ \]K\\X$\X@1\z@F\4^PY\Mn\O \|k@ \ \|RX\Q\dQ<\ \@@ ] ]Sp(]Pp!\T[5]7AA]AlX]r]o][\]\  ]A] ]K ]R"] ]|Q]dW ] E^J(,^8EM^HV[4T^,5[L]^([Lx^L~O^h J^LpG^xSh^LT@^8F^F<^(R4^A4^8Rd_ЛZ _LQp_hNHxWH+_,LXF_`UZ_`B4t_A_Mn_ q[_{E_3U\W_n(K[WnXX0`nPIkn|Nhyn nK,nnX<x  *U[nD ^n]nLCnUpn,%Y`o O@o -oW:oCRoPW jo4@tuo,^Po|SVo SoS(oi@o@̀ o]<oV4oT  SxrF(r^r,pXdrS rZLr`hP<r EZDrMr(Y\sAds Px)sxP6s| Cs/RhQs||YF|`ClP|Mnb|(v o|R$|0C|\[t|XA|4Q|dfVL|[|X |SP }%}4~A2}(J<G}xaQ S}  c}D/Tu}X QQ,NP"@x [#W@9 G̵VTT [lYz_CeO4H V4YT7XĀwSӀC ߀CHO<G@< 1@>P= PIH0_Sn$&R~B[(T ^EHNTD|Vс'TށOx  K[(.I\HgO X#YlmfD   Kh4SMnׂ_@Ā )BT!Mn4MnRXp dTZ$IP&@(MnW dN\ʃLӃ[ؑV4 S,,R4  J[BMnS$[4kMnV$yO lF[l 0PʄMnXx^D`€ .N`&ȘY4MnJP\(aZ4j vIQ(Mn …C,ͅMn7F`[((XUp!0|UzV+|S<pB`NR"|  c|U@n.B*< ~NT\?RVPTT4Հ  Æ$Nچ$][,P,m+XEZ8 X}@(0MWlAlZ0`GTl,Fp@V\ s&JXhWh ,Jh܂O$Lj8(NXш<@kCTi@O!, !MnG|QYR"qdg[SIX_NTMn͉ ۉ| HIT@AX؟OL [G4K[;ĭW|MAW0Ya ftiU@s0"@4PD2ED`AC ĒKƊpKЊhUlڊ Qh S$4 " F4,LQ?BPVxRlcT,p] z%C P@4EtW tYHtMn׋dt]@AH2hQ@EGN`]L[Rhc^ t[,P(pSÀ  ˌ ׌t@D ^~SDDTlZ 7POlE@LhB(^7RiS0sl!TܔIARh [DōlR$Ս OBQW#@T4!K<IX-tOp?MnmW,^`r j zpYLM\EdT$ZPĎ JҎ,[dPyNl+KMn$h@0_B@ɀ R4C ^Mn\zB`d_S0]Ϗ>Aߏv BT6 `X0[0,Mn?HO^a[$~E[(@tSXEIX͐ސ&T )H8  l %KP3ZZCtNOI[itZt8&JMn ExR‘X&BۑAL3M,X$  >Wh['MnE7E[L  m,WTyqY`[(W\WUl@qX^ ŒR8ђL@  Mn, $4`, /K( T\=hCHX \VLpkDPKPO [O`n) |@LQY`(2SP5pR8[ T`7WHɞCS4՞ԧ@](? U[xj[<7LYPlE<jYTy<*B(xYx@\\Wl=V8Ɵ[,՟hAh$@LQ T[4 );V4_ <x@QbM@b.T o4At|`@̺[DR C0|wLP~aК@dȠ ٠ZjTF  VQgM@y\Jd^oPDpR$`UХTݥvX\0LWH= O<pV\-`I;4AOjXTYVT`h=DDm~Ny}@(]p" ȉW WXCBlȦZ<ߦ8YMnz Mn/6EHMMnrMn ^jX, N4\PƧ@ˀ קl@V,aP aQ8Oԧ@_Mnr RP7FJXt@Ntɰd ְ6L`^<T  ^H&S!LI[<tPTN(T`N`q\GCx~kC NBT {XMn ( ӱLT߱d[(XESMn@W $tuK2S<DP(TMnsMn4 D /U|@&YL²W$ϲtN@ݲU hK[WYEPt 2F=|ZH\O_h[r$[dyv @ TtCT ųܸSͳC@EtD vTYL$خA6RFH[aMnaXDR@lz  O`:C Ĵ>VҴlrFD۴,[DD, X)T@4 ^1MnHIC`V}Ta/JtOV8,{ #Y0Y`!BtuBT[ʵOh׵tUߵ T,]OOW RQ.T,;\KlNW8\ ^t1T ,iHePLxUBʻWԻpIdgHjD`nK0,4,V9 ? J RVhHJZv,]Cx~jCHxC`BF8 ̼.NXռ~A:HX A  \{ +QEUUPJd]P`eK[䅀, 8?@8I PXM8.D$h&`T[,kDKSx RpܤM۾pM ]$l@ USQhW0ViT 2BBP2XM(.S4[tTthX6SzMVX@z E\  ExӿK߿4W\W}   PR(%gVh4€ JHV@HO$W{ gPtMn0rU>JL ^S,ԂW$NXp]`Q<S@E"wO1T`Z0> NtGYWؘLđT(gTP(xMn;RXA|W-X|MnR hRMnT %| 0V QT:4YI$VORƀ h@YDx[H~PY< K0̊NMnEq,U[4",  , \CT Rl# GUldwX,|CH N Xd̞]<*qOl:lF R*T@iȉNxMnhJ8 ^UD CT ,@\GD H Q|?HBQZk-JwÀ L|F0t7X4lZU<~@0Wg[QX,R4R"! ^0yG8< EH-VS4Kf^xx2SHu &A$@$t[x/Whh0 |X,LXx5["l0 1dS@WNOOx`AoOTrXxTa@\CW[P^^T܎[A@' 6MnU8yK\dpOyԇJT$[0Ax S.TmS<]  O"U)THD@xG LMnbDEXr`^\sLLwM|\I\7 [l6S`ف L?TXSL0=T0A$R"&(U[5Pv DNQ\,[Eh( qA8E8dQ ^ltS4EO QrOT.K[I@0U8 _(@u]zS`A  hTH JH4U8]]Mn8 Q8%x$ >LY_2ZkVXyWxDT0D/Lx@EtyMDO@z] \.DxrL8<7LtR"!C2"SpGtہ QMngZvUT0Y4[01D MnwRP'}@(7EJM@pDdZmOS,J [H@0*T_{H@` F U H@xpL-J4SCMnd$ WLu[XR8EEA  ^ hL[LWLL ȭY$bC $^+x <d}N4IPG8YMnw([WHti[xMncNHNLTVkSHu'TWR\MnJȊR,n!W< S(Lu < {E\: O8O| [BgPANwUN,4 BlY |F@,T8E0}( CRLl^ NP