'VI(h0KsNetBSD/earmv6hfeb ramdisk 08h<  h0(/t th@@<@T 08h<  h0(/t th@@<@T Uht`Ahhh$ hhhhAhhhA.hhhhpxAhhhAhhhAhhhAhhhAhhhAhhhmD"$hhh (08@HPX`hpx$hhh8@HPX`hpxN$)hhhK$(hhhM$Chhh (08@HPX`FAhhhChhhAhhhAhhh!hhh ahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhh ahhh ahhh ahhh ahhh ahhhahhhahhhahhh ahhh ahhh ahhh ahhh ahhhahhh ahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhh!hhh4!hhh!hhh!hhh !hhh !hhh !hhh !hhh !hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh B!hhh B!hhh!hhh"!hhh"!hhh"ahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhh ahhh ahhh ahhh ahhh ahhhahhhahhhahhh ahhh ahhh ahhh ahhh ahhhahhh ahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh !hhh !hhh !hhh !hhh !hhh!hhh!hhh!hhh !hhh !hhh !hhh !hhh !hhh!hhh !hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh !hhh !hhh !hhh !hhh !hhh!hhh!hhh!hhh !hhh !hhh !hhh !hhh !hhh!hhh !hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh !hhh!hhh !hhh!hhh!hhh!hhh\?!hhh\>!hhh\=!hhh\<!hhh\;!hhh\:!hhh\9!hhh\8!hhh\?!hhh\>!hhh\=!hhh\<!hhh\;!hhh\:!hhh\9!hhh\8!hhh\:!hhh\7!hhh\6!hhh\5!hhh\4!hhh\3!hhh\2!hhh\1!hhh\0!hhh\7!hhh\6!hhh\5!hhh\4!hhh\3!hhh\2!hhh\1!hhh\0!hhh\2!hhh\/!hhh\.!hhh\-!hhh\,!hhh\+!hhh\*!hhh\)!hhh\(!hhh\/!hhh\.!hhh\-!hhh\,!hhh\+!hhh\*!hhh\)!hhh\(!hhh\*!hhh\'!hhh\&!hhh\%!hhh\$!hhh\#!hhh\"!hhh\!!hhh\ !hhh\'!hhh\&!hhh\%!hhh\$!hhh\#!hhh\"!hhh\!!hhh\ !hhh\"!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\ !hhh\ !hhh\ !hhh\ !hhh\ !hhh\!hhh\!hhh\!hhh\ !hhh\ !hhh\ !hhh\ !hhh\ !hhh\!hhh\ !hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh\!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh !hhh !hhh !hhh !hhh !hhh!hhh!hhh!hhh !hhh !hhh !hhh !hhh !hhh!hhh !hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh !hhh!hhh !hhh!hhh!hhh!$hhh4!hhh!hhh!hhh !hhh !hhh !hhh !hhh !hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhh!hhhahhhahhh!hhh!hhh!hhhahhh ahhhahhh ahhhahhhahhhahhh\?ahhh\>ahhh\=ahhh\<ahhh\;ahhh\:ahhh\9ahhh\8ahhh\?ahhh\>ahhh\=ahhh\<ahhh\;ahhh\:ahhh\9ahhh\8ahhh\:ahhh\7ahhh\6ahhh\5ahhh\4ahhh\3ahhh\2ahhh\1ahhh\0ahhh\7ahhh\6ahhh\5ahhh\4ahhh\3ahhh\2ahhh\1ahhh\0ahhh\2ahhh\/ahhh\.ahhh\-ahhh\,ahhh\+ahhh\*ahhh\)ahhh\(ahhh\/ahhh\.ahhh\-ahhh\,ahhh\+ahhh\*ahhh\)ahhh\(ahhh\*ahhh\'ahhh\&ahhh\%ahhh\$ahhh\#ahhh\"ahhh\!ahhh\ ahhh\'ahhh\&ahhh\%ahhh\$ahhh\#ahhh\"ahhh\!ahhh\ ahhh\"ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ ahhh\ ahhh\ ahhh\ ahhh\ ahhh\ahhh\ahhh\ahhh\ ahhh\ ahhh\ ahhh\ ahhh\ ahhh\ahhh\ ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\ahhh\! hhhi!hhh!hhh!hhh ahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhh ahhh ahhh ahhh ahhh ahhhahhhahhhahhh ahhh ahhh ahhh ahhh ahhhahhh ahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhhahhh!hhh!hhhahhhahhh!hhh!hhh!hhh B!hhh B!hhh!hhhahhhahhhahhhahhhahhhahhhahhhahhh!hhh!hhhahhh ahhhahhh ahhhahhhahhhhhhbpf!hhh $hhh$hhhf$>hhh$hhh$shhh$hhhAhhhm hhh$hhh $hhhAhhhAhhhAhhhAhhhAhhhAhhhAhhhAhhhAhhhAhhhs&LzJsT+ޮC3;GBTv~SqGYX.=,D,9ߒM*2gʲV*75UOb5S%j SK~3.X>) $udB86 TKe=L,c)T=Lh5lB i3] <k;p;7,*H> IMZ_?9;B1!|O,COX1}j.+axUpn~aXE-g0G:,XYOk/>>tkZ4@>b'k"|k:~0M9hKL;>9=@}P2^R2fz}0!.dw HIILg@{3:e*NT]/h)qz,Uh~S!FZ+rU sc{*4gig= YeA Ѳ Gu]u@ y<t . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4"T4 (!'~!'~!7\%g\%g\הLL!7\%g\%g\NetBSDAn8PaX NetBSDearmv6hfeb4p@-D0D 0@`Qp(@P`F`F&a03/T@p$$fPA-`0`` 0PpU(pGpG@Pq`P03/T@0US ]$X\@-lPQMK \!\1 P`0 0R0819  0S  /S 0S10S8 0p ZpG2 pG0@3'q1*03/T@Y !p0pWH2H0@3(1*03/X@ cd 0 P0 0Uh$d$dD$d%;8@-t tt{Pl@dphP Lkn`POU P b@*5&7p lT 'P@-@O-`00R@,2t(Mt@0[m oPp@tt@( { R  @Pp0: S `0SЍ j@P0`0vw9 0wpS0SP0 S0 [ HP   0S;00 0  7 P $0s s0T CTH%*T   P R&6&?$[ .h&?8H0`  BR` pRp RLX Xp/&6&7@-s0 &7p 000/&CTpC-؀-`P p0M @3.{@ (-.@{{z`P$0  tЍp@Y&CT%4&7p@- M @00@   P  ЍA- l1X0Zp 03 @P s0S@ ((~@0X;0% P- p U @0`V/PmsX`! pds0-S X@|@PhP ULP@ U(p0SX %4&ChO-6M@T  x@P Ѝ  ,p` @5Xp0S 5%0 0 |5X 0S_d50S&<0kpP(@0SN50S0Lp pPJ400<T$尠E00CS0 -Pᐔ Pp  PYU 0 P00CS0 -0 X80: S  + +pP p  Qt X0 0( 0X3,$05x000 00 Q00SD 0 0 `AXp8  t 0Y 1(#00 H F 0P P@P㴂~ tF0S@zhK"I R0  [0YY]820#0 p00 R0S 100S 0 7( Pʨ0S;)a@T c@P@0 ?oR20S 0  H1 0R0lP( @P @0S "P 0S &P XTy P0Rt00!P &Cx%4.&CX&C`&Cd&C\&Ct]&Cp&7p &6&Cl&CT&S&C&C0@-MM@P  p  ;0U$C dP TT|ۍЍ08 P ,(0P XA%4NY&ClQ@-@ TP DDY,P $ 0P@%4Ne&ClQ@-@ XP HH:0"P $ 0P@%4Np&Cl@-q0 z&7p0$/'TX0$/'S@-'@-'@- '-@-'Cl@-0! 0 \ 0 ЍX'TP@-0! 0 M 0 Ѝh'S@-0! 0 > 0 Ѝt'TX@-0  0 / 0 Ѝ'T@-0  0 00 Ѝ'S'TX<00/@-0  0 0 Ѝ'S'S<00/@-0  0 0 Ѝ'S'TX@-0! ,0  0X. Ѝ'T0 @- 00 $0Q@CЍ%8< C-`A!圁!ᘑMpW0 |! R0B=00 B  T0L 8 R<B 8!4100!0Ѝ`PP .&=`P 0p00S  0 P0P      0 3/R ! 7000@080L%D0'S'S'TX n=#[u'T+(0p@-@PP0 00R00 p800 p0  B0Sqs 'T'TX'S0 0 0 /'TX'S@- % o.@-@- % o.@-@-80M@0(@3/P $ %H08 : S( 0h 3/P   00 0Ѝ00 0 1/pqso0S 00.@8m@-@SPЍ@i PЍp@-(`Vp80@  03/PPS%8003/(Pp@-@P`P ,80 (0(3/@2o P ,oPЍp'SO-2 PM`P(`,PB  0S9P06 I0S +%0 % 0 R,P0(`R0 *0 AT 000+ |tpx h0x ЍO0 P % pHp 81/pq4 $ |?P p 4 T$n0S4 < p0 )0 )"Rh)0 )'0 '0 %)0 VU)(0, SR '0 ''0 ''0 [X'y 00 0S04H0ʾ004 4pX TЍ'S M'S..RR/ R 0 0 /\\CC  B0R00!/0"SSS S S S S SSS SS SS SSAQA0/C-hBM 0  P 0  4 `$0 0!( Ÿ}/LB/DPN#b`0@ R%H }//@#b`_`SP0!!!! d 4 !P`4g4 " C\\ T!d4t4g4 " C  !d4a4g4 # C  d4N4g4 ? Qg8<@p 0 >gd  dp@404kg4 rЍ'TP?bM'S P %8OV@-@StG-A  `004P#"6P8P ( 1/pq $ d#㰀娐pUЍ0S0C080 $0(3/P 0 `V`PE@<#0  Z  $) 'TX.'S%8@-XAM P!#"18 P (5/pq$ #P< 0080 0( 3/PЍ80 $0(3/P`P4 00V0:0p080 p0l( 3/pPp 4 00V0* 0`/PRP `'S.m0P@-@ P M4  Ѝ'TPO-騇IM0@SpM. 8S+ #=|'|0A0S( 000 P" ! <!x000# #|0 & %IލЍ&X 0 W0 pS 0E0VS06  S  S $0S0 600000Sl60 0\60 00 H6RD%f 0Rr0C0C00Q0 0S. ,B< 4"5i*0P` U,  ( , (0S$0$ ,0`040(0000 0S~ $ R# `5`%``i(0SP%0 H%00   0 (5(,0S 5%0 0Ň[4$pWH ? W08 3* ff08 e 08 Pze Uf8 0$pep#0X 0040 0@"D@ 0@p  ( 2fU,0吉((0吓) )f$0吳v'P00S0 ,0S#$P0U $   40S `~S S *f 0$e 0ke$03&"  0[$p[XR3  0 0, ( y0$   r#0X 0040@ 0D"<21,0S 4 p'W'U%D'V'Vxp@-<'Vx40000 01h@-B &><'VxG-R肟@p0 0S0 "3( 0`?VJV$ V00 0 0S0 =D a \e1@s4a0"S04 @pp FQvPDRRRR RRRlRRRPDRPDR R0QQQQQQQQQQRRRRRR0^V ^V-Vi @ 0s000@^V-V00@R$8a0 01@s@-a0"SR 0.V@0 @R T /Fo@P0 R00R  G@PR 00;V0 00 W@| T0Sw'Vx&><'W c0@-@00 005P 0S  S   0 0 0 ,Q;Q S  S   Pp000;S'Vx p@-PD0QS@@R0p`VP 0C'Vxp@-P@P `w, (M$ p 00&7pMQ 0Q\S@-Ao/`@-0S*  0@000S! PXpP CZPP g@P ~0 S</R/     0 'VxgA( Q 0@30/@-'Vx00@- R 0C30'VxA-ppA1SPS a00S S P4!`0`00`0S00 S@P0.S0 S 0P00`P 00CS0#0 m W  U0100CS00 pP'Vx&6G-AP pRpGWR0`0`0` 001S 0100CS0H89 ^P00CS0' 0S  NP 0Sp`0 0`0R00 00C0p00  %`p'VxG-P4Ap  QR`X0A EP0A0S6PC000P 00CS0'0  W  pP 0圑0CS00PU`*<0`'VxG-A 0`0P0 P 00CS0-0 o& 0FSp 1S 0PEP0Cp00100CS0'VxO-LB`0pSP UA!0SR0XPPP00 PD 0Q0CS00KM!1  P[00`F`0#P/  B P) 0100CS0G'(P; 0堑0 S, S  PX^3 00CS00  0堑0CS00  3]0P{'Vx?&7pMA-A`qW ڬQ1ECe R0 0 C0|00PP^ 00CS00 v 0q0CSQ00 \R `R `'Vx&7pM0O-D0!10Pp Ѝ0S/  $SPPPP3P]\ XaT400CS00   _0Q0CS00! P1̃أؓ 0 S)"Rʜc0U```00P 0b0CS00 e\ 1Q !@o!S/ %S !`V U 00 0P 0帱0CS000!000\Q00`PR# !RU``0``00Pc 0a0CS00jl0` 1 1S 0S11a0S S`l  jP6 0a0CS00=?10`! S:`Fp00  1S pVa0S `10 BRpE` S`l   *P 0a0CS00   'Vx&7pM'X@3( Q 0@30/@-G'Vx`01S @-0@!S @WP /LP /'Vx7@-A00 S1 RUVʐ0\00PBO\* 00CS00- 000 @ R, R xP Ѝ00!S HP w0 Sڰ 0R0CS0000 0 Q  tP   'Vx&><&7pMGX?A-O0 R ,Sp WR ! GrYQYYRV||||||||||||||||||||||||||||{|||||||j|lm|||||||rHr||||ly|||||||||h|itjjklm|ntnoopqh|qrs@tHwxlyz\|zPP00 nR pR lR 00 S  PP1S )PPPP0 nR pR lR 00 S1S 1PP0PPPP0 nR pR lR 00 S1S P!S00P0PP!R "R  RP 000@8 `PP 0 nR* pR# lR$ 00 S~Ps "PPPು0S!S  dF0S 1Sk aP0PPvPcN 010<+08+0[ R000@ ?PO 0!SP ;P00 nR pR lR 00 S+0S F a_v1PPQUt P#G@ouG`GooPbVWP101 P00 nR pR lR 00 S PP0SPNʈ0 nR pR lR 00 St)0S hh P0PP0SP.ʈ0 nR pR lR 00 S20cS2 P0PP 0SPP00 nR pR lR 00 S1S @PPPP0 nR pR lR 00 Sz1SqP ~P0PP  PP` 0 nR pR lR 00 SV_P0PPBP T0nQ pQ lQ 00 S 7PPB@ 0  !P4p PP/0S `Vn0VkV PPPVPUXp 0 nR pR lR 00 S1SP0PPP 0nQ pQ lQ 00 S   0  P 0nQ pQ lQ 00 S   0  0SPʈ0 nR pR lR 00 S2S040S402P0PP0S 0l0Cs0S 030 S1S 2SqW P000@ 0S0 0m`PP| 0 nR- pR& lR' 00 S`1SW!0R!S MD0S1S dc hPUU 0S0Q 1OP0PPP`s0 gRG  R7 0 B RX `d@p?X0"S; b(pR1 rR1 U0 R 0 S\ 0U0b0 * `P'00CS0 0 P00 S2S 02P00PP2P02 P P 0b200CS00U.4VP!2R002 0nSS pSH lSL PP0 nRL pRE lRF 00 S1S"!2R000#2 0# 0&><'Vxj3%X%T'Y|&7p c-M'YX'X@ 'W%H^220 2 2020P0PPKP^p PPY0S) `V0V PpPӔʈ0 nR pR lR 00 S11S(67P0PP0SPӆʈ0 nR pR lR 00 S|P0PP QR000P0P00@j `P 00 00 P0 nR+ pR$ lR% 00 S!0R!S dB0S1So bWW P0S0P0PP1S 2SqXP0S 0l0Cs0S 030 S8 P0010CS 0nQ( pQ! lQ" 00 S3 00SFV` `S@pV0"SY`x 0  PP00 nR pR lR 00 SQ0pS ZPP0SPPN0 nR pR lR 00 S2P jr2S7P0PPP&  \-@- 00 ЍЍ/''Y|-0^S0]S0]S S]S[S .0Ls0S^30   Q  ]Q RoG-鐁`P@0 SS&tPD(!,RF`a`qU`0``00P,V( $ 00CS010 [S \S @@P`0 S @ 0(a0CS,0p00,a T L0 0@S G 0m'W'Y|'W&7pM'Vx'Vp@- !0 P< P@01SE0p0S S u`Pp@0P 00SP0P00 P l0X 000QP0Uf0 ,<('W'Y|'Yd'Yh'&7pMO-|b|B0 %Q + PXrX00 SM Y< U 000P "$TU/ 00CS010  Q0R0 00CS0000 S0&0Q@0C0RapU`0``00P 0A0CS000 0P \S0P 0 S 0t00S|hhP 000S Sq 0`00 Pk'W'Z'W'Vx&7pM'X 'X&60A-P0 0p@ W 0 `BP! 0 R00R000 1BQT@ @P@pT0"S,$@gR000'W'ZO-@SMpcȳ00 0GS TcsT`0``00PkTF` \X00C0+0&SK   BR  D R: XJ@p RP>T 00C0S @Ѝh20    BR   0 \SH 1B\C00 BR?"p L\ DR-WppB@ \ p iP SD @<h00C0 AQ 0 T0 Tpppp  7Pu p BR   @W0 `0CS0(00oq 0 b'Z'W'Vx&7pMO-M!@0P 0k 40S 0 0 00 0(0pPP `Cij0 S pSP,0Y01 Y  $ P$OS*X TP  B R+830 #   BR 200S 0 4  R0 0(PP0 ߍ40Y0 Y H $ P$  BR 200S 0  Q P4 00Q' 0 p1pG Y<xxZ  JP@1 R0 ,v(I00C0StX 000 "2 0 0(0P< 00CS000\^W#00 |wP00S 0  Q< 0 X db'V'Z'W&7pM'Vx?O-pᬡA0M0CQ` 01 00C S00`NlЍ|  0P5 =P!` 00000`P00CS000  [  O0S00CS0x00` P  P'V'V'W'V'Z'VxO-RB0M00bsp 0srЍؑ0ЁS 1    000P@ 0.#⩟ɐ Y Fp10S 0p0000000CS0C01; 1 \" \ 0 0#0L\ 0C000@00000000 0C LN 6'V%T'V'Z'W'X'X 'VxA- `P 0 0Cs 0x 0 p0 l   AC^  00@pT @ 0'Z'V%T'VG-@p0 PR` 0 PW(S%R0  d P 0 ,(i'Z&7pM@-P0 &7pO-dGM0PS@pM$Q403/P ܾ0: SP00W +k< P9:P?07P0: S 0SP0: S 0S 0S 0/S& P3P0SKP(  P 0p#- PN+<0P 0#P]]P  m/RP/RPppvKP! 0S0S rBXG X 00CS0kE pl Pph pYWr TTM}\H Z0Sh0S0c ?o2500x?G YU.<.0 !OG=0JyPT.<.0 OG=0INgP8!<0Q\ LH1RPX0S 0S"P#0S(GݍЍX0 X p00CS0 0 0S 0: SP  0S 0 8'Zh8. 0&7&6&7p \\J0\\JX X0p@-DPD@@@T ` U H H0Rp@\\JppX 0Xp@-DPD@@@T ` U HH Qp@\\JppX X0p@-4P4@00T ` U 8 80Rp@\\jJppX 0Xp@-4P4@00T ` U 88 Qp@\\OJppX X0p@-TPT@PPT ` U X X0Rp@\\5JppX 0Xp@-TPT@PPT ` U XX Qp@\\JppX X@-p0tp t\@ ^0@\\JX0X@-p tpt\@ ^ @\\I5S %R R S R SSh -^L^S R 0/0/0000'ZO-QMTf @ `u @ 0 @0L0@@@ @@D@H@<@@@4@8@,@0@5 SS$c\ Ԟ0 !00`V0S8 0 0刐0L0St ,0D0000$0S00(0@ C</ H$pp5H,0S `4 @?C000<$0D0p0H0D0pH0 $ppH$0S0040080#0ppH,0S 3 @?CZ㸰张 0t#ppG 0X#ppG0 \ 0C0CQ0B003/0400S NYT R~S0 00 R0! 0L0S XP@ |0xR< H  <@0\DD5H 5 8P ! t p\48  4 * R," $\  " &p P 0 0,  "0Sb Q? 0 !X=X0$0 Q9 0 l!d2d0(0$kG[(fG 0R  P ,P0@XG0S00P00P00wPPu\0.S0S0 !z=0P$00P(0 $u (p R P0g᡼P000Ѝ'ZkeUUUV &OrO-@a!80S 7PP! :tpW  ЍO8<0匑SB儱|8@P  M@8M@M0SL H 50CSlll\C $ɽ :00L0S \0.S0S  :@0S40S +:<0?oQ20S X 040 Ѝ'ZP"!kG-`LUiAP04FL0 $P0S&00D0H0P0pP蕟0 'pN5T H0 `F0P 0 DP n5X0 s0X0d 0t000|00PP' S'Q 'R0 S" S# S5 L0S5 T0S40S4P$Q40V  00Ѝ10@GSLLLLLLLLLLLLLLL $LLLLLLLLLLL,DLLLLLLLL8LL D|\Lhp $L8 0$00H00P0L00T0QX0s0X000P0L0T0H0F000P0L0T0H00X0<0P00L00T00P0L00,(0d0%PP"0<0080 P0 D0h l00D0h000000 0p0p$0,p0$00,0000@00 00p00t00D00h00x00|000000000D0@P7KD @ \0 SPW( ?R004(0\ SR PPP00`0S0\0S00S S S0|0`0Sp0\0Sd0d0P'Z@th%\d&0|`L0<%`'&7p'[ d8 (80p@-@PT @@\p'[h H'80p@-@PT @@\p'[h H'-L MRM\0 k+ pJ坻0 rލЍ 00 R>04@pl0l 0 0  L00S   .&7p 0'[`'[d'[<$0\ 0S '[h 0.0L0S/0 0 0/@-00 SM 0 0$0+4}ppdhZЍ\0\@ X0R@P00C/C 0Ѝ@E'['['[P'[$'[ P `00CS`0p S00 P0S X0X /Xy&6: S@-  S  S/ I* S  S%|@=A-t1`@pTXPM !T@L10S @10S- ,10'p @0 0 0( 0@0S00S 0: S@Ѝ0l 0R00C/cC0 T00S '['['[P#'[`'[d'[\'[l'[$'[ '[ {Pi O R ,ZP S0 ¯S ,!0 0 @!@ ({{ z0 ip,R00@0 P @p lP E0S  X0;X0XtP oP E0-S  PURpPt0S  HOp @Y'[ &7p&6P / c(.8CQers@-@ `PP(0P UЍpU \@0 "P4@%pA-A~M0pSM P0` 0`PwDp! p~,uP jD@!1P~܍Ѝ0 0`PWD ~,XPPND ~,OP `0 0P9Dx W {Q \00 00P!D0$ >1%pm0Z00CS0 b0 /O- U`DMp 000D$000 0000SXȬV"4`0p Q 30Sa4PZ|SPZC0`$0000 0K4$PC0$0V 0030p Q  #P0 0C0#0V0030d#PC0X#0L3000DЍp(0: S 90 S" P 000 S|2"00"00 0R  Rz2`2Vn `i S0% 00 09pq:C0S 0㐐唠0 0p) W W)2`V% 0 /<010 0R  S0R 0!CQ:++R:0'WW~Ta0@  0 <T04[@T ;0W ` W00l W~,0 ~l0`Z BP* BP*Q*S  Q T0`%p'['^%%|('[5%%G@8m'\'`%}D00S/@-4@~M0S~, P~܍'[%p0@-p@$0l00S Ѝ00 09 P0{B, /xP%p'[xL0@- R81/P 0 0 %/'[('`A-p`P@ Q0PPEU`@T@A-p`P@ 0PPEU`@T@p@-P@T0` Q"@P 0 Q @;;S p@P00T@ B(0(  /( .%p'['`)@-,BPU` V0bP$00 p?W0 pGWhPhA0 SV.00P ЍP#ڀ;;S 00 0H8 P0Q/PppD1$p0pQ Q(% 00$0SP ( f.A0S00A0ES00A0S A0ES $0SJ.|A0S xA0S tA0SPU kA(0( .%p'[J( ,)tp1 RW@-`QM R P!  BR@.Ѝ R RR.  6 R R  -R R @pT pR0 L7Po 0:p0T 70 L 0P000S$ʳ/'[%p%4mcG-0 Q@ ,pPP"ڴAQ"i7P`0 Q Q 0X7P@D -ЍQ 0S%p'[@-xaPMP d1@0S2 SQPD;00Q0pp 0"7 P@ -Ѝ0Q R(0S 0 7P}@ 0Pڌ T0 /:0 d4-0 L 0P]@ 0, z-%p'[&Sx'`mO-rM R4M0`RX0E@FPE F園 0S 0  F0S(0S h  X"T2p0 0904">00"#Tp" #>܍4ЍT 䁟0S =! !!0`##9# 10 00Sx1pp10 0900!|>08!000$q0 10`(0尐C  g  a ,0 ( $0d9$0 t O 00 0 `#D#~9# T%&7p'[( ,'x(k'b'^I'h%p)C-LRLb0HBS0000 Ѝ((0 0 0S  2 r0S T1 1 0S pP (0: S)0 p10S10S PUbP  0 0 0S q4#+H P>"+RB$0`SF 0`CĂ0S2T+p9P} 9Px 0 u S( .p@+l>+h2Lr0`0CSXX5+2+H0+D.+@,+<:+P,9P000 0+ 2 `ލЍ+0S  R  sS SS YSUP*yS*$qx*l*<*P,U9P 0S8 4L9P( 81P *0S(*PP {JP0000**(%p'[( d(%%| 1%?<  M_(Vwm 0@\ }00@-@FpQp`%O-q\ Lt0S(P1`@PPP"@U(L0 R1V10S {*@DT  A|#0d#0UPTPd*PV0S pW*@X`ꓢ" @2/PL0 !ᓢ#, 0+%%'\%'\( ,O-Q0@`p@F T[ PppWPH* ЍPT10S   *p@ 0 $03/P$ 0 R T @ A"  80 3/PxP\\00Sd \) Q < 02/P " "( ,'\!%Gj'b'\@-AMP/M]?@P+ p`pP/0P0 Uh0h )AލЍT0_"/0P0 0@0 `)'b'\00CS0 0 /0O-S$M00`Y P$Ѝ P0,03/P00嗪L30S,0@Pz=0 Cᤸz  Jލ Ѝ   Pk@$<Pc@$<q0S P(4 $R;<(4$(4R;<(4(40*Pz P#P/ 0 `0 + H`\ QX00O0S0(4 008 00(( ((%%(#D/O-pPM W 0EQ 0S08 0<000S@@0C080pG0S 0`S : 08 0 x! x3  P< "/@0  0R X2P0P/%P*/@0 ,0嘰 R ~P` dЍTT   ` `Pz\( p( ll( x( tRs@-Ѝp@0 @`PX%P.08  媶P.0 (z0@-@MPPҶ00800S =J"Ѝ0(G-`QM MJP㠔@ Y #p ⓶P 0p 0PP=! RS J(Bݍ ЍPJk.8 = $LH0RP J(L0 00$PJO.8 PT5G- QP 000aq@T+00CS0&pT0 0S0T@ 0 S@ 0 P 0S@ 0S0 0 S P ((%<&6 0 0 S00@-@R00000S0@000S `P LP40P( ( (( (p@-PP 0S|p `ẚ@P` '@P0/S000000f PR @@@p(C(h0 RX R  H R/< R/ $R/Q/ (( (( $l0A-0S X0XP@0P`PpT R S, 0@((&7pjC-b@ 0,MS0S.,Ѝ0 0P50C S="l"""!"""""t20S 0X0 00!P! " PPP  0!$)$!$ 0!0 㓝 Iz X B+(4 : S>  S8  S%  S04 0L! x0 J $!o1'P6 S  S0  S04=! 0400S -ЁЂ ;Ѓ"040+04 ⩴P,0P 00   0 P(( (p@-8M@  D 0`P`⁚U`$ $ @ 0DP8Ѝp%A-t1hM0@S ThЍA`Z(="(<.p@1WpP0 0000p084 40CSL$0r"60"$0( 4 CR+x غWhЍB>'PϺS+<  |(P1C Y#UNe@-@XM="p:(⅛0 XЍ]7@-@Ppp P Q Ѝ0 0 X Ѝ0@X0S :R Q/ 0B\/0@ P 0 0B \0@ AB\7@aB\/W@Q/Ppp@-PP,@0CQ0#S : P$B0WN%R0CBSB 3b 30=*PpA0NQC S*p@-@P0*Q@H? $0S\?:! 0S* Q R T 0 Br\  0B~ \! AB~\ " !. Ta Br\ ! p@-@0CQP0#S : P$B02W"N%R0CBPBb 0)@pA0NQC S*80P @-  //( fA-@8q8`Q PC-PQPUPQ S A蚟AM+:UP0 ddV? 0:S@ 0S000 -M(&0|&7p/%s@- `!0QP@ Q10*P@Ѝp0S mR! bR kR%$+ 0*S xS SwR!$/QP0P@0$+*$& QPP@0PA- 0SV`PpP &0P# X p R 000R p0000S ,P0=0~@PS(s@-@ `P0C30 0  R R00P@P0@( 0ЍpPE (00(@-  Vz&7p%0 Rr @-/%@-4@4V(V VV^&7pY0*O-px D@ p\Pp`)0, [/00 ` H'O-lM/P+POt`P `0@p/小0/ `0@ ?/@|p??A0s S  R`?`/0X CRSE <zP񟗳6P41,46H444446x466`6h6p4444644444444444444444444444444466 4466$4606<4444444441,5@44445\5d5444465441,5d45454544444443343444<44H4X4`4h44p44445 4555$454`N>4=Q $,PMP>@J >0 -R,Q0 00 0;= =, 4<=@?<?<?<?<?<?<?<?<?<?<?<?<?<?<?<?<BB?<CC?<ClC?<?<?<CCCCC?<?<?<CCD?<D(D<DP?<?<?<?<?<?<>H>P>>?<>?<?<>>>>?<??$?@?<@@$@@@T@h@|@?<BR@P꼃@2QH |- 3@ > 2@ 9`3@ <2 3 T2 @ .83" * 2@@ % 2@  2L 2LP 20A00㬁堑 RK aR eBp Q P?@@@@@@@?@@@ !00000 00K1]PJ `1J  P1I  0I Hꈁ 0 010L0〱1Pd H(((( d%:&0|%&7p(&7'\'[$( %*((%( (( Ê%%%%%%( $%(h&6j%@Ǜn p"ES( (( %(( ,) '&7p >.( 'D[( ( '\x( ((((%(-M'[5( dG 0 .( ,%&0|#(% R#ijL#R'0   0G 5가z0Q , G# 01F  1@ P00F FP`1'PE 1E  1D s1 1C1TPC1PB $2B  42A  D2A  T2` `2h2l2 p2x2x"|2+S0020" R002XR0 B+S002 C 0 0S3# C*SS8C0U Pg000Sv|30UӈePE3PlPN0000S 3 Y0P  /(l0P/`0p@-0 PL@LPP@0@P6 ᷲB(( ,Jy&7p(A-`  @PA?\+ \ *\.  Q R( [\SPQU !\@@]^.!Lo \0S8 /0S0 R0SP/ S QR S0*S S 0PS 0 P0^ p-W pW]W ^W #@^ ( $p@-@@0/SN00N P\IpPQP`Q*C0CT030@"L00Q*pQc@-1MP MAaqUP/]P #0P0Sۍ Ѝ.S@T|`l @ @(PĀĢ ī #O-cM M33 "@p3]PW0`0 00S 0f0 0 0>P``$00 ;RSVz @0 0;T*Q`DV:  cݍ Ѝ&Q) \Q$ 1B\ 0 BQ "P P BRCR0 L 0@&R\R ,0 0CP;T+ 0S( `0V"p0S 0 0S +0S s  0l 0 x@T *0S0T00  R S 0 ( Nŋ&7pšhC-`PMM RP p\SP RT P0S #  0S{\S R. gS PS$ SS GS f 0 0=pS sS0S00 R @@@(PPP :ߎ@P p 2P ; ͝0 0! ۍЍūC(A-PP 0Sp{`pᰎ@PL P40  R p`@@ @av(X0A-@0LPL`LpT  SL 30@(&7pƣ`10SS p@-ZDT @ Q  p!Q R$R S0  0S- T0  妐04rP  0S/  00p0S/  0`0  @0/S000 0D  /(( ( $(0A-j40@TPp 00S0o`0 00/S @Tx0T0oP0 SD fP04(( ( (2A-0@SP' 0`.S0.S0S/S XkP 0 Q CR S.R  S.R0S/S r 10S410S 4P:4 CSR ! Q`V 0/S0S.00 p\ N00C0V0<0< `V#>_ VP:4 C/o"SQ  S 0 BP  0 C 0C0 0A0 B!"00@&><[ cn|p@-`0Sp@e\ 1e #@ PX000p 0@-͇500S/( `0-h0^0 SQ0Q00P( ` Q#p@-0PSp  lP`0 r   Hv @Tp /%ͱA-`p娀o@PPP@P 0 \IH0@ LD00CS0 $ 0 4% N( `M-`PPЍ8" :0J840K0CS 2  `70 01 .  db (l[ <tV @ |pq}  F=/$4  0 =C@2Q! 1Q) ($5Q/^)040)($84K ARKQ  $@ q++@@04(4 :(40/S0004084(49)($ q++ k$( l ( tG-z4@0CMS*wxx,xxx\x<xLx\x\30SPP ލJ(nJ(J(J(( `tΝW:(// Qp@-(0PS$ l` ÿ@P|t 0000X0 `%V0  y@p|( `τO-P`P Ѝ#M:0J84YqW V#!/00p0K0CS`3X IPk0<0043  a  d ( |pq  }? 0$00004JH1P tn@0 B(1<@P l`<0 㓍 H K06S 0S 3 CRR~~~~gSt K CRW0 40r;; (49 xS!04(4:(404(49(408400C /Q000S($4S::  $ R(4 @0&"**40 p0 2S($0 *4($040)($84  R KS 0 0 40r;; 0KS8  0w( $ ( l( t4( ` O-j4@SM- S pcW:ڬ60WS0dpGp0PS/SpS 0EoᨂSXA T0CSPP J0xğs# W/0p -P 0p %P04 T 0 !.00 S~ .4 0pp0(p Pw J60000 0 P JS20 SK010d 0J43 00 0P J4 S&L p "p Pp e++ 0S  Q0 ^q @ P0 c0C 03 306P J( S0070 0=Pp0u;; A 0  0S  Q0 ^q @  2.0 0~p0<x P J7p0@ P J,1  = 0qpP J< @\YE   ˂XM  Ă} 0 KpP J} 1P LP$PP P P $p px 0q0cRa1P( `#+ C3<E  Kc(gPm0@-PMM@ ` z=XX  0PU U;@ 00$0$0<00 0ݍЍ0$ pD ( `p@-@  PP ip@#tA-0p-S0S' Z@P#e 0O0` S0 DP<PP40TЍ@`jъ&6ѝ-@-0@P   Ѝ@Ѝ/( p@-@ATp@0 R PcP ` `P`p( -P@- 00|0 x0x 0 0 h@0S X d00L0L <Ρ ,ڴ$ c Ѝ@ Ѝ/((((&7p(p@-x@PlhPP XP p000S  pѾ( j(  -P7@- 000@ 0 0 0 P0S xc00l0l hw X僴TᕃD 8k0 c Ѝ0@Ѝ/((((&7(&7pP@- UO&7p@-M @P@ލ0/S]Pt]P p Tݛp  0RP 0RP Ԏ M 000/( @->  &7pA-q`@ MT ttlAPD00CS0?:@@P hDP0P 0@00aT8@p(A-ppP`0005@50 05000@0CS000SA( ( p@-P`@T  PV 0@p@@-PG-`=0@T3 =P&P 0 V@0P U V{X00CS00 aV 0 00@p(% %C-3sPc 0 p3@0! 0  0004 Bl @3 3 00`D]5蒟  0@ Ѝ/R@R R@ G&@ B&Q@,0@0=S0  "?R 9R:BPh$@8|R) ~R$ ^R \!000Ph; 00@=S= >S 00@<S =S 00@|S0 0@&S0 0@=S0x g  +R'0o  -R(0h )d%b#`0 ]&><( t u( h( p( \c0@- ( Xӓ0s@-0P`0Z0`0@S P 0R@P@.  P@&0S00S 0ST P000 R  Ѝp( X(%ӳ ;N u@-L ^ $Tpl`PЍ%Ԓ(gAԕ r ( xԢԮ MԿ@-A$0Q @  T @( xԎp@-L@Qg70P000S LT#PP 0S}s@@P 101P00CS00 #P 0 P0p yT+(( x%5G-pPp@R` V101 Pp Pp `b\TQ @0T! \0DsQS񟗀pppp|p8@pppppppHpppPpXp`@0 0BP!0 BS@@00CS00 O 0@0 @T0S 00CS00 O 0 0SY00CS00 yO 0 [O 1 0d1@ @ @ @ @ @\@@%[@A-@ ` PR 0R 0S S*Op0S0 R O0S  OU  OTOx xO Td@00CS00  O 0 AN%( ( % &.% 0@-P8 0y( @-@(0Q H0S 6Ho^0S 0S$0S @TM$@P10S H,10S H 10S H00S H  0$ 6 $0?o2$0-0$ R  h00S G 5@OL<Kk+  Ѝ%(( (%G-PMp@G+0 `㠀堐堠APP  k+Vx0$`W U ^0S W P 0`S++Ѝ(%%( P8PG-P* `0@00 0R0Cp0W S `S0p 00 P++S p0@*PD0(00$+ 0$ 0$/%%(p( A-Pp`@䀟000{^0S 0S 0S00CS00 0S  BR0 00CS$`0$`0C0 $0 R SP 0$`S S( %G-P䑟 M^`AV $`*pWT0尡p0p00WZ 0S- |1|a4:Kl8K 6K00CS00 J 0= L00CS00 J 0 J  ]N^ $`R 0S S00CS0 p  0S pS00CS0 0$`0C0 H* Ѝ%( ((%yA-@ M p* 0 0PV@T/ 0S0$`V@ 000,P 0`@0T$0 R ^ R 0 R 0$0 $0* Ѝ`0(( %G-`倂Fo@p0媢S' 0S$ L2LRH23}J8{JY8(vJVrJ00CS00  J 0 IQV000  'P7 V a< 0$000CS0l10SG  D FP~ P00CS010S C00CS0 VVp00S $0$0CS0|00S 0S0S0000T3I8IG 0}I%(%(( ( ( p@-42M000000 20S 00S 1 `1&3II0Q@TI1HIPP& |1  1@@0S @T H1Й YD@I8I$1%I0S  1$ ލpA 0 000 0vBP00CS0 0@ a0 00x0 ?00CS0 0S hIlfIL0HX00S @00S ( %((%$( +( ( 5( 0 @-`o 0 00^0$MSP4P @d(000P pl&P 00S Չ?͉0 p000CS0(00S h($Ѝ%( =( C-@?mM000@H0?_00?0 0P@,@(0@ ? `0d00@T 1PPdo0 `0Z@T pd0hP 0$o 0lP@T 000P0l $00`0S$'`0 S 0D0>60S >0S$0S 00D0$ 01C 0d>0S$0S ph@DnT@ xP H047S 7S) >0S*00S5 -0000,0(00 0p(0P =&0S(7S%00S 0 0Sd= 8  ,=, ۉp@ P 0 ,= M8 = <, R , },( w%P000<<0S @A @X$ 0 $ ` 0bh<<<f1 Hh@T: =p<P`P H00CS00 G 0PppH@T4`@T @ [00CS00 wG 0 H@`@T0Hk PU#00CS00 [G 0 :,0Sh@P3 F 0,0 0H 0((( ((% qT(( =(l( ( (%ļp%((-M&0|%%%N( ( !(t( `x B ZOG@T(0Sp0 t0充,0 0s,!p)DlAHF0/( 0 /( 0 /( 0/( 0  /( P@-@(P@<0 QP cR   ( 0 S0/( 0@-0M0/0@0P mP T0: Sl  S` PЍ0XP0 : St# PP( QҼבp@-Px@x`M$P*00S m#0`00``00,"`0#$Ѝp( (@-h@P$0'0 RP  B R    ( //C-LM*8ℕ8 p@<(P@0` D, ` 0CLЍP%קA-@P`ጄopWU vNU" 00w(Zp(( O-pWC R``%` P0S:S2"E@А @0S,W@  @60T/S/00Ok0 00S00P R:R0:SPPP@DO`"S"%%( ܀@-@MP/p P㨐K  0 @ T9Qp0 @~0!0P 09pWZ0S 0 `T0S 0S 0 S&p @F" f`P T T T0@@T >0DS( kA- @PM`RkPl褤1000  8p"XZU h CB Q PBLBQ8B 00AS 00CS00 sB 0* 00CS00 cB 0 ЍQ PBB000M 00CS0 TBBHD00S Z,z(.%( ( p@-P@@Pp 0S%Sp$P @ {\p@-P8@Pp 0RPp@ z- @0@ R0S P P\ 0%H( G-`P@唀0吐00|Up00CS0h00SG0S0 S 0S00jPPp( ( %H( A-`pP0@00 Q Q:R@ @:QR@P0SwppR %Rw@J%Ppp0V:SP0@w@('%H!A-`P倀000|Vp00CS0T00SA0Sp00Mi@T`( ( ( 0A-pPS R+፣`a@T"W p000g 0 @0 0 Ji00CS0H00S G`)P `@( ( ( p@-P$@Pp0P0@ z@-L@000@00 Si00CS000S@( ( ( O-PM/`@ 0bP @@@ (7P000 0S 0S 000Ѝ#   P@ |DP @bPR R R R 0S 0   " R0""  " /R0 dpP>Z0 R"00ㄲ0  pPZ m P2 @ 08@00Q  0S/R10SZ  $P %pP A0000S R  pJt#P+ R ' R #(P0 * R; R 60@@DX P R  Jm T@0000S R    BR =D R9 7 a( %H( %!( )%.( O-@`pM&PP'0S*[ 000`0p0Sw|2!| S6hB?01 P@PЍbPEU00p`@[ Q $dL\V  0P!0X ZWYV M1 00 _0S& 0s1TP P*X 00SW0 0 S0 P 0Sl4YT 0s P ks@TC(( %M( `(%Hp@-`P0000S S@mK000 00 00000CS0p00Spp@ ( ( 0@-x@M0 0000\0P>00K 00CS0$00S Ѝ0@Ѝ0( %( @-gP 0S*KO-@p`SM%P S0cS ``9 pP vPp VP``*00S/ h0@ T [ W>@P"P4Xh Pk   R񟗩00S"" 0RePW>= >0 @ TW 8L> P 4>>0 R @ T Ѝ>>A00CS00 > 0 00  x100/PXP!  qZZW Yh>e>T.PW[>W~`FgWxWtWq ~W 0` @ p`>`'؜(ؠ rزPy %(؇#!*@UrO- MLBLRp(0@0`V' VV:V  VF /V   BR 7` F R0ؘ! R  |a[  0000SH%B@P  ~p[/R 0/S 0~t\P Ѝ?\ @TW 0 BR r R  BR    BR  U P %( d(p%gA wA-(A0S 0PS0 0aqP0S00 P000 Y X0 S@0 S@HY" \YX0 S@0 x0s0S7X S 0S 0S<Ѝ@0SX0 S@0 Q@p X S@0S0*SS x r SR ?S[S p0R  @R @ R X R R  @SS0S0^S!S00x~^\| ]\Q000``S XSQ0 0 @ 0000xqQuS^ P[Sc:Q! P-Qe]Qb  \QQ PP$"`( |P1 0$0 $`( |P%H0=PP0 QPQ P !$ P80QP*0$0bP b`0]S0 S 0p@Y(\PP  8QP4\SSPP0 SP0S  @p4 uO- P@M0?S*S3 [S;0^S!S00x|\/]P? [P%:P$]PP/P^ P 0/SS 0:S0:P0]S 0/SS  P0P/P 0S xpPS@0/SR"@ R0A$x r RP R  \$$Ѝ^{PX9$P| 0U0/Sd 00EpP $0S/00E0S``0` xqQP 0S ~V/00D0x r RP0  Q: 0 R /00@>0P .Z. B/o" R  P V0 `$( d M H'( 0 q Q0@-0 @\C\0CC/x~^ࠑ\@ \ 0 A-@QaT0S 0@0@ 0?S*S  [S R 0 p00$0S P m$$$`0$000CS0H00S O 0S ~0P( d( ( p@-@ PTp 0@ @@( dG-p 0s0 S QA0P 耟`V `R`F@ V @<<<<<<@S`` S =QQ RU  0P   P u0G-p@ Mo oF0P 8a000e U00SW-00E@`PIPE@T Ѝ00CS0@(pO- R@@0`-SPM S! C RH4?So @Sy 00C Shg0 0 >_`_0S\ 00S=SWV 80 R8 RN0aF1@ 000U00S gWG 00S; 0 0CS 00CS00 ~ 00CS0 0 00 P@7@p<(W@A0S 0g0CS00  P6FBЍ666A0000Q00S h6h pR\&TV(0S 0 0S/00f0CS00 w 00CS00 v 0S 0e0CS0]0 00w0000v00pe: 00S 0 0CS 00CS00 ~ 00CS0 0 00 00~00 0  0000CS0 0 00 0S 0  000000vH4  0440`3p00 R I 0  U  R~ȣ0d R R7 V~AQU R xx  BR  BR  BR  ~  BR   O ~ I   0S q QAQ$AQ!   Q R V  BR + `w~   0 BR儡  BR  ~ ~  `K E~paQ 00S T 0s0 S00CS0 0 p00CS0 0 00 00~00; 0  00 00~00 0  00((t w(p( d r r%(h( %(%O-$M000 Z0 0H'0=,W0Jp00 0 7'0` 0`F#ZGF@Y0/ 0h@P`6 Z0`Fk   @ 0@R `F( h6@T @@T*T@@ Z 0JSG (A49 6`0P`F 0 0S Z?0Y : @5% @AQ TK[Y0I Y@i ZD5  A0B F0  %T5  0 Zr@00@@S[P@ 00㐴 Y" @ 0 @Rd$ R @  R$""$$#H#H#H#H"h$$$$$T3  AQ AQ~00AQ ~ K R  BR ~0 0  BR j~0 0d @0RP[ 22 0AT[ @T 000S[@Zp  Ÿ0Sp Spx hSo T 䁟̑00CS0"0 娑0 A0 0000P  00B 0C 0000000T0 00`P 000l0 GR00#S00 B00S0p0 G0 B0[m$Ѝ|0s0S[0000p0SQ u( d(p%%ق(p(t w(ٚٵO-0M P0 4ԄдД00C0~Q 0 `p0 @Q Q!:Q =Q Q QX   L  BR  V PR AA KA P񟗇)p&)))&&('h'W 0S@ЍQ Q@Q =Rp( `p(``# P  BR  wp" w     BR u    u   BR    ( R 0BQRQ B  W `   BR  v v 0ASq Q AQ~@P   Q @~  @   }@P | i  ~Rf=Q0Sa 00 f   @(%( d%((pG-P`h1hAf0dS 0\q00P0L1 00<1 (V0 S8000`0`0CS0!0 0@$p  Y 0  i 0  R 000/ 0p %( d%(p%(( @-0@%O-XAX`0$M`F; 0 0C 0S0P 1P0 R"Y 0C0PEPE0000C0$Ѝ0000( d%(p(eO- aXQ q0@ 0 R  p  000XP P X 4 0 E0CP0 Ѝ0S L H}1L008  @D0000D B( d%(p%% r O-@ brP0  DR400异Q} R    00d2T`P `8 T_ T@-@FT+: PR0CZU * TR Q  S0D2@ P80Z0Y0S@@T: Ѝ@FT: P5 DZU *0TS0Q00R D2@ PZ 0S@@T:@PF0D0 0 C00PE0C0`FT00 0 D0C0CS@0 000000C0000{0000%( d(p%C-PpM@`᠐ 0嘀00000p000CS00 p0@R i@ЍF00p( d%(p%A-Pp@s0A00CS00 / 0 ` V[000CS00 / 0 ` V`000CS00 / 0`Or%@-@-00S/ R%LT0QH0 0Scq o/P0//( %L0    B /( A-P夀0@000p `R$ 0 `0T @ `  0 0C  S000SAn( %L( ( 0A-P` @0p0W0 P 0X S S0 000 00 0h0 $P   00T tW00CS0 00SA4%L( %( ( G- b B0 pWcr 0S .. 0R@P܁P0/oP2b000r0S^00CS00  0S 0Y0#S  o P   oP/ 0 0p0P0 R R   BR   A   BR 0E0CS0000`0D00S .00s.`%L( %%?\%%@-L@00CS00  _p00CS0@V( @-T T@08     00000 0$00( %LA-P`@000% NoV |`0Pڸ%p0PS Z  D0  0000CS0 00SA<( 4@%L( ( @-4ap00MP0o@P pP(0: S$0 |  nP  Po-0 00c nd%TnL00CS0,00S Ѝ( vڄډڦ( A-h@Q0P0`0 PHpP<0`00CS000SA( ( %L( p@-`P@00P0%P U 0S00U0X 0000CS0p$00Spp@(%L( ( ( 0/%Lp@-@,`,P0SpSTp%L( p@-P@0Sp%L( p@-@Pp P0Pp$0@p%L 0 R/%T @-@0@1^ `   VpPW  Q Q 00 r B"Q q A,PU 0  0 (Or5%TA-R0S20SP`AT p p$mpp ($V$SP 9- 1N PpW0np n 0P V))) n qP TnpV  USp,tV m P 9npeV  ;SpZV $00(((`((l%TѾ=%(hA0S/p@-@PP1PL1DP0a 0(00R 0S"00D05#0s  0C?o2^0SPȟp'P VmP p0C Ao PQP0S*00CS0p,00Spp@,(iOr5( ۩ې( p@-@\P0P00 OT@00CS0p00Spp@ ( ( O-@`LM R0 LЍOL,ؐY) PPY   0SPs  0 S S S PQ 00SЀ0S@LЍ0S}22 F!0R+  p  !R -  x",`p 0 0H" , Tp0 sT S0Hp+ 00CS0h+0p W +㴱p^ Z 00CS0Q+0 00CS0E+0 | 00CS09+0  Ѐ YZ+000u + #40  + +P S#4sT 0 0p@ gd n+pZ*0㓉#ЀC^(%TOr5 @- 0 S  .^\Q0  p@ S0C  C/o "P R pO-PP10 0%SW P g0@S!!Q@ C$0S 0S  R-S %S +S @@1@YZT X@1 r9 002#00S 0S 0p?Sp  t.P T"@` P9P \0@00SJ R Q !" R @%T#(3G-$a$C0S Qq0m0@S_ @ *Р㼐0Sʰ00CS00 * 0 R+0 R  0 S !c*(P(Or5QAs%A-p@`QP00Sxt10P 0S XjPp pP@ gP`WP P11@'*@V Q@ T0`p0S0 *@00CS0)0S 0 0 00SJ 0 S 0 0{(ܧ(Or5^V~%800S /@-P `(8 P  /Q 0SZ//(`060S/P00S/D0Q<0  40 A!0 S00)%(l%(Or5G-Q`0SR@00SiZqP000L:<@ 0@C$ Q 0000CS0H10S 0q000 100S01000000V 00CS000S 0S @pWZ00萠@ 0 Z QꙂ! P00 R @(( ( %A-`!@SPp% M'WVV |1N0S9 U 0S0P kP*jV811OpuPR!1@ ! #&0@$$060S& $$$V&&U 0S PP aiXIiP HHV WT  0 (l%%TA( (d( Fv08 N R S  0S  P %O-pR0`BM0 pP 0S0S ЍP880@000$00 ##P%:T 0S0 10S 160SdTf P c100CS010S 0S 0 2"  \ Q R05S00|) \~ Lo ^ \ \ \@W~ Lo ^ \ 0S 00?TP 000(( ((l%%( G-pPE@P ?P1N0St `N@iT @iMp:Q `㜠@0S0S 0S0S%`@Y 0 X 000 /%%TjA(A-@P#P PT0Q 0S zlP@ pP@ ZP@z|06 R0S@@d`Q 0p* 0 0 Sk(.%%O-PPdPt,M @P Y8 U0!0S05 @nT pTU P300SU00S00 ,Ѝ 0S(P *,P p0S 0S@3 P#Zp `X*00SL T0 @@0 00 00QBZR00 RiUX *Y ^  pPX2 R  Y RRU@ )260S(  @ Y00P'  P0`0V 00' 0V0S(0S0S 0S06 P 0Q p$@J0S 0S @sԀ0U0X0S 0 S0C0 fl0SY UX m) @0S 0S(((%Orp@-@f``Q000 R 0S <1ILp hO!r0S 0 00D1  S A` 4s` V0P 4s0``0S`0S^00CS0X00S yp800P0V0S ( %TA(Or5( @1A-Q40@S|%P`q0SP00CS00 $% 0 v&0Kp  N.S!%PlP000T0@0CS0800S (AQ.%%TA( ( @- @ 00P(@-@ @Pp@-`@0 0 p 0Qp\ PU%00p(A-:pTb0AU RAЍR R =RU "0Bh 'Rf 0 BR`a\bbax`aa`) 1PU ^ S \R0 R  p ` Q\1 0 0A Q "Q" .  Q1 01p0} 0$ S0." W p 0p: !0}RQ 0 0\ $ `0" X00{ Uy 0"  @PEs(4=KGN%\QWA-@` tMTg 0SdPUcf,ddddpccde$ete|effffHc,ffhffPf\ftffdc S0S p#k$$"00CS 0SDA0#[$;P  @`@P@PrUV0S 0S Pl\ЍP@@rP i 0S P ]PRPIP\ |klh0`aHPqPLUH %} 0 SuPqE Bv P5 P2 P/ P, P) P& xus(Or~ /nsx{4v݃݊ݖ `ݎyOݕݛkݦݡݫݰbe`hk_ݻp@-@P\`TpU 0S@@Tp /p@-Px`x0PP6 R@N0S2@@@0S. @D0    p 0 p(%A-@1P0pS`3 R4 0N0S- P/dV0H@0S$dV0H@0 @000W0܀ ܀ dV(0H@V0H@U (l%%TA-P`pVp P@ 0 A?L0 O-P- 0rM00S z1a 䡟100 0000 S  @PЍ0SI  0 Q S/R " CXdP" 0Q 000X00S* RA PP0S:SU@!00S8@@J6"@00CS00 ! 0 ( `0ST0 @00 ((0( r (D( %(p%%A-M`.P4q4A0S Z 6V@oP 1%Ot!0^0e 0P!1U00V0S^0SP60S .0S !P P P$ЍP ^X8 0P0C?o20(%%%%(0S/p@-@000CbP00CS0p00Spp@R00S M00CS0 P@T` `@V0`0T0@0l0S V00T00p@e( ( %p@-l@0P00aP 00CS0 Ip@M.00S ( v( p@-P@PUh p@-FP7@-AHP 7p@-P@HpA-@P0PS`~Up~0000 p 000CS0h00S 0p000000C000CS000S %( ( P @-(\a  00C00/D%00  0 00   /%(pp@-@tPt`0000S0 000D0 00CS0p,00Spp@d00H( %(p( @-D@ 00040 00CS000S@H( (p( G-qA0@0000I?o2 V0SPkPP) 00>0 000E000PS V 00CS0l00SG E  P0(` 0`00( %(p( T 000@0A00CS0/00S/( %( p@-PPP`@ P T @D|@p00C0C0p%(pp@-(P(`@0@Dw00C0p%(p( A00C 00 0C0/%(p-A-@P(MHp@`DpPVP u JT(01 0P @ @`@DPpU(ЍAЍ/T (01 p@kG0 P pO T4O-` 0< O-f@ PsMc`P#0S 0S&t30@T#UP3Y PsPP 0STDC01 ,`ЍSVP aV HVP@ Y0S WUPPk  Ÿ 00B SR BX :|ꘁ)"ß꺰 0Q y' : P_pIF WE_0 W S  @ txD  Atx;Y  6 p0WP 0 @*0W D 0 @qpT0 p  S,^P^F0SPt0KSp wx?0   0\5Pf5 qp( q| (9ߚ%EX ubߠ߄߹(`. BR00/0S0/@0S/ R /0@-00@00C S  0RR R0\ * _ЍcN000C S0S//p@-PP @P  xlP  dfP TLEP 000C SPpppp YNQX0 0@- ^ @P U@R000/%p@-`@`P6N0Spv@Tp:]O]:]\@5] 0P p@%(XI{G-pP@R^Q6 @a0S 0  pW@A00CS00  0 @aq刁 Q 0S  @TPL$aDqD0 R R @TP@00CS00 K 0 Q IP @1@UT@Q@`Q 6PGD`V0 8b% &%rJ 00\%P0@-C%0S/p@-@PPEPp@DCCCA-@1S`p@DPU 0@P00` P (tO-@P0q儑0`0S -R  RF -R0SF P +R: `cP Z TPoP0S TP T``T |0|0T0rP0S \HT PT<0@@T0SOz(t(%P0A-B00`0Q 0S 00S0S006X pWP P6p60S0S60N0S60N0F0 0C?oR20S  0-S0F01P0CSQC0SQ0 0SKP   000S 0 0^0 PA! R   R0 0(t%( P0 b@-\@000D00S 00CS000S ( (t( 000C S/ @-AP 0 (tG-0p RP 0S5Q 0S @0?` 0CC10@ !,a``@ `Y@j ``w -R \ -Q0S 0`@T0:SF 0R@1T0:Y " @`'@ `0 T 0:S  @`@?:\00|@Y00  T@0 CB!0 4$@ ЍOrW@%,%PP@-HAD0P  Q 000CH Ѝ^(t( $0S Q,0S/-PP -PP R0 @-P :R0S0 ^ HPP0@:T  ($(tG-tR@ 0S PP -R`@@$0P 0S 0S@0-S ;@T 0T T@/@DSq0`000@@CA!0S:0\:0l0@#1 T030V:0 000CS0 10S Z3  0 #@0S`p0C 0 XZ0Oa0C R 0 0CS0H00S )@0S V@(t( ( p@-H@HP080Sp0u`0CS0` 800C80&%(p 0R @-@T -@0  B   B /@-@0S@p@-P@0S0ڈ0@0 0B2 ! ! !!  !!p@-@    @% 0S/xqQS  0s0 S/00 0/0S/0/ u08 0/=P/P/0/ u0 0@-0%p@-`R`@P:P t0 0Ppd0 Pp0-S0S0 0pV ($00080@p(`(\%O-RM0 p0pᔒb"%Q  X @  [c { R00CS0`D``@&20`0@Ѝ X @ ,\[8R /j P0  BR (000]p 0 S B R { [000Jp X R  [R.@@  B@-0  ! Q P Pp P  Q  R P000@00 w 0 C%P%(p% r,%0-0@ P RDM`=0 Ph h "  4U0L T<0< 1 0 01 0 % r,@-P@M0 D 0P0Sp`@T*vpPT @T=PLP @0 PЍ@%%(,:l000S p@-XP@T T D0T@p8040@p 0 /%( NP(X%P(@-0@?( p@-d@dP^\Pp[ P 00008  P8 E Jp@F%P%A-DR0@T @ B 0S 0 @ 0r8 0 00CS0!0`)V*V V v va A ~` 0F S0Xp V@0000 @\V. |V ;V&P @0 ;P @0 @0 Ppx&P@0 @0o|P@0 @0@0@0p P  00P000K 0 %%P( ( yG-pc0@0 T T+P,0S)㰀" `PP @ @@`P  0RP `FFa@@T 0 % rp@-`0$P P g 0R$, (@R   RP3Pf    Q 1 00000S@p 0 BRp@ Q080@ p%f@-y0 000%@-@oPp@-+ @fP P @0 000p` P @`@`% O-С`P0 $ @CPp/0 CR00SY%3PB%V 0 H100SD (100S @ 0YP@0@Y PX u@PW W! V! f000 @(pGWoVP0V      000% r,O-PKM 0 5@00 04 P00~400D$0kd`P v 0S 1< 40  |4 Ydt$0000 `SH4 ` ,4$ ($00CS0c 0Sf@pW 0䃟RPp *p0PC0pC0 Sڈ#sV@0  0 0C0Ps000;0 000CS0030S0@2 0 2 0 02 P B1 2R z0u`B0PUZKߍ20S nd2h@d2d0p@00 0S V 0 `PPA P5 \P p'100p PP 0000 00CS0\00\0@0 $P 0 021#20#"P0"P00CS0 PC@0000 9@!00CS0 0000DP3+ #.$@@*pb0PC2P \00,0-,M00CS0`fR {00^%( %( %P%(p( 0O-鸯帿pM0ϟ  Q"/O/0 0202280 `00P/20S0S 2Y H(\@X0@T@ 8/Q00S: P.Q00S1 0P0C0p0000PbP.00CS0)<.0p210SxPpNTP"Pg KPEpE U0@#S?@@@@@@@@@@D@@@@@@@@,@@@@@p6p P}00@ S0P@ A0@S7P@a0@SdWP@Y_ P H'P 0p@W`00@S"UwWX'PGNp0000Pgw<0 0CS00C0~00P00C0l0P@700@S0P@*u Y p0P0C0t0E&`0@?o? @2;R0S 6\P\Pp ?PPpppWppUpW 6;E S8 5:0 S0 U0C *0?0%3?P00q Q~  B  PA0U!*00%60%3?00q Q~  B  ?PA00q QPA~P•3U5*00%90%6?00q Q~  B  A0%3?00q Q~A• ?P B 00 r R P B ~ P  B u300%<0%9?00q Q~  B  A0%6?00q Q~A•  B 0%3?00 r R~   B  U?p00%?0%WUT@>P0 |P0 &PU000@$P 0Ѝ%%P x% v( ( % ANi(`(\%&>< u((p% s(p s y wP0 ,  0@ 0 0 S0Q >W @<P >P" &P0000000p0p0((0 P -P 0(0  pO0ZP0  0{P BP 10 }0 01{W00E000C00R#PpIN}PP 1 " )00 0: =}P,p @R<2 3 wp BR *p* p|2  BR P=  Ť>= P2 Y%W :W5 #Wg}i 0P 0 j^"0G P wp BR pYpT3 0 @ R   B 0p3p2P3?  BR 4p02!R1S $HQ x0H@ 00 X"0`0001BP11=tP|4  wp BR pPP4HW I/o}W" R #p BR p P 0X0 'P02`5Qw0  0y0"0 `! $0  0G-`̠̀0@T@@0PU @ 0S 40 0  B/o"`f0p 0S 0 D U0 0 0[% x@-P0@-2aM0$ 0 z10< 010@01|0000\]PI@1| 1Q @@00I d 0S $Q. 4QG Q ,4  8000<  ,000 0 0 00 0 0 S00aߍ0  p0 `0 H0 D0 H00S\S,0u 0( %( % x%( Pu G-Vp0 004 P" 000-P68hh hhhh hhhĤ0$00pKs@P 0 R |0W` p    B0@0S 0 00}Wx P0, R_P}" 000@ 00 00 R, RտP4  00300 0000    BR   00` P 0000 CR Sm 0 tP P`  ``s 0 0008 @0C 0 00`0 Sl~P XC0 R   L000`0S.0 R Ӻ00 P 0 R000 0  P 0@S P 000 i`@`0P0|0` P/ 00000PU# T 0S F0@P0@00S0P0S0S 000@Ѝ0$00p%%%A-Q@`Q` @ p0 P0 0X@p 0HP Q$@@`Q < W R    0 00 00 @ 0p0 `4 P /`P l0 08 00C004`ЍRQ%%P A-P0 5P@. 000`+P p@``@@P 0`0 U000 uPPe``PP0S %%p@-@|PP ,0 @P P 00000Sp Cpp% P/0S/80 P/0S Q/0(A-@Pp`00p` P@-` KP 0@ pT@ŕ PP  J Ѝ V@PJ2/,) & d L=% 0P/(RQA-`Pp%hKpWpPpW@ U J`0 R@YKP Pe@3 0嫺J0 %A-`P@xpT@Q00C0U U 1@P0 PTJ(p@-X@X`0P0000100CS0p00Spp@@( (( p@-PX0@TpU@PU@TpPJP(|0p@- PR @RP  J0 _P `J2 'p%p@-@tP0 S000C T  DIP 0SI,03O@dA T @0@p@%fffg(p@-`P0 Sڜ S  I@P t0 R@U Ip0S 0 S I@0S ((`%p@-P @0Pp @  0p(@0@-@ P  Q 0@I0( 0 P/ R/(C-LsP0 U00000@0CMS񟗮ҠPҀ`ppTT` AI@P@2@.޹ t2I@P2 R@Ux20S Tq *I &I`<"<I@P2V0S' ` Ip@! vJpPIP 1 噹 0: SH00`l!x`\!l `V'jPP 1 0( V U0S000  (P @1 0H00CS000S ¸Ѝ@pT 0Pd1 DZH( ( ъ%% W  ( .Rp@-@P PP Up <1 |娸qHp`U RfHp0U G"1 plpO-P `ppW@p  0Ù`ȐȠȰ0S UT  O   0@  U  }T 0S@@ `U %n2P2c s$5jx< (?p@-P  @Gp R  Gp d0 Rp  Gp Gp Gp (%p@-@PpD0 0RPPp03/GPp(O-@$M0@000`p@A p2@ ̒V 0S"2 0S2" $Ѝ2@0Sڐ2 R@00CS 0SP P D0 8尷yGPz]sPP jT sG0S_ ZPPZ\G봡P000P000 S`|1 0R  GGpP\H) B R% "/ ( C /GPP  R  %GPP UP G R rP0 00CS0t00S T0 00`Q RP(%%%(`(\( %( O-`0Pd#dCM`s`` `00 _6p(V( PEWUCc 0 pW` w@p00S0S|P20SU0SRp0sS vS ضV`p0+S -S Xʶ @W @Q0 @R: _gP     -PU 0 P0SA<0OЍVF p p0 %  " Q  %5S' ?Fp"#. Q  0,Fp0T 00 . P X0 M IU00 DZ-M&0|-M5j(\(`= s$/%aA-PQU 00CSQHq10SL R@ 0r`0CS00 `01L00<S0S  50qL0S 0CS>S0SSxh R 00CS00 -  s$Orp@-@~0TP R R R& 1S# 0 iPpR!Q QT " "D0600S0T0S 00S0q(( ( %@-@1P @-PVP H@-@P WP0  J Or(QA-@ 00CS00 P `tpt ?U UH?U!P0P0CS00 `.?G-@Pp000 T` 0000CS0H00SG0S 00S (,@( (( P P0  /\ Q0 S//(@-b@0pSM910S5 0SPPT,2C 02S yp? 0Sl UX U` Pp2 W`RU_V0@D>T000 0ir00 ^D10S WT T T02p160S02&S- S SЍ0S P$16 R ! R0S 20N02S S S PS S SP PPP0N R TU U DR60SS S|2 1 @$ ((l%(PO-`@TP P@P ,P0FpS`@ PCPBPP34 ضPP`tDa0S! 000+U 00CS0 PT40S г00CS0 40S óP@U00P@`s䃟1 R 0PU TgO@`@VT @c儃Q0S 00S 3@@TP@P @ePP?`FVXn V@8X @ᴒ异 0E0pP 1`V T@@WPT \@ T @@ Tv@X P̱̑@DP; ?P`1 y10S PP0-S0SPV @X Xqp0S@ ap;0S6 0@0U000P1 qR *pVP 00CS0\00S Ҳ0U00 P /[o%(( ( '? ]%A-@P P0` pUTA0S 00S Do0@0@000CS0 00S P((( ( p@-H@P02`S@20CSpܹV02p(40T0P?o20S 0S//(C-p@`1010r!Q0@S10C1 ЍqXPU X2ƼVPXl)빼P 0S Ἴ(( @ 0P/!!R /(p@-8P\2Sp@?<9\Bp(0-MM01`"R !R X"R   1 1d"1!d2S ,TQPl1, ,KQP L!0,00BQ@P$1, @T0d6C`0P, U @T 0S P۴00CS0 ! -B00 0$0(00D>S {00 gABA"!031(( ( (  0@-`"dy(p@-L@>'Pة0PPp0C/U00p sp@-T@TP0 0P0 (0 0000CS0p00Spp@W( %( A-@R`P  A0PPEU`pp WD0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP0000 000CS0h00S sDP`0000 0C0(`( ( p@-@P@0SH00Spp@00CS00  %0%0%@-@?Pװ'Ѝ-@-   Ѝ Ѝ/-@- 0  ЍЍ/% -p@-p0M, @P(0 0`0CS0a0`10@0DЍp@Ѝ/G-@'`ɨP$ 0S! l0S00CS0>0 "  u00CS0/0 " 0S pW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU TPP 00CS00 '  s%0Q%@-@@%@-0rSگ0G-p0 P0R(0帐@0=00=``F@VPpPER000 S=S B`` R`ĥ`PG跥@%(p%0@- 4@ 00C00 0 0DЍ(p50P P PR00/0@-HP@^ ^ R0L00 uA-鸀(  R Z(p`@pW p0S 0QPU  0S 0S   3/P@P00(0SfA-@ᲬPᷰU p`pp0S'STP@DAM'GPP(  EB=XU. /uA-P0`Sp@    3/@PP@X #W p0@=S0U0 0 00CS00  0 00CS00 x 0 T %xO-@00Sp 00P㼀✠Z  0 @PU* Ѝ`V Y   [ QʁoaP`0p(p(0@ R P=R/=R/A-`P0S=SPERPU@'\0\p!0qV@pT 0S 叒PVpp@(p(@-1`0@S @  PPV 0 `+% Z h  `R Ѝ@%Dq   R <0 2/0`% 0R , R  00 0000@!L@0P U U0 V00CS0`00S Ѝ@覭Y0#L 00P P Ѝ%_( (p( -p0GM00`000LP  80  00 Gߍ0  0 g( ( A-`p= P 刭@VPp PfP0D @S= O 0V  @B$`ЍA70Cr-GMP00 0LP00$0 0  Gߍ( p@->X@P0`P$@0U<^ 0U`00 0p@(pI{!0-P$M00S 0-S00 0 R0   Rc  | Rf  l 6QiFQlLQp Rs    \$Ѝ(t(( %(Xp@-@`TP000T 00CS0p,00Spp@責@( ( s@-P@T@ bPP0 P00Ѝp@n` PP 0 @]00000 00PЍp t (pA-PpU`A0  #0#@TP@ s0@00`( @-@P 0S   3/P 00A-P`0@T PP 0    R   2/P @@@ pP =k@@( C-pP@0聟rS``PW! 100S T! 0  ЍC^nP pPW@0F?o2T0S p@T410PU 0P U  Ѝ 0=SP W P! W0000000  h@0 L @   W P 嬫G(s@- P`@@P 0 Q   00 00CS000S dЍpQ     R T0000   w" 0 r"( ( r A-`pĀ@TP0U0   \">Y"0S R   0 02/0 A"00 0000(p%%A-p`P@P 0`0PPEPvT` eTp` fTxTp`X @V R@(PP@-  VC-ܑp000P0`-S㴁@TQ 凱@ 0@00`0CS0Uh10SQ ЍC蜪 Z@P=P 0 @0 0  0 00 00000  0  RP 00 00=S Vt0T 10=S010C0 0P00 Ѝ( (p%%(  (pp@-@PTpu@p@-鶴P@`P \UNP@ xP@ IP@P(P0 P pV(00@/ 0S0@/s@-@ޱ0 0`Pձ0S ѱ0"S U1r0!l%*0S`0T 000 @0C?o2R0SЍp&><@-M@ ;P ލ:P@ D0RQH0PP0@-M@ :P ލ:P@0D SPH0PP0@-M@ :P ލ:P 0RP 0RPA-@`:PI0 0SC Pg:UA f:PPPdp]:PJ! 0RA @- 0-RS# 0S0 00t = Ѝ0SX0 0P0S00 040, P$ t up u t0@-0P!S@M0SPЍ0P| 0SyPUo U U ፥Po U (:P? :PPEURDT\<d|<<<<< 0 O  P  P  P  P  P  P P t0Sp00@9T @90(S0)S0 0pnp@-@`P'P} 0Sz00CSt`p 8Lh<<oop4P.)P.@`*TV#`@VT@`V@ @` Q@`Q@`V@'Da0S0!SPpp(S0)S0S pp@-@P廪PPE絪P.U)\p|0op=Pp0 \0!S0P p(S0)S0S 弧p3@- 0B㿧%@-$0$0 00 㱧( %@- @æ R0Q0\ * 巧ЍO-@`@MT0pD P-R lRC 5R -R| `jH@P{2 000E @PppGWP PW pGP〢倲PE0%S``PX啧pW ;sR R`6pTP`2儧PU W@1 000 PPP@U _DP@ 1 yHp HP l1h7X忩@P G@P0S0Sp@VHpꖮ0 0   0X` R Q!q *S0 0R dS 6pv   TTTst6oP&>< / H% ;N Y#0@-DM@0   0@@DPU#'6@0 ;   70P x, pp LdDЍ0=᠞P ( ( - Or{%*vWI{@p@-^00S 0| 0x 0p0p p@0   PU P@P0P H0H P pD Pp( ( ( (%(%%%%%p@-@<0@W~ 0 0@0PU@0000A d0 R 00CS0H00S ֥p@[@C0PC( %(%( (( P/p@-@PTp000@p@-@P<@-P`p@P \P 6/)0 cS 0<0 Ѝ0S0P@00 #10#7Q00AU@MS0-S@6/P^S   +@^S@0?S0(&><0 0( %p@-0S @0AA00p0@S tPP0 0CC``֣00p."Pp0`0PPEEQ0 ģ00p(6Z}@-P0`V) 00  J0 0@00p 0 AdA៣0@0T0 A$AᎣ00 Ѝ(&><@- P@pSᵤ `L0P h@ 0\AAV00 ЍV@@T @ 0AAY("}@-`0@T/ 0'R"R0PP Ѝ@Ꝫ P p+0BP d0000 0 A@A)00 Ѝ,pP(&><-G-pNP@UL@D 0P0`E (50`@0(Q(0O- d2  Pd  xㆧs0 v0 t 0 (p B`0 0 ;0 xt0  ol c)v t0 < @"0P 00t  {j  v t  i 0dt 0]h0P $0'S"SmbX0S$ L v t  0 # 780$E0$ X t 0 "v t   0 t 0 NVBT]0 <咠(%_[&0|ipV&><@$(`%.0C- 0tqMP` dp 3@P 0 Dp3@PH 0p W ; PuY <YڢP0P 0ES, P Q0ES^Y0?S0 -S00PH0,Ѝ \00S00H 8PH6 | } -s@-0@0 0 \5XPX`Q P 0Ѝp@o500 j5 P |O-Mp:ݗPW]0䁟䑟䡟00SЍ@P 0S =×PP =]00  jc[hAP 00 Ta4i[D6P 00 ,/P j 0$0l[!P 0 0o[ P 00 P yj 0(0 `Q 0 SP00CSH cj0 0 0S } |V~ 0K00M00P0D0 0C0D080;800,0/(#Q00,,#0,0/@0D 9K<@0(080$00= 0D00<00,0/+@$寡0@-0$ 0d8 Ѝ@-@4000@-@4000@-@(0(S00 0/0,0Ѝt` p@-@x.PPlဝq8o<m@kGPD[`gUc\a`, 8V.`n.V0,0p@-@4a80,0@-@4W8x0,0&14 6@-8@)4( R n8 ", 8 <  < D ,-D  , /(0S \@-@8t@0<<@00,0@-$ /P \ Ѝt@-u/P[ tn#@-j/P[ to-p@-0MP`0@-S00(00P0 0  P1P 0( RT  0 0 S40(P03/Ѝp<4 }6A-@`PpQP-U@Q᫠P00  PᜠP 0-U  `0p@- P@@0P ,pT 80$P< D0TP$ <0<Pp ~  \ `p@-$@P0S 300Pp(hQ+  0 BR@- 2 M| 0- BSs^0@Q ^ 40 ? 0 C  / /Or(p(hp@-hP@`V P3p`HV43,320(hkH. 'C-MPp`@pT `2V@P 2 @< 0$    0 S @     T    t h@9  Xv Lr@ @n 4j (f  b ^ Z0 SSO K G@>: 6$A 1|@  < S S  SP  L6 CVyP   $W        @u̅0ST  l2 1X@ |1@W h1t @ Lx@l 4`(TL@ 44,@   T4 @KV ` X@H~x<z 4hv `$r Pn Dj<<f0b(^Z3U@V LHD @>|<@l 0@4TY 1Vt,<*8 $"H@V S  W  2VxApr`VЍ00 d0 @V   Q  00넑0l  @u0 T⫾l⩾@ p6V&-3:@GQPXahov}&. |G]s%,49AHY`gw~-@-@ 1.&7p@-,0, P 0 0 1-(xf&7ps@-@`B000 #S@yP70S  0:X00S 0 *XЍp.0S/#Sp@-@,P$p0P 00p(x@-PRP@ p`@p 0R" Ѝ0"S0SO 00SS  00@O&><@-TPL0 p@ϡ0"SWЍ?(O@-TܙPL0 p@0"SWЍn(~p@-d@P0S 0S 0SS 888 U   S$Pp(p@-Px@Q dW፜P L0    P    pp@ @ (0@-@PPM 0SLD00Ѝ000 0?P0 0 (@-;0S S S8 4 Ѝ'S$ Ѝy.G0/O- pPMPa  R <`$,x  P R ߍꃿ Q R @@sQ Q@ Q@ YT WpZ: R D 03/PUPP( U@c7@-lP$ R\V@4 H $0S p (V V Ѝ0((p@-@P 0Sp@c0PS 0P0h00Sp@-YPD@D D`DpD0S",00/  &7pqC-P`PM 0S00(p/p0 @P" @/Q `0p0@0P T0p &PH$0@@ 00Ѝ (( G-@0X T. HRD2D1H#<.( 4 ., (.0 .8 .4 .#4R! .!4S .!4S .!4S h.!4S L.p!P0S t0.T!T0S \~.p(HP8W ЍG0S. a`v`  0b. 0 ].0US !S|  !3 \P.0US:3  U02,  B. 0t=.pP=&7 8hov}8PBB /= /L(O-Qx ,@QdP0QL 4QP8PQ$80S,00 80<0S#<0P;PP;P1 QB"8{`㠱8X0apS wpR  j <0RTcP)0< S4ZP0S9`(Q M(Q F@P0S0 BS `a 0p4h R  R* P*da !(Z&8W(TjO-4+M p* bP 0$S  ߍS P@T[D@lP 늤 40ਫR ZS$ "$0f0Qf/ju,2!S!R !SS0С1,21S ?1P P @ P0 0ꌡ1P#>00 P,2 S,% P 0 @p#>00?s0 R* 0S 0p}j5 P 0S 0 po1Sw j  P@,1S j+ f/j01P P%DP ((%WEV}}VEWPM(T&7A-P@p+P` %R 0R000005Sw D $0f0Q $S  (((p@-0@P  P$p@` $0@-0S ,P(@-P  (O-@:P,kCM M00 8P( 8⢉P008Y80p0SP :P  @00 AY x gP 1(p X p@ YP$4 X p: 0 $0,P$0S  $02P  P pGGqr/P,圙圩$ pW 0S$00s  P$00  P$00$0  P$00   A@P pWa 0SY] 0 0$0P '@: 8$ 1\ t$ H`P( $0S  S;Ƒ8@ 0;RZ(( ×P  U %幗P 尗 P0 0$0P$0S ++RP0 0  |唗 P 0 0$0nP$0T0 <僗 P 0 0$0]P$0`0 r P 0 0$0LP$0X0 a P 0 0$0;P$0\0 |PP lKP 0 0$0$P$0d0 (9P  50$0P$07 ' P  l50$0P$07 { P  (50$0P$07r jd P  40$0P$07a Y$ P 0 0$0P$0x0P H P 0 0$0P$0|0? 780aJx0S0S  |P0X: `X0 H0I0?0t 0 ST 7 6 2Z/ \u0S 1 #0Գ000S05 0  3000"0$0 0 0 $0dP @$0!S D@0$0|2$ 2 ,@pCލ Ѝ0S 0$  QP0 wP0!A"A0S 0崡0S 0Cs RS񟗚j`j``k`j``kT````j H0S0 0S Pz  0$S 儕o 0 S Pe  0$S~ oz 0STsr 0 Sk PI h 0$Sb S>] (2a 6k   ^t~( ( (%& -1<FS^r( |&><s@-`0PU V  PYB@P hЍp`PD!t 00-0@DV  |,N$00S #@-Y00%p@-@5S4 0PSP p@<$Pp0S 5S 1S 5P|Pp5S T \Pp< HPp%(( PpP((`PVAdeAdrts@- 1 AP(000(`;a5 S4 5S P0S 0S005S  Ptt p0pP&"5S ЍpH DlP8 VEW(dfdm%o(dg@-@P f/㵘@( 0 I%(|dm0S/!  -3@-PT P 0S S@@ P@Ѝ0@ Ѝ/&6p@-4@4PQ{;p@`s' p' @%!@-t@t0MQh  `P0cS CS SS 4,sS00ۍ0(>m%&@P0@-MM@` PP 00YSP , ۍЍ0nPy 0 u(T&7@-@M0 vP ۍ{p@-@$P 0p@ T&7(T(T @-YMM@p p\YލЍ<0< S <fCPژ10YS<0<0&Adr@-*0gj zgzz'z'&z'z{zgzzz { \&Ѝ57@-P0@ 0$S0S> 0S6 TQ+BQQ+PS10S+ 8@ 0B 000 C0ASu tttuDtttu tu8tttttt<uPc0As Rxr&tp& Ѝ0zg{{'P{ zg{{{ { { @(>-<@-\@\0MQP  HP 0nS yS0 $00ۍ(>$NP `00CS`0p S00 P0S X0X /Xq'&6G-P 0p`0?@P N &pGߑT@Y @ 0@㶆H\Pp E|p〠 0  a U ố`V `` X,Ѝ"r&7O-@M MhP`ᛳX%XTuTT0S0#!pD P ⾒P eP'p0 p( P 9 nTt`(p P  ZP `y%Z⏹P<08 Tt`( p P  ZP U%0(0Ss`, p P  ZP >%0,0xSXs`0 p P  ZP 4'%000$Sr`8 }p P  ZP %080Rr`4 fp P  }ZP l$040xRDr`< Op~ P  fZP $0<0 Rq`$8pg P  OZP $04Qq`$!pP P  8ZP $04xQ`$ p: P  "ZP 8$04(Qp`P p# P   ZP $0P0P|p`T P  YP q$0T0ۍ Ѝ(T&7 X7" &>a|?g *MkO-M@ M0(p PT `V:0S0`S68P`P8apEbWWnF `F`0E8ġ0 0S0A"S0#1` lop P( APP@#" 44׏ >P0S  3/ PA P ,ࠐ异Rx%.A 5p P" 4SA4`S>74`P92a0C" 20< S :A$#"YA#x5|%.A  pY P0 <x5 0AApqA#A0 P<0QADx[0x5< 0RA| rP 0 000S P0`p尀(V R s S 0 0)0`PX=#ލ Ѝ% X 7   X  5    (T&7(>  - BR0 R h$A-P@# R1!# 0#0 #X0 X0 pX0 \ ( H#, <#0 0#8 $#4 #< #$}#$y#$u#$q#P m#T i#0p 1R0S*0X`p\PQ V#VlAφ N D' U _ k x            # 2 D d O-pᔀ 2MSR R@`aW 8QT ,[Q 0偏0 {  0@" ! 8 l,  f ׎`@04" ! $ 0" !R21` " 0S 0Cs RjSg\\\|\  1 0 02 p"8QI 唎T "<0P+8Q* 8 0A0| @"2<0P+8Q *ЍO0 0 02  02 p}" dx"8 T ЍOЍ  D   P   (SH    A-@Pp(DW"<`8SA΅ 0` . >0/p/0p@-  R( R((,,004488<<DDPPT@TXPl XRl@PUt @ 0T0p  Q CQCQ}C(@-@t40Pt08Zf/VEW0H @-P \PY Q@5VEW(80@-0@S K08f/Α(L 0PQ0//@-陒L0 Dl!<<忿8@8P(` R] 0]! x&7p %P7@-@ PT媍P0 08P8 0p0 H Ѝ0o(>dvk0@?o2P0S@- p`P働@P ~P yP tP@V@lkPH@T@T p0 4RH@@ Ѝj (>duk0@-PM xdP@` p D3H 0 4' 00+ + Ѝ0(>@dz   s@-@ p H0   0 0`P   0   0  h0  P0  8Ѝp(>@dt5M Pk ( p@-@PM`Pt =p  ( hV V dPЍp (;}H( "p 0G 0(>@(d};ˀ(d~M_0@-PM @ }P 8~G4P 0p0 yGЍ0m(>d{kC-`0@Pp!匁匑,M00 p0SP@TTA  p  0OGeP qP p` $0Q 00S*@P -GQV&W V 0 R00tP 0S,Ѝ00* *  `@-M&0|(>d|P @-P$M /@P jp pF@d1@dBTO--PM M @ȋP30,0}=Ss0 $( *p X.,@$`L0V "0 0(0Sڍ Ѝ!# ؀R 0 (@`F友P Bp zF個@PpR0p|Y 80: S h"hh 0,0}=$00 @$@(@0  p $,p`V4 00 0(0Sd0P0-  0P6`1p  (됁向吡T !  pp ` 0R0$@(P(pF (G`F@ @ p0 Q` 0$0+4opq 0`p , P \ (>dw dxT#&7p6O~&7i1A-PM @H{P D @{P $E렏  0P0`S 0"S U1r0%*V  10p0S w 0"RsprEPdPd `尀pp0 8iE0_Ѝ6N(>dykhC-p`@P Q EESP 03/ ЍCU@@ R; h6p -E%(>. 0@- "E(>kP7@- UP@T P DP804 p Ѝ0N$(>dwP7@- 34P@, np Ѝ0(>@d@-黎(0   b&7pO-p0$M@QP`H0 00000X$Ѝ Qz 7pD P (p 0 S 0T@0SxtZV X_W 0  @D' +2 /p@-@PPZ1P' 0P, 8>0P L [D0P 0PY 0Pp@!p@ 0xBp@d<p@U@@ Ppdictaray]nmbrstng/ Y..V 213/P/(BA-PT0p`$@ ,0T@@DA??@(B?0@-0@ 202 0垇0Q!Q3(B> 0R//G-`pB 0P၇E @PPW 20CS20CS G0(B@-@p 2SM"n#^  2" E 2"HЍ@k"2d`^E"2@}X"\4Ѝ@w(B%x,6V-s@-P`d  <0SЍp00S@S0"S1Ds@-$M&@#00  0 0Pe&7pA-`P 0p @Tʬ(C /, q0d / 0ࣃpq  RЍAL`0S`@D@, Ѝ%x(BA-0ppP@`ph!14P S H d" R S R 0 )S.+U(BIp@-4@PL2S0$( #y0B1p(B0/p@-P@ŽQUp@(Q B?   ^ L043c 0PpQ B?   P Ƞ̌ Č @(BX0P@-<8B 0"@@$18<4@(BO-PLMx0 $0|0#(0p0@00030儠s,4000S9 23,Q( `0$ 0х  0/ȅ0   0 000  0 嶅#,bd"ZP A 0,0 "Ц 0 RD0 $R0 S p2000#1-R0" 4DD`P@0夁p0P00S 6P  0P  *P% D`ᖦ0D00 S> 刅0g24 plU$[EL1P?$S%\2 @P@\2CP0p0PXBp0 X20@Pp0 X20T@Pp0 X20T@P`D`(0T$0000Z 00S $0 0(00 0hZ @ PLЍ P @ }(B%x(D&6? &>< D|-s@-@600CS0 %FP` Pp pp$A0 P00CS0F0 Y@oЍp@Ѝ/&6 ? O-a@ p@Pp?C$0e@O 0upq Ѝ  R ЍOt`0S 0 \pq `BE,ˉ 0S %x&(B0p@-"@R  lP"n/᳉0!!UU08 T0p@@PB @U@Tp(B(L(DG-HbpH@,#g2PPH @ P UW0剔LI J$ Kp0,)U 02U!U !" +I s?@sό0QlX2 G    <1 81 41#(,$#(,sO$@tr ,! (! $!0000 0 8< 4^0 p 0 8< 4P0 @H20H2(B(Dp@-d@0P01ps/Ġ2P@ `^`H"̌ B B$ oH20CH2p(BO-Q04 ЍQ\l hX(BiO-@ԃ00p00Q`0= 0 0T$" 2 R 0 R, 21S( 02  P   0 T0 2S Y Ѝc R S倰[R21 RS& [# 0 2S Y LE9P0?Y 300 @@``0Lr`@H2[ YH2S S021S 2SP pr0 8< 482<"#~ SRHZ*ZY 0 SZ H"02 BJ RLQ^P$nH20CH20 @@```@l024!0R 80Q! !! Ƞ ̌Č0 00 0R02S0 Y t   ̠ Ƞ Ġ X2 @02 ,! (! $!0,($(BxU`:@-`p0F0@M 0 "$20S WV ||ߍPT $ PPp!0C0,,, \ ņ(BS "R 0S /(BO-M@DHr  QPʄߍO %@"`QPx0@0P<5 000 2P!00% `P@0# 4L0/`4"RKXQFT-b`V )Z b Q Q6H O42S !1?  !<0 #!1?  !< 0#r01匳S"0@R@ʇߍ@P x\QS-(2SbV #<L Kpp !0ಟ0 9 0p`0V!002R x""  px"Qt2 0l4" 0L `1 RS(2 0S(S"*R1!0  12Sڅ?0 1R 1 t!?q0412S Z 0?0\1QR02S 0 ·0S>0)S  Z0)S  R0  Q !P<00 0|l 0<  P2S8#(B5 <a>PM%xjy(8UZuxA-x RUP@P@aЍPP0RB1P@4a4aTSp ЍALJ 0Cp p9 141!1<0 + 1&1 ?0 1!1<0d  1P 1@?0ЍA (B'P*9J^qO-- 2S "$, 00S1 1S. 0W , Q  RW !(,$!(,0$0W0,,0`L$@hd0S, 21S( 02 (, $W P,$ QW  0 W@T0,0`@ pp3"Rk2S |p900 0 0 P D00 0 0 PWK (0pD <0 8 0 4 0  < 0 8 0 400 %tb0 @2S` BT$0`pPX " 1 B<0 0@@2 0C00 @@pn2 0?0 @@pGq"??pp1 B<p0 @@2 0C0 0h@@p2 0H@@?0pGq?p?pp$0S 2SHB @TJ0241S$0Sd 0s XPX2<8"0 RS 0 0RTPq܁ܑH" 2RSi9P=. 2S`1!8!|!!@-0AM0@ pp`Ppߍ\ ˀ0  0e^P \ tx02S 0S " `P H0 SR ⿸0PS!!(B!0A-da0 0XAP d2SD  P4!p" 2SPqH2U 00"$lpㅄ"e Rp\EU$\pW0 00P d2SX PHGЍ0"P 18<4%x(Bdm" (D"B(L"-A-@T2 @P?|P :|P 5|P@ `p@T 00S p`V@ |PD00S @@|@P 5(l%A-Pp`#@##000 0@@@A-@pT` zzPP#0@ m@h#@?G-M d4 P@TPD {P @ 0{P(4 00(0 4QT(0 ,0b#4@ 0#<0@,0S @@((@`@,0s0000CP倃0P>PP0 !01P,30  ,3Q #  ic0dT0< U p@8 PA ,0S ,< 00S< 00@ $aP8&0FSʆ`)#P0S -S@= pP00@@P,0S ,vt^A0 IVP {8800  0 R00S' 410XAXQXa400C0  C`50S0S0S0S C 0S C CC$0#4 ܍p PS P(lP) % ^5j5$5 '56% 06> >hk0/(l0/(l0/(l-@-$@  F! h- &7pG-P`pt@0S m  0S X|d  U 6TY Y0S  0S*@ I  (l7sP7-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-   C-@M Mq` @lPPݍ Ѝp!rp@P=0PPD@rORP00: S0 RP00 0&PP 5P81: S  S U r&PP00P%PPPU rPP @P(l H'7(m .7778@-@0P  0 000 $Ѝ  ' 8%(q 840@-4S 3/ (l@-v~0 @(Z 0$}j~@ P(l@-d~@He}}Z~@@-p PL`@@0 7/P0 S Ѝ +e00(qO- MM06@  @  @ 0p$000 (0/P(DDu@ ܍Ѝp 03/0P0   P @$0PS  (0SDUI.`P 0 W xU euX0YpY 0 `  W p[ 0S P%5  e@ u UT \ 0s @W0SU 000 <89988@-Z| . (9H&7p-p@-QCM0S 0P?o20S@@Cߍp@ Ѝ/<7>!0 0S# 0S,aQM n00CS0":7@ T 00CS0!07 P @YT Y@DOoB 0Q  )  @OoB\ 0 @0  0 0 SNT(q99&6&7$N90@-M 03s0c00@S  oPP* R!PP<c 00@   0PS PW `Ѝ0S 0S ~ 0S\0S\  0/@ \0Sp 0@0 @vp 0S0Sc @g0SX  @"  @0StF @D HP@ @0 @ `!0xP|"%#   T`    P @@``a5 M] x Zp h 0 @`(q(q(q9\99: ::A:c:::;;P:;5G-0@ < 0P 0S< 0  Q*g  PP`   0`P l =pЍ!URQ H l y0H00 p?s0W0p ;P D2 0?s0Q(0  1!?/s0r 0 1!?/s0r $0 0 02/1( ?s02/0, X0`P  Pd 0SD00D0Dpp $0"3?X0(0R+* 0H0p$,0#3?803?/s0r 004  pp00 PQ  y  [ 0P VP yVpP1S1S1US1S 3S3S3US3S,  pP0p- p202 12 1300pp00 PQ  jh'   0Pp00S 13?<013?@040  xp40  PQ   0PA0O A0  |VP 4J С 0R  A eY%#!X`V P0EGt 06#++R`DX4 $0S,0,  RT0C*tD0"P#10P 0 # 0QL \0  0P 0PdP@d;wl;;;;< <+=W==@-p@t`P P00 Po 00PQ  Ѝ 60P< 02/!@ 2/! Po 00PQ 4 0Pml<+,G-X` p@PI Ѝ0PZ%V0 0;oVU D8 X0 X0 P>5>TO-@,M0p@l@$0`P PprP$P @,Ѝ 3w0 LRŸ0XPT QQ9 QW @5q3Q \ \\\@! P PPPQ   @P@CL0!Sp sppP0 S ~0 Q q ,  L 2/Q0r 2 q 2/"  @ "  p@*"*  P0@ S  2"!"0  0@p>g>>>>>0P s s// /??oIO-`@PpMP0S Ѝ X  H r0A D00 s/ r qh  \P0p@P q x0 ` P 0 00 P 0 00 ` P s0 `P pP0 0 P`8P ? $?A?q????@@]@y@R0/0@- PBU02S0P^0A-p`|P@P  PP P0S"R0R0@>,O- p`0P\PPX $P  qQ0 0\Q@T(2 R@0 P" R S C0BTX t0D s  ( 0 TX  R 0  0 p p P YP  L BPTR2 Q PE@A1AsA@O-X`0pM@`PPdЍ u0Yl08L0  S 0    s   00 P䑟P#б 0 STS sH 0/MPv u n 0L˜ Z,$ z ,(\  l  ,΂l0\ll 0\ll P 00Ql"! CClX0 )"03 0Ul0 PQ P P>5AG-@P`p,P0S 00S <0s+@qa$0S  0S 0S,0 ( 0  `0SP  R`pl S HDpP@ q P0Q-*l0S 2S !&l0q<0 `@q P R#S 2S pP Q *S 2S pP0Q*l0ph hPP0P Wp0RQ@0AB-B3 $oE#Be@-?`XP\@#@3P@T@TpW @@T`L(rO-`@@M18 00TP0S<0T D0S Ѝ1@ 00 `P0DS%0 ᕈ0 0^kPQ P0 Y:0 0 0KkPQ PLF 0 P<0T 0B(qBBO-M@L0Sp<`@DH SP PJ_o VR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T:BCBCI(q A-@/pp0%B?[`0S 3n0ES PC Osp@@0T?  C0(q0 PKB %/(qO-pcMW , 0 [P0 S@0Pp(0@@D0 0$04@TD0' R$ X0`1#b3<0#0000 0,<0j<00 PQ cߍ0P@4p(0@pD0 0$0``0 K2#  ,PV002800aL0`F08 0L0SD00S   800 2800,0<0Mj<00 PQ (1 0H 0  RR R0(10D40L0 `0L0C >p h)P.  (10(11  , B 4 0B0 D0P D0[140S  QI@(1  0I0@;+ q P(10(10@4 40 0S\ 0@ F /o@0(0"s R$ 00, P 0r0p(0@0$S@0! 0C@0 0@ 㓢#X0X 0 PP :X R: U$0p 00pP01So | U)0 pPf(@\Q UpW$ P   pPK/\q g0x!P0p00pq P$ b QQ#hQh  0 U P p$pu00000 ,p$@Pp0S*0  Q .b A0 b @ @ bρ LG?@@0Cs PQ*W u0!L0/r s|!0<80|10W03?1t0U`0 0\|xQ1PP|!R \P PPL0sPP|!=0I|1@|Qx1U0P U* SR   1S \XPP@ 0I 0000@1 hPmPP 1|!RH PP 1@_3s00 0Qs (0R~ U$0p 00pPv, u]000U\`0( 0$ (\T P000 0T 0P0 00 , M@W $0[g1Sd Ia1 S0(0ZRhlP0S 0Sm \llNR P0S02S 0S0SW 0\2SR\M|!.xQP 4PPy 00I@ s 9 |1P /@P PPPPPPL0Is0PP@1@S"U @ZShlP<PU p|1WS P@ |qppL0Ispp@P !RP d,PP 0 1|10|1#40L0s_?00|10PP+ K/\+pPP05(P 5P0h00h0Jd 0ES:\P P|!d1HrH"HP :0 @0|12PPp?18 ,80P$I0 [P0 S0 U$0 P 0o00 0000 0,@ D00S0 0,<0@g<00 PQ80,R0 PI Pd01S\70!X P %4QIP0%8%\0 P@l(qBBCPCwC~ C>,(rCCCDD> MDDDZD1CIDwDEE1E_EvEEEG- p@r W pPb\aPP YPp $PK/nD08QP0Q:" 0PS00  Q pUxPh`P 80"8 R 00 05 !$x(qEFF;FXFFGFp@-@5%SQ%  5%QPR 5UU@>QQp  0Q   0Q0  (qA-lP`5p@ @ 0% Ņw@ŕ\(qO-POMp*P* b5S 5唢@TE  jP@ ET XT 5d 50 1 S$52S$5P ROߍdsP  RR @` d0C## 0 e0 PQ d Od0P Eh0K/0h0 m0 8!,qr0d  01(,n  j m  m,10,1#40L0sK?00,1001001#40>00010 00 000T0 Ce(5,%PQ Hd d0P G(qGQGs(vG2GGB &GZ@-@ P @0 5(q0/(v0/(v0/(v-@-$@   㳿x&7pG-P`pn@0S  0S X| "U TY0S [0Sun@ B(v7sP7-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-@M Mq` @PPݍ Ѝp!rMp@P=0PPD@rOP00: S0 RP00 0+PP P81: S  S U r>PPOLP%PPPU rPP @P(v H'7(w.7778@-]/0P  0 00{$Ѝ  r8%({840@-4S 3/ U(v@-m0 @( 0$Hmm@ (v@-m@T;m8mm@G-`MMP@p`PR0 `: SW/o0P  rR m00A 0C @L# @ V& 0S UP0P`弐0PPJ0: S,^0"]:@PTP&P ^hP  PP @v3M`@ S @ S>@PPZ GP Po }UE f-%@0 S R UKCPXt5p1 " 'PU00`P00D! @P2  rPl0S`X P^P0 TPP (W80% ܍ЍmPUy eUu TqU  GG FG F@F0/p/p@-P@N $( $(0XRX0X00\00`0ddhhllppttpp@-@ P MMMDDM@@MHHMLLPPTTXX\~`\`0p Qp` kP0@ S p@-0@"!Rc0p@-@PM~M{MxMpA-0@PJ04S->CiM->C?XXM9>:>CSM?n:>CFNM 0? AC>EM}C>G@MmF,M}S>GMmF MHHLLPPTTXX\\O-@  $$((,0,0 P0PQȡ\5 S L5sT 0K TTpXX\\``ddh~h`lzlpwptttxqxL1[ hpeb`0 `$Q*\5 S p0S&P%@ PSزK 0CA0Q R,P2.0) T U0+P0sC@p/0@-@R 8< M4 M0`! @SP ۍЍ+i000 400 0  0  0 0 0004 QP S<#0#$0 2"8<"4"rb ##̠#4rb2"LABLQA- brs@  O&d PP1+\#h0A0 0 00L B 00 00 00000u0#$ 0 ',"'("&8'$"2&,&42r"bJ 40ЍG@-@0S6(~00S/0/(|Lp@-@PD @ FP ,00S *70 0pp(~@ 00S/\K(|L00S/p/(|LO-l2M 0 00<2P0pS@ 020S 0`0 `X#3WQI 0KW0A? R! R   X %|10SI p10SET@Z000@S0@0@ a``0@S.T0  0'W ,(PSQ RЍT /T AAV@Td00S X00S0S@ FP( 0 8(~(~@(|L(|(|(~,({Gp2O-0@4p 0 L0PfQ7, (0R000U00S,  7`P%0SP Ѝ5  prX001P``` 0,00(0S/", (R00Z P000 `0` R0(0, 0 Q 0R000V00S  P0P`"`F0S/"0PS0P X5 P PpX00 0({(~G(|TG-@PDcb@ppT@@@@   0@S)st h` 紐pX 5pD /NT 8 0 0 00Sp(~@(~D(|LA-P`( p@5p0S |50S"0 SRpp5p0S j50S 0 SRP@P@A-P`p@ `$P`P00@AO-HMQM &#0@20 C_ `P/a0VP(P,0 \`" :lO"0S1 P L000 0$t  HP' $0000S 0 0 Q.P 3 p\tD.Pt3 0"0J 0 3 @p | 0 0S =r  P1 !.P Ѐᰢ L000S0 H \ t 0D0X0x2 0J0  000r00S 2j0 0H 0Hh [ Z0# 030C  4 S 0040FP!~t1 0 \ 0 \000kI000C0 0 S 8   0 0001   p"0000 0 L!0sv  0 00S GV HA({(~<HK({%dHd(~hHHZ(|TH|HHH4H(|I?I,ICG-P`J@pXpAZ x10S l10S 00 0T P4ЍG&@PEU<  1 QP0H 0  P `% Hh0S"00S U  0S .~0S GprpЍGcX,P H0 ЍU({({({IV({%GV I\IjIII(|T0/p@-TP@081 00 @ 00 .0@0 `p({00S/p/(|L 00S/(|L 00S/C(|LQ000R0SO-@<"P0 `RMhD R0R0aď080S  C/ S ! R 0C00 0@ἰ? 0 0o[\5p!pS 0 00Ϯ0 ?@U '  ϬR8 R  00 \5S0 0/070/  0Ѝ  [ X R  00Ls0 0<00l/(|({({ITIIJJ.Q0O-`@:!0 R0* 0p딑唡 Tp3Qx 0 T B:\5 00ZP/<# P 1R 0 0/."<0 P 0Z`0 C c 10P0S   0 -0 x0Z0T 0x0 Z4 , R Ѝ(|JS({({T(~|(~ R. `@|!\! 0 S P  P  (    . #0 @#`P0 P 0 $!0 S` @00 R0 SR Q\ 0Y((P({Q(~(|WQ+({(|TQEQ"({00S/p/(|L00S/0/(|L 00S/6(|LO-M,MG@g" pW+# p000SPEW ` p1P' 1PUP!00 0؍,Ѝp000 L(1P  8X1PUPh0S ! L P }0S, S : : j  W 0%4500! ?0S S :00/0S 0 S :U00#03  R00S <:0S7 0( 2 : 0S R 8P40@S0y4Pş 4 Q)Q90000C/NPp`#p90S 0p l!h 0 0P 080S, USmT09 S`p0 SUR680S2 U0;Q0-*h0S* 8(d03 (P xK@80S (00X P! @((970S0 h0!&77(%RS?U0O:7<U0030#\00SDRQ7 !0? , V0$00(p ^47 V`Q0tX ZuVPk 8' 0 0pPP6.cPK"lh0S`p&ao'qQ `panq V0 Fp`Q `pt A?7#bp 10S0A[p0 ` Z$0S 1000S 50S $0S 04  p`lt0/M$0S 1000S 50S $0S  ,N 10S0ꊡ  0a000 04 0 S0 0  P00 0!$0000 #600S<40S `4 PP @ p t3000 00S0 LPX00H00SS7 0S 30S0 \P$ !D7@lP  2 pLtPd\2 0\00Q&&0: @000S82<`040T/806#e PR8P<`@hX0@\ SP 10H0K00AMPa`ppPU 0 \;<5 D5@0LT 0 b32 R p'@ `글0d$\5S b5 " XD0/0 oP,40S$40V SV 4t`V0`@0x@S vd0,K0 0030SX 30ST s0S9 3S0? T!. 0 D sQ< + 1 0D30qA101XS>  0A00Ϡ% 0 S  s0S\00 0T@T` VT0?  `@@T` 1 0D20qA000P0P0E!O00pQ :*p VT0S0@  QX`` @W0`3Vŀ T 1,0`7: @T @0  00   ^ RT 1VSd 0P   W *  A 0#O 00(~t({T(~~({({(~$(~(~((|L(~<(~S#&7p({({ U(|XSdSKSz((SO-` @ 0MpԐ԰ 0 0  BRЍ :PP U  QP p@` {{p @Q RP Q @p(@(|W0/O-@dMX N0pP0P1P 0L1L H1 0,0SdЍ0S Pd0,`xJ0 `00 Pట 0E RpU0 :u`P 0RA0 S0T TX0S P@Spt0l({({(~(@S&7p(~<(|L 0440@/00S/p/(|L00S/0/(|L 00S/ 1(|LO-TM`PV`@@M4:0S P *0 Q0*`00#010S y0 qJP0 X P )K P9 `0S 0S \)8L P00 49 < 80R0p00S0100,0:0S80S1?10000#0%n 0P @pdy _ 0#a70 @0C0P M100S 0y IP 0sF0 S$ 0S '00qP7}`{ /00S0100,<0R:0S870S1?1$'p 0pp00ppP*0S  ;P^ 0 1c4`V/PR @p` xpP4 I4#0 #0@0C0Ɵ 0 00 0Q,*0S  P 0 "pWQލЍ0S #0 #|50S pj0 00$001 4b,P 0S #0 # 50S i`0 $00 `S!  Br p 3x ᴑ3Q@6#0 #=00C008S< .PRS8$ 0.S ($PPP3P` < 8<#0 R0 *3 00hP2 0 0v<X P0Sp0AS񟗳DS$3 00V20S400005P 2 B< 80R0؀"0  < 80R0xQ' |20Sp20Sd"؀0  (P  : S000! *!0 < 80R0 Q   0FQF?h!h  D10 S' Ph< 80R0 š!ɡ0S  0R ؠ{P!0   0p0P``0P00C0X9P2]  (~<(~D(|(~@ MTRV(|TTk(|LTTSTTTTTT"({UUU U1U@UGU({({T<T4UZUUUUO-WM M0AS}PlP$ YP 7 >_l hLP P7 00A , 7 7P 70S 60V6 A;X 4K0`06`00Ħ100V0:6 R`0S:`@aVxPV~Wލ ЍT P@P   ]d 0S X @ F  Lq30 00@(0S S㜕u%p4G`pG(pP) 5 /  B+ !D ]g850ST 0$0(0 ]/g 0S g(0pAp G0pGS(pE p(P@S,pJ40xpS@09Y(0G7 @,0 S1 # (R' S000000Y!"!"9 dxhp:  (  0]/   ,0 S1 #( R S),)-*-{ {d ` p0S(0S , J2(p2W ,@R@ )' 0x AT!W"!"dh 0R@ )' 0 AT dx@0 (0S 0$P Q 0  s00 \"0p10S t10!h10!/00C0H10!P0 800000C0!" |p(0S{@0z !0C0v 00@qUH(|TUHUQ"(~@(~\(~l$(~({(~ V VV$V@&7p(~<(~Vc({j VwI(|LI({VV00S/0/(|LO-В"0`1CĢMa2@Tߍ0S Pdp@FDAG@D0 ddp:00@00C0 00 R2PU 2PU0p 0S0S)@P@R1PPUPRPU Q0:0000S 00"P D1y00C,(P X PH0P0!!0` 000pSL" gTdXHw!Pe 0 07 ;000pDTt(~\(~l(~V&7p({({(~({({VHZdx(~<WePO-䳟P3张pM/`@ 0C\1P 0/ |0/ G0 HT30SL30U SU <0 S 3 S  @ 00000CSGTYr! P 80R000303L32   0//C` R b3",Q Q0|`B*D/P2020S oP PA PЍS   OPe?00 1>!  R1W 10SF0T!  0 S01`00/ B  030!ܰ 0S H0S 0 04040c/ $ 80QT $00$0 40 4L3 2   ^[0{ {<0 DPpC({(~tT(~(~((|L UWB(| (|H(~({({00S/0/(|LO-plMX G2吒吢00,0SlЍ0S @d0,PBC0 <<Pc000P㸀 @1 0 0D RpT0<:9`1 PQ@ \`X00X00@SQDp\t`d`V %P 10S  0^@P%P 00S  0 0S  Q\ {{00喷 xK0Q! 0 P  H 08G4({(~We&7p(|X(~<({WW(|IVWWWO-oMM@PL00 F0|2?0SX0S $5Sڔ0SXPYX0S $XmX S RLfH?`0Vd2 P\20+! `" d" BF00!X d"B1h21$\Pl2ڼΟ\0C00p21`t2QB1l2 ?V 2l20CL0=SLq Q\20B <80S 0 ㌎$5> *_-t>h>0S 00 0S0 $5B111`R B- 100 S ` $|00S% @ 0帀- 00$%BR0Ө`S<B11D%L0ḵPP  Y PN 0S  <P| *堀,<<0S !0 00\0 bA?L0<5A?X0 =<0T0.H0E; 0VHRQX0h0@ @0E8 <48ϠQ b{ S W,0 Sa?^ @y#PC ;0S @ A>+@B@  C(P4;"  @0\ 0 000D:J*t,::0S E0 0؍ߍ0<00<`/  `!.0i0S pd, @ 0  000y;!"\Q 0 i0/H LE0ЈSh90m Sm X90S 0`)S 3S 0S ( X0 0h80S 8 0S8`0`80`M 880;."\^ `0 0/dh pN.' `n3&>8+?ᛓ)T<D  0PRT%ͱ|7DpP0W`C ?Q `,00C["qS  Y0;!"\Q 0 h0/D0刖S  70S P#@6z0堦h n+60S 0p&\Q`\uT6PD60S6<650;."\^ `0 0/dh pN.' `n3&>N `$5S8?x( 0R #0", 2R #,2$24"00 (2S W08" x S0! 2C 2@%S\2/< C 2%Sd2/?L CW=SL5s45p`Ḡ? ?`00SE[ 2$Sd2?/0?  (2h$0C(2 2Sd2?/0?  (20C(2`D0P ST003^0 `0 D0d]"{ "{ `,00C[ @^?p ?! |"l 0AS 20 2(2@#0C(2 2Sd2`0/0!!!p`Z0: 0`P   Phdqzq08PPN$20$2<0S4 d? 2,"S\2/0?! ! 2"S?ԀP5/`20PZdl?ph?0 0 b?>000$5S `0t63 03080D ` ßD =R ,20,2! 2`Sh2/0^>0^00/\N({(~t(|x({XH:(~<(|hXX.XXHX`XXt(~D(~ZJ(~X&7pT(~(X(|p(|t(~,(~YY8(~x 8(~8Y\({YyY(| ({(|H(|L(~HY(|T({Z/(~Y UZ$5St2 ` 0h pp WS $%S0! !,r  $ t p (t | px  | l L3xh  bhl  "D0H P3 00p`Y7 0$S0\000S7呫!"pW`嵏X7 0 %S 0\000S7呫!PpWO-P`@DDT(p } W @6ZZA-Q0 % C@*r`!00" q0SU 1^0aO0  a*#(1t10S N0 0T 0@# 03A0S4  ^@ 5*< 5'000S &0 0u@rTP/UA*t0Tp Pd0 0S L P<0 0S ({({%Z(| (|H(|LZZZ(|T[0/(D0/(D0/(D-@-$@   㻒&7pG-P`pA@0S  0S X| *U ቲTY0S c0S}A@ J(D7sP7-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-@M Mq` @PPݍ Ѝp!rUp@P=0PPD@rOP00: S0 RP00 03PP P81: S  S U rFPPWTP%PPPU rPP @P(D H'7(T.7778@-e0P  0 00$Ѝ  z8%(T840@-4S 3/ ](D@-@0 @( 0$P@@@ (D@-@@'C@@@@@P/00@-0@S @({[+0Q0@?o2P  R0 P0 P0S 0 0SS  0 000/X xPP  hP R 8 4 Q  0/TTT 8(|d(|L(~ (~$(~(T8 t0t 0 0 \5` S\0 X SP0\5L00S/\5, S 0 $ S/0\5/(~8(|pT 8T8 (|tp@-@P0000 0 0022=p 000=000X0X0<0<0@0@0\0\0%H3H3L3u/L3P3P3T3T3% %h p@p@-@P0000 0 0022=p 000=000X0X0<0<000@0@0\0\0%H3H3L3u/L3P3P3T3T3% %EEP  %4K44K44h 4|% 5- 5d0Bd00000P5P5H5H5=CS>S>h p@/0 \\L5SXPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//(~0 0p 0<&0|&0P7p0p 60pw>0 P0p 2S # *#8P *8P *.rVXZ hY 4[ 0S[?관X V. 0;  p7 <0\9P$$V Q2C/w6iPPe 2S|3%8 S20#"20$#20PC 2SB4$040404`02P&V20A2\02@2 070C`7 `Fb7 0| "6H 0/`0PpT#0`P\`Q=S/0P 5` ( 2RV0 S,S,c 5*< 5 "3 30S 70 0`20S 0#|#0 0R V 10S \2RXX0S@}2؂= C ,0x" t`06 Bq'/ 0 >#a0 `0S10S!0 R=S0S lG $000/ p 0L%000P%X30,p:q *! 10S W0 0(~4(|\\(|`\\(||(P\\(|({(~x\v\(~L(~P]! %]N]W]]]]^T^N^^^^_^^m_3T_U_}({_\__`E_`K``a\a(|h?a({aabb=V(|xb(|(~c,(|XcP(|(~h(~d(~\(~`(~l(~pcw(|T`$`ka a9`a0(~@bb(~D(~<(|lbb(~H({(| (|H(~b(~0(~((~,(|LcQ"=SZ0SR  0\p<<00P%X30* 0 |00S #0 00S5 0 >0S wPq 5*N> 0:#: 5 (1_ 10S 0 000S(SP0q0* 1? 10S 0 00<cQ3,hP 0r<0* (2 20S `0 0倂0 RL%r0L%r0H00q" T 000cH00SP4Pr*] 220S .0$# 0 00L40q"  400cL00S Ps*5 330S `0# 0 0x4pW/E4 ^  RpW\ t0SPT4Tt* d4\40S +0$ 0 04t R,5S0%45 RS! t004e0SP*$5`50S 0X% 0 00刅(0S xQ$ Y0S< x 0(%0S8zPȅ*5350S t0 & 0 08%<5HRS$ + H00<508S_LP*u660S F0& 0 0܆@%D5LRS$  L00D50@S6P<*FL7D70S q0' 0 0 7 70S ,帇 0R" 0Rz7 0SQ `@ᨪPLX p 7@ Tʰ8  @@/  @!. A@O@@ᅪP 4  7,@>()P4 ' <) QHI ϠR 5l)p) x) )pPW)pp _ 9 r3 P. ~P)Qڨ0Q, G 0 0S kPz*:$ :0S e0H* 0 00S T0S0QQ 0 0S 9Pz*b::0S 30+ 0 0P UT0Sh OT0S IT0S^Q  "Q  7T0S&! 1T0SQL<Qk )T0Svq #T0S0 T0SH00<5L080D5h<@ ,5S0SP ,000<0,5<0(5H04e0/<5L0l08%/@%D5*0<s<0S 0 - 0 08=0S 4=L=0SHm*T=TL=0S 0Mh =c |P'L5s0SB E-000=0L50P5?T5V>X50$E- 0 0B0T ӣ1`R.B!!DtN00 00L 00*r>>0S C0. 0 0.P0 @DT@8LH$d0/ C#Lc c,1 0@ `3P Z( \?0S  Q8L4H$0/d@ A! a,3 1=?0S  60p00PX6@ ᖨ<6P0E V0$& 500060S 1S 02P 5 5 @]Q U0@ `P @@0 8< 4 0h%S L50S PZLP 0  0  `` 400 0 0 8< 4Q Д A0SXhPY 04 S 20S^YP_ 04 Xh$0Sd<KPe0 $V:PP/PQ  0Sd2Pe000 400Ry c0ScPd0 0 0ipFR0S 00 0 0 00 40 1R0S 0 0 00 400 0R0S 0  0 000 g 400 0lR0S 0`v``&$` 00Q 400 0`qQ0S 0@00> 400 0 1 1Q1Q,+ 0S A 5< 0!00|!0x!0(pCSq #0p R0 !80Bs00WP P0S0@PT0  Qt \  (E/ !0!XD H!](|T(~tc({(|`]N(|h(~P(~(~0LABLcV({cYTdd6dLdidRd?a0({(~d(~V(~X({(~TdePa?00S q: S *C   S D00S @-4l * R  S//(|L({e@|1A-0`S hdc0@ TL! 0S<10S,C$11 00 700Sp@,_'00CS0pP U 00CS0 P PYU 0 P0  0 0 SNU ({eSQ"(||(~,er({(|}e{9&6&7p@-PD0@0`S  0LPp({eQ"O-01 (1$100 ,P 1 P 0P  PPPpp(㱡 @ PT`00 XT V p WP @@ 00p(~(~|({e(~(~(O-@10$MϠ,"4H`  00ݠP p0 <v 3(bP U  0~pP$Ѝ? 000/  嵠0P0 0<00? 00QS / Ϡ/-0  8#p0P (~Pee(~LeOO-`M0P8 0Đp@/2#@ mZ 0 Ѝ 0|xPZ ЍO 0/  RP 0/ 0Pp(~P(|eOC-P`U@ (1 U -P0 PP0 0T2`p܀*0 L@D0T@S   8L4H$0/d@ A! a,3 l1 ~0S   x0P00`0@T Ѝ(~Pf"Pf-(| ({(|L(~, 0S/A-@p da Al a3`Q0 000SR P00@00 0` PЍ({((~,(~0@-0P@T@T^d pA `anj3ƌ` VW @ 0 0 0P0@0@00 Ѝ(({fSp@-`P@XMX  1 `P @%XЍp @-Q  4  4H0@S X00S LN004^,P00({fj.fvf~p@-<`# $  $0 \# 4$$ 0<$( 8D$ @HL$C0 5L5s0P500ߍTf({f(~((|L0 \P/Q/ Lœ4|    ,PŒPŃ ,DTPH40S/<$0G-4DP,4$ 40S2 40S. T0SD #3 `3R0B-R? CS*3`30S 80P 0U`dSTS}PswPUU00Q A2P 0S ?/@*XVP`"hR0"00S8 pr003Pb0S* xZ0S* 0R0E>0*X4 2p510S v0 00SL[P10S L 1TQ d1*yX1`H10S I0 0H10S <gL (1P 0*W0`00S '0t 000S d0P`f 0c{ 0~G{(~D(|T(~,(~0(| (~4(|l({g(~<({(~P(|H(|L(~(~(gWg<(~(~|;5gn:(|pg(~8(|tg({(gO-@PMp8 R3B\? 02 ? Q00PaV`` 0[ΑYP  l"0\P  0@" 40/ ~0 . 2 r0S0a Sa 0!S 3S H0!? 0!0! !0!S`0 0 0` Td!Ϡ 0 8 L3R 24  B # R#  B ` 0Q" @*q0`0S `A ` `Ѝ0jS  $  B$ $ R $  B ({(|(~T(~t(~(~((|L UWB({(| (|HA-Pph0``ATR [@P<u0S @ -1p0A(~Tg80 0 1S/ 0S/(~Td0 5 /L0P 3 SP 3:.  SR///({ܷF^QO-0(,P0p4@8`@ P P0P` 0S 0 S   0  0000 S 0 S H0 w0    ({((~XQ/0/O-@8`夠 砰P8Q ЍP@p8Q Q0pሀቐp ` 0` RP/! 0p P  C1p  1p @- (h0` Rt`@0o/ 10#/C!000P/@- 4h0` R  /  /C! C!/! !/@- Dh0` Rh\  /  /C! C!/! !/@- QhG-@$ uQql#`h RPSq p$ Z!Y  @  T*B\ !B a ! L @DQ%`L  R V@T@ ^@  `R A G-`RM@Xr PP d{P`T `hoP P8  ,p e-0S  Yߍ<08 0(0`0,0 000040!04 04$0D0(0P W[  öpU p彶p* d=`` 8 + <o 0o $o o  o 0,0o0 o + fp 4`?`a8SXPb 0  00*0P0  0 *0 h@dAdeh6@dzh hNhh_hqhhhA-PMPp`;@ p@P  P03P۴U 02 " ݍG-`MMP@p`PR0 `: SW//0P  rR ,00A 0C @L#(@ V& 0S UP0P`弐0ԵPPJ0: S,^0"g@PTP&P帵 h'P  尵PP @v3M`@ S @ SH@PⶵPZ QP Po UE f-/@0 S R UUPXt5p1 "PU00`P00D!⢹  @P2  |P+0S`X PhP0 ^PP 2W80% ܍Ѝ)m'PUy eUu TqU GG FG F@F00S/p/(|L00S/0/(|LO-pT1PL1@00ʟ 05% X 3#ˠ121` S`0 '%Q䐟a00!R00S GG% 0 %#s(0! RXh000R T00 pp8P,0(~V({(h({a0(~TiV(|T 00S/ (|LO-,Mp0`@Pᄡ0V000,Ѝ00 ?U0$p$00 0000P$00S 000/$$ P0 0 0 410S tD$0 S0   /000P+ 0(P0$00 00{0$ 0 { 0  0S     `@`00S ({[%[ (~Vi({KjKj6jfjHj(|LF^^Fj(|TH|(~<(𪪪(4ja0jVO-1APQ P1a`3$MS0_ 1P11r00`g00 0p000P0@T <cPXpXT 000/ 0cP'0Ġ[@  0S \C  OP PD0$Ѝ({[%[ (~V({(~Xj+k({kPkC(|Tp@-P0 % .  @Q 0S pP# #30l0# #:>00@0SpP p({ܷF^({kVQ"krkR/G-P $` 0p V@`0 @`` V`@&!D( `G-@P4S p`%X30剑zuP| | 0 0! ##P 0p`/Ѝ_ uP : F^ :^Fp@-@P`    pp@-`P@ ((UX0 3?X0pA-$P0 U PP(`,0@4p*^ :^ *^*X@40P/ Q\/O-P5>UM 1!#0@`Spp$`J0 U  0 0n7Π ^ÌVQ 0V>   P" G Pa b72 R0 V1Q0V"   P 0$P ` U `P`PЍk Jk0A-1àQ`P x0x xx#0@Sp$P࠱ ` p@QL ࠁ PQ k }kp@-@PaSl0l ll~#0C800S   0,0080P4 PR*Sp0 k ,kl 2,0S/`0@-0@  LA, 0,0080S 0  F#0@(l)l  k,0@-S ,0, ,,4#@TP @lB  kO--\MPpU`@8 U0!@3 @#81S41@D2s2@Ds1@DS@D5@D0  0 00P\ U0#03?W[[USU @0P$0,5Q $BO0$0 ᙔ9D 0XR @Z"!H08pp(0

pPts0SP@$ 00#T {q=,PtUhUaU$ bU !PCi0E SQTPPQ4PPPPPPQTQD8^p, k P@0( 0J 0 0S 00 040(`$0#!,00_P P]V0 WЍVp F pBP ` Dp5P`P8V:P4VX  &P ep,%$0S 000$4 ! P  0[p  0Sp 0 Xd  l X0 P0  !j P0 o&0| oo0oNoio}OrooG-@Pp 0P`6oW  <40 040G 040p040O-0` mM$0P@t004080 0  p40S+ mߍbP AP LP X8ŏ4ÏcP iP07 p8~ 4@L0 0H4: S@ @0(0D04,0008`0^P PP 0! tTT` ⫩p 0Q= $0 ! $∑匱.@P 0V$0 0/S4<<`V $pP*pT<R0"<;P0<0`P< Xv HZp< , +n?C0 n?< n/Χ0P < ߧ<!$ 0#$0@0P!S `V|t 0S `0S  R$ R Z m0$H 8 HPp`G0$pS 0$ pL ~pCZ 0 PQPQ0 S R `TWpG&0| pQ@dzpoppq'x 09pqqmq0qMO-P-@p`,M,$P Ֆp($0S0$020S'$p; P V 001 0P0Nd0 ; /fP AP PP \pP$p,Ѝ`P0 `P , ?o  0S0 00 ` p 0Ppq 0p U,p`q&0|qq qUrG-@pP` <p`:D10S:  p o09 6X $$ 1}p+ P%W00S $$ !mp YPPU `fV rV GTP$$  Qp$lYM&0|r.rKrgr rp/0/ @- o A-@P`pP hhܬ XU  AD<Ѭ4  ɬ An&7p@- 0R0Ѝp` P@3n0Q  R SR  R $$00BR R P0 -M (P/00#s01"$# O-`p  @W@ @T  WP00 Ѝpꄀn>6 \  dp7 P Q*" ?    PQ* @ P*Q*? #? O-@`P0LLp@P T \0᳠ 0S@P 0S@P 0S@ 0PP 0T# ?@TSU:[*%@@6 p0 7 0Pu R0Q @@ 0B R ! 3OG-(`$p@PP 0㘤I$0 0P Q bPЍ PC-(p$$ 啒S%p@ 0 `sP Q Ѝ ɤP404-@-0  Ѝ Ѝ/-@-00@壍 0 Ѝ@ Ѝ/-@-P 4(巪 * oЍ Ѝ/O-MP`p@P(Ѝ 80PW0 SP 4S  0݋P@T=$Q 0MP 0S 4S 0 40XS$ R 0  ᥋RG20 0 !|0`!u0 0 0  @ 0P 0  Pw < t0T됩'P*``4`VS ڴ 0s ` -j0  p`P@ 00PY: r!rrss<s8sQ.sUO-,MX`\@P$_ 3R 4S 0,Ѝ0 P P0   RSRQ" "S 0 d000 00 @0 QPҊ4S0 S: 00 000 @0 10P 0 oO0@$00SS P %XPp'xp   0(X$0@S4S 0g$R  pP[0 RS  0   pPN P0P 00000 0 P(p6rUsssssssG-`pHMP@P(Ј@TC^t# E@0$4$ 0840 ;p+Sp բ ,p H4$$: S R B.\ pL $4S@ ($,40-B.( p E0"dR04<($$4,4$t0K>Ѐ 0 0E  h00`d$t؀E0  PQ0`0 Dw4S  0  Pp 0p 0 p pmp| p0 ppt P AP 0 0 SPp5:Ѝ0Z hpW"t$t9utE@dtQth@dttttt@-@P 4B BRP up 84  'Ѝ@Ѝ@du,uK@-@Pp P P4PS 4 uuuA- @PPvTr 0pl`X` gcp0 puv$$ @-@@T@RT ńCs9 #600<0$0@000< 0 0 @-T$0    O-`P@p M6,`)ZP̀PP `00000따 V:Ѝ 1 00 0P0ܧ`P1 0 0ҧP UP :=v+Pv5&7pvJ]C$4 A@-Q@- `S@l)ЍpP P < 0R00  -Mv`v|vO-P_o 0R0`@tMR(0S00S $ 0R0oU tЍP PU 0SIpWF (0WSB 0RSR8$ 0R SR.pG-0[ KP# 9/p  9/p 40 P m0 $8  uP P  P vA-@pP`sP 5/p 4 5/p 4 zvC-(00PS4pR Ѝ$d@ 0 0 0d`> 00  0 `WP vvwO-0 0Pp@᐀删T Ѝ` P `V Hp  0 [@-M5j w7A-P@$`$p0 @åT wSO-Pp$M `@ȀJ뼰0     Q   x0 p `p X0 X p`000P0  $ЍP  waO-PQ@04 p 00` ЍP P(U0 E `P0  t  0 4   04 p #00 #p  kwhwwww0s@-SX`@ PYf0 ?o2R0S  <Ѝp-Mv|@- iR sR aR p`  wp@-P@P (`Pp p-Mwp@-@T 40`PPpp-MxiR@-- 0 aR bR LR( sR% tR@sP 0P0S`00p`(j0 x:-Mx(p@-@ M\P`ᖶP0 0͵0,s0S m )ЍpPxSPG-Q@PM Q  |ЍA~␀ p$u`P pxhB~0 00 ` 0PP aጅx[SxvxO-$M@p;P tB p $Ѝ-PP0  0 7 0` H0$0V!<#P0*Q P`0 0?V `S 0S PV0P `E0t PU0 op $P< 000 00 `P  4! `00004- )4#0W0000S08pu $$5 3 M0KH R*F0P01 T0P=Z-:L0SX 0 pO L004 0 00P0!9P= 4$$  X 4 P44- p〰% xxxyy3yX!yx10S 0@-@C^M E$*E$4 0 04P0Ѝ0 @1q !0 p0 \zX 80 DP<1&0| zzzzzz{{+Or{>{P0$ 8fO-`DMPp4 2<0 qp 0S8 ! R4!DЍLRd a0BS)S&PPppp$ppPpp8ppppppPPD10S  0P c@P   7@ ㍁Pట ۃ T %0 圢0@  T @0  @P@p{m{&0|-Mj9 &6x{{A-p`(P@gP0 p!`P @00 0$0@-@P$0S 凃@脃O-pP 0 `0Q 0`0P0@SP 8@4(P<Ѝ|!|z ||||O-4Md@`P 0\0T$00X,% 0  0 0 0 04 0  0$ 0 $0 0 4 $0,0tWH 0Sg   R  _ = R  X 00S(00 0( `S$0 0 $0V0EV0B$00$` T0  0 0dP  ( 0,0     ` p4ЍT0 0 (0 0w (00 0 `0 0j `V00V(00ppO-M8pP <EJ`@QU`@0S @ `00 0 0 0 0000SpQ `@Ѝ 0 ' X 0ZX X0 0 @X` 0  @S` @@`000Sp `  0 @ ` 0 @T` T#U` @ Q 0S P ZUpP 0S 0 SU Q 0T P fP00  T 00S0p` @k||}}#|}=}a}P/0S//P/0P/A-AP  `pSP  0@W S Q@-@,MP@p`ZP8,Ѝ $ p`4P |xW@-iX@ P HHH0H7@@>@8P8`@ T% :=~w~~A&7p~ HR R R @-@R R/////p/0/ Rp@-0@P! R! 44444p4x R444444444 pp B R"Sh 1@\ \帞T0 L8 pppppppp <:(?O-0M `@P "PЍ"0PP <8PP( p0Y:4S 0t $4m 8PLgY:P `PP04S ڠ0"S1@ ;0   <03/p! 8 H0 ;0(8$ 0P  0S  0(0 QPEpzVEW <:(O-0P`p4M8,0  p@30S,`;^P 0! b pT AT fT @4ЍsT0 0,p00 00@!pq 4 `0}p0 00$04S 0Q41!0 6 R? 2R502F. YpWp Vp 0oo`@ !Lp@ R@ `0R R 0S 0S0  00` 0` 8 H00 $F C0 Q`F&0| <8X-:(<A-@ĔQP MP  An``llph`p>P LЍ^p ( 0 S\wG-@Pp* U$4 d& A~ĐĀ p$$  50 P`` 1L0#p  H= 0`$0B~ 0 KSQ O-M@`Ph  4PS 4S ЍtW P tWnP 0 Z 0CPQ  WFU 4S 0dp pP30   0 yPP ,G  ?o  0p0 00 PWpU 0V p 4S 4S 0 P 9kqqUr@-@P@ Xt*00CS񟗎D`Ä`0``DveP P5 IP o_P0Si eepP 0HPXcX HP  HP  pHP  \HP  HHP  4HP  HP  HP P HP H HP @ HP 8 HP YRnP  UNP ZPY LIP @P ,IP pdP fHPU iX}"80xGx HP P P2"GP   nP_ dP^  p $ 02#W: LIPN <dPPH [ 2 " iGP= 0!xx HP2 !0xx HP' 0 HP 0 yHP 0 `pHP m0$ 8}0S nP  W { HPp@810T Ҿs00Ѝ8-M&0| ; Ql9"=dxqOr oaG\fO $,F(&7p/0/O--@PptktM {p T;0S DЍO} 0FS iS ;`pC>؀C$TP W ЍPP WPl|:Pe0Ph0 `hdPT00 $4]P,3WSd`P OdP 8 ^PW8 FP $8  p|Q< pGP <X8 P < hwPr0 Q00000[00$0000S 000(0dP d0P,0 mPP ؈ؘبY`P Y$HqPP0L< OGP <hP hP H EPn DP EPh L0 SH00T0 RP0( 0`0 qpq 0S$$03"apq 0`~ᶊ$4P p`$$嫊$4P` V<c`P! ,cP 4g' |cP l0P$0+800 $Y`P$Y&? `0 pqx #EP 4xo h -EP  P &EP 8 EP    EP   EP   EP q EP   DP q/  DP q?Kr?t 40DP r?1S 0Rr/0s/0{0r?0,s?xr?  DP s/ DP sa$$$4Pk,kPc ^X`P ^X$4` 0upq\8 x8D FPR DxP D p D FPB DPH DP7 @ (|DP. 7 dsDP% .D DEP $ D(@ 6DP @ Y* 0C$ Bx $ pP$$03`"pq$ [X$ "0P"]  $p ( 8X0$08$Y1T0P mR\XhM` $4pq|_$$$4Pp`\K0$$;`"pq@$$$4P `&0| -M{lGoaf\ $8!d|q"=Udx,F(!20@-@M P  2 0 0S[p< <延 42p$島0Ѝ0 di'p@-SM@P, J0 % %$ &&4 '@p H0P0x00p0`0h00`0 0X0D0P0L`0|`p& "D Sߍ@iii!@-@   WЍ10S/p@-!MPM@P% PA. (01P A!A6P7 0`0?oS c`1 06P- 0H,0 0A. 00P0P A A 0  带ލЍp`0 0A. 00PH0tP A4 4xA@ލv`((PPs@-6PP ͵P Ƶ -`@TGЍpP  00SRV   _@ 0 R !O-M@ Pxp.p"㎵`P"    C`P- c<`P:7`pP cpx0`P c \AP 0"h 0R00  p!  lAPr 0SohQl @ 巈pal c! R R RZ  0PW l Z XX (s< W 0j0S, @ h偈P@ `{pd HQ L 40R !01Sp0S 3/p\ U 8 X\p \ [ 5@ `Op Ѝ d m&.q5UA-p_@P@L_PP _`_ PNR U_P T`PT@- BP Ѝ #A-MP pCA@P00 p`ЍpP % ؠ0 p 1  0B-i@-@p @A-P`_pPI00bP@@?0b : FA-P`^pP+00bP@:"?0b  F@-( @P 00 ЍP 0@p%@-p0( 0`P/ R/%0 O-4M@@!2T0-  DPƂpğo㋯(p"WD@P`T `P 1sexT6| P`P`@ p00KTp R  P Q R07 0TS $P\(P  1/P C@0S  kp 0$ SR(0S`#\ 2/P X0 [  (;O-MMPp  X p`$ pP$ 1  $坟- H Zpf ;t Mp Q Xņ う8 p$0Q 嵆$_ X@T X00@0 0"P圆@U 0 0 ,0@4@ p 0e0Pl0q 0X 40,@pDg 4<ug0H0S 'P31fH0S=I0S:Z`@T 0 3/@: " 렒M0S:00 % p" pM0S  5@ -@03/@r J≚I0J/pNI 1Ra`"%J` 1 0 d1 T|p 1 d\!1 H`@#%Js!1 @ t1 x!|1  ㅅP@Tf 03/@ 03/ݍЍ rd%ii~%ii( Սj|i `a #.O-@PpP  p 劭T W@WPT!vW`P \sPPU D1O0S  KK W cP.Z  \P' ;P! K0S 0 L0S 0M0S 0 N0SO0`S PPV ڄ #$, 8( #&7@-,MP@vpP WP`(  p0S h H+9P00< <0 $,Ѝ U(T(i8_ l@-P@ᨕ0 P̬G-@WPP0 b`@ Y㔀4[p&[ᯟPP  pp H H@@@e@ [ 2(TFs@-@{XW@P00Ѝp[PZ{@P <` Peu (Ts@-@Q.W@P|0| |ZPZR@P T` Peu( iЍp [ (TA-@"VPP0 `@ZZ!PPp ᨕp< >FJN@ [ (T @-@ \8PP0P PPL 0 S@@00 >00Ѝ % (T"&7p0@-M@VPVP VPpVP d0P P P Pm 4PGp 嶫Ѝ0(Ti7ds@-@哔h埃 P L嗃HPH`Ɣ P! ,匃Ѝpᇃ@.q (5jzG-M`@PK _ppP"t(    З ~p% (( px" <@T t8PMl2P\F UR TЍ0 PEUc@P2 $@~p t 0R k)΂ ̂` `ptQp R%P\ 㺂mLP;ЍGOdQ\ 0Q    1 0P߂P0 RSᨓ ς͂ # ㆂ0` R P U 0pD` P\\\ d(i8i ,_ /4 aP ( tPp@-P`@TP V  U`P 6H`3H 00pTTp%HA-@T r00`PpCZ0 p `@@-MPPV00Ѝ`0 00p0@ 0 P bX0P> 0 p 0 `P0G-@(P*00!`( p Q1r0P*0X 0U0$ 0R0 "00"SЍK0P 0 , Yp 0 @0@-@P G@ O-`@pP,(0V0S 8`P$P$P 40S 04S 0S(0p(`8P0S$0(PcO-M00 X$000Ѝ 0Q`?  0Q> 00 6PP; X:ᰜpP ,,pA,4@[T /@P00 D!0800 0STz 2PP]0"ר8!10#R0 0l8[bP Z@  0YPH@T 0CS 0 0r xC0X0^ :T 0CS wR0xL  @0aD\W@DAD\ 7@Dt@S 2s0@0t@0@Dt@ T130V@aTp ts SPF@ H F0 0 0`0<5j ;NK SA-X Pp@`P>006=0P5 0 p 0 `P0O-P`$M@ HpX8 P W0  pPp` 0p0  08&><QhQA-@P00S 00QQ0s0S Att|p0 000xSX|`PpV|`   @0&><^&>81p@-P M@ QU U( 00P Ѝp 0TPTT@ !5!0P!!`|[PP  @p 0A-p`Pp@ @P(b Ð Awh p@-@P`M   `ЍpG-SMMPPx!x=ppX!\ S p@!H F/ $@T SލЍ%`P 0S0 S 09(00 1 ,0wp[@(0#70St0 00#00`X0`M/rP41S 80X4M/,{ Hdi(Pp@-`M@jp 0+SЍpģP  l   R # <+wp 01S 0/S [Vi  00S/@-@{(A-P@`TpP @ 0SP z&7pA-P@p `PW\] TNPH0 000  (p`8&>1P00(Ѝ 00S H x/P 02 , p hdo=i9E@- np 0QSЍS   zQX/0` 3?S $S DDD S/8 S 00,/(/$/PP7PP0t 3?S $S $S LLL S/@ S 884/0/,/(/7O-X`@p1!0R  P A^QT XPPD@YZX80PE00O( D [JP1@- M @pl?d _.PT0T TT0H 0p@@,Z Ѝi % i@-@(M!  0P p< <4 p(Ѝ M /i(@- M t@n.Pq`0` `\ spL 0@ 0jp,١ Ѝ7 % 9iiA-M< Pp!庡0@P "` # 0(0xp0@`@$`<0m\PT100 0(000804 /p'坡  !P@0 @   :R@p00CȀ0 0p0 6Pq00ݍ@ T0S lf@ 0@P0  S  0R MFY8ia&><5jj0@-0Mx @ pd d=r0PP  041p 10Ѝ@ Xi(&7pA-@BM`(  dpP 0 P P PP  8 ! ll pz l RxlmU#0P 6qp 6S30S x0lP 6_p 6S\L30S Hx 0$P 6Mp  3Q?xI0P 6?p 2Q8x8 T /p 0S0 Sx8 $pu p | p 0@ `PpP2Q HvxBߍ20S ,nx10S gx dx0  `0000pPxPU0``0` Rڬ1000 0:S R TPD.x`p0PQ %xV pWP ,w;xH0S Lx w~ x! !px`0Q w w(i8ii( )8iiii cg&><YrJ)30@-@Pw.1O-PMM@ 4 0L00h4 T4PLH4'S$0P0@ 0 0 @PE( 0RtP 0S0'U 09 0909 09帰090909w(@!!0 P o0 /C BRZ      -BX9$ B2"! 0P PE ^r PE0y900IppcppCppPpp Spp@BppA`8 0PP0` v!0tX@"0(0(0S@ }v0$ 0B'S$0؍Ѝ 0 0 (S   BS>C0C''S Q:ǟ"!! CR   ##9C0C<"!% 'S>C'>C2"" N=C0C Q 0*S ;S. RU 0C'S񟗸;X;;;l;t;;;;;;;;;;|;;;;;;;;;;;;;;;;;;;;;;;;;S66h4644462S# St 0S R S8Z 4&S0U 0R  t t0!v0( 0 B( @U0S 0S `p v븅帕帥pW>u 0R 0u`|0Sl u0S `p0H00 <u45H3,,娀XP0  @ up` u0S Z0$3?S Z^0S  -Pu0S xqu`u`ov`pDW1qv `pov`J, zX4,003c1s0Sa|quw ,, wu3pGx#0P# P# ß P# hbu`HH#S0S TUu0S0  8Nu+S Hu0S#  Bus匢 `0VV /r  !"   0,uV" &u0S Hquw0u` pov`X1pwp 0J,0Y 20, `&#Squ ,Q, t1H!0P! P|! x Pt! TtLI  plhd`\XTPLHD@P4iW A\.`(e( $UN.`P5jPU]yP (2cboP7 t~+Z p@-P M@` QP0 aPp@@HT Ѝpi_@-< @r(P$0$ $ Ѝj % @-< @\(P$0$ $ Ѝ % 0@-MP "Mko@PۍЍ0@T P+  nP@SۍЍ0@n0S0S1iSs0@-M TPp@@SЍ01 ޛz@i@-T @G(P@0@ @@mI \p ǛЍ % A@-T @)(PM<0< <O  >p婛Ѝ V1 %  0 /%|/-@-@ M,00(000 P  Ѝ@Ѝ/0@?o21  @@@@0Z-@-  bV^V ЍЍ/@-@KVEnm 0S/@-(-@-  BV>V/ ЍЍ/-@-  4V0V ЍЍ/@-\00S 0  0000 0 pЍ(~@-@YmH&m mp0nɃp p@-pMPP2 P0S 0@P 0 0 00 0XPp DlP@@ ((@,P0P4P8PS+00!031 0@-Mt 0@P \ QLPP @ (@@ 0qP 020Ѝ0%F(@-@0P ,r  ro&7pP@-d0 !T| T@0!6q0\ (0000/ P@-`0` X| TD0!6q0\ ,00 00/ P-4s00#p^0<\ 0000/ P 4ps00#\,s0P00/00 PH- 0:# ^4 0P$0000/ PH- 09# ^4 0P$0000/ P 4 <# \,4P00/00 P- 0:# ^ 0P0P@d|0:0# PDD#^<s0\ ,00$00  @- 0 00nP ЍG%A-P`p`@WЍ P 3MP@ p7@-P@U0  ( R Ѝ0F=A-0@nS0oSp@ p8P``RPQ0nS0oSJSPPESPP'5j@-X0 *q$nC&7pO-MM`<(0pP&7ckO-@}MMȐ⨀p 0 HvnP8b88OXUF ,2S$0E Ÿ" P0 _n0S% 0 0S 10S P0   0In0 0P `Pt p=nrFPpp5nX10S\PT@ލЍO'n0S10S P P'n0S n& % n& %n0S;00 P   P00@P  0S pP@ `m\ލЍOn 4 P( (.OrSH?p@-PQ@@pQ(0opP0p(PA- 0nS0oS 0 ڈ@P0DtMP,WpWLPP`8MNp@,@P@(1@-c 7n1k8&7pO-@PM p(0`"P0"儒 P0x"Wp/\2 00CS20%|000& 0|0`P0 +0000 0p00*0ZVjhpg :rPdPMP* UP? GP e@ PZdZZtZZZZZZZZZZ[ 00 0 00 0< 0x`|P 00  0]PN 00 0< 0mty>hp [,0t0Z00x0V0;;0|0ЍZ00x0-M&0|-M] -BMMI^@0 P@:00 X 0tgp0 <峔0 0/  ZxNj 7@-@P oM0Lo SϜ 0 凔 Ѝ0@-@B0P@@-@D0P@@-@ AM0S 00S0?  [Ѝ p@-@P!P (U0/Sp.p@.#8Q@- lie&7pO-p0000@P`ᜐ (,唰00 Up0@DTq oP0 P|~P<m~9 O4&0|-M-M8 @-M@A>0 0D@00 l0fp0S SH N 00,00 דi p@-@PᙩP (͓0/Sp.p@ .#8Q@- glaie&7pO-p0000@P`ᜐ (,唰00 :Up0@DTq oP0 P}P<厓}9 O4&0|-M-M8 @-M@A>0 0D@00 l0(fpa0S SH Z5N 00,00 Oh %p@-@PP (E0/Sp-p@-#8Q@-  7 h&7pO-`0@P(,p娐娠娰0 Tp00@DT oP0 s}PP d}  hA+O8-M t&0|@-MM0An H 0P0 $@ep h0p@-@P៨P (Ӓ0/Sp-p@-#8Q@- mkgh=&7pO-P@M P0\`r"?Tp)20 R. +x   &  x `!p 0 *00)0`Vpepz {uPfPMP9 9P$ GP g@Peeeeeeeefeeeef0eUP|0 0|00|0|00|00|00pt`x0 |P,|~=Pyyep Z,0p0Y00t0V0;;0x0U Jke$00|00|000ЍY00t0-M&0|] -MMJNP0 @P300 x0dp0 \0 0N/ 8 ሂ000 0@(iug 7@-@P J0Lo SϜ 0 孑 Ѝ0@-@$@0P@@-@A0P@@-@ gJ0S 00S0?  偑Ѝ p@-@PGP ({0/Sp+p@+#8Q@-c@-<40 0,0,0(0(0$00 0jg]nC&7p 7@-P @JP00S\ 0 6 Ѝ0p@-@ PX0 0(pPPP(&Pfp@qJ(1O-@H pH 8444f Rp60pGWQq 2@FPl8ljjjjjjjjjjjjjldjlljjjjmjjjjjjojojp,pjjpjjjjjjjjlpllljjljm jjm,jjm8olpp p8pjpTpp40S = 4 40S 4 0<007aE08:h$0000000D30@90;g)P&04P 0I 0(80@008 0zPP^0       +  @   ' B ,# R#  # R" , @ ( "  )            %z20  xz0$000 Tz0 000 0 z0$800  y0<:00 y08:00 y0@900 y0,000 |y000000z0909Rf01r`0$000 0 0tS0,0wL0 0xE00007000+040 E Ѝ%P%`-M&0|((( ,1( >C#-7BH%dA-RMMI>0PC@P@(0L AH`q儁( `L0bpG0KSh0  R < (Lh0+)&d0 6( h0N/@  PP ` p,P.`0TP P T0g0\ $00X 00@00\0|00x00t0 0p00l00d0fRݍЍ @( xp@-@P᳤P (0/Sp))p@%)#8Q R R @-ʎ/0@-@MP`p 0`000 bPPЍ0P0 0 0a0 `0P s@-0`08/00@P `P0 UЍps@-`P@x00!  PT0 0R0S PU @a@_ 0]fЍp(X Œ(002P0/0S" -CM001010 000000 0 0P 4I, (1f-H00Cߍo/ ŚkO-MpP8@@`p+ p D0 $00 00<0040D0(P080,0|0PF0<0lP<0< Dp PH00Ѝ0S R@ e(Xts ŦO-$MP 0Ep@` PPW V0<00$Ѝ 03/ Y0p P$ 0P-: Pp ` @P LH03/pPE0 0Q pW@ P  EQ Q Pp `0  |e ůA-PMM`p/"G P@1L# N4AcD0@@ 0@00 0p@/pPߍPHڀ@T ,(\G-P[ 0M@@0P` :0P`Pr'U  00X 0 P  8]'0, 0pp00S0 W0S00S0 p p`  oP 00P0S`0vD0D00W 0 0000P0P0Ѝ 000<0( @((\--0M 00H0 @-P (峌ᇐ zg 6ЍKX@-{ OeIbq&7pO-P@M$  0@0p 0@"b0"@0@ "Np20a0CS g@P}H|||||}`}x}|||}|~0p00@0p O! 0 vPBv (P g0S Q |$  dKz \!! 8P E0S Q   -z ' ⧎p l+}?_p t 0[4S08pS @p @Ѝ?B-M-M&0| Ÿ%TY@-MMCN@800 0@(00 0n^p 宋 0 c"c!c(; P(0lc,6: P ,0Tc0LcލЍ4c(c ,Jh<Z7@-@P HD0Lo SϜ 0 ` Ѝ0@-@90P@@-@Y;0P@@-@ D0S 00S0?  4Ѝ p@-@PP (.0/Spp%p@l%#8Q0/p/p@-P@ၶ $( $(0XRX0X00\00`0ddhhllppttpp@-@ P =:7DD1@@+HH%LLPPTTXX\~`\`0p Qp` P0@ S p@-0@"!Rc0p@-@PpA-0@PJ04S->C۵->C?Xʵ9>:>Cŵ?n:>CF 0? AC>᷵}C>GᲵmF᮵EnF᪵E~G঵X J.X R  $$((,S>,ᆵ}S>GၵmF}HHLLPPTTXX\\O-@  $$((,0,0 P0PQȡ\5 S L5sT 0K TTpXX\\``ddh~h`lzlpwptttxqx1[ hpeb`0 `$Q*\5 S p0S&P%@ PSزK 0CA0Q R,2.0) T U0+P0sC@p/0@-@R 8< M4 M0`! @SP ۍЍ+000 400 0  0  0 0 0004 QP S<#0#$0 2"8<"4"rb ##̠#4rb2"LABLQA- brs@  @ PP1+\#j0A0 0 00L B 00 00 00000u0#$ 0 AA',"'("&8'$"2&,&42r"bJ 40ЍG0S/!  O-,Mp0`PTXPk $ "$ 0P. @T 0 [bP BPG@U   Pxp@ @ @ @g@p \0TU @ T0 0D dS1R #"P  T8 DR0UQUDTP 0  @@@0X R    0M"Z0 p00 S   T?",Ѝ0 00 $0 v( @-@ PU xx`pp0h`SPP\@Lp0Sq]D0D,q`  j`@(<&7p p}00S/@-U](0/s@-P0@0S 00S Ѝp@F0001!Ѝp@[l0`1#ā0P0=V wRB 0$s_"!]Ѝp(( (((l(tR/s@-@00S#000S 0 Ѝp@$?.ă\0P`=V AB 0$=_$\Ѝp( ((((l(tA-Po10MSP8MU`aO0@OS@ 0 402#0, p!?P0< ??. U00S1UN@@D 0ݍ8ЍA0*Gx0 R `\ : V 001ԕ0*jݍ8Ѝ( (t(((X 0O-C ` d 0A axS0 <0S  0Ds0S 80  B  R\ ?0!.0S   d 0A a 0< 0$ R$  B ,0X0: 0Pm^ p 0ἠ/<#\P2[ 0  ?>#‚ 0Px0 `0報 C c à01d0 P CS cQ0@D@ @00C030S300C00  0#0030 #300020SNd 0A0 a/5 0 ST0T00  B 0Pu SX00԰W,ڨ0d0? 0 0A0 a5 /v0 qϠ Ϡ,,3 0`Ϡ ,0/X00C000 \qS T10S   d 0A a 0<'0! 20Z7]V40A{8 0 B0 080 $0C  $@$  $ 40040 08 R R` /  1> ( (t( U9&7p%hp@-P   @ 8@00Sp0?0 00Sp0?0p(%hd0p@-0@SklP 00000B0F0p(dO-MMℵp,@ `51n_R0PPCSyq451uWW@ ?F 0SB ?2?F4$Q/NFp؍ߍ @D@Œ@2L 0@?DKd04 0BT0 0 SC0ISyq$411WV@/0p22220B'oF0k?0 0 40 @DŒ@ @0L0 @?DdK40 0L l104 @0#p R0Cs000 2s00Vp`20S7w 2࢟ 0 000p0u   `  >Z XZ0 ``a , 2\0Q0@/,040<010(08? 0$UQ `@0 0D@ő L00 /4;0VV 0@d0 0o 0  1r 0aW Vp`| 0"/\0X0`0d01{0?{{{{(0, ` D@őL0 0/4;$! 80pW:,0 0  0 'X(((( (X(lP@P`P @42 P@  4(pU 3Ep@ d3T@  =SPp * =P tC(0S0,5 Sx0<0(5002 0,%S0022Q04Ze 0Q Z]xx" 0 04 0A XYO 040A 8YF 0 4QY= 00 Q*Y4 00Q(Y+ 004 QY"1 p00W00G-\3Sr1\s庐XX\1X0SHY X0SS0$50 40bH00aL00BϠ<50A8ŀϠ@ŀD50\P00\T0R380^S`R001Y p4{P 0d0 a 31 Q$ (l(d%l%p#J(4(@}+V(8(‘©(XT<(Hg(t%hT(D%t(0(<(P0RC00#!3x000<44$0<0t D0p@p#0|00pXsL5P5 P4H 0/8@`D0/ p?`Gtt00F,o! L ϧ !>  <4 04%8$SX+22 p<4800x 0 08`S¯PN @NP@0? 0 0P@YQQ* 0 /X@QP(5#R0:.P@0$- 00Z00 1`%"0 ?001>0Z`0 c2# S,[!Q [300 !1 00^00CC Q`0?#"4 0/V`1V`#T0`10F 0I  0/ B@TP 0ἐ둈! 00B1  BZ1 ` Y"B !!0 R0C1I C0/ 0`둈!0  B!Zӡ!` S1B0 S W@u @P`x1p F0<48ĔCP`0S8Ą<4-0$5BPS,`QɑRBDL0 0 0000|60S|0` ?H4L04P@0 @6lp;' RKp00R  QDP7\5?>C00!#4t x0Yt7 8!"T a31< A202!0 0P@ 04 `  0L$4  E$ ( B, D%LV.  R*h 0(b < <( X D( \ L( ?.@Xd@+@B@A.@B -< He `劚 @40K `0 ,p B A YZQ !0 XZ R  ŵ{A/ 8pW $?. t{ 0Ąß Rï<0\@D$44 0L4( 0ĀpH2 R 5#< 5,23lr0S* 됺 z'z'zz {' 000d0 CSQ c6Rc(;R`V @ z犸 z'(Ȋ0 (08圍;R,tV 0  R0:1P000\tP2#00@Q@0 0Jp00 R00J&$0 0Sc@ SbV QQ0 뀠@t9 j0JF 0qK0`0S>(TF^Å(X x(`-&6@th&7Y(dĨT( UP /T( ((t%h(($ 8(( `00S^ 0 #$A $0+V. 00S  0=S,0S$0S0$0! , 0 B2\,,^   00/d A! a,3 1 !dU$1H pp?QPP04SP0 0R0 S00C0 S 0,030P0B 0,0STѹ p开<ȿ 0ᘥ+" 8 Q \%p#R!0@ (0 0 @DU`@4At20 @R40 `0```0T00<(s 0 ` pL3$,X0`0 I9pQ㸐 P#(x0t0 Sx0x0 B\0X1`01Q0C00h0`0lR#00B1 d0R*,%u U0   (0 0C0D(0( 0 R R` ` + 0$5S  l01` p0000S3dv0%ST0T00! !04%SP5X0`0`P5S00d0 0    00J00080` o@Q 㫋+H0H (qP+HS 㚋H000-ᴰR㰱 ,  BU 00o0000T0 10X0岑0; R\ ?0  0  B  R\ ?0   00C 0 080 C  C 4400CS ~T00C@ 0`w`d4  80Q~T:  $5SʨG $`$`(0wV0S ,4  d,04  0,4 $ 00`  Vj0S   0帀0 X#` x0x 0X\%Ϡ  R     d 0L  l!1v L9\%R Xi0SP.pi\`/ `ƌ$  $ m0`S` 0$5S  l01` 0000S1d-04*ST0T00! !0X*SP5X  ``S 0d먐     000080@&0C 400400T%*$ Q`?0@$00$0l0`0@hppT:S $S0ppS $S00S0`@Rl倐H)ꄖP00@8p`0x1塿@pY70IX!@@jl00@0T: 0 @%A$\Q  @08( 0x 0( Od@ 0LLC l 01sp0SH=0S0 000S.R08C|M = R0/5,\%R    0 d0/ @ `.3,0 $ R0000S0S 0,00C0S0 X>0S lR0S DR>0S 0z 7R00|:x*,8gP>0ScN C>`>?.0S003040 4004 pCVW*DNzV.JP\oV.GV0S  ?0 PS?\5=S,??^0E/׽0 0S 04  dHLĒ 0A a04 <,$0S0S 04 d ,04 0\M 04WM)ݍЍSmfG-`RM@Xr .zPP dyP`T `P P8  ,PMp 0S  1ߍ<08 0(0`0,0 000040!04 04$0D0(0P VW[  'MpU p!Mp* dy`e$` 8 F < 0C $? ;  7 0,010 - # Lp 4`?`a8SڼkPb 0  00*0P0 f 0 *0 h@dAdeh6@dzh hNhh_hqhhhA-PMPp`;@ hjp@P  P03P?KU 02 " ݍp@-@PݎP (y0/SpSp@O#8QR/xG-P $` 0pᑼV@`0 ㊼@`` V`@&!D( `G-@P4S p`~X30剑zuP| | 0 0! ##P 0p`/Ѝ_ uP : F^ :^Fp@-@P`    pp@-`P@ ((UX0 3?X0pA-$P0 U PP(`,0@4p*^ :^ *^*X@O-4MX0p0\00``PB0 0,v, 0Q% P 0 1xmQ;aQMQAQBA0|bA Q$SQU @  DT dR$0 9Q"P T U8$0UQUDT P 0 sQ @ @ @U  @@@ X 00 ` w0S000 00  0$04Ѝv @-,@ (oPcM&7p Ȍ0/p/p@-P@    pO-@0p CPp`G0 00000ZI00SB_: W `B?F ᴐ(($P0  /PPP\!1cQ\ P/p@-XPL0(FS 6@0 d0 P 60@\0 <@p(0P  C @- /w co`/ Dŕs@-@PH` 008-V  P@wЍp(( JŰs@-@X00SPH0`ă5#40<h-V  P@vЍp((( Oh10 PS/C-TQ@@MPM`6`@f$q `!`0 P08 0 T:@6S/O@ ֻ DD6ۍЍC 0+0 R  Q\ Q 0`;Pd% 0+ۍЍ((((( TO-BM p`-PPp"p|v F (0< 06# R 0 "fv0 40C 0 !Rv00060 &806 0@p00C0(0&V :D!Pp``Vp ̹03 r(o$6/役 6   C c1 0 &$6/ᨹ `V&L0S% 0: S$0$ ` SB0d  &ЍOC/6X( ˨<Z%A-a00S FT:p,PP  0 0A1S0S/ P @D A01 S  u0S @21060&.06@p  p 00C 00( ˭~O-@PGM@XH``?P>U㰐Y  0@00D @/60d& 6F H  T4> S`$u h3 XRQ 0@H0儹̭0D~ 0 R (cR 5-0 (0n0Dp9 i0U C 0 fP0  0 00CR0 00,0 O  (KpFD0L0 06 0 66< 01200UD  ,000$P`%($0\ $(p,,|<d0c0@LP HG 0T0;0Lh5*L0Sf h9*;PU FPZ   L f[ $ ' \p$  0A! \ 11 C V0Eθ0%QPffC0CP!Pp\p : 2+PP0  ڼ 0 0d00,0\0000<402802@p$0 0Cs0<000C(00SE4 0 /)$Q@-$ Q:ͪ͘O--@yMMh J)`0#20t00@00D00400L00X000 0<0$0H0(0T02000040080(03h0<080404d04`0F0|0G0\0H0040P0050P?0(0 SR 8:T0S PT/X0L 0H0, S$0>i/0>p @X0L 0S @I >P $s0 @;a =ePP#\#>p "@P ($WH0aS 1XL : SRQp9   {_@P@0j V@r@DOoB@b } |f_P pY00S  wP@  plP 3m`PUb$0 p00D0Ҭ$PQ @ 80S}0t S 10S10S00S11021x0 0180SK0 RS00 R0 R0S= /|P; 0@S 00 T^X0Si 1Sf 1Sc 0 㠯1C0S [  [ *0SR3#:\00<0S @!0S NP@ T <0 0P U8 PDJp8ǰP@@0111e000W0`S`St0S4X0L 0H =0 0Mp+ p`PlC0S)7p3 p1S?V?`#)+p' a 1Sp)!p Q1SAf1S Y>p( r 2"OKK@0DP?`|KL0OKX0K@L0 0Z0T0Q0S<P[# [ [ F [h0S h480S h0S`0d 000@0D0 *d0S %`0S  T*,800S0 [0S0S"  0C 0T 0#Sx{g0S0\0S S <k(0S ( 0C(00\00h0S0x0  |0S|010S1d0S 1`0S$140S /$40P$0&9:B9]0P$0 $<pl$ > P1: SRb0-V000S(dR0$0S00[X1` 00PV`5U0,00A,0Y ,`'Hڮ넵U pѮ 0 pSf:YfƮ,0p`uU ?ⶮ 0`SM: !DR&0S $1 S+40$00l000 [ 0R5 R4*P !RP5P"S4U  R$1SPP$Q$1t SR U HSRQ SP" 00S<0 XP3P%P5 0CP0L쐝Y [  0DA0P,00pP1+!`G00b#02b#b& 0X 0S쀍 [( Y&: [,0"P!,"00 S :0㈀ 0[,0P!(",0"P!0 Y` ,00 0!030q W5o:0+a&0G 00+10000 [\Q [PQRU10A+!0 ǭY0 0@c&0p0 +1άG0A 0岭0S1!YV*<͹' ;L.S6Wy&><Ό˜Ψe9vϜoFПо/?Itіѹ PSҍқҷҿ &0&7p)$Bfffg pU[RRaArrAa [0 [00S 0( S00R 0( p  [0 [00 bU*3!A$$1QR0X@@Q5?01SU001 [0XS 03 !p515@000 ,0x@P0S r@0S0 k@1L0f@Y `@1X0 1X\0\ 0W@1?Q0 8P@Y!LJ@PH@,r \b\RQ@@l>@$Q9@ ?H0S yލЍS03150p5 [1 1Sx0 ] #>H02;`PP hHW;#>Cj;Y18800 8,02#|H0凱 [00H <0(0$4s0`0,0#4s0d0P0#4s0h00#4s0p0)4s0x0X0#4s0|0\0#4s00@0$0Q $$   T  00D4Q0T0(0 S \40S d( B(0 0 0b@0$040S& ["$q4 0W0W03 W00S pZ$lp0S  l9p T  $< p 1Z [$1l C/oS" R `0 @ 0 0 0,0 [0d00000P00h0000p00L00x00X00|00\0000000 013?$00(013?,0 100#410$120#430)001t 02@100 0$2?@1c4 04v 08#$0 #(#< 0 0'9> 9>Q T0Q40S0000o0 00 R  ST T'?  8p@ TU z !R R S 0 S7071011H0, RZ*8JګQL0 [0 0+ S  R   0S* 0H0< 0J?oR20S ?(0 00 25 0?10 0P B24 0?180Sn0   k B*{@-S-j@ 8 / Ae@00@- 44@4P\P 0B"" )(@-'B=)P@-, ?;Ә&7pG-`@ P p00yP U0 0  { P@ G軛 0P`0 , 0Pf R 4f U   )(-M=Vs@-pP@ 0  L9X 0TT=LЍp @ P `<90 =)(.)8p@-0S 0  = Ѝx.@-@p$M0 0S ` P1 00P 0! 0=))=1 l=8\=8L=@DpQUVPE:$Ѝ=ԀԾ10@-4M@ 0P0S Q 0  R0  2  0$4Ѝ0@Z=R  #  0$R 0S 0S  0!( 4Ѝ0@1=4Ѝ0)(@U @-7p'e)PfD@-0 L@ R0* 4s# p)HP `00CS`0p S00 P0S X0X /XH>&6p@-`@P8!R#<10 <10 .810CS81V <1S 0 <1l0 hd`0ƮPp <10C <1$0 810S81)(%&7&7p)h0@--@4MT <A`<d<hQ <`"R d2RK< P<d2SA = hk0:{PPS['ΞkHk?[E{7<1 = ># * + (;R  PPPg< 0 @@@ ! zj{ k{[;R[M<4Ѝ00B:k{{'*k{h;R?< ?@@?6C-@Y)Հ)(՝ն%))Ko@-㮭i0d2S9)(@0@-0S0@d2S嘭`2"R2%)(0@-@ 081<*@*,*t&7p噙A-@P`pm P0 SR 0S0B0Q3 00@0   *@*,*t*P 00CS0 S00 P0S 0 /O:&6A-P@pP  pSPd¤`ῤ`V :<<60/SA0 R0S /Q C0p R@ `/RR FR .R@` FRSP @D T0t/S`0 /R/\ MP&7p0O-cMM00@00<+0< 0<0<00} BP 0S~0,3,00,30S3S0>PXl\O P|P 9H 匜 00 3 S %@@ 0T S S00 0K#=PCAP0S+K K_40S3/S9+K &K @0 R@PH[K>D 08t,  t  t  0S (8xS`S)?S DS . x000Sz*P0C 7K+ C (K0C+ o00CS00Ra0CS/.001`..1...2...78.8..8\88D ⌣  RPK @0P* 0A0 9 90Sx9 00K  K F f 8 zRPK 0 V PK. +8K  I  ]RPpK P 0K. 80  / p CR@PV P80S 7    +RP>8(<08808407007,07(07$07 0707070707 070707077   QPK  PP ,70St'0 0C!0R3z T70S0Ss K 2 @P PQKh ?⺢PK ⶢt0@Pp] K> 0 p媢t`@@hP0V#T00  HT\HX0Qt0pW p`R000QSL00D0Q3DD0@m0 `X\0X0S 0PV)PP PP K 0P@0 K. .7K>x%x 0 6 `@씟D@pP @ VG| L 0S$0 0C!0R3 0S0S 0`0VP `0PP c=0,C 0  R+ .t 6 ␓0  d0d0`@ 4֖L Rp 1 1 S 01 \Q \HHB/p@!bK L0 S1P00P0P D0S( X3 R  h6  X   `H0 S   \0T0 S `,@0SJ @DUYF  ╡  PP0S|& x 1 ⃡ ` PPcݍЍ v4  p  PPPA0S, P  \  pPP O  cPPv C x WPPPj@d0SXTc000+ O[) H'\$'***x*\&7p h#[ 0 ?1*X%<<@m3okH=7*,w(3Ji ,Npd*t*@fffg" * M)1" ).4H@-<00iS03S !>KP2*0*l0@-h@   LO @0J 0E @**@-@`| |0 P0D!0PUR3P T0p0S @0R<< 0,$p]5 Ѝ*t%8*@:&7C-P`@!@1 0E!YR!tM@p  10S 95 tЍ000iS00S 00S d `P 4W @ 0  P + mP000 p 0pi W@000*t%8*,&7*0*@%<` @-@X 0C @T!0R3@ 0P   0S %8*tO-xQ0S ll'T @P 0S @D@a@qP0 0@0C!R! 1S1 < T`PpԀܐ 0U0(' @P 0E!0R3x0S   40Se @TP`3# 00 @$ *@&7 *p*t*h*,*O-M 0% 0Cq0WsP88 P p Pp0  @P ``G FRAB|BdDAA@C@ [ R  R  R* T Y   ```_ @$ R 3  4 V 00030S3Ѝ  R  R  `& "  V P \Y F 0 F X@00020S 3`%0 3X0000  000S 0``3 0  0@0020S `0 Ya  k 00 0 X@V0000Sp X     Rd @ 0 0 8T R$q0S 1 @T 0 @g 0 @$ 0 @Wh00S 0 tL} 0 `D&30 D$3*t+*,C&7Egt&7p*(p1G-0S ``[`@TqT 0T0 :@18a P8qU @T+$PtP@`0S 0D !0R3 PȐ尠U 0S 0S   2'P0S0S \0S  2@*@&7`*h*,*z*tꘔ0A-0S P `p @T V @\PT$@ 0S$p$00a`@*@&7*O-!1 RR0娑S @Pq倡 0 P0: ЍS DP`P 0 #^ C2000] @QP:RS  0.2n Q yq`P0p[0 o000%`000*0*@*x&7**h "2&7pIj(2O-0S I0b0- 7f 1QpԡP@p0Q00]: 0Q0 *@@ > 0X0: 0R0*0 S( -0 R S  T0:X00#03RQ00S !Pq 0000 S  Ph] \ X}1000P@ Ѝ*@&7**h*x+2&7pC-MM@P Q 0S 0 iJ000@T0S p@ 0T0:ۍЍ`PP@p0 C Y ;  000PU/ *@&7*h0A-0S ^`P　p 0U0(@TP`0  RF000S ,@*@&7*hA-p`P@P 0Xp0S 0X0 0C?oR20S ,DoS 0&7p(p@-? @Pᛛ$ Pp0 SRp*@-80S$0$ 0 00-=*a&7pA-@0`0/0000 SPڤ/0>+b T0 P<eP0? 4 00?** %F0@-@0 0&0AЍs@-@P`P @TZ TTA0 ?0 0/ +"+R  + )Ѝp&7p$0L<S/ @-P* %F@-<p)p @,eP|)0@0%F O-2@`pVCMy Qp@0DWCߍ`TV B/  0R ?s0 0  U@\1P0 S8Q 0S>(h X:0000[3*0S 0 0S  0 000R*Q /0S x`WQ0/3?0 S 00000S  `*$*&7 $*݀*@O-X3p0]MS DD@c@C 800#0R.00RS #0G.mp"& @ZRPP "Va/W 0"+.00RS[ 0" .xmph"lLZPP"L  PpDDB@@r0PSY : SVH`P؀? !aL<S $ 8 <8  @ ( D `  P  `\  T  ؂X  HڐP ,@ .8!88hN/0>+b  P<P P d0?0H @P ZPPD  .L P ZP1Q|]ߍ*@&7L*`**0k%Fx* %F H' **qXPQh*ż-&7p%F>@- @ 00: S*G-@q `0S+'P 00S P0 S00P R HRڀ00S |pL. Y \⟚P Y00:$00S $4.*h*,&7p]v H'O-AMM`P@opP8 0 840 AލЍO/0 009/P6 0p!p , -`Q D D @P <UPD {@P@ - - -=PD c@D }`ḰTAލЍA> B   R ; 0 0t-D G@D a`4 l 0  D ` ** M&7p A-MM 00 /R @`㨀pHPP 0S P@ۍЍ0 D /ᣘ`D @P 0V GP` H'* p@-0@ @P BP @ p@-@&@ O-3tM0 S ppl00RS\3 P3P#0L%,HC4#S<88tЍO, C-$PL  qL  "-+-p0@`00&آزL<` ,L\0@ K [WI < h`VV#W  E @Pp bL<0@'pm0PxSiSbP 0'0@$ 000 C,L<0@  j ` `T|L XtЍ0 0C0\10S 0`S$0` S\\&X\&h0SS   5850S d00X00%90P!Td0 <t,d2&*@&7**0*`*%F%FQ&7pgj* *4*81*X De~A-MpM`@PP 0ppd!d%@P TT8,L巏~Y< 0/,ۍЍ aD D< %pPU%% U`k a%p0P ,P+ x,(0S *%p T0TP 8 +78 [E&7p* *4*@-&P@-L@4#S 0   p&0#S0 x @f&%F0A-@P` 0 Q0: 0xtp0/ᗖ @$aL00S$`@pV0 SR$`*h**,  0S 0 0/ R  /0S0 h p@-0 @Q0P*H`0/Y Pp0 TUp$/p*h*0p@-P@ 0 Q0: 0|$x`0/3!1S 0p@D $P\P@@p$ 0*h<*YA-PM@T 0``p/VVP   kP @T@ۍVP @p@-/PᲞ@P@p00/00@P 0S sA-P/p\0@oC 0T@@DXU pDP@D*G-pP`04PSp @P`0PP0C0 T`4 $ D@**HG-頁P6pS` @Ptf0&(0C0T%Q&F( $06|00vPPEPP Eፕ @$  (@/ z 00 @ pP`0` P0@0 P $ **H@-@O00$D *0@-S@ \0S 0S S 0S M0 PDA T` R 2bD0&F$ ЀP 0S00-@]y*p@-@`PP0S = 0P0 @/xPL0P 0 0s00pO-2lM0pS 2YIp)PP  X T)Lj0`000@0 Q 0*`  0R 0?*A0 Sg @018 $1 %1 00`080$0AS@ ЍH0 D"P ( '%@*x*&7pz%Hmp/0/@-x 0 RS T0R H0P88'Ѝ Q *I*&7pA-D@p 0 0SP(i ` `~ `*L0@-  Q0 0P ,0v'p$ Ѝ(**&7p@-0xP 00S@%*S` P@` 40P , $  0L'Ѝp**7&7p 0@-0@S 0$P B5/x0 RP`P0pqH0P@`oJ 0 ((@'$ Ѝ*(**4*k&7pp@-hPh@4S 0SP LLR&H0H P0000$R0p4/***h*d0s@-0@SP  40B3/p00S\0  pH0P`@0 ((`&#Ѝp*(**4*&7pp@-P,@P@pP @ p@-X0XP0SpH`@P IP  #@p* %H*&7pA-P 1 a051q0S :pK@P 00PP'p#͒P&P 0a&ltt&P~T 0HS&000@A(* **\*&6jѾD F*lC-`aM! XL H4& F 08! X (A((&08!Q 讟 0"P&/&X, , X  & F 0`  X %8#`Rp000F"%t F%dC00@ L9MЍ*n&7X*c&7p*8m~*O-鼣@0EMSP8a  %0 @ሳ00T*0 ?o2Q03S P30S D3 T@#@ $%0S Eߍ0S 00p0"$0S 0"p! 0%V- V V:   B B B 0 0l"p0S0S P 0đP 0- 8徑PZ 0SF B  B B B 0 0c!  B B B 0 0U!V! V V     \!Sq*\ Z&Q%Hz* *,&7*`*P#**dPHiO-C匃5)S+0`V3pRXie0S, q 0PS, 9RP=0S c U)5=0+5 %+ z909909 Ѝ02 <?oW20SPR P `FVpZZ4 P0P5 +"+REUYQ! R  "E5U9 1 R, R" R# 10S&HP"T10S 8`0S6P!90\,P $" "0 { R  P l" t 0/6pq;#;S <%1B+XnyH** *,&7%H*@&7p**DM*x 4*ـp@- 7@0MS&6PP iP P ۍpV0S60S p00UP 60Sf KHE B ?<960htht0)04&48#8< <HHLLttt xx|]|t9^EtE~t:^EztET0AS| @ c Pn 4PD PgpT0Sd40S XXۿ00 40((,,TTXX\\``+J0 #  1 0002#22 02 0 (0#/",0H0T0d/%X0/&`0,0i20q000%60, (0x2-02R0J "S " .x30=00 2R 00#| # #/%80/&0 %0L0<040h00S! #3  x l1S 0ST! Ha! AQ 9-0CS    R0 R R 0N\ \0Xx0=0- 90 n*$lT**@&7fk*, 1(&7p%H c TAC-,2,B P000000 MRbM0S q=0= P 0RP 0AS_P=0p㄁0W`lq P 0RP 0!=0=0S p20000000H00%"4080&"<0<0%#L0@0h0D0"$ 0 @-Rڌ0=ۍЍt0 h0P0`0\0S H,@(**T***`*#&7p*h{O-AM0J(0 "S $`;q (CA#͡ 5/0(0#S00 #0Q0У0d[ (0S $<(0C5/0(0,0S3,0P0?0!#0,0@ (P Aۍ<ЍP(0S  ;q( AC#͡5/0(0;q ;#͡$ 0$0  BRʠ0@SP (0S 1 P@0S& 0$00S  B0S 8#S 0SR 00S \0l 9P tlx3  P8P0S*T'**#%H**,C&7^ 0 *qX@-@0SS*0O-wM< 00 0 80 4 @؂ P 0 @00L0@0HP0D``PP:P S  S  S;  S 0 PPyp SK  S"  S,60S  i60S  6v0S-Pz 050S  HЍ50S P 0 p<50S  ,,- 000 %p\0S40S  40S  P 0 8C'@' V0 00T40S 0 < ~30S  30S30S q0/P  0? ssV 0 8&&H30S_ H [D 0 .(#p0 0020S  20S8x20S " P 0 ''V 0 8&&20S 0 o"p0 00r 10S 403/ !LhV00 0NT10S00S 0 800S 0 o4\  03/`V 4   00` *&7p*@&7*<*4*%<qs$s|**8,E PYqXiz*(*t|u A-1, 0  S !@ 1 1R 4S8 !4|q04@0t\a00S/ P0S  R+* RS-RP- !0 010  QP 0PU 0$N R%P ЍPC/0P;C0P|90S050 000 0 @ 00 0**T'**h@-|cM0S ll区hChS0S Y^PqL0#0,,! R0n 2r  0500K Pr5"0C590C990C9000Ph|n xC0S \2d"`2Q090 9*,"@*t*p-@-  A. ЍЍ/&7px07@-0@SP P jE0 << Ѝ0000S 0  Ѝ0@ *4o&7p*@&7|0p@-P@U0  P B 0<<p000SP *4&7p*@&7p@-P@T` 0T0:pVP 0S 0@P*hp@-P@T0*p>P 0S 0@TP0@-@  Y0  xhS0 dPM0 P8G0 < A0@ (; *ݐ*ݑp@-P@P @0 4 0D !0R3 cp*t&7pA-Pp` U}00CS0Fp@ T 00CS0F P yTnTyDo0 @00  0 0 S&7p*\9-@- T .-L00S @P@0P Ѝ@Ѝ/&7p*D>'R7@-P@00S#|P B0  Ѝ0R00SP-0 l`X00SD 0@P<$00S $ *4?&7pp*@1&7:@-@   P   P  P  h$P l H\0QX X ( H~@0R&7p'#Z@Pc0@-@MPPPP8  P$0$ $?Ѝ0Pn~*@-0@ M \0 00U  k[H ۍp@-0@S g9t0P0SdP 0@00^9 p@044 000Sp p@*4&7p*@&7A-/`z@Pp/@DЍ/SpPP B 0  EP0000S@-0@S  0S 0 000h0@0S P @044000S @*4&7p*@&7@-0@S 0 000d0@0S 7P։ @000,00S @|(*4&7p*@?&7@-0@S 0 000d0@0S P @000W,00S @NO*4g&7p*@&7C-0M.S`p4P4A0/SS 勶0  0+U ! {  u         p  xX  d -00@ <D?Ѝ*8P5j@-)?A-@P`App` "P L?0 S000ЍU00*'Pp@-BM @P`0E CR V  hP0FS \0 BލpAS ᷂P0P S00@ M>k*eA-P@`ᝂ<0 pᕂW >A*@-1 BP> 2 0S5P  P>01PP `@yPP 001F0S8 0 00T1T00' `V!010a0,Q5 S:; S0,PP!00P  0 0 P 0 Ѝp r _S-S x`0 00bP0;C*1ں&><** 0@-CM@P0,  0  ?Cߍ0*@- @ R300*@-$M0h `  P!@PPDp$ЍPU D0P =*p@- M0P@H  h ᣁ4`   Ѝp* ?-\M0 PM  \ЍnQ -CM0( ; Cߍ/p@-`P᫩0 R  @  0!S TP~= .80 T0 D00o d10p*p@-P@U U  0<\ $Up@y  &7P 7P P / //*-M M? 0-6ۍ Ѝ&74`00CS`0 XsX0 X /&6O-pQDMDЍODy@x `lP !W200 u00020PS00C00@@ Rp@T3 W+X( U U L   ዅ  ҅!0. j   {  ….0X M  p8I p W&7A * '.*尤3<0S/@-@QPM PЍ@ p31Q``X00CSpppppp0l((("m0PЍ@L a!0S SL   Qd0AS&HB 0S0PЍ@$ 1 + ' #01hS fS501 0400030020j0CS PЍ@=01 (0<00$0;0d 0:0090080070060 0500400300201jS$ $Q Q !, xVPЍ*N yP  9 f6 6  ј :O-@`pR X1L0 S p   ЍO>3I/00  P*(Ip`-P `V6!P5 00 i P IpP P X L0S` Py : P ЍHp` X- ~9*%p@-P(@P ~Pp@%l0S $  R R  0@-  *@- (0 0 0 0 0DЍ    P P P1   ! @-(M0@ #\S@3@#:@ (Ѝ  ҄ +7@-P|  V@P .sPP @ ~PQE ,n Ѝ0**0@-QPM @T 0d@Oo@' T%<%(Tr + oU  @ @%<b P Q ,NnЍ0U P Q%Tq @ 0>u  @4 9* < 6 3 Q@-.@h0 \!@@QR  0* ҄*0s@- @R`  +P.rP ,m0S ,m|Ѝp l0!PU U 0< 4Ѝp@!Ѝp@% ** B@-@T T 0( ( ЍЍ@,Ѝ@ J*"!Q p@-@P T p@<  p@0 p@.=O-@"PTMA@ p` @@0@$(@BlP P媝TЍPP7 @@0+lPt@ᔝlT:TЍO0 EW y R@x   ;y0P ayL  ,\100 0 S00C00  Q,4P `0 m0 0`g M` `tX`00CS`0 X0@X0 X  T c%  {&6@-00C Ѝ@-0  ; ЍO-@p P7 aTAD -QP  P PPP@D`FRPP00SP Ѝ @-@0 0 0 Ѝ@?@-   &7p@-K @-QAM`p0V@ M0dl*aXQX!0TLN0P 00 ,Aލ ЍP0001!! ?t0>B w!R  0GdqO@PC :  ::<T0 <E<@D@ \0D0X P@ DD*    PA* Ԭ^@--* 0@-6S & *@- xm/l`k@P" XBTA < <84+z, 2@h** @-  &7p0@-h@  0@ 0\0CS @C&><00S/p@-<FAC-@`Pp㬀嬐@"!0# U 0 Dpp p5 :P@T0S0(P    ЍS ZP_-,M3 808"40!00!,0 (0 $0$  d&7p-7@-`P @XT@  R 0@   000 Ѝ0@Ѝ/%0*p@-PP@ 0S 0CS 23 0 0pp@ hh 0 00Sp  0 0p~ Up**A- `(p 0CipЍ P 4@P  PP 0,ipЍAt01Sh0 `  0X2TpT 0` 0S e ` F P `5*%0 (PSA-Q@1(pS1S` W 1SQU(W1S WЍWx1x s QU , ЍA <1ЍA oW(^ QU0S) S S M}U   F  ;}U  5 WЍA/    '} U P"  DD  ЍA *%0 (&7 &Or`g4 0Q 000/ *%0pA-|AJM1MSh =`pjn0 `P| c40`0 !hp0S JލЍ;T P0z|A7J.H0 0A1$HpL  $`0P0p0 Php} Li0S8b1!0  *G-xAp1 `S1SP V1S \$V1S VG 1nV 0 j \ # GV] \\0  嘠EPe0SVGxH 1S B Q 1S :  05  G *&7%0 (1^A-a0 MSP@\0@sX 4 0 0 0 0P3A7/(%00D0 Jލ ЍXD  RH 1 H0y`pH0S# 0 0 @3S H  ] biP00 S5VP#n0 xxpn0 `Xp* .  m!l # 4 ]y h D Y# U ! b &7p O-pMM`;p.Rp P@@ p p p0Wp㼱0Z:Y0S ލЍ0 0Wk@P\ i@PLqLL?HhP  1pZuV㟉 1Z SP mZ.pZP mZ.20Sa00 0ZO0V9 Z-P m\Z.@)0T:Z^P tmZ. d| (Ade6!@*1~! @-0`0 0\PP 0@PT \P Ѝp@0(PP DЍp /O--tM< 8@40PP(tЍBM0P(0  (PC# U  兽T T T;P0t4tT$0gT6P0X4XT$01P0H4HT$00SZPTO(4TP$004 0S0R0S00 0 0 (0 @` 0 0@TF*3#03  0303P0T0P؋@(0P`,PY6*40S 0TS0[tDd  p 0` pt 0+X pl X `(m0P02R$0f 0BnS01 0<0S 08 S@ p?@0?D000S+ 竸z0相S 0P0/?f T08  GP/0 L /f?L 0H 'f {{'0{H 0s,00@ ,0 0D0 @ PBn| 001 00Xu p`?$ 0\`0 +4d p  0G$/$+4hU p X0 0T01 {{'0{0h `Pȟ 0 e` 0e $0pT @Y"e"""P"^"W""""i#1z""###CP#Z#0SQ0兤d4 00kS& Lp p4X p p+4` p}  0[ $+p4h pp h0` XPp ǟ 0ie 0ce$0`00[ 0 We$000$ T,0S0gd0kS㋤8 q 0pX p2 $``p+4 p'  0[ $h+ p4 p %@ %@{ {'{X0@0 T0 _%@ %@{ {'0[PpǏ 0 {d 0 d 0 dT0 @YP###@- k #&7pA-@`4Sp  P T0DPEE$UX fP00fP 0-80 P $ 3MDPE@D*L .p@-P@Q0  0 peP @0S \Z$Pp H[V0@ 0< 0p R$H$%+' $b+p$O+,+(+$$Z@-3400S (0 0 pp ,+'@+' ?*O-\M0 MS1 HpW-Q`@`((Q(0 5\+ 0=P 0 0 $ۍ Ѝ0 000nS ?S aS ppS qS x0  0 d00L0P0 8+'d+'H$u+' &6$+B\$&>8LL$$$A-X`0S L00S 08P8@p0Pp00+B\+'@+'d+'H@-@L0@?3@00SN',0, 0S00F'+'P+'$+'D+ӈ*C-RP`tM  ,,E P RQ ğE R`S c0t`FQ ğR   TDR 7 4* CR ` 0S $ Lah ,4\ P20@04ßQ [Q \QR $Q  0R0F p1 B!$QH lH RC pppDW_ R @T$P \P! P 0P P00^@\ 1Np$$ l  T\pH 0 P p00$0 R  x"DQ"00P" t 0Q "4F0S 0QX ]Q \QQ0 00DS000S+T`tЍp1A$^? l0HS pppDW\Q> $Q" 傀ಀ 0R8F p1 B!$Q, lH Q' DY  DR R DRڵQ0ӕ00,Q ]Q 0 $R l\p0 Q,Q ]Q B  DR Rm DRiڊ&><&>8+L+]+L+L+' %PA-@@P@T .@ P`p0Sl叕 d0 3@ P ,0< 8)(0@A% /+' ({|+p+,%A-@P@pP0`S00|0 R dQ R 0L 0S @!P@`T !+$+'x++%%+ʘ$O$ZP@-- 0 D+p%P@-- 0 8+p ZP@-- 0 ,+p&P@- - 0 0 +p+' +ʼ& P@- |- 0 0 +p+' +&+P@- j- 0 0 +p+' +&NP0p@-AM 00@0 0@SM- P1 PS" 0S00!C;P 0S0V>PP 0T00aS0` 00S0``0 C:PaS` 0` 0R`0 0@0S0@T@ @0 Q000S0_'Aލp+p&&~+ӄ&y&t&+x+tG-1MMP, 84 1ݍЍP0$C:P @4@0 PZ30S Scs 5@PQ x0 3@cs0S0S PU~\30S5 0P/ P30 043 0 $3$ 3Q0RQ300?o2&Q20S  2 0[P0002@0 0R R00 R ?P 02D"000 H 2 2QT100?o2& Qy10Su 1@P0001@h, Ze 0^PQ0S0T,PU Q 0S 0S0 0P+ 0! 0 00} 00QQ000?o2O&Q|00S  d0 0P000<0P+p&+B\ ,*+'$+'D+x+'`+t+ӄ&t&y+'d+'@+|&PC-p0JM M 00@0 0@S+ 1 @Jލ ЍS2 0S! 9P 0S0<PP T0  t1t p1 R0 0S0QY`% 41 0S (1(! P9PGY#P0͡ e0S @$00 R   R 0 'l00QN5pq T0SP00@ +p&+|+t+x+t+' &&+Ә7&0 0 0 0\+Ә&0 0 0 0R+Ә&C-KM MP + x2 Kލ ЍP0\"C8P @<2@82000(}`P 2 0S@2l. P0 "aQq0S 0S 00 3@P .`1@0S p5PH1 \0P 818!00,1 0&0S xP+ 00 000T   /o" 3'l0 Q00S 0@YP0 00`0@\+p&+B\+Ә'+t+' & ,*+'$+'D+h'+t+|+x&+'d&+'@7@-PAMM M* 0 @PP0 p` pF KP|0p 0pppp0+7POAލЍ0S 0 `X+pj+' '3' +Ә& 0P/rJP@-*0$ 00 /0+p+' 'N'W'bPp@-@P U?o20#pP `$P tP )p0U0P0 <0 @U,0 00RrJ+' 'r0@- 0'z+'L+pP@-) $0 00S/0,+p+'x+' '0@- 0'+++pPp@-1 R   1( @0PS 0 0S P q)0 0p`PPl@ \0 t LP D5P80 @0+ӌ+' rJ'+''/,+'|+p'0@- E 0(+'x+p0@- ; 0(!+++p@-(@(0 0 00S 0 +'|(7+p+ӌ0@- 0(D+'d+pP00P0SA- )0 !0ЍPAaq0S000+0S 0S1v000PP$P00P ,N8`0H L0<\04 +p+'+++' (\rJ*+'\(U(0@- 0(+'`+p0@- 0(+'t+pP00P0Sp@- (0!0pP@/`PP0 0  00S00P|0x0 0l Q40P T400?o2$ S0 +p+' ++++(rJ(P00P0@-S ?( 0 ЍP  6P 0;Pd00}S`00S T0T娏0H)P 40 0, 0( 0+p))K+'x+' ) )J+ʐ+h+d0p@-PP00009@Ppep dip@P p@'2@ 0S80 000f+p+,)R+h+' )c)|P00P0@-S ' L0 ЍP 4 5P 0 P 0+p&)+ʐ@-M P' D1 ЍP0! 5P @1@U+P0P`p 0@PB+0@0 S0 0S WP {P l0 Q 0S H0@AP000$0@+p&+B\ ,*)+'@+ʐ+'d@-PG' 0 ЍP 0S t 5P 0S0T=P0@7P ,0 $ 5P+p)))+ʐ)G-@`pFoᨂ@\P 10S 1ЍG舎Y(& 1 ЍYPq YP4Y! YUQR 8@P dPPPA @1 ЍG0`\,1PP(qPp6U@0 000l#T6U@ pV(PPP 0RP[`~5|0@0 L000 L0B# 80;#1a+t+' )+p)**)j*NA- MPx& 2 ЍPO0S!J4P 0 1C[P 00|S t7P 3P 0t[@h1d@* PHP!@4Q++++/ZA-p`Pj @Pd0 A\tP 00-4 0 RU A_+' /+'x/ A-PP   R ЍAP  R  B@0S00Ѝ@`p+p%0+' P/0A-p`P0 AP @PLp @AP 00 00+p+' //p@-X@PP D0 p<00Sp@,0,O0 0Pp+'x+p+t+' //p@-0@p@SP \0 pT00Sp@D0D/0P0,Pp+'x+p+t+' /0+00p@- @x@RP d0 p\ Rp@L0L P0 ,Pp +'x+p+t+' 080e0mO-MMPQ a 3 ٍЍP0 #C4+P S@p3`X 3 |v PP@)LKC0`t' P00S 0P @B0S000p@I2囄2@0SP$S \S0P0" 0   0  P#"00B   BR 0 D )bB0 =Q@0SPiR0PS 0 D)bB0)Q@P1O d1 0S x10SL1h`10S ,0800CS0. z B0 03/00S 0S 000CS0 S0  )tB00000i0 EX 0`S8 +p.M+A+-+' 1+`&><+'8+,+'D,=+'x+'<+'L@-@P .00P (00P"00 -d0lM T00S VD 0dQ P,00pp6+'P+'@1+' *-lMP00S uV@ 0d2 P(00ppq +'@1+' *A-@ZPP` p0 0Cs0SQ3  LPP 0 B RQP  00 0Cs0SP3 p@-`P@:FP  - 0S1PS !x-p@l,*`L)P %FP00 0,S!0R26u32p@-@P m00PU O TPp^00p@-`Pp@0P<&0 .0Sp 0h R001 Ѝ0 0S0C Br RQ"  ++2(P/0S/0@-@Q0%Q#0S P   R   07W0C20s07W  Br&>+ H>+H>H` +@>=0 00P$` Q(0 A `00+S>=0  0`0@@DcT@@0P/tUP0,00(S  Ya@p2p52 H'+'`22223++3"+'D+'h73)m+ʐ+p&7p3P' +'+'d'1$+'O-iM Mh8dLlOpt͍40,xHD@|0 >0PL0.600K/p% ,Am'@0j'4QDf'8aO?ⰐV=HLa少'TU01d 0S THPD Ϣd0sh0sl0sp0s0St0s tU 0S V|V?0S "'?0S0 /TP''T?0S 00SV( 0 _ 0 .<0S ~P' Vh<, n)0S ~OS)P$.d>`N 0 D)00 HPL /=0S-`= <`R*$` (`,`-0 RLP;0 00|S h,B0S;0s ÿJTM zL= ,= 妢XnP[,J=@;P0S00(  V L:+ 0S 00S ?0Px 0Su ^&pkK PPP 0S :SPQZKX :HGPPW xPx0SV x0SY ; 0 P{$P %AP  0`!U/1\1X1T100p `10T1S 0S \AT! 0S xGLP h 偡UV0 0f0S 00S P Pv%\K5I*+p005_05i5l55 H'5+'56E675P+'h+-+A6?+`+'8+'< |4++&666++W4666^6m6y++6'N'W74h4U67.7I7cSH77O%&><7x9D77777%788'8J8^8d9 88v81889&+'x9c9q9  {9 9++999:::3+ӌ+'B@*:@3:b+'|+'d+' :+Ӡ+Ә+'+'P? P[ 0*S0 ⓞP,P0-SL 凞0P($0C(0, S$0 0=0 0/R8 *R0 o`P<,000S' 1 0y5P 0, sT0LTsIP 010Ss|PP "PpP zP JrPBT}W GUmZg Z000YP TP P . "4GPY Y W_ hT U"5K/IR032 U 0S|,3 0vl#2S T$W $4Y0SK?00 T| W ؼռ3 |(˼~SKM|84 寝T0SJh4 0B ($0000Q$00S,0{s0Q 0 00& l50S0|057z<0vs,5<`,0 RQ ;0S50CKpG6d R$6$&$$J6R P PH6$F! 646`l0Əs l"0l0/@T? V  %P!PL0 0 夻 2 @R L0"0C?o2? L"0 "0A4嬺3000 R ;R <GP p000 R RT 0S?0S40?'"4 00#.0S ?0.T .͡@!͡!..S l0"R0.͡ 0#PP#PP0S0Sx80S#PP OB|(L 0 .S0D@0$.0 pww0PppP0 PX pX \2L\P #P U T \pWl90S `90S d9Xy P $H>0S @DT90S pYFQ 1!0S  PZ0S= S EW#!(: (:` T00R0SE uPtJ  $P  FP Ue g:0Sg*0P a** ϠP 0: T#= 0;R0 sr ZO.!0Q3/P&p;@ >+0 R0;Q;FC ; 0 S dh lp"0S,d< 0R.Kw u420S 塺000S 嚺000S 哺000S 区00|iލ Ѝ0S 03/0S z00s@- P@AP  AP0P (Ѝp`P  mAP 0 FUpP Ѝp@6 0S S0S  OA0PP2A2w2{2p:00@-Mh 00WP P10S 0S00 0 Ѝ qQa @T0 S 00S 0s 0 :;P 0 S000Bp@ T dEP 0|S ڹ00 0S00 0000+, +'D D *+++'@-`$MpP 50000000$@2D0P/S:S y@P@tQV夹P $ЍUDPᖹ@ 5  5 50/0LPP":LpPk@P/000 09@P00-`0@@DcT@@00@0CcS1S@16+p H'172PP00/@-I (0@  000I@+'P+@-I p0@ `00S T0 0Lpp<0000S BI@+'P+'@+' ?+@-I@\00S P0 0Hpp8 10 10S I@+'@+' ?+ d0@- T00S H0 0@pp]00 101000+'P+'@+' ?++B\ -X0lM@ d @480 00ss8 +'P:+' +@-0lM@r0 0 00 0rS sS l3d d4d X4P0 00ss,d $+'P+B\++Ӑ; :;/+' +;@-PP`@ @0@ss00V 0ss0000@? P UV 0A0T0Ѝp00CS0 Sp0 S 0 /+O-pTM|0x0?X0 "?0p 0H0P`0V0X B@4 D000S@ H 8PZ0S= S DV0  @P+H0S H0#S H|0pS d!0 R LaR 0# :pHtp uTЍ  ?$0 0   APPUH0S QH0#S@DT|0S ld@"\t:$0 V `~#O" 00 "B@+'+' O-@BMMV@ A`l\?0a>0 @@0P`46 pP,6P<96  BR  P5(50S5V % 0U ":0WU S00G00S(+ v3 0S+ 0 S( Z000[9  BR $5PP00CS00 l9 @P00CS0 0㠴0 0 {P8$ ap0,TS (400  00BލЍ@3@30S VW@@c3!93 0p330S' U U# fT$30 CRKH3000+ [)[00E@ 0A>V0 `W4$2 22 @U[2000 p"00KT1#0V CR@U-[ 0S ,2  00 020 CRUT<10S@d@60 @S405  [ [P [ 10Sʶ50F?oU20S d10SX1p10S} U T U00T0SyT} dT([@ 0S10S 3/1V 0   0ZR\@\ 0YS P 9/ 10 XS P 8/0F+ x +p+++-+'x+++' +-+-++ ;^+ӈ&><+p8+'-A-` @T 嶖 0 ЍAЍ/0p0$ P xZs8 h0h XAo0@S TP 5/x+-;~+p+ x3+++O-@sFM M`  @D D 0D0$0`30(0$ 0,@U0P SF0 S 3 Fލ ЍT0 @,Q(12@@Ȳ@aGT  5 2 T 0 PD0P|2d `JP `"`de1 La10S 00S , 0(d r  PP d⫳@0S00?o2 IP D0@6T6 D01@p  d僳 01 D0(66S0d00 0d0A0`PS 巕P P 00S t0 |0 'P@ 0 @0~0,`@x0?++';+p+p+'x6E7+' 56+;j+-+-;<0O-VJMMsn0p̖FXv600S00p / 9_PtX \6  T60 9MP,JލЍ60 0 0097S 50Sa5q005ĥ0S# 0S5 Q S 5R "P 0S d500CS05Pq00@;0S P97S, 44 % O0S 400CSX0$000(00000 PF h40000S\40܀C XSX 4T00$ 0C h00d00`0( CP 3x4\ 0k0$<` ((0d $r 0+ <7$ &S \3]0 R0S R|3(0008'P 2X<0097S0000 0C0S  x 09p8'-P420 00 0" 0 B !pL 087dP,α 97R_ S㴁 0S [10S. 0S* ,0< 1, >HP8!81 R  t 0 4 1Z&P 0S 0097S;7(0:70?70>7='<0S P0s00`X0 -0S [X  U++'l+'+++<+++'p+' V+>9>0A-H`D0 82Vp  R`RBR RB`2b  Q  ,+.00EoE?AA?1 R$!$! 1 (!(! t1 ,!,! d1 0!0! T1 4!4! D1 8!8! 41 w M+ +' >+0@-PQM0MS <811S (1 ۍЍ0@ @ Pp0 P 匯 E30 wPP  |01S |0 T  +pp wPCP000S;9ۍЍ0+->++p>>+-00@-$M00D 0_<P@`4`$\4Q00P4@T D40S@ 440S@@$40SPr40S3/nh 3 3!n$Ѝ030SCP NPDh< `3 0 HP@-'10003 & pP@#R000 00 0{SP  tKP dC@P  H 2@;,2P0 S R0S S @T% 1Ao0S3 1o10S 1 gP5JHX10S  P01S 0 0S PU P 0S 0S h01Sv|/ 40 &+Ӏ&y&t+(+l+h+$+?B +Ә Y#?T?J+ +'$+++-?jA-ML8  0/$484(P 0@00 8@P@8@80$080SP 7Q  Ѝ 00-S0S 7 7 770Sg040080<0p7l 0W@PP\G]X P H8 :PX47,06PM=PP7`@0 :P :P6Qu AQ ,0 p,00006Pn 偭80su<0svlFP0040Sp00St5$  0  |=0S 5 00|S  0P<,,0S L5@540 ,,0S x7p5H40,0p,0PP0: S 4 04 n0 0,04 P4 00S,  P 4 000S!@8@848@0SP4@n @TP@00S 0000 4 s r4 R 4 $  }<4R P ,3Cz<0s <30SP 30S 20S2P20SBr, 00CS0|,p`Z VmUR tJ0CS,0#p,000q002P001!P y40S 40,3/0,0@00@F!0 R04Pc>0 SN1#r00 ? 0!$$P000@ U ,00@ 5000@ 0M 0 0F 0 |, 0`$\0 /#, 8N< J,0S 40,3/0+'+Ӑ+'+Ӡ+'|+'x+'$+' ?^?+(+$+++  &6+Ә&t&~5#+'+pj*(TD9d??J& Y#+ʐ.++? +?+ +ӌ+'??@-EM X, 0 0PO$(0,0DP@,,,D0$,$<@P@@<0 0<008o<<0S?;0SW 0004 8 + R<00S0 @0 PPKN,14S$p8P $00|S $P/$?@p=0SR l=0 SN $ `); (1RS ,1S $00-S0S : :$ <0S $ Eߍ0S h: 40sp80sqLJPO0000Sk,0So9 9 9T$ 9R dP90S =0 S $P$00$0Tt $K/00<0 S$dP$D 890S<,9Q0SPh`P=<0S!0S' `+80S b(P  88(l80sS|Op8  d>Pq00S  <3Pf0W,,0S%P 7 '0 R0RVO,1SC$x7P!7,!(087 87 (0xp(0p 0: S 0&0&0X7 R,L7L'LL:$00|S 8$$((0S$Dh6,! d6 600$  ((0S6$6R P t6Fz60S` 50S 50S5`50S 0CS0<0S 5  (p(2P$,0%p,0(0q(05`001!PM;0 SF4100S 00(3/0(0,,D0Sp$0 S<Q  X40S 0 4RL pq{ X%&0$Xp0>po4P@$P   0tTch唩P$T厩<0S s 0 P0 (P^P@ 0T0 0 0(0PPvLsh( 00CS0(epj P @P( 0@#t-0 ? 0!$ S0 , 00CS0 ,9@ T @0S  @(P!, 0@(00@ V;,00@ $;0 SC1(00@9 (/T! 0 t, 00CS0,p@ TD04Q0D0 T V A, 0@$\1 #lը@D `Tg <00S ,/48 (0S 00(3/,_+'+ӐK+'+Ӡ+'|&+'t+'$+++++  >w+'x+' ?^?+p+' H' M+Ӏ?+$.+(+Ә?J Y#j&7++9 3?*(TDd9+ +ӌ5#+'@x@:3@@N /0g+' @oQP@-X@ L0 ; PP V@ 0 +-+p@@-@/:0 ЍA<0 Qwp@-P,@P@pP @%0@-T@0SHP0'0 0R D +~YCB+@-T@4SHP0 4 0R ' +0C P+# 0P @- Pp@T Wp`W VL\ P  R/%O-@p`M4T oTP ЍOCT <<@DT#Ѝoa 1 !Q@ aQPy ЍO' 8S 0S eXP pP 0 ?P 0 X  % 03/0 00$$1+CCBCJ%Cy/8($\!\R% R 8( -0 \ \ \; (R ( R 8( "\  \  0 ( ( !R0/\\\0^ (80\ "\0 0(88S08 S 0808+%p@-H0H@8D0 (8080$8P  Up$80+`++B`@-AaM(8S e0 S  +0) P p p $8S 80pP\ UP 0S ,8S0e (8S 00CS0 0 0p 08'$ 8$ 0p3/48S 0S 00CS0 S0  P0R H@ Ѝ++`&6C+,,= d D P/@-@P$TP  MFF-@-<@0s(00pp 0Co%+' p4p$0 00/O--KMt@t Q 0 0SZQ=9 =:k{u@8`V0 @P e@{P{@P0F 03 3# ( `#0{p`Z T *<#[030(0 0f$#u`  [ (f 0"d`< (00< 0f0" R0` U  S  RS0( `"1f 0;#;Z0S;#;0d ƒ>#/+"+ 0"%+?;#;0@#5;DE @!0X@\ P`U0WTڬ1PP1 Q IQ@@k{H{7{ZY(0`0!dYP (e 0 P<B(0@<e0   00S @ P0S S (0dt @(0h dX A.+'x+'|+Ӱ+'P+ӐF^QFqF{F F+Ӡ+ӘFFF?+'  00pp(޾Kߍ@P%U[0DE:@-6X @0 R0 @00S 40 0,pp6@+'+'@+' ?-$M ?0 0 p$Ѝ0-4M 00 0006P4ЍO--pMM$E$ "  4P p !PUp0( RPUp4$ 0R 0d*pğ^P $0S 0sX0S P 40⃥,40S` $1` $[ 07 G{@0 (@{{:?dSd0 0#f3` 3R - BP  0 BRڛ \3\図"B P#0 f<#2` 0 $ß S#3RPR  !00f " $` Q(0 0SZQ=9 =:k{RH2@Q09@ {P !5 Q; %#3\PO  d! !00f!c1@Q0G10 S`dQ 1*!3^4?^0350l!P0@`1 000ss( 0S #5; !jUp; @0S00d @0 00ppLMߍ@YA.+Ӱ+Ә+'+++'|+ +Ӕ.+ӠF+ӨQP ,F GGG&F+' +, G3?~@F{G@ / Q!0 @@ k{I{7{z`0Wy&0P  Pe@<00`<p[e0 @  @-5@R4@p@-Bd00` pd00CS01p ,P P00 @R0S"P8d`Qd00CS0+p "P \Pd00CS0p000S 8A0QPA p0 0 `Vp0 c`Pd00CS0p 0@S P,P \Pd00CS0p `V0 0 /Pp@+%Gf+A-pp@`/P@ .$PP %@P PE *P@OoB@+O-$U0mMS pDPd =40S 1mߍ0P.0͵1$4PPd'0P0S SUpF P`4P PP P0CS    p, P P P0 PsdJ.P P .P d0pp[P 0? d%`#d{p P 0Sd0pp<P0? p P 0Su0S dMh0 P P d00CS0p\2\` P Q4280 0 dAQ 0lp0 1@S P0S!   Cb"c!   c# 0\S81Pd00CS05p0 dL\0%p 0 p P`, ^0#S^0C0 dZPXX +'j+GP+A+pEGGG+' H.H:&><+1+AHHj+'$+-@-0 @0S娣P  O)P  0 00@ x0 l吣P T0 L凣P 00 ,~P 0 &><H0++tHFH - BR0 R  P R 1A-0aS0P0P3U Z(P 00.S Ppd1l- `L(X1P@  H,(P10T0!0!00 (1( U 0 !  0Aq000 00000P0 0 0pS000P0T h0h0 @U t0!P$0`1_+++'x.H+- +-+' HH+'$+h+l%+(+,%+t+' /HHp@-@P 0x 00p @0h hP0d Q0 P0P H0@D0@ K80@0S, 0p+-+'D+l+h+`+++'+'+'+'$+- H0@- 800S ,0 0$ppX+'P+'@+' ?+, A-@1Qp0S `0S ppX00`P޹Ĺ00000S p`0S ppʹ:000080xT  ~1p+'D+-+'+ӈIBO-P"2 AM MR0xB p" R S4 P 04 S` 4S4P  $Aލ Ѝ4Sg1+;004P/S ++6P)OpUp儑0倁 00g000000000S L1o]81@$1 R100CcSppW100S 0o@ 000000弿J4SU005$@;PPTy X!P00+B\+'`+@+'D++ H'I\Ij+'x+ӌ+'|+'$)+p+-jIA-Q0qS0`00@S Q`Ѝ0]3P !P Ѐ0 R 0000@ Pl00}S0s00T 0S$@,] +++'x+t+' II+-&><+pO-쁟a0AS000qSP4M Q 1b]4ЍPF  P0.0l P00X*P" H@-P$,!020$A$000 0ݾ@, .)P 0 Ͼ@ P 0$0xpq00P0}S0s00U 0S(@<\ A+++'x+t+p+' IJ +- JJ+-JQJdJ|@-,@02 娩P+HJJA-`Px`pt L@P  8@P $@`JJK@-@BP+h 0A- 0@0PS0p`0$P㬀"  P 0S 0"S0x R S  p`"R"^ 0 00+d+++'x+pԎ+h+-0@-M M P  @g*Pۍ Ѝ0Ph?4/S) @ /P;0@TP/P MKO-@P`pW 1@@Pp3:)pF)`ܰ0X1 0(T@1`0 10S 0 SY E0[ Q0(0S*00 000 Ѝ+Ө+' @-.L0@0 <ppPpP0 0SP0 0.@Ѝ+' @th+ӨP  R @- Rx000 0R/`0000/0S < S0C00S/ S/0C+'+'KA+'+'@-0 000$ `0S" R 0S0000S b0Cs R S < , , , , L , , , 8 , D Ѝ &><&>8@-(A`0S0 0 0 0!0Ⴗp 0S:S50P0S0 0 000 jp40S:S5000h `0PSpT00, 0 Gp(Ѝp++Kk++KKKC-@\ᄐpA`\P ^T1:00"\ \ L|9̠ W\\ ^@2O-`p@A R %R Y0  0 @PcUA +/U-U<%U  GR%0R0PMU20S2 2"0S0 C0GQ .QmU P0mU nU|2G0Sx2l" 0 BQ P082 R8cU.U0  K" R10S /Q Q000S10Ns[00N B B ^^/[S0C0S*0\/0C?o20SRQ 0GSE.UGTb*0SP ^*0SPZ*@P0LG RX QP 0TJ*/0SE*<0 RS=*9 0S  7*+0S2*> @ S,*0 0 0GS$0P(0&+'D+p+`P+d+h/A-p`P @4}P0  T  `00T  &0@ R   `FVp`00CS0 X PpTD000`000 T00KK&6LC-pP`q&@0尐TY < 00@)ax0@P`0 \+tL00D P 0 Ѝ+`?+' LL8&6L>LH+'<+'8G-M@ ` 04P0 03`PT 0P #T 20S+ ` Q `V` cp+,0@00E.002 0P Eh"h,E@T ލ $p`0$T  p T0q10@S =$0 0/" pO+0$S*F>C0S  #\4$`$Q(00SZ=9Q =(/?@#b!"/0 0dzp4+0S +0#S Z+0AS  T0 0000 0״p 0S +0+ 0 ᦳpx0LT P+<007+,LYLlL++bM6E%p@-@Pp@蚴tp@-@PP`v&P 8q&Pp0SpNpv ;NL@-@RP OL@-uxPGM@-@xp =MBP@-/ZP0McM0@-PlMQ@00 00 T  40S P h00 P _0 0 0 PACcpW' 30S $@$@@` w LD @P 0``PJ P {0 S8 w0P 00P02 i 2 PP 00 @T $ V) P 0 0@T r$ G)P lЍ>P 0S @P@E S$ ()  P@H$ )T T0S @P@&4$  )0S @P@&$ (Tw 11@T  0P 0p`V@%PP)'0008s0 0 0PhQ XP@++E0+,+' +'*kMM&6LH+pM****+`+'$+'D+A+-6?+`+'8+'<+h+d7@-Pn 1 Ѝ0Q0S 1 1呸P !80 CRhA R S0T!L1P 0S0,!S P 0S 10S 0 0]@ @90 @0@10 @+0 @%0 @ 0 00S 0U+p+'D+pM+' +'+'\++N+'T+'xN# Z+,+(+$NJ++NT+ʼ+ʸ ++cl+ʘ+ʔ+'h00S#@-@0M, ( 0 P0S8yY@0Ѝ0@O+'`&-A-+4@- 0坽+8+لP `00CS`0p S00 P0S X0X /X,&6C-Pp@  l1s0S `l ĭ0S t 0嶳`V   Ѝ+<%H+4N+ڄ@-}A1%.% p( P@ ℽP iA%%Ѝ%%X0/LA'P 00R,yyRO O%H&7p3OO#0s@-@ E1`s0S P0S / 6 H2@0 K0nS AЍp+%HJ+ ?+(O.@-PMP T` P H00S@0\A PЍ @P @O@+%HOFO@-@80"T  @1 㶰+0OZO_D0@-|AT 0S  0 ڬ %H+<@07@-LAP/P'0P00 U Ѝ0%H @-@0S S S 0\ \ \R@ R0 RG-P0@/[00圀/V0p0/Px` 0@㞲 QT@D0 DЍGi@s0 ፲@T*Qs00!%|Oh.OG-AMMP`PTxB  d2d `2 RT2 Pk 0 04R 0 0 ^ 0R  0 S!#`HpP@D✡0S1  <1 0S00SR&@@T   T @?<1<1s0S 0Q \! 1 #%AލЍP0S S  S00<1s0S p 0圠0CZ ȫZ <? 0 @+<+8++(++++ل >Ou%HO++ Oq0@-EM,P ⰬP@P?Eߍ0 ,PP ˫ ɫ ᷫī 1#x0 <  )#↻TP|宫 a?7OOOO >%HOO-`h3MP@ pPPZL`"<#03 ,jUPE c`S00CS0%Jp00 R0ScP1s0S7 `$jP22l1s0S  9I 0 0 Pp`1 Ps0S 0 ` 0D PVS,1s0S 8 ` 0 S 1s0S <1s0S l1s0S 0|0Md1  RGL1P) ? V 11s0S WpG'ې`P~a"<1s0S0 宪 DЍS R   R WP00Uq QLLD{>++< >++(+%H+<Oq+4++ +OOPp@-BM,\PP3L1 Di" "$!1 x{@PG>`0<1s0S i0Q 0 D !!Bߍp QP`9TPp0.Q!!J<6O+++(+O%HP:+ ++<P(p@-BM5,hNPP3X1 P!!0!(1 $@P=`1<1s0S 0Q A0 ک p|!y!Bߍp P`ϹTP|PĪ`!]!<ɯwO+++(+O%HP:+ ++<P(0@-@pP4M\0PP <<0000<<0  4Ѝ0+<+0@-@DP4Mo0 0P88 04Ѝ0+<@-M, ,PF A f 0 001 Q1 010000 001s0S 1 011s0S1 011l s001 012 02 2s0S܍PD%H+rJ+4@-(@ $壪 @圪+< t{ tz@-@>T@1p@-@PPpP p0@-AM MPAލ Ѝ0P0!↮ީPPl1LAd1T@D0!P0G\u+¨@ڨ ⧸U0S S 000 MT城   T lRt  10D0 S B/o" R  0CPKsPV%H7+څ&7pP^PmP}+ل@-MP Pppp pyl@PL\܍@f, HP 幩܍,0 < +P+@PO%H0@-MP MuP%@e0@SۍЍ0@<P551d d:PPTۍЍ0@(@ 5 , ۍЍ0+P+لPPPPp@-"P dd;@PpPPѮPp@4<8P L|l1s0Sp0p@ +PjP%H+W8W5+WP+4}%HsR* %Bns T  +@+H%,+T%7+X+P+DWi+L %+@Wl+<O +8' @-@$P ˪ Ǫ&7pW{W @-0S 凥㒥+ЀtT@-00CS0p0 00S00&6+P@-@rP7 ⊳+ W+ R+0@-M0Q00@ 0SO 廩 OP 0 @P00CS0p 0 2 /h00S0@oЍ00 p0 P 0S*000+ g.&60Aq P/P//0@-^@\P0 R NQ | 0\ P0\R@ @ 0$R ^ ?+4WPP 80 dÅe"Å^ P?d" @pef"/++4A-|+x@xPx`xp 0TS 0T `0h2So T 0T * 0 @W%Š%HWW+0@-P@4Ml<L 0<, p"lR < 0 2  s0-  ,S 0"!8 0r 0R><r> 0U4Ѝ0+%H@-`0S@ P0S 0000q20\ @譈+W ?7@-0Pl000p@h R R  l R  R4唨03/ Ѝ0Q P%H%Ŕ+.p@-$A`1QS 0SP ӉAP00p00v0P oP0 hP0 taP  dd\~ 0H@H  "  \ p%H+ jW&7p%+A,0@-1s0S 0P ҥ%H+H@-(0(@ 0@ +(++ p@-`BM P @0 S0`01s0ST01y0 忨0Pn00x0 СBߍpB/ BR 000P y0001+ %H+H+( 0?o2 0/%H@-AMQNRJ G0b0000@000  ᱡPڶ0 q 夡P 0SS WS BSs0 +②P  Vt0S 1@0S0 pW R1s0S ؀0S R      |P W 0@^S00CS00  S00 P0S+ n+<++%H+Hp@-PH@P@p4P P -P @%H 0/@-闡o/A-@PP" p00CS" r sh sX sH sX sX sX s `V PPCP0 P00TA4 0S P0000 !0S0R 00 XXA-AP00C!SaXp `0000CSP t tl u4 u u4 u4 u4 uT`00CS`0p S X0 X 0 "S  0S`00CS`0p SX0 X ! ~X!Χv0 0P0 PH000 `b0"S0L0A240W0 0P0 p +L&6.X@-0S S S \S ^S R@ Br0 000 Cr@T0 0 Br@T1 0 Br\1s0 P P0 XG-@P2 pqp =`P`~PP2 00PF 0P  : V @P @0S@0S300@PP?FP PPP P 0!SPᬥ Xs+L%HA-@MPP\1 7 `@P `p崀  gP2u00u0ۍ0 P 0@ 0000S q  P00 Z%HY j+Yp@-`@.PP 0 s9Hp$_PI@pss@-@P` # 帠 R 屠 孠@T|(Ѝp(R( d$0PP O<P K(P +<@fY tx tyY+P0@-@M@0(@,0 0 厮@P Ѝ00,Ex0 >PPPP0S hp00@SP {+P%H+<@-ɤ (,qZ"+P@-@ = 7墄lP 嚄 卞0P3P x堤t垤h  Xzv~  娞Ѝ+< tx tyZ?ZEZHZ_@fZ0@-4MP4PW 1<1s0S qAJ  0 9 0P LCDS<Q8 ;,0E R) 0 ,<P! 81PP )0(0S$4Ѝ0=R.00ES ~, ~d ~D ~L ~T ~\t"h `\XT HM%HZ+<&7ZZZ+PZ HMZZZZ@-0 ߝ@4+<-@-0 R   ЍЍ/+|-@- ㍡-@-f0 R   ЍЍ/+|A-ARp`P@1T ᤝpPE`@DO-dM@P᳂0P0㬂0P0 0 U8`800,@400(P@pP@ `0`,0SW ,0S5TppW $ @@[ W  ( 0? 0 ( (cjpl T+o,00,00r0o0T񟗾 x  < \ l @ ( Q 0S0T勄剄 0S ` dЍE 3  ( 0C,0,L@ @( QQ h, 0C@( ,0t( Q< 0C@( ,0i( 0CP@( ,0aU@^ ( PE  ( 0CP@( ,0Q( 0C@T( ,0IU@E @B ( Q @0C( ,0: @7 ( Q @ @P /U @+80 "(0P5 (i10S! 8 l8 R/ W (b0R040880(7Z|xp8 8 (b0R  "K $0 P y8 Ï0000S(7@SW ( 1P0C S,0( W@S( 1Pl0C,00 S( L[[&[[A[^+|[x[[[[[[\\\<\T\d\\O-lM($ PPU``+8@ p00Ÿ   0<02@02 @0` 00H@P dJH@  J`@0S( P @/-` $0PlЍh@ ?@d 00 S @. @ C< ⤡0ЍC0%p]]:]T]c]j&7 ]p@-MYP* 0 :  S00R P@` tЍp Śp P @TPH0 0000T#+|]p]x]O-0]M-SP M0S @p܄P8 00S0W0S' 0S"_ 디` pPxh4P ]ލ ЍOv/L]ލ Ѝ h d@piW ]ލ ЍO賁0: S  SQ QPPLu ]⹛P Vt>0v: S+ $ 0P@`/ P9  P p  0 0)0 00 0S0S`-P`[` vH 0S 0` #P V P {z R^R\ÙpPS 0Px!1[Z d 0?[ᤙp`4 0S!P0!0v0( P: v?b  0S -v⃙pPv}P-Hሙ 0Sკp<j+|%p]]^U]][&] ^^^/^E^j^ (^&60 R R /0@-@P0R0  APCU 0APLU aC\ACP 0^0\0R0 0 0@-@P@@ [!P U8IP00S D00S  40 #/+I#NN[᨜+,"+%t@-J@-Pp@-P @p 000/+p@-@P0-S@@p IP0Tpp0p@-0@S`@MP0@ Q  P@ЍpPU Pw  0P0%ʠ+_ 22@-@P @200S@+p@-@PPp00Spp@*+A- `pP@P000 PP0 0 dP@-@P P0P00S@<+@-`dMqPU< 0S9 H[P0 @@?T-  # `00@ C f @ I  0*R /D/ZP10.HH>~P @ dЍ` 0@-2 mO Wr+O` & k dpD|B &` S-) #+0  +0  }+@-@(=St00S h00S\00S L00S  c400S  \0(=+,#+,#,#H,#L0P/0( P/++0 D+0 $ ?+0 :+0 5+p@-D0@0S 00S 00S  "<0S <0S 8S0,=t00S  \00S PH0(]0Sp@ DP 0Sp,#++,#L,#H,#,#/@-0  Z @+$00S/0 R/ ,#+00S[D,#0  +0+@-0P4 P1 +P00p@0-0Cs0LS ``PP"0-0Cs0LS rvp` 0  0.S00 U`T  Ѝ0 4@-@P P  P P ЍQQl0l0ѳQQH0H0 Ѝ@Q$Qh` 4```/p@-P4@Pp@B0S +S:0+Sp@p@@-@@@    0 0+h 00@`/%p@-@lP     <00S   4u @p  +,"D0@-0S 00 @T@JF@,#(+@-@0 0 0@+@- Bo 00S C0 %ʠ`+A-PRp@ FpqADFpq PP JPp P`UX@DTUtl@8/pXVt @W@T*U A  )```a T $a"$0 0) 0 00S/+pp@-@ P 0s  hD@p%ʬa6O-`0S P p0崠9 00 ?990 FI†U00S[   RP DP  .D%ʈ+aKP 0S  R 9  (0///+ جO-M`V 0IS(,   RQ0 R005s: 4) "P  2"RgpV  rq$ L$Q  4Q Q 0x$P 0 {   {`  @`   0 PP 0 @@0(p,`vyf`pzVX!RSB 0?  0<pq2CЍ QP$0 0@R*20 R    @ @  " @@900 SP05:Pi09p`2 q4   10SP  09ϬRXW a0SGnC002gAT10SK d10SGPD  H1 09 0( 00*b=@p 098p<`yp  RB 0P   l00St0PR8p<`0SH00SY K+,$,#l%ʬ ak+.,#,+ ذav%ʈ,1T800S 900 //+@-`@0Sp <)00S000,0(0,0(0+p@-@0Sp Q ѐ00h@x00p098@00ps000B(Pp 0 %ʈ++a,1TG- q`V= P@7U000Q00S 0&)ņ(\^# ;#;0bQT |` 0X R p 009 00S II(, 0@+,1T@-P \00S @T  S 9(,0 +p0@-@TI0 pq0@ @}00p+,1Tl0@-^ 9 @!@&)60 Q@ ^@U+0 R$ 0@-00S0C0@ S 0S!‚"\0PQU 0000@/+P00010 0/%ʬ7@-P R I00 #0 Ѝ00R50 @!"0@@pq Ѝ0@[A+a0@- 00 Ѝ80098<@ q|/ 00\ /+A-p`!PP"@i9  @0@  P09   !09 r`A++@@A-p`VY@  @ @ 0 xvP0 0o0 /T 0 0cv0@AN!++0P /+\ -P0S0@  P2:1S0BS /O-@8QM44@`@|0S!U  BЍOwbS6 .S5 00C S 0/QP @cS@U:y@0@0CS000 00 B/1QP @@+$aa+$p@-@P 0S`PpPQ P@dPQVL>@HqP0S  p P%ʴ% aA-PP`p@ 01S E*0S  R@ *Sn#0S 0Sn0*S0S sS0 dS0 k0C?o210@@ 0C^S0SP@u0C?o2+$@-dMvX*@PPLPHPDPT 8S8c(s0S3(3(!4!!!8!! 0 -R  UR +R  >Q @u?0:S m?w0cS .S bS S@ @0,S@pS wS ,YP ( QP 3'vP@P@P@P0 0  SxePP`PP [PPVPP hP ^Pb+(+4+@+Lab+$ab4bkbv%+xbb+|b@bGbP&><bUb[babf 0p/+$@-p  01SP R t0 T!WP R HHt@08 ,卒@"P0 +$b+ (9b 0S 0S 0S 0S P////// 0S# @-@PPPR0 0`aqR R S R0/0 R /!0 R0S //@- @P  H ń0#-?003&?=r 0?0)6'?:0 ? 0? 0,9$?70 ? 0 &?*00/<!?40 ? 0 )?'0 &?*0<1@-1@SQPqP!3? Qs0*=#=P00 !&?0Qr 0*--P 0!ɠ? Q| * !P pq!l? pPpĕ ?`llp@@`@@+$0p@-P@P QT4@pTT@DQ0`VC@S@ T0CQ @6@+$@-l@PXPHP <00S,P+p+h% ,#%@-l@PXPHP <00S,P+p+`%,#% Q p0/+$P@-rЍP@EP @ $@P r0 0tT! _P P0X!P80T@ 00 0 b+b+$@-,@2P-P+X%$00PbA@0CQP//DA-RPp `@X@@Ѝ`>P@\@P, PP@@+A-P` @P lpP ` L@P  A< $@rT gAgg#g+g8g"p@-Pl@P TPpDPpp@U p@PpgF FO-MM`p 0@P P0: SXHqX  RP  c@P> ލЍ R R R00 lP P@ eP @P ^PP 0"SU T 0S0C0 6/ RP 0mS PjgS%gvgg%goP P / 7+s@-P@` "0 00 BЍpA-@Pp4` R 0S ᦐp@g|@-P`( @p0` G Ѝ+@-`@ (8R808Ѝ 8 0 CS  8 0C 8++p@-`Q@PRpP0S  e$0Sp [p@0S S D0V@ ` 0V, CU  p@<%gggog| $0 (((( 80( /+% 0( (( 0( /+%C-@B㼀`p0S Ѝ @oP0S 0S 0 ( ((089P 0 PP 0+$+7@-D@P@@00S Ѝ0 7P+@-PP@X: `8 R8 R8S Ѝ 0p 8 0S08~9 80 8 00S08p9++P0@-AM0 08S0Ѝ0S 0SP8 (0S`8p000 0C?VRh B(08 80C 8 0 CS ڨ 0`++P@-P@`8000 00C?UR 0 R00C8HhЍp k 0P 0d0S 00++Ps@-@8 R 0R0` (0 RP08 80 8880S Ѝp0CR80S 00S808++Pp@-p@XU N8PE`V` D0(  p8Soppp+%(080S @-/+p@-D@0S PX* 8P 0( pp+%p@-|P`@l0 R(0p0CR0R: $0( ip00+%7@-@@P@P  AP Ѝ00P$ /+0S/0G-0PS`p@U @0 pP0@@@ X P00nn @ P00,#P R/-@-4@$P(0,0P  $8 +%7O-0PSGp` 8(hS?Pp $8SDG(R008(h8! 0S0S ^ Ѝ0S08R00(hkP080h88S 08 ЍO`0F?oP20S `&0 S PpP0@S 0 0 H ې X  ܴ T   @eP 048`048lP0480488080 SZX0488S0S S 8S0S S} 0488r04880Sl 7048g048e048048[0488S 0S S8SO0S SLLJ8SF0S SB048a04880 S80 S4US80,08)0$h48VL"3P( 圓R( B( ( W(PV  CPPl?@emH80S 48PS8P m088 80X28Q W 048 D}800 QXPPUBL@b405XQ&ZY [`XZ`PX`Z X 0ѦP0J``` P Q`*ZXP@$ 0P+$++%+g H'0 pC-@P M!00 0 B R   0.S 3 `! P`;HP P 7 Ѝp0 P`000C/ !GP00+g0(8R/+0$P00 /+00S/ + ظO-鬡MX[$ 00! 0S S`PO P l@0HQSQ0Z00@P7 ppmP0: SppH P)dp0 R'0 Y& 冋@Y  K0H3  x*hllЍpP00+%,"`ggS ϼgv800S ,00S 00Co//+++p@-|PPF@T p@``kT0S S VS 7Sg@ @+p@-@0S00S 00SP8P p@0pq  00S Rpll0P@ eP0PL0@p88 SP@3d%ʨ,#+++,#+@-?=@Q4G-@" e`T00P  00pတ倀 00ST  0W0 000S T28  ,+,1TA-pPC @`0000  :P0;0 A9 D A0PP     P  5X A< +gp@-}@Pp$R0%S!S0C Sp S} ( ( ( p ( ( ( ( 0C Sn ( ( ( ( ( ( ( D \ 7S ESM /Sp0  00 0pp@!p@?0P S+S@ AP j0S0pwp 0p@` 000Sp p@B0!S $P j$t00Sp$dP`p@&L00Sp7D00`Vp(m'p@4p+++gPggp@-`@P 0p@N+A-`P0@@@p0P/00,0S W HT T A,0, + ZOg+2cp@-AM0 70000^0  d0  _0  Z0 U0  P0  KP`0S1 0 H=PU0 D<<2 40 Ѝp+gggghhhh H'7+@-@0%40PiP/+< S /@-0 0J4 Ѝ%Ih @-@{0@ +p@-x0@M@T 0S P0`P V@Ѝp`F0PS +@-@M0$ 00@S 0+@-@@P@-@0G--e`㊋,B,r0(2(0@M0?000S0S  A10S z0S 0S4&5\0P P 1Pd0S P 1rP$0SX80S! vH2U80SeV}Z0PS0S\ /S US S S U U#38>P h#2Z 0S H:1' "1 +++,1T+,#+h0p+DhNhf,#%,%ʨ+h|>;,#\,#,#@.," ,_u,#,"%0hh++hh%<+hiih(Pi#i6,#XiBiR7S< iS0S P0 P P P 00[`P iV 0FcS񟗧 0 D  x  h l  T @  ` l x    h  L L   L \  8  x x < d \ ( 8 x x `  x x x  L x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x 00E.U S``dP ePdP= R0S`Fc 0SP0@_U0q ,0Sl U U000#=U00S `J V P+U@  U !UQ0-UQ00  z@0#0P MP 0 a0CS00 0`/P  _ 00P 0Sa0@S @P000S BV!P '2,00 @0S 0|$ -P 0S.P ,Ta0ES000,P ,0 /UPmUU0ESe x       D    <    (*U( @U6 !U[ Pq 0S US'T60S# PP pf0SL`960S 60S0 97R0<  J60S07S ;07S 00#0'PD/J10@S0 @007S9 :<#0CSdP J=P 0 i0S e`p!S '0 0R0*?0G$80S  !S d(0 0R0*?0-  0R00 !ı 80S 0R0T  0R0 0!ı  (9 @9 0R00 !ıl90S  0R0) 0R0 0!ı  0R0*?090S  :0S `!S 0P:0S s!S 0 ~ "r L8G 0`jR00 !0060S0 !0<0!eSd0C0<0S d0 !0<0w<1rQ0kQ0 ~ b0S0 !ıd; T5 *N;0S0SSl @ 8< D @< H H< P ?<00 00R00 !ı<00<0 0 00R00 !ıJ 0< `0 0000R00 !ı4 ` `<02C!O?P`~ 0R00 !ıP? ,,P P  0R0>>0_?PZ 0R00 !ı P  0R0(?(?(0E 0R00 !ı?`P`8 \P?pq ?  0R00 !ı?`P 0R00 !ıP ^D3`P?P 0`0,`9P?)P 00,00  20S8V"  *0 P~P U U ?V"H0> <PkP U U -"80 P[Px U Uu M"q10S %PGPd U U.P!0P]l!% X(P0d  0R0L1 0S<10գ?0/!(!0 S00C0 0 4 0R00 0S00գ?0/! 00 0 00iS 0 dv,T00S0802+2c+I%<i_ijiwii,#<+P,+ /,#00S/+$p@-@P/!pO-S`PpM`6`@ pP Z:T008 "1 0T S@D0X0@D@Ѝ0  0T80$ 0S  P R ! CR 0T@1 CU * S0SS0S0 R Q80 10P R* 06P0   80 cP yd [0J0C+$0   /G-pȀWY+p S@0!PPP @ ZPPE0S`0S P B0j 0R R@0`ip@-`R P@ a0P @@@ 0ppM-@Pp M@(p00`Cv RT0Ѝ0 p/e>P0/D p/>P@7@-@PPe Ѝ00;SP0;S@@O@U AU \00SBCD00SCB0mS$00P#:  0 ,#++A-@P`pTd p\@Q<QPP gP @P% @@@T AT T e00SCB00SCB0!@00CQ# 0 DPzdP fPP Q gR 0S 0R   R E0 i,#++@- @ @+T @-P@,+Ti @-P@u,+XiG-,2pW pЍzPP* Q0`zp`@P 0 ppqa szz? SZ a0F 0P 0S0MS0+S0GS 0US 0US0UES0UnS0UdS@0 00vS cS eS LP @UxS ?P @Uk 5 P @U(X0jP +++\ip@-p@`PP<I,<0RV@` `<D IP +p+Ti 0 +T 0 +T7@-dP@ PP 0S  P Ѝ0+TPo/@- + Ѝ.A-`QpP P P@P%U0P 0 P l @`T @P 6/P`jgAj*@-~|0p p0h hhP 0X X@0L L8P0@4 4 %T%Lj2 PjDjT jejrjjjjC-L1M0SK <10SG 010SE P` p FPUiP@Pe@ЍPЍC0  @RS dTU PE 0DSd@T 0DSP @@+++G-@`M0PSS003 @ R S0\R% :R R DZ Pp ᯙP0H3/0S@@ R0Ѝ ؔP/@-p U( q*_Ѝ00S @  d`*\0PT T Q( 8(pq j.,"jjjG-@P@`p:ppp 0SR 9萟蠟V)W0 p@pW0pT: 000@R(V0 R  S 0@S0@R(Vp0  S P 0F@@%8%9p@-@QP 0S R SppQ0 QA QR P/@ PRP/p@-`; PPp@p>p@. 0@-M +0 x@sr  * PP  000Ѝ0++400S/@-$@P P@,"+@-@P  +P/ @-p@''0@-M@'wPw00S@)PaP DP OP AP )dP oPi|0t00SЍ0 gw0LP 00pqpw00@#)+kkX%ʈkO-(M0S 0S 60@S Q v P 4X ЍM 5@k Pp 00o pPPP`TP DP  PPpP 0S P``30STPQPN ((@(!P3`00P0`0 pP0`0 3P T ( ^0 bvPl& 20SP `JP   @( YP vY |2 pd T2 D2p@20WF0b,2P 0S {P (wP11P +&0S )/ 1X [P DVP Pd1 ]L10S P] 010 (0 yq 000Sp 0 39P  0 R  [ R 0 0P: l X ++_uk,#`k+.k++,$,"+++,%0,",1T%$lP@- 0@+00@-P '@+lA-P`XpVWPU@JTXlP0,1T 0 +@-zP@ @0 + 0 + 0 +p@-P@@P Pp@7pp@-@`P*PpVU p@K Pp PpA-@Q`Pp f\\U(G-@@` PР @PUЍp pPx\7CP m\8p0SkЍG+@-W0@0S @y+0 R/%R %R0 sR0/@-(@0SP00+lilwG-`dd@p00CS0 ᷧp PP 000 P U 0D IS  [\~p@P@- 0PlA-@n0 0pR`@0S00 R0S@00N`P0S U  \P@00%8%9O-M@`5DPp!Q Z]`@pW*p%pP` P` X P UpV`P:`00@0H0L 0`yЍ8P 2[@00%8%9l@-@*pEPPP Ѝ@g@@@`H0H 0P0yB[ P@<[ Ѝj ]yA-PPЍ0S `p@@@YPP D00< 0`ZyW sP[s H'@-@@ gAA-p@`P@0S P@0S0# CV* UR@ R %S0P V@# CV* WR   R %S8 P0Z:@++C-EMPPEߍ@0 @pq `,HsPڬ嬐P ` P:T0S EmP @  =0pSC`P  P@+$,#dA-kX1@0SGk @1RpP? ,$? 1P````P0p000 0`00x ЍO} *O-@P4M(0X0 ,0utP @4Ѝ40SX4  0/Q)(P@PpLd00$0<p P:C   `V0/ ;3p` P PP00@ἳ弃0v V ` VP@,0S4 x3X4 P @6L)X30pW0 0 `P20S Y Y` P P `V@Y*.P `@T_P @0S x20S 0Q (0 S 9 8&PI 20S 0   P @1 0R00S7 P Pc p 4ЍO V0000Q h 0P@ R ~LA0 Pp``rP@,1` !X$0e$0@Q_ V V]P@k P P Pe PQP@ut$0H$0@Q_{( 0S V V0$0$0S 5P@ B`0 ,"++,1T,#P,,#8,#@,#,#7@-P@{P ,0 R  000 Ѝ0,O-p`4MV0 ?  4Ѝ p`30S3V0V0 00B(4(t30V8PT30S @ T T,CF $C0 PG0000PO00 0 P @,0p 200(00P P@0% 0P,0\" ,00H" RF0 0Rï[0 P P p| p}z0Q Z 0PO,0P!,0 R 1 P 0$00(0 ( $P\L10ST 0  $P @H X XX P P@P PO P@P@P P T0'I r0Bz{0 00S X X0,0,0S0S0b0 P$0 P$@,"+,#8,#,1T,,#P,#pqp@-P@ SPpp P PL0L`P@0SV3 @TP@P0P@p%ʐ%ʘO-PM@`<P!@@T 0000 00V `F@P0 @Y20S1 ЍO~#pP ЍOd 0s00 T 0Sq G W0!pF0x!0h!0 0@0Ѝ00[ 00S 1 0000@0@ 0UPuq@ p6Puq@ %P Q0@` 000CSed00S`H0`0 0`0@,#@mZ+++,#@-p` Puq @uP 00S h0 Ѝ@2V0 @P80 (, Ѝ@ p` Ѝ,#@,#Xm|m@- Ppq   Ѝp@-P p@`@P@PQp@0pq  Bp@@PQpp@m+p@-P@` P P pP@000S  p@,#@@-|P @,SQ00Q  B@m+A-pPpq\u>`vq@A410 `Q0T0A mn,#X0 R R /p@-h@M0M0P`0H n P*`0 n000nۍЍp+n)0+p@-P@@Ppp@-@P \R ^R3 R    0tR'jRbR< 0BP @R00 SH# 0 Q' !kB P T R R S R R R S R TeR 00@! 0@PS RQ0 p2 p@@p x2@@ @h@p@\@p@P@pQ 0xSQS DSo LS 0F ! 00 0R0S@@@p1S] BS03 C^R!!nR C&R U T T U T T U T T T T T T T T T U T V U` T T U U T T U T T T T T U T U U T T U0 @@ 0000 0000 00 000 0000 0 00000 R      R .+%+ &?Hn>Pn7O-`PAM@ M\`p㼕Up!`*(p*0,p<00}*pQp `TPLuK DnpPF!0 0$0͈P0  ƈP  ⿈P ,00 0PhAލ Ѝ ⫈Pg t⟈P \0`=V* !V' <V 0F^S0`͕0͕0$1mL>V =R+` =R-`8 { Y =R<VG +VI -VL 0 S 0=V C/o" R  R P ` 0 S;#S0BS 0R\S 000SR  `RY =PV&* P+R#)`0P=40R  0R  ӿ0R  [3` R R R000#=R00S000=S 먡+00`0 S0S  Y Y Y ` Pzd` P `` e0Sv} p0Ps {Lj%+%I&6jn]nqnvn|n7nPnnnhno$0 RP  /+0 14/+0 Q/P/%p@-04 ,    00++++G-P㌐剀jL@fLPT`ppP MT M - ! ( M M @`匀+A-8p@0PS` 0P0aP +@-@$ 0 @z+P 0 R   /,"p00S/p@-`@m_PPPpP 0S8@pPp  ,#d+`q@-@P00Pl0 0  ;D01(</(8-(4+(0)(00q+r r+++++P/0/+0p@-@00P0 0R0 .PPPPPPPPPQQPQ(H(D(@(<'Pp P0 Q00++++++C-頁@0PSpM`Mp`tt!0 0!0S0@ 0  @P$a00CS9 `P U9 0 Ѝ P -0!0S @P 0R 0 0rq U l Q H S  yPuP,#p,#8,",#+,#%ʘ%ʐ,0P$0 00S000/,#8,#,#p,#p@-L@P`0S0000p01S 0v'P+Pp@-`0 p@X10S |P@@p(1@0PSP5pP/i`P0@@S  1CP0 1C#@)P 0S"000|  0p  0d  0@@PC 1CPP +$+++++O-M@pD`C00wvP1S{0\P1 0S M 0 S1C10p&QH   0   PP20SK 1SH P"1 sr R0x2q`01UPX20SGXR 1R 0 sr0`pS`K e`0F[K 1RLЍ1S  0A# R Y1S1S  p` 0gP  00KO1 0[0 `0S3& UzH& 0R 0çQ0pP 0C001萄 S lI  0+,",,#d+P+,#A-pP`=p00S HP `P 80@0@D@ 0@0TЍ,#d++Pp@-P@) 02PpA-`p@@PGE$1S 0P $@@,7@-PPP0 0 B01S0R4ABᓂ@D`  pP@DT0CR0S*A8A@D00SV0S P  0 7D00S p9,#d++++++,",#+$,"%p /,,bHA-(BP`Pp P U = ClP  U@10S ! RS0QS 0`E0 0S$ l10S 0SB0$1 01 08P@0$1Q 0S&0S# 0`00S R 0S$1R0$QʜPP E E 00WT$@0O0$10P0 00S $+,",#,8+$,@-(@0S =500+G-APpP 0P0U0S = CW`dq, `0S( 0 0S0@000X0 0C0S )10S0 0S  G 8Y 0 0R  x00S U d00SX00S D00SX   ++P,# ,#,"+|+,#d<-0 R!  ^ !0+04/+0 R 00S P@0~0/0P 0/\!4 0 / B  0/+,#D 0 /+pq/G-p` @PpP 儐u U 0 0W 00V@00CS1P Q 0P@P+,1TQG-P0Q`PpЀ@ 0@Dt P kV 000U00C0C0y TʌP 0 BJ 0 Q@ @D 0@DSB+,1TG-p`P@0@@0W  S #R0C00C0Ѝ #,P  j _F 0 ?pGA-0PP@q1e`EP q0 P 10+G-1@`p`P0LL0 rS00TD`0PT@+P++p@-@PPp P0S0Ep P%p@-0P %p0 P/0S/  0S !/,@00 0S/$0$ R T,@,#pr6+A-X@ 0S0dS 0p,0(`P` pU` r0,@rNX0QH0H 0.4 00/ 0 0,,@,A-@PU ^"04P4p 04 R0PU R4`40 0  P^P Pp0࠱`  0,@O-2P0sUPPP@Q0Сp`@` V 0R00 SRP@ 0 V 0 0 W0QR 0+4PP@` Y0  0t W`@TP0 00 0` vq &@P PP@p `W 0 0I0  0`yq @TP,#p,@,1TQ0G-dpPU  0R0!RS@ U W0S P*P @P P`@V0 0 0 @0 00r  0P`Pl`@W 00 @0 00r  0P`V@,@,1TG-`8@Ppl0Vs 0S@P`%@Ptu TUQ+G-N@P0pP`xx80p @ 00 0P` 080uqm,@,1T800S/,00/QQ//,","00CS0 Sp0 Sc0 p/O-0P-SP Y   9 e\p\P\@P0S,}@ 0R S%t@T DCs\\o\:X   m  0 ЍO`P @ @ <@ 0A $ a{C?rg+ ]yG-@P $}`P( trpP ` } { ?" H @yz  0Z P p@ ;p Tt p@5s ` [ 40 z prx?+C-`Ixq p@tq@PP.Y U0 0 Ѝpq0  p 0a0@S@-TA0@S<0'@ Ѝ'P( #P  P ,," ,"r.Pp@-: $P# 'P> P 0 srp7 p^P 0 &- &P B06 p"Ptd0`TP@\0 L0Af&P,@m006pr+,m+," G-@p`dP4T#0 5T Ta0'0s000Pp0 eB@6T` P'0,@-o0@-MPg@P   rsЍ08!P =B0 00&+,@-GP0 sr@0 ! 0&,@- w rs @@@60P&6 B0606Ѝ,+G-4@PP`j>T6k.sq 00P6 A06PU p)`AP0PPЁ G-P ,+,#X@-P ,0 0R 9 +rl0@-0`  ^ @^TSa04S '0s05S #+,0@- P@0 QA6R 00,G-[pP@P P/`PuA`rAp6W @,00S/G- M`p`@吠吐pqp6W @ Ѝ 0 ~ PU!P P P 0 `,# ,r@-000mS Ѝ 0 Q0 <@P 0 S#  PPP0`0 S  P0 R pV`PPp Ap00+17@-PU0P( P@ P0 Ѝ000S/@PP @]P@ Ѝ0@H00S< Ѝ0@6 0 0$00 +r+s%ʈss3s? 0 +<00S/7@-@( (P/@ 0 Ѝ0%+B@,#X@-P M# @0.S [00S Ѝ .0S 00 00S000 l ^P0@  0R 000@0,0sM%sOse,#Xsyss<00S/7@-@( (P/@0 Ѝ0%+PB@,#<@-P M# @0.S 00S Ѝ 0S 00 00S000q l 2^mP0@  0R 000@0,0I%ss,#<sst@-@PP  @D Ѝt6@-@PXP  @5 ЍtS0Sp@- Sp00S p@t# al0p`vP p@Puq@ 0p@ j+tw,"d,#XP07@- S S8l0 Ѝ0ҾXP@T0PP o?@y Ѝ0@f?0 00 %@%DtP/L0@-0@S 00 $0$ @,"+," H'P7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@P?׾ Ѝ04@P,0  0 10 %0%,,0%4,#.0/0,#hP/MP @P/"@-@| pl d@0TxSPLHD@<8@X%It4tttu$uHu|uuv#@-V0dSK@S!1 CRJT" R&0CO  R < < < < < <  < @P3 @.A C#R  | < < < d < < < < L < < 4 < < <  < < < < < < < < < < < < k Cr \ ,0Ѝ10S Ѝ@00S  00S  00S  00S  00S  h00S  P00S  800S  00S  ~,"vvRvoO--@N<M`00PP*0 S 000C S0/   00 Bp/=pU:Y U :TЍ D0!R1@0P S 0,ST00( @0D@D1!0C 0 ,,%%C-PMP M 0-@:ݍ ЍC` @s=0Sڐp吀吐' =0PU`^=P0P = @@ ݍ Ѝ =%v,,Or5jv%v.P@-  0S 0 0ЍP  R lЍX 0L H 0<0408000000000%9%8vv@-PM 0  0 x0  @ld P 0S>000D ;0Ѝ,0P ,# ,#wP @P/ 0 /w+P/00S,#0/@-@0S,#0/@-,@0S0 0j00Ѝ,#w-0/@-,@0S0 0X00Ѝ,#wZ0/400S/(00S/@-pq@,"+P@- 00@ ^S00S00 Ѝ0@ (%wp@-P0M % @!`P@@0,S  R0S 0 ,R 0p 0B0SX 0Ѝp40@0000$ Z @,","֚ww>wP@-P A7 ЍRS+DSSS 0e C R L L L L L L L L L E C CS -S 1 CR 0CrS dSWS ^S0SM0wS     0  E000 0 FK N R WR Q S-00 0  w,"x 800S ,00S 0P//,#T,","$0P/0 0 0C/,#\+,"@-PU  @; Ѝp`@7kPppQ 00S0\Q0S 0S@V ļP 00$Q00x ,#$@-0 S 0*( (Y Ѝ * Yx;,"hx@@- @ q;,"x<P/0S/P 0  //7oP@-/s 0LP/,"h 0@-L   Ѝ,"hx @-`MP@ᗺ0-S0p00Cp S T 00ЍU TP PTU $PT00W`xKxgO-P$M cLP 00S S03/0L0$ЍeL0 @PpXX 0 R @@-PD &$PP 0@s093@!+P0P0U0 P @0+S3P :{:9P/P0z@ pZ#2aD[@TA7nP0S -P00 0 +P0P0P aK[  0 p0 @ =RP   R R tq000SPP000p00CS  L 0U?o 200@S 3/TWU 0 [ 0S00S0000SL@40 S 0_P&00S ,"h,"+xxx@-@PM @PU@`p0@ mPzPU   c(A R  u 000CSc 0 @ 0 0 0  RyV)00SS# P|U  U Uc0?o20RP 2/ 0RP0 VW 0 {Ѝ 0?o2RP0U U U6W0 0S00S00W 0 0S00S000ESX RU U U , 0 S0R  c R U2/U~00SS 00S000 S000;S U000 0 yy!y=yXyy+s@-P`@y000C S0 ` 0 Br ^ ST00T00VЍp $`wS 00xK 000S/P/,#,"@-XP H0H@ 0S0S  0  03/$@y,"% 80S/S/ 0CS/$%O-@pM8Q 0S [= 0S0 0 Ѝ`V/$P  0P ! AAQ-P $ SQ@ S0 0@@Oop B0 R ` 0 0S Wp0p%@- PP0% /-4M D20S8ÎP 2     P2 0S 104Ѝ001 0R= 08"$01S 10S 10S1 `11S(  P2 T!2 R (10P!000 0 Q R  RP0 000S P 10S 1[\ 1P m0S} i0#Sy ,0 0S P  0!,#,#,1d,1T,x,#,% +%,"@-9,#@- L6 Ѝ@-PA9`@@@Ip0 `U Ѝk@-@9P  {7,$G- p$@P`0  )  0@@ό@ p\p3#@- d0  Ѝ(7@-P@2#@/ Ѝ0B@@-803?B3c/  0 OЍbMB@40@-0@@T OP  0 %,$+@-@0@%0$R/ $儼,$p@-8p@-@P7P %@.P @800S ,0 QT㔴p +P+@-P1@0pS Q*㭴0 0 R0 ?o2 `?@P 4W ^@Q \㎴000P T @P I4` Ѝ4,#t,1+V@-@P 6400o/O-|MpP @`; !1 Y0 00  \0ACX 0s0^YP P0@ 00  `0 W" !Q0S|Ѝ@00S0/0 0 0OOP 0h0S0  0C™\S X HQ/1!0\01 0A0A1,#t/fp p p@0@(0@ 00/0@+,(@0p@-`80V0 FP@ ӂ!w1P@p+,(T0p@-PH0Q@0a0Ӄ1` A!B0 ]`Pp+,(0 0/!3+,(\0  Q0H0@-0^@Q C0/,(+@001P/  R02:/,( 0A+0Q@-@q|0A \0L1!0rs 1!0rs  Q ,(+@-`P 0R@T0   i30@0~qr 02C Ѝp+,( 0P0PP@/+0 :Q Q .Q 0?Q  \QQR/ R//A-Hp`᧽0P; R@10C @C" h20000,(7p@-@DP0Ts 00CSp@W@pqp+@- 0 G Ѝ@- @ Ѝp@-0@PSP b0Cs0S| 23 0jS BS bS 00mS tS@p 0lD,#Xp@-dw`P`00XS;@@nkN g,PVc`p!,(,"!%,C-V0`S@p$M`$Ѝ:S/ %S .S 0 pX@0S0S x?S \S0S 00@ 0X 00|xX@KXBX DXV @LH,X ʰ ʰ ʰ ̔ ʰ ʰ ʰ ʰ ʰ ʰ ʰ ʰ ʰ ʰ ʰ ʰ ʰ ʰ ʰ ʰ ˄ ˜ ˰ ʰ ʰ ʰ ʰ 0 X ʰ p ʰ ʰ ʰ ʰ ʰ ʰ PP50S4ǽP40S 40S Upqz P Ps P`4 ipq <Qa~ 4Q0V{, Pv3XI 00BH@6X? `  Π       τ        Ѐ               < L   (  L   p ϸ     `    Д Q0R 0 opq 0 t2Q0h2 d20\ Q0C0C/᷻g괷pqG0 QQ01!0 Q111181 P  T10 { 0R0:Q0Q Pf  Q0 \  0 Q 0R0: Q0DmSA Pc ^ PHH_ 0!P,(P,(,+,#p+,"++{ 01%,H0@-@@00SOoBi(0(01 0 ,#,",(%,+0%, 0@-P P0P0^ $@ S \0BS@0^ @S \ 0$@ S \^ 0R0 P00\ 0/ R0 P00\ 0/@-@P N000@p@-@PT `0S`00 # p`0@0000 S`@@@A-PQ@` 1 P 1 PP7`ЍP叺p0W"0 S 0 @o0 0PP /00o㣯/ ⟼U0P 0/P,#t,1A-`pV@0  ` \  R(P  RPR(SR 0$QR@ "$ \ (P  Q S ^U 0S $PQR $2P 0S` 0 00`Q0S  P\U 0S `0P 0S0Q  R \  P  RQP 0  0 U A U0QPA00  @-doP/,1C-pM@@8`0C`F!P/ < 夀 AYЍ I/o0"P R  ? 0 Q 0  Y0 ?0 @,1O-pP@$M0P`@0L00SF RC L R Q R*H)  H0 0@000000 YH  )-   0S0S @ 00L0`00 0CP$Ѝ@,1 0   /,10A-0@S 2PT(`V0(0l00S@`p #(`.pq ɲV@00CS/s+,1++$1O-`vwB 1!0РS ЍO00S P@̐00CS & ЍOI rq  0 [ q WQ wP㙲@ Ѝ%ʘ+%ʐ++p@-P@T 40@@@ @p `--@,1,1p@-PH@U p@\Qp@F(0?o2(0,1l,1@p@-@P_ p 0$P  0U@p,1@O-M"7@040p_t780<0h7C@ 9P70S <70/S 0Ï0@{t , (0 `0s007S(0 0(000,00P$000060"rs   T000S0S@$Ѝ,0S(0 00000 0C000L0H # 600 000zy,  0S{zqtzq0S`PJ00 00S0 @ y50S PIUPe U 0U 0P40S 4L H_04P4U 'V4PR0 QR S P PS P400S0R0S44L0SP`pP HL0#PPUP9  0 `hPp`PL0 P* G 000 0`0 L0$ `L0 `    h  D0PD0$ T 0PT@X\Pl, j, ` P @<80T0s00004 T0PU$00CS$0T20S g000 0`0 L0f408 CNPPJ h0S8 Z5 ` p J!` 0C Q00_0p f0S0( 0P a 00o0 T0S0YPPYP,1Up 1+ +0S@0$0`P0S 0S < @B X0C  BS p aogZ0Yp0pP0+P+,#X,",",1T,#p,",1,",",#,#d,1@,",+p@-P@P  08P  0T0p P$@,1@p@-P@7  0HP !Tp @S PP@,1@p@-`PV00 1@0S 0 sr P^U00 s00 ( 0P p 0P tu  0R0(P Vp00@00S 0Sp(0(0Sp p,#8%ʘ%ʐ,1,",1p@-P`bU 0S0P@T 0P@|0 pP+@ê0 00000@Pp@*0P00,1+@-陴0PP,1O-̳@c004M040P0P 0 X0S 0  P4Ѝ0  $0 0$0$0X S38< |r utE T % `p 200@_ 0 rs 0S0 P @0s00Q 0S/\2 c0  4 Q 0Q0 P@ 200@_X 02X0OX`pQ 0P `p @ 048<00 0(00X0 0 00 0P|004 (sr, R0S0rP 0 (Puq@ *F`ut s`pw<80W 0 s00  W0|HPw 0 5pqo P@`p0X0,1+0@-MIP @ut 0 kЍ0@- 0( 00S@,1,"p0p@-@孺@P PP0 P 800S(0Sppp%4,1,"@-$@$0S000P @,1,1,#tO-0 ,M"0Qp 0S?uPy tC 00#  `PL ,Ѝ4S0S (30S 0S(0S 0(0u0(0P+ X`@PJ@tqPNױ멯@PfR00 &PlBlb0 0 0(0a0S 0S D(20SX 2``FS iX1H1X`( 0 @Pᜁtu0`V$@PxAtu` }810S ,10S  g@PtuXZ@P 00000 0 0*P@ 0S 00SJ YHSE pq PQ 0S 00S1 ,1l,",#8,#+,#X@-(׸$ 00000S@ ,1T,#@-(Ƹ$ 00000S@ ,1T,# @-8㲸, 000M00S@ ,1T,#@-@P 㜸x0x0Sd㒸㏸P@苸㈸ㅸジ +  1A-@TPP l묭"+daXB@[X 0@  `Ppj0S0S 0X 0?00f ,0 ,00SA舧,1T ++P++,#0G-pl0P` o @ aP 0S 0S S,1XA-` pP凧@M'0Up0P >r|'p@-HP@T 80   p 0 '''%8,1XO-,RAMMG`'V 0A0 p0 P r0S0 000AލЍ0!S  aPA>04S S S ὦ0S  0 [Q0嫦0S 0  C 0Q/ 0   ^R000 Q\ S$R 0C 0 N0P0000\\   0C R 0 C%8j,1XO-pQpPpMW My@xcPJTpd3dC  \\Ls PZ PUA (3T Vۍ ЍpPS@DT2PR@ OL @@~ 0 &X &| U@ &T@"0S000*P ;04P ST@ 2 Pp 0Q 1T VP 0000@ PP0 @0P @ PQ @000 0Q @ Q0 @0S 00@ 0 S 0 S 0 S  P0/ T0p0000,,1X%8&6,1T&><!Pj0@-@ʱPñP |徱P l幱P \崱P >P>%8@-@P @P P P(@SO-|1M0S" @`0 ЍO^pP400 0 Ppyx@`00S 000S  0P Ѝ 60 000 { q% o% 0S @`,1X,1T&,#p,#d0@- LLPR^0S @T 0 B,1X%80@- LLPR^0S @T 0L B,1X%80/,1X0/,1X00S /,1X@-NP =P=PѾ@-0,1d//@-L@ p0 P~S0PЍ,1d\ QS *0/QR QQ*/0000/@-@P $000000/0S0C 0//@-0 #3P Ѝ@- R@PS/ P >B`Q  )$` PЍpA-`pP@T@  A-P`"F$@p ᦮PQ ,0 0(000ePЍFP@P7P/P?/80@SQ 0@p/a0@SQW@Q7@A-@`p?PP@@%?0P0U0S P@s@-0P00`a0C@S  x x  x  x x x x x x x  ` x x  x  x  x  PЍp  000@@0 0 0 0 0 0\/\\A-1!0 ij \[Pa@1!0 ^j[S[\_ P0^S00@@]S0QE ]Q0'S! [S \SB@[T0 T nT 00 \TpR0000S[Q.CqQV 0p@]^S @p^404 0 4ip\00,C,C4oep@-0Pt @R RP D D <'@D@ p@衙 @&><,C,CC-1`pMQp@P0᠁ `0Y 0 .PR l1@d1`0 Li\Y R T R 0 0P@$ 0 0 [S[0[@0[S [S . Cr R 8" [T \[R@]S  000TT[T@  \T  \R(0 R Ѝ,Cx,C,C,K00@-00M/SP M $S+ +S00+ 0 0 9S#\S @P0 0 %i0IS@P R00ۍ Ѝ00@00 S00F@,C,CO-@T Ѝ0tS bS rS aS @{S000pW` Gp 0S 0QU t0t Pp0 `hb`0V ӭP0 0"P,1h,L0,C,C.0 0\0.> 0h S \|.t>0 xsh Q  l 0 p     P   0S 00@0!000 0S 00@`0`S 0S @p#S ;S 0 p00@\ 嫢P  P 0S| @,Sv p0S 00@P 0S  00@[VX<,3l,C,CZ%PM|,C . ,1he,;mVCq&; $ p@YP  0$ 0     呻!1 !  0叭0 $@$(⇭ 0 0 0$00$0 :00܍<ЍG-@`@lp圀P䘐U@T00S Gl0h0@X0 0S0 0  P,1h,C,C,L0,K,K,Kp@-P @"000P @p%@-@ 0  @0%0p@-P`PUp<@P 00CS0ip @hp0 h,CpjA-p`hB R4 RR R P$0SV0(  R R <P$0, cP000 P0!i;PQ$00P0PT0, PP (00S(0 #R nR0V ,0020#00$0,0$0Ih( T0R #R nR   RpG QT000(0V0(00P R R0   $QT0S $v (0V0(0 00  T0(0V0(0,Cpj.o,C@-@X0  0S 0S00CS08hp Xt0 o,CpO-DMX0`SpM00S 0S c3#X0X0\030 `00d0尓XSXP 00CS0gp X;X &pP0 `c0 X PލЍP2 gp0S @60.5P 05P p4S /680p0p4S \PP qgP 00\04Plp0`0d 0R00d000S 00Sd 6P00 2 01b00S +)+ P0 b+0+0Jd6Je 0h!: P*5\PP g81;P\e ( p$p4\0pp!4 0`PS(00;PX70>000t0\`0P l000S S P@ /o"0 l 9(00(08,Cp&6[ ,G,C.,C:0WRj@-@P b^P@-@@P bjp@-@PPp0 aw@-T`@PP E 0'p0 ' Ѝ,K@-`MQqM0S000@03 0@ū0S  0a 0 0S S ` 0Ulr:@P *0 9 PFf 0A00ڍЍ,K,C,Ckj@-@P  0Sxa p`\0 `  50P S w faЍЀ,KG-pA嘁!0`PU , R:(,>0(0 &U# \U   0 R`Z &R\RP` , R:(,0(0P     pr  Ppu PE ,  R:(,0(0   ː 0 ,K&>S < ,T ,T ,T ,T ,T ,T 0 ,T ,T 0t 0 ,T ,T ,T ,T ,T 4p ,T 4 ,T ,T ,T ,T ,T ,T ,T ,T ,T ,T ,T ,T ,T ,T ,T ,T / 9 /p 04 ,T ,T 0\ 0 0 ,T ,T 0 ,T 4 ,T 4 5t 5 6 9 ,T ,T 9 :L : ,T 9S4 0 PS0@oP1  Q Q* S  H ~S 0Ri 1cQl0Si0H0Rl0S 4 0 q1S Ps ^S0@oPfQL0 R: L `0p岣0080S8<;8 00 \04 0g<0S H0S[P80S4PU 0`  EP0800A E4 j0T P 0  004 0 0  0;00z040 0:倚R <00sd 僡0P 0S 0S 0,( 2P2S 0 H` 0S0`V: N$* '00@ 9@40S /  0+_ H0$P x0 0H$0ϧ$0 S9`0V: $ `000 00C 00P0 a8 0R:`8 0咙 `S p L^,8 P0   R: ` 8B 8` }7'1 01S:` 007 i70 S0``78 00 g04 0M<0S  gPF40800 WP80Sg04 0'<0S  a80S0p4  Hɚ`P <000F400<0嘆04 <0S BV 0400<058 00 8V04 0<0S *fL0 R: L ' `0pQ00pY R  Q \5 0L^4000  P 04`Z Z 0Z000 G 00 0 0 VrX4Z 0 Q\ 0t 0 |0  0RQ7 p0V`XCcH0p0<Hp<(0000S s04 0V<0S p PA #000Q 0 D00 p0V`0  `0P   P\  p0VX`0 0 P[80S0s T"Tb/p0 8W]04 01/40P0 )/P 0S 00Pw80S0s!9/p 4 0 /40P 0/P P R0T 0`pL<0p<e80Sb4X_  0`Rl0#0VT*0000pW(p0 1(W$0 p09,C,K,L,3h,C?,L4&7%`@th /*,Ck!`,C,K .P&;,LL,K,CdH  !  R 0NP 0 pW* 0$ t(1 0X`pH0`0h<Hh`<x0h00 35<0 0R0((Q 0{Q  ,3hP,L4p@-@P`Tp0wS {S sS 0p w.P 0 DX\0`@p h.P `.G-`fOP;PU006\p01@ R  pFPVCGtXpp0!S < CrQR2 > > > ?d > 0  [0 0 00 00 00:S 0S0S W00 000 0V 0S`: SP 000BS ,Ldp@-P0@T P ɠP1 0S- @, @T @ @8 @ @ @p0 00C?o2S Ppt0 0S00X0 0S00<0 0S00 0 0S00@,Ld-E 0@-MMP-@P  P{[ W-p4s[+ l- P-ۍЍ0.H0  BR Rp R4 p/&6&7p@00CS0 S0 / 4&6@-,A0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@gf,Ml1@-01\ @T P#OoB\@T P P P QQ Rr P\ p\ P P Q qR  -J,Ml0@-  `Ğ\ @ T\    %R    ,Ml-JA-pA0 5S$\! R  (P 8!宠0  ,P !奠0  4PP6 僖A/<0S 00 <勠P`p夀0U00S 000\P FP D q000 kP&S-J,M AD&7p,M p@-@0` /T  2t4d lUP`PT p qP000ST @&6&7p ,Ll s@-@P P<@P @0?SP@P` ✪p Ѝp/$P@OP 0S S @ꠣ0S00Y A/aM0@-p D2>/i&7p@-0@<TQ T00 020001S R0Slp@vTX` T@0$ @H42T(8  @, 2,Ml.p&7p-J@-& 1.&7p7@-@P;  ᪒0S 0@T -00 Ѝ0'0"S p`@-@P  p YЍ<0p@-XPP%0ATp0 "R   DS " @DĈAp% 0p02#L @ "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L "L / 0p02#L "L /0S00//00//H0H 0p@-P@!@R0 U0 ,0P01p,t,01//00/00/00/00/00/ 0  /, 0  /, %00/700/O00/X00/00/a00/p@-@G,,00/@-@9,T 0  /,,7 0  /,,O 0  /,,X/00/00/00/s00/{00/00/00/00/00/00/00/00/00/00/00/00/)00/~=00/ :=00/ %00/rN.gb@-0  0Ѝ@-@ +@-  ,q 5@-0S04c  +@-  ,j @-0,Q,T @-  ,TO( 5@-0S04c,T @- @-0,),, @-  ,+3 @-  ,* ( 5@-0S04cz,, < @-  q,  < C@-h, < @-  `,, < @-  W,  @-  N,   q@-E,4 e@-=, e@-5,~ e@--,` @-  %,  @-  ,R @-  ,  @- 0,, @-  ,  C@-, @-  ,, @-  , $0Qa @-, @-@DuP d 0   P 0@-0 |1嶈,t p@-@-8)@-8 0@- ,@-3@-ES@-T@-@-qp@-P AN @H4S84p `  `00 @-PPL04S@<  ` `,n,T00 @-PPL04S@x<v  ` `,F,,00 @-PPL04S@[<Y  ` `,,00@-<<7P d(0  ,Q,oP@-<< P d(r0  ,),GP@-<< P d([0 y ,,P@-$@P G,tA-\`)qW H5@P |A30 ބ,tM00/00/00//A-P@`100# 1pS021(S%0pu10#1Ux  Uua r wRb1FW80S  3/1SA uL0p(q S0F`b -p9 / /O-Q@`uPMPP%#J S`PP E 0  0忍pW 0S  xp1 v1 `Vp@pGqS100C1ġ`F10Q@aQA\00Q0S< 10 \`(0 p0 0S1S1S  0p! I10 CĔЍOP G  $p0S 0V01`Foa 20S2 0 0` >p@-@` P  0p@dEX@-@Q7 d( dP d\ dh dt d d d d̸ 50S04c @   埗P X03S B \X T T L0,< ,, ,* ,+3,) ,G,F@-@Q: eT e| e e e e e f 50S04c @  WP t03S B> pl h hd d`00S  0< ,T ,TO,Q ,o,n, ,@-@ Q? f f f f f f f g< gH gT 0 R $b @<  C  P \03S B lh d d` `\00S  , , ,, , ,  , ,,, ,p@-PQ- g h h h, ht 50S04c p@| | / @`⯖P 3S/ 8B A. p ,q Q h h h h h< <4 40 0C( $ $/,R ,  ,, , ,  Q iH iX ih itD D<0 0 0,00S  /,`,, ,Q i i i i0 0v( (C  /,~,, , ,  Q j@ jP j\ jh jt jH HX@ @< <8 8C0 , ,/,,4,  ,, , ,  Q j j j k0 02( (C  /,  ,, , ,  Q Q Q/   ,R ,  ,Q Q Q/   ,,4,q/00////00//00/00///00////00/00/00/00/00/00/00//00/00//00/00//00/00/00//00// @-@0@,Td@-@0@,Td @-  ,, @-  , @-/0, C@-r,  @-  j,  @-  a,, C@-X, @-  P, @-.0, @-  ?,  0S00/ @-  1,  @-  (,, C@-,  e@-, q@-,4+@-  ,q @-  ,R @-  ,  A-T`)qW @1@P |A0 娄,tMA-@PP 0S d`/P  .`1S0RP /P 0p RE .`@-@P F P x 6i0 0t}0i000p@-P` A Q 2@D D"~<0e#Ap RP*U<0p%@-%@%@-@@Q@-@@R@-  $&7pdp@-@0S*vCP) ]^;P j ؍Lj|PWrXr(C@ P < 0@ S< 00ppp,M-D%O-,M@0P0 T; R0AT 011!0 S01  R01;X_P },0S  R3/00S 3/[1P  SP \0P 0 0S^`: p` 0 011S`@S0` $0很P$0p$0P``Pp1U00$0PeUP0!S$0๟000CAP PCڰDPA_A$ Q!@ Q^ 1  pP$HH &0 `p0C0CS0V`0Z `1Z츟0Zڲ^ 0 000 0&#0 "P P V`x 0CÀ  S CUPPEPE_P0 'wP ^ 0 0@0 P BP LKi1 0 w | Q 7/w+눷PgXP Pl7000F<^ބ! "1 "0SN SP 1S b !ġ1S 0C" !s0R11$PUL"Hfppp0 vP $vR|va!`P 0PSY *C 5j0 j o뀥-X P|500xPF qPC >P' dP% <P  SuP5P 0CP  @@PV 400C`F V$P P P0S p400C`]{m1ST !0C B/!?1C_xP00 S11X@zP`PxP@a@1S50200D(PZ) @@P y } }00@S } x ~ x { x x x y x x x x x }0 x x x x }L3P#0CP?P* <P >P P10!1 NSPNQ0^ B жr0s0Ɣ P P?@ "0C S񟗊 y y { }< { yaWvPr P1aB P uhz1S'ʰ1 B P uYzP j00P1 RE40S 3/Pf PP e P,ЍPR0j \ 0Sp0W 0] 3/pW P `B P xu e `ze00x00A>0 b02P 00P000w`ye,MG&7p>-DRS&><-D&>8 001/,MP0 R0//,MO-p`*@PP [ ! 0P @ Ѝ0"00 1\$<0P0 00U040080 0<0<1@0q00D0`80H0, 40L0$0 0P(P1  @,MP/D0 R/0@-A1 P -e@< ؓ,MO-Bp0 "W g0p 000y Ѝ`((0S 0S nP W000 @  S! S0 30S hnP W W 0 0 0 R @ S 0 JnP W0S W0 00` S P0PS PH0SPP(n0 003n0S .nt0#?C S lWPU  j0X!0Cs0S;3PP0 PEYW,M&><@ UUUVO-$MHZS  R0P 0L`nDp> =0Y0 0S 0g g)Pmmm@`0l@0@ 0000. 0ESET 0 D 0T00Ө?0S0 CR C 0DS0  0_gmX 2 !g0  Bu4U P0{ P>  PN P P!VUA`E Dy@DP`0f ff@`"PD P AP;  JR !   ` D0y0@0!P`1 V0p00@  \`Zx`F`FV0p00@  DPEqy@DU`E¨` Y @ 'j@T`— R    BIV0S 000 0 0$ЍO0Y S ,M &2c3&><&7pA-lP`Pp `l@l@0T N`P@ P P,M@-P@p 00T0) 5p@Ѝp0 00㦉0 h` 0@ x2@t 0P " & l,MPp@-@TP0Ps D` R : P 0S@@Q@p& l,M@-@?,M0Yj,M0mj,M-@-@00$  Ѝ@ Ѝ/-@-00  Ѝ Ѝ/-@-  ЍЍ/@-@@.@-@.@-pP@`M,0 0( 0 00`Ѝ@- ЍPO-M P`@pl@kUjT0 0cP 0D0PSY 0SV L00SRD+PPL00PTP]y@DO@W =p 㻂PQWpV`KЦo`0 S`K0 p@PC@0 :PT0 0Pv00L00$T >Z  q bLvbbЍ00D R00S 0S ˋL0X#3p w.qP 0 q똰EEcc >40 EGpfP`EiE`cc,M-D@-,, ($ +ЍP@-P@`$0 0  0 00`Ѝp@- ЍP@-pP@`M,0 0|( 0 00`Ѝ@- ЍP-@-00e  <Ѝ Ѝ/Pp@-Pj@jp,M@-7@- K@`3Bb$HXPU ^% kK00h@PU N%T [K00000S$$% Ѝ0,gA ,X ,N&7p O-DAM@PP4q@ &@ W ٫@sPࠟ   FPKAߍ`V Ị zm`PX Y  ᱫ =R@ᩫ@0喆 `T|j&7p2!h 1@-u0O-MM 0p@ɀ`P2 PP* P :mP 0S0 0    MPP咋P 0 Q0 0P,~ۍЍ0P 0 90  09  H',00S/ 0P J@-,\,@-TbP 3P </AE(?"P@gA H'A-@M @ێ0S0{1%P,  ΎV0S#K|P  c0Sl Y0] x)Pe*B@PaD'D*#B^&'ЍP@R<}P'P'20S "AP'.bAp 0$!P~<e} X $P 0)AT 0PP |AP p`PP 0q+Q Sp 06&V`T(p`AT-}@p0T-:W?Q  R@4Q p0Q  R@AP`003/P 00  h0S  R l 10!@@P,,t,L.@-MM+@(z+(zB+(zB+z(1@PލЍB(@P 0 T @@@@@ @@@@/'B(? 3 1'-MM+ z+L Qz+ |z+0Iz ?P  >ۍЍ 3 1'0@-@M ⃍1@@##P @  qP A0$*!PRU)QX&Ѝ0RL00S 3/P 0$003/0$*@P3%P/[P+W@P'@P# 0P{ XN;{  0S 0_ Z'P @P4o0m&([*00,,ta : E-D-D@-@M 0@@ ?V#P* @@b  q{P 00*!R00$Q *@P  }0S 0` 'P%(*Ѝ,,tO-`M!  0X#*0S ` 0 SS 0Ӈp0 S00C `@ć0 S:6PP@ B pQ %S0S iSc %S, dS 0T PsS(200P 0 倠ಠ@ZR  @P %Q0@ 0S0 aRT @R$R0PPR@  T 00S  0! SD 0 @S$SS0P @U: R R 00 R @ 0RQ\P0S  S t00@Qb0cR^ 0 3/PW Ѝ 0 x&><7@-@ +PU F! SG00 Ѝ0llP Xn .!L h ;( 0$[*,X  P ` k  (Qp@-P @<00S   0 p@5 0@,Xk,7@-@ PU  ~qG00 Ѝ0PP | j~d00S L 0H[ꢌ}0 ,SM,   ,Ts6 ( &7ps@-8Q`@`9iOW-z x_c}<_cy m_c5c._5ze 0 A*k@Pxxf 4P L@?o^r^ "yЍp-D.&7p O--{MpP` 0{p F 0S  P R  0S  됵P /~뀥P *~op@T Pe   DR0B? 0SM*P "rF@P "viF00ˆPƆP\; P  lW; ;0S ;P ; 4*00?y4"0{ߍ4_3 ,60z"!`׋؋ 031,0l0,0L,0   L 0\P600Pz?"!!0 # R PV @ YP*U l @2 0S h2P +A&0S hPU L P0  T 0  SR (&1P 7} 1 pT 0I2_z?0YC0P0SP @ 0V0 R0SQ շ|0S/ P ]!xk  PS 2  ,\&@tptb %@f,,X F (m 7, :   L, q V ]30@-0,MP0 00 0\PPP@P DDv@0Q ,p,Ѝ0@$ &D&7p , -O-piMs?!0WP 00iߍOЍ/l|@PX1P L!L00(@P jZ` (PPW0FSV030#Z0S k00W"D!` P Pmp0W0DU80P , 00H)PE)j,!  Q-O-p0MT@X   p$p} `V X @M'U` CzPPᙃP5@P ?H E0qPU 0'SP0U*S/ P y [ k0@ 0 0H0 ~P11Z 9w0_p`PUQR ( 2S022SP0220C2   S`` 6v$00 00( 0p|PW  @0   (PU bb(c0U 3 '\W 0X0C?o20S [y`$[`cv@0Uk[[v00CS0000CzR0U Y$0S  r5S_fvi 0%S @SJ B* B➇D0 0y/00L 0.RP 0 01PH00ZpI@P 0A0 0X3 4Q5 f}S[v00X (S2b@[0U bHvz  0UX ~_S[`5vqoQ PPW  .WK0ЍO Ѝ/  ^  /@th-D&6? 0@-CMl1PP 0S .Qx@P 4sCߍ0 Ps ,N ,O G-p@ 堀堐PB`AT:00Z W ,/Z 000 xP EQ 0 @ &>d0 @rT400ހ0 ,/P40,   -8 4d0 w=C$ CFDTrP, 0.̟ Q(]?P 00 ( 0 0uPPPPP;@<,`0tD0D,Dq,y \<I /  0p>0a Xv2r /PP\  /PP;U 1sS 1lS;"000 \P p@ v '! H#dH Qp0PKP[P{1@+0~( lP gP  bP ]P XP SP NP0:4: @p A*0p 0HAup H0Sp:K10d*dM%P 0H0 H0Aup ( APPH , `$U 3x 4\PPP@;P@- ,q)0xV)0wQP\8 0\8UXDy0 y?T. ()0z8;Ԁ@PEPSPN X0 "\6SE p0 6p@P: 5 |tl `[7S'  H@8)@(7@ P 0(AAP\XP@Ps:4S 0 zP 0'APpOP 6H'X0b@Pal\804'8\8P$W 8p8 uP0&08P 8p8u uP0060&S\880\8P 8p8]0S \&8P 8p8N puP000S\80\8e.P0S\80\8P@sT %0}C\8%0|;5T$A Q0:$R$ Q9ğP \0şW|t^H4   3Ḧ4SP  0@?S @P p4{ 0Q0:$R##TğR#$R#W%HR $ 3   Ts0S1 %`P 2@T R[NHJHh#00S "0S 4#tcv>3S3 TE 4"8P0  0@F0@P]hP$A?&rp@Px080Ca@,0,dP pdX0S ,} _!X >0S@0 < X+4AS< ". 0 0S D}D=!W5S x!"o0 0S $}!XuXz,N 2, P&7p s9y  &><&d ,P, $  H'i,RF (  Q / !,P (   @,O ,R ,SE ,Th      3 > J e s v {  f U  ! s ,S\ , z ,Sc,R( ~  ,R     $ /,Vl > ^ v     P 01/!PC-鿏P@,MpJ~P3S0 `0 0`:00 0`@0`00n/00 P 0P/S/00 0 /S 0/0 P0% R $b@ 0  `@ߍ    '@-p`CM|@}PlP#d0RXPP @ W<0080 `0(PCߍ P 4,, 8 ,T@-@ @,@-0  0 P @0@ 28 0/P $  :Ѝ, ˸, ,X 00@-0@XMP0  0@ P x x0 t0Ep@1P0/Q   LL 1 0/R@, ,@Ѝ0,N ,,, , 0,L-MMXPa}P  m m0 00SލЍ\0\ \VP L0 (0< 0, ,, @,, ,L, ,R O,0 @-RCMX6S P \8lP XoT20S H2\6S 81020"(52`Pr\8. T^X10 A>:4S !74\@B10 +:4!SO *00 0 B ptt1@P) )1d TL < 0S ,!,$!$0S   :<FP\6S V $<sCߍ 0 B,N Mc ,  ,P ,P C O c,RF  v,R     ,O ,R  #,Sc 0 f z @-@T^ S C @TR00S\0\ @B_TQ00 "#0  @ ! 0  @  0  @\RQ @  Q  G-p@PhM 0S'phЍ0L0 3/P 0`  Q 1/P P p0ᄠ80:/P 0 083/ 0PQ0//!01000/ 00#0//O-`$MPA@T z p)P00 0S 0S0S$ЍP P00 S {S, R ,0S R : 8 80R:P#3///@-@MP Mlp" :  *`pu Wd5\\ SS=S 8 d3R 0 ,d0 _ڍ ЍTT 6 J@-`QM p@ P w PP ~PЍ,{PTP0 p2P@$U@@dT @ @Y0 @a P X % fOrO-Pp0@0Mw'PP `ĐĠ0 R 4 PЍ 0L03/P  0sy놁 0 my  @$0S P @k @k`, rp@-P`40@0S 0 p@J(k@-0MQ!p0`L0 3/P< 0t@T 4/@0 p0'y 0"y 0@ $0S @j$0 @jT `@j @j@3y0S0C@ ,o$@ 'Ѝ,  / &.0S/p@-P@I 0000p@O-p@P|M YN0P,0+`~,|P|Ѝ` 0S0 !X V 0S0L0H 3/P X0p``P 1,0000U/0 0L1<00 00RpP ,0<<0@D*@0S FP 0@  !D00 0S0 !Z Q 0S0 L0H 43/P4 X0 0 0 \ Ө@-Z P 0P 0Pp PQ` QT{PQH "P <080P/,/(//!#p@-8@Q0@P@DPp 1Pp&p@-P@P  i i00pp@-  p&@- z p&G-@PMP N/| i0 0 s0S1 0S XP a,P ލ}0S }0S1S P ,xP @l0 1h0$1d0(1`0,1>1S nP >$0`>h @ppԠ( `p$p `  X WD$0῿OY 4 P 3S4 @c D| @|0000? `䀍0Px Ru'R 076`>0`N C(Q0Bn Q? C0.P *P P  ,4101PŸ "b`w2P  @000@A0" 0N?P0(S  0C Q 0 >0 C,4101P吀 "'0!`9J` {KR {000`811!$10 100-!(, X<@ax1P,a( {1S%4 ␐0! 0A 0z ,001 "P `0 R  ,001P "`0\ ? n % {D},WlQ! P&><  '`Q p@-PM`p PP 0fp ~@P  xPP 0fp P@PQ 7/PЍ!x /@-0 0P Ѝ ݀@-0 0PЍ O-aM,MQ 0`aݍ,Ѝ@PEP 5wPK p0wP0 QpL4PpUu80$P 00S 3/p0$Qrbb>0Eo`YG_FPEwP 0000!!9PP 00S 3/pO003/No,P4vP (S("+"-g b+b%g`uP@``VBaV>+"g+bg3\QQ0QUh $P 00S 3/p $QUY ` p0 `` pxb.;8/ 0 ``px`;".6/0S3   f f0 0}`PxqxxU" b +`P  P|^P"f+"fb_+ "`P CvP# >vP 9vP 4vP /vP *vP VxT yf  uf` (}P  H'!,,t 3X6 5j 5. - 00A-p$[?p@` PAP0 @ p> C 0 1/@P00pЍpP@00003/003/$A O-PUMM.\h,@4Pgy.zcyQ`x(lEJh 3T`V`(0$S^ 0(0(UݍЍT   70.07 00P00@P#Ppύ\40z(Y^ 4S = 7h400C27\4=1 V =6h400C26\4=1 0 00  000000pp`d , \044040s -1yv0 00 00000 0zp` 0440_40s -1ଔV3 `v00. `lE "e\5@0[^ =2XL=1pP0Nόgph \  v00$? 000,0(0S00Ӧ?$N?@/&#`<\T,0(04@S0S N?/$$04pW$4 0}10  A (e "#e e4!0p 1$,01(,L!!H48> C6$1^(1)041 $,!0 (q,! 48qHL1$Q pz \w^u 2Ÿ@p"\0Ÿ$1H0!$+ 4Nx2P p>ؠC\ $10!0$10 0: |0G80 ,! (6$H,@JS  GPq<PM ;KSI 0.$10B04!8C0(1}1S0}1$1S `4@@,-D&6 YW.&,t,,(,P, '^PP$030/0@o//BO-@P MMA E0*!Rp0)Q`U0 $0   /P s Pp ,}*'0$0 |$(pP d4\,H ܍Ѝp 84f0Spp0 @0 4p0SW00_ , R\  000x;8,9/PI 0  x8;,;/ 0 x8;,9/T08SS0CS񟗕  T T T T T T T T T T ,Sn "Se S P0~  R{ <p(Wv  &P d0S P"8ZH8 ~8Rd0S $"8L\0S  "E8`0S !;8X0S! S! 80TL0@ \Q\0S ` R !8x8 ?lQlh9`Q`\3TQTP-HQHX @1R<#0Q0}P00P0)0YP0 U @& 'pPv 0Q  c,t  %e  H' 7  Ԍ Y#      vU   6 <  O  a  m u   y a  ,O-UM0M*a8V"e&@'@m& pepV pW d&0 T0T AQ ,ލЍ9 )qWd ^P FP' P # @P @p`H吴 XBT0SYd \ T 0S 0$< 0P00,0P FfP14s10#5:# '&%&#&0S && !1h qP0@DPd@  pg `V  L `p80  P 00 ,0ST0 S00 P0p800SS 04  0x; 8:/P00400ST0(pp S S 0 xSc  SV 0 <0qP<0PL!@  PP ,0$  40|( P2 } 01PT $pP 0045S0+4^Pa14  u 0R0s  jE%԰ 0Ȱ 0,t 8:,    $P m1~,~ = V p  I       vg   H'          %      mO-@AMT MXp P`L @P`T $P```oPP@Aލ Ѝԃk̓C̳ @a3 (4@$80YDP@<@T@X yP \qC430$3 00 d52 $02(408@Y QP I딢娂  <t20 8@d2@DDAT P2P"PPur#P <2 8%PI,2 $ *20)ATp !0Q xP&!*%0 Z@0S i#P 0St H0@4 000@0x;8 8/P6  %P !\%@P 0  p @$$0 L@pW:p@!  m6  % CH + = C U i m }! , ,t. 7 Pia8:0p@-`M2 R !,^RЍ0P @40 PP@xp0 ;87/P  PB,Wl,Yl $0@-@"!Q(@,Wl@-$@2S 02,WlO- |@P@B`P@   oPP@ m@p0Ec#రPU*$ ЍI `PP  ZPP @BI    R0S ;p&><6@-@00 WP Q P 0IbЍ pC-`PJMM⼂```p 8.r@4PT_H)PeP8_ Yo`GFWI qnP 0 000!00P < 8<1P#<@XNo<0S0 0< 8 `PV 40,0F= 01@01A0000 h@@@@,z@|0S7 0S(8tJݍЍAT4P0 8`$!QQ@0RT<0P 0 003/@#S0 S(0S 0S8<(0S003/@#S@, ٬&@ 0S/p@-@P`!a(0S  R 0Q003/@Qp@ @-Pp@`4M0S4Ѝ0 0L03/P 0 0@P`180/C-PpMM`0 PPpx@; 9/PލЍ0 PPxP;A.5/P A> o  0@o/b0 !!/,]p10/Wmp@-@4P0 `]1111p,]pO-P@p`ԐԠ԰0/ C !  !0  Pp00S  0 0S 0P1SR0B 0 0`p@P X 00,0` 00000 Ѝ,]p !|  < ,0@-P@M/.p1, 00 0d0@00 0T0@@@@1 0 000@EP,#ߍ0 (,]pO-P`@p4M 0SpP pPp 0S00W0#S 4Ѝ0 L03/PPp0 L03/P+ { 0 Q{ 0S  ]0 0P  P 0 0H  R,  4@T  8X $ T\ ( p` , d A- 0R 0  DQHa@1QRpB   !LAPAPH0 \A0Q     TTAU @@,]pa O-`BpX1MSL2GX\1S,2\X1S \QUЍ0C`1h`1S)a`j1PS \1 XX1! 0`1V$ 1x C H0C 01fP 0 S 0.S  s\8p `Z!XNP ^0X`0 0_X"ro\8P \!ho000: SX1x 2 \1` 0 0 X1 ` SX10 2 $ e[,]p&p X,^o ) H'p@-MMPhPoۍЍpP@`+\ P*+p[ P*+[ P*P⽾P; H'p@-M&@(MI`P5  h<0 0)j P (HN5(LN gK] <@P )ލp_ a,T! " @-X@01SP@0S01S0  ,]p  O-p@MsP! c0  % 0!`崢Y p` 0 09P0SߍP X%]P0P0 a0CS0S  PU`08Sڠ0S) R& S^0  0 a00 p 0h1劅00 0s0Z+ @p ~P` K0P!h!R( 00@(O  00O0 0S* ?0!C Z 0 00t00 00S 0vUa0 4u: H 7 @dAde,^ S,]p -pC-L1 @1 R0   A h9'Q   R 0<1LPDTPapHhLP hU `1DP1 hU `1TP1 hUP1 `1hUp!00, p\@ ЍC !!,]p!P @-M@  P @oЍ@-| 0S lP \0 T0T 0PP0-L004 80<&( Ѝ Ѝ,~ Y,0,, 0, !, ,L@-p@Mp)t90 0 0T00.00 0Xt9$ p0#:! Ѝ,]p!p@-L:@0P e/p@ ~-?@-P @ ߉ R ,2$0$@HЍ0@ Ѝ/  @-0  0o P L0L L@ 0< <@{0 $@Ѝ, +, 0,,L-3M M T.DP0  4hP ho3ݍ Ѝ H'#-3M M DP3ݍ Ѝ H'00@-M  0 0S@Ѝ0d0d d@P T0TP P00H H0PDK@00( (0P,C,,4 ,0, ,,  !,, ,L@-0  0 P <08 0440'000 0 Ѝ,, ,, , ,L0$ 0!S/ /,^|0$ 0 S/ /,^| 0( 0S0 10 1/,^},]p11<0@ Q !@-0 " !/,]p0 10 1/,]p@-M/.k, 0l0d 060 P000@ 0@,eߍ&t (,]p0D D /Q/QQ Q/,]p&t@-@0@ 0 0c\PЍ @- @0S00,0 0@-pAMhhPN @^X  P<04Px9ַ/9]0Aߍ0 (,]p $ 7,@-P@ m0P  fЍ,X-@-   Ѝ Ѝ/-@-\0X0@P D  *'Ѝ@Ѝ/ @ M v-@-\0X0@P D   'Ѝ@Ѝ/ i z v @@-4P P P @-@fP@ HoS@-4@;gP 0 P y,,, ,T@-4@'gP 0 P y,,L,XQA-@@1@#PP1P#Ttpt` __P t u`>>66MYAJY-D,T7@-@Q-P @k0  Ѝ0 &7p 0@-EM&P@ OW 6\P0000U ($$0x:@:Eߍ0,7,]p@-pM5hA -WpeH1^ P0x ,!% -k<$0P H ` p 0000`0 0PP`P$jߍpb02$jx:X JP (V((Jv !,]p, (p * !3 &p !Z (@-@P !0`Rxz;fP SPP ~xZP`h 1  T ~-01I@0Pw@T 5qX Ѝ,]p p&p@-@<P$0@- 0H Ѝ0@- 0> Ѝ@-0@M00  0(Ѝp@-P<@0/SpQ ePp@&t@- 0P, ,O-$M@p`P 0 P( 0 PP0P00P p @0PP0PySa00ͅ0݅ 000͕0ͅ$Ѝ !qP, (,` !t,0, !bO--,M`3d$Z@op[PpPd $ZP@bcT00S@ XdPPEUM P1P!PPg$00  @b$0VSS00Y00S c 0 C H C$Z0 0$0  0 A$ VRR   Q # 2R @D h0@Q c `P$ gZ@,Ѝ !! !A-`pP@P!h gPP 6/ApO-@ M$:Z`P Ѝp0P 0`VPPTP$Z-@- 00Ѝ Ѝ/ $-@- 00Ѝ Ѝ/ LA-pp3`PMMP` psp@uD FV '(($$cp&  0Su 0CS2PJS0)  0 0S8 0S r0S 0S QN@|PP$ 0 \0 L@nD2P 00b0C?o270 㧏0\(Gb0SލЍ!7S dP1Q! F?p@Fod!H1Ph0 D 0L$%' + 0S q0Sv 0Sr 0So QN@P  00 @PYF? Q. Q^FHmo " " "2 "%,n "= "e,,4 " 0 ",Td&p  4P "pk,R, " ( (-MM P  P  ۍЍ "-MM P  P  ۍЍ "s@-eP' PaP l%P0S 6 5 5 5P @D`GP O@TTOЍp M "x0|+R/ @-d|+\0XT0PL0HD0@<08~40,]p #, #, ##,, :=,,P@-@ MH @0WU,Tp@-@M L(@H@f0 #,0H ,0@@0?R8h2Pp0: S HP ZS VS܍p,mf 8ifQ @P@Pڨa <PT81!Ae|8<DQi T1 08808PP oQ P00S ny < R t00 00000 00l0p@ m(t(0S!,,p,, ,L,h #-!' ! L,~,0,i O- 0CMSP3q ` @i0!`30`SPW!000  @ ^\@3/@P CߍW! 000Z 0S X 0 @8T W  00 0  0S l00S \  P0W0 ! !  000,, G, #> #f. #, #,]p7@-PQ@0 SS 8;0 000] Ѝ02S   # # H'O-(UMp !4Q 刓 .e#ß0/SCP3c0ЃC0P/UE<# 0SP>MW|C1 dr` PLP$ 0RP EP V=^ 0 10S 0S6 0 1S20S lP`F $l2lpC0oSP!!0 a4'0 0L 0R RP 10 1000`zRP 1R QA  1S Q00R /RSR UߍP 1 0000$0000 Q1 PP 1 <T1 2P  !,X #,&t,]p # H' $ $ $ $ %0-D-D, # # $ + $B $y $ "p@-Ph`@TU`pUP`CP  wp&,.O-`MMp`` `T PP0P  X.@ڍЍ P ۀP 2P-PP 2P\x@P8D @! 0^ P0=S`  < 2P}{V  P P  ꈠlP@ PP0@ ~ @.2 %B %Z&/10p@-4 P@Hc0 Pp@@-G-`P4 5c@T$ `V! p0F&04 p0RSP pPp Pp40Su p ]cPp@T/0 R/@-p`0LMS@`aP 0S0L0 3/P (0! "!P 3/P 0S00LЍ 0  1/p@-@ PbP  p@F@-@ c(a@^A-P@p`p0S 0pp RNAK05#h00P20#X00Q #"h0Php P#"4`V000S 3/0Q #"40P4 A-8pЍP@` 孮p P៮p G A 0ᩥ`9VVȻ -t@ lr P\FP LBP ֮@T {D}P %! %rp@-PMM`; p  @p JcPiFcPۍЍpaA-@P apP` P  0QPd| @dz@-PM Mp;P `M p  @0PQP%UbPۍ Ѝ Ade! 0 02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/@-@p HPa00/00/40@-\80S0 S0010\80S  0\\@!SR0(SS QU S!0$0S\  0!(1Sp@- l@$\ 0P!QS:pQQ   P \ Q0\" 0 ,04S008 0803/P,000403/,, H0 , 4 T 8 X !(40S80S0 S001/S S 8 S S S0/00000, @-R!R@ b4 Br Rt01 408 00803/P,000403/,, H0 , 4 T 8 X !(000/O-0@p 4M PPp`104ЍO$0 L03/P# Ѐ0 \ p!ФZ ["H* 0*P T P , [p `8``pp 0S0P 004Ѝ0,O-P@4`崁崑崡 Q 1SQ " 010 r 2 R  R V V $R RR 0S 1R",0S 0S0 0 0S 0`0 K3/P p  0!"0 0  `0RPH P00P0 < Q Q  Q R ]p b( K ^ KH K4 O-0c(0M<00PSp@p`00 $ 80s!3 0Zh0@l0lS@3` 0L@  <3rR0p0000ЍW0W*8q @ 0L03/P 2PR  "00 0 00D0@00t2 p 00mZHL 0eZ  (, 00  0YZQ23U 40p0P<0SOP0 L T00SH0S000q p0 j0 0 000000  T0 w0 00000PX 00808/@Z0 PpQXQ Q(00,0p 0#^p a X0S l^ 0$0p0 0(00,0  0#4p= 0,p0, &_,p4 &P &C-F`0pSPlM^tY0SX Y0 S Y0S Y0SY0SGY0SHY0SIY0SJY0SY0ShY0SaY0S000$ R(000 "0A W(40S  0$S $SS $S)4 00$0 40AY0D( hY0SP4 PQQ008Q00S (4Q (4 $lЍC!W2W/ Y Y` Y X4P Qb Q]0 L3 0030X0 lЍ\3 00P30X0 0HS(0p`@ /0 SH0pP0`@SH0pP0`@SH0\000 SH0`000|S"H0d0S dP`@0 8", P0 8 R>0 H0L0 }H0L0 vH0L0 oH0L0 hH0L0 haH0L0  PZH0L0@ 8SH0L0U lЍCJ!SH000050PpG0  d 9/ 000(0{0,p0~ ]p b( ,P,P & & & K4 K KH m & m _ & & & & ' ' ' ' '# '( ^C- pQ0@PE0EM (000S 0CSEߍh0 3/``d0 9/0 00(0 0``q0 0pp07/@-M0@ 03/P 0 004000 R003/ލ@-`,MHP I@0 0 0PP@500 RS THP pW XP00P00P0,Ѝ @T@0/W/0  0MIH P00P0&><0@-$M@D0X F 0P 00 00,0PH0Dd$Ѝ0 &G-%p(M@PV `\a `T`~P08 ,`SS0 Q "S `P  P !X$U0V$U ` 0 Z0 00 00 0% 0MPP(Ѝ L!( '1! '< KC-40PS,M80S,ЍS S S !S S .@P `p䐟`q`X 0 000 00x 000 0 00 0 0MK`P((! N, `t MO-P@0p(AMP U  0唂0 `!"00(p1 "UP 4P *H00 P P G00P0[@!kz 0` 0 @ABnA0  0x!Cd @0  P!-Z P0  (!DP`Mp&VP@!@3P@VT -`ZT@D@`0@@< 0 0K-Z0 0@`0P ت.!h 00@p `DAߍ #"0P0RPPP,Pp,p0 'p 'O--p5AM0DpP$oPN B@`PD X- @D0 ,`4 S00,0ñXT, 0 $0p0pC0@ :x  Q * Bq Bq BQ B` B  0(Y 0@ X@@p0 0,(0 @@@@@ p@@0`PUߍ 06'0 pD`∀ J00*80A-0<0@SH0`4 pTV09T?V090VP:0Ab!r0S/A-@P0\03/0 0    `0V R!  B B" ?10C)Rp0!`P! 0 `VPPp !@` B"?000>000$0 01P0100Az vD!2 B"U>1ᴡ0C100C0 wW `V`s`V T00 03/P0 0D 2#4`0Z3 P0a d!0` !p D00C>D!2 B">10C10 0?o2100C0@ !V ,!!0 ]p! V< P0A-Pp`@f!0P  p0Q p=p V{`P !@ B"= VT0 01`0(`10q0000៾" o 0S/ LP0 05/0P0 8

0=C0D00 N$xU 0S  T0Pp0 000D0P0 F0PT0S xSOP 0S00Q00`Q0S 0L0 aA3/P 0̀`0`0 &003/dP`p E 0 g&` @o/MX` X 0 Z0R0 ` <0@ 000R<  0S8X) a`v0"$0$0,0.0,0$0'$0倒 D20 M0 px) 00 uM0 80 lMȐ0  x0h00l010h Ht0pN+D?+  ?L L0` S*pV 0 TZoU 00 0`TOo0 8TIoT0P0'$0, Q030#Q0S $0( A(0b2Fup0 ` &?00`P3/ ``0``P.VPPZ0G X 0@4`8T(Oލ Ѝ, (2 (7 (<,P (B (U /9 (R (E@-@! "  0 Q0 "ġ0S "O-Mp P$ @ `|1/0PU0@5@[0Z@0 0L pP 0LPUp TZpP 0 L X00(@400,80(,U00%000004p8Pb 0` r S00 $g00$DTD0\00`04O0d0嬿\ J PU P㣿\ APQ㝿\ ;UpH 0 XHXnp4P0PT0"0h00<040080#0hX, 0S)  H0L4n0 0<0倀L0 F0LH0P hjMPHЍXDo0 <HnH0L0 0S! 0S00Q00`Q0S 0L0 aA3/Pu 0PpPU0 p0%PUp@g;tpL0 Tp P%@\003/%C^0 0 $ PY [c$ S \$0X 0$ 0R 0XH>$0 S 0 00(0,0 $00S,0 00(0y00P3/0 PP0PT P0pXQW崾20S00c + MKX0Iÿ 0/CK0X XS 0$Q 9", (2 (7,P (R (U /0@-@M0@L0 3/P" ! !DP 00!SS@Ѝp@-`MMMP;` @P O < SMލЍpd{@-@P D;LP 46LP $1Lo H' & (\p@-0@ 8M! 0`P@@ 0 o;P8ЍpLPUJ0 00  0 V;P@oA-P1MMPL 8a0P *1SC$A T )1S ݍЍ Q 0 1/PPP@ 0S0L0 3/P ,0pW0wP 0pxp;H 7/P H}@,t,h@- 0P,P@-0 /PR ЍP/R0 R/R   0 0 (,p@-@@@-@@ x (e@-@?PQaPp50S  vB=P00 Ѝ8PpP#0S  cBW $ X @PP  4p CB,,X (v&7p (}@-@ @0 (@-@P@@-M@  ;  {; <܍ (0@-MP@q  j;k  d; 0TsP <ߍ0 (@-@R@A-pPI`ⱼ@P P  N0! 0PP Ѝ0$D (,hp@-@P4Sp@Tp$ @Pp۾Dp,h (G-pt`DTP }JPP@ 0 0PP$0R04,h (A-TP4SAp`4p@ 4 0: : D,hA-@4S0tp4TU TU T`040 G~0 4v,h (p@-@P0 p@.p@-@PQ@ `op (   @-o@-o@-o 0P/,h0@-PM  0xPP<9 ֻ@  0PPP29@P,ܙP0Ѝ0@! ) )$,|@-Q@rA-A0J?`V=p$X"0 8PPЍ p> C 0 1/P  0R$LH R>0$0 R 0S P P 0$003/0$a,t#0pQ@-4嶻㱵 #"T R0//s@-(@T@ЍpHA0P=0 0003/@Pw㉻ㄵ/@-tM`P @P0 p@@"P  20@Tp@tЍT0 @T|0t dl0l p u`P L s>9, )8 H' )A )P,| )f )J )r, ) )/@-y 9@6 ) C///@-0@Q T@o?0 \ 0P000@-P4M0 RLT0@T #H 0 ! @4Ѝ0H@0,|//G-pP@`㈐VT0S0S HP$1L0PUG0 0X G0 `p@ )J,|\R0  /p@-P@F<0Q"4` 6D0# A@$!<p,,PA-<`P@CHPp( 8 A,@-p@-@M @K0 h啺0S X`P0PP0`V 88 0$ $ ܍pbcX,, ) ) *1G-1`PM@PN/1!1|  tatayp@Ph7PrPL寽L0 [ߍ BgB?F pP0=SBF?q@ B?`L@TP h BPp@Cp P 0 PC>@ =>9 @D#j ( *,. *% * *,1A-1P@+PN/1Xp1T P`P`  P  <> ,, d,9 *G *Q *i *| *@-0M02000`00Pp0@P @T 1\ 1T1H 1 3P1 1 Ѝy *Q:; 0@- P ,TdC-`CM P@ `JP pܐ܀0 `0`P0S1 1 Cߍ5S   |p pP\ ``X0S  @S1, 1,, *,+;, * * + +2 +O:Ip@-P@1 1  p,1p@-P`娸@P夸0 p@O +pp@-P@P 1P1   p +|7Up@-P@1ֲ1(1 P1 1 p +U@-Ƹ@ +|C-@[M,hJT[BP`᠂rU U.20P$0 dPZ `"0(@80ZPW @"(PU ( E 0(P@EPKO?PL0P PN?10PU)!(`pAhP0S7 S1  @I 0` 0P@PX1M9PP [ߍ@`0!YPW0 (80P0@>8 B68 0 0 0F& 000 h .@ y&,,, + + ,;9,+,,,, + ,7-D-D J A-P$p2a@P a-@T ' >!|P( 0 #P  0'< P `@ĹoЍW\\jw P< 0  ,[, ,k - -.# , , , -h//O-0p4`@T Ѝ@T@T' ^% L U[Z [ԡБ YZ PUPE P$P P@B0"/,O-4Mp(t$ \ ZX0,@P @ PR00d``p ͱV0 0C0 0VP @ 0uCPU@U0@P!00000 00$ U0 000Q0#02S 4Ѝ; 00 0S  R% S    0@   00@VP00VP @ 0,CPU@U0@P RG RD RA ,( ZQRZ3UU  Z 0S0 0P@V00VP @ 0BPU@U0P@0U00P@U Q Q0   .0@-4MP!!0  P P!P@4Ѝ0@/@-@ -@c -<0= . . . . / /"!( v /T /d /- /E /*?p@-\P@0S 0R;)r00 S0@0 N Dp,O--BM MpX\@P 0 `^ ;`( pBލ Ѝ<0 8P  Q 0 0d!`ppr0 $0!`4X00 (00Cv$0;S P t姺PT +RQ 0P \P SA0Rpʩ0S S 00S 00 0`S0S 0 ű0000 0 P 0S  / 0 R$ ?!"S0S "m Ade /zO-DMh`lPPDЍ;@P >4&"R p 0=`P0+"R =p0 d00\ `0h0x00X `$P`Pt0 (04H₲000 00 00p;! .@-`X0Sg0 gA\0@Sh0 `0Si0x d0Sjp0\ h0SkX0@ pP S0 06` Ѝ ..! - .F ._ .w .O-Ѐ0TM00 0$ 400 ,00P(0 0`800!0 @ @zP$0SSDp@p Q 0U U L0!<01PSPp=PU<0pDPH PU@p p0S $Pp40S0000p$4P S 0  S PS p0S/ ;S S 21+1:$0S D$0,  QB\X:X2RQ2ȠP,$0,$0(Q $=p(0 S  0S H (v}.80ƀ1 00 0"S 00S " TЍXRX0H"1,zO-P0M@GTЍp`ȠȰ@D0S W0@  0 0 `P1/Y  S      Q R  0@0Q0 0`Pp1/P ,!A-Pp@`0S P8p0 S7/P 0403/P 0D03/P0403/A-&O@P`p1S 3/P @`VTd0@@8T0P0S@000S4000S(0000Az!,,!!!0!'p@-@4`4P0Sp@j10S 3/@,,0 @-^ ^P000S000 0#0/0@0/p@-@8Pq8 0X0S3 3/P0 0001S0180sp `^$ 4R R0 0`40$ Rp `083/< 0 2 P   ` 000 0S0\000 00//00/00/00/10/Q@-@@ 0A0003/P@$o @ .C-B`0SPEM;0X2;0pSP*;0 StH ";0S\A;0S :;0S(3 ;0S,;0S00$ R!000V F 3 > &>0!C> f`+0 010@0`P,H, /.O-PM0@0` P("  `b0  e000 9p!0 009@!00p@߬ }@~4xxp9@gЬ 0 L!hHǬ @p0 $!^$彬!p 0U`P0 R + P+HЍ 0p!圬0i `5 `*OT 0-00@p NR S3#:@`0P,P, & /,i / /, /A-@0`\03/ pPW@@P@ᄭP< 0쀟DW  \-W0 U  .  ! 0 n/ 0 00$ 1 x    ]/  C\  0SJCT H0H HH<0B@@ q,i h ۈ ` /!0y 0s@-P,`@g01Ѝp,Hp@-0(M0P,03/`0@ S:0 00 0 0 0 Vp` 20A0ᝩ0(Ѝp0  мO--PM4,@ :PЍ 5pP 0p @r @< ]= PZ0H03/0S`@G`@@00嵬`P p" 0Q!d2A 2]? 00000008"  0$0ȥ5ȭ0S ("0 L0P 3/P \0T@P`@X0`0 S8tPZ 80 S ,1 0, S001{40P ≡0L0 3/00 P0 0&0L0 3/P 0 $ R @R ! ! `W0@0 0Xx+@DЍ  3/P 00S@ 3/@-,M`Pp$$P@L T  00 $  a PP0a,Ѝ ( 0HD C-@MP;0`@`|0@P\  @0H03/1p0`TPX000 Hx0T;@00403/0 \@! <1p `0S 0  003/P; #$#%0 006`00p00`0 0p`«@⺣'ẫ0S @, 0H03/p,V@<@0 0S00s01Ѝ&,t, ( 0@-@80q  003/P3 04ЍP2 @-0GM0@00@3/PP$0SP '`p0 000 `p0U0S 00@03/PPPGߍ/A-@xM`D 4:0Pl00$pp0Ph@P3 P p:0d$0\ \,T „P 0X*0L08 3/16 010100 0 00"pPxЍ 0cp0S 0h 0Q*08 @,04/P,qP 0q00 0?o201& &p ( O--@0lM0$3/0H03/2`0PTPqX0pZvT0 !0 0 `p P0 (3/P`Z L9"##$0 40R ! H 3/0L8 03/p? 0L08 3/PP8 0 R5 `#1//L"P#0X 80T3/L0 083/p 0倰$0Y 00㓩.8$  p` P(;/P PlЍ ,tO-|5P0MS J?0STU 0SD5D%DDq8`VG 4%@T dSu5F 00% % d 00q$p`@大0,堧0坧p嚧` ㈤8 |44@`1  `40 000 (0,0pڧ0$10q0\$10k`\0@ pd0900S< p0 PÁx ,]? 000000 000 0  0f0p⭤p` 3d,0ᅡl0S= S@: SM`p$P H3/P 0p0072 |000L0p 3/P '0 00S 00CS`p 0SV iNP2Q fЍ@P00SZ 3/@@OoBS m@0 0610@!Rt!@!x@|@pPpt@t0S|0X*@KP PQ 0!@x 0T:x0S@ Wt@OoB@|0xT:ި@,t 0O!J 0,,H 0R XP80 | Ќ, М q p, 0g>O-UM< SD [/080844@`zP upP᧨ Uߍj0P00 P,Pᘨ3, 040S 0R? <0S5(1SK!L ,LH S!C <H@$+4- 0@P^P1 @T "2B 00P 0S 3/P,00,02, 0SU@`PD`D@t w X2Rץ Y8N Х$ͥ ,!L12HPH@"`P`T@幥P W` 2@ 2,2,00 0040嫥 @ç }2   , 帧 r2, ⯧g240P1: 1 !  '6끥 @0 000000 0000 00p` DßD0U0 Q[T Y ᷧᵧ᳧0屧v `䨧,,Po 0 Ьmn 0![ 0O-/<@JM M`0>PP+#P) 0S% 0l"`!`\r\/:0P T  0CT *0C/Q 00P8@m+# P:7?0  \P+0: S `V7>00ꨰ  PJ>0@0/SI 0o+ b# S P+ V# P*UP 0/S`0oo`bS 1p10&000 SV+t# P*+# P*P7@ᮿ7@]᩿Jލ Ѝ M 0 ( H'@-M @P(0  ~@P s P Ѝ膿P0p@o O-M` x'PPp X`p㴠崰,P%Ѝ0S @ 2P0  RpL*P Xp0  @G~ 1g 0l 0@- )G-|M `P`P PP<+"e@P@ 0 @ LMC@P\+Jr"UJ.0M+Jc"FJ.0TT>X PP~D54 ׬PPu$J+JC"&0J.ǬPPe:+J3" J8` ᰬPPN#+J"tpll40 0J>P 0 .⑬P UT mލ⿿P@Y+J!J⾿PPp0J.l@+! aP h lJ>ZPR 0 0 0 0 0 0 0 1 1M 1, 1?  1L 1] 1\& 0* 0 1 1 (j 1/00/00/00/00/0@-@0!$Q4M0 /P\ P0T0670 P @P }!@4Ѝ0,,P,`O-AAd2M(0!0PB(0 0000= 80s#0(0p`\05 0f/%500%`N0$0 0$0S000a5`` @@`@0S 80< 03/P0p80<P Ѝpv'80s @0D 0 0Q:8`0S0L0` $3/P$ `0d P[ T0 SW`vp 0 ` L$`0$00  0 0 0#B4P00 0`0000 0庢$0Sr Dڧ 3D0Sa @Z%S[eQ*%0C?o2 00;0, 0H03/$0pS`, LH0I #"0V 0  .Y 00;000P0 pX00 00 (00 P0 0 0S { (0 7DP0v1$ 0;$1 ,1<,t # H'C-pQ|MW0PSSp` 00  Q 02 0-" 0@T0 S>X2@t&L"@(@@,0S:((0"P@P  00+0@080s=0 0( T =W|Ѝ#٠!@&(q00T1 0v-X!00 3 & 2!p 2/ 270@-)M@ῠ0p \*3 +Z@,WP0 垠*MP 嗠-F 0 F  .<0 0Ѝ0!0P8q0 S+P ,!P  A%?,Pp!p 2M,A-@  "(0M1( 0PdQ1\2 5  D! n/ 4!@`, 1 0 $!8 0$P p"PUp 0S0p\(pP,P(FA;(00FC0Ѝ0`0 PCp0 L03/P 0 0 0Pp 0  UPp0 @!pX O-p@`700Y)Z]p "!PV p 0  0 P0>1Q 0S  008,04p $0T0 0X05p0  P,[.[ P Q  0n-P0 8q84p T$Q[00 0  Q QPPZ 00 00 ЍO-`2M04p@$妾P `MPP 0 Sx 22@|]? 01Ax00 00u@lSlSx0SR(mPPK p(P01ᑪ!Pb0P@ x 0`(R b ",0x  B ~0 z0 0 8ŞPh l"040x0?o21000Ѝ0ԾѾ,t pO-p@ᤁ夑夡,M0 S0 0000 /00ӟ0S,Ѝ/S  I/00`pPU0(`P p呈!PP PP%0(` 1` 0  00 `400,08`0100, K,P 0 04 P4በ`,V{O-P`@\M4 ‐儰/!SPV 0 [ 0S  $p#P09\ЍO*./{ Q:0p R  ,pWTp W 00 8 S0p0000Y%(0Sp p 0 RH03/p`0[   80s @P000  BR0S0Sp 0[p08 r  * * W0#0W  [p R 0S 0*p 0 p 10 p$P"PU0p[ 0W[gp0 PUp[b0[* !Q&:p0 0 0 00$0 0$00S 0X 0)XZ 0 P 0 pZ $00 S%0 0S 0)0   2 Q(S  0UPpZ 01Z0( Z#QQp 0S S  0 S 0 000 00000000 \Ѝp0 0 ,4PP80 TQ 0X 803/P0  0, 0( 0R T RR0  0 ,0S P 0 0 , 0R0S00pR  s*Pp l*P 0 Q ppT R T  R X p( 0Sz0L0( 3/P <00S D0SS000(( b L0( 3/P 80<00S "S400 [0 0 p( cA0P\0f0[ W0~" p$PPUp 080sp0 :  0 W 0c[p呀!!QQ 80s  00UPpp 0 Q 0S  0 i(p 0   ,!,t,! P H' #O--`M,p#@PVY pຜpPT Pp0Z:`PU`J6ERUA |6|&||",00#h R 0  80s0`F`pHU p h-h0S 00  80spHY pPp U-h0l0 0L03/, 00Y:pPp嚝p0`0P80`5ЍO60H03/,0$, ($08RPp0P(p$P<00XN:< R0*p,0$ `$0 0S`0S<  `S p $ PR( P`( $0'PU`P!S_S Y0S 0`p8P0VR:40S00000040,0(Xq싟8`0[:pp8`Vp0< p 00<<( 8`q ,0,( 0L03/0 000 0V`V0$0( 0S ` ( $0C'`V`P p0r   008,0,p(p<0yS 0| 1/0 0Q  RS 0 ሰ 08;/`0P0H03/pt0D08P 0@00Z}*p0 0 `<080s`00] <0 0RW04 pD R@ 000 H3/PB $ <0 %Q 0 0X 80T,3/00T00X0 0\0$0`0(0d0,0003/p 0 L03/008 000` `0W `0 &0V400000P m 2b! _] 2, 0 4 0Q0 0p0 P80s00  h0S~ l Yz* 0L03/Pm !0 儐X09/Pc 雟00040$0(00$0 00 0S(  0H3/P, X$ 0 03/p7  0L03/ 0pP$0( 0S pP( $0&0W40000 00040(0(00$0 00c<#$‚0  0 00 H3/P0`q 0R04($ R ( 000 H3/P* $ %Q 0 0X 0T80,3/00T00X S \ $ ` ( d , ,0S~ P0 P  R0P0v 00040(0(00$0 00c<#$‚0  0 00 H3/PP80sc 00` Q [ 0 SX 0 SL0  3/P @0D RP0 RP0{0 80X T,3/00T00X0 0\0 $0`0(0d0,00S` 3/p  0 L03/040T0S ,0S P0 P  R0P0p0`W:0pQ@Pp`,0 0U?:8徚p" 0S p ! Q\px`P p0Pi"0R[p Z[ Yl:PpW00 U0#S~ p`Ѝ茀 8/ #"08,00,L0 3/P 00p开8S  8y\  WX08P@DH0P00 00 80sp8Hp0!8p 40X 00 0S 0P*p ` )80s0 L0 3/P 08400H0, 00,0+$0T00X0pPq 00 80sh p )Php@-@P(Mt (0S⽘(`,`}0 00P0F0 P P`0(PP,(֙(P(Ѝp000ʑ,7(ʙ0,`(P-D R,`O-|X`M)1$qS W W (!0 "@PЍ0 p0> C 0 1/pP0$q Q 0 > 1/@P@p 0X:@1S<1@1> x.؀BCPp C( ,H3"0)@ 78! 7 0 W &%, 080000, 0 N00ߖ80000  0'HP60ϖ0H˖LH0P (P0v(W0 000p8500 %  % %P,  (P 0 %<  ]? 000000 000 0f00pp ,5P,0אDXpW* 0GSC0.(>P C$ 00S H @3/Wv@DpH L0] ZYX03/ 0& 05@ 0L0 3/P 00S 0SpW+ WP0pH03/0 ! P7/P%$%$)@0 Q1LYK@1003/Q  01/ 0S 2"&$Є  0 <P 0 ? Hp0  @D@0 ᄀX80X> Pmn,0S #pP p@H0 0H008L0P 3/P p0`0 0`0080P 8/00@D@H,p\ 0,QQTQ D@ pP Q Q0p p@08L0P 3/P `00`00p80P 7/00P  P 0000000 0P 0008,t,P4p80 H d t, T q H' 2! p 20 @-@P`#}4Mp@0S $ 0dL03/P #` 0 #8PUV`4Ѝ 0R00S0 //O-Yp@P` 0< # 80s#   002&  0 S R( 0S%   吁( R Q0 2v&T 0 < {+800 s"000S   s 1 SR0r01/,!0 /,$1p@-S@ x1SP $003/p@x1P$1 0SO-@0`PKMM0((0DpH0S >I @&0 0<0o- %#{ 娻 KP@T8p]? 00 0 0U0000@00 @@@@0,⻑ppK܍Ѝ(Ⓨ(0S*< o #8 ;c&@@ O-`0@PMM,0d1d0p 0S (0 S> 9 H% 00 0 <0.%#@~40kP`0V,p]? 0000000 0 0U000000 00dp`ލЍ,<ᩑ,0S*< #, 00A"X R00C0C0000S0 0,0A$P, @-@-u%0 !<$10(10,1P001.@-@a%0 0! 0O-,MTTpPP`0 R嚾,Ѝ "P9 @@5/ᩔP`K 0%` V`G2 &% 0" ( 00 0Ӑ`ᱍ᱕0,ЍO/@Z:p@-@Q-===>>(>@P= 0 P640 P0 <0`p@PP'80 P<!,0 P(00 p& 2' 2)*+p@-PBMH`@  V>??4?`?x?@,?@@D@l@@P 0P Bߍp`ޒP00Sؒ0`Ӓ40P`͒80PS<80  ,X0S(![@幒 0P屒\0 `0S E@ `堒d0Ph0S 5@l0S +@xp0S@ !@T`|t0P] 29 3:;zr=> 3 3?OrABC@-PAMH`@b  V(A`AAB BH0D`qK0 @0S    8`V@? 0 P7 0Aߍ(0S p Ȳ#@,0S H 徲@@00S ( 崲@ ] /. 2/Or1 320@-AMP@0Q*BClCD D$D<DTDlD   Uq0`N 0S (0S  H  D,`V HAߍё  d 1q0`N 0S (0S  $  ,`VP屑 $0]P娑 0 P墑0 P㜑0 P\喑0 PH向0 P4劑 0  & /. 3   60S O-@MV M>Po 00x R# S `^嬵嬅adDp80  @Q D0 Pl  gPD  H  `V8p00(0S%ɱ$B00,0S$⼱$B0000S$⯱$Bt0+ 0 p0B/%Ppὠ C"U0S1 `F` {댣0p⇞ 0S   } `,pYV o$ 8b0` ⤷0`0"  #Tߍ@ 0  0S  < `pV ގ 0  1 PS0N  L̎0   0S @0S@彎 ߍGh<0040!00M@0Fo$ 0DL03/00 Gppqr0S !03LD` 0S    p8` V0 a xQ0W < 8 RFO  0@ /.@[ 0  f 0R0Wp 0   4 44 5 / & 4!%. 4' 45w 4=- /u@-x @ ; @0p0徕dk @v 4G@-D @000(0,0000婕dV @a 4Pp@-XQ`0@sJM]/   0g1S:S$S<SlSSS:Jߍp0 00@ @@0$_(@0 (k0 0(0000 0(BP(B0P,@(P0@00&3Or560p@-QPM,0$0`s@]/   0($1 SITTTUUUxUUUU 1$ ӇPЍp 0 ,ʇ,0S$0rP@0 00 000000 0娎0sBP0oBLP@!^@8P@0P @00&,OrO-P`0I1P/S \(ʉ0(0 00qe0SvU () &0S `Pp _  1!5:% 0p RP p Q 0, ($!p p $ >P] 00 8a4Q101S/,, , 0Pi 5 H' 1? 5K 50S@0@-S@00 0S/,0O-P̲EM 02@T PP0 2P |1S$ $P| 003/P `2P X v@Eߍ$0 R P 01/0P 003/P A10SV aPD  <0 040000,00800 崏pPP2@0S- $P* 0 x0D 0xQ6@-P@ML d`P<2P0S%  (P2 00 BP P< "0 4 P 0!⯥ tЍH0S10S-  PP'a000C R  R41"$0  000xpP0` 87/0P0 00 !`0x] U00S-  P'000AC, ^ ^ 0!P^ X^ ,0SP\ $0H ">S,,l 6,, ,w,H 6A-$A0MT@ QP` 0p@0 L03/P 0 @p$ 0S0ЍQ@#*11P0\  R&1p1pWpR\-l1h1^0\@@T  @TC @pW@dpW5V8 0# @  R @ RD RV @  @H00\ PTTXV , # P 00S, 00S,P8 <0P8 ,,l,,H,,\0p@-T00P SDPPp0AS@  1SAD,(,t,0@-P$4M0@L0 3/P T  0P  0S4Ѝ0R20^ @^ T 0S",p0\ Q0/\ P@ ^U Q0000@-,0O-`GMM40X2@T]? 00 0 0V000000@@@@ 0hՀp@c<   G܍Ѝ$1SpA0L08 3/P H0Z Z ZT0S p$ 0ST0S8 P P0  K,0h 0 t0@W 47 `4M}Ẁ4 VH0 <0G, ,,L, ,0@-PDM@T P08 @\ 0@  Dd  W0 0DЍ00S,0@-@DMP/ P0, P\ 0P  0T   R X  .0S0000000 0DЍ000S,p@-@Q`P@M<も@P   T0 0SP@Ѝp@0 @00 D0U@Ѝp,17@-@SW | Ѝ0!|P4PNP<<0HP0<0AP0<0;P0<04P3P<0 S, 0<0(P<0 S@  0"d|080#^|0,0$X|00000s{@-@PD x 0, p U0 h 04 ` 8 ,<   0 x`0 6/Ѝp@IЍp)s@-@$P04M`L0 p3/P $1 0803/P $ 0@`0 P4/4Ѝ/0@-@|M8 P S0 $< K <Uٺ ᄰ0$巼P 0|! ㌬|Ѝ0,t@-80@SP`4Mc00 0P 003/00$1U Ut  4ЍS0 000 0xp 7/( (0p  H 6 0p@-PQ0M0@$ 0x`0 6/8 Q`Px1煃x1a1S0C€10Ѝp 7p@-@P 0P  6Pp0S@}p P #Pp0S 4! B! P  Pp0S hּP R 0L  4Ppp 7 7#w 73 7A 7VO-uM Mp, Z-oH0cS_ C厫0SSzB0S ́PBԒ0SzIJB0Sz2 P     P x2@    PP2 HD     P!0x0001 @@K @P @ PHPP< ,h@ ,D@+1K 01R010|100P Pd0}p@  Pz} 0S10$1S10 0Suݍ Ѝ;PaH4Pk-Pj1S |!R |UP  &,,,H,, ,,l,,,,,,,,L8@L8,t,_@-@Ც00S @P, 7m@-@PЍp$QU0 [`P PP> C 0 1/P ,0 0L$H R>,t80S @-0 @//! m 7G-`@Pጐ匠X0r2 S80S00 00S80S0|1 P S$1S00 0UOp@-8M`@8  T P $Q$00S U 0 |1 08ЍpcP P P Q ᜭ  P ٭ ! ᠭP ,A-M|P8 U`ЍFP $A003/0 R   01/`P 003/@P$a0H03/0 p`XEH2 08 8/PD?0 !! `b7#Hp0  3/P"#"#00 03/p p0` L03/{b ჺ⦭` 0SWp`?`B414!44G0<0S P L3/0L00 3/P @0D t0Rxp`0L00 3/P @0D t0R 0 `04dRP  v00`p 0Sv " 0 |1 0?! /!!  7,G-`RM@Xr PP dDP`T `1SP P8  ,嵚p .0S  "ߍ<08 0(0`0,0 000040!04 04$0D0(0P dW[  匚pU p冚p* d`q` 8  <vS 0S $S S  S 0,0S0 S  /p 4`?`a8S!Pb 0  00*0P0 d I0 *0 h@dAdeh6@dzh hNhh_hqhhhA-PMPp`;@ ͷp@P  P03PᤘU 02 " ݍ /O-T  0 Y Y 0 0<S, S 0Xpp ͱ @PS ( P#2Q<ЍR <00$Q*P$X( Q   T0pTp 0 pW W0 0Q4<0p8 P 0,4 W\,Z7 SS  Z" 0 S 000 TpTp 0a pW W00 S 0 S\p\࠱ ؀0@-4MP!!0  P PP@4Ѝ000P/S 0/D0S D/0- 0S^ 0@0P00@0$^ (( P@  @ \/A-`<d|d{ 7 3N 0$\ (00S l S  S00/Q 0P//0S 0S P/ 0R@-404 44 R)r0@/ 8A!$ 7 80R*@-@0M$ 0Q0 0 !0 ! P0Ѝ/00S/,Pp@-,P@0S0S< 04 p,@-@0S,A-pP@0ST 0S` @ P<0@P`V@,@-S@P ' dP } Ѝ<P }`P (UPP )QP` P P(  P` DIxPppZPP 0SP` P P @0`0@0 8V 8] 8c 8i 8q 8w 8~!#40@-M  ,Pڔ{ qP p@tPzPzzЍ0Y0S 0 (f 8?!$O-@M M@P;B/$@割`P!$ ʔp c00@QD0S.8 R( (z0( PP0D0 ܍ Ѝ y P P    0xP 4@cT4@0@T0@袟brT{0  r00#pHz@0T  00# p#0000D (` (00#?P X \004RP` d80<RP,y0( S 0`0#ҀPDplP `p#ĀPu@ph W #WX`巀Ph@4oP_ pp#gPV0'% D0S(0 D (y0{S  0 ( 0 0{ㅀ@0 0#@@#000@T(0 0 0{m@d 8 8 8 9} 9U 8 9 9 97` 9M0@-M 0u 0@S|( yPX%wx0L @8⾗8 P 0  Ѝrp!$2 7@-fv0SЍ@-@M  vT0  CR$00S ЍvA-pP@0ST 0S` @P ;&!' :p@-`P Q@@d`Q8M2"€ 0)r000% 0S 0L0 3/P 0  ** +"+s  S   "S2006 ߰8Ѝp,tp@-@^P8Q @ 2"p282w@-0p@-tP@0S0S 0DHSTPSD  p# @0p,,̀08S^*/,݀,x p@-@ 0(  P0R0PS 00Srj ppC-@`PNMM< Ѐu0 ` P `P000 ;ㅤ@PD Ɔp`NލЍ[  8dyG-xM` @pᜐ壠LP! |!0@P 0S PU 0 R<D1D!DD00S 00" !P@&P0 0S0L0H 3/P H L0RPP T 0$RP0 0   x@ 04/@xЍY Y ZL   eYZ( ( d, ;>!( : 7 3N O-`p@BMMP/0d;@ 0P0p X@+4  i P* 峄z BލЍiP (0  h 0  h0/SX k0H,n k!14"?s0So[ 1 SR 1S  RS1S1Sr`2pB@?↯0Q 0ZTm "0Si[@TjpPc P 0 8< 4W , ( $ 0 (,$F , ( $  QR@ Q  A R !Q Q Q  "r    0  廥妥00 " "No@ U01U0190.UXRA-00MH`LPp t1t!tt]Pi@PP0ЍT00פ0 S` 0!?020 20C02p04 pj 0PS"$ 0Q00 L03/P Q P0Q    R D0QR003/ :-!( :>,̀P/A-2u_Svwo10000B“TBpLҁ B D',pA- @P^U PP0 8^ @T "hP ` ` `b` ` ppS` 2 q!aPaa Vj00`U08fRfP08}/ ^Q 0Sp`82S011111111108 p2aq40S0St  P P2S222*040UP 2SX ;PO-bM M 00 QP $00/;̡P`bލ Ѝ$ p y?`00@ 12,(0v0S 2S 1SP2P"PP 0@?0 Ẁᾠ        @T!? 0 Up㣫ჄG (fPgbV ]q ( l (P T&RQ 0 0 >pD 9 W p!p'q ?p? @*p & W p!p'q??p0g@P#  0He   `f?WU E ,(  Nf:i?W U `@d/!( :Us@-RU0 m@Q`d0T `Š#+ Q H a`04 oЍp ;!( : ;@-@ T  ^@ @Pp` ^PPVPU Sx   D L"<0"8 0"4 0$< 0$8 0$400 0<<@0,̀,O-P@dM0p400 5Q 0 }Q Xg QP08B^  RW* 40'D0Q   R0RS 0}υ^ @^TX 0SQQY WvpdЍb400@F@  0@TT0 @04@P SD 0`P P\ X 0`VBT`@00T04R21 SR8080<0 0Q80$02ơ 02< 02S01  (, ,(0 PH W2r`!R   R 2S SX 2Ƒ1 0 Y   ZW1Kt "QR 0S1!02#38P0WZ neV,0$ S <02o(0 0804pPC @0 Ă2Z02HY PY g sL0S 1P0S`10T08<  01Z o 0  RP   0SD0X X2 P H,̀ ; ;/!)T :!)lO-@|MHX0(S S|ЍS S7 |( [h8h(hhD S0@ }(0$00,,QT@ R4   (R$  Q000S 0[SXv?70QP241(0$0(00) 0P00U00( 00 0$000 0 U00040 04 800,00 0, S0 08B4X6u?v? ( $R BT@200q? r?`h0 s?` 080S000T0S,0S0w < aepP< =X50C\0o_P0"H``V PV }fL0( 8 @0o/O @0S U SQ0/  T0 000?01o?0R㴲<0$ 0 ,0S00AQ0P0T00TX2y" S0 ` 0 @ 4D @0D`7PpD0S0 00[S@PHpLP 0K0000 00Q S 0$L PH0`U PU0P0TP40o04"Hz`PU a<UP qe@<@B3C H41P,02S 02#38T0 Ro_PjPU d1oώS U 0\ ` \V U 0S^w?0 8, R X00,̀ <@!)# : }0P 003/P8ondUjdЍp@fd 7!)0 k :@-@0MP M 003/00; 1pP pc`P  |Bd}ۍ ЍO-p0\M0SR `H7b@Q P0l P09c0@>S@ P0[ P0(c0@SP0 0LH S  0/ O0/L/Z[d0Q @10`d! ἐ 09/0P@\ЍOr,tG-` p0P@LHR0418 S ^ ?Y R  `0 X0?Qࠡ࠱000^ 0 G/,t>0@-@0M 410810!ia0 P0T0T na0 I0PU ! 5/=Ѝ0,t #@- H}@ |@-@ 0  市P =K&7p@-<@0sQ|(00ppa0Co& --$M ?0 0 |$Ѝ0-4M 00 000P4ЍO--pKMDT } " }h4`p p!`V0 R`V$ 0R 0*`ğ $pS0S 0s 0SKߍ0S P (b30SP #)P|#[ 07 a{@0 (ŭ@{{:?dSd( 0#e 3P 2R - BP  % BRڛ 2図"B "( e"2ՀP  0Ÿ R#3SPfS0\10(0eL"开 PQ 0 0SZQ=9 =:pk{l1@Q08@{P!5 Q; %#3\P/  d! !(0eP!|$1@Q0& d( [P Q * 4"%+0!V5 P@0S(0d G@0 0(ppz@YA.---- -.-F-QP!)XFGGG&G3?--~@F{G@ / 0 Q ڬ0@ լ@k{H{7{j`0Vf0P  Pᥛ@<X(0`<pe0 @  @-A@v=@SRG-@  2700pP ąP:<`X:00X 0P L@-P@`pP0S -S :S S  000`  0 0P0 ЍU0S T  `P&> > > M@-`0tM0F?oP2p @p > >@-M@ H )xp8lۍP  !*mp@-\1@0S`M @@!*!* ?t ?!p@-@$`P\Pp0 @ `P0 002 0pp@-SP@`xM  Oj0 0wp@) wp'  wp! wp  wp  P  L0  p,4xЍp rw!* >t ?!0 0 s@->@P`Lp @ p0 p`` P09p @ 40 pЍp!* ?!p@-@PqP  )w01pP`qpI w0#1pp@-pM0 p @ vpv@pЍG-QM700ۍ   Y  @`V v@pP`@-`R00 Ѝ@PTp \@P  Q*@ 0S0S0 S   0 0S0 S*]P ` ]]0ST  q 00000`0 @@P0   t@-@@ !*G-`P%0H0$:@0 D  10 D&00 0 sH00"4S4 0>0S0&0 Pp0P W  g080P040L1p@-S@T1S#d1S.RU9lRUppbV:lR]lbp1CM]L10CL1L1PSE]0P11C?]T10CT1T1XS7]0X11C1]d10Cd1d1hS)]0h12,P0C2bV]bp2,P0Cp27@-@0 PP! H10 D18-0@@ CB Ѝ0@ Ѝ0Q@-@  C  buP p u00`+ Ѝ@ Q @ 00 pЍ@ Ѝ >!*!X ?!Q@-@    QuP p E00 Ѝ@m 1S870|\9ZP| 01@ 40pЍ@ Ѝ >!*$D ?!@-t0M0@Q0$*p Ѝ  !+ ?50<1/@-@d{'P0S  P 0800L0S S@ b' ?a ?WZ@-p!@RM Qt0 ph Ѝp1S ?i0@-800@@@L P@-@p t10cSt14o Ѝ@ @d 0 Ѝ ?q#Q7@-@  ,,X _ Btp C Pt Ѝ0@ P 11P,|1@ R  |&AQP |`00CS`0 X{@ T0p 0< Ѝ0@ X0 X Ѝ0 >!+&7&6!X ?!p@-PDKtp44p@ @#up p@Ot F| ?p@-P@ ` 08 l, *>U\& 0 0 008 , <1pp@4 ?1 ?p@-`81P:81x1S0p0@Tp 0S    0@-@T 0S  @@- @T08 0 0 NHP 40 *CHP%p@-8A a AF AM AV@-@  ,Xpp zP81 ,3,\p0,1ЍP0@D81 P$5 >!+ A A A Q/@-@  0S @C-q`@ x @P00@ 0S  z0 Sx   0@ Ѝ 0U pPt @P 0@0PE-W  x PP 0S  B$0$0> R>  **X  0S 4@0 S   000x1  @  0SP P0 0 S   0 B B!+ B& B<0C-MM000@"0pp%00+P؁+ goP`upQvS07S O0 S W h0 0\!`1 `Px1 (ލЍ Pp P  R쀟쐟PU Vxx  x 0 S   x0  pP 0 Px1p  P  0S 0 v0 P!, BP B_ B10Q@-@  \\^+p07S@Y0 S 0VS@ >!,'A-`R@p@M PP U70l0h @ЍAm"QP6>pW<@Ѝ"WP->pW PU>P; P"R!>pW-U  *3P 0S( <0 *L  <0B | 0S 0d  r 0S>0 P 0SV>P  *@ЍA_!,9k B C BO-p@`,$MPaP   ZP 00A $ЍOKPy FP000 pp X)SP     0pG 0pG0 ZppI^U3#pp pp Zp#3s <11<100x1Z* mPx1C <11<1kP NP  6Pp4PpUPpP xP nP p 0S 00 P  YY p 000 0SZ<11<1$Ѝ P  YY p 00`` v00T0 :0G [W 0 f00x1 Z R& ` @fP `[` @H0` 00 0 W W W 0S 0`0 :7 0S [ x@x0P 0S M[{X0 xr C C* C1 CA CQ CZ&0|!-l Co1p@-@>Pp 2R0P0R(0000> *> 0Cpǒp@-p1PSM"`! J%@P T 0p1!V 'T 0S X\{QP Dt@tAtЍpp>0S ]0x1@T l1S S  @>0S@ F`l1S   0 @ NeP 0  @  B.(0$p ,*l1S J K.!, K+ KN K Kz 0 R/ 1/-/A-@P 1 !  SXpR0 qP 0`0S<000S \ \4QP0 S   00S000@00P10 paU0 K!,G K K0P@-p0p ppq 00P R0 U   K!, Kp@-T`P\@0^0S\*\@\0 0SZ0 5Qk9 <R0p@-`pM@Pl (0l``FSЍ R*p 0  B\  L *R B  ;G-PP $L1L!LL/Y@10!<`41Vp(@ 1!0 S0 R S,   @T0@T 0 S4  0(p `Q ,00@,@RP@P0S 0S0 @@ K!, K L; L!@-^0(00 Ѝ ^   ;@-0 Ѝ@-@P`p#, 0B0 0p"#k ЍbMB@p@-P(0 PUPUR PU PTP,PP@PP4PP4\pQ@ K!, KP)@-0 m0PT0/ K!, KP@-0 ^0T0/ K!- K//P@-$0$ $$K#08D0 K!- K@-,MP` I1U0@0$00 .0p@000 0<0S kjp,Ѝ8010C>Sn00@( ( 03(00@000 0<0S80 :p @E K!-"Y K@-XnP@P kpQ@0  0  (0,  0004 P0-s@-@T0P0Ѝp@Ѝ/q Pp S  0oQPU `0 P  S   p0 j00C0HVQ0HPLPU0 P(P0P0V00 S   0>Q0 S ,  05Q0 S 4  0,Q@-@@$QC-@PM pbȂT0SY 00C01@0S D3/2"P(PU0S Pg0S R=0 S ,  003/00400P4P+1 P0V0U0SH. L0 S* RP& HLH R 0|S0   0    @@U 0 HM0SPp?0S| ;`Ѝ\r P RUj Yg T0d0S 0S   PE  \P 03/- K!-4 K@-8 0Ȃ(@ 1p@ t@Ѝ&7pA-`M4PspM rj0 rnp@ h@ۍЍ4F P ڣ# "P  RP@@#C 0 ,$@4   Q& (&7p-@-   Ѝ Ѝ/@-MMP`@p0  .nyQ 0pۍЍk-@-   Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  j ЍЍ/-@-  ЍЍ/-@-  T ЍЍ/-@-  ЍЍ/-@-  > ЍЍ/0/& ( 0p/Q& (p@-MM p &hp P@;00 dSV 00@ۍЍp P0 4Od& (.0/& (@-$@@P4 @P& (p@-dP@i; P~4 P P   PT V00pp& (&7pP@-@Pz:?@@ O@-q@ g01p g01@!0ip@-PM@` Z  80 Tip 1@ R! 0 p`Ѝpii@-@M  4  0 pЍi~$0 /L0s P/0  //A->PXMUSV0P0XЍUJ700p@ `R0 PU B0>000 <0  ,> b!PP> *" L:@-@T>@Q/@-@T?@0P/ R R /0G-`P M0(0S @ P P zP:_`P 0 01 0   J08S0 00 Ѝ080 V00S # p`P `P#0P 0iS.S  `P04S 040:S&> 0*{<1 T48#88 S R Bp !S 0 S T X @@@1 0?H0p 0P0H0}>H0 @000L0PPP!-@ L` Li L L0@-@PDM QP@T %00'p@DЍ0U  'P @0S@-`Pp@MTЍ 0S P 0S Q 0  p]<@P @-000Q/Px1P/$0/@-@M  }  [0 @fpЍi~A-p X`0P M0 @R  RT T 1 # 0@ @ QPUx!@T00 Ѝ S @e@-@Xp !p !p`eȀ %0R* -  r % A  !  + "*   )  Q%£ £   + "*   )  Q%£ £ /A-`PF@P─@Ѝ P\aK_KP0 qd*P $pP !-LA-PR`@ M 0S0T00 Ѝ/]pP P'0 0 0 0  <0S TT 7PP/00T 7 L MO-P@z0"S0Z"SJP Y pwpP w70p0 ЍT WeYpW T0p000 Uf*`X*T 0\R PxR U*0X :p@`0\S6 TPp`p@3nB P8ijjjjjjjjjjT0Z`X:T 0 0ZR"T 0Z@`V0\S xRc0pPmR0R@ bR RP T ZY~Tp{ X0#0%w*rT 0  !     PP0S T U: I U*`XJ:0\S 0}   0P0N[ SP0Sl  IPTPp@]p&><P /0 S S /S/P0/S 0 S S/0/O-Pṃ@P ЍO>=`P hhA ЍOIR U qWIᘃ@P  @P 1 A Ѝ=0@S- FP'[ w`PI ``HP 0 0 + 0 0!-S Mp@-@P zI` 0SPsI$` PP(0S $kI0(0$0p,e P,e PO-4M10C`p@XPSThzXzpz{{{|h|||||}}q},q}~qqq4$qqrrqqrsDssstHqtuquv(vwLwyTqyz(pXq,DPdqtw@@P|duTv $8pH\wwpHU- `Pp $tP@ 8P7 7  '$ !P`0@T\0S @U0 @9 0H050U/ H0?0P H0 @PA t014Ѝ"FP 0 pp 0S 8PfH01@U  ChUH070 0 JpP! .R 0R77@0U p 0/pPT H RU H0@1S@H000{U P0H0q ,0 00 0 K,0S _ `zU ,0 01 0 ,0 S< I Uz 81C80w40b儒000 0 P PP00 0 P  p@0  @P  UL 8180w40b儒0p00 0 PP00 0 P  0@H0:0H ;P0<0UH& 0S# /Pp؀  #P00<0/`P 00 /0P0 000H060U ,0 00 0 !K,0HS  <h 0A  a,pd  P 4p@AK0  U , mU ,;P 0S U 0 p H0 50a h050,0 % 00 0 ,00,pYP 7$ UPPeUx700 5$)0 5(@pp 0 '  0 p P H0@40U 0S 4S 04S0:006S 06S090PU- ,0 00 0 jJ,0HS 7U H0P SPH0;00H090U ` dh`,pP D`P 0$'d C]KFH0Q7;0UlQ P0l1 P0l1 P0l1 P pFE0P p1tH000zU10H 2tP0H 2l P 0H 2d P PH V H000PH020KU  0pPl[ H0 S;708H0203H060.H0;0)H080$UV 818b0w4儒00 0 P000 0 P0P0P@U2 818∂04gr000 0 P00 0 PP00 0 Pp@0  @U =P bp ~PWH0p000 SP0<00 ~P WH p P  ~PWHp   ~P  ~P  x~P  d~P=WH(  BhP T  ($p 00r ,p 00tpPf $ ( H,8   P: B5 \e~PWH B$ $op; EpP7 ((y (v H$8r  P  B M-& $!-_ F M_ Ml M M M M M N N N/ m NI N} RH N S- N" N N N N N N N O O O7 O0 O& O# O? OY Ob Ol Oq O O O O O P P) PO Pl P P P7p P Z+ P P Pq Q Y Y Z Q/@ QL Qg Q Y Y Y Y Y Y Yd Z Z Y Z Y PI Z Z" Q!-_ Q Q Q Q  Q Q Q Q R R0 (}P  <}PW ,0 00 D0 G,0HSr  }P /o"Bb ($Py/P0H (0jPi 7$ ! (0'0D ($P[/P0H  (0LPK 7$ ! (0 '0&UX H0 X UP|eX0 3&70 0 + 0+0 0P7}0P7 0 000 0@:0030 0 5 Kp W ;(0 0 0 |00 + P0 P#Z 1H0E,=P0047](88P,:^؍<Ѝ80ܔ$080,CP(/p,078247024<7囗 SJp,8>@D7囗 SD@>0H'87l"L'<7@7D7p"H7L7808 p,20! ((P ((pW 400000(0 00L@(0S 0 S S0P\S @p p8000SS 438 P,,00  CP 0?o20804P0P$0pD(x(P h((0S0' &  PP(PK Z&d hΑPP9@?00@(0S 0 S S0P\S 00@0:0P0 .pPpP80,CP(0)S YL 400(hQdqwPpdq P DP0S (P  P 0S (P pPPz 0)R00S P W400000(0 0  0y0S D4* D000X!4L!5 -@ !4[!6[ Rgkڀ M+ R0Q//Q *///G-p0@0P `=P Y 0 0 `R:S@C@3@D"X HGU( HGA-TpW0 T`@V0 L0LS @sP X X| |00 S HH0P 0RS  U!4h U0 U^p@-P Q@Ppo(=@- VP@-}H0H H0S So/00 V!5I VP@-D0D D{0S Sp/00 V!5[ VP@-H0H Ha0S S,0@o/00 V!5i V bp@-@Q0 CRP_0 0`S0 SQ 0` 'Wp@p0 p@?W0 p@& W'!5x{ V W3 0P@-x0x xx Qih0X  P R !P BR #@@ W;!5 V WGp@-@P M0 0S R 0b0?oScP 05R *0P0 Ѝp#/0Pd`Q 0000P 0  V!5 V- WS'A-0S00@Pd` pW /0000Pp 0 - Wk!5n VP@-808 88xQv(0 0000 V!5 V Wp@-@PQpV!5 WC-`TM@ P `Efp) 0 mf ````|f1pWp0`V& hf @ 0 Q@ (fT  @TЍ00C>Sy00`"P!@03@000C>Sh00p"P!@03@0!,!,x!,!,-3@- P jp@Ѝ0@ Ѝ/@1pA-@RP0p`@0S p WA-0Pp`@S:0SS 0  RS* R0 `V1S* P a 0@DpR: Q  W!5 W WO-ATP` M zyA@PAD@0<1 Z  wp 00PȀ P P P P P P pPpZ l Dp \61@ R H:p 0<1#?Q0800 00 & &(p L0S% S% p H p P p $  p  pw P0S t0$0Q0p P pe x0SA0 p@ h1PH 00 \d\$k0P|$| p* Pd p-"p]@x p 0S P Q f[ T  Up  #UpPO PJ PE P@ P P9 X00S 2"Q`` Mp  Gp %P %P0 x1`$@ 2p X00S!XppW" a a!4p%P `V%R  p0S0S"0h 1SPq2ዸp@0j   apb 0!`pZp  < OpP 08!pGpPA 1 RZ  P4 ЍZ p pk!6 X) X$ ?aZ ?W @ X3 B ? X;!5 XH XT Y/a @S Xe Xr X~ X X X!4 X W X X X. / X X X X X 1( cp@-P@pp p@&RRA-P`@@pL0s  S  U@ p@@@dW0S R H R U p ?W X3ZQ p@-P0U@Sd` 00p nP@hi@T:彷p/ Y &7@-P`1pSMAT  p@l%Ѝ T[nPЍ@!R 0$ 0 0 p@ @aV 0 !p@`P p-0S lt00#40  LLD SP 5 0 (!6 Y Y!6"k YK!6- Y) Y@p@-PP 0S @0`0S @@p00p SU   \@ .S0.S0_S-S.00  @R"0T0 0D0p&>< @- @0P PT00Q  ᳿DP `00CS`0p S00 P0S X0X /XS&6p@-h1@SPmPPE @p 0.SSPP XoP HjP 4HmP 0  .̴PP(U4 Yp@-@P'Uc 0 :R0 t5R0 d0R0  T+R0H/@,8)0& (#@        Q0  Q0  Q0 Q0 Q Np@t IP Y PHp Y Y Y Y Y Y Y Yc Y Y Y Z Z  Z Z Z!7o Z*&7 0(HLǒ -\ lp Q^ ,\ ,@-QMM@pP[p000 /QQލЍA. !. d0h "Qp`0SPE@Ep 0S:0@0D C* I Z5 Z;O--,Md`pP. l}`  @P2 0S  @lP@ :lfP@,P$ X^P$0X22100,Ѝ P,P, R 3P,PE0S h R* 0p20 H6$ R, R P 56$ R R ,Ph!@P !!!  ZJ ZQ P/ P/Q0@-0@0Pb^ .^^Q\0Q CL|\0@0Q C B\  00/O-P@`MpUP:T 0T00D0S00V`F@@V00ЍPWx"0$?S 0[ PW RPPUT  PY70 V.0 I@0 0IU:D XG0 0 `TT  DSPO-`@P0p 00900W*0S T [700 Ѝ!0 *00@KP  00T [ 00 P     @ \Jo"p  & Z/Z#T [\*00 0000K@P\ZT [T [ KP|&><!6;C-QM MP<p`8p; @<pE <DPp V=rp L<4 3PpTG    0 Ep P; EcP E/     Qލ Ѝ   P20MV0042 0@E p  @pP0P@T*p0S4 p`@tT*T 0 hOp @ p 0 Opv @    @  0S *⺛P PU@kP PzP`/0P@-,0, ,埼Q 0  @ [!? [ [>@-` ,M00<0@SP  '0x Bgp ᄽ0pt0 0 01 0 0S0S|0@0|0 0  X40Qx0 xPT ,Ѝ0 8 0A0S 0xVPT *A-`@VPPFP|P2Xpx`E,P x倂|"x20 gV0  |20|2@-`@MpP!  ( (ݩX( 8pGPU@ T7700@Ѝ /i///0@-$!M@ 0  +PPЍ0 3"Qp 000)00`FMV 0P0Fߍp@PF/ h9  0Dt01 0 `夼0 HF?GP 0> *0 F?G ii@-@MP4@ $␸P P@Ѝ!@Q@-<0< <<0SSP`/// [!@$ [$0 /Lp/@-Q @ p000t0@0Q00@-P@,M(    Ш PFp 0 00S p,Ѝ0(i8p@-@MP λ ` ɻ ⧨  (PFPЍpi:C-PQSM M3#堺T0S2"`V2"@p@"᜻0B01801T0t0 H00C@L0@T0H @0H0L00L0 P T0X00L00L0PL0 0L0TH0| 0H0H0X<0 x H0;H0R `0t 0`00p0H0 L00$L0T@O120@ 2ᑻT@@D@@0@L0 X9   @L0  vXH@L0   @L0  XP ^UPPEPP@ D$r 9Dp`Sލ Ѝ E CXH@ VI!@/ [ V5 V C-`p"0M` 0$`  0↦pP @Tr+Ѝ`*PPA   0np0 S Y+@ ``T*x0V*00J+T00V:0 (P|P@ (Ժ ۶Y 0@P!@8@-@P`DM p@  r  P T0 U134  R2$ (@0 DЍU@ii@-|@QM  H00 p |2 0"x2DЍp@-]MP#Cp PP -R n000S0S S SS wR0S HhpPVPS CQRS@ 0`  xS@P -$0 Bp 0S$ H޹ H⼦hH Dp 5 $ L 80St S S00,0S  R000@0S  R00@ H @ 0孹 H⋦150H \0nDp[0S 01S hh0Sc0 0 000 0 0`ATRY>S SM  ]ލpRIx@P= .@; 3P0 0- H))DP[%0S" H☹M P N000Si@i!@B [@-40 000 0ߤЍ!@L2S/2S00/@-@@aV002@-S0@0 @@SV0002S /!@TG-PM`p (PP](@P. PP`0S0&0T0DT0x1 RpR 0S TT0Q  0800 >0S  p@ \p@-`PK@%Pp00,000SA/00/0KpcScO-@GM`ḠȐp0 QGߍ0RS*R? F8  00K C%PP0 d R FQV (P Q PPh   "  > BQ00 *U0 2& t QqR) o T  K$$ A\  D^V Vd^ h  \ 0(/$  H\@ ȟ`$\ D\V R < R @HT6    < @ V60HS 800007 S0@0(1S p0 H0S=00(  ݵ(100@R0@ F Q&%0 p Fr 7rpVd %Rp#  HR+  %A C0宵0V % @= W`V H %R3Vp p  0 RN  HRp3   000HSf 7000  0@"0,2 S380', 4QnKp     HRB2   W @(1SlVp 000DKP*0W(1S\(, 03s0  PV:0BST   0,00)R\ Q:(,q  P V:@QT ,   D B W   HR9    @ B D $R Y  HRM  $A 0ڴ0 40@(1SWHVwW08 2Sn J( 2S P0Hw 00PQ0 0 2 0000 00@V5 VpWG h 6SC 0HSs^00 &A ⌴ 60@3W08 2S'V00<1 0 Z00 HRP P0@W 00  ^00HS?t000@0D0D0 HS4<0 0 " M 2V0@ W}VzS Q0000 00@ 0 0P0"9 0HQ 0  # @}0, v$ \, \:cSc25 \b \}7@-P\ R&@P\0S x0x08  Ѝ0PP @ 40p D&$4 \!A$k> ?!@-PR1!y`0@ 0p\ 0C R1 0R00  06 30 0 0P0 0:0 00P00;0 00uP0060 00XP00 ЍP 0000000 00=p0 001p0 00 \!A1 \C-P@UM"P, 0P`00P 01iH00P0 0븀x0`  (#0(10: cV `7!P (8@  ' 0ta&!P( ``(1 (1  0(t!p0 +"70 (P 0 >``v` P( `"(1* (> >Qߍ 0*   ?a!A; \ \0@-p0i0 MSP`$M M1!pp;p@0S i rp ۍ$Ѝi@ 10 Pp f<1Q50 00FpP P(F ⊲ ]&6$k ]!AE ]5@- 0080PP `V@Ѝp0S t @P  j00O-IM PpoPHLL `PR /R @P0IߍO"0,0"600 0400` 0 p00,0 PS2 V30a2@0 0 ,0Tf<`0 VP Y<4\@PIߍO@O<0 Px >VT` 0X`0T;<0 4`+2<P ]M!API@ ]R ]b ]uO-@pP`QP,b尠,`2S$P㘀U`,@ ,@rP@, Q 0S ,9 @ ]P,`0!A\ ] ]RO-00!`p@PT:sp T  X ⢱00U *w"0 ^p Ѝ0R0  g @;0 Ap ;   Ap U '@-RM MI00@P0BP Pp` 800 pۍ Ѝ` p p @o; @p 0FS.@- 81SsQ S0 00 05PЍ 0SDPD3O-04MS@ h@@ ԁ`P_0 o0 00 00P # 00 y00P|# R @ ^00T0 @P0g 00 0`P^ 0 $ ( XXVpP 0$,0(,80P@ Z!\*"0 0pP 0[ $0*(00 0, $0(,8P@0 Rh0` 0h0  0304Ѝ$ G Z0 j"( !0,  t  00 !0lPu @ q Zp0$00S,0 CpP@,0$ S S S0,00(0R41S 2S00s(00t0$(,8P@00 ]P ]O-P0M040@p0` `2''pp'ppW9 pW6l0S~,0Sp,0儂0噇 2Sp,0800噇 847Sp,0l0噇 p"R000, 20wS4~47S 9 0P 3pߍ00 `2(Dp (r  0 p 00 `2,2p( 9 0 py (9 0 p,9 0\ p'0}0,404l0 40po'0n@0!04,0 40p`qp`npgkpn,0 !P ,: 0,00lS  R0 `">pP 000100,0H0 p 0 sY00, }R0S*P 0I p p  00Z,0 !P !0 `"P 00 0H0p0  0=,p ] ] ] ] ^ ^@ ^+p@-PUp@0L0pp@- P# Mp 0` 0 ` 0@8p7@ Ѝp ` 08p )X` 08p  -00D0 U1008p@-p@P`K<1-(080000%0S  0R PU Adp`H Ѝ@,@ ,0p Ѝ@ Ѝ!AtAP ?!O-`@p 0帀SP$H` |000 0 0 `00`0! Р30 `  $Z8 00003H0<1v Hs ЍO<0 $<8 ~000|3@0Sp3H000s$8040)8 HkS 0z00080 zS!G{k{'{z40S& zkg{{'{ z0S+d0S( $0P$h0!7 00'*S:kG{{'{*zhF8 S zkg{{'{* z48$7 00 H0S0ST h Q 0R<0S 0S11H000s8040 P14 EP18 ?Pt10 9#`0@ 0R0i 00.0 0p 0h` & P0 20S00H B P 0dh0 ЍO Ѝ ?? ^= ^\ X$ ^c ^ ^ ^ ^ _J ^ _ e _g%&d1 _{ _ _ ? _n _uA-@PT` R0A h0`  | R 0i0A_P 0S <0S $7  Y .p0  p pp 0 00 0ppH0  00 0$0 F3% FAd0h0 _O-0R\M@`pP 0$P X0 #3P 0 RT0l00 p` hPP. aL0S0 0@S@0#/L0}4?H00P X0 "2P 0 Rzgjzzz{T0d0S  $U P $[ <X x$ 8"0 0"  ! ,  0  <  @ , D  <H  $P(P Q48`LPPPTP4pX pQ  PPH  0 0h1v`00s0 10 E000~@0` 0`P10 0\ 0`"v y뾬04S"1S0<10  \ЍOp _  0S @\Ѝ7S Dz _!A _ `CDC `@ `h `u `Q $@-`@pP`0 }h0X $7S R @`0O0  `, 5 0 Ѝ@4    `z _ c0 `p@-P@ $ 0 00L0p@ ` %p@-PUp00CSp@0@ .$z5  (00-0L0p@% ` &Tp@-P `@p800  B\000D 0<0L00p@8 # ` a% ^&A-P`@ A0h 0R0P3 m0<1HAKp` P0<1( AP     Pd0d ddJ 0d 0 P $A a6 ah aq a!A \ h00h0 C-p@ PR0  R $ RP508̀ `4  -i@0S PP y P0 U lH<18!4?788'00n Ѝ@ 0 a @6$0@-@4M<13(0(P 0S 0 0DP00  6 000 0 0 4Ѝ00    yL4  4Ѝ0@ a0p@-8 PR@    P   0s,Hp@UPpp@ a6 ahp@-@P (_h00h00L0p@6 a ,+C-p@x0ЀM; m F8 8C0P2spЍCS@ 4<pI0 2s 3p p< ЍC3`@F3L`  ``H  ЍCwl  ЍCv80'   0S 0 0{0 #QS 0 0 $  S 0 0 00 R* $`0R0@00S( OP `&P  00h0d0h0 2 R h0 00 0S2ЍCz8000s  ia`Ppq 00 Q R  e >0 00$0C40 040800 080ꌑ0 S0&@TS 0SP 0p0x0Ѐ60L  HP$ ЍCI`0@l0 $2  <=0S 0S 0 S&$2  ,0 <`0  @ R h0P cЍC 40PЍ!AA` ?! b cSc b @= b5 bQ+10p@-800@P  Dh00h00L0p@ [i bk b @6\/ R/ (>0/ Dd0S 0Q/ @6O-0M0000PSp0T @R` 0 ЍO> R*⯅P 0S 07S Ǜ ǛY  SG2  !  Q 0 S:500 0p00 0 ( ЍOV Y 0 0Cs0`o0S0 S0L0  p    0P 0 0 X0SY0A060@ 600 0Np0 0  `P  "0 S 0<1vi@x6P DP0S0 0<S<0P0Ѝ 0    0P 06SY700S00YV0S9 0Ul00 0P0 RS0KSK?3050X%50 Y ,iy0 4 @0S0  l P   BZ0S Y Y 0  Br.  Br*0 8- $P0 0 0 RY * 0  3@ $ 0P 0  S 0S0@00Y$00D0<0<0<1(?00; P0 P4 000а 00 0 0P00 S*lP *   p^ @ 0ZЍO!600 0<P0 0S * AP  p/`<1 000H 0 000 `0`0E\0S   0L!YP 0 8 R @ 1ЍO8Y Y) Rr   0 P0Pd0 Yk 0 6&0 t ЍO| d# b b b c c c) c5 ]M c@ c<$ cP @6 cz c c c c c!A X$$% c c cA-h0PR@/ 0 DAh0BS`pbp Q0 Ag$ dKO-`Pp 0x1吠@ T ЍT 0S R T0 S> R *P 0 9@ dzO-,M@PpP Q0 ,ЍOPE  UM0@SI 0SF UC:aV?0U<:0 "R3 U0:!DR-   Pp%  R P  0  Q!   p  P S/  0,Ѝ J 0  B@!A d d@-` MQP\@M  0p000 p 0S TH  ۍЍ 0a`V \@T >!B$kA- p`@PpAjPU. 0 HAj0S 0A \0S 0A!B dA-0 ;M0M`pp@P @ p0;0<000C$00(00$0C,00@pV004p8  XX4U0`$0 0d-p ݍ0Ѝ!B >  p@-@PT  (@x1S0pSq ,U-02p O-02022p R Rp07@-PX0B @P 0S*0>0P 7P7;020C0s0S0270 00,3 Ѝ0@/}v zgjzzP;R, ^@ 0 Ѝ0Dz d+p@-@P0( Uph0Spp@c+O-P`@T Q Pd0S  0 tC0`d0P0BQ 0S 0P -  0800 |# 0帀8!=0 80 $ 0R0hd`h08 R0 , 00C0 x30800<0  P`00 0 00S $0 pWp1s00 2   0P C @R% 00pwpWL0H0Ht0p e @6 eA ^\0P s/0 @Rp@-00p0`PQPE@ `㣢 @d@$,b pP/1S P///P/P/Q 0\R/ 0\/P/ P/00S/x1@-@T P@x10S/ R0 " /Px10S/ R0 " /PP/h0SdP// 0RSQ oSQ&/\ Q /Qh h  /h h0 D0 R P///@o/cScG-`x1@PMT. 0S pW$ P ʝ ᖞPP@0Sh0S d0S4$媠Ⱍd0 0S PPPЍ|0d 0|0 00d0 00 090 [P] S PU9$0 00 PP 00d8dXP +PP I|0d 0|0XxᦝU" 8P{P ጡ |! Pp|0S vP 8 q P  JU` P < 0$Q S "  Q  ˝Pp h  5< 0   hZpP; t0<0t0U0 0P0 80KdxQY XA ᗝP ᵝ  U ↝pP ⤝ȐY $0% h  5< 0 E  $0<0|!4 e!B+* e f ep@-PP1!{ Rp`ȡ01S ġ0S 0S 0S  n0 @T 0Q0 PSP 0U d0S0h0d0p@ W!B; e f=kp@-@T PP@06p!BHG-Pp`P)@Ѝ0E @P00 4b@P 0P000000 000*>0  .$00 pPP*0 kp.0S p0 CP  0@R 0 0000@@!BV U fX fw@-@0T PQ8 :* SP h0S dP Hh` Ѝ$`  Pdp (0Q,0Q  P `P 800000( ,0@P0S  0h dW $0Q 0h0d`E0SH f f0S/0S/   O-MH08PR 0` xP{00ЍEpP Pp0 X@ XP R R R0 00Cs @ЍOP 0S3Y0000000Cs ЍOt46 @PЍO p    @@0 0l) 0 - S!Bc U0S/G-P@M T 0p `x)00 0@0 0 @_@ЍP/@-@TP@80S   01p@-@PPP (000p袙 P 00p0000 S0 @00:S 0S @\S000@:S @-&><0P/:P@-^@\ :R\:\0P:P@A ^0\:R\0@S0/&$8 0@-@AP:\|\00\0S^ 0N:PP |P P O-CM M 0d4!Sp  SO4E`VK `0P0E@ 1 PP' 00pCލ Ѝ@@>;04pW p40(0= zP  0 `R0 :R`00Fd4@0  0(880P4 PF0 {0S 'G p PP ;000P6p 0S#0 0 0Vp8`@[ +  &0P R 0&0SJ @뱞@ &0P 0S00 `0 SWG p@DW :Sp:SY @\Sp S Spp p00T:C P@D 0SJ &G0P0@ 0 Y@S 0#SS `P@<0t[ {P:0p0e7 p0 R0 :R0 0KI 00S B:S:0 00IS! PBP[0 P0@DJ`F  0S ?&y  00,  @ ` P D,0ރ  ڃ,0@PE_ P0S &$ D0A00T*q PPJ 0P-&$8 @-0  0 Ѝ@-(@ P X0 0-0C-BMM00pS 0S`! \0S)  R&    RA^0C R[ v}0Pv Ps @ MX Q0g,P ލЍ [}0P P 0@P2X0 PP U LF,P   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R  0 A0SPZ\R    B{:R|R  -&>< p@-@PDp@NA-`= @P@ d PPd f 00@^S0S:S_ p0 R0S@Ad{ PJU \Sp0S:SH 0C^ 0@0LT1 0L\s0TSpASBC\ ccbccbbbbbbbcbbbcbc0bC|^ 0 0 00:0 0Pd @0:SS0AR0@A  P A-p= `P@ d PPd0`F 00@0S @Ad P Pd0 :RRAS@A P @-@# P 00S 00XS @00As ^a0ASW0AA0AS70A\2" 0@-4@0P @*P- j fG-Q0S `pʯ uPV00Ѝ  ᐌP00CS0V Pp0  cW00S(@ P  U , QP  P00SW  X  R00S 047σ,P R   S@T PR   R - {-H-(@0@-0S yP `P- -H@-@WP08G- p@-P@PPp.VPp- @-@AP M 0@87ST - -Hp@-@ PS P@p p@-@P & 0@87ST - -HO-pWP`@P @ ЍZ K P 6PT  RT@ Z //////O-Dr@00S `P$  4UPV00 Ѝ  pP00CS0U Pp0 0 卙 ?U00 S ޕP 2 .P P00SU00 Y00S P P00S  P P xP \P DP ,P$~ :Py-`{;0@-4@0P w1)P-`j fX0@-0S ;@@0@00DFP0DЍP-`-@-@`0P0`Sp 0`+P PP Ѝ-`@-@P08D-`p@-P@PPpTPp-`A- P@`pPЍ0 `(0P84SUP @-`@-$ 000B;P Ѝ-A- P@`pkPЍ0 `(0P84SUP @-`@-$ 000B;P Ѝ-@    /0A-P<<`0@ B0p0D0& SQV 0@/0PA/A/O-@PDpDpG``b0Y:0z  Z# 0@@D 0DA\0:Z: [=0 S: p `$ Ѝ `p-A-@`Pp% ,! &!  !A !00@-A^ 0 n /o$P b2 0.0AT doP$ n  N$ A000R00@-p`TM00`< @P~p TT0 Q"p@ <0@˜404 4/,00S 0TЍ&$<? f-A-`@ 0s P0!0p0pGWp0P!P @P @pT 0@@PP @-p@-@P?@0 ?@0R:@@pP p-p@-QM$0Sp A1` 6/`1!6/&%!Q10P! \`6/*)x!(Qp'l10Pdd! \\\^`P 6/ ,`0 ,6/ `0 6/ 0`0 6/ 4`|0| 6/ `yX0 6/ Pp40 5/ 0@ |4/Ѝp-&$<P g ?2C g.`LsM g g:J g  8 g g gS gZ gi gx gSH g gO-Q<08@0(00IpPR @pⓒh`,@480T:(t(@#0T(:(t(#0@ (0T: r030H,@`(4 d8 00 D3#00 `@4 T#00c4 0300 `@80@r000 4/0SD0p -!Bt!B&$<P gp@-@0`,0DPSp1S@-0D0P/-O-EAMHP MU=c`0, 00PPp0,0{0@00`o`L+Jpp A>0t@lTllH0SpW W DMP P 00PpXA C9R񟗈{(|X|X|X|X|X|X{<|X{P{x|X|X|X|X{{|X{|X||(|X|<|X|P|X|X|X|X|X|X{|X|X|X|X|X|X{0|X{D{X|X|X|X|X{{|X{|X|||X|0|X|D0000&000%00L 0 R0C00S00$000S0C…0L 0 BR~0 0S0Cx 0vL 0 BRq00'0l00(0g00)0b00*0]000 0p 0  ;/Qꋖ$0`S #0 R 0 >40<LT@C^3A00@C32 0\  2` 3 d ! XC 2hhh 00C0'08S 0 0 00xQ`| j,`PPDAލ Ѝ, !4P 0H0- g&$< g gt|!B-- 0H0S/-0Pi /-A-HAP|0`S@M*0S'0S S f0P 0P@ @Ѝ pW*P 0 0000p5pΕ@ `0p妕X0 T7/0S 0SP 0 P0@ЍA辐-- &$<? fG-\qPL @0P12C001b5R 0 0&0S  h0S*0s0PE`1``d0 R1 *! q ` `  !`` 0R00t0S0PS &0S,P N,@GH--!\  0L0#0-@-p0M  L0@31 ^AP 0C! 0Ѝl֏- @-L 0 0@11D ^Q       -A-@b@0Mu L0 @2# p PW%cP_  Bc p\  Zᒓ$0 HD@,X#10000 2R01   0 0S0" V00 S X ЍA X 1(4/00~X0威0 ,SV Q`ЍQ0S ●ЍA葏`\c  Z5 l-@l%0S Z #b0@0-!BtC-Q`0MS 00S` R@P: 0s%@Ѝ ȏpᄐW   @忏 ޏ0p0|0S0S +@Pp4p00FV@@+P 00T p@p\`W 0S:S* ᆏ ᥏0p0pp-- O-`HqL1P0SU#,@T,P@P5 &0B1 `P 1h L0C R P!050%Pd @T: b ǎ0 p[L0CY1T*Q@@-G-QT0Si:\0`S& 2 c@Oop @d(0d$00@X1 0S. S0 P B H %Q * RA  *0<408@S1:X 0p@D7C 0p03 c0?o< @@D@  ӎP  OP ` @!0 a`2!! !00p30P-&$<0p00/&><0p00 /&><0p00/&><0p00/&><0p00/&><0p00/&><0p00 /&><0p00 /&><0p00@/&><0p00/&><0p00 /&><Q P00Q////////0P/ R//A-`Pp@0 P @U*0Q R* /0/&;J p0 0CSp0 S P0 /p@-P@,`ΊPp@ Tp!D0A S010//!D0P/!R/P/P/Qa/P/0p000 /&><P/ 0S S//@-@!z0p00/&>80p00/&>47@-@PD@P 40R0PP]80   Ѝ0P & iP&7pPQ 0S///&$ 03P/bP0 ACP 0ABs0P r CoSPS//00S00/"T&>0 in00S00/!&1$ i///@-@H0@P (  @*&7pP-@-   Ѝ Ѝ/ -@-  ЍЍ/ -@-  ЍЍ/ ///@-  Ѝ@-  Ѝ0-@-   ЍЍ/ //////P/ @-P 0A 00ЍQ@P @p@-0P `| @P  \*. Q  Rp R  (  p 0 B &><-4qA-P @`p>3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p0@- 00j| Ѝ0S/1>3 !/0S 000/-40S*p@- @PP P p Pp/0S/p@-0P @R`*0 PQp0Pp0S/@-@0 0C0 0  (  ( 0 S/! ^R/@-@0 0 0  $  $ A-P0S@`$0aH U ( U ( S 01 BpC B!Qs0`0sA-0p0@P`M̂ p00p00pS 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0S| u R0) Q/QW\PT|PQ00 |R 0S |0 3/000Q R R0SQ|P.00 R4 R/0S, 0S 0 c S0000  B 0B B00 "0 00 0iR R R S: 0S   B 0  BЍ-4A-PRp `@P 0!᫋000A-@Pp`0 SW' WV00S񟗋$$$T|V VjpGPX`ч1 X``0P 0 B 0  Bs  BG "j A> A``0 F  BU  B) "L A  C d0PS Hp  B0s  B`NpGP`Fe`AA-`@0PS0<R"*1 21<0S 0R0PP0S*! !x000S(!!!,p (N0PA , (0 ,P&;&>8&>4A-Pp0 R*S\ ]\ t`@BX T 4PpP`&$ R@-@:0S000000 S*Q[Q.Q000 S :0S00D000 R .R ]R00-4 8 0 s000/`Q'Q!//&>8&>4O-P 0R@M 3 P&  3 P 000Ѝ 0@  MPP ЍO 0 PS@ Y 0 00<00S*^Q000800R ]R00-R f0S* ]R -RQ\S0]Sg-Rm0 Su:0S0086000S8\ 00000 5^p0a SaR ,0Sf40Sc$0S`<0S](0xY d 0(`c0@`F p@ ߈Uj 00C0e-R [RQ :R =R 0pS:   0Q00`S0`000-S]S0`S0`0p4 R*000pBW R:0`S0`00 S=*R: :R7 ]R400C  È0p pB{P⌳ 0w S0<R$ LP    uP  p$0  0$ 峠0S00`` 0Q00`S0`000-S]S0`S0`0= r R:0`S0`00 S*R =R ]R 0S0 -RC Q@]Q= -Z00  W2 0S- W0`S 0`00S ,Z00W0S Z4 0LP  pwp400!0pᲠ40 P0S 00000 P  P{  [n 0]S S `Q\ r  0  EB#ЍO i i&;-4&><&>8&>4C-@PPp\X [XC`U*00U:0S00400 00 X 7JXX @0P U1@P(p 0 S *R \R0)S ) \ U 1L  vHS\* VY \RV )RSPVPE0xXF )AXXat0SJ 0PB Rt r I 0D OX &(  RPSxPA4#X z 0   000`020+U`3: Ѝ e 0S00200 0RSPU S 00 @2R00PS`U>:$Ho0*S P 0 BP"  B   B0  B0V0\S0{SPP0PS<* ,R9 Q 7 410000 U0 R     0 S *R\Q}Q00n 0RR \P 0}S b^0<0S 00$000*Xe .X< 0e-4)>{^ ]&><@-0@``P?Q $0As R S,,,`00,,8^Qn [Q \Q 0S Ѝ{Qx |Q20V:0S00500 @0` V1@`(P 0 S*0)S  )y V 1L   0 S':0S00500 R*0*C?S\{S0P$  Q0 0S 4 00 0)S  0  $  $  0  (  (  0   000p030` 0V:0S003000 <Q >Q q`x!P  &  R  #+S  *Sg 0S8* *B?RP {R1 Q. 2000' E#,Pt 0S 00h2Q 0   0R  0 `S|* ,Ry  2000< V0 R  !   h0 S*}Q00 0RX}QR  Q +S ( 0  BN  B   B0B  B~?S {Sz   B00  B 0  B%  B  B " A 0000S 00000-4&><^ ]0S C- `M pQpG ipL@P 6W: ЍPPP P $PPxP @P0 uPP 6   00 0  $ ( , 0P4 8 < @ D tg000G R:0S005000 S3:  P 0A0HP  %00Q p0 P>3S! 1St Sq S <0RpQ00< 0o (  {SW S<0RuQp< 000p000Q S S SS8 S S4 +So >SQP>3S S' "S 0SU\ S: ? <0Sg 2H 0@0 @010 0  P0S (IPR, 0E10S*bP 08 BB0SE0 1AS*, ^ R0C*@ Q U B!U \1LX0R#3S#^S!7Tl80SD 0>Q Q QS 00 0R 10C/UUT0-4Ee$1p@-0@S0<QP: 0,0R04S `$0V':8p1P8 S50#p(00<^ 00^ 0S8op 0! R R0 0^P`&;&>8&>40p@-0PS0<Q@*@80P p<0S P pH0@0@P(00Ppp@&;&>8&>4O--P@pMLPԦH0W: TЍ!>3S # S~ S S Sp  p0Ga >#RH0 00 P>cpSd Sp So & S *Sb &S0Sc 0000_Q0SX 0S0 0SO*0T _0S 0R0S=.Sd S 0R  _ R Q RT P o_QP R00 00_Q _P0 T 0r R  T @ T *P0S0 ^0S00S0 0S*0S0T S0s0S 00S00S* T00000_R0h30   _S R  R F R * T_ R P R9 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRJ RL R! 4Rs R>c0G`T R 0 >c0D0H0 00 P0 0 >c prR pRd[L A T0F  ^P?0a !0R@p0A0!RHH A>3   0GrP 0 @ iPw01!># R 0 p`>c`1>3"S`F0>cb 00D/ H0 00 DP0 0 O&>< l%O-Pp`0,@Q V >\# (\ \W \E \O `P \V \[ P <\[ \ \G \02\ \ \6 "\Y \F \ 0H \ &\{.\$ *\ \0s0S \ {~ ^0s 0@0s0s0S{0[00>@4N5>5. P`F`FV00@>N>0> \0C>!0>#0 R@x @O-4M0_0( 0(0 000p 002   0 X @ Q  0 R)  R # `Z X!,    R  $  S  R  V  PP$ X$@1`v X PP@(@ xPPP @(q P  @@ $ X0  QvW PYst va  r _V R  !    _X RG v@(@X 0x  v% YPt P vI_Vxtt xLt v _`V `R`V t@@ v(  P Px Ptv x N_XN 7@Y (@X fY0txPt, xt v  t v  r   _X_V Q ( X 10 _X @jth v xx ,    R (ZS $X $ 0` (ZS  P 00004Ѝ0S0 0x~ @P &>3S SY S$ SVSc 0 F>s2 R >sp0 c800@ 0 ZZR  D>sp 0 L800@ 0 CZH  D>3 1> Q p0p0800@ 0 p'ZF  DS S S @` PSp S 0 >s0F0@P0 P0p  0P Pp 0VP 0P  `pO`p 0 PE >#P  0T 0  0Q>SP!>#"RPEPO--P@pMLPԦH0W: TЍ!>3S # S~ S S Sp  p0Ga >#RH0 00 P>cpSd Sp So & S *Sb &S0Sc 0000_Q0SX 0S0 0SO*0T _0S 0R0S=.Sd S 0R  _ R Q RT P o_QP R00 00_Q _P0 T 0r R  T @ T P0S0 ^0S00S0 0S*0S0T S0s0S 00S00S* T00000_R0h30   _S R  R F R * T_ R P R9 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRJ RL R! 4Rs R>c0G`T R 0 >c0D0H0 00 P0 0 >c prR pRd[L A T0F  YP?0a !0R@p0A0!RHH A>3   0GrP 0 @ iPw01!># R 0 p`>c`1>3"S`F0>cb 00D/ H0 00 DP0 0 O&>< l%O-pP,@ W`> ^* +^` ^g ^N ^_ pP ^k ^Y  ;P ?^t ^ ^\ ^05^ ^0) ^D "^{ ^h ^ R i ^0 &^y".^00 *^ ^ r R0 ^ y | \0 00 r0     0s0s0Sy0 r RY 0>00 E 0000S0R0SpG pGPx0 00> 0 0 0m 000>301> \00 0>000 1>3 SPO-3S SY S$ SVSc 0 F>s2 R >sp0 I800@ 0 @ZR  D>sp 0 2800@ 0 )ZH  D>3 1> Q p0p800@ 0 p ZF  DS S S @` PSp S 0 >s0F0@P0 P0p  0P Pp 0VP 0P  `pO`p 0 PE >#P  0T 0  0Q>SP!>#"RPEPO-3S SY S$ SVSc 0 F>s2 R >sp0 I800@ 0 @ZR  D>sp 0 2800@ 0 )ZH  D>3 1> Q p0p800@ 0 p ZF  DS S S @` PSp S 0 >s0F0@P0 P0p  0P Pp 0VP 0P  `pO`p 0 PE >#P  0T 0  0Q>SP!>#"RPEPO--P@pMLPԦH0W: TЍ!>3S # S~ S S Sp  p0Ga >#RH0 00 P>cpSd Sp So & S *Sb &S0Sc 0000_Q0SX 0S0 0SO*0T _0S 0R0S=.Sd S 0R  _ R Q RT P o_QP R00 00_Q _P0 T 0r R  T @ T ?P0S0 ^0S00S0 0S*0S0T S0s0S 00S00S* T00000_R0h30   _S R  R F R * T_ R P R9 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRJ RL R! 4Rs R>c0G`T R 0 >c0D0H0 00 P0 0 >c prR pRd[L A T0F  RP?0a !0R@p0A0!RHH A>3   0GrP 0 @ iPw01!># R 0 p`>c`1>3"S`F0>cb 00D/ H0 00 DP0 0 O&>< l%O--lM%PQ0t @%Qo ppl        Q 0"RS. 0 YO,Q 4^ 80S 0~ <``F`Z01S` 0s vQR\R 0C1!S` `02o0 Q[0 000,@4H80<@ F PP 0 TX\ L0`s Vd 00 S`FY1`0 0 0`,P XD0S 0 0D0,`PD00D0 0R < 0JS : QP Z Z `p4`XD0S[ 40S,0@440S pi, 0@ R0%00D ;0$0 0D0,-P5DQ/*0 F00,`P& 0 0D0,WP HP 0000 0D0,DH0SPHDgX 8 D0`F0C X?4@0 ` ,0@` V 2 1(1( XP4P HP PR [S. 0 Y),Q~ 4^e 80S 0a <``F`Z#01S` 0s vQR\R 0C1!S` `0 n0eE&; Q00 000V,@40H08 <@P0T0X0\0 00S`FY1`0 0 0`,P XD0S8 0 0D0,`PD00D0 Z ` 0R< 0JS: ~PP Z`XD0Sf 40S,0@440S  p4P HP lЍ, 0@ R0%00D ;0$0 0D0,!P5DQ/*0 F00,`P& 0 0D0,P HP 0000 0D0,H0SxPHD^X 8 D0`F0C X?4@0 ` ,0@` V 2 1(1( XPpS4 0 Y,Q 40S 0r 80S$0n <``F`Z#0 1S`0s vQBo \R $0C1 !S` `0l0Q0 000,@4H80<@PP 0T X \ L0`qV 00S`FY10`0 0 0`,P XD0Sd 0 0D0,`PD00D0 0 S` 0P< JP:$0 WOP $0Z`XD0SY 40S,0@440S , 0@ R0%00D ;0$0 0D0,HP5DQ/*0 F00,`P& 0 0D0,P HP 0000 0D0,H0S]PHuDiX 8 D0`F0C X?4@0 ` ,0@` V 2 1(1( XPppq popm-Ѝ///@- // //0p@-8P00@S PpgP p-@7@-4P@0S TP Ѝ0P -@@-@P 0S k@P/kbP0 0 0/ /0 0 0 0 0/////0P P@- Z / l9-@ l1P P/ /O-$MHpL`@`pS0P5p*P000\ 1001000 S3#$^Q^A20 #TP@P 0<*0 0T A2@TPT  # 3Q R0  QR#   P*0I?oP 2R0SH 0  0XH0Y$ЍT00#03Q0S  0jP0   @XH{ >(  `Q00@-M@ $0 P"RA\ P(TU-00ĵЍ0~0s \0G-M@0p`W PV P%Y P.X PmZ PNx P4 P 6\Wf  /\ *\V+  #\ \Y  \t \X5Z! L \< \ЍYXZ-  [ [  [ [Ѝ [ [ZVY  PЍG   d |  G-PQ00R0p`ᤔ00M 0 ៾@P @0S nS a0CSsNU2  0oSm kPN ЍkPZ V000U000kP[Z V070U070PjPZ V000U000jPZV000U000jPZU000V000zjPZO V080U080i0@q@jPZ: jP jP jP`ZL V080U080?jPo jP yjPJZ8 V000U000"U080V080U000V000U070V070U000V000ЍU080V080U000V000l/jP T(jP  T ( t | @ T $ 0 A-`M 0 P!!0@H@>SHPPP PPP8`"`!P03 pP0  p, 0 np@ np@  p@@@dn0 PnnPn0 PnP`Ѝn00@O-1MM @PDX D"$ "4"(0 p C. `pX@D;@8 (0Sl pp  ` ᰑ 00㨱$ %0!`zp@ t0!0 PP |0S RSn001ݍЍLn0S 0K0S R PGp 0U8D<4! @ P0 0I0Z  0/0h,R <1ݍЍp l 4HtF d d Ttg0@-P@M 0  PLp Rp@ P Ѝ00 0 Ѝ0@Ѝ0A-@@0s/ cPP0P 0 'p` `(`0`0m0ppX`p m``0`0m 00 D p7 ۍЍp)0si/1p0 +Xl@0 P@0  P@1:l?00 p 04l0#S @l@l@+p@ l00l 20@% ۜ ۤ@-qP`O-$p(PW,0-R`@/U'Y1 0/FfZ0 0@fQ :["J? P5#I x@t4 2px 2@zPYh@sUZ0J[% 0@-DM@ P, Pl Ռ= = Դ Ԕ=L= <h+ TeT0 0d0?`0t00T0?P0l0D0?@0p0<0?80h0L0?H0?X00\ 0 00#$Q `@0P"R" " #.0\ !#/2x"$0S"x`@y0`@0s `@ 20$P :$(\0<Q0(0 =S%0h00( @D0c0ba$0 l!#:6$00 0.$0Ϡ.>D!! 0!!!0C 2^!>0$0.S0( /2"́ ?0 0 #1?B! ,  ,$0 0S (0^ #0`@0##q""!|! p@?l""""'%.Q\(\)(0`@S  R $ R `\I!:6$4&60 Ϡ $0! >0!!!0C 0Q ,"΃0/($0?,0S00#0S<,000, ,00Ϭ8(<00$ 0 #1?B #: 6 4$&60|!$,$0!,>Â!!!0C 0R!,"΃0, #1 (, ͌ , ( 00S$ %0 00D2u`Z0`@00V `@h2p0 P :Q00 <S$0h00 0 c0$M` 0$"#:6 00 0.$0Ϡ.>#! 0!!!0C 2^!>0 0.SX3($d/2"́ ?0 0 #1?B! ,  , 0 $0S`@ 0 P0Y*0^R*{ r0s{PT 8<0`@0 dS2  Q9 ^ $ Q*&$ 0PT80<`@  P0000  R00SPT8< 0`@D0`@0  0C0  CQ $0 h00$%`@0 @0D 00 h$%s 0Sp 000000i$0`@2t rt p p _`@ 0  S  0 & D%K`@ D SQ#=`@!D SQD# &-`@  SQD#`@D !0 `@ D!0 `@ ! 0S(0Ss `@70P h: c0 $ _$ ',:6$00 0.$0Ϡ.>(! 0!!!0C  0  " R!Ό "$!( h(\ ?x#" ?00 #1?B!  ,,$ 0\ (  R0004  Q#SJN S  PQ%8< &0dQ(00 3)!:60 0 $Ϡ0! >)0!!!0C Q/ 9 #? /" R  " R $!$0  0#1@0L h0 0%HE 0C00000S P 00W CQ 0_$ 0 0 0 C00 00S ^ 0 0 #\ bh+R" suO-M@p$kd0`l0gd0T`0 W0 0 2c1 0008 PP/ 0v> 0d0?`000T0?P0 0<0?0 80 04$$%"p˟$p 0000  000W 0;0d0PY 0TPL dPJ$`P0Sʼ Rʨ R ʰ R  0 0a 0S0`d@?O$@Tȏ(ET0}N0`d@00cDp@ 0G0LP\T<00 PR\p|hPv^DR PE pPQI d4 吠lpptxP[@SRZ Z00d@x0Ut0Yp0[l0Wh0 Rd0 Rxt [)[8P0>C 0C 0t00@p0` VP x0S rc0ptp0 00@ d0 0Pd xH( "ό R t0"! R RWv 1p?'/!! ԧ#./ B pW ?,?.P P00#1 ?Pv.C BL\Sx  Ptp Ppc 0 zqp 0pqb0S@T` VP|0 ?oR20Sb00ߍ 0bd@ xq@0 Q Q"10!Z@%NS" \TPd0 P0,Pd000 0  ZR 0S 00@ b0d` upb0S  0X0ZS0 `ddp pY0dT0? P0P0d<0? 80G0dD0? @0>0dL0? H05\$XFZP ?@Eb0S= C-ßs"bW2&:##c2S P#m8PP 0 hß0dT0=L30@8b 00P` d0@P ?/' Rß&0Q| 0Y/0 #10">/ 0C!a 0C0 0"#0R"P#. W0mpW!10'/ "#Ό Rà3\"= #30, S0AA^ B0 0 0Epq; @(@Aa#00a0SA㴰@0d0@괰[@0"c01 2c1@TÏ 0a0Q  sPraT00oa0S!10'/` "#Ό R]a00@oWaT00VSaT00Hl(ܪ\)P\( ɚv $I%@-@ Lp# TK taX00 R 0 R 0Q/  /    DQ 0@-0P S@@H  ^0 S  Q 0#0S0 0/T T DH  Q j.0 0#  Q/Ԡ00Ɠ\ 0@-pPo> 0@" \ 0 /HA-@P `p@P@0% XP PPA-\@`@P pjNP@0& >P PPHA-\@`@DP pH@P@0& #P PPO-P M } pP9 谟P n`P P @@ % P P0S  Ѝz T W Y  E0p0SL A-pPQ `@Q P 0@DDB(000S  ̸ @- M`pPPp) _ 0 0@0S _0"S" 0p000S0 7/ Ѝ_0"S1Ds\0pT000S @ Ѝ1Ds$ 6 L ˸ @-@ @O-P`U M PP2SpPK P@N P K <10`0@P6 0nS# =OPP00Q Q P R  \0  KB" 0 0Q@00oS@d000S p Ѝ4 0 O-BMM@p_@0  0UP:OPP  {UPn00XP PC @@`K'0 PPZIp 0P0 0 PPLIp \e@P! H 0dSPkPU0 P p` Ip}  0YP C@PP0 PpS ǩQ P ^ 00BލЍP/U ` P p@^0SQ  JPBލЍ J0H0PP0 Hp=  Id^00 P 0Id! 0 0 0P^0<0  0IhD^!0 [R`00'+^00 P 0I}^00  P 0Iq^0\0 P 0If 0  @dz @  0 -{M 0 { UHPЍ -{M 0 { ?HPЍ >-{M 0 { )HPЍ ?0-,M 0 (MPЍ --S0$ S   0/ 00πtp@-P'IU@p]?( ( 0P 5/p p@-PHU@po]?( ( 0P 5/pθ @-@P 0003/h @-P@P 0003/( |p@-PC?oU20S@ 0 0 03/p 3057$ 5 $ !PpO-`@VPpDM@P؆, Yp0@ U p 0@P UK UK [,0  S#3@  57,050,0 Q,0 S 57,05 50S,0 R#00C R00CT,@DЍF, 0R3057, 5 05 R, S# 0C 0S 0C 0S 0C5$0P$p 0 @V@B 0S1 `@@0 SS( S R 0C#@ =0 R,0 Q ,0 0,0 R<@0S80S ,0 S>3 57,050,0@q`V  FV")VX*0FSTRQPONMLKJIHGFEDBA?>=<;:98bV1 ?R20S/ 032 b0 B12 00@s 0 R,0 Q ,0 0,0 R @YfV ?R0@SQ  b9@S B88 C c3<21FV ,00 S Q 5075,50,0 5SQ= 305 7,5  0,Sf @ 2$01$0@@@0TS`VI2=0F?ofR20S00:FoFRQP Q P=V, Q05`7,505,Q,0 P,00,0Q  1@ Rf 0Sc @[ @ 0PW  @ ?RM0@SJ b9 B88R00F @00R%#jo%#jx%ju-M{0{0 Ѝp@-P`M0@ 0 4/ЍpG-PRM[  `TpPC/a@IP @1000< pp. Ѝ80S&  1 000< ppX0S0000< @ ppX0Sx X0S X 0 < @X00X00 t ( ,@-$$@M Ѝ؅O-EM M`X@P+p `E;D =[0P@'T 0 1[0P@T| 0 (0EAP C CUEލ ЍuX00pX00 @-@` pMPWP& /Z 0RP$  rR$   P @0C rR  Ph 0 @Ѝ0 Ѝ@}0rS ,X 0 p  A-`@ !p 0P/S /~ZP @0 Sp 0 S = Wp@-IMM@`PP Np 0: S X0 0up IލЍpWO00@IލЍpW00 p@-IMM@`PP #p 0: S X0 0Jp IލЍpWO00@IލЍpW00 t-{M 0 { APЍ 0P 8 Q  8 //p@-@P PP`  ;PP u IP  p@*PPp--00 M (0  ЍЍ/0P --M  Ѝ Ѝ// -- MN<P 00  0 ЍЍ/00-@- M@NP  Ѝ@Ѝ/O- q`Pp,M< PR% jPpp0 0CS% P[ P@ 0 @[P N!,Ѝ000:Q!0P00,Ѝh  BKL 0 4z @L 0 '0S 0 B 0 b00  00  0p@-@PLppp@ 0RS00 /p@-@<0<00P  @Kppp@ 0808 00 Q0R00 /P0p@-@`PKpT T   p@pp@-@P\ \  ` @KpTT  p@p0O-!PP Mn 10, 0D`S1H0?a0P^1!p !q1 W0C@(t  ,0@@KDA Œ Č Ȍ A`| Ap2  W R ? \ QQ Wt ,0 000IC1100Q0 0, Ѝ00080 00w40@-@0@ 000 @T AP80@080@-@P AP80@0800-M  nЍ0-M  ЍO-ϟiM P̑Ёq QP@ _P? `K͌U NPD? K͌T =P? F͌(1S *P> F͌(Y Pl> C͌ X P$> JB͌8W P= ̌1S P= ^B͌``=@ 0S078D H0P `P P  P P Pp PP P, PP( QP PP (P PD PxP'( lQ780H0x100C40S000C,0h0LP 0P( <(0Q0Pd  , P `P X hU1q @a0T0 @ T, 0X  p @dQYh`@0`@ 㞾P`'  V U `0P1A1S  ,000@!1S 0D 0| 0?piߍ00P,,0`L0!!\\, @  B  $8 P<`@ Y& 00A00@S= 00 1 `V P`V ,PY 000 `,0匰 0[p$0p1`㐀0@@p`Pp  W 0@0@S  P8<`@P(04 0R(0LPP1@0W0S@@X!(@L N0S00!$0P F[T@0S0 0 8, 8P 0BX00P0 P< BY 00 O0 T ,q` 0q @PV f`Xp0@  P  U  PU,0V00@ Pܰ封[ P@0㋽PP  U `X0pP @Y 0@X RY0,0P0  0, H V 少[0D|A>`Fp1``  0[`0Lꈰ  0PUMP  0@TPOQ @ 0PUQ @ 0YSJ @ 0XU @ 0pWWQ^ @ 0PUY,  `6,  B 08P< T$,  p , 0 H T0封1D|a>p@(8P 0<04 ! , B BP   $@ 0[X T[0,p`p0q0 0q08@<X\PV f`Xp1@  P  U  P対U,0 V00@ P封Y P@0BPP  U `X0p8@ 0<X\P@U.[P,0 CT', 40p! ,< ,0 H0X 0q1D|ac=p@P 00 0R1 (0SE ,00p W 0g1(0pS3 1@ a! @0T0P0 @"T,00 ` @!(0R1@pPB㵻0P@> T  0Pp 0,0 SR,0, 0B ` p0 W" 0 0B00`S9 0P 0Q!1 @TQ @νT,000 @,0,0Q@@ఱ>P`p] PP U  p ` $0S; ,04 1Y 0i1$0 S- L 1Q!qD0 @00T00 @傽T,0 0P @Ta$0V1@V T  0 0P@,0 SX,0 00C @,p0 [# 0 0 B0!0@SC 0T 0a!H 1 P U a P9U,000 P,0|!0RP 0P1` @ɺ0P`R T  0 @  h50 0R80000S 8O-pYM|Cq0cS@` Q 00L3?K͌ 0 0v0S?H`3K͌ 0H0w0S?pp2F͌( 0p0u0S|?Pl2F͌( 00x0Sp? 2C͌  00z0Sd萍 1?B͌8 00{0SX 1?̌ 011s0SLN 1?41@BM@0810 PYߍ 00v0Sk H`w0Sv ppu0S Px0S z0S 萍 {0S  1s0S N <0@-P@L0MH( 00 ,0 40Ѝ000@-P@L0MH( 00 ,0 40Ѝ00\0\ 0 R/D@Q 0Q(00?H/40|$P0P0/ D <  R ,  R$ 00?H/|$0P07 A- D   R'P?UH@0aaS,p10 0D C  (  \@Ub@U(  R 00/T|$0 00L0l P  `0H?30\ -@@  G\,00G//(|$O-PP 4M 0pS4Ѝ>PH D0 0 0L|!00:|@+P` `0D0ZP`@0PZ0 T㱸P V@``@|H:L ?3Q 4Q<  H0 00DpL |"(099`P0S R@,PR @0P  : R0`S4ЍT `@004  0V`Pu @|`|$0 00]40p@-\0\ 00PU 0@S 嚻PHipp 0p@-@P 0PS 僻P1Rpp0P0% H -? \0| DR0  0R0 S000 0\$( /L|$0 000 00 /x(O-tRt2P0M`@V0u T":L"@"4"("2 2 $ 2 T 0 01X 0 01\ 1 ` 0 01l  1pmp0p0npp@z20吲0唢園 $TX\0` 0lm0n \1Q0'0 0 0 0 tЍ|0x0t0p0l0h0d0`000X000P0L00 0D0 @000H h( d0C-餂pP@M 7PP @@{ d"j =@-ÆBBB {`@C{@@@@PV CM pQ 1pL 0p R] @B0 @@@(P: 0 @@@(P/ Bp+ #p' p0 @@p(P  'h,000S :3S ЍP [B2T @T߸ݸPЍh0S,ApP_ ߀4t _A-Z`pPp ZBc2S @TO宸嬸000 R A褸 A 埸ܰ@-lQ+ P@E0`XM_  S- <1^p0!!!!v : !' !_ !| !o !* <#>4{!*prQ>{ R 81 R 0SЍQ L0 0 0Dl0T0Ѝ!fqqp@0l 0̃ S/pTO-C@p`ᜣM[ +㸸(p($W k0CS0SLa3m8rP $3$0/# {% 08:x{rH̲ pŸ夒堂8ırxrhÃqpr(rhrq`r`PrXr弁qPrxrHrÃq@rr8rq0rr,rqps rqrqrqrqrq rrrqrsrq}@s: R 0S 18p10S pWЍQ 1 0 0Ch' Jl`p  \p  00(@T(0Ѝ `ar(@ ` \q!ox+!,!-%!.%0%#fq&i%"`j#%ok{% |l%m%<ns%t%$u%4v%,w%x~#p#r"dy"ezoh@lmt>㖷pp<㑷^㎷v㋷8#㈷:ㅷ0'シ#z #{H#xp-u-r`_o|loipfrcy`z]{Z@|Wh}T6A-``'^` p @ 0^ 0(`V(Pl\O-`ܶ6 6M000ƟJҭp6 0000SVF , p ;p PP[ Q p?P4S S S|V0S%pPn 0@l   $ `00 4S 0 0 40 s 00bR$ 4S4 0P%00Ѝp PP 0 04P40 s 00bR4 440P ?21 R R0 ;0╶ $Q B q 0 ;0 冶pP.4 S S040S$ 004 0r0  cR$`S 404 ` pse0  ;0 Wp PP4P0u0PPcRT T4S{0z$0P s 00bRS40 00V0SipP 0@  ^ $@ `00 4S  20 zS 202 `5 p_ p 0$ $P0 s 00bR40 ; 0p@ P< pg 40 s 00bR4 4$R2P00$0C?o$ r  aR$2&100#?c p p 0pT 4 00 TP0u0PPcR TTg40 s 00bR4100#?c0`00$P r  aR$ $ Q 0000 4 00 40 s 00bR 440`00\0\0! 076<P~Q{zAy PL0(  0 + 0040 0/xO-T4P@P0DM+ 8 `$Qi w :Q|#R3Z 300S 8 1pP 0@T $T` @@TP  Ѝ<V>04P0@P@P@X@-@?P @?P =P-0S* R"'0S[P0mS S@0S 1 CR#0@S ;S 00C S00 0@S0@S mS 0 C;S R  "!0@S; C/o" JP J8O-08vSp@`M$f`ZP U0 ʍr `r 0I"R 3S(0$00 0;PK ]T;P T 0XSd%$ X% 0"L5`0T <504S0300SL p0SI 4SC 4S 0t24W】匡Tp2 >PN 4p2[  LAT `P P Q@ᎲዲoX4Ztx2 PX 04x204Y|2 Pl 4|2hЍH5S4S~ 4S0?o20 D p$l h $ <%$(lY >P Z =P [ =Pp2?;~0p220P_0 rr 0H"R8YD  =P[2[x2Y  =Px2?;~0x2W  =Px278x2Z  =PL2|2[  =P|2?;~0|2W  =P|278|2w1S06 4S2{L%R/q[W]  =PXx2!78x2|"[Z[(`1M80<4 |2O[W,  q=P'x278x21|29p2[G-lp@`S0 ST0S"Q0S 0STC-@0M0`M@ửP. 0 @  S 0@0@j✐†K~"  2 0QU r: P* &, \@WۍЍ 1ee <-P PM 0 R  *’0  ЍX0 Q0H00S :\@-  i/p@-0 0P0S :#`Ra# #p @ᬮ0P: ##Cp# B%0:#!Ba##( -L0LM0 0\ 0ʌ   : ЍL8 80 00\ T 0//p@-PS|`p`@0@ ?0SP0P0:3S 8 80 0 L0:#p O-ll3 0dS0`` M*pB`P 'WW p p PS p   r  `R  00/"1 R" @0S S8 SW0B S h20`2 `tpw  @U ` Ѝ R j  P  Ѝhp P ` Ѝ0 r  `RR  1  S7K @y ` 0  S q`R Q  1  ЍCp  B/oq`R"n000#?c Ѝ 0X0X0 0/8  aaaadQ`p_\ 6l^G-0S03P`@PZ 80$ RG V ʌ3S23pSmW " Rp 38 0 S;,0 0D | 0 00P0qipI PX 00C K0HSP 1TX[00CS``[TY0IS`YPY0 0CP!YU|0 00R0p@-@PpP`0P0C(, ,1C B00P00@UpP 0S 0@//P 0S 0@//P/P/P/P /P/P/$!O-PP + С1D0, 0 S 1H`?c`` AAp0@!qW#갑@W0 8 0| 0p@ P@ 0@0 0C}QP0 00O|0T0 ?o2R0S P (1  //-(^,0R0^Q!R@O-A1@ 0QM4 P`p, @p 0S" Ï#SÏH000C  ```P  (0R0 (00000C00T0 03/p 0PS@  ЍN (0A-S$'p`P4@(0PS@Q Qa ppQ p 0P(0@Spp(0S/p@-`@0P$ (0@SpP0@-0^ @ 0 Q@R0O-`P M@ VU``D0S  00C(00P00 T0P 0 S `&, 0 SPp0SᴀJ`Dp0 `| 0mpP Ѝ 0 S RQ Ѝ,hP e,0a0P 00X p  ``F , B,(`aaA0  U p0E`47P  Fp`,004@ 0U` p0EuPT   PB  0SQ 0 0PC 0$ 0\R =PT 0 BQ 0C R G-l@P 0Sp: P PR E PPQPEPUP ` `R F `0`S W0` XP0`F`V` pW 1 $p00SC 807`PL! R@! P( 4! R# $! R  R 000U1Q0/P00` 0S0  0V(W ѳ`F`V`XP0U0P`W`V``0 @p 0 $p0PEPUP H0 PQ8 0 /$ $\/ P/F(PQA-a@`ؠ1Pp0$ TZ 10 0 QT$ D 0R U ETpM D10 0 QT$ D 0R U EBp; 0D00  Q P@$ R U E+p$ 0$@ P0*@0B0TP @T 80@Tp` 0QE0 PQA-`0`p0*Â@$ PP q@D00T 0QCP- 0S* 0@- \&@T!\8x ƌ8 t @,0A0@PU 0P0U00 S0/0?o2?=XA-$@0S00â?P4 0\/@ 0T `ApB 0S%0^! 0S0X K"@ 0 0 09@U/0P 8 Q@ @ 8 //A-P  0 BS0@( p`0,,0A0C1!0 0K0`S@( X0@-8  PE? J0RB8000$ R8 R0 00S00!R0$R0 R d1S0800800 080 RQO- M4}ڌ`'@Pv z{툰 { Pp,o :PP0b Y4& 800S0 X0 08` ``$T`L@0< H0|0P08 8!\08 `0d0h0p0l0 Ѝ P4/ P) 0*Q! Q80 SpG V P  PʪQ Ѝ  @ A-0QM@PP(C p`QAR   B P1 \.X) P$,PAPP H0 DH00R00D p0$`P!b@0SЍPЍ=@-M @ 0Ѝ@-M @ 0Ѝ- M ЍO-M@ā` HP`JU@p_WNVPED  0  PI L1D00S*Y p$`(D0p0S0`@0,0U00 D0U@pC@`C0Y Ѝ00H00H0t  P PEP` V IIP ЍP @;|$ 0@-0@P0M t  l 0 B/o 0"00  lPP :Ѝ0PЍ090@-44@M00 MЍ90QP-D00M  ( @05Ѝ8P8 /00@-MN  P@N000 0E DЍ0QPO-r( P0@0, 0!0 s0PT( H00#D @ t@T,0Q0@t@T4000SH00SX   R ,  H DS400,01$00Q$0 0P 0qQ 0%, S00,0,1$0000 S 40p0L|@0H00D00ep 0SL01H@400 0,0000,00 0Yl0Y 00S 0` S0F 0R_4000,00 1 1 01IY0CRڸ/o<"L\ Rn Y@L0l00P6P 0 0 SPT P+0 0S0R0S 00Pp ɟ`V0 0CSZ  S[Xp! 0 AS 0 V P0P ` P R  0R  `9(00S< Q0C0  0Y,0 0S000,0 0S(00 R, 000:3s D  RD   00SB 80 S8( 0`V 00P0 0CS 80 @@ NN Œ Č Ȍ N LL\80ɟ`Vpl$8( 00S>0X *1h"0( 80 0 @ `40 , 0W Pp$t00Sz000 @0p` 1`11qW878'880 G<00 00S 0X *1h"0`40V @ 60S F6( 0p|Q:0A0 0C0/l 10 0 S' PP 1 11RY@ RRQ 0   S %( R R !%`FPA p0p`P@ !?3 pGWaF`P `/0 < p  L  `P 0P0P00 PP0P0D0T H00S y080  400 e H(40  p`\Ѝ8 L0h `T<00D RW 0 R PP! [R  f[ $R[  0E0 p0S  0E  <000$R ( 3 H000S2( 0<000h0S0B  0 0|P@t 4000Vg0 0C B!H00 R d1S\Ѝ4080 @0 80/P00C\H00^B0SC V\1( 0, QA@`2`4! ,\@XP ppX@P FP0@, Q J   4p@,@ APWp@PT ``"d̠ˤ |Ƭ  r\pP@l`TPp P @0`, AVXDP q@DH P! X @   \`Q  ABQ`P P4 BQO p @ p  ,@ 0$8 R p P p , [!, !`w @@[`o P p0 WPn $ Q  $P p,@08 P LPA\H0000`, Iy$ @A`0,  \/ `@00400   0}8 0'00@ 0C40c0 pWPx p p  P  , BQ 0` R G 4 DP @P | 40@ PL0Y0I D| p~0TpP:W W@ P p@DT GpGGD@b0 0: 40Rpp0,@0C 0B0W,0P 0p p000E,0෾ PU U R0a R  W R R!R00 S0@` 0 RAA8 LD`$ P@ ,PE@7U LD$ P0B `0 B8 B!!% 00C{ 0U40P0 P,0a0 0R0h400,@P d1S ( 47 I <0@00!R 5Q R dP  .@ ``C 0E0p0 0E  <000P) @8(  <0@ A0,0 0000Sq 0 PC<0U0 4000P4b pQ_ S4S 4Sy W00Q?H5S<  X9( @` 0 ``( <@0 0L0 00 -<000N( t>@ x0 `C0`  <000tW 5 b0 U<`? 0 0LRP6Pj <00 pCU ZʕcH5Sp@TL 0$`P@@U= 8P8P `$=`O-x:xz0t*Mp$P( ,pP @*00\` S@@s  aRXAkHQ00) 4 @Y @B@0@T ROoB@TP `NNQS0)\ 0  |  bR\ L)` R&<) R! CP'I@, 4R S[80S 0P0$  B$ X@0C, 4R CPf S ^\ \( 00Q <80, 004(0RJ0H 0@0( v $P)0S700S00l0S# 0 S , 40R#0l P, 0S yP$0CP$D70 RЍ (70( M$(00 SBFf@`- & (00 S4$&P0C (00xP0S  >P$00C$0@d&  X&0 ,@(@ R 50 60, 40Rp F f@` 0 0, $P, 40BR0S(0g 0KQcڤ%%  p p d% 0(@`Vᴸq@nR @D%@ T ,00P0S 0P0$  B$ X``Q 0[^[ $ 0|$0C ,00(@0 K[V p<$ , 4,! ! x D @  ^$ $@$#0 P(0i0 Rv ,,Xqa00P* x# ; l# (0$0@ ?3S0V{( , 3\0$7 (000P )(0$0S p 60P0  G@$(0lP " 20,  , n40 S ^ ) D20$ ,B@0S 0P0$  B$ $ 00P0 ! 00(@T7ڬa` ! (@00T0!0@Dx P(@0S  0P0$  B$ 0, )a`0S 0P0$  B$ 0, h|XdhtTX( (dX(\|d0 'tƒ /A\  B\  ^tƒ    /1P0A 00` P;ʀ :l“3\0 /@P%0000CS 00000000000000000/l@-@P@M&\\ Y #3t P P 00 C000 0mЍ@l`P -P\P Y͌# /x@-00  |00S d d0 8=0!D00 R 0@-4!41 00ʃlœ\   R  ,Ǡ 0:'.t00 R@\ !A\  `0H$0 000:h/p@-@0@`P0M*l"R R`   P H00 040@ 0 @ &ЍplX02C-00$bS`@ M "2p @  "0S 1QX0&R  l"R. R !p@ '( V@ Ѝ1=00QM0SJ\1p20P10 0H0剑Q:20t1=00Q!0S0p20l00 0(0剑Q:20h00 00`0pY0!Q 00pM0!Q 0l0 000/p@-x0x 000@00CS0 S p0 S P00pڗPp0٘0p@-0CS@0 S p0 S P00p἗Pp0p@-,0, 000Px@p؜p@-Pvx@p0 000S  @-@J Q P\,Q    @/@00P JP\@-\,AP / P/0S/p@-    @ BJR@P`,PTa@@@AR  Qp0O-3C$M0P`Pp@ W 1xP 0 0C S0+,+00GT0 S80  G2 0@0 @D BT p`$ЍJʯ,0  1@Q!R 1Q0 CPg(^01A@D D P[Y :0 0 0I U0@D0?Y 0封@0p@`P`p HtPP+  U  P `X(0 SCJPC0 0(0C\00CtH`$ЍRz TP P  D0|0ip H0@D002 T `V `KvV `` P|TX0 00Ҡ0p@-@Pppp@p@-@80800P  @ppp@D0O-<6dM0@P$0 ^ Q| 0pw`PyU Ps0P0O W 040P0[000P0@SE:I.A@`0XP0P00PEPUO000 00PS0408 00 0`P0p @R@+40T R80 ) 4000C?00vP`FvPH` v$ \400Pp pG`0 0p`0 PP Y 00 00 E 0 4,QpQpP Qձ,pp( X4 R!p! Bp G" RU     HU pG4 S0 0 P` 4,8p 04,0@,@ 0<8?PU 0 4Q00C  00 Sb 0( 0C0, Q0 00PSl 0002 v$ 10 P 00  0ۮ 0 K00000p0[000C?00uP pGR0H`FKuP 0I pA! Ww 0H 00 0ᰡpG W!D0|0ptdЍ004 p` 040T pR0`40 00 0P} 0GPtfdЍ`t0 00 bˤ0p@-`@Ppp p@T R00 JD0p@-@Pppp@ =p@-@@ @  `  @Ppp p@'0p@-@<0<00P  @ppp@ ʄ0p@-00P 0`@0000 0PP`U1000C1.V P*U /UpR00ppP00 0PEP``4O-葟MS D@HP 0X 0p`@ 0 0[  E4/ 0 R < $R0<SP10000#10#.Q00S0> P 0 0@0 0x00 P00 Hr R0S0 0?.P4/[WЍZ00 Hr R0S@0刀0pP4/pW((Q" @-@ RM !R "R pPĜ\  00@]Ѝ/0Q " @-  MS S PpP$R (@4Ѝ/Ɛ-4M0 Ѝ}@-@000M, @ Ѝ||p@- 0B\\@S ^\1  @ % e ,\'\ { d"LA!!A0 4"!! L}0 p%   @ '  pPU< 0 ER3\!@`P    ^0 B! { c\  "0  {  \ @ o% d  + {o\\:\ { c0QO-M  oPP 0  %  0  S  h `\ @u,S 0   @0S *  QS%S +0B GSSQPNMLjiIHGFEDCBA@3>=<:876543210/.-,+*)('&%$#"! 8 0 Sq< 00PЍ%0iR@ 0 `fv`  00#1.R0*R0 S l@0 S[0@@00dR% d 00 @0@00 S0[  00 @@"0 C0 0 S[ 00000 K0`"@ @ 0 @00 S020 0r 0  0@ 00 Ssؑ00s00 00 00 000@ 0TX 0@d0 0 r 00 C C00 0 <0  0 @D@0 @0T0 S\R Z I00 S0   pt  000S0\S 0 S0 00 ,%p%c%+%c <$</>p@-P0P`@0MS PS   00 0Ph 0 Q00QH  8 x0 Ѝp0rrrprtA-@0MS0D0@!0@p0S? ` 0"1!1P!1"b2cP@AL0L  00210BP0 pW$P@WP 0fSPЍЍP 0ЍNTgȧA-@0MS0D0@!0@p0S> `i 0!1 ‚P P@0!0A1 0120B{P0 pW$P@TP 0nShPЍЍP"0ЍxLk>C-@0MS00! 0p0S2 P  0`!`1H $@0 x 0X1@ $A0!b4!b @1c1c0A 0 00ࣀȈ(!h!bC P㈁ 0tS0cS0S㤠 0 @0Pb 00< ?X 00u m8, NgȧLkX>L?-S* &HA-@`p0\ %\0PpS sS lS@ 0\TTW 7000P1CP0@CV` 1D!&00O-霮pQ qM PP- 00S0406 `$  0l@H 00S1  RS G@T l P p 4 @@T %T@%T400 R,:PRlP 400P,%0p,00=0,P0 - ͟00:T T) `DV%?#"< / XT c`Dv`Vfz t``` 0`D@lQ 0>T-0p0  Tg@W -@@@C?T@^ >Tp A0Ds =R=S2t 0BXaevV.`^`0^@ C @00! Dr 2\* R:0Z'TOP ͍R'R ͍T0   R'R'Rp@@pI@[iP 00040iP, 000p^ Q1`!RX 0BS11`U PB=1&@DQVTywvurrpnmlkjihgfedc_^\[ZYXWVUTSRQPNMLKJIHGFEDCBA?>=<;:987654320/.-,+*)('&%$#y1S 0C-11@ Q 34 00`Q,\*P 0 p 40P040`OU; 01 1`0@1O1S  0C-11@ST #Q,%*P  4 @@9AT @D=AA0@a DrQA DR3@D1@ؕ& R ?R ;RL  pR 0%R 0@a0Ds RA0DS 13 DOS ͍!!010@Sl00l0 0St00t0QU PE@=1QP OU5 =1 =10@1@10Ds R-1!TORP=1=1 @T!p1S 0C110 S@Rb  ?R ;R QeR  pRT 0%R 0 00000 0 B10 OQj }RR0  R}R}R@@ps!R =1X@ BT! )4 Q`!`10` Q,0*S 0 ڈp 40040@M, 40,qߍ! 1J%00@QU PE=1@Q@1OU =0@01P@ Q$-1 1OS00P|iP 400P,V 2qiP 4 `V -``&``VP``P``Ì`@oobP``V `{`@xu`rQ AQ A QU PE=1!T@QOo1BV 2i0PQ 4 0,0S@p00@ 0 n00 @}00 '8V a`p00m0&@DQ0VT&$#"y p ]K5#0@0C!@DOo0B000@00-- M0 0 ЍЍ/--M0 0Ѝ Ѝ/-- M0 0 ЍЍ/00/@xA-pQ@PM 0S! XB gP V`V! 6 0v0* V Uz ``ЍpP0U0b ``U  0 0 R Ut U\DP0S U( t p 0S R s0r (0 000SU00oP *h0 p0(0cP h0 p00T;U@541 "P "X ! "@th> ! ! h t 0R @-MI0@S G ЍA-pPP U) @`TV 0PS |y@P0DV  P oA-pR `Q 00@ PP{ % |P vP H$p0 GS  1gP  0 /0r 0 /r 0R0 /r R0 /r R  Ͽ|Q  Aq0 pQ?Us0p pWP·Q| 0?s0S # pP  o   1@pP V0?s0 q%rfP v0?s0S  pP  q0Q ?sp!Upps0q@pP 0?spWC 0岀ḏxS$pCPC " X9 $ 0?"s0Ž nP6 sPD fP*0pS  U R00000qQ 0:!fP fP" $ pP 4g$p0g eP$0V0 p03?/U  R000000 /r R0U0p0p?s0(C-Pa@|!`pM0 8 P 000S= PЍ`P a P 0 Gp R 0S 0PP  VPP004PЍ 01 P @``+ P *`PL KKO-M M:S&0:SSP 0`S:Spp@F T R!*  @ 0  tDlP 0P:S ۍ ЍPۍ ЍC-pP,Ÿ,M M@`tP) 0/SI P5=P 0 ۍЍC0P p! qP20 ۍЍCl0P 0S/S pP fX #0 fX P 0 ۍЍC0 PۍЍ p 0eYW L0L 0 $ۍЍ404 0 $J< X D $   HD H$ XG-p`@P  X0@eT  NP @\PPWP P @T  @0GUut-@-@ M)00 Ѝ@ Ѝ/F Ѝ@ Ѝ/@-@seqeoe@meke ie0ge@dep@-@0 0s0?0 0?0P 000p 0p@-PS@:pS _dP!pb@- ^ @fR^ qSnR sRq^ 0  Q A- 0X p`fR0X P@Ot P0  nR sR0?s00X0 0 R  0PA-P# P x00`pp0,SS00 0\,\@CibP  _ [p`p@  ^G-pl@`PXP#;pWU*nUL sUC fUH0D Y%R> @cPH H0D@ / H0@0 H0H0nUp@0 H P4 sUD fU< L00L0@P @QP00W ,00 ,00 a 0S0000  0@SH  $03?0H00H0H0@ HH @,0s0?0H0@0, H0(H0, 0H000$P0s0?0H00H0 \  O-@ M PZ p {pY ` t`(080H0aPS 0  u}Zw /   qv Y/   g00 R0 , 0R0 < 0R0 0L0S00@ Ѝ>, R 8< R 02L0S @,@-0 000 @S* 0\ Q \R 00\ Q  @00 RER\\  :Q  Rx00\A-p ``V@PR _bP A0u0W00 x /    0 0 0P` 8  O-`0@ $M 0/P pcPpUP5  P{ b0P  0b pP| @P P`@@aPb $Ѝ rbb0,P U 0(0$0,0 @ p @2/Rq 0S00eP^ PU X @/r b0LP@UH0@0D0L0; pfS0  0p2 0 @P PU  @Ot@0nS sSqpX @p4Op [b $Ѝ@pOt@ ``@o ( A-` ppW@P R# XaP 0uϿ   v0?000 0  0 P_0A-` pW@PR &aP 0u 00` 00 0P_0O-LM<  <0+, 4 0OpP |@P0|0`PF 00MZPT FPEB:PP`PP  PI V 0FT 0:,P `a 0 `10#0 $00 0p0s(0p s (00UPi ,PC 0S@ $ .S  ROSQ = pP# @Pe pp`v , R 0?s0V 0S00 R00 D`D0 0SP PO 0 K 0S% v0 L 000  00 n0P /aPLЍ0TS 0  0 00 800 S,0&Y0 ,2`0 [  @0@SQ p@t`00 0 0f0 EPdX ,`@V 0 V P ph (\VQZX %P^VPj `@V 0P & 0GSI( r (0tP ,)0 FrQE F/RVTSRQPONMLKJIHGFEDCBA@?>=<;:t76km3210/[-Y+*)glh `V@ V%40`  @ `00@ @%40    `p` `p,]0 :08 ` Q 0?s0T R0 0P  `p       08 x ?V  #v 0 S00Pd0`@P00 T0@\8 40 08 HX00S0`@ PV```pI 0 00 s0 P ,'@ p@tj p@tG , R 0?s0T 0S00 R900 0S00 @PWQPOT` P0 I 0  ,=P5 P p`v0[ 0@s 0 P0P 0  `?_LЍ 0   pd0 l < (p( PH0  x | P/$P00//h@-M@v0 0!1l!1"b2cNL 0@@0#@B!A@C0PЍNgȧ P0`0K?//@-M@;0 0 LlB N0"0L 2<@0#AB@C1dKMPЍLk>$0P00?//@-M@0 U0L@N $@L0B!b!bN?AA4 1c1cL0P0@$C!d!b8A@C1PЍL?- S*p@-0P0M`2@P 0Ѝp`], 0 0S Q20ЍpG-1!0  aP P@4 04 S0p0p2,0FPP0  |Qp`  3WPeȄpEQ  (W| 0 ȇ0H00-|r8p-4@-@P ]]] ]$],]],00!R  !, 001/+001P//+ B@--@ X@X0@0@0s H PJI HH @pDPA--(M g7`0@[TpSo[jW4C@-whO<(q*]{b~ y\[9&Eo8k  )SRQPO_LKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!  " k{WF{{8!00 (ЍP P 30 00WB0h {kWkc !00 P ~P \# 0W 00 "P  0cP0L30{kWk 0 rP  0cP0I20[DW{ 06{kF{{\Pm  0cP0x20W 0y0 "JP;  0cP0y40 W"  8P:  0cP0}10n[DW!{ 0a2!"SJ P,  n0cP0%ʘ0 W"  R `0cP0$d10W 02P!"P  N0cP0$10W 02!"P  <0cP0@00W 012 "P<  *0cP0@ʜ00W 00 "P  G??oP  t @ G P  P0cP000[D{k{F{W{ 0! P  0cP0tT30{kWk 0 P`  0cP030{kWk 01 sP  0cP0m20W 0^2""aPD  0cP0Kʌ20W 0<2""OPL  0cP0H20W 02(""=P  0cP0D20W 052""+P2  y0cP010e{W{ 0 P  h0cP0ʀ10T{W{ 0  PA  W0cP0@10W 02!"P  E0cP000wWB 0 P9  40cP0jʼ00W 0[2 "P\  "0cP0%x00W 02< "P   p 4 \ $ l G x 0cP0000W 02@ "P  0cP0(t00W 02 "P  0cP0ʴ00 00W", sP  0cP000 00W" aP  0cP0<10{kTF{W{ 0 MPm  0cP0d30W 0r2#";Pc  0cP0 30W 02<#")P  w0cP020W 02""P  e0cP0Xʘ20W 0I2""P/  S0cP0IX20 00W" P  A0cP020 00W" P  /0cP010gk[D{W{ 0x P~  0cP0ʈ10W 02`!"PL  0cP 0<10@W 0% Pa  0cP0Z00W 0K2 "P  0cP0ʸ0 W" 4 P  0cP0qt00 00W" sP   x G  $ x $ P  L0cP0_(00W 0P2< "KP  0cP0h00 00W" 9P  3P  00{kF{W{"00 r3030vx300#W""00 _H30@300#W""00 O300X#W"|"00 B20{kWko!00 520200"W">_"00 %x200p20c0"W"O!00 @20|0p"W"B"00 20200H"W"2!00 1010$0"W"o"!00 10a10100!W"H!00 `10:X10l0d!W"!00 (1000!W""00 00000!W"A!00 00300f0 W""00 00  8  H  8   d X  x P P L  L $ 00 W"T!00 `P00FX00`00-htp00N0| W"!00 G00{kWkq!00 7300#W"d"00 *30{kWkW!00 P30uH0L#"ZH _H 0#"W>"00 20{kWk1!00 20{kWk$!00 20S"00 "00 d" \20A  PH  T@ "00 "00 !00 !00 kk!00 "00 "00 !00 "00 "00 "00 !00 kk!00 "00 0Sh !00 |0S1 !00 t0S !00 l0S !00 dP  ^0S !00 V0S !00 N@ !TD- h \  ߴ h ߀ ߌ0S q"00 70S i!00 /0SO a"00 '0S/ Y!00 0S Q"00 0S I!00 0S A!00 0S 9!00 0S 1!00 0S )!00 0S) !!00 0S  !00 0S !00 0S !00 0S !00 0S !00 0S !00 0S~ "00 0S "00 0S !00 0S !00 0S !00 0S "00 0S !00 0#[D"~P !H H 0#"0SK!00 e0S !00 ]x30cp# v"00 R"00 M"00 H}"00 Cx"00 >s"00 9n"00 4i"00 /d"00 *_"00 %Z"00 H mH 2x""2l0 02L0 0 2,0 0@2 0 0\20 0820 020 010 01l0 0"1L0 0L1,0 0!00 P10 0T,10 0j10 0y:0 @@0 lL0l0 0c? ٠ |  L < P  \ < ` ؄ 8 < ظ \ 4 t ք ՜ d ՜ T 0P0 0340p0 0*2X00 0!|00 0`0 @@r0  s0 @@e0 100 0u,1P0 0,P1 @@F0 o1!00 10 0!10 010 0G2 @@(0 82 @@ X0 l2t0 020 0+;R\0@-L @AQ MO!Q0P PP 0 0 QȠ\ 0;B{ 7G 0 Ѝ0;B Ѝ03Q Q 0A@@1 0^46 0b0X #6 !k(7(@{6F{7{   ;B Ѝ0qq/ /P 0S $0S 0S P? @4@P//A-P08pP`& , R0( 4", 0R40G@BT@! RV @D 8K,0400GD0, #@( (8/P840,0S00 40Q 0 @-P0 R 0 I H SpTPo @$ @ < ?40P R $ R  R S /0?0Op\>0U) 0PEt@T7p0pp@$>00Sv ~=0000CS 0S =007s@ Q=0 C0 0,0`S P?N?P@?5 $?M t?Q?H?A?L (?J \ ?C | `B ?9?:?;?<?8?R?D?7 \?K ?BX W ?O ?E?I?6?F ?? ?GX ʈP ;UT 0PEt@00SQ! Q6;7sD@D  0;=0(000q^ ^  T:PEt@ T*U#   0s 0 @p 13$0 [U ($ ,U 0PEt03>0@\,( @Dʈ+7~M<2q@D0 D0B$0Sp0  0p2@0V'8<#0#w[ 202HL0  200@S2D0x pn 0S 3q0P0;T02@D0 C@3q@D07s0D@C s P7l0{1r0ರ^l[PEt@[UwR!B"0$ 8 S0l00X0S>0p0P0?0X00 p0tP `40s (CP @n 40d@ 0p040H 700p_40R4l 0X[qPEt@[kU 0C00Sq 0 000(1 T*U $((U_ PEt1岐@^ Ԃ 7sQ0D7{D @C7s0D@CqCD6L0$ R'400  0r@6p0> 0sp0@+JP7s@DZ 0ಷ@D'q@p6l0 00` 0 0P00p0P0 Xtp0(0$P$(00 70( 'r0R0S(07@D0SR: @3 0@|0-8@0F(80v 0s \ p T d \ h tP 80C pC90S800p@-@VPP80S ($03/$0(3/00pPA-@`>PP@p0 QR 408 B4 08@V000PA-@`PpP 0R| S  'P00S  E B0S  00?>?RP 0S $0S 0S P ?,B4 BR/  $0 /C-"2 0 M000P@P`P-@ R2Q <001 0 0S!B<@0 RD R  0cPࠓ^ S R5 0 1 Ra @ <00 R1@ 0 <l0P\p\ G R R0c BP  R S R 00S  0S  pl0Sp0p0Cpp0+x0 00 0NP0,40p0 x0 0 0 30 Ѝ0l0S  pl0@@@ ꐄ(?S??&0P 0S $0S 0S P?,A4 BR/ Q /@o/?AA-PXPx@ 0!(`3/PPu 8pWG  ( 0(3/pP00@c  Q 0  \!NP S>0R:oRS B P T  B T p W0Bp3  (08#08pPp  BS>00p000@ Q 0  \ P S>0R*pS. 0A p p$0(3/P 0S $0S 0S P ?,B4 BR/ :+/P 0S $0S  R 0P0?0@@/O-PM@ @㬰(0"U 0C0 0$SQ $Cp0`0 sRpW($0p  p0 Ѝ0` R`V40sDJB 0|=J^S30 b6 0s0^0U 0 CP0S 0SCUP!( P 0, ! 1T2 0! T 0SЍ0W0T0S Ѝ0D?o 280%R00S02000@04000408@0D?o2<0,000 0 0 0C$0 0R0pP0 R`0ࠃ40Nࠑ@00t000(@<90C1@ R@P00F3 0S $Q Br R$AVJ  ` V$  \ F C 0 Y( V F(*Q BR  BRW < Q  R^8 %Q  RX,  BB!   S @1P ,01( 0 (08 $ 0 00 40V@NL(O-pX04M3 00C PU?PU@PUAP0UAPR@oPP 0C R R0 PR \:0S@\!v!w|U!1^  RX  `\h$X  `\h, Rl R O- M`0P 0\QpY 0@SQ QKW0ϟ S  RE R  R( (pQBWR BQPH/S6Qt0S 0S: R R .0 103/0@S0P P0W W 0S0(0 Ѝ0S>00000 S *S0SWq00Q 0SD0@S>P0 W0Ss S00W0 00#400 00 0  0#400 0 `0S0c0?o20 Ѝ0 0&S+B(l0S<  B0#2 2c0# 0l0S q000. R0f9S H0t0 0 0  R ,0P0S0PUP$ ^01 R \01200 00 0#400 00 00 S0 S00ӈ R01 00 00S 0 0 0#40,0S0 0E000S ! P B R  PE[ 0 X0 * PH 0 ,0 SR0 B00 0 0 0 0 0 S0 S00ӈ R01q 00 D R}0ES IS= [S8 gS8 40S0CkWi D8 RC0SS@ S   00#  #800#"0    ,0 S R 0 0I000S'  0 0S0   0S,0SQ5: R ,0S  R0 0[00$0S,0=  0$ 0S0   0S,0SQ: R0 B000 B000,0S,  Rg00 0 B000,0g  S  0Q0u0S 000#400q00]0SZt 6l8&`6&6 &!909&tl0I0Qtl0" Yt0SWc :W㴖K 6SV \0l S 8 B0 l0\000SDI\ R8 C0 l0\000S7 xZt0(l 8`R B  ^C 6ƅ6ƅ6ƅ!909&6Rt0l 0C t0l S/t0 SW S Sl 8`0  W 0S0 B00 ^ ^  [ [ [ [ [ [ [ KoP᫲[@ `P``0P0@&ƅ&s0(!ƅ0 01I>  1001&=  &6`Rt0l 0C `t0l z\0S8 B0 l0\0<00S=p#  #800#"0 00]ۼB 070c*W6F &R< \ R80l0 C;0,0|T 0 00 0000 B 0L0DC0C t0S*l0\06\0l S 8 B0 l0\000SD10,\ R80l0 C97531/-A-`pPTq@PG Q00V0SI04!S 010: (0sQ Q 1@0@!A00000 |0 `\p# 0S%t l00\ R6S S L D0 BC !060@! Rppʈp@-@.PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0($03/0qVP0pPO- M8\04< `08^1S00PP 0 0pS{ $0Ss wpVjV`F0HSs0FSRo WmZkFoY㫲[dV @!( `4/@Pi * @ 2)X  P "L  BT  A0`, `4 ( P6/ , `8(6/ L `@(6/jD 0(3/68 R! ( @ R% D PR! 00C60p删$0 ЍOzv `fp00$0`(0 } Ѝ8 80  000&Ī-M 0 BЍA-P?PUPr0 `0@ 0S  00 0t!(3/@PU \!@@ 0 ,(P3/ 0 ,(83/ 0 L(@3/z 0( D3/080P. @ R+ D SR% , 8 , @@ L DD &!0 0C006& 0&;> 0$0;/TO-Q$M R0   0S "r ! "0o P@pLß 0@$0*  ")z0 (ay0qx0t0@Ar0 ! P1:SuPQ`&9SuPQp'8SuPQP+P5S>3s0uP1@$ " "@QP0@R P \!R!!P! \  ++ +P ! @$ @$ $PD!" ,!$Q"0S 4X @RPR@$t@a@R &P%uPQL T%$pAR%D$ pQR$T% pAR%D$ paR$d& pQ@R&T%@$t@\%  C R  00#s01^ #$ЍT 0o""1CBQ) @pm@P    C-PRp ` P  0!\0 0#@B .P@18R0  C @$' , C-PRp ` P  0!\0 0#@B .P@18R0  C @$' P @-@Plp`hPp@` 0!ȑQ0 0#B   x @-@Plp`hPp@` 0!ȑQ0 0#B   p@-P04`^00# @L P%!p G-pR'wph Q RO SRCW-o`VA0A0\\\0 p\ \  0p0\0p\ 0\p0\0p\ 0\p0\0\ p\ 0 0p0\\0p00 R7Ǡ7 lŒcV V-2Q0 pGN0 Q"R 0pP1W1|G.7&c2pG0N 1pW|GpG1^NNQV=F10C>@AP  $B0R`R0pR p`0pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p0\@0A0C 00 pP80'7b"c2pGNq%R&-7c20Bp c!qÂ'b "0C0,Q  HA P A@8R,C(0 BR,B B /qR&-7c20Bp c!qÂ'b "0C0,Q  HA P A@8R,C(0 BR,B B /q/ _xU/0S0`0// 3-66@-S k>@@0 #400k.06S0k. ς 1O- p:PTU0!`Q`+ṐY* V@ : U @0ς!\KU V*  p0Q=0^QQ [ 0O-DM PX%@QX 0F  u pGjP0P4 \AB\S 1vσ p P Q-0[P4尐&G B&Sp  @  ipWPQ=00ද0 K`{P0: `;VT`+0I AX{T4T+ pQ}Qp0W20|q~6x `00[0` IT$P0>0 0@00 0p~0 S[0 ⵟ0  !  W X SA ׾ᨦ [㑢* & "& R\+ ೞLY LQ LG⋰@ 0p@Q0C Y> 00A@N0 \0000C01 LQ @00^ 0 P 00U0 0S@\ R @02^02N00 R0@\DЍW@  yP 01LX 1R 6 G2#6pP^p N j p=A-`@PT1R`QPE0+~PT S#Ό` T000U0 S @S ΌT00 T,`0R V1>0T000` S ʰ0T00 0`0T00 0``0O-` MVPPR@ʀk` W !.⾐ἠ i5Rs0( P000P#406IP0cZ3s0V⾐5s0iS0P⸠P0%TPVIPeQq BYr 漖P9s0000P#406cR!0C 6Vj VPT@Q p` 0F?oR20S RV0XW R+}~ʲᰐpj5WPs0pPJs000p0#40vPpgYww0 UVA5Pps0k.00P0p#406VPcQ 0C6PT@ Ѝ Br 9 kV0& PPQ^`徠἖0`j9Ys0`J 0 00#4 0编0iQq0  R0἖`g)0 6b궐pi5Zs0P000P#406I0cW3s0 Y㼖P Ap9s0k.00P0p#406VPcQ 0C6PP) P V# Br 5 yO-ʀ6knS㼖0M #P  #  # #  #  ! A@b9 Ts0@p000@p#406 B0c^~00἖&R @ P$ pḀn9 Zs0 0N 00#4 060cXx0qX tq@DphWt@>s0挥pH000p#4060cTCt0 BR@@@CAԕBԅqಐApi>Xs0000#406I0cWsw0 0@弖^ `D Br @n9 Ts0=@p000@p#406N0cR#r0&0R἖f b9 ^s0 @Pk`0`00@#4PP0 B0`Qq0 k0&Ѝ0἖=0἖9h\PD800@-(  ;0,8+J &̀+k. $ˀ0G. 0S0 0xS0 0LSZ=I, ( &&A-@ k΀`P s0! Qr p p "$  aS2s Ak> ,u 0  u0#Ġ  <##4U0 0 000*60@-S S00k@@6 0C60k>@PP@@!PPƂ0*0@-k6 Sq00@PP0#4@@06c\| 0Ck΂ S600@PP0@@@#406 0CS6 S00k@@6 0C60k>@PP@@!PPƂ0O-0 QR@ M, R 0p&]P+&(+#0N  q/ ! R7@P j   Q&Q3 "[q6k S ;p3 s0000 #406 cPp 0Ck N.V6 0G. 0R0 0xS0   0LSZ=00IX  &&0 Ѝ  \ R+R +R ,RE R  Q ,_ R3 "&][Pj 0w ЍO R \3 "[k. Z0q:s00 00 "$ 缦0jQ3s0 J+ ZB(弦|qk>0#40缦0j\3s0 J Z㼦syzk>0#40缦0j\3s0 J Z㼦T@|qk>0#40缦0j\3s JpM⼦k> / ! Zq ! 缦jR!r JPἦ L I  Q3 "[F@q:sy:s0:s0 r :s0]q#r 0:Ɠ0@-PV Ɠ!DPV @Ɠ@QF !6@o0ƓAƃDQ  !I.Ì!ܕ"܅&  0S A-P p@0 C`0@HTUT @aP /@- MP`p@P @= P Hp . @P  ЍI 0@0 ЍB@ Ѝ=0@.T  Ѝp@-P@P @ @p' 00p@-@0P 0000 00p@-MP`@P @ @00 0Hp Z.@Ѝp0@Q.T @Ѝp0p@-S P@0 C`\0@?HTؾ 0 p0P@pvaray0p@-S P@0 C`70@HT 0 p0P@pQdict0S p@-`@0 CP0@GT @卾pp/0S p@-P@0 C`0@GTp`(0P@kp/aray0S p@-P@0 C`0@GTp<(0P@Gp/dict0@- M P@ Gp  @P Ѝ0-@ Ѝ0(@ Ѝ00@- M P@ Gp < @P Ѝ0@ Ѝ0 @ Ѝ0aray0@- M P@ Gp < n@P Ѝ0@ Ѝ0@ Ѝ0dict- M} Ѝ- Mv Ѝdictp@-@P0PPpdictp@-@P$0P p#00pboolp@-P`#@P  0@^p@-@}@%@-@w@<@-@q@S@-@k@i@-@e@@-@_@@-@Y@@-@S@@-@M@@-@G@@-@A@@-@;@@-@5@@-@/@@-@)@)@-@#@8@-@@C@-@@P@-@@]@-@ @hp@-P`@P  ]0@pp@-P`@P  K0@pp@-P`@P  90@pp@-P`@P  '0@pp@-P0`P@P  0@pp@-P`@P  0@xpp@-P`@P  0@fpp@-P`~@P  0@Tpp@-P`l@P  0@Bpp@-P0`PX@P  0@.pp@-P`^@P  0@pp@-P`L@P  0@ pp@-P`:@P  0@pp@-P`(@P  o0@pp@-P0`P@P  [0@pp@-P`@P  I0@pp@-P`@P  70@pp@-P`@P  %0@pp@-P`@P  0@pp@-P0`P@P  0@vpp@-P@(0P p#0P 0pstngp@-P`@P  0@Spp@-P`@P  0@Bpp@-`P`@}<P p P U pdatap@-P`@P  0@pp@-P`@P  0@pA-P%@BX0P pO(`P  P `*stngp@-P@$(0P p0P 0pstngp@-P` @P  N0@pp@-P`@P  =0@p@-@R 30@p@-@$P$0P p 00pboolp@-P` @P  %0@pp@-P @P K%0@yp@-@$@@@-@$@W@-@$@n@-@$@@-@$@@-@$@@-@$@@-@$@@-@$@@-@$@@-@$@@-@$@!@-@$@.@-@$@9@-@y$@D@-@s$@S@-@m$@^@-@g$@k@-@a$@x@-@[$@p@-P`@P  v$0@ pp@-P @P $0@ pp@-P`@P  U$0@ pp@-P@P $0@ pp@-P`@P  4$0@ pp@-P@P p$0@ pp@-P`@P  $0@ pp@-P@P O$0@} pp@-P0`P@P  #0@i pp@-P0P@P )$0@W pp@-P`o@P  #0@E pp@-P_@P $0@6 pp@-P`N@P  #0@$ pp@-P>@P #0@ pp@-P`-@P  #0@ pp@-P@P #0@ pp@-P` @P  i#0@ pp@-P@P #0@ pp@-P0`P@P  F#0@ pp@-P0P@P #0@ pp@-P`@P  "#0@ pp@-P@P ^#0@ pp@-P`@P  #0@z pp@-P@P =#0@k pp@-P`@P  "0@Y pp@-P@P #0@J pp@-P`z@P  "0@8 pp@-Pj@P "0@) pp@-P0`PW@P  "0@ pp@-P0PD@P "0@ pp@-P`3@P  x"0@ pp@-P#@P "0@ pp@-P`@P  W"0@ pp@-P@P "0@ pp@-P`@P  6"0@ pp@-P@P r"0@ pp@-P`@P  "0@ pp@-P@P Q"0@ pp@-P0`P@P  !0@k pp@-P0P@P +"0@Y pp@-P!@ (0P p0P 0pstngp@-P`@P  !0@6 pp@-P@P !0@' pp@-P`v@P  !0@ pp@-Pf@P !0@ pp@-`PZ!@B <P pP U pdatap@-P`[@P  d!0@ pp@-P`k@P  R!0@ pp@-P8@P !0@ pp@-PJ@P }!0@ pA-P @ X0P Mp#`P  dP `?&stngp@-P @ (0P p:0P 0pstngp@-P`@P   0@j pp@-P@P -!0@[ pp@-P`@P   0@J pp@-P@P  !0@; p@-@Q !0@1 @-@R 0@' p@-@0 P %%p@PP"0S "p"0M@-$@@"LvDP 0R @-P Q Mo// b\ bPP 90 t@-0 ij  @-P Q @$@ @0@ f0 ⯳( (0( g0 ⦳     0S p@-\@`@@ PPpP p@ 8ttA-P`pD# "@P  `P `ppQ"ǰP` R H" %@" `%%0t<Jhp@-P @`Pp=P p@?@- "@P $ 0 0 0 s A-pP |"@P"  0 0 0 FPk"`P  a` P0 000 0< @r h @-@P $@ f 0 0X ߲ d  ~-A-M `V $P0 PB@P)"pP  0PB <ЍAЍ/ЍAЍ/ 0 0t ⬲ ߘ H V @-@P ֮@  0 0X ⑲ ,  H~p@-@P x0 0 0R0 P!0P Q # p@eppp \p@-@P `0 0 0R P!0P Q # p@po \,P/0 0 0R /oP/<0 0 0R0/P///oX [0P @-od  QP  QQ #/n [,P/ 0 0 0R/n|@-@P \0 0 0R  N!0P Q b#00nD ZxP/00 0 0RP///m Z8A-PPM /o00 0"P R Ѝ R0 p 0 p !`P 0 S  R H  A pP` N#  00m| 0 YH Y:p 0P@: $0p@-P2s0AL7@LP@a`Lt0 0LWLV p@|0 T0s0^0pp0 // p@-R 0@S PR :   Pp4 0P  , 0`0` ``0 KP0P P0 C<0< <<0 ;p  Ҵ  ( Ҕ ( t  0S p@-P@ P@p 0Sp/p@-@Q PPpQpp@-@QP Q PpQp@ @-0 MSPp@(&TX zP @Tp <TZ >T8B&@Q hP Ѝ\T\^P YP @TO /TTR0D'SLIC@H<9EDCBA@?>=<;:987654320/.-,+*)('&%a`@T P@&@Q Pr@f@n@t@ Ѝb@T `p 0 a>QQ P, ,0, (0( R l X  40p@-SG@`PU Q Q P<Pp PU Q P QPU Q P QpPQ P Q/P p@> 0 0X  h L 0p@-S+@PPU Q rPpQp<iPp/bP PQ ZP Qp@>Q 0 0| ⹭ x \ 0p@-S8@PPU Q 6PpQp<`,PpPQ "P QV P Q P Qp@> 0 0 p T 8 0S /p@-d@P@<@Q Pp, , P p@   \@- @P 0S <IP P @[p@-P@P  P 0,P0 0p@A-pP+ QPP0` 0SPU!g@P  cP <P P`0P 0 03/P PPP PA-PQ`@    0 S S C\P 0 S S C^\<SA 0S= !S&0-S80F?o2-P0S00S*S( -S0 -S0>S  0/S[ p,p0 S S0` ` S S/S >S S 0 S S0FU0 RcP0/S_ 0(00>Sb S1 0S S S   0CS R` 0 S S   CQ RS `0 S S S S 0 S S`FV0S p 0 0W/! S =S`B`0"S0S   0"R R  "RC$ >R0 W0(00>S`~ 0  $ 0  `pG-MX@`pO P (V W$ P <P &P@ aR lR gR- qR uR oR  tR ;R"@ tR Ѝ mR8 pR oR sR ;R'@ ;R<@ tR ;R>@P P"P \P@ V  P U WP P pR ;R@ uR [R\ BR񏐮pugf"R /R@S00S00 @!1 0-2   0Po 0 +r  RD*0 Re \Rb  uR^ |PY +r PT6I %" 0 )Ό" Ƞ"̌"< 0 Č 0     SP00SY" Yy  ͕)   0)#<  Y,!*-"-  {  )&  s \0 S S   0CS R/0Q /@- ᚉoG-@0`PPV V0`@@S aq刁`p00 S S   CQ R<S:  UP#   UP  UP:0@S"S -S 0@@-S0>S @ 00>SS 0 @>SSS @@PS S0S@@0S@\`lp@-P @PP V Pr0@m@p @-&gP 0 0j/ PO-IMP g @T p `0 R 2/0g\ P Y  9/0  pPV @T!1 0o/ǩ003/Y@ 9/T fT T @T@" 000Q 1/0f' P70S+ 03/P. Y 9/f@T 0 0.Ⅹ 0 0o/|Iߍ 0 0.q 0 0.hY 9/Z 0 03/l l0l h0.U U | \_ X0$ 4, @:O-IM袟P @p ` @@@$@@@(@00 S S   0CS R0fSE ;"Sm [SbL20 @3/P 0 0  0@@@P p40,p0P4080<00Y@-2@ N x@-(@@5 ]0\ṟ⶟@-@@O-4@T p`, ⣟P @@D¤@`T P礀Qㅑ@0@ @0 !PZ PZ Pٴ L @-R 0P< P 4Q ,  D D0D @0 0 000 ,0 /4 @  tlp@-@M4 00R0SP,0SER 1`V- P` 0 0<P 40, 0C40P% `ЍpS' RgcЍp 0 Z0D ➡p p0p l0D ╡\ \0\ c0D ⌡D D0D @0D ⃡ Ld (לy x TiA-@`,pPP W 0 !,P0`,P0`C-`0@SPpMD  mPL00Ѝ!0 P ,0SU !0 P ,0S(0S00  04P 0S?0S0"S]0:S T0 }R00 "R  0"S P  P @` 0 @]P , ,0, (0\ ՠո H T  (Ԝ0p@-S `  Q P@,0@&p 0  0 ⯠* 80S 40 00\$ $0$ @-0 ☠) 8Ө 4 @-R 0, B4 P @@ @0@ <0 }, ,0, (0 t < `O-80M@ Ѝ@p` PP @H`W@ЍȒ  .NPP0 0 &004QY (4 R] ,剱1Qw  ᒝ P 0YIW  B B!D,0 P 04 `<0 04 <0 ?P,UN<U8U+_Y& 嘡 @ mP  PP) 0,S<SS> cP@ ,0P`<04 0<0x<( !,0P !YP {,x x0x t0F/⩟d d0d W0,⠟L L0L 0 ◟<& x3 TѠ 0<Ϥp@-@PP0S L  Q <0 0 p@ 0  0K/j$ |$p@-@P 0`0VPP l l0 0 E0@S0<  pPp( (0( $0K/<$, l8O-0@SP MR z`40SM x `iP@ ЍP pP 00S 0q 2 00PX 0S. @0R* P# [` P 0P 0S P'X BD` ЍOP 0  03/P  40R 1#PP 0 0U/⨞j 00C 0rP `@zh h0h }0U/⏞P P0P L0]/↞# #"P t!t h˄ \`d@-@j0,S<SS 0  0 Z <HʰPG-U p`0VRV@P7 404 S ` S` D000,0 100,0$ 100, ,0P ?o  @ 2\0S0SP`P : w u 404 SS` k `D D0D @0c/0 000 0c/ ( " t,G-PS @- Y`' T 1p 0R  004 00R% PP 0S 0 GUed d0d `0i/⤝0,S0 000 ,0F/ⓝL d42 8ǔ G-PP' 0 0R" 4pP 40S @,0aᄡ1 a _,0`儡40@T:8 408  p0P 4  Q@-P80080/Pp@-@P 80080p@ p@-@P 80 0R@ pP 4@ pp@-@P \0 0R@ pP` 00S@#:} p@p@-@Pp @k pA-PP 0 0R4p`[ 40S @40S ,0 P@J `D A-@P 0`0VpP5 0S ~P @T @ @0@ <0]/ⴜ@@ @ A-PP /o0`0"Q@@T @0R p  J@P @T  @ 0  0]/y (,0P \@- ^ 400\@/ 0  0F/Y 8P¬ 0P o@-x@ T\ @\400\@/ 0  0F/08 ¬ @-PP M @1 0R Ѝ`@ 80  Ѝ@  P 4 0Rp@ S*,P$0 B!(400C40<00<0h h0h d0s/T T0T P0s/ޛ@ @0@ <0s/՛ phv L4w ($x P/?o0 2 R0S/0@ S/ 0P -?o82 ^0S 0 Sa/P/0 0@0R/pP/0 0@0R/D P -/o<0"0@0^ R  R4/ ZA-`P @PpP (0Sp 0P  pA[`L %` 0O-0S@9 0@S7  `P. X8qPp P P @P HXP0UU@U !#10< ,$P?@O0 s0 X% XP0@#r 1 P7 0 03/P0  40R 1#P' `P 00C 0P  $@ꀐ |pG \ \0\ 0 8 808 0 <H n| nl40S 0C40/ 0  @-0 ۔ n,0p@-S `  Q P@70@1p 0  0 ⺔( mPip@-@P 0`0VP0S R <0 0 p@D D0D @0 ⒔0 000 ,0 ≔ l lwG-S *X@` V 0P 0R t`q00p V` V _0S  Gr@ @0@ <0F/H0,S kA-PP 0 0R4pP 40S @,0a, 40a@T:8 408 p@-P80080p@-@P 80 0R@ pPg0@dpp@-@P 80 0R@ pPS4@Ppp@-@P \0 0R@ pP`>00S@#:8p@Pp@-@P+%@&pp@-@P80080p@p@-@P8@@@pp@-@P 0 0RP`40S ,0AT p@p@ 0  0O/{L hhaA-@P 0P 0R@ p`8040S ,0X M<0, 0Q<0X@@>@D D0D @0S/=0 000 ,0S/4 g ghp@-@P H0 0R@ pP`@pxA-@P1 0RP`s4P%80,0!qW&  P  1P ,0P < 0@ 40< PAAJD D0D 0W/Ւ, ,0, (0W/̒ e< e0P -?o82 ^0S 0 So/p@-`P pP@eP (0S p@ 8 h c011/A-\@`pP \1S 0 €  P 1P1 `p P 0808 8A0 Z$0$ $B0 R| ed eDt@-@^ P ^%QRS  T00NQRS"  TŒ 00 0 Z0  dPxG-@R00QP(M P 0 ` p Pl `0T?o20S00(Ѝp`0 p0 2/ / /    Q /0 2/ / /    P /0     Q /0     P /p@-@PP`(M/ 0S, R00$P (Ѝp0-S0 0 0 0 0 0 0 0 0 0 0?W P0V00(Ѝp@ R 0S V00p0Q000 00/@-@p00T0002@-@T @-@T000 000S/@-I t000 000S/@-9t000 000S/@-)t000 000S/@-Lt000 000S/@-  t000 000S/@-t000 000S/@-t000 000S/@-ْLt000 000S/@-ɒ t000 000S/@-㹒t @- @?^ʎ0 !00@S  \pt ? ? lR! 0^ < 0  0^ \#h  0 01/001/h0 01/H0S@-@1/00/p@-P0P0 0@0PS` cPpnpCt/@-:-@-000 000S/@-)tAo//0@-p@P M 4 P Ѝ0 0 ;0 tv [@-p@M L P pЍ(0( (;0 @tw [80@-pP@ M T T T  0 Ѝ04 @y Ѝ0 0 :0 th Zp@-@ @ $a 0 80 ૏ t^ Z4p@-@PP (P$Pp0 70 0 YXp@-@PP (Pp0 70  Y4p@-@PP $Pp0 70 p Yp@-@P  Y.<+ < 00 ;0 R Y@-@P ( 0 70 A( X@-@P $ 0 70 /$ XR/-ptx` P RgJP5T   RDJP\ P?e0 ?o)0⃑ iPI> 08P?e0 ?oP 0CP(5H RJ@= IP?e0 ?o5H0 SP RJ@. 0SYR03<PR 03<@@PP!R  @0!32P@@@2 R@᠏ P//-ptx` PP5? PP?e0 ?o%0⃑ iPI 0 08P?e0 ?oP 0C5H@IP?e0 ?o5H0 SP@ 0S0Y 03<P\#4@@PP/8@-@Pi80 0 @  0""048# /UUUU3333  p@-PQ@ : Sv P Sd0 V Sb0?0 r-w - 0!= S [ 7SJ @Sx00 r-w-0  R< R7 Rx 0 r-w-8!@ T. T( T0 T x :0pRs  ! Ss0  Ss0  Sw0 Sl0?0 Sp0  Sc0?0-0- S t T S0- A0a0-0$0$ $90 ຍu( RO-8AP@:  ᲈpPA ؉PA  pP% 00紈` 0@T' 8P0=S AP` AT BX ! [붉ᐈD0D D>0 l ꑏ00 QC-@``"`2`M 0P$DT@Pg p`XP `@\@h@d@l@XQpk p Jp` o{{o{$P  {Jp[ p0 0S08@R0<@@@@40040,4--0-4L1L0 00D000B,X  #(0S pp@    Ѝ^oЍ @0 0  ݎ َ tO-PMp 0GW"S00`0w@ӇP-TPh +T@`0A ? 00e 0^ P p   @00Ds \a0DSW0DA0DS"70DURY :P Q   S  R  "000T7 W. 0p0R00S 0qS 0F0 Ѝ0S R 0@0`]00 R0  Ѝ p p᠀堐 XR A B0A PR W @ 0`H0H H?0 NW ppmd Ll00 0M0Ѝ1.O-PMp 0GW"S00`0w@P-TPh +T@`0A ? 00㔇 0㍇ P p   @00Ds \a0DSW0DA0DS"70DURY :P Q   S  R  "000T7 W. 0p0R00S 0qS 0F0 Ѝ0S R 0@0`ꌍ00 R0  Ѝ p p᠀堐 XR A B0A PR W @ 0`H0H H?0 3NW ppm H(00 0M0Ѝ1T.O-MD@؃ [0`P@HpV:V^ U0DPW p T"S 000@0`Ѝ0000 0L0|@0S 00000S0S Q .:[ 0:0SV00ЍW00 Q0!:[00:S0S @ d0d dK0 ஊVH0H HM0 ऊ"00@ "00X F\ F4-M{,0,0 0{ {000{0mЍ hO-S$MpPP@HL T P0S X0S 30 000@ 000@0 `P၌0"SA Q, 0b CR!o)pp y4$;R`P  `0*S# xS! S: "0 @`P$Ѝ5%%;R`;"008("0 X0 00T0 0P000sP00S6#0Q``PU 0NZ0V0P 0$Ѝt!0 ?/%1R`:*%6R`0$S``  P01!%?R`0 0 ୉T50 0 ࣉP0S-0 0 $ 0PT  `PXm` 0PT  `PMbl B B| BP@- M|d"{@{ @0S D <0 0 |0 30Ѝ yA`44kd-M{(,{ Ѝ 0 0 9/PXP0 S0C0 PY 00 0 ~p ?~xO-I4MQ@p07 RL Sb 0) 09 P0S009`0S ) )儩儙  @l PS0+0CO LI @p  q 0 0  0C 0B0 0 S00QE0 0X0-SQYςP0-S`0!00 0 4Ѝ`8``H0@q 0p 080  `4ЍH@q 0( / 0 B0C0@ԧ :Q` 0+ B RzP0  WV :R 0S000\7@0| | -Q0070$7 0,  ( R& `=z P  0B0 0Z p @$P @` Pp @T  3PP2 x   Q Q 0@RTZ pBx 0 bZR 500S 0:S  20S|5 00+ C\ :S] TeTTU` P 0 8均W 0S 0 ⓇUe5PP`0 ᇇ0S $4  0{$4  0q;R30S00FS04000400S 0:S X40HW 40 0+ C0:S1:` 0S0  :R 0S0!  # 000S000P300S 0:S 0 30?`0JSR8 0 0 `S``X0S4Ѝ pB5  200S 0:S  li \20 D200S 0:S WZ(0 10S,000100S 0:S >00C(00!S0 0 (00+ Ca1 0᫆0S-Qa1P`l0 ➆1 0Wp1p!0 000S 0:S DH000+ C* 0 u10N0 0kd,(|tD~0}0@0  ; @ :y<yH_ :txy( :<xx :xxa 9@ 8 7 7 7Lu 6uHudu| 6PtO-pQ ` V 20 R" P@T60帢 R01-[@P-T@PA T"lRPP xP? -@x0P  :R7 $20 0S" 000PP@:T0S! 000100S 0:S ۇ 0?@0S|1 0 0@`P 0:S  X 7 0100:R@ 0S  0}P00P0 0 0 R0 VW0 S0 zNQ0 0 ،X{zzTz$yyrHyXy,qxxp 3@q0qH 3qxH @-@P @ R0 /0 Cp 2Dp@-@P @t(0( (/0 0@hp 1p@-@-\ \ \  0P01 0  0 0 لR s 1 0R L^0 s 1# 0^00404 40 ஄T00ph 1hp4o 0oG-P @p0#03w0q0W`@DT@!   0R ! 0 ZP   G0@ pQP@-pp M P@P `P# +{0 @p{0 PP  Ѝ袆00PꝆ0`P商`ꒆ0P`匆P|t0 0 XC((-0   XO(p@-@PP` /o"0p@ I0 40 ,m .m@-@P 0@ I 0  A0  -llp@-@PP /o"p@; I0 60 lL -hlt@-@PM 0 07SPЍ0 00 l4 -l<0 p@-@PP U ڏz00QUPQzp z00QUP{z00Q0 /0 ഃk$ ,Pk1R ! /A-pR P@a@T T 1 !03/pWG /p@-@PT 0p@/pA-`Qp@P RlP 0开D00p 00$`,@(P0R00A-P`p@PB 0U0" V W- p`Pp`P;P, 0 0 00㼀@$P,`(pD 0W pPpPV W lpl`p``PPX``P`PP`PF00|dXp@-@PPM& U 0`1S ,0S $$0S  pЍp@0@ @<0 ߂(0( (;0 ւh )hpg (hL@-@P 0S$ y0 P @0P F0 0001 1 00uy404 4<0 ू̈́ 0 f ($gp@-@PP% U 0`1S ,0S ⶃ$0S ⯃Hpp@0@ @90 r(0( (80 if '`ge '<fp@-@P y00CS00 Pypo?P0 70 Be\ &ft--M  GЍ Ѝ/ -- M0 0OG ЍЍ/0@-0P$M Rb P0@S&  S$~0  B!  0 $Ѝ00~ L000 ;0 PS@$  je`ePj<P 4000S$/00//jeidC-PRSQU D0Yi Ys "0  G7pp J T0P @  P$$ 4  " 2   0pTC!1  0eV:!1  0Z[1!1 _ 0O'0$0S㌡ / ۃx!P  0  6P1P! @0 6(1(! @0 6 A 7 0* (  `a`aa` ` `| `, __8y T_t_ z (_X^{ _<^V`V,_P_P_ _$ (^x ^p ^d ^\@-HH1 0M`P000@P< p T T+ /00@ 0 0 0 300Ѝ0U000 @' @P00P0ݡ0ƀ0@@0U0P0 000 0( ~) \[ @-@P @  0  ~0< i~ d\P[ O-((ǟ GM MtčĝĝP ! $ $0S 0Se 0Sn 0SU PI CP@80X D,0( Qp `h6P000pp P@P! f hPdgD00S! @0=S0`S"`V`X`V `ሀgP-0#S !PU (000C00pj@p P@5噄P@( Pp P4冄P 4  $k $|k 0S000C00  0PP40 0pd$h`0 k y  y0X0H@45PP0H Pڶ5 ,0pC 0PU 0Pq0Sh Sf Pqy  wPiy  oPay  g P4 R1(d"2 0 t4 30Gލ Ѝ0@b=0  (F@t 6 0400/40 S  FP 0pW 0XV (" 0   4`崃PA P= Pk!1 H 0|x!x1x 0H |0ST!T1T H 0|8!818 0H |$0St!1 H 0|j~0S $00p'T$ZZxZ`Z0YY|(WW\ TUU ,UTT U,T UT TT\VU8UUC- Ÿ TM@PLЇP`pA VJ WS X\ !u0,P  " x00000 $( 00 #PLQ PQ,P[PiP0 @Y !0 0 L0 306TЍ 0 P 0|V 0 P 0|W 0 P 0|X 0 P 0{@ Xl@'qp| $R4Q RQ QQ QQXJ-M^ЍO-llŸ \M@PTpP`က儠刐W U` Vi Xr "4  w0 } 000 $(,00 0 Pc0Q ,  XiTP 0S 0 @嫌H!01 0 T0 30C\Ѝu0 )@ 0 i\ 0^{U 0 j\ 0S{V 0 k\ 0H{X 0 l\ 0={@Y d@G&oTn,R R Q 8OHN O,N ON NNlG(-MCЍO-M嘔 rX  [  0S 0 0Go-0YP mPe 1 S S   #@ # S]  0s000 S SP S0 R R R R @ B RQS 0S1 @+S7 -S[QUp @Us0S 0S 0 0_o0p`R0+S4 -SF wPPUpw[ WPW6 Pp S 0QUp @U40Sa QT 0 0_o00p+SR0S @S#0 oPP _opR0S @S&0 [PP` _opR _op`RU6 ! 1 0 2 30:ߍTwPPpPp py S!@A< 8 _ 0 d 0yx x0x td 0y[\ \0\ 1d 0y$$X KIT tKI, HKIO- ß MM`PȍP@yr T{ W 2U0&N 0AM.0; PY 0SV P +fgl+2gS 0 | 0  0r$ PP @PP3H0: ST 10P! 6 M6 W X!1 0 8 30_ލЍX P 0 @GPP * ,6T100SP<104!414 t 0CyT!1 t 08yWz 0 t 0-yp6 P \0S  S 0000H0000  @P$fK,S\JeRJ GI` FxF HFX tHF,HHHA-@P`p0M- V6 W? 0 y0 0 0ⴊP @T@T 0 pPP 0Ѝ @P0Ѝ| |0|  0xV\ \0\ X 0xW@ @0@ < 0xI GD< XFD] ,FdC^- $MT00  4 (0 0 0 30$Ѝ#-|| $MP00  >4 (0 0 0 30$ЍZ#\O- PP`w p By0@00 00Bq PpaBQWpBABQ7pB R0 S1 0A0CS: 0 $S'""  0DSRQ0 / S ,*@D T0T@0 T:0 00 0 wD[00T0S  [?0*00 0} w00D\0\ \ C0w }@0@ @`0 wD DTDL TCC ,CC C G-t1@0P?  @RP>T !6*> X< =<2w00< <0< 0P Zum D<< V:0/[`0@- 0 0MPP000@' T S0P ""  0S0 0p d0 0 0 30Ѝ0!K@P000 040 u"  d:h :l@-!1 0FM M@P0d40p/ `ᥐ )PPd@"Ḑ+ P w0@+w @Rh \0 0 d4 30Fލ Ѝ4 404 N0 t 9X90@-0 0dM@P0\00p` PV pTX P0 0 \0 30 dЍ0 000 h0( tD 88`88@-<@<M@ ;b0 /ЍX(8LP1Spp//0@- 0 0M@P000P( U!  @0@  "" 0S0(0p d0 0 0 30Ѝ0)dPP000 0F0 (t;T 6 7 G- M砐 p@ e$UAP'0G T09pPUo0 ;u0+ '@P   U0 U v0P0 vTP v0@%v@  nx p0 0 4 30܍ 0vlP gp x`|P80 - M Ѝ@-0 0dM@P0\00p` P .X P0 0 \0 30 dЍ0 000 0 sl 4h4O-/? 0M@Q000 < 0SD T@@P 0\@ ?T P @`DPPX@*p@@$@``@n*g\ !4peq(p` eq'pd(PfQ }adP8`da!<`hda& g! `dl@( " .%pPm` ,* )g  g* gtp捈@$@x@f ,譊h%fQ(! PffQ%|` . Pj(]@$ a,(@jA!@jA$͌@e! j  "+&0p'`) "M)l. '/.e,$ e.d, e ! ]P P!*L  ( !$(*((**() ()H'p0p ))''p, pL `&" po&` o&p p`(da `+da&++`pn mg pdq0 *@* O*@,nA!@͌pnA$f!@ M$lnq fq,p?菠fq'f1/(`/"Ho"_! _%,p% (( P !d!,( 0P "! ;!`$dQ  P%P- n (]d,b!On"@!O O$$@ $@  ͌O(e"nA 韠@ )..))),le,O@( /aA,e!@$`_@a! P " _%_% ,_%,,0_%MPh _aQ)_%(!!-_%$dA_%%Ph$_P+❉bQ$齋i P%0韃h P菃b  )]O坉$(((O$O$O$@kA b@$ @/(/"(/" , eQ( (/k% (/k!Mi%_䍈 o%dA_%_%i!$ "_% $o&& o PhQ$iaP%Po&o&0*o&-*`&$ha 矃`&]bA `(m@$heQ b%O)@@,捈?b1/"''p . p/".p /"$M/"(  h / f%  &h1f1 ?0dQhQd10_fQ``1d1`QP0Hp?h1P0m?#,,p?# ]?#?#0,0n1`1nqp?d1Ϡp,(0@!?!$,,,0fnLf}`efe獈n@gegf(@!!!0@, ,!hghA@e@H`,P!,_,!!!`h`M PgnQ`Qn_͌hQ dQnQdq p_`QLp P++,P   $lQ dQl_nQ_._%_%P0P}.`.aQ.lQaa `_dQgAaA`gQPOmlA(P`AgA` OaAO!O$O$!]!!f`$f͌菂g''( (''eqfq(e `qlqeqlፈ,fqaalaaqpoea`0p_/l!%)_% ''(0_%_%|Ÿ)'0'韌 +4$0 + h1a10h 0m`0韌h! a " =f 韌h! -c1f#韌( 蟠 )((,돌)돌$))ppfqb1#o0#0&a''ppꯌo&bqb!! "= `!-!c1``#O @ b1# 韌0#abb!!(p뿌0 "= `!-!o&c1`q `#  b1# 0#abAb!!_0 "=P `!,p!-c1ό``# Zyn롏b|#P ۴#P#h ۈ#$b1# 0#0 ao&bpb!! "0= `!-!oc1`a`# 8P͌ < @@nDPbb!# "`0 0m0 `0 0 30Ѝ1!0 'o 0S(1(!(0 o/@-@P 0LL LHH  004 404 0 ogE#ͫ2Tv ,# "A-PPp`8 W, 100.!0% "0 ?0%0?S@@h pb0hS@H"#p ` *X0V@@p`F AoH H0H 0 n, ,0, 0 n !X! !!|p@-!1 0MPP0 00@A TJ R00 113R0 0~? S ``4` 0~? S |U PE0"0 1<3R0 |0 0 0 30Ѝpd d0d `0( TnTH H0H D0( In\zl!< yd t d  H (0@- 0 0M@P000P( U!  @0@  "" 0S0(0p d0 0 0 30Ѝ0)9PP000 0F0 mx x DG- MM砐 p@(e,UP'0H T0:APUo0 ;u0+ @P   U0 U o0PoTP o0@o@  m x0 0 5 30܍Ѝ 0IfPP9p p`|Pwvd0 - M Ѝ@-0 0lM@P0d00p` P" +X P0 0 d0 30 lЍ0 000 0 Rmeuu\ Ԥd0 {,!0 { / gE#ͫ2TvO-tM, l 03?0\ 0 Pp (0 " 40*i (0 8` h;" 0#0<8i;b iˌ! @D`ah`#h,bhD͠lbˌ Pb+`c! . `P% PH`b,`+` ak,`&iKL` c c;lk"`&0P`;a;abk `&T`lhlˆ`k#`& X`ɠbˌb+ck! `& \`b)`+` ak,`&``c c;lk"`&0d`c=a;ah`e\bhl@` `@$e{@bk `&h`llˆL`Kbhl` `.i pp'`#. 0dkŒȌ̌iˌ pzhlpbb+j{c!, `/&hl̠L`ˌak. `ak&` p@c nk,`nk&c0c=da;lk `lk&aa4n`k#``k&nXlck!`ck&lT`bhl`kk`Hʠi`ˌeka. a)` 8p'⢘⋜搉e pxd[f{l c P(n[,Pn[%c 0\PRX\Pd[@踠jp '<SNzmv3he;#0T0 0g;)0隠l c{0P $h{cp0fa"a(f `hHekb.b(e P]@a[n&an( h4bf%bf! Lp `$ 8q8pPa a`$0` (`a0PPP#Ptapa`$0`(`ga0P P"P 0dZaWalЍlЍ'G(0( (H0 dB@ H @- M`]tqt1pP@P`@@T 0Q P Ѝ$ ]P @ Ѝ@ \P"0S- -S?@0 0000 P I U RP +R@@D!0DSX \P0S +S!@?@!@Q85NX ?P L0P00 1 R/@P/!R/P((0 @>R0 00//O@-M Pp @e`P`W0D>S 0!3100 0eЍ>SD 0!3100e00e00Oh/-p@-MeP@U@0 ` ` qPx0x 08 R;0Ѝp@Ѝ/0 a0I( ( SNHXpA-@PP`pU =UB 8X ERR14/.-,+*)('&%$#" Vp&2!0` 0`00+XPp -X% =X00+0E0VpPpp-0V0\0+00+0`0p@00,0, ,]0 c00 , D0p@-PP@`  0RuSpWSRX0CSG5 +p à 0R ^ PSPQP^  0    T0 0+S -Sp0$ $0$ b0 b@I xXO-0xSpLM 08@ (`(0,00040MK 0 0d @ d@T8 P0p000003  0a0GS] SJ$00+W@ 0-SR=W000 0` @X B R j b\S  "=W  R"   P:0$P3d @  +d R $ "@P0 偡   n Y# @ T:$Pdp@   d0S$0 @"@DP@ @T X 00X  0  0pW ,Wsp`TS `! Z0$Pc ` $ c R$ `"`FP`0 `偡   ` =W +0G?oY20S# Z$Pc` $ c0S$0 `""`FP` `傡V X 00 00X00` `Z$Pc` g c0Sk$0 `""`FP` `傡 0T0 00  HR;I?I00 HRP 0 p p@ bHЍ_0S @XH0H H>0 ]@0P R@x <߀O-P4MP@\p{ WoX0S2 `00 S 5 000 0?!S5 0 0 0;!WgW0c Ya X00U|5Sx50 0 0 0 0@0` P(0`0t 5`0$0XoY 0S90`lW ,A0` .YW00V0SP@ ,(05#K 0P` X $ 2@0 @$*&  # $#. B@T$0#"A $1?Ϡ "!,:#  0`V4Ѝ3 00 0;!k3 0 0?!dp30$0H\.d0La#0L0|2pST0,@` P !XQ 0`V ^ @P,x ^[h"$:600%$0L"%>!!!0C4"0T,P%"1 #1O"QX00 0" 0$0 0?S%D P P@\`1T101! T$?01>! R01"_0`A(0|10X00`d(00@t`dP(0 iX  R21@$Q5 0A`X0 0A$0PE `0P 0  `2`2 0 9@ 04\ 0 8@ 0*\y` zGGQ\(\) 8  SQ و\ 4O-PP@`Mq Ty V 0 @@T:R P* $Ÿ P0 P R# 0Qz SQЍR P P PP\@Q @ P @0 @0 X^ @ 4^ p0^p 1^ @0T^Pp# W @ 00 0 [T0 0 [V}0 0 y[t(@^*?[!]-   dp@-@PP U p@KX X0X 0 H[U8 808 40 =[p@K ` Ep@-`P@P T U pPpPUpH H0H D0 [0 000 G0 [ ը8q @-1 0M M`P040p@' T P+P( 0@ $03/ 0 0 4 30ۍ Ѝq` `0` \0 ZH H0H D0 Z++` xE DCG-P@K TT P` ``a V00"5SP0 JpPO 0SR 0p R 0C à PP0 TP8 0 Q 0  ! 0`V#*_oRepP U !H[x x0x t0 ]ZT\ \0\ X0 RZz\00P P Ҁ$O-Ɵ MMMčƟP pTDe0< XE 0SN UW V) 㰰E\U00U@@ R R00C?o2$00⃰0S U0 S0E0@0Sy00 000SgV ̠+ G 0 @s 03/0Sr 0@ 850000,00G(003/P   0S00 *  0.S  Z0S0 W: 0S $0S  ,P80: S P (0JQ/03 10J10 00@"P00$ 00S  0{P80: S5 0# $2 MލЍK0S0S + .P @[0 4/P 0 000z0   `0NVD 00SS ̠+ PR  v 0.Ss0S^ 0. SmZ0Ss  @p 03/0  00.SG V P 0 @JP6 @n  2/0!1 4 0X!1 , 0X!1 , 0XX!1 0, X0Sl!l1l h, 0XUP!P1P L, 0XV PZ00PS P$P-H 0@ 03/Z0S* 0HZ0/(0 0@  03/0tzHxH0o$ ((* % `̰/ 8̈ ` ̴4 ̐ `O-PPß KMMPčP`pؔܤ9 UB WK YT \[ /\@ @ 0\/\0   T:"2 0 4 30KލЍR_/\8T*P/00p/\V4"424 @ 0XU"2 @ 0XW!1 @ 0XY!1 @ 0W@Pp PP 0   R  F 0T/S 0: S* S 0 0 0 0 pX P+P 0@ (03/0S0: STm*/8060 0 H 0WY/8 0V!x ɬD ɐm xn po  Ǩ\SO-XşX5M$M 0PQ000` 2 @~\< 0  pH 0S/S;R/ 0B0 4ZS 0H*0; gP4S 0 0CPR IR*0S0;R X @H p0\  0  *\2 |@\ ?\" [\!PI 0^N \@000XS 0H 0< S ?@ 0< 0@Ⲑ 0R  R QR Რ@  P+j@PU "2 0 0 30ۍ$Ѝ0@S D0\P ]\!PLm @Ÿ]P 0 p-P]^ ~0]P @ 0< 010t  0BW 0R S0BW 0R S@c 0Q 0{  00P1A0 ZGY0 [0!P0@ E0 0 p3P0P 0H*0 ;⓾P 0Sꀀ@p@p0P h3V0\X .V@S@Q=?** [-]X! y\A-`QPM+ 0  0 S -0{S @ p0Q @{Q0 #P Ѝ0}S0S ЍAc8 808 0d UX 0 wLO-@PM`pM R T  D V^ @P}\ @\ [\ {\PU PE0]\\ \8(PPލЍ ]RRR0C @Q`0[^ ]RR6R` T: `{^0 ,^SV  B0S00 8(G 0}^S0CV  F B   xV  @ ]RR ]RR zpPpp0PpP  \00UWgL0 D0(U`8 808 $p 0UT uT4 uTA-MMp@PP` ; 000000,  0 +R0 0S0 0 ލЍ \R@ @R@ )\ L 0 RKލЍ$ $0$ | 0T@\ slp@-`P Pp@0T1@D 0CP@DP 1t-000p 0  0 T r@0 S. *S8 ?0Cs\#S 0 P/0S /Q 0S 0 0/p@-@PPV 0S] "S "$ R6  CQ   0S- @ 00 CR S 00p\S 000#  00p0"S0@000 00 S\0pp p8 p@-((1$a0QM`M0500 S   0 0 5 30/QލЍp, P00 @ 0 I@p x PE_0 u\PD04 P 0P p P5C-0$eP`M 500S E@ p#S"U0 P$ 0S %P @ 0SU0SЍt `p  0@S0 0 40  0Sx t刄刔p 0fS0fS 000#3R0 <$ 0000@SV 0oS 0oS0nS 000#3R0 # 000  P 000#3R0 x# 000  P 000#3R0 (# 000 P( 000#3R05 " 000 0#S 20@ R@@dEP00Ѝ0 S Sd P 000#3R0 (" 0@00q P  P4 000#3R0+ ! 0 00T 000#3R0 ! 000EtP ` 0@S0 @  mP =QD 0P0 0 [P=Q 0 @00 ।D 0P0 0 \@ߘ`ptLdܴ@@ jX iTp@-PP x2OP c@PLPPP 00p( (0( I0 Q h@-,@@P00ٔO-ȟ MȟP P`@ pUpVpWT 4 Hp00; [Z {RU D(88 0 0 30Ѝ `s?0l0` Ⱘ'p 00X xM UX 000 2c110 0 0p0S( A8  $0p PpuS<000S[ kS000@dS@Z 0B ]S00p \PZpJ 0BqQ #S P BqQ #S Q BqQ #S V BqQ #S S BqQ #Sy R BqQ #R I BqQ #S H BqQ #S G BqQ #S3 L BqQ #SN M BqQ #SD N BqQ #S: O BqQ #S3 D BqQ #S E BqQ #S F BqQ #S 0S:U 00S! R B  LP `0000  00 F  SS0,Z *p0S R00 0(RW 0 \[ R000@R@p, 0AQ @x  L# 00 0 _#   2000s00"   2000s0000q[p00,(@ ((@(@00,0l\ $ ?Pk0Sk[y+Pe2"_0 OAR00X Q_  Y P0`00y0`0 0SpCr X  pGw0060 Q0SpY003[ p0S0 P  p`00C0A   p p p[Q GkD \$@x a 0ˠ- M0 Ѝp@-`@`MQ P0ˠ 0P ЍpFz2pP P ЍpϤA-P`? A@0S( A@Q0+pPpPP @\P  Up0 @BAQA3M@ @p0 8p0 ,0, ,<0 NψtTP` ],hp@-p`pP`P਽@T T0T0 R@@pP00ᑽlD(@A-P@P`@pჽ0S |@@J R"@`uO@P00P0@b͸͘@-w 00 C-`4MPH@P 0S|0V ! JUpЍ |0P;  =R6 0Q*G B&R&>$#"M = -෠ೠ௠Rp㴀Y WꘀqvK　SБp0X{FH  0`̬̘ Dp@-P@\ *Pp0Sp0O-# BMM $ #S  #P 000 0000+ 08Pm 40 4<P# ` @FP 0#S 0000P Z20 $b@`P 0#S 00P 0xS0xS0S 20 0sS(0wS%0S"10qap`0kP q00cP q!h1 0 4 30QBލЍt10000IP q00AP q 0`F +: 1 0 0`p -@P ,IP`[[ TJP000xS0xS0S: t00P^ d=JPY.l, X$D WȨw< V`$<dHvp@-d@@0S P Hp@P@P 4P pT4|sp@-@P$ 0PP 4P PPIP Pph`h`PLżp4 404 0 LŨs< S0p@-@P$ 0PP 4P PPIP Pph`h`ePLp4 404 0 [LrT RH0p@-\PP 4P p<`<`8P@]p,0q@-@@P 00ÄO-v,M@Pp0Y 0SM 0SN h60` 0P U 0E   ,600{0?SO Sm *S 00 *Q @S50*QMU 00  q*QA[SU \S0  0 @ LQ8 ,Ѝ?[ [2 *[ @[[1 \[0S @@0S /Sx .Sxv 0X q 0X/Sn.Z] Q /Q @>P } /P P,ЍQ /QT  400 000  ^[![00 $0 00 @   /S \S? S -RG S0 U@ ∀Ḱ0s0]S^$0 S w tm + 0Xm  0X/Sge @_U/200 0 /ZU0@  0s0U ∀Ḱ~]^^ \^  @S ^U@  ᲀ~^" @@  #0\ @! q  [Q @H1H!H|0 J010!0{0 J 0 @0`pC p 0U0   峠zZ  0 nP/ZY  /6=Q /QV 000 0\$ L` Ldl@0IP@-@ P L 0 Q 4Q?o2c,p@-@lPGP XGP T00pT 00pcL 0 pO-0p M @+p` P ᡻៻10230Y ߍ;PT 0  pI  /P: [ ; 0` 0P ᗺP) @@ 0  p@ 0 P0P S P J ">0 "C 0 p@K -R O-0p M @p` P 10230Y ߍ趸PT 0 pI  㪸P: [ ; 0` 0P P) @@ 0  np@ 0 SP0P S P uJ ">0 "C 0 Np@cK -RCl O-0p M @p` P ᗺᕺ10230Y ߍ1PT 0 pI  %P: [ ; 0` 0P ፹P) @@ 0  p@ 0 P0P S P I ">0 "C 0 p@J -RXp@-T@0`P@ e0P0S SDP p Cp@-T@0`P@ 0P0S S+P p Cp@-T@0`P@ =0P0S SP p C 0 00 $-H- M 0 S 0  00\100M 0 R0    R 8 00 0 0 30KH Ѝ/-\-H- M 0 S 0  00\100M 0 R0    R  8 00 0 0 30KH Ѝ/l -- M0 0+--M  --M  A-pPPp` Q @Q ]PD@L0 0000Ak$0$ $0 GH ?(0P R   0//$O-X'X7 0LM@P0D00 8 P7f/0QH0 0 A0S 0* R 0 :R|R PF@   x  P P\yDPuX00X0ὸ4: zP & X00X0 $` bp<E$0 @(0Wp$0 00Op5$ 0,  Ep5$ 04 E @P)l 0 \5 0 wL )p$00% ,00  E @ 80p840$4 0< p40 p40 p40 ph40\ pD4$0P8 p 4$0T p3$0 3p0`0*S$ 0P3 3 3!t002p,t6p"t!,̠:p<#tp` t0448",#< Bp0@a@P8 <0@(p ' R E8 @0s@qTP?  A@=@9@5@1@sp (   jp$   cp $ R  , Xp ,BpE LpE  P <E 冷0@1 00Q`BP#$#< \P00 1@)p0@$0t@5T0A1@00ct!0 0 D0 30LЍ  p 41"0 $BPX00X0!1 h0 E24bl\l,DhOH4D  \00T, hVEW, 8\|p@-@P> 0S0 vA0@0T9  T04 0R/Q T: T% 0 \/RT0C"0C/QT :0 BPU0P!T0h0p\@@PT bF08@@0/S(@@ @@S`SSE8A-M@P#APq0PpC D!0C `0 00   ! 0b0C S0;.-,+0)('0%,p`G0 R0S@ 0S 0S G0"S D8#Ѝ T1r0:F00Ѝqv{p0$ @-@P1 0S* @@T. 0T)  /Q0C T !@# *0P@/S x0 B@T@!h0 0E  T <@0@0@/SQ4Q$B0{-DM  {000Ip 804S DЍp@-`P*p' P@ #p V U phfUX {p` WTQV@A~P?o?o 0C-@c^?c%^& ^ `pCc&Pc2681E270G2&0H 0./ "0;:(0C0 /0 @- /0, 0-;BP @@ 7[D0 0/E0E0C004 0-;BP{$@G{6[D0{7P/ E0E0C0!/0Q Poo G-@a^?a'^( ^ @pAa&`a43V4X4G0Y@000?!1?1>4!50;:(A100 /0 @- / k{0   ;B 0/AC0C0 [k{${@{7P/ AC0C0 JJ@ @-Gq@ J?@ @-<q J @ @-q J@ @-qPP `o@-ZE00p@-@PP  p@$Z 0 10 Ci . z@ :PPY  @-881 0M020 1@ 0p\`P8 00@\ 00#30#^0#02S000RP0@  p0 0 2 30ߍ{PP @@ @=0(@$0ȤO-\ϟC 0C,0  !/"b!!A0,0 W0 0000 0YWP 0  R0( SP 0 00HWz 0AP(0PW%S(Pk6 ,0 6,0,0 v>C 0CWP0(Z 000"0W0QD6 0 0P( 0, ,04#/A!b!b0C P0( 4 0 Br0 S8P(P1W*p 50 ,P(W0 00W =0 P( WTWp ;0 P 0 0p S0 (0W(Ph 0 P(]c0 , 0PS( 0$0?2c1, 11,0 020 0000 0 ,, ,0 0CP0(J 00000 3 ,, p,0 0CWP0(000c c0 ,_P([(P000yW0T 00. 0 GP(1 u  RO 0s! `p0@@v0 @`   ` @aKal B  0 B0 V PKUS ZSP  @ 0,"P ( $0 0 R0Y R0P ,P\ !/#b!!0"A `XK/"TbQ:L1bS0#03  h 1 01 B00,0DSd0,0,04 00N(0~0 S!0 @pAY_"pG@D  W@ 04 0N~ Q @(0P 0(P00l\)P\( &` &< %|Ql'I$kkktnil]  Q<(PP @ ACLC|q \^JS S 00#3P0z z H/o"(PzXn|TQ(P7 pp@*CP(!B0pu10 B0,Pp> ( ' Pp#/"b!C;R, a2ba126MP P(P @ @0C2c2c2P$00( (0 00 @ 0 @Q ,0@0S} 00@y0S 0@r r,p0 0P P(00, 0C$0(^3000c^\0M0cP$`jP$`   0P  P(00 , 0Cq$00(06  p  0P( ,  #P ( (0 b$ 00 0M0ЍA-1@0QHPP P MK Q$`10 P1#L@p P@@ (. R! v P`U Ѝ0 P0  P La@` iU>T 0 Ѝd   0!>00D  *aa,a afffga8`@-0M@ 0P 00Ѝ@-0M@0P s00Ѝ@-P@gp@-LL1 00Mp0,00`@P= U2    P00Q Q Q W> 0 0 0 ,0 30"0Ѝp  t d\0\ \;0 <D0D D:0 ;h,t,t,tQ _G\ |^p@-@PP U 0DPp P @pD0D D70 ;U(0( (80 ;^t ^x^| ^PG-pP`' X/ Y 7V @P0PES  R  D#0PEV R  SS0@0D@ D0D DH0 ;X(0( (I0 ;] ]] ]xR@- 0BAs @Q 0CR O<@O-阡PP p MU WC b6@PI 7PI  6p`M V74101S Y~7 Ѝ060P@j6P- 0 0P E60 0 O<=00 H<l0l lD0 ;69=00808 8C0 ;>7d\ [Q [RQ@-M @PЍTT =@㍫Ѝ = 00O--ഁ M Mpō@P`pH 1PS pK @\D LX0 ^00pt_0 O⛩00 T>J9 q@0,  (@P . P 0 0 5 30ݍ Ѝh0h hD0 x:<00@<00 ,AD Y0   M Ѝx@--M  Ѝ Ѝ/ -- M0 0 ЍЍ/O-鐒@P p`M X X00?0T.00P @ P 00 P! !  F1XPH  .VP WU V[XPVppPpW` D 0`f`0` pPI PLLL1 0 09W`!00!1 000 ЍT0XP C0PP00 0 Ѝ0 9`ߨpP V بpP `@0@ @?0 9c\ DWpWB VH@-@ MC0(0S2 -0 `0( `1/pwqP0)  0 0 PUR <0PU)0 ЍPpTP 0S  0CP0w;00pP 0@-P M/(0S: f-0 "p0( p1/`vq@0/  0 0 @ToR <0@To/1`V ЍP`T@ 0S  0C@o/;T00/';00/p@-PPE 4A0S5 @Tp1 Rp00P0 i P 0S P0_ 0c0(Z 0P0 U0 SP,P L4P H8P Dp@AT0T T0M 80Sp000 0K0 8eES$ RR TRp@-@$PPSWp@LEX<@- @@EW@?E p@-,PP8 X@1pD@-a@P`Mc P10`00S p  0 XRp p 0@@SE @ W8 CR67,0L0 S0\^,*N^(^& N0 s0QW   "\ ^ #R.S @A a  00C ƒ@0@Ѝ "^ #R$0$ $F0 7Pp Pt4  R  *4 8/\ 0X\S 040:8 R РS /jBx@-@`P9LpL0ppD尀 T   ʊF@-P`@90 UA-Dx`Pp@P1 T&  p0 SSS7 S300x S(u#g\*7'0 k7p7p'p0 b7X70000F00,00 00#R00 00;R c\&V Psd\ 1P01 0S1000S0d\ Q `60100 R =R% R 0 060000   70Bs0 00Bs0 20o00BQ00100C0e00BS0100C0U 0?X000 R00000L-X00B ^Xv00= 00 k 00Bs0$ 0W0Cs0 0 ' R R 00" 40000 Q O 00B70B s00 X00 K <$ 0W0Cs0;R 40000+ 00C 1 0HnS ponmlkjico[TQKwja[UNI%50#\X00S00o%0H?o2300k&0H?o24 00d=Hoᨂ% d 00[ S 101000 B 0M00J 0 0K 0 0F 0 0A\ 0 0< 0 0100. 0 0/ 0 0* 0 0% 0 0 0 0 0 0c\ad\z@0<00R00PNx NPN dN, L$ pO-PR Mp@E W9 [`G 0`@0  0D\  S@C< 0  @[) 0V1 00 0 !0/C5l700 Ѝ 0 /045 0 }/0*5 ;P T0F0F700T0@D0 ;|E EEt EEL0  0|0z   KA-R@P0`Sp ""#b! DQqU? 0S$ RV 10 R RQ 2/!U 00010 ( 2/P p $@"00@1003/P(!p0 $@ w0V0 p00 R (ϣP000P3/P" Up  R  SVp  0STˤP000U t3>/t6|th6H5Is55T=A-R@P 0`So !#b!b DQqU? 0S$ RV 10 R RQ 2/!U 00010 ( 2/P p $@!00@10 03/P(!p0 $@ 0V0 p00 R (;P00 0P3/P" Up   R  SVp 0S7P00 0U rrL4,r33Gqd343G-@P P/`P (rp^u  0F0\c<!"#b!0CaqV; Y 0PpY` $00100S p W!`1003/P00H  0 $0,100S100S& 3/!p 000``0S 000S( 3/000(㓢P`0003/P 0 p 0000SX嚣P00}00pD3>/o1`o81on00np=G-@P P4/`P $rp ^t  0F0\c<!#b!b0CaqV; Y G0PpY` $00100S p  `1003/P00H  0 $0,100S100S& 3/!p 000``0S 000S( 3/000(P`0003/P 0 p 000$0SP0 $0~00mȂm$.l.llt.T.kSR: G-P0`00Sp 3/0Y @IOP  T 00 00 Y @IOP T P00 D0D 0 p`P/-Lk8kjjj,SR; G-P0`00Sp 3/00 Y @IP T 00 00  Y @IP T P00 D0D 0 p` P$/,0jiiii+tO-PPM M Q@ \ /\C 'Py-P8p/\ @ @. D\k `P /RR.\' B Rk/0  F02 P 0E P^pE 0: S 9S0/\0Sw@/\` FQ .PQX 0t/S0W0MʨP !ǻP uM - \@  2+/\p@` @ލ Ѝ.<0X0/ލ Ѝ @3 X 0/ ?   ㋠P@Z~300 @y3>00 @t3?00 @o300 @j300f300p@-@P Q ePp`\Pҡ0@P VP`V H30"S ᡢp@300p@p@-La P`M=  -00QP03P ; 00\% 0@0 :\0@S \S 0@ S @ 0:S:\ \000ЍpL0P O 800  2 0 @e`dxd`p@-@P`P3 V( 0Pp:P @P0R P:U P0@Sp P P@Rp:UR:Rp@0@ @0 }0(0( (0 t09\ 94+ 900/$p@-@PP" U+ 0PER R:Q|Q00Q0S"P0@|R  :RRpT T0T P0 80U8 808 0 -0p *,8  &7O-ȟ M MDčpĝP 0o 0Sx 0S t4!S S,XPP `P  ,pP 00S `D R!' ᳿0 00 Pi 00P0s` @ `PV 0 S( [T :SZ \S S S 0U:H_PPE VpP+ ڹP @0` S[1ZP#QQ ,Ph600`SP0@VE0AX0 0p$&6 0 D4 30dݍ Ѝ:SZ PPEV  00 0S m00@ ⇞pP< 垠l5@00PS0 00@5p0040$0(`,= Pv :SL 0@S t40@0 0$<Pp2 ` Z2RD 00@00@00!"2 0 . 0S"2 0 .0S}p"p2p l 0.sɸŸ `@0S= 003/P0H?o20 0pP00!1  0'.O00@婟J0@w`ᣟV c@0 00l'03/(` p咟V 0፟.0 0 0 }I 0La`7$!|} x4 11 P11p 1@ ޼t/p@-PP`@M V T 0 @ Ѝpx x0x 0( -VX X0X 0( -T8 808 0( - 8 d.X .`., .@-4@@ P u0 000WW0O-$ğ$$  M MpP ( ` 0 V 3C0 @R` 0S S P@T 0S  _@P 00 C R x30000#30:Q0#Q0S(  0R\Sy 03@0T  P P 0 0P0 +P  20   =0S00S\S00 RAPx 0S6\S4 00S0 :S:<0 0 S4So A 00S :S|S@0@ A@0S'!1 0 8 30Y ލ Ѝ  @P 00 C \10 Z P @P @@$QP P @ 10   0਽P 6 0 04 , 0 04 ,0 0rP] d @Zv uWHW@W VVx!VUspTTXT8 ج*) ؄))p@-PP@ T `` P 80 0 t00p@   T T0T P0@ M,T8 808 0@ B,RR T(t ((|(HA-`P@P T U = upP dX@P 0:SS  `d \S p+ Q0 @ 0:SS ^S0S:S 0Q0p @Ld⩜@P 0`:SSd@0QLpA0]`0S:S 0C^7B Cp2RIFB?5/A)&"!0p 0 B^1 0 BRs0 0 0 0~0|:0z0x@8`P( 0n 0 0L ~+M 0 0L t+T@t t0t p0L i+6p pspo- 00  %8 % % $A-PP@`I TR V; = PPf do@Ph 0:SSpppdQ0:SS   \0@@AdΛPJ pd@ A\@ATp)ớPp@ᓜ4 0 0X + 0 0X *T 0 0X * 0 F0X *p㈛P@@]@, 00 $#D$ (#" #"# Ѩ#("p@-`PP@4 U= T& # P? 00S 00XS@<,00As RaPAUA0AW0AS70A^p| |0| x0d *d d0d `0d }*UH H0H D0d r*p <!!\s @!4q !0!rO- AM Mß3 0@P0(0 0`p 0SH W&0/44 PPN PX0D 8T  0兴h,00CS3%10/.-x+*)(&%$#"! . * %0:S 84Sr5,0S1,00\"H2 0 (0 30 K0=$P* 0B.KS:S00 B0$ 8T S%졟 440<4 0 S BKJ ; /0$ I 4$4I* <4$0C 0$CPtB>K0C 04 8 0S:S XE H R0 0  Q!000M P@04@@0* 0:S + 00UOPK0 E0 )10 S:S008$ 0S:S00< i@;P  dg ̠0 00 eP-H-M0 S0 00 0 0 0@  00^100M 0 @R0    R L00 r@ 00 0 0 30KH Ѝ/3eedt4@-K0 @ @0*ExO-`@$MPᒘl20pW^  0p0 u0?10KP Zp P p J X 0J0PH0 S#: )% U10 r 1$4S1$ !t@00H vH0S "<100S (!0 0 0 306 $Ѝ U r apP Р P 5SX0( ,VT00#    PH *H0S qc| E4DdCb8Md Ȕˠ@-(@M@@0=PЍB  {{ { kG[F { // =A z z kk'k [FKE{{ //=A  {{ { kG[F { //=A@{ kk'k [FKE{{ // =A@-Q@0M 0    ",  0$0(0T )P0 0# 00Ѝ )0Ѝ0-$M  00 0ԱP$Ѝ0-$M  00 0ıP$Ѝ0 -M 00 0 峱Ѝ ز ߲0ײ/C-LL sMPP`0 V8 @X0^00pAtA%0Oa0PP P1{0p0>TA{p# 0 $@9 0 0 1 30sߍd0d dG0 I'VH0H HH0 ?'R ^D]4 ü ÔX0   M Ѝ\|O-ϟ MpPÍP0^ Yf 00!R !Z P   -"P0%%Z * 0S0 R 8/0? 0 3 30[ ߍ>P0  "P 0C PS !000C 0 `0zS|NQ~|{pyxwvus1jhc_^\ `ZEU000 `0CP0PE 0SF0 0C0000 000S0  IY r<yP0 F!P 0P0CS0000 @ 0D SU*r? (0R0 (0 , 0C$00 40A@Qnt#zx 0 S0 00 1YK @@0  P 0C0@0@ @T  0SP 00 0@0 @0 0CP2 0S0 000$0 $0S0D =. #RR 0 @00T0C0 0 =. #RR 0000CT0 SP P000, 0@C0 H9T@!r?(0@0@ + AMR^\ZYNMLKJIH654321A@?>=<;:987654321f/.-,+*)(! F Y @ 00CS0r000@T@0TS XRm    0 (0     7 5  0 00 0@0( 0CP000&     ( S@ @& YʱY  P6P&P0 $Y464&40 $Pp _P @0cP P  0 S0 0C0 S P @00CS0K 0 S0  @$ 00S P40SZu 40AQ0Q 0 Sk $ @00ESZ P 0@0CS0W 0Y0 O @0ES$ PSZ R0 0@0CS0  0 S000S @+ D  @AQ X2 @ qP 0@0CS0Z000 0XW $+D @@P 0 R0 @NTA 0Ti@@P[ 0 R0 $ @XQ[@@P  R @0 00KY? 0r?(00Y D  ?o 2R0SY 00 00C@0@00<000WS0,` `01D00(0H@V< • P 0  B0=>J(  r$0  sp P p qp l=>3PSx $0S0000PS`FP Z,`X@ $0S0 00 0000V0\H[  X @ D 0   ,$ ' 0 :P 0 0C P0 SZP 0^Z``,40#Z`Iy @0&0,(0( =>0#C0,`-Ql ]QP @0c Q: ,`0;00<0000000900000 000:0090 00|0:0000s09000l 0  H  0 PB P>  +"7 $3P1000;000;0A00=jIT  , BR@ 0Z0 @$P 0 R0l @X<0#  R @#  R2XX  P BR@ $P$M 0 SJ 0iT nT  , BR@ 0Z0K @ R񏐷D" AR>  @ BR  0X0@ NR-  @ BR  0X0] $@(T  @ BR  0 R0 @)T  @ BR  0 R0 $J$0Y$@Y,Y0$ 0(0@T 0<050 (@* n00 500S @0SI 00 0!Z] P 0@0CS0| 0 S0  @]0SHP 0Z 0aP 0Z 0 p00 00= 0#P 0X 0@^@ =. #RRc @R  B   @ 00. @0=>03SS' 0@T0C0000@000 0SP @X A 00 000|P@ 0 S= 0@@Q#nP2 0 S/ 0@ bPG 0 SD 0 0 ( ?o_T20S 00CS@0 0 S000@00CS0400 0S0  @0  PW 0 40H0 B=>  @J!r0 ʒp= P p P 0Y0C P 00S"0,p `0#  , BR@ t 0 R0l00 (@m00 P Z 0@003,  ]R$ ZzPp80$0 0P80,  4`, rO<`T xP$0 0P(0080<$VPR 0 SO 0MP 0X 0$@3{P= 0X: 0@pPD 0 S@$P P; 9bP 0 S1$1I/WP 0 S 0$ @0IP. 0S+ 0 @0$P P 5P 0Y 0@/X,` @ t,TP 0 ST @tZ( S C@ S  &P 0 S 0 @0002P $P @-  , BR@  0 R0"  ,$P&, WP 0 S 0$@ P 0 S |Q 0S@!0@3ZS 0䞯P P 00 0Z  ` `d0$0H00 ၑ PK A=>0 $ CP  0r3p5 P&ZP@DD 0S#T `Z 0 @+ @D00YP0T0SJ0000rp0SDP Y ` 0@00X_<0< <08 00CZP@D`( A-@P`p0 0@@-@`P MDpk@0p0 000@g Ѝ:A-,R@QP`r v 200S5 H0P1S010n C000Pv`! pW@0PA PPZ 0 00  C `C000#0  Q  Q*RQ0 <00@8 B`0fP$00P0s0 `P B/0T0T T`0  B0 `:0 \p@-@P ᬀ0@p@-0P$L`T M 0S pW  07/@P  Ѝ808 808 0p@ Ѝ 0 00M 0Ѝ6A-0P$L`TpM 0S $X 0 8/@P Ѝ< <0< 0p 0$@ Ѝ 00 0M0Ѝ6A-0P$L`TpM 0S (X 0 8/@P Ѝ< <0< 0y, f0(@ Ѝ L00 0M0Ѝ50A-0P$L`TpM 0S 4X 0 8/@P Ѝ< <0< 0D -04S@ Ѝ (00 0M0Ѝ4LO-MD@`Zp@P] U? 0ST$ZE 0SB [? 0 ;/0S) $\U 0S H[ 0 ;/@PЍ 0 0 0H@Ѝ0$\ 0 0[ 0h h0h 0Jh 0D D0D }\ 0  hx <  @-$$@M vЍ2 @-0P$L`T M 0S 8pW  07/@P Ѝ< <0< 0 j08p@ Ѝ 0 00M 0Ѝ1@03?0/@-@`pPQtt0l尀 T  )@0 7$  0ج*,08O-ğM `@0  0P0 pP0ʿ00! B b09<Bp  UQPE @ 04BL3@0 Sh MTRTWMTTRQPONMEDCBA@?>=<;:987654210.-,+*)('&%$"!  g^0DS13`0 b aP  00Ds0S0S0 S  \00t0!#300@ 00@00 @0`PUb*Ѝ@\ M00 #P-  R^^? @ 0 `0  P 0J ZS0 0 0J ZS,t1 0000 Ѝ0S0 01 0000s00\0`0\00 00 00Cs0S  ``a00\0`0b00\0`0t00\0`0n00\0`0v00\0`0f00\0`0}r00\0`0w0\  @`q0HqA- Q@Pp`! ȌP=0D?o! D2]R0S =h0$"0@ !1 0 V V 0* P0 A  A-P@`PPp .T Tp!0D1(0D,TS0 pAl_T %(0$"0@ !1 6I `O-ǟ UMLǟ@P `|  ?o2V0S Z Y y P㭊0P0 rp᥊0P0 [00 x190 H@ "U1 p00PU`p! X U0 1 #6P00? PP P@6@&@0 PU`p0pGGq WP1 P! D`XpPI Ƞ  0S V D0 G0CSax1  * 50 0  Rx1  ' X50 0  Rx1 00x1 00x1 00x1 "00x1@\00x100kx1 eД U $`xPUk 0p 9/P00`/-+)\$84 0 L1 30Uߍ 0S IP/4$0 VԉP 13#z0 F3#0 m3#0 dZ3#0 Zꈓ ꀓ 0 DzpO ̋aV$00ŋ 0S 0S 0 Y `0$0C0@4@ 0UA @0S@! 00n(p Af0S$  0 0 ,T 0 0? !$0S%*F(p >0S$ TԄԈ (Ԅd@-PP@`Mu T~ ,0PXPI00PY0: S Sr  SЍP P :hP 0pl`PA0 `\0`.S0@D`H08< 0L R%0L R!8 <P\@ D^V0 0U :0Ѝ]0S \040.SЍp $pm ЍT T0T :0 T4 404 00 uv ~ ~xѬA-pP`P% V. ,0 `␄@P0\X0.   0  0P$00R y@P \0 00X0T T0T P0$ 7V8 808 40$ ,@ }ад }TЈ@-`Q@M Ġpp/  80<RP @0DRP 10P0V Ѝ3pp ᢠpP0@;@Ѝ0PPЍO-`P0S  P ,0 p( 505M@@!0(@@ 0%$0 0%$0 ol, n0`hU8 @Pp@-@P T UUp 0 pH H0H "0p , ,0, (0p } j\ jA-PP`F L'p@,0 $5 S9 S@T @T V,0`<,0L0`S00/S , @ fp00 tpp@ S00zPz, ,0, (0| !k i(X\1p@-P@PP 0P0S 0`0~0Sፁp@N(~(~(~(偁$0$ $B0 $t hA- 1 0 0PS`@(M @Ppp 00 @0 P& 00CS'  p0 0 0 4 5;1:(Ѝ 0<080"0 0(Ѝ0h h h00 00M 0Ѝ(@-@P P PP 0 *0 x0 g0|PPu Y#: 10 001[ 00 @c00 P @ 0 S0S[ k~ @W; 0p@D@@0 `$0@$Ѝ0 T~00 0y00S0e0{P 0 !p`{  P0P P0   @  [@p@-P ~ @T @ ~T0 0pp@-@PP U   p@ D0D D:0 h U(0( (;0 ^  [0 [t/O-pP M@`0& X. @T Pf[ P@ P  P  8/P  00[W@D:P PU ЍD0D DD0  X,0, ,,0   Zr YsO-PLM`@< Z TV, <000$0@ '{0P 0 Za <0Sh V0P@000p000F

X` t| ~}~P~(}h}P}|}l B Y|LA-01@PppG> `1&P #Qt PFR'000  0 0!܀,UPP@P@ 06&```900A @tl00A0A100H H0H 0 |{|H B {|{${{ Adt@-(@@ @t0@ztzxp@-@P PP P @p@p0 A0 |H @A-PPp` @P# P# tP  EP@3*"00@004 404 V0 j00@ ?{Q:// BQ://G-88!000s0S03 0p0Q= `AQ@PP 0 `Q ̀@P   0PR@ vTl@0@S v000  B BG!`y4x\ p@-@P P8PpU0 =Sp=SppSp@-@P PPP@Ppp@\v 0 0 w =p@-Ps@P 0 P0@pw,p@-@PP LPp P3#p$ $0$ 0 v < O-10  MZp @To p `P ᥯P0=S] @PT[^ A@ZP1Z04 S@@@S*Z3 u 81 0   `]0S:a | D!+0 0 @ Ѝ0Z   RS@[ `/T0S a1S  Ѝ PP$Dp@- @t,PpP 000ppA-l`PP` p\@P 0=S SP(00@0ϼO,@-s@P0@s,@- s@P0@sP,@-r@P0@s!00-!0!Q00 000000 0#0, 0# 00!R0Q0  0R000p@-P@1`%S 0p 1# R  " R     Qp@PP@1`%S 1 S  \  1  p@ Q Q      p000 0/A- Up `QU @ @E 7/P@G-Tp `AT P PD 7/PX PPHPG-Tp `AT P PD 7/PX PPHPO-P@U`pX 1S P@@E  7/P/@P@@ @@ģXC 1Q0000/ @0  0000Y @0S0@0 PT1S1 S Do  00000@ @@@@0@@ 00Q0 -"P 0 PC R00 SAP 0@/ p@-`P@T0^ \ > R>  "   T0"] \haa0 00000 0#0 0#0000``0000T ^pp@fR1 /o"!T0#00#00!04 000T p`^`  T 0V0pp@7Q `T ` R\ ! O-p`pP& 0Q@@PppW@Q0Jh `X  0PX@aap(OWp(0pG.wZ_TaB 0\000 D..@-n,@@0@P0S@nM-`@P@_}P(p0@aao0Op00ZO.TTaXPB(0( $0 0 |Č$0p@-05S P@pP0SZ sX@ 0CR\/pp@T P UP@phdmh g/p@-@P $P[rP Wr$UrP Qrp@Nr0 0  -Mp@-PP@ T $0p@! 0/L L0L 0 T, ,0, 0  -hDL -<L p@-@PM$ P$`0.IP  P pp(R00S 3/Ѝp003/( (0( Z0( ^ , ,X4@A-$P0@MSp p0(`0 0@0p$p^Pp0(0V,00S 3/@Ѝ ᦋ00,0(p03/?pP A-PP@M) T2 0S Ѝ $`0P q00 @ pP fЍ00pL L0L H0< T0 000 ,0< *h~D~L *<~|~ O-d`yM(p`p,PP } p@Po 2 ln20 RF en0!$@ !  000 4L  00 0. $(p,`L PP 80 03/``oP"   !0 0 1 302yߍ         PqopP ppP||Paop``PXoG1H$D ( |` '| '{P00/f@@- 0UM 0H`0L10㸪p! 0H1弊@[pP[0P`p  S 0$< ,0 0 L1 30Uߍ71ep@-`PP`@M& T. ~bPЍp fP aP  aP |0 0  PL0L LG0 T000 0H0 D(y %y %yO-@P(p,aP/ ` V &S1Z V@ 0S1 0SZ 9/P V@PV nP``n@P V@0SZ V@o00 $xG-`R p@P8/PP @VG-!1 0M@Q000`PQ UI U J.00P!1 0 0 30ZЍ0) p00P 00 S00 0`PP  0UPP L0PSUp!0T  IPp0 pPp P8p 0 @P0 00Pͨ8/0 R  B   /0 R  B  /0 R  B   / B/0  Q B  /0 R % B   %3 %//Q0 /0 R  B   /0S :p@-@P0C0 R 00 0p/0p@-S@ :P0C0 @ 00 0pp0 $000  / 00$04p@-PP@ T" 5cP 0S S pp@(c5aP p@/aD0D D0 T(0( (0 s hstsx @sLp@-PP@ T bPp >p@cH H0H X0 , ,0, W0 sr r,rp@-PP@, T Pp bP 0S S`P p@`p0p@/H H0H x0( , ,0, w0( q q(qp@-@PP U p@ bL L0L g0< sU, ,0, h0< h 0pq0 qHq0@-PP@ M T# z`P Ѝ0bbP 0Sl00 cP P0P 0L 8T0 000 0L - DopD plpp@-PP@" T+ 0 0 0S p6`P !bP ,`P  '`P p@!`L L0L 0\ T, ,0, 0\ 8no8  opo G-PP@; TD  R R `V V  0L0 00 0 `V000 0`V 0| 0FS84/+' 0 0 0 I0l Tp堀 pl 0 R R 0h ` 00 00 0000 0L n@mn( m% @-m/ 0SAS/0- Č Ȍ$(0Oc?S_c00 P @ P $4#4#4P 0U0P5_oPT 0/p@-PQ@`0 V% T ^ 0S^  S 0RR00Ap@@Tpp@0@ @;0 (0( (:0 l k[d kC- MpPÍ`@PZ TO A< YPE Y`S 0S d!\1 0 3 30Nߍ(#@? R R  R P8 R   l p0S % 0p 0 0 0 p0p p0 P  B 0ꇥk j| jPj( j,jhO-LLğIM,M IM$J͍$@@Pp P0`S S  #3 I0$ 0 30Iݍ,Ѝ RJ- 岰RW# " " < J=00h#<0I8 0J=00|4 0 hP J- 0SJ=  0"I 0  ʼn J- 0Sv 0S? S" UV J=00 O J=00bX> O<  XPf 0SQ |0S 0S  0S0!S S0S UVJ= 0 0"R #< XS) S LJ͍0 F:01 00000G0 ,0sTP @z., 00SLP$ P P J=00X0  XPJ͍bP eP L,htf  O-\\ğ M@pQ4@0P0C`S,H6)('&%$#"! D QWX00 R04{ 0S SY^\#T3 0 0 30Ѝ4#(3 0 0 300 HD@pЍOQWX00RTVWX " 0 ឈ X%:  0 t" pP5T30Sy0S D 0" |PTVT00P00Sj!0 eT@@O 00!0 VpiT 1i #EYyp`1``PP0 ppW 0@D    2T00? pYp} 0蠟谟 P0 pY 0@Dm    T00? D PTpyX  Bcclc<bbtbd}\sa|a`a G-` 0 FM5 P@pp, P PV  6PV> 0@Sp000 0q 00  0P 0 0 1 30Fߍ Y:wp0SX 0S P 0 90Ģ0$A-@P`p 0  0P Np@-MP`P@@P@T 0S  R0S :P3@PЍpP+PЍpp@-@P pPpP p0 @0 P9 |]0. AASq0C .S .R Q P-S.S S /Q P_S /0@-S GRC 0RS 0^; @PTU 0S`\ DDp Wa U[ \# DPD`Va S`# @@@0TRR00^00S 0 0 0R0C?o20SL`V0\ R 0R 0^ 001 S0S0^ U \( D@D0T 0U \\U \ D`DPVS` D@D0TS~ 0R0S00@-d!$M 0 0 AS0 0S  R lQ  hQR 0S0T000$Ѝ00S S R' 0S  0S0S0S/R /0S S/@-i/ 0  00S S/ /0S//0@-@P M 0S PPH0 PG@@0S0S 0S  Ѝ0$0$ $n0 qH LX@-PP@p`M( T Q Q Ѝ0SS ЍS PPW0S# S!  0p 0  000S SH0 P 00 \WWW<:tp@-PP`@ V T! 0pPpx x0x t0 V\ \0\ X0 {T@ @0@ <0 p hW V <VV 1tV|O-Ÿ2MC `<0 0\P0  03/P 0`&<00&,SS00 80R0SQ H RD(ՑU? [=:E$040@,$0 C 0\@P0  03/P @[] 0P0V]`S]Vx80Sg U &<00Sj&<00SD妀!P` E/o0"SQ[Eo᪢R,0S0DZ@0P@C<0D\; Z^7 @0C 00P3 0P00,00,0%SF @%4 0, 0 30ݍ4Ѝ\00&<00Sc &<00Se  E'UR!`y [I_40@Z,PC [n H0@0P0 p P001\//g, 0 o@P30* 00S  Pg X0 SR eP 0 I@P 0 00S @P _@@ @P <zf(y;O--ϟ MSp 0E 08 x0嘀  0 0` W( 0S0S  ` 0 . "2 Aߍ0S0S;0S^>3> `p.p>p l.0 `P 0 0Q P 0. ^ 0S 0A?o@2T0P00S0S  p Y P`@ 0S   0?ST CC" 0c6#PY$@ 20 RS S0 00c`P  `<00@(0PP`$pY i792 I120Y0 0 S   S  R  R Q ^  ^ \QRSQ PRV  0PsQp X+0 0Si QRe 0S %0P,0 BP , 0 B  ` 0"P0Y ,00 X,8` RX R R ^ x0S  YYB@pTP0S~ 0``,p@b S R \  PW \D @T( T d642 D52 0S0 S P  ^&S㜐Q^.\+@`T,p7 W 000`P 0 `pVPUT p\0P$0N ȇXP 0 ``P`TPXP=$]0S5 0S ] 0`@/oQ" SCR㜐  `gwPQ0v 0PM RJ 00SC RQ? 00  P 0P1 P㜐  00SS㜐RpmRo \;R P @ 0XP 00[0 0[*0e/0 5%0 @Y XU`0@S 56p$P(`X0000XP X@T0 4p0$P(`pP` 000 VP@T 0S S00S0000 0  `}P `@/ T; W8 $ 4  0." 00?oR20S u 4@,8`ù `uP1x00x0 0[긔`PPP@ `0V 00`[T0`[O-PLM` Zi  a@㰱q p  %PP0 0 0PF ``0S S S T@P `0S `(0 ( (`,P00 U `V Y 00  Y``VU$@LЍTT T0T P0/Z8 808 40/ &%0 h И%<% iG-XM`@%yP pP @00  0 /yP 40S0- XЍ PP aZ 0 yP PZ8 8(Pğ  $,4P$ʃ @ ! " xDb(@@ #! P\D@@0,0#P0@Dc>@ @",$P$Dʃ@@ ! "0P Db(@@ #!@ @",PCʃ@@ ! " P Cb(@@ #!,PC@@0,0#0hCc>@`" `& `jDPDC@P! P%@P,#eX @# @$@#D  , $0l̈́ 0 ! ba` ` " X`"0  0#0 e0@ጒ@$ @|ŸdM   " b0T"0  0#0 X0 ,,  b(Ņ` ` "  bMD`!0  0#0ck0 ̑!  Q<P0 P0#0Q5 PP "@ b-@@@P4d , l˂ Da @`` " (p,P! P%  PpLЍjxǷV$ p|G*0FFi؋D\׾k"qyCI!%b@@&^ZQǪ/]DSء!7 EZgoٍ*L9Bqma"8 DKϩK`p(~'09ۙ|ĬVe)"DC*#9e[YÏ ̒}]o~O,CNS~:5*һӑ@-@P 0D DD@  00,0, ,0 :ͫgE#2Tv HA-PPp`6 W* 0!ᣁ000?0"@@h>V0: E?0hS@H"#p ` *50S@@:p`F A,H H0H 0 , ,0, 0 x< dp@- ! 1 0MPP0 00@( T1 `  !? 7R8 bx b$   0 0 0 30X Ѝp@` `0` 0 T@ @0@ 0 갎OX N P $xG-@"@2 0M000(2("00P003  `p0\ @ 0 XS@@|Q0 C" T. .0N|Q0.\'^V*004!$1 0 0 30@ЍT  Aa r  B8 LR\ P 0FS0 S S XQP0@^*0^0 8< 4^*0 8<NML- McP Ѝp@-D!D1 @0(MT0$00B  `RP?o2T0S8 ?o2T0S A 0 0 $0 30((Ѝp (0!@$R0@0T$0B0S \@0S ( !0$ R0D걍KK A- rM`PpP: UB @X0^00pAtA,Q0OhQ01 000TAΌ LQP5  0 ypP& 0@SP 0 0 1 30 rߍ0 <0 FUh0h h=0 <P S00^ 0P0DJBI, ( x  0   M ЍHP -- M0 0x ЍЍ/--0 M0( 0 hЍ Ѝ/Gp@- M@ Pt00h` 0`0 `P@@X@0@T  ЍpEGt@-TT1 0M` !000Dmp @P  { bmp k@ 0 0 0 30*ЍkPpW @@T PU 0SP@GT00@>00ꏌGiF 0p@-P@0 0p0R(0PR(P,PR 0\0PP 0P 00,,HrP 00p <t 0@-@ 0 0 0 0 0  0 00@- 0 MP @0R 00P 0 B?o20c Ѝ0H4 00 0p@-@P 0U0 0pp@-@PR0PP~R(0P{R(P,PpG-P0Pi `8Pb 0@00 S S0 S S d'pPQ 00pZ p8 (@P 0q0p0S S S@ 0A S  A@P0  0S 0000BQP  PP0@@@0O-@ 0`p M,0(Sw: (T[0 T0W 00SS 0 RM@D@T0PH 00SD000@D@D0P0S- T0Y  0!0J@0PI 00S$0AX00R0  %J0S000 @  90S& 50p@Q0ppQ(0pQ(p,p$@ ЍPP  (,@(0  Ѝ00@- 0@P M   p P  Ѝ0 0 0$ $ 0P Ѝ0Cp 0$  $ 0 2 Ѝ0O-PLMS `E$P@ @0 ``1PR$NpPN 0 ``$PC$PPU 0`@Q QD QR Q1 0U00Sz NPb  `00A0 @p R  R/ RY R 0 @Up P 0J[0H 0 LЍ   @QA@ 0U`   (⼐p 0  ,>  p0p 4`03W G`@& @U 0zP00uP `^ \LQ  QA@ \Y ^ Q\ @  p, 0S QAR`  R  P@T( Q  A X # X/ X5 p X@ P  @U)<X X X 0` `Vp  `  Q@` ``  `p`<0< <]0 LO  ( P,@-@P @O( (0( 0$ 1@O /i'QO-b PPY<JM(0p7W `$ :6o@2/0p $` V( ,2(-P W0#03V,0( 0!( -0P .QKU00⛁!Q03SQ: PQ Z5VV030#1! 0 LO@000V; Sp3 p#P 71S41pG2s2pGs1pGSpG0fv0pGwp4:0;p0Z Sp3 p#P 71S41pG2s2pGs1pGSpG 0jW0pGwp0809ppp p@-`Mgp& @ip) P0u0'{0 {@Z0@gt h0 0)P Ѝphgo00g / @-\(,\ \  Q:^: A Ͽ|q<Ͽ1:00500C-P$0@SMT 0( _4p :`I;$880IG81GpB70 B-0P % P 000<890L>1 0 00LЍ 0 /?Ͽr s0|13? <Ͽ2/0 0 0@-S@ 3/@$N@-p] Qdc @P 5_2/P ` 0@ PEPET% B B&"@@" PEPEX% B B""@@A PEPEe% B N B ^ w" ^ v N1 $1 0@`@DF$FA!B@  D B &"AA!@@  B B!"AA!@@ a Q@'P 5_2/P `<ϿL,PE PE T% B B&"LL",PE PE X% B B""LLA,PEPEe% B N B ^w" ^ ^ ^ , ($^$^2 ^. ^0 `1@^ ^ N1@N1 `1@}^{ ^ ^ ^ @r<`@^lhdLHD7y @-@P @ L0 /0 L p@-1!00 P@0 00D@1011.T 0@\0 S@ 2 P pp0  00C1000L  00t@.H ; C-P Mh 뀐pM%ᙞlaapGQQNHH0  @ N 0! Ѝ Q@-h4h$00 0`P@  @0C0APP@@ 0P@pP Pp P0pC0QPp@ 0@pwP  0pC0.S 000@000@ 0pp@E0C2S20/.-,+*)|'&%$n"! je \NJ2S2\0/.-,+*)Q'&%$L"! J< 1,*000 @ @  @0BdQReBn`@BdABdBnPh00p00 R 0pGqqp00 H 0pGqp0000pG00  9,pO-`!0@@R@@Ɵ GM MtčƟT ࠤH8(00t6 I0P40 0 0T6(`0D0h0,0$&$6 0 < P< 0`P@00 (cP?o0 2R0S 80`1  @0`V 0` 0V X DjX/`0S\ ,0Te?pH5`00` 0VH W,0?p 5 0= 0Y& W0 ^j@X,0? )R 04pdp`  ( ]P* 4  w,X4  p0 84< p04 p04  p0 `e0SJP aH0P40[ 0 #<3 0 t4 30Gލ Ѝo\3` 0m_:0S 00ST80`1   *L  i"2 0 t4 304Gލ ЍOsJph,0!(?q0 r iW^t2t"0L0l2 0XP T@\PL i`GpFW.pD `R- V @ Li  i Y 0 P1H 0 00 .+Y`G 0 pFpWT@X\Pl 0   cVL 0 [ @ 0 TP   WiY 0 D0H 0 00 .y+YdK  9i]k''ќ$+<Ϙ($`d#Hl`H<O-tM@@ `VPPh0 P p 0. 0  0#$`14 %S, %ἴ0 徤   (6< 0 V 1P80 6< 0B>PU  0R40008 h`1S   ;`1S0 0  0PJ0  0P7P  PP$0  0P0  0P0  0P0  0P0 0P`1SxYz < P0ppW  0R 0:hnpW 0pW  0Rx 0'h[pWf 0pWa  0R0 ,0hHpWGpWD 0 PS00 h`1S   0 ` 0 `@0 `0 `, 000 0I tЍ   Y _2P  0B001p 07001p 0,001p 0!xt1p 0[IL gtЍ tЍ 0 |10 u0 n 0 g0 ` 0Y0 Rx0 K dH( 8 ,T ,@ X8x@-@`00AMM0 400p00 ?PP0S tD 80 0 4 30AލЍ./A 0,@-@ M pp P?`PP 0S <0000 Ѝ00S.S 0S ЍDp@-|0|AMPt 0 ` $ 0 @P "8 00 0 4 30Aލppp@-P@Q`  @Q ucPV 00pV00p@-@ M`pPU 0PU  0\W 00 Ѝ_00P0 `W00 Ѝ(p@-@MP`0S 0 @S 0S@V00ЍpO00@0 PV00Ѝpۈ0@- MP0@0@0@T  0U Ѝ0p0 0PU:L@@ Ѝ0<00@,0 0P Ѝ0ڨp@-Q`M x00<@EP 0PU  0VЍp_40P 0`tЍp @@, 0@- MP"0@0@=@T  0U Ѝ0p0 0POU:L@@ Ѝ0<00@00 0P> Ѝ0t|ڠ80@-@ M T ' T2T7 0DS3l0s.-,u*)('&%$d"! ZTO #TC |QTP  Ѝ0 T6 XQ TP 3^H1P( 0@T" QTP Ѝ0 T" PTP @T PTP  T P TP PPPPPPPPPPPPPPPP|PPtPPlPPdPP\PPTPP(ٜ٠p \8T0 X0@- MPA@O@ uP Ѝ0 0( 0Ps Ѝ00@- MP&h0h@0@B>@T  0U Ѝ0O,0@ 0PR Ѝ0 tՄMp@-@ML 0 Q0P0<00P@ ` 0. 03T @D D000T H0 0 <0 30 @Ѝp@Ѝ/.0 Ty2~t O-PM@PP p|`x0 裟Q  ЍSr RSPP -\0  0+\0 0 t30P0 00L1011 .\ 0 @Ts@ q' Q  S#3@  Q 0R \  S # 3!# 0T$+<0+80+40&<0&4 0'< 0'400&( '( ` p0R0`z 0 T @ P  S#3@ P 0RQ  S # 3!# 0TM 0 T @  P  S#3@  P 0R \  S # 3 # 0T 0 0N 0L0 000J 00  0;LO-`Q0 dM R R{20\0QS0N0<0l2a!##\B2b1!AP2aL5BX2dD@AEW0E0@02h8's2Q>?2crlqqHL01NਂhL΅ReXT P0HP QN} } }[P0 T XF Z H Y J (0L0$0\04 0@0,0H0 0<0p 0D P40C[ CZ CY CdЍ00N\0`R`(`m  0 0dЍXZ HY  8xgibMӈQЄ  @-@P 0D .R\0@*S0T .S@@T QA.@S@@$ $0$ 0(  vX  @-$MP`@P`]0pv> 00pp< pp_p  YaPc$ЍΰC-@P@ `p MPOP @U _P@Wt Ѝ @Pt0 0000 0 P"@|0S0Toᨂ# tL(C-@P@ `p MPx@P @U ^P@Wt Ѝ @Pt0 0000 ?0 Py"@70S0Toᨂ# `p@-@P00CS0 S u P `0 Ppab`u0 0CS0pSr P 0 /Ib@-M@0  00v00 !R !0@sЍ@-0 S 0@Q0 R  004S 0@l@Q0R Q    R 4Q `Lp@-DPD0P`@0pp 00p@,X0$lLp@-@ @ `@0Ppp0p@,LA-DD p@0P`p0 ALC-P0 `0pMpp@ H 0D @ <8 @ЍL:`LC-tPp0 `0p MFp@ ( 0  1@ Ѝ*: L0 00/ 8L0 00/ L 0 00M0Ѝ LA-TT p@P`Mp 0 Ѝ L0 00M0Ѝ `LC-tPp0 `0p Mp@ ( 0  l@ Ѝ9 ,LC-|Px0 `0pMp@ 4 00  r@Ѝ9 L0@-P@000 00M 0 0Ѝ0 Lp@-D0D 0@0pP p@ry9p L((  M  0 Ѝ lL R) p@-P`@V :P 0S.S  0@S \S 0SBp0S @Dp DU!B2p/@-P0pSp@ M` 0T  0C0 ЍH0H0 p<0<07/0 0 d̠̔O-Mp`@PP*W3*00V.:Y `8 @1@0 p pZ, `;P 0 P0 P 0`000000Ѝ0 P`Ѝ ` ph0 qP0V0`FV0S000 000 L hʼO-M͍0(0=000=8p08<0͍00\@P 0 P, 0PzYY~ 0IS     E!%Bd[k 8e jDR_~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"! +Ps R 0S .S 0S 0S00S.S=<0@70-< R' 7d 0@ 0 PE0D0 SiL7L.4,00$,0PJ00 CY 0000!( !, p@B <[@$p@D0 PYʠ0 zP  0 0pPd600#$ #(#<0 0 C0( ,600.0 r  .00Q$0 ALP00Z0D:0<H+B 0?R0S %T5 0 0 30  ݍ ЍX5Y =<00S4=<0@050S=<0@50MH0⯽00@0 0 0 P@0 50P,0$ 840H0寽00 @0 0 0P{%5P"5@5 0PD;<4@@2 0 0 P_00 0 B0mPU0H< 0R0JZ0S~#3 0T t=<00S4@0D;p3d 0P 0 P(0 0 B8P H00P8p4`@C 0P'P 0 vP0  P0=<00S&40p00Wd 00D{L20 0 PP=<00P@C 42 pPQ W[ 쁟W# @P+ 0 2P0T0 0 E)P00d0W0@DWp 0 PP1d 0X 0  PGP 0 6@P 0pD{ 0PYW.  0  P}&=<00@C00 H ƬŐd` Xj Z,%4@ T$px*Tlld Pp N N|==== N,==UUUV䪪 <X \4h\x|@0@d 00 0 P0P0d 0D 0 rP30d  0 cPpXD{ @QP0d 00 0 MP0DK0S3Y  0 >PDPUD  rp0X1 0E@HS Y>g=<00S]3@Z30 P@D[2d 0 @O 0 P P:;3 @DK2Sd P05 0 Pz&3@DK0d # 0 Ph30D;3d 0 0 PV0 0 BfPN0D P@C 4> PpPz(4($0 @0ZDn: T 0  P,0 @C40+Yi =<00SD0@d 00P 0 }P 0 d  0 oP0@T0DK*4UpPTDK 0d 00 0 RP=+L0X 10"3% 00;L0==0;L020 200;L000300;L0<=0;L0L10 0;L 0 P0D0 SQx@pT P0倠t @ Up  R @ Z$ v0d : 0 P@T+A0X 10"3@' 00;A0==0;A020 0;Ax7;+A0X'1 000';A>A C7;=+L0X 10"3' 00;L0==0;L020 200;L0L00 0<(;L>L Cw 0 0  B:P"0DK0SPገ\0 p$P倠P 0 W#  R @0 Z$ 0d  0 bP@T0-< L9!?C0 Sd  0 KPP10@)DK1#0pW  0 2Pm=<00S =<0@90[ 0 0  BP0D{0PCUQPH@　 @UG1 X2  0d E 0 P=<00S =<0@:0"00P84p@C 0PPo  0 Pg 0  wP_X  0 PW0DK00CS' @;00 0 B[PC  0 P;{DKp0PD[ 0d  0 P%0PD[ 0d  0 P0p 0P 0<@d p0DK P 0 hPH=@ <<0 O 0 VP=<00S 0d 0H=0 0 APZ0pD{8  1R@P` @@@@@0H;-P $0 0$YP *( >0@@$> (04/$0Z= 0I0pHD{> 0S@t 0 P0%$0d 0>0/ 0 Ps=<00S0@0?pD{ @@2 0  0 PU 0 @PM[ p_ 0P @DK PA 0 P:` @ 0 DK P0 0 0PP(' 0D;  0P0 0 B-P/@/0P00( D[@=0@0 p 0 hP-< X=@B!?C0 S< 0 UP=<00Sd=<0@<0~=<00S0SH:=<00S9 L0@d 00s P 0 &P00d 0Da 0 P 0 d S 0 P0PD[S1iB! 0 *P0=<0@;0$=<00S%/0pd D;h;0# P 0 Pg0084`@C 0 rPZ 0 PR 0  bPJH=<00Se= @ 00H[0 N#T *0(`+`  0P: L08/= 0 @D@0 PH[0:d 0 0 P0ZD1*p@ЉЙ 0 DPZ W 0  aP p 0d @ 0 SPpG@P 0 Z 0 AP|@0 0@ BP 0 .PPDKg. 0@c.H`.  5 = 00@P ( ,9L0,P@8 05/D@H=<00S=<0'@7 01=<00S*.0D7d 0( 0 PMl 0 0  BzPb0D[0SD'C1#00 S( 0 PL= @ 00H[0 W"᡿T *0(' 06 p08/0 P- @DH[P D[@= @ 00H[0 1"{T *0(&0 0 6 08/0 P- @DH[P D[@ 0 gP=<0@50%5 0T A $P0 PU0D[:=<0@h50{=<0@T50u=<0@@50o=<00%@,5 0n=<0@50a=<0@50[4d 0d 0 PU P0d 00P 0 PUDK l 0 P PDK 0 zPg 0 Pz0 @dDK00`PC@ Pk 0@{Pc0DK0S 0 PUP HpP:WW Xc`@P᤾ 0 P<0T0 0 EP300d0W0@DW 0 P#=<0@20P< @PT@T |rp`Pj 0 qP0V0 0 EhP00f0T0`FT 0 YP=<0@10= P 00H0 8U@9*( 10P1 05/+h 0 -P= P 00H0 U@*( H10HP0 05/hUUUV `||@4l\PxԪ0LT4 <TElT<d pPhxl@|\4d<lDpH$tpt\t\<@ 04l`x`@@@ ,+qpP 0 D P<1d P0P 0 yP  0 P 0 iP+P 0 D ]P=H{ ` 0PPV *0(! 0,2 09/=`F ``pH{ 00 hP| 0 ,Pi+P 0  D P=H{ ` 0RPPV *0(" 03 09/=`F ``pH{ 00 *Pd 0 P++P 0 D Pr=H{ ` 0PPhV *0(# 03 09/p`F=P `H{ 0 0PIL 0 PA*t@ 0 DK @P3=Hk P 0@P)U *0($ p04 07/=PE PPp 0 0`HkyP 0 PL 0 iPl 0 `P=<00%@C5 0=<0@50=<00%@C5 00%@C5 0| 0 8Pvpo f`@P  0 &P0T0 0 EP00d0W0@DWQڈ 0 PI 0 Pf`=<0@601 @0@Y0D:-7'0 )0'@C7 0"( 0 PoDP @_pP`WSW xg`@PἻ 0 PS0T0 0 EPJ00d0W0@DW 0 P:=<0@80  0 P,0 D \ H xA-Pp@KU`, T @ W0``W0 .pPE^p P0070 2000 S037#Q00 ^00$ $0$ g 00x |X/0o////@-` @0 0DM0<000p2 0*0 RP, 0 0C 0< 00 0 <0 30DЍe D O-H2HrP0੒ 0 M #r $rgqC2(0B刀B# C@$AQ i!dP`3 @@CB*TJXRW/Y  @0 SP7[0S  `  0T0000000S @B0?R0S2  Ѝ @0 MgP Y W 0 \P@D 0 RPX  @0 HFPWY @0@ @e0  Ѝ :$I% $} }0A-`pP0S-@ .T 0D0@D0C .R T  S\RT  S0C\R@D @0.  0 @@( 0 p@-M P@ ȍP k`\ PaGo4 (0 0 8 30ލpd  0-@- M0@R0  TIPP * Ѝ@Ѝ/ * Ѝ@Ѝ/dPRp@- `@BPPqP0 ?p@D_ꖻ00pPRp@- `@ PzPOP0 ?p@D=t00pp@-@Q `PZP/P0 ?p@DT00pp@-P@DP p@ p@ p@-@P 0PS <0S P  00p(00pQP@- 0R R  00p@-PP Q@ @Q Q QT0 D3200pP T0DS@pP p@-PP @P  T $0S@d<@mP$o@P @oP0 @n0Z@ @PpP@40S00""[$D @nnn nn94pPPrP4 oPPgP km NXH ,3Q 0Y0jQ0S {ǻ {:S03:gXK{ZZ k6CHJ{{ ;R{D30SYj{{L0$&00G;{ǻ]Z@4`n^n\nZnXnТ6{@{7{Jꪻ XK{ZZ H {g[E gk k# 0X:0:g{ { آ 0$0<Ÿ 0 \0p0 0\@0h <D ~j0@ S$Z==L0S46S`b{ f ^K{^CZ\EjMPzP DP|{p`kP{'P`U{Hq5@H{k{&{VP{XNPpa5d́H[5&BHJؤH 3{{ ;R00S{ 0R{ 0 $0 00Co00XpT@H?A?5?? ||N{ 0 S0G{0Z1k{&<00;R`@P{ǻJ{ǻtSR0 $4@ ` @ P@ TPR 5`l@am0D Hgk 0S3 b0A!Fk{1[{'{'Z<00;Ro5&H [p  $pI(R ⋀RЎR ($ 0W 0 0 R<0<0C<0lP<04"0<00N@4C0Co00~0S40S0SD X@lll ll$0Sq kW{{&;Rp{QcD\ EhP%46H0L $ H X(04 Q SL0 H$ {{7@{pXL0S㐀\H 46SW|0$0jS  Q Rk&BHH{{@{?5?559Pd ?L004H 46S<00kS~0S0Sxm`P\ *nPoH $0@S00< kS:7Sq]l[lYl WlUlg$0S H 00jSQ.LQ S& F H${@{7@{@J {;LL$LQ*p S  c+6C#: :L H0%Y!SL040!@$I1R 6H00L0(jQp82Rtm`P mPpՙ0 $&p!knP0"@$0 00M 0Ѝ5 2A-PU@`ᷮ0pS  ]P 0S UDp@-P@}PyP0 S :pSSp 0R:pp808 8e0 G$0$ $f0 ?^ ^^ ^A-P`H@ET*AP/ =P4 pPW 0P P B $$P W 0 P l l0l C0 T T0T D0 < <0< E0 ^] ^ ] ^ ]x0 0@-@PDQG-^8 pP@`  0S+00CS&RF#?! * \U0 S  RXV``W`Q`V\pP\\T0 S@\`Q@-P-r-w0-x0蠳 00蛳000S wS -S rS  0S /xS  /  p@-^ PB2 pn 0 pP P//0S/ S S/0S/0S/@-@00@0T S R RT/ ?/PP/=?0PQ/?SQ $0$ $p@-0 ˰/Y (Y ??SQ $0$ $p@-0 ෰/Yd Y|P P P`/AQ/Q/Q Q/?0 H0H Hp@-0 Q/?S0?/0?/X @XQP0 ?0/@-Ѳ 0  A-P 0`00`@pῲ PZ帲0S貲0@ "뭲@pp@-@P`M P0ES  aЍp 喲 0PiZ厲0S 0 0 Z0 QW\ W`p@-@PpP Q 0S P!0PS!p@!A-PPp X P@PEX `bP@`( (0( 0 ` VhVlO-` MV " p@IV P9P @0SV F!0 `F`1 Ѝ Ѝ f!` \    t 010/C. *     A-RP`p(M @x 0 @0@0 P0 P0\ P@ 0 (Ѝ t X00 5CS @/0cS#:3 3Q31:0CS! 2#0p@-PP@ T Pp S 0\\0 0NpD0D DL0 IT(0( (M0 ?,t Sd, tS`u@-@P } 0`00@|0 60 ஬ `I- M 0/ Ѝp@-PP@ T 0 0 00 pD0D DD0 T,0, ,,0 # I$M" HNA-pP@`% V. 0S 0S 0P Q00 00 R` FQ`00L L0L 60 DV, ,0, (0 9 H4H HGbO-ß OM4`|@P `pPdh V V 00@/00 Z.` 帞P 30 00 [ !!.PQP\.Q O :!ᓞ!PH [ 00:[.[<##=[0Q.S7 Y_0IS00X00 I Z  0O * P00 0J ` `嶧0 0C S:: Ѭ0  `  ":[ 000(0,$P0嗧 1 !01 `0 $V P00 0 0 41 30)Oߍ Z]00啭00<4 ӺP@Ux x0x t( 0V7 T.R  :P u]V p p` `0 m,EH m 0DPBO-ʟ UMMLōj|ŝpP`xU刕 0 0S 0  R0 R R 0l*0\: 0 L5 30UލЍ<:0$0(50P00 0 ZS#``P 05 0 0@P0 $03/P Z: 0B?o2\0R0S80q ݦP0`PLP00 V T00 Z@05`F00 0@P0R?D H<0p4X`P0 C 0?`P!0 $03/P @ ` Ve00p0 S(,0WW ,@x TH:0040D000@Q 0 d0H 0R \ Q  RL pp TP@`BZO[P0 0 0Pm ! R soQ \ V\pp0XP 70$05W @0ST0 B@Gq 0P^!P" SPSP@Tp`0S 0 0`@D @PC0@P0CS`@:Dp` @1H0T C0 0CS`:#080S0 S R:  C'SR^0@ r0Pn0%L PK RSNd5 0 <0b@PD0  ,0@S<ƥY 00`V5 <`v`` P(0U7P0( 0S 0S @0S0P壥P( 0@T`*X0H0Q*p䴪@0`@0,@Hp@0 R R $4 0@ r 0SL#3 @ 0fB 0L0?R0 0 @P0 > ,0@SP D001Q>*0PNP P`PG0` CR00S]D0004D04004<_PeLp.0`P@ CR00S#@ܖP`@$03/P `00D(`C 0P00P  0 D00000# 0  0% L%a p  0 Nύ00;1@!R7P0嘖0pP`pH v6P 0 ^@P@0 , ,0`S@0S00PD000Ấ@T Hp@0,`!0%L L4!P D001Q *0D0P00YP 00D(@C 0P010P  0 D0SD0400 l l l ( ׄ'< T&< h DA-@PPMD 0 S`05 S Ѝ0p 0PP> P9 80 0P2P  0 0PኪU 00S S 0px8 808 40|  0 77XG-30BMPP040@ 0 00S0. S @ᬒA~ ` p0v #0G7P @T *X` \"pT2P 0 <"$2 0 4 30Bލ 0    ! 7@PI `PD 8 0 0@PK` 0 00 00000 0d0@$TA 0 p pIP  ᶨ00S 0  0pW0   0 0˩ 0  0 0 0 b_Ჩ 0 ᫩ 00S Sy wᡩ_R _706 _6D D44O-PPM@ 0X0 X0 @ߍ0( 0XP 4000 00 ` @ p gP 0 "00{P ? R R R#[ 0 R@ 0PUI:PE0S[PEi p @  p[PEW RX 0 0 00 R R0 S S pPP  Jo P P !Tk*0@ZU  0쁟pP`P R R R RZ T4*ؔP  R`~pp ~ U:  PEXA Hq Ꮷ PE  W  a U*(P@D `( p@ 0  0B 00 ( P@D pa `@0P`p+ `R`P2p 0^@-pp10LM`P0D00@G Lp0PS- @.0 P( U( qp0 00  46P r  0 0 0 D0 30LЍ5Ptpp  @ TT@ @0@ <0 ࿥P X0f@/e W\. ȸ.H-A-PP@M7 q`p@T) X pp00妡 0 5P   0 Ѝpp E@ T Ѝ5P @, ,0, (0 ld4 l,, G-M0`pᝧ@P0P0 V 0   0 pPᜧЍ 0  PP 0   02 Ƅ+A-M`pPg@P , 0 (   P0@kЍ0, 0ЍA-@P M`P@pR UV'0S9 0S0S9 P`8818,!<P P0 0pP 00 ЍU U- / 0 0 Ѝ0S  0 00S000h S S 0SP` @< <0< 8 0੤0 F+@ R `t)O-DDğ DM<h@P 0 (0P P`sp 0 `'PP ɒP ,0  0P0ß RR RR 0 Q Q 0 R R 8 $0壒$0@P`  s p0S S S@ 1Y g*@ኒ@P 000S 0 R0 ?@B 0I  R06@DQ1 C  @D T!:  @Dp30 Sq CF P`0  %@D q [p>`PT* P`pn 0  0d!P1 0 <0 30HDЍ({PI `  6P@ P1 0 0 0 0 J P`001/ 0 #0 000徥00 `N`P R4$d4 O@p@-M`P@ ),0,0   0aЍp[\@-M@ $$ 9 Ѝ[[@-M`P @ᓥpP0P0 ɠ@0@ 0   @0PᒥЍ[0[H0@-P MP@T 0t  P00 000i P 9 @ Ѝ0M@TW 00ZZZC-a@P`PMD UL 1 0`    p 0\# 00 0 L RU0100 L.\3W 00 @Ѝ R0 XS 00 9\0 @ 0 m0 ໢U0 n0 ౢ\ @ pG W QU$ (,000 K " d"xO-ß3 0,MPQ0$00@`N R Pk PY0@:T000 0n Tp 0,#P P` `@0  P _ ZZ @ `V pW` @$pTᰐőK0S T0DE S0 s\b 0@@r@ p 0I4 (V@ T T[ K/00!1 0 $0 30l ,Ѝ!1 0 $0 30`,ЍO@:TP pᦔP :V=Z& 0S 0$ SPq1pJ04 ۡT TU 0 0@ ̡N0S m 0@ C00@ ⺡@$pj@.T`@$pTP]ʨLTi I H P d H< H 0P @-1 0,M@P0$00`P& V.  0 0 0 p D1P* 6 0 0 $0 30,Ѝ萣 0 X0X Xh0 YV<0< <i0 ObL F E@ P<$ (O-ğ lMQd@p0 R P P% W/ 0 p$h4 0 d0 30lЍHHTHdP`0H W T~ T0  040 $(,00h1T@ RT@P  0 q0S P q u \P 0SP qI u00 \0S PZAU00@P40@ 0b0T0` VN*:0TU0O "K 0 m0YP?@T$ 0U00S 0S "2 0 d0 30x lЍOu0P040@` 0bu PU 0 S *  0CR00:'80 S8: 0 /Z Z9 Z@P(1( R0  KP LPP`0P`I0 7T T0S 0 0 ': 0 000@SPl :0U0@t"K D Dh8 H4 B  tDO-ХM@P pP) 500SL ᨖ([P U U U  0 墖Ѝ0` R 0 ? 0[' + P%P 0;/pq 00P @ P :00 0 00 kЍep pE+P0  * R + L UY pp 00+P 00 0 SM  00 0;/pq 00`QßQ <`V;ዓ0 P0 ;/yq`0 z 00 0`VßR <0`VßpX0P[ Rh0w0cX0`[MS  00Qe <`800C`V0Z & "  RY`L0i/  0`;/pq@ 00 `P  @ P 00 0 `Z 00 K\P)0S&: I y Z1!0 ߞ00C0៕2PT` 0S  0C`ß$1$!$G0 žA`V0 Z 0CJ `J`P @0P .0000 00c_ 0 WH0H H0 0 ? \ X 0,p@-PP@` R 0AU0D qV p<0< <H0 _Vp0PpP O-P$M`@ T\0000 0 00#pp0 0`' 0`B0S0 Q; `V00S  F 0S` 0 0PP0  0C0  T? X0 00P6 0SW @@RY00S@ 0`V00S`V[* P`Q @ PR  _PV 0Q @`咔H04 QY0 pP, 0 S# H @ P00S T0S S/ S4 T: P@000S 0 0坙V $Ѝ  P `BV@` 0r ^` D0@@ yW TT SSD D0D h 0`@$   p@-@PP` U 00F Gp 00p0 60 8Ud0d d70 .0 0@pO0TSK004  h l  @ -M0 3/Ѝ/0@-@PP M U( 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0D0D D0 ߜU(0( (0 ՜l  8 L  0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L 0 U, ,0, 0 l 8  T p@-@PP" U 0S S S pp0p@0/0p@0/H H0H 0 g, ,0, 0 ]   X d 0p@-@PP" U 0S S S pp0p@0/0p@0/H H0H 0$ 0, ,0, 0$ &   |  T0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L H00 U0 000 ,00 | P0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L H0@ ୛U0 000 ,0@ ࢛ p% D&0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L H0P jU0 000 ,0P _ dE P8F0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L Y0\ 'U, ,0, (0\  X ,e0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L a0l U, ,0, (0l ښ P $0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L H0| ࣚU0 000 i0| |H 0@-PP@ M T 00vP00 Ѝ0L L0L H0 uT0 000 q0 j   d0@-PP@ M T 00P00 Ѝ0L L0L H0 GT0 000 ,0 < d  8h0@-@PP M$ U- 0S S S Ѝ0003/P 00S00 Ѝ00 0S0 02/ Ѝ0L L0L H0 U0 000 ,0 H h0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L 0 ཙU, ,0, (0 ಙ <  A-PP`@7 T- V= 0ppgS S&0  03/P" W 0 A 0/0 03/P W 0 A0/CoP P0P L0 d8 808 #0 Z ht L* $A-PPp@`M3 W< T% rP RP P P ЍPX  00R X# ЍAt 0 & 0 0  0 W 0  0 O P@ J0SPw @@  x^ L|_ p@-@PP U  ;p@|L L0L H0 ĘU0 000 ,0 ๘ X ,|A-PPp@`. X7 W@ T P  R 0 R 0\A/V 0A/ 0  0{ 0  0qXl l0l h 0fWP P0P  0[ 4  8T (0A-@PMP` 0A UJ 0pS SW ?  dP R`V V V Ѝ 00p0SP Ѝ W`# `0SPV 0 /0 Uh h0h d0  ;Pp 00 ( 0p ޤp@-@PP U p@T }P P0P L0 U4 404 0 ൗ#( H? P0@-@PP M. U7 0S S S Ѝ00 03/P 003/P  Ѝ000 3/P 003/ Ѝ0L L0L H0C/oU0 000 0C/d ܬxW `L0@-@PP M. U7 0S S S Ѝ00 03/P 003/P  Ѝ000 3/P 003/ Ѝ0L L0L H0G/U0 000 0G/ l8{ , p@-@PP U p@UX X0X 0K/U8 808 40K/p@= , |p@-@PP U p@|X X0X T0N/ЖU< <0< 80N/Ŗp@d 0 \p@-@PP U p@X X0X 0R/খU8 808 40R/⛖p@ وT 80p@-@PP U p@)X X0X T0V/}U< <0< 80V/rp@ < @-M@,P0.S00ЍO@-M@p  B0?R0S Ѝ$0$ $0 =0C  R8 ..R01 .Q( -S.S AAQ0B Q S$ .R0 .Q AAQ0B QQ0B ^-R 0 AAQ0B Q S//0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C//0 0 / L0 00/ 8// 40//O-0 MS P`ȣȓ Rl Q Xg@.P` @Pc X[@RAS0SI <  cSB!  S   XG` #SpP@@P   pGW`W0P@W `0FS0S0S V*0 00R0`FV0SP"P2P 0 , ЍT S N(00`AQQ!X@R P\! C]R% X!q#c!! Cr   "!!1Cs0#"1 0@0Ls 0;S!S" Cr 9" T*00Ls`@S \S X 0@@DQ P`S pg' 0`B0j pg'!"p0`50]ؖ000X.0`0b ` tQ O-Pğ@ $MQ `0Xt P`p)[V> 'P @Qa P @Q`P P @`VT*` P`Vy [\Vr .V DAv Xt0S Q.Sm @]Pj `0PCU`PxQM  D P XS  ``/Qj ]QOP R02   0 ]R) PR  "  XSnP   R0 F b"r R` V` v`A ` @R^ .R @ @  0D0C  X1(00$Ѝ00P  ` < V   \  PS X R0Q  S0 T 4*@DT[@ XS(@ X000… Q ` T`4*@DT[@S X00`   0G-\AQ@M*p0S& RD @R`P001 0X; 0s00ࠟ   r \ 0 Sp00 @NT00Y0Sx x0x t0G/%AS 0SPQP!00P0X@(0@0 h$ XRO-P3P#RP3 M0U 0p`\ @X @RI R R5 (00 ЍQ*@ Ġ[? A @ GRPR@\ 40S4  0@0[0Q0A[0S 0 0K/ⷒ  Y*@T*0PՓ 0A\ R!ɑ" 40S 04 0 \4- M{ ЍO-S@4M p0S0h 0S 0S0^P @^Z \S 0( X S B `$ ,PU P0S @Sf   [@pU `PU00 S 0W*0 B>^A ZP `00  K Z0T?\P0` RP SAS^01"0!0\VP`&(00X0S $0 Q*0F S(0S 0 `(  0AU0S"  !  [)@Z0 p w(  ABQ APAU QpF  p  r  0B>SE0A S0AP`0S 00ӓ(00@4Ѝ R p0S   P\`B0[,? 0,$ @C /Q R!1 0R/ypꞓ00 0 0R5 P`ᒓ00j,@J0? Q0S 0 |0R/T sX \Q\ @ @0@ <-0@D z<J zߨj yߘTp@- M P0 `00p @ !xp < 40 0 1 30ލp@<  (A-P 0 0M `0 10@0 (q\p 0 ph0 (0 0 1 30ލ;  xQ:/R/0S/S:00/@-\@3#* 0^ @R R R (000S0QA^ R! Q 0Q 0 ARL ?R@- RQ0A  RL ?R00C諒(00/C/A-@P`TP% UVT P @TP 0?Sp ~00y(00QSp@-`P@ ֈPP@`V  0R p/pA-PAUQ?UU@A`pP W ځ1AP6(00100-?00Q @-A?SSRB 0@S A00 (00/-- M/ ЍЍ/@-M@ Dp TЍR/0S0 \ S 0S0000/O-P M@P 0DT"S ` ÊP-Ya +Y Q0Yc T@ @Q :pV`Ppg:pV`P" [-SQ& K0Iq P0aIQW0IAIQ70IS| V[SQ;+ ni0S \0J0 Ѝ`Q0YXP A@0L ^P @B0 0R0   ЍQz T@@z0 ?0 YD rh00 0M0ЍG DA-00 rMPPp`, V4 @X0^00pAtA0O `p00TA΀`L PP &0 @t0 0 1 30rߍX0X XF0 ઎V<0< <G0 ࠎ9 t \ pt pL0   M Ѝ  -- M0 0 ЍЍ/--0 M0( 0 Ѝ Ѝ/ O-@SM ] YXc 0pS000!R !01 ւPP E`#3`7P*Q30A 0#1#2#4#8 P 9   U U 0C  pSwKP0 0@pQ 0S  Ѝ6T 0 @00Ѝ808 8@0 $ 0 0D nA-@`Pp㥄0 z0@㥄$0$ 0 M Ѝ 8TEp@-0 000St@@@pdPddPXF@P@P 40000 0 tELE, p@-P@ʏ p@A-@`P៏ppp0php mT  w1<0 V  AY 0d@-@P0S 3/000S@豏 A-pP@`  F Ju000@P p@-@PvPpp@@-@!1BMM 0`PF040@@@ @@y8xqPpU h10S \!p0@  P8A0@ P< 1 0}!0 0 4 300BލЍDP B@P  4/P Q Q 0 0}p0 00P &0 0 ! @W7 DPBt, \ O-qQpMPk 6Ap@e $a` Q00]1PI 0SP p Z [ @@P 0[pP 0PU :Y P``S@PP TP 0@U:W 0@@00嬦'IQx00p@@ЍPЍ<0 0 }  p@???x , 0@-@PP$M U" 0 P' 00 0 7P $Ѝ0`0` ``0 UH0H HH0 >X f<\~ f4G-@PS  RL `10\0SA HaHHqP`p #)/0PS-00兑 000S 0 000 00 0 00 0 00 h G~P00H H0H D0 ⇋h PD4( d`pxA-pP8 0S@P$0S!0`PP @0S PU @@P 0U00 Hs\@ 0@ P 0 000 ,0 3<;` c (O-XğdMR  0 S X (4`000SYD@0S00 G0#003 0  0 0'0P YP3s003@0p0VQ QN  QI P0S_ 3/0 0P U@p@ SP00SJ" 00C0T@dЍ|B,@@@q20\ 0,0Sq  R20$   @$(0X0 L00LP 0S 0 <00@00<00P 0 S@5$0S(  ( @0+PN 1S@iPQ 00C0 d!d1d 0&( S0S X @0!010 ,0( CX!1 0( 800$   @$(0tP @$0S(  ( @0@J$  $(0 dt: ]-= 0 |0 30Ѝ POd @040 $ (P,9T-T##P-cR:H-c2S<=  PP 0 0C@aa0C0C Cr  \\x=N>?#c!!"N ,  "bQ-5:bQ , !-#c!!2N 0  T\0 S 0!Y&0`0S00 Y `0  p`0 S00CL  B2;Q/0A!b0dP  Y0`0S00 S 0  B20;Q/0A!b0dP  Y0`0S00 Y0 p`0Q0: 00dP Y0`0S00 YD0 p` 0Q09 00dP Y0`0S00 Sa /1 b !Q 9Q00dP  Yj0`0S00c SB0Q0(9 00dP nYR0`0S00K S*0 p`8`p0 w`-p8 Q0 0dP  :Y0`0S00 SQ!/ b !Q  '0 dP0  Y0`0S00 S Q '0 dP0  Y0`0S00 Y Q $'(0 dP0  Y0`0S00 YU&P#U"P Q &0 dP0  Y0`0S00 Y 0Q0D6 00dP Y0`0S00 Yj0 <008@0 0D00dPH00L0080 0X0% uYm0 `0S00e YD 0E0 S0ڜ YU0`0S00N S-YH0$ `0S00? Y00 %1?2c 1 R11Aãd0Sâd0CS0c0`4dP 04Y0`0S00 Y 08  8  p80 S0R`050dP03 0 Y0`0S00 Yp0 p`0dPS0003 0Y0`0S00 SY0" `0S00 S0 p` 0S 8 @ 'pq   Xpq 0AQ 0! S! -Rk Si! 1Q0!Z0S$)@Ϡl  ^Z R SH*ȟY`` Ји  v@@PPȟ%ȟ堨 ,H)q Z.px hȟ5:ddX@ $ ^, LΌ3# `_ 0RS@wWCYPP  `E@E@ǟ'ǟ|g ,F|t`(ao[.`gl 11 :Hg$@BW@122e3cPL@/ c0 y4#(: 600+$0+>! 0#Â!!!0C0(AX Oÿ2+" ?00 #2>[?W'`F@PG`@2#2:#0D"D "Q0 3 #101`0U15? B4sppp0/S[0 o c0 y(a!(: 6 o`00+$0+>! 0X!!!!0C0Xÿ41+" ?00 #2>`T[h@t c0 Sy $: 600*$0*.0$1110B@T0 I:#$B0Nm:.EQu_9k"mn -cSI$ňQ\\(=p ( (Q\(\) 's c0 y(a< (: 6 o`00+$0+.d01110BX|0;#(0``0 0 cQ @R0!T BqgqgYpC(1 ?  0c0x0,!(: 600)$0!)>X! 0Â!!!0C0x!Xß)" ?00 #2>r/E B  P2?A1c1c0R0B 0$2!502c4"2c2A" "b1C S/  `008P2P":#"0 όB! TY: 0"#2>"Q0030#0000U  PE0 S0  P P$ 0Ѝ@t)1? 0 c0Cx0t#):60 0($0#(>!!!0C#0Y("0 #2>t<0P0@`! 02P"> 0R \   10! S j~00Ѝ0 S, 0Q0% V 0? VQwŸ0 0#́P0PQ  V0" RR!Y0h&P l6m&N R0 RRR@ČR RP)0OCN  h2zN,h 000 R( j0p 4$h`@,P,0^S0 * P4P"<$1PP TZW [[(p W0  @`  0^ ^4$0^$!? K[ ,P04`(0V0F 0 n R !0S ^  0A0B 0(1 0S,pA0o R !0S \ {t 1PpN h y0 P@P0/C0XO0p CU, "/ ppcW  (0]# @ƨ L0hNhO-0|M<SPM 0@S|Ѝ0S >S`@@0FSHypP Z 0S10ƒ!1 hh "003yY OX10\1 001Y" <Y50 S0S >S@p3S*S0S -S0 C R0`@0F0H0N<)`h0hlpt x|Ѝ*YY -Y00I S@0IS0   S ,S;SQHAL c ;S,Sb ShH^%- Q 019mPhj`019mo\` @KOh6Pc^`̠L 9 bp&kg.htlw@0 0N\hPx00 @{x @ P 1 00 A1 01tP00P 0,Sd0,0P 0S  H LI$ bh& `p&g.tl6w6` p0@ `pĤĄğ@(4$cR0#034 1`002c2c# b?0cY[  Z  R `pJ  ($cR* $L2P 0 S 2J` p0@ 34@0 尃@0 `0pcP0#031`002c2c3?0cP`cs \pP  P003:#cP* 3301c00 `Z00p4@00"0` 8p @@  `p@D 40g p 0HSh0Ű1` p0@ yyX ̀\) \({ 3P A-PQ@D 0S! pN,00 01h6l6h`v`P 0:S fP `VpFPW N hq0PPT`V_pHPNLg@P`1hPpVE`P rA-A`P@pP xqPPPWrPqpATW  P>UH QP |1|!0 t0000`0V m``@ v P =D0C0CS\@0d/@D  w@D0P0T0S00#  1PWPࣶ N0I0Uh,nh8P@P0P P0p0 0008 Bfq0S AX0@-"@ 0 0!R ! A @@-\Fߜnt >X0@- M@PD0@ P00p0(0 Ѝ0 L@-M@300  E/  P00p0(0Ѝ 0@-@P MP0 Eό uP T $00t0(0 Ѝ000p0|  p@-`@PM`0 YP T 00t0(0Ѝp 00p0 ( p@-@ nRt00QU d 0-P@Hp00 P@ <l݌ސ 0 n {4YHYP@-@P ke0#3@oe0 ;0 n Xp@-P`@j R T0U:T0T:p@oR~V@-p@-@QP> 00!R ! 00! \ uP 0B RQ`0 Q0AP R 0 U00SpbP#bP `bP0 \0\ \<0 3nD0D D0 W*n 00BOp 00 dW`WhDW=<;:97310/.,,+)('%#" vrqp! $9 roR V@7VK 0V & 0 aQ S  T ,4ЍPP؀PP؀010 00C0B Q$ROLP00 x3 0S 0V`1!'  x 0SM 0V`1!  x 0S6 0V`1!  x 0S p 00B S0@1 00B 0B Q$R8 x 0S p V`1 0! xO 0S  0V`1!xX 0S 0V`1!0 *RS 0B Q@ 00B S@@@ x: 0S 0V`1! x  0S 0V`1!    x 0S pD 0V`1!dx$ 0S 0V`1!W V  x 0S] 0V`1!F +  x 0S p (  xz 0S px) 0S 0V`1!x+ 0S 0V`1! x 0S 0V`1!xn 0S px 0S p  0V`1! py xp qp jp& cp \p Up"s R 0Hp0y  V@ `1 | x 0S 0V`1! | xm 0S "pT  0V`1!t ; x 0S4 0V`1!e ; xX 0S p/ T- "* p# p$ p7 p#l x 0S 0V`1!'P x 0S p[ x 0S 0V`1!  xi 0S p 0V`1!$R 0@C p7 x 0S p  0V`1!x 0S 0V`1!x 0S bpx! 0S Vp@ x 0S Hpz  0V`1!  x  0S 3pe  0V`1! PZ PX PU KS PP FN pG PD :B P? 5= P: 08 0B Q@ 0 B  0B Q$Rh x R 0p0 V`1@b P  p  P  p pO p P  P  P  P  P  P  P  P  P  P 0s 0 S ~p  0V`1@! P $Ry@00 P  P  P  P  P { P v~ P{ qy Pv lt Pq go Pl bj Pg ]e Pb X` P] S[x 0S pP  0V`1!p PE ;C P@ 6> P; 19 P6 ,4 P1 '/O-@Ο oM M0Pƍ0L@ H@p @0Sc 0L00!R !0w0'0 ` 0S   R  @, 0 䰍D I/@$吰\ 00000d0X00PU @%U PU `DV0pJ00S00`00pU 0Pv0%10`(P 0 0FZSeA 9^<.2w>rAB +Pl\P    R\00sX @0S Pb?`1RRm`O`.>TQChˠNP`G0L,@ \DLt/0@8D@P@[P@@0@ 0@00e@00F p`A@00F S$V (@D T V4 $P|:,0   S !10R q- 0v RR P @TP@@ 0R00S@v0bo,dp @_TP<4P$0000S 00儀0@0S0000XX )8 0 6 30 oލ ЍV_ PP0abv0@T0P0<040%!(R PQ  R8  儠`AV{S 0000S0v00%1S \0000$10000S0Z @DT0 )00Sp0C0 (0PCU80P00P$U0X0Sz v040 0S@@0S , 1 0,040S|00 x0 6 pR10P | 0BD00?R0S 00S  0P00 x0S-0v00s<0 ` `p fL0 9p 00 ,@p0 b4 \X'Д7t7D ˀ T \ D p %h%(^%, 00d0,  v :I RB 01  vPc\I 0,0  0R00SJ 0 , Xbo wd @jpHXKdXq XPPv0T @P < 4 -000,  > : R 01 0, SH 0H x %! * ʌ R v  \  wS4 , R boRdp !". #2 g d @H, 10  g00R00S 00@d0G @pH,` P00,0`@D/ 0eVH0,0boH0 L0p ,@_F@@P`Z@P`P`P`[ `*V} 00F S0 0 `! 00F S PPX4<,  n :c RU 0P1    R%a, ` 0`w0X0l40S0S00D <0@JT@T ڔ00Sp@0x<`T`FV<0pX0Sy0 00  0`0Sbo `0 0JZZ ڔ0 0Sp0 `Z `FVV0Eup$p@`FV; 0Sp 0P 0(0CZ_Z ,ڈ6F0`0 @ p$P`pGWQWPpGW F p 87 0 R00 #:P$T0$ڐ` ᘧ   `$@K[0S`0 PK[0 @0S0,800@0P$P x 0 S 0bo`R@)D @R0p 0 D `@Vd RJ? 0PF$V$d9 0F @$Pp`FVQpP$`FV pF 90Q`0v0NP $T~P$]d0Wv0! XPPT @P < 4 U0ڨjp$`@PEU 0S` 0RPPEU00S0(;0P0==P60H0R)p],P)$U0000S0;000G0 00 `000000S03`V 0D 0 000KR,0  H0H0 0 S 0 v0,0Sj R@D @@HVV ,<  , 0a=000NSn `Vv0r|p @P@ T@P@<@6V,}p$p@`FV 0Rp)P,)`FV ʜ  0R`)fg@& c R ,0P1sb 0 P 00@0 | RH0,0  pH0py0R0@0 L RH0,0  pH0peYP)$rQP)$uP TQRӸ PwhP4P $`Y @ @LTT0ᐐ @HX \ PvHX@ P0\@P\PT/? 0, `|00CD0\P8P:$v0vV0t@ 4P$P`@K[0S`0P0(1<0 S+0S cB-0C R)1ھύL1BcR0 0a0  AC LQ;*JopL0 Ta0d.d>d , 0`H.H>H D, 0`0S0$>00`0>EPSH , 01H S-0`v0͵ 0S? PCR ,0P 0 -H000 H0,00,06RH0,0  H0 `4P0S0=00`06P$.X 0p@T P 4 _gPr$G0w<,04 04bo,dX v,pH PQ$ < =  S5 , ;0 a RH0,0H0  ? 0 I RH0,0H0  ?  Re ,P  S ,S, H0! H0? z,@pX R <A R R R <PXT@0p_4@`Vhzp0v0XzpTP$~w S4 ,,  S bo{X `pZ^L 0 spP" 0@00R ,01 dR ,01 \R ,0P1KP8"828 , 0,\| @B0?W0D@PH0H3_ 0 0 0@ 0px_ 0 0 H0PpH0P$`X!X1X D 0\0@ 0ap 0SH0 ( H0f@d SH0,H00, 0?H@P ?H@H0PpH0J!@ x <$(Pܜ(3 l\LHh `h(> 0@00/0S~ `,@'`00F SG@A@00A S$Q0S+ 1 0`0$ T P   SH0,H00, 0b^ 0 0 S,H01  0,, H00@ 0p> 0SH0  H0 @&_@-@`P MDpR@0p0 00^0@R Ѝ /A-@P`pR0 H0@RO-[T/ M p0Piqa \ ЍO{[D{&{83`):Fk{J @ H 82k0 c01{{&""{ {0 k{{& {0 P{  { x C $00$0XCZJ40S[00SWpP( @PPU 00S0SA UPYH Y @P= (KP9W;  W9RpG  Pb8w@P&@P [0 (0P(0 ?@?@$@$0SW F 000 0 `0408`(P pP0` PU8$$$0$XQP 40SYWQ+ 8` (Z 0SZ  pP` U 00 E0K[ (K0(0PP1 0`00 (0S0P(0 0 <0U  p(0 !W `S;%{K0F[kF{7@{*0 0r  k[3{Ck6{9J\0 0R?0S@ z0$000 P {'{0 {O{;0 Q {'kkKE{{*N{7N BB*N@{*0 r  P`w< `  s0R @0P0`kW~ 00 pS`C  @P 0Z 0P0 P p 0P00W0SpG P)pP   ! KXPP 0CS{  s9R @ r `  0P0010b$04u(P]00C 0^@P 00SL0SR E0 LMWXt 000pPQQ@0S Y Ys U8`a@P (P9X\ 1 @$?@$@[ LP0: K[{[$kk0kP0C [@0" % %A|0P(00@   1 @Q Y! Y {7{E{ P@e P@ 6W?X 0009 QY8`d 9X a9 pP 0S0$&R !**R Wp@ P `QP `N(W0SEP`F 0SrPU1 000P ({0 {!` 0P0 L0S E0LL)P8`9X8` WE 0 L A-@P`!XUT0p  R*P @Xp@i@ XpR XT@pW@P0D #460/\460//P@-@00 R@yP@Rp@-@`0P0RP*h0PpP R 0 R VpP 0@!O-0@ MSY@DPqap)RV`q!%:0  &^ ^ W0 * 0S  BX:X@D*0S @  P  00S 0S W0*!1R 0CX:X@D* R @` Ѝ-0UM 0,@P.0L10:V {{{ {"d 0 D      WV 44@-@-,@- RC/A 0\R#R! R/p@-`P@ TP P0F R @P  U00pT P,0, ,?0 T0Plpp@-@P P`PP  Up0 :0 T0-M Ѝp@-@ P` !LNQ !@Ap- M ЍP/D -0")2b3c1@2`M1 ЍCރ0@-@PPM {  0{ P@p`Ѝ0(0( (;0 4T   p@-0@Q r P p0 S P1 p PP   ! -U @0O-`MpDu@0D0QP095X! @0S S[ @O 01 aPn P T@@<  0  "W @TQ @0T020$  0 W` ЍQf@0 R AX0P @0   0`00R.@0QLW 00000`VBQTQCp0 0"!` b  V0 ;T@P@00~U" 0 @000} @ 0Se0T0 2a PPl"! 0#000 \ @ 0 `@P 0Q/ R  B / 0Rp@-@P*`0B @!S@ *@B@DQ@@@ S0  `f2& pS@ * A BP   Spb  PPO- -pM@ 0mN 0(l x t0`-P-+*)('&%$ nu000P0 0 00@ S 0 040P@1T00PCT!Ђ0 @t@00@ S0\ @0, EQ!0 00 tp0t00+S -S0t000C ^(0Stt00S 1C\8Q 0l0 08 000AS,d S^ ?o2<0Zg{0T@S{pp S ڐ*5 g{0[1k{{05[S,0S ,0S, %0aS*pAp|0 @0p @pw Px |0p0 pLW|0[ |0p0|0  A R@ Q HpCW= Qx pqm0p00040 S|  @00S 0@000(0 00T ,00 8S B ۟˟p?H0 0( PT0P@h Pz  T ! Rx0] @Po x   !RpP|`; PE ` R(0H0P  C0E(H PP0C PEP`PU00 S 0SPE`FK(0SEQ;q,0SV[  P2 A PP- 0S0S `  <0 pSp Pp W= 0Sp# V`@0 S0l0 x [0[` KQ 0Z00S800X00Mc000p 0#Z00S|0L0I hd `P dQy{00xS  ! x Px 0 S B\w@0 S+p 00 B0p  WL0p |000C?o82Q0S )K{8Ik{GZɋL0S    0SpЍ ?@<V? (Nd?00XS `t`0P P0 0x Qt000Sl00l0R x lЍ , RiS IS NSt@qP 0 l0000t00(S 000nS 0x tpl0P]  ^P00CtT0v @00C Q,Qt$0t000pC,0pW|0@0*W.  @P htp8000t0PY `00W'"R20{|r@HТ*:?C0C0  Jk'AQZH@ rR,zGpGp04656 0 kF @30@{  0QF @0S t00S l 1CQXt`0C00000QP|0Ct00C YLt00N0C YL\>88Z8a8[x- Pxm p00p0xt@P* t00Ct0Pt0 0t0 00000x l0s|0pC,0p|0@0pg  4k01{{{pc W'"$450{LuXX@HТ*:?C0C0  Jk'AQZH@ uR,zGpGp04656 02 kF 50@{  0J<0 0l00 0 Pz|0@00pCW p6k01{{'{PvV  OV 0I8pX00p Px  B\0S> p 0 0R0p 0P 0P00 00@b _ Pf HP^xS Px @0| 0C B@0|  xY0p0{k V0 0ƋX00000H^8pUZk書<0jSI8t Sc Njfpqa `P_{ڃ{I{7{pl0X 0l00Sp0KS0 x PxB  |00C |0  0u sqPom |0 R# 00S S S\ x^0x00 l0000 "AQ!*O 000  0c2300x S 40S 0P 0l GP"0x 0l0Q000l0{ @0l06P"0x 0t `BxPx |0p0C|0 ??A?oNG_000 l0x0 P"00 0 0000P@m!0!l0 0I8X00{00<000c<0 100Y000 S00S0 00 0tx0$Pl0x S0tpp@00x@0 |  |  W p00[o K P]px @0p0C|0 kPxQ !\ \ \ \Qxʀ0,P^8|0"S|0|2, 01H0|0@0 0&| H0 `0"k <5S,0Á!{{'l 0 G  {2P p00S800:80X0相00cX000S 0x000 P00 @0CXPX!Ђ \@\00=0=0 480< k 0  B1{{l00{0 G P E BI  4k0<   b{,{' A1k{'l00{0 pE0S! 0|H05 `fS!00pl00Vpn 0S xp0 |Q0{ ! 0 00C lp |0Vpd!0Zl0 0@ R0PPO IP0l0|0  0Cxp|0XPx> A0P00l0 .0Sg  @ 0 00lx 0SW 0px 000 0|0P0l00Z!05 l000# [00Sx 0 VZ 0l00p 3S~ 0l00 Px  p`1`f`Pp00p0!0l0@0 xSl !0l00Sy0S40040s|0p 0C|0h@-}00iG-` 0Q`ppp@PP  PP`q0s z #8 *8"80 W# G B0W   3`Ea V F A0s#8)8RᶐL0L#Y 0U 0 Q 0SPP   ! L@P@O-3ß0 M00@Sp 21``C000 0S  0S  S0SB00XS 0Q P@  QZXT#3\Q]WI:Q0 [ \ 5 0QR T0#03\0SuWa*0 GV*0F@S3 F\   K0WN 06S  ЍW*@DPD@ Q0: Q0Q l  l>P:00XS Q0p O)AoR^" 0[0 k12000 QS0T0l1 c, 0# Q:|00Q )Q  0 O-M<0 $XHX8@`p00S 0 0Pu0@0P0  DB0SG^P0D= PPb P0 Q DS ZH P 0S S SD `Pb@00@0 00Vp@ !KT 0 PeS5q0 0@00S Z 0 P\Pc R  BPPb SP0E0CSڣ0SPX 0Sa E0 0UX 0p 0 Q U P  U UE^ PLU 0CC10BgP0DSy`0 S0 S C U 0S S S KP@"00ЍRq  BPP+\~ -\  L^ ?L NZ @\ #L@NT @Pl '@Ѝ \ 0P@0Q 0S00 LS S80S $000 0 b@0zK"00@C }`P `D21 2 Q` rP  P \ PR  @V 0Sf Sg S @00ЍaF PePf x0 S_ (K@"00Ѝ@P0M@E PL `K"V`pKW  ` 21p 7 ` PEG@QP!80Sj80S 000i U U EP 80S800c8080S `}T0)  RP!@L#80ST80S P 0 0  B P\ \vj 0`e  BR "@` P3 `2 c 1P5  /A-@> RP`pn3 ^P 0 W@0 p0U0`PEPU 0 BP @` pV  0 BPp0U`890@-M@Pe a  0 B0C2S  6c@ J@{k Ѝ0@-@0AC^ 0S R@-@A0B@SA *@Q0A0C00T D B @ H0"S1 1  !2R / 3RS/0 |0|0 c Ra X0X0 c RA 4040 c R/000A-^0000PbA1 !0T2, l!p(  T2,0N10C#10R! T TNNN1^0R @-P@M: Q @ 0 R Q ~@ЍA-$a$1`pP0MS3 U10AT !0S 000ص H@T 0 0S00 0Ѝ@0!0D1S<000尵S 000娵 ܘt/H Ԍ0p@-@P0p R pPQ`00App@XD `ት80 0QApp@} Tt.H.L0  0#10/sP30s R#4#2#10 0// /A-`p@P p1,0@U00p 0Sp1P@P;pP   ! G`~P03#01S412s2sS/1J //@-@P0@0O-0Z  @ SMpPA PaU* F B  G  ^'* 0H0C X000300 ZP@T   `d` X`Z P` @T@T 06S @ЍG-0@pR$A0 QPiV'10SP`P\ 00001010i0S l1~ zPP4 @p PU `@00SaPP# 000S 0T0OPU 0C  pPph0=iV0S <02 ,0R0i `*tq*PHPp(G-P0R@T`塢ڃ0TP$ Zp  !p,F0   a!  \2)0L0C\0003R @@HpG \ -0P!1^$23\ *G-0@P@DTpD !1PD*32\ ::P @ P@a0 0S 0S Q 0@A@DpQ$A3 ! V @00S 3 #V0`F`F` 02NS @0@PpP 0!Q@3A! p@-@ AP`DD 0` P0R @ *\ l1 0DR%& 501 P%&0;Bp0R `5,#511,?C-` M[Tp>P Đ4$66U0P 0Y0 0 CII50c0 Ѝ 0P c2# R   Y C>C0C012`0S0/0 R /@-`ap`@PMA H1P4PP2 cpP,0S  Q5 p 0: S.BP 0uPP0@ 0$  0,  0( 0 0ЍF00Ѝ\PT0T TE0 C F00FO00 А4fJQp@-@P :00CS00 P:pP0 =0 Ck J$4@-@P 00CS00 @ 0  I0 CIjA-@PpS 0rSL wS aS_` E 0 \`0S! e C+Sr ^R)# `0S``0[S0\S0TS0USP`0 >0 -CXH8`p@-@P7 0S= 9 P00P! !& 0S 3/PP೼000P @ P 00 `剴00aa9d0`` 0p{7P404 480 BE 0P0gG(d@-@P 00!R !+P 0C 0 ;0 Bg\F@-@P 0 0 S @60 ;0 BfFHp@-Q@PPR 100S4 0 XV 5000S: 0#$0 3/0P:s007p00P @ P 00< R 800p*A0PឱHᙱ6P00s07l l0l J0 EB  0@000 peD 0 @00 XtDeh$-Ѝ/p@-@P@TS S S FD 0 pH0p@[,0p@c0p@e@600 0 00000/<P 0p/@-D/41Su C- Pq M  a 6/p0`@0A/`ipf APpMOĀmZ@Q 0p?PP X PP0U4PS 1P3\ X\\\@4: P3h` ZŠ   0 `$ 8gPf33  JF<, 0(@ HPQPXIK P  0p '0~ Xk PUh A/ Qp APW ` VS@ZO2  !2/@PG(P QPC aD0!B1\0 Q!NX Q5W0 pp$4q$ެPx b"0bP  @0B 0!p PpލOp?p| P? 0 Op?p?Qo?`V/ P<Ƞ*  008P4` aD7>@ 3>z?PP R o?l?@pf?pc?p0|[?@V?@ (Xax\O-(P`P10p5fS@(Pp5 Rؑ[P- (2 ,0[ D D S 1"1 Olhꂡ P ر $ J= eؑ@-@ 13/, (Q0@-@Q 8/00 2> 0 O-鴶MS `p & 0Z0 P!U E QX X R Y 88YYY  >00 Ѝ P 5%0 ؕ !Ǭ@P 0 10$!12嚫P- 0@S0 200t5V00h500`50 0X50 0P500H500@5000 S S k>00P íp Ὥ 20 2 80p *0aUP U\3UX# 2Z 00 20120QSE  000 1S 08pE8`@V*v`V`3w`0 b-P0 "  -P 1S0S1S S.0 29 20 29 20S 28 2DR3S # .  P~P s R < "4 <(P0"<S 04,8<004$`8, 48 |&4 <0&<$0%4<0 %< (0.4<0.<,0,44<0,< $(00*4 ,<0*< 40P$0SM(P`|0| |0 7`P00@ @0@  07?p\4@A 1Q=00/C-A MT' }TP# `P  E8 0 AT R0 X 0V@T Ѝ0_P 0 00 0 1 01 0/p@-P_p U@ p pF90@dA9@@@-!1 0CMM0,40@PP: T10P!,` @ PB*F{0p C{{ p@ rp#  'p U p  0 0 ,4 30CލЍt10P80 P8P@8?00 ~8~4 }TO-D@@Ɵ` TMQLpP )00 20dU}  800%5 0 L0 30iTЍ0w 0Sp1S6 ^(P䁄/  0少0 0!00 BR{?Ⱐ0张:1S ZY0 0YP 0弰ᰐo(0S !(( x0P0 (崰0U P0尡 1 0C S[*0 00 P U 20 2(  Rw R0%4*0Q0$ po 0 0008004p@000S$0<0<040 pX 0 000000,`H000S$0D0D0,0UY 'P? 0㸱0>JZ㪠*z0[* C00C 1! 0Cs0 1! 10 0 00(0 0S 1S RM  R[B  (q 2 Y 0 xpR ' 0R1 S0"1!PB ' 0 LIY㩐?*yI Z0 0aP0{ ! {0!10CS`*v00C S010{/ⰰ10 b0 .5iV700\0\ \b0 !5D0D Db0 5+ d v|vvHpvXv$Lv4O-(0p RMC @a0kP`0P P FP1uP0y1JZap@0 R 0 1S@10CS㣰L* 0Ks0S0Cs00 VqS10C1(0 0S Ѝ@ Q! R0(0 2 0p. 0  =PJ  0R1 S0C1ȁ ip P bp 02"b0 4T`^ Y 0I p1~P QPEUP*0EY!:YQTQPEUPi*u00CY Vp崑 (00(0Q1!0b K4u00CY*0 p1KPQ Y Q #&PP @ PA7PE(00 (0&0!0!0`@00 0`p崑P l %PPg 1P0CS㣠$*0J 1 P(00  m&0 b0 3(00(0(00(0 W&@0@ @b0 3s sr $sqx qq  Tq0p@-@PQQp %P 0 0,&Q %P 0 0&ppO-P,a V0Fh  1%@P `Vp0ഀ0 0 `po 10CS0*S0ST P P 1!b0 j3  H `1zp0FV㴠p1p 0 R 0 1Qp10CS㣰4*0Ks0S Cr   0Z0s00R10C1 % R bP  0! 0  P% %(0( (b0 3ol o|m$nO-Pp@Q$M p%00 2T T 500@$Ѝ(  @i @$Ѝ007ķħ0 0 `Ph  R ft@Y* P 0PbA 2@D @aT㴐: 0 bt@2Y:@I0Y0*0S0C0x  Pr 0pp 0BRs00010CS0O*SUP@0 d$pP 10CS0*SP 1 ]1@0CS0*S#P $l $fT*TP]@ 20 2$Ѝh5h%hb0 <2T $858%8b0 -2 $Y꺐Ioᩒ $.`0 @0$ OP 0 RH @`|t S9 `V j$q,Z@ t@@DXA [$q Wt 0G 1#P AᴀW@DT@:b0 13#b0 1 7$s 3$ #pPH Pd D3D#D0b 10@W1 @t@ @01p 1 0@1@p01$ y#P@ Iy 0  # g#P 0wd2d"db0 l1@Tx #T z300m ` # P_ ,p 0R X #aV@D #a0W! @0F 1#P> VR  B1r T 崠0@D1 %!0Ist0`崠1 加1 0` # "P@D 10CS㣐:0 b0 0  i# "Pm8mPjjjxjiihhhdhpgtgee@-@PM 0 0P Ѝ0 50 0e 0X0 0UXS 00; Iv0. T:+[) P0K/S  00P00: S x2000S0I Sn2?00$1$!$?0 90 QP PV# 4- dp!S20S X  \0 RK [ "P<200W ᛻p x⚻P *2@om cTR Q0P:Q0Q:1@-@-@@ᛞ $ @ -p@-@P#,`P$ p@O{ ,0@-@T M 000 @?P 0S  Ѝ([ ,| 0O-TM Pp`0H0 @8  8$(4PD 0,0`< @@pLp PP 䢟䒟䂟`p  @$ "dXb`%0# `!,l(a `& `zcna'b(*abf ` +l(ldH)c: fj.`d\l` %pଊ眉a*pl&`ah `猈b,) &`dL(bdl+`|.`lXpp<%cjgpl&`` `ga*aldH(d` &b() `b`j+g .pl\c:%pWpl̠UЍႹuppePU3 ᧜ @@P tЍf0S p#*0p 00  \0p@  Tp ?T$ .@ &( %O-PAPPEY0!Ÿ\M `T B000 0"3*S*s@? N: R\:Y#Y*W6 @s@ T0@P00W@@PZ%YQT!L1 0 T0 30J\Ѝ,!,1, ($ 0_-@ 0 0.WZ @  r.@ B 0 $ 08- T:YY p p0p l$ 0(-YYW@3 v\ uX|X0HWWWWT0O-00MpD`$ $0(0D0H0,000L0P0T0X0\0`0T!0 <  S P 6_@# ㈱CP ^荐      @PF -Z3 Z0  D 0F r P  P 00e @@ߛP0 f0`00d X (0 0 0 30Ѝ sVtVt d T 0 q0@- 04M 0P0,00W @T d 0T T H0 0 ,0 304Ѝ0$ K \ q x q0A-$!$1 0HM Q0D00@P `$ @xT( 0T  p` gV 0V  d  h X0 0 D0 30 HЍ$  $  궚 p  h pC- 0 04MP`0,00))`@ $pW:T p 0T )T H0 0 ,0 304Ѝ$  y o P n0@-,M P 0 00$00 @7T ` 0T P D0 0 $0 30,Ѝ0$  K n  n@@- 0 0,MPQ0$00` pj@ T 0T x l0 0 $0 30,ЍP P0P 0| Z+$ U f m  m|PPA-@P` Aq08c8q0P00P 0p0S   L| P&00  000 0S$1  @p  P 0  P 0 0 0mC]O-؁HXPp`}* @x08xc8@ 0 7 A@DT@O*t@ @0@0 @x@ⲁᶁ A@DT@I*t@@00 0 00 02qpGpWwp=*W 0 rP@:각H⨀Xx *X 0 0@sQ: 0 b 0* 0 b 0* 0 b 0v*h h0h b 0l*L0L LL0 c*x,KLKKKKKpKM|M$O-1,M0CPSPᰐ0(*10C 1R0 0r0 0'*0S8 @p`4 0004 00 P$ W PP0ES%"! ~01P0P0P Ws*00CV 0@p P`Uv`n* 0Pu@S0SZ 000pVwp: P$@@Tt@*1@A(0  0R 1 S0"s0&1!V 00C01ő YP0P 0Ӂ p0C00 pV@n* ⋰ppR V @Bt@Q񏐮uka401 W00:!00Sa*00CV] WPU:00 ~)01 P0P P P h01P0 P0P ^TP   r` @pv`R@Vt@@Tpt@A*0 S10s00s01,Ѝ   r   rpG P$wpD 0  0)? 0  0) 0 b 0 )l l0l  0(`@pJ[J IpEH HEG EEExGC-Mp`]@P%  XPP 0!0 000 0`r 0@@!! 0 040000 00i@PЍЍO-M@ p8)PPc 01 0 0 0ءR 0ⲡ 0 1ᰠ0CS`B*v0Z5 ء `PG  00 00 00Q㲡!0 hP/ 0 0<0 00! p)Vp@PЍ 0p!0@PD D0D b 0I(Ιp  BBO-dM`0匀pSFL0H @(804 0 qPUp XN*1$0Cs0 11 " r  0 0(0H0LPS a,ZE 0)  ) )$  00 00F 1pP% `V 0`0v`0CdS#U  HLp  : P4 0 ,dЍ0 0封10CS<*0S00000#P `V 0(p,0 000CS?1!00 0R0 0  00!0VS00 HX㨀*x戀10 0 \XP0TXP2/0  S  0 00 !0 00 0 궄HX 010<0qpGWpH*< wpp0qሀpG0wp0qqᰁpHX㨀,*0x0,0LpS\ (0S  2 0 pPB  } yaZE P 궄HX 010<0qpGpWwp*W 0 0 sP:<1  刀0C s0 11qpGWp*wpW 0 0 sW0 0,0LpS 0P  * &dЍ 0 S10C$s0 11  R00000 0H0p 0 xP 0 0 0b 4@p00s H R jcHX㨀<*x0V* C``F Y0,01`01(p@c` 000000 qpGWp{*wpp10<0@qpGWpf*wpp10<01b 0#&8P 2 0(6p00S S , 0 0Hh!h1h b 0&L!L1L b 0%wp&,!,1, b 0%!1 b 0%p00b0 $%0!l 0 q$ 0% 0 b 0% 0 b 0%yXAAܼܨ:L:`9999Ԭ9p9Ԅ9H9\$::8888O- M  @pPPd 0S9 2 @0) 봠Z( Q0? S   \`PL A`@DT@#*t@@D @i P"0 0RZ @0`10CS@;*t0V 0 Ѝ0 b0 :%0 R 0崠 @T Ѝ  0崠 0R P 00<0< <b0 % y665<5O-PpQ`,M f00 VV 06J  (0`FV񏐑ea0FS&00@,Ѝ(0VP ,0`1V 0 `1 0`1 Iⴐ0 1" @P a`FV`:趟覟&  0b  $ 0 a`FV`:v` 0b`  $1ᰑ0I`1Y婐: 0 b u$1,0`1S  1`  H@P 10CS0:5%b0 K$ @崢 @P ʕ0 00`(0r00@(0帡= ` 2@ ] 00,Ѝ0SR 0SO 0@TJ @崢 0rp@; 0S "0!0 u @P* VJ VG V(0%Y]Vi ` [V$ @P 10CS`*0FsV @崢  @긡0(0 @崢 y 4@ . @ ⴢi @`Fv洢 c(01ḡ0CS㣐z;*y0ZV> ` V ~@PIya @`FV`: 0 b# @괒 @,  1 `@P 0VSRa V0F 2"b0 \#괢 @, 1 =@P 1ᴠV0CSz`!*v0Za V0F ``f1崠አ!0 @ 1 @PU1!b0 #0Cs 0 B 0Fs=0!1 `0崠C 1x @P- 10CS`:p0p pb0 "X0X Xb0 " 4(4<π2L3/4ʐ/D.0Ɍ.@-|--Xȴ-hp@-@`PP R0 00(0`00Q(0pO-@`ൟM, 弡 pPJ 1p0C0SsP7*U/ PrU @t@ @ 0Es0P P 0%0!01@0 @ 0Z @Jt@ m0@$ 0b i"0p 0Ѝ 2 @ TQ\10CSP*u0TQ0 0@p 1P P ἐD P 0㼑 Z0  u00CR 뼑 Z 0I 1pP Q0YPEU0P:434#4b0 " " @QP@ Pr 10CS@t*0D@ 0PP` Y0㼑 Z0Y M뼑0 Z* P0I 1pP @YT 1 @Dt@ @U0PE1:1!b0 !1@Dt@U @PE!' @10  pPP 10CS@:`1`!`b0 !7 8 @' 11!b0 r!0PK{0 1 0p1pP01 FP0  p0Y!0s00 !,+x)D)(('X(''R0</ B$0A00 0P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/000/ \@-@P L  0 0@ (!0 "O-@P2M0\0(P 00$` p @ ` pP0%0g#" 0," ^0  0#0F &0eA$  "eK$  0 h10\00` pP 0 1 cIC$A$ 00#l!!00%b !b  A@YIH$*E$00@0 @000000 00 0 0 00 000 000 00ЍA-@PP $`?(p7 )!0(0 0`0$0d0N0  Sh ! 08R(@R )@ b 08  )8 b $0A-1?`@Pp @f(X4 @#!$0刁0$0 0@pG0( 0p * ?W9@`G?`@`(`0@ @T 0"< T"?pW (q "0 "?W@`G?`@``"@@< T"`R @-/ Z@-@P P Ό 0 0@ (n 0 "R @-{/ 5p@-@P X00m]\`  0 PG 0 $$p O- 6LM0^o~?,00p(@ @,@@0@ @4@ $@8@HP $D( @<@P04P@Pp `( ` `@(P@P$` .w0` y  ,`0 .) 'p',') "!p00 "`$   " p 0%/$! p   !p 0 ($~o%arp' +lc  !``&``&!p` 0,p `Y$`3,0~?000@4      ( 0! A"Ġ0̌? 0#P$Ġ_̌#,,0#, ' IG) "@P@P@!W!IYG`%KD "@@Q< ! @@8`a` A0iAqNf`&@4p0yAvN@$"#%C$-Q "P8`ˠČ ,0`P0@0#<`@0@`Q `.0@@4p0 P$ 0 /P)Π+! Œ,+N /)! B(p`@$,#,@$ &` .` ` " ` .0@,b0P PX $ X DP0 0 0 00 000 00000000000$00$0 0,0 0,0(040(084000 000 <0 0< 080LЍLDp@-@PP 0 pRPQp bo Q0P0L0@H 0D0 0p@SR Q bIp D0A-1`@Pp fPX5 $0 #$ L00L0H00H0pGPpP +WF`G```$;  S$P*$0 $UpW Pq$0 #$$0 $W`G``P` s$;  S$P*$0 $U`R @-/p@-@PP M0 E8R pp@-@P X00k]\`  0 P0 $$ptR @-P/p@-@PP 0 E(R p00@-<PM0AP@;P񏐽ndn<840PLHD@<84}yuqmi}yuq<84KJzP;DPnE@5Py|{xsrqponmlkjih{xizQPedMl]\[ZYXWVUTSRQPONMLKJIHGFEl[x5P l5P 0P9@0ĠH 0P%0H p Hߍ0?CP 0P0 !@0 ߍ00= @2S, DP੧700  r ,0Ϡ{000H {p l0 P@000H Anp DD0/0 0 !@0H Tp HP ߍ00 d0 F0 y@0Ġ 0P@0ĠS@0Ġ0 d0 a0 ^0 [ 0 0 0 0 O 0 L0 I0 F0 CE0 D0 C0 HPFL)HP >0 *G0 @0Ġ0 0 x0 u0 r0 o0 l+0 i*0 f)0 c(0 `&0 %0 Z-{ {@ U 0 O0 @0Ġ@0Ġb@0Ġh@0ĠB0 - R Hi \0$L@0 $0P P@0H Ab`0pH0<0 ,0 @0Ġw@0ĠpQ{G-P8M(p` {{M(^@U@W@V@Tn 0S?!Q 0S !Q0Sz Q 0{ 02{r"P 0 ! r R  #|:W UQ VPw  ` 0 " Q!W Up& V P`0P( U    V x! 00@` ˉ8ЍV0 `,0S0 0 V0`W Up V P0`000 P0SQ q0Sj Y @d0`0  V  ׈ l @  T p@-0@T 03/@T]PP Y00@T 03/@T\gpJH00@T 03/@T$Fp Ո ՘ \   @-@M@P Ѝ{  0{ p P000 0A0 o t l< xO-p@R M ഁУP `A80 S! 0SJ: K 0 Z 0!80S7  0Q?0 6 0 0 Ѝ 2  Z  0  00 0 P 00  }P00 2  ᬉP   ꥉP  000@-0 P R@MPQ ! 0 013/Ѝ0s?0r? <P100@-@P0U1!^ 0C B^ \ L0D0p@-0P`U1!^ 0F BS @\ `fpUpG-`P @P0Sp:ؑI Y `1`! {  PU p ` @PpP pPO-Mq0 P0 pG 0  PU @P U`1`!   8[ 0PU0  ЍЍ0A- P@ P 0 a`F  P@D p~V: } 妣P/0@ 0A0S'*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-40P$<D%LT,\ Ġ.̌8 R*0 :Ġ.̌ R*A R: B0-80P$8H%HX,X Ƞ.Ȍ8 R*0 :Ƞ.Ȍ R*A R: B0-<0P$4L%D\,T ̠.Č8 R*0 :̠.Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-#81 ,Ġ̌%T\$DL0P  R*0@ :#Ġ01̌  R* R: B0@-#81 ,ȠȌ%XX$HH0P  R*0@ :#Ƞ01Ȍ  R* R: B0@-#81 ,̠Č%\T$LD0P  R*0@ :#̠01Č  R*0@/p@-@Pp00Sp 1` 71!004 N4PU 0<  R<<T@P\`0(A@ ҇0 <01248 Q!:h0 S pp01G0(0 Q@p0S(00S0!@Q0: Z Y @c/\%c/! 0p 00S 0 Y@0 SR@T 00 R 00"00t'd7 0 2 30ߍ@2S@70< R,000 4`0`\ b,0(`04`,0(倀wP 0  p (pV:` 76(0_Wࠓࠃ604< X00So  0\ YppW` p``!XY0•2  \<Q(( Q )`p00S 0 SR@T 000S00t<@To 4Xu @ X`@n Z`D 0ST 0 QP X^Y@LZ 0S,c/Np* Y3 0 SRb@T 000S $0S  !0 0S 0@T` % S P0 SRPU 000S?00 XY@ @c/\ p <@T0 SR@T e000S00c/\@@  X `2 `0 R$SY`bp]Y``2 0p P  T0  R\ 0(0QP0 P  PY   T`X/oT" R@pP T 04S`X# @@@4VD 0 W 1DU V W(: 0 0 0 30"Ѝ-@@@~`@ T X _Y` `@ T`I`~U  00ꭽ h T (@- A0@ @ €1p@-P@Q g0P ! "0 2pp@Ap@-@P` VP#p0-P@  P 0S RP0/P *0?c0 ?oPP0/0/R00> B-ptx` PP5y  R i  ` RPJPN P?e0 ?o60⃑ i`PI 0 08P?e0 ?oP 0C!P05H RJ@+ IP?e0 ?o5H0 SP RZ 0P@ 4 0S00Y+R03<PR#4@@PPrR PP @0!32P#4@@@ P5`P_eP _oA/@-4!41 0MQ020' 0S0. /!PR*/ "RR /@ 1@Dr0Q R QQ*QQ  Rh `0 0 2 30ߍ@ 40 0 2 30ߍ@  r t  t/O-?o2P00#R00,MSPP "[ 0#!    c 0pR UU 0E`U㒦&0@ (UP (  ;/P ;/PbW0 0P``V0c   F BR R  L B@ER !R6 0T0TG SX:P 0C 0 0 0Pp0pSpU0@哥(T **p@Pc`Z* p  Wp ;/P T T  0 X0 W p0p0W:,Ѝ  `;/ 0P 0D  P@V. ;/PW W  00R0 0 R0T 0f:W  000@D`W 0XW   S W 0 0 00   R0 0 S*T PW  RW 0 P  WF  P  B B@ER !R AH;/P  ;/PM `Q0  0;/P  ;/P0F $0;/P ;/Pڅ00DP 0;/P d;/P ;/PPWAD S  ;/P`  R0 RP] 0 C 0D[PQ 0 9 "! R  B B@ER !R A"! Rw 00ST;/P?P ;/P8;/P~ $;/P$`v ;/Pa ;/P Y ;/P0 0P $;/P`X 0 R0`P@0@ @m0 %(0( (l0 ~(~-0 M0 ЍR Q0P:Q0Q:@-C- 4PS@ M  $3/`t0   PQ` x}4P4S  $3/000 Ѝ00A- 4dpV:@T@T 0P0S  00 S  0~@P0`0dp@ B ! A-`M p5@P0: St~PP ˅P@ P 0 J tdЍ00PЍ( $$4/p@-P$0r0" @`Pp$U04  0B0  0R 1 00 0 p  0% 0}@ 4` 0SL@-  00AS 0O-4MS{@Ap⇁0PS`*0S'  TP [ !P0 00 Q   0    Ѝ P@ 4   0 PQ 01 ]|$R P0)00@000dS0  pq0Vp 0  $6/Ѝ 0000O000Q 0A00/0@-S@  R   0 ~0S~p@-@PT @T 0 `pp@T喗P`p  0S S/P/ Č Ȍ$(0c03?c00 R  0 !!!0 ?oP//@-P0Sp@M:Q !SV@Ѝ0A 0` P F @Ѝ&T 0 @00O-PP X 0S & % 0S" p@p" a,0T T 1 ! 3/PS00CS@D0 T,0@pVP ?0T` BB \|  i V`!  0 0C00`@000CS0 0T` @pQQ    D R ! ,03/`PIʼ0@00 "R( Y `1`! 00PVQgRJ ,03/`PY M 00CS@D0 T@0Tp   P @0S*V* i 000P@DS*`A 0`V:|0P 00``F0 ``i D 0Y0C00 00oP  2 00C000Z` ( 000YP sd0d dG0 XH0H HH0 00_ 00[qLۄۈq$\p@-PP& 0 `V 0@0@DT`0@T`  ,03/Pʼ0@00pD0Spp@/0 V0 p,ڈ0p@-@P0 R0 PSp 0P0, @z Pzp 4tR0 q R/ S/p@-Q@PP8 100S 0  R 0   p0 0c0'   0R0 0 P @P |0 0 $0s0 ,0, ,<0 $ p hnDظ@-4aPP`p@M* W2 T: p p浖P0:*C/o" R  S L 0( 0R Ѝ ; 0 Ѝ;0t0t t0 WX0X X0 T<0< <0 0mDmר׼l׀@-p#p3 lS0lM@PP0d00B 0 C 00  $#3 0 d0 30lЍ ~0p0S, `y0P " V000`S0 rrhP0 L"L2L |0 h 0S$"$`@ )Pk 2 0FB0/Q/S-,+*)I'&%$#"! 83 )`00 5{ {4{ 00{ 0SQ pv 0W 00 ` `` `| |0| 0 g`2P  lkliLp@-@0MPx00TayV( y0T1S Ox0T1Sy0`vy 00UTX!\!R Ѝp@dx\!py00Ѝp@[x00UX\! X\!0 000S/ tp@-0 00PUp@09x00TQ;yU0` TQUP -xpX1P0X1*y0T0`X1 th0h 000S/@-@0x0X10CSX1 @ xT1Ofx0@x Ht0 000S/g t0 000S/p@-P@0wU0 \AQ\ X10CSX1 p@w`x0T1O2x0p@w t-X X0 04M 0,008 00 0 ,0 304Ѝ p@-@QP  p@$嘔 0 90 @,t`e`0O-MD@؃ [0`P@HpVV^ U0DPW p T"S 000@0`Ѝ0 00 0 0L0]@ 0S 00 000S0S Q .[ 00SV00ЍW00 Q0![00S0S @ d0d dK0 rVH0H HM0 h"00@ "00{hc{lzc{D-M{,0,0 0{ {000{0mЍ hp@-@PP` 0S&U  ppgP%0/%p0:0pl0l lC0 #T0T T0A 0S 404 4B0 blDb\HDb0p@-@PP`M& 0S/U8 0  0pp0 0pq 0 p:p0Ѝp@ 0S%0 DXt0 S 0,/00@-X,X,@0 S0 0 /00@-d հW0 S 0,/00@-lW@0 S0 0 /00@-x WL0 S 0,/00@-W@0 S0 0  /00@- ԈV0 S 0, /00@-Vp@0 S0 0 /00@- V$0 S 0, /00@-U@0 S0 0 @/00@- `U0 S 0,@/00@-sUH@0 S0 0 /00@-` T0 S 0,/00@-NT@0 S0 0  /00@-; 8Th0 S 0, /00@-)T <0 S, 0 /00@- ѤS0 S 0,/00@-S<0 S, 0 /00@-B $SL0 S 0,/00@-S @/ /H-MF 0ЍH-M 0ЍA-`@PpA8#pW 0P@-M?#O0S!/"  QO$!Q Ѝ  0S RP/0?c0 ?oP/G-P@`P pR#W  ` SRR Qa 0Bi ?o/o0CS 10c4ÀWR' /o?o BR 0b14ÀO@ϠU0P0 T R∀ᣟW0 0C W0 0U0e0?oc104/o?o0Cs! R 0b01ÀW W00b0?o0c40@b1C<àQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /| 0@-@ P  000t {T/ 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/ 0 ///Q R Q/U/Q0 R Q/00/Q- S Q P 0S0 0P 0000@-Q @% ST 0 C0 P @D^TPPU0N QP Q  00S@R S Q0 S 00 /U/ S R0Q0 /0 U0/Q@-# S% @P0C S@  PQP @ ^  0@@U0@ @-Q@ ^S QNP  S^ PU@Q @0S Q RU // Q#/   //s R RS0  0/U/00 0/SR  Q 0/0 U0/0 0/0/R  -/p@-@RP` R V  U  R 0 p0 0 MHQRp@-`P@ 0S0 0 0R0  0p 0   0MPR S 0Q00S0 0/0 0/0 // Q#/-Q S  BPQ P0C SP PU0-Q S Q P 0S 00P 0@-M | @*0000 4 ,0 0 0 30ЍF  - BMMRč `` T @P 3 P"_2   xO|p0@- @-ßs M Mp$ȍP|`@M TF "  r" @$@`p 0 "l2 0 $8 30ލ ЍB^T"P0 @p ˉ0 B^P.!0 r100A@  0 P0 \ AL+\ -L+*)B'&%$#"   \P  i\\\\\M1 pN p4 b,ITD oX n$0 %0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-40P$<D%LT,\ Ġ.̌8 R*0 :Ġ.̌ R*A R: B0-80P$8H%HX,X Ƞ.Ȍ8 R*0 :Ƞ.Ȍ R*A R: B0-<0P$4L%D\,T ̠.Č8 R*0 :̠.Č R*A0@-0M000 000@>S@P  !0#00  :P0ЍM000 @-0M000 00@>S@ "0!,03,0  P0Ѝ)00@-@ᶉ@趉0 00/ -$0$0 0M 0嫉Ѝ x -- M0 0 ЍЍ/4 40 00S 0M00Ѝ/ t@-@p@-0@ ,ppPg0PpH4////// g@//1O-0pPW`,M 0200000"00 ( 05/,Ѝ&@PK 0S PPP S0S3*0! 00S S( #S1 0 0S  0S S * Rp C 0QW001 00 S0000t0t t0 *0X0X X0 χ@|P<X@d(@<///O-DD͟ M00P0Q0S( X Z5 < 0 0 0< 00$0 0%SS  KS 0p  0GZSZXWUTSRQPMJ5~}|?>=<;:987643210/.-,+K)('&%&#" ZU  {HrW  ` P0,p` ,@     P  *  Q [: R  R0 Z ˄S0CV Z0Ԅ0˄PU*a 0 `CV`F[ 0 [04`V*U 00Gp! 00G S[      0 /Q-0s 00 R0 bp<p*WM 00G S4p00G S-p)p&P @T `v  y0P 0CV  P b0`PBvp  xp $000qf QP^`P@ 0S  0 S00CN  P ( $ [R*  RP  BR BJ0 [4 R*DO p 0 0 000plWp p`  P0`,@, p倐p@  000  0p QP`P@0 ,  q QPu @ 10d0Q00 S 0 0T0`LV0 S B PF^5 0 @U  000 0  +0p 01p. 0pS 0 0(H5 00 < 0   pQ @#0""d e< 0p i S @#%:PXa`*aA0S`<$4&"j >0dU00`0d? *000D@Du0 O 000 0L000D0@@ 0c [  04   BR B  [4 R* R [!*  [* 0Zp˅  X  000  0g0 [0K0"2 0 0 30Ѝ0 0 / D   0 1 0 P; F2 000-  @ 0 0  0 ;@9 ) s0 0 0e @00r  0@  s0 $A@ P0 00  0{0@  s0/ 0  0 0  00p0T0 0 \ɤ ??lT7 $43_2A-@P@ `t0pP@PU J0PES 8/`uX@pW$0$ $:0 } @x,18 0SS S 0R / 0R0@o/ @-&oO-((@ CM Mp4čP`r0@ k 0 @0 44 30+Cލ Ѝ 0p `0pP ,lt 0h pL+  i  0i/  NxG-0pS+ S'QU$ X!`@0`S  0P 0#4@0S 0S0S0S%  P V Q@0 R!R  "$0 R R \O-` BMMVčH1 0!Ȁ Pp `V' 0  ,bP@P Ubb0 ZP>PH <0 0 4 30BލЍꃣ  O-<< AM @ MTč1 0Y,:0`x0(SPp2 0S"W0 0@T bb0  P pW p   0aPL @0 0 4 30Aލ Ѝ0x0(S- h lO-M Mϟt p / 0 n @T 1S 6 S `1  0 ?l@X@0 0 p t @0H0 ^0S3 S90PpP@u` R PP' p 0 ] 0呃P R!R㇓ :P PpU`@P0ST `u岀0S`V@ 9 S 0S< d - L - @ T p P  Tc0 <0040v?D0\@4 0` S1S < 300S S00X01< 021帑Y[0H0tSp080400SAT <0CP D0PpPPw 0;O8@  ỢP W@U0P PP  4 <0 @4 D 0 T<0D \@0S  H0SQ 0<002p0^ S00H00SS *pt`P|@600P @9/P"8`0 @PF 0  P{ |*: 0 6 30bݍ ЍpW 4@P{D0Ppw} !3D0Pp0 e  0 : X0L vD0pd4000S70X08<0PS\0S  巽P@xU00 `F P/$P0,0 蘰 P(00E0, 兀P [0.(  QO `1  0 P90 X0L@0 Y  @00@0'$0 0 0 SO@0b0!0Tp?A9c!OP A0S =@;0P i0P(0@'   ,@0P@01 Q!  (8 0 P0`1  0 70TX0 @00 00r  1 01 0@0`1  0 $70X0 @0r0 M 00 X6cPW0&0< h X LP 00 @q @1W㲐@D0 `TPv? 0WP G  0‹2 0U 000W    ‹0v@1粐0 0 l5H@X0 0@0! P0D pc@a0P 8h0$0@$   (0d00@0"h0$0@D$D 0 AQR `1S9 0   0@ H0@@`Tiʋ |@ A`!!! Q=   30 @| X0Q 0H RC A aV *Pv|@0p t@p6/P񏐠0+S .0CS@0PPPU a0 2|@X0 r0`!02 @@Xpi S0\01S< 3`0`00S S8P16 _`0 P00 `~P101@PDy^hP p ` S~0PW`0P 0D TP Br R D0DI `~PV0d0SPQ0@L@ d06SH[F     CރH`h4L@0 `h4HPX 08^6pSX06H`s DP TP Br R D0D }P0d0@0P f0 0@! VW0 0R 0`1 g 0 @1l0XP0 s&0R  cUf0!0@! j 0 P 0 1 X@0N&0 R  >h ^H0S[=00blf0H"0l"l <6   & Gr R P T Br R D  R,#u}Pʎj 0 c0@ 0P`P 1011S1J00 0 x30 X00<0d06d000 3@X@0" &0 R  *0 3 X000m0d0@ 0P e0l$0@t$t ೃ0d0  `0 l0+S .0CSB@0P e0$0@ %  W 0|p0 (0d0wP0 @ @r0|5 @Xhe0%0% [P0 @ ue0&0& Ew/0-P@@0/M- 0  0 R1#0e(6,  Ѝ/;M-  0S R B 0S N   Ѝ/;M  0S 0 0 0CSЍ/RЍ/0@-$MP@p}P$Ѝ0 x}P͡0ıġ0"c110$Ѝ00@-$MP@P}P$Ѝ0 X}P͡0ıġ0"c110$Ѝ0MM {{2aЍ/MM {0/1A#b{ Ѝ/bMO-@ŸBM M 1Pd$č$p000 S00- 0p t P@QP0L T0l PN0 0A !< S s0 T40 ; P0 0000 ; PPA P0. [ H010$430CBލ ЍS  |[ 0S0Q( Q" Q g[      l0 2J[F[C[ @$@ F C-LLP AMM č@`p04" R3  0@`  P,8ĝ0  0 0 4 30!AލЍR PP 0@ .R` @@H oD D ˀZ꬛ t@, C~~hO-嬡 AMM  čR|pPLpPG `hPPB t @+0BP7 0S4 `  0S+ 00@ p~6P00@S 0S0S 00@ @K @ a @ D ,0 0 4 30AލЍ3 }. pO-ß CMM`,č@pPX\/@KZ0S  .S@0SV :T d1#T#*0 40 0$ 0^0R.ST00y 0 "2 0 ,4 30CލЍ0 P0 1$0l$0s $Z000$0D DR @@ 0S+ .S& 0P0=Sf 1S( S S @0TP0 000SJ0 PA0S0000   R@00S 00 0@1( P/d!"" 0Sx0h 0@$0000]0@P@Tk0!0$  00$0s}0S 0S |YV0 tO0  kY4  (O-p0Ÿ\M P@`#T V 0 |  #8 0ŌpU@ V 0 `\Ѝ 20s  0 VX0 0 0 FvXP0swpYY0SUPPR   B RX00 0 BWXP YXXX 0`C /T %0 `F 0S0 s XwX X0sX0S`P 0  P0`C /T RD0D D0 iz`H /T  | HwuvG-@0`P p)@D T@7)X0WpX뵐0`  X  @X0U0@DT0 S L* @& 4 404 00 @u(u(tttG-@P` p嶒Ẃ- F0S@`?0WV!; MX@`HX ,@FT00W0S ?T0*Gt5X0U0`FV0S ` T T0T P 0< <0< 80 `t 8ss=sPshAO-0P䡐 M0S5 @@d@t@`p S S0  ḘP&  ᲘP0 ᬘPI  क़P00^  0  SR 0  SRS ЍPd1 02d1 H}P0 }  mP  fP060 P0 `} NP  GP090\ H}000<A}i0:0  +P  $P090090| P010r   P020h  0P0Z^ d@ ?R? # ] 0 2M$ 0P0ZC @ ?R? # ] 0 (32 ˗P+ @ ×P010  ๗P010sss=srrr<r(< rDqqHqq;D;,qPxp ppxpX@-@HMLxx'x% |Ô0{ D   0  x{ 08xxHЍ @-AMT  w0000 00wЍ@@l0@- 0 A0tMT0l00  w 0P0#0 <@ 80 0 l0 30tЍ0@@( p pPϸA-@PUv 1!01n0SPpuOPp Dvp0Sp@-Q@U x3s|p m]01P g]01000p$vcwVxvP //FP //lG-P`@>V%0VQ\@ 0\!R p Âp p "p O-PH+H; 0MM050,;@00U0YT 0 0Z01'0`,4B 05@ d!A  d!. 0`11110[P  LJ0@ʏ 0(S 0(S 8 R 00sS2 S S 0T( @8 R2 S S0S 00 S S SS@@ P `0r[_AP@ 0Q.0A#A'S? 7R2 S S00$R00S 0@0 S S00 @PpP0S S 50P PPPPP00H00@06w_ 00 0I/Pe  PH1H0?:Q@ Q$10 p?  960@`@0O-d I`ݐx(ܼ@, 4$`X@DPCDӰX?p?8>?X@-@P00Q  P    $00<0 0@ ($ 8p@-l@@`VpPPp"0U1pPE1PSp ( 0$ 0pQA-pA@PT`QV0;N@P 0 P"P`p p``@ 0  0 pq~ X X 000@Ф "h@PЍ <R 2"00@ỤW 2: 2 (giP)0Z 2< 210 010010 010 0100100x100P 0 R00   0T 0 2 13/pTd0-00PP 0`2 2u00@Z@0S|X~ 2: 2p #Pw 2 @0 2D001800 8\8<, C-@`pQP M 000ES@P>b<;@8Q 2 ` 0 R0S 2 &13/PP"R0#03R0SH xP (0$( p 2P ;00 ЍP Ѝ00P Ѝ(". $X000X "R0#03(0 $X "X002S13/p ( ЍR @-@`pQP M 00U,0`V( 2S * 2 P13/PPF `P 0 p 2P 00 Ѝ  Ѝ00PO-1PSM0:00 X1*q`I`[ p@ p W &0 9 P tZ 2< 2ЍЍLP O-MXr=*`00A̱PFpP W [K DL@P' Ȃ @1@DT0 @ 0S 2< 2Ѝ1@D0 @0 Pu 0SЍЍC-"1`S M2:rWB R"*T$* RU  R00U00SR 0  PpX U"B Ѝ 2< 2 ЍFLP"! ЍG-pZ RbM'*Q* U@0U @ RD0 l P X U 2< 2Ѝ@EЍЍG-P഑p 0@F `` I`G!v` 0 !`!0 0CS @Qà>z0S0Cs 0 R 0 1P@10CS㣐3*y0 0 00CSÐy0S Cr   0U0s00R!2 B0C!2pl0l l0 T0T T0 < <0< b 0-Ĭ--Ĉ-l h-p@- @RP ` xPP  EpPp@-P`@Q 700T T  0 p0Q 2S*p(0 2S $APp$00C$0 2:0 2pAPpC-P`@Q4M 00 Vu 2+ RI 13/p) 0 "! 2$  00 3 p`0 9/P 0 9/P  ad0P 4Ѝp$ 0  rq0 gP 2: 24Ѝ?p`(0 0,9/P 0 *Yv`G V 1 !0p pGwpIT0`v`0s0抠G0Zp01`*0ಠ0`0p00xPP} Y```0S0`0F2"0y (02"0 Y0v`0``FVl*Xv`V \\\2 00 00000``FVK*Xv`> X 1 !r0XAq 0H0ppGwp `0`v`s0扐G0Yp01` *0ಐ0X0p0`0 00PP @ 00S;0`0FNЍЍ0 00 0 0 0 0 0e 00 0k 0$`t0t tb0   P p ( p  Tt 0 @ (t  H G-p`P@0R"  0S00 0ԘU@ T9 P0X BPR RQ00S0Ӳ00ô00A0 0qS CY01*s0  0000aUU800C80h0剐CY01*P0L< <0<  00 0 S ಐ<O- @T @P@D(0t@S(,W य0PPI# PP @T @(0@Dt@T `pV T`  0 P``p@-P@ 0^\ ^ P0Q Pp\ p pG-@` 0PS 0S  0Q@PS"  00S p\: 0 BS P= 0 \՗P   00(!S$! 10$1P0 P @0徐p 08p 0 S )10 B\r ᾐ᠗P  $1 0$1(!=00 O-\0`0CS0P@Lp M P A H@P& 0 0  eP 0z S0 ݷ Ѝ0 0S0VP 0 0P000@- M@ P p10 Ѝ0O-@PM 0 0P`Hpa ˒ PM P0SSD0Z0 0 @ @ 0 pWN0@r s pGW0K*0@p 0@000S p0Cps0W㲀Ḱ0>*0p00ᴀPP D0ZPPЍ0 P ǖP 0  09 0  0/0 ph h0h d 0!P P0P 0H 04f lt4}T G-Ÿw?`0 (MR$@py2S:0JS `P P崐2S p O6 IP ZP崐7 Z1! BR9:0CS㣠S*z0Y(:101@0p扐0p⨶ 20  2!0 0 $0 305(Ѝy C00C 0 pBP202 p 000 p  ` 0u,0, ,b0 aty @HA-@pPQ`M 00 2   Q `:1Q;0" B1"000 VI VFEXBAF?0PU: Q * 2 13/p1  R* 2<00?0 P  R: 2 E0 EP VP V$P "0* " Ѝ 00Ѝ0PU Q:(0 $P0PU`P<P   d>P 21 s9?@--M0  @ Wh hP 0PSP000S 3/I W@YS @8 80 $0Q/ $0S/ L<<0 0R/$ 0S/ tTXA-@T 0SZp`/XP0P@Q0@ @@!^zP 0A/P lL*k&7pO-@$M`pi@T Fpܴ4$$0Rab (  QWpV=BP b0@SFSCx 4=3 3$$ 3$ $ 3  3$$ 3$ 3($ 3$,$H `3$d `]$Ѝ $  ( ,  C # PU! Pp "P]@P< ` R]PxB `  p  BR 嗉pPG Q]($R0 U tWS UX,$R$ ^Zp4 IZp0 W$RD $pR $R !(]&@ $R $eZp P$R& U Q R  T$ ]&@ @ $F<  ` &@ T `   p Up$R UM*Zp -&Zp P  ^Zp U?@ PzuY^P&?$&0|-M&7&7p&6[ &><j.O-@`MpPh>뤳3#@ @Bp#x3B RP!GP P( Yf@(hPF  H@ Ph888|8888`xPePXP dP@ 0!C!-\\ R0C0p20pW WT R' X @啃` `Z`r`T hPP   '`Pd 0)ȱ0V!Xq``pVpP @ g% B R P00|| 0S wU X g0S X  R 7/ P  R $;$ >  t$ =  kP0S PX XP% N-M&0|_k.O-PyM`g=0pI00 00 Dp8 PEU( 0R` S 0 0 тvPePRP&GPʙ[f0@SH0@ SH\pxaP0000 0p0 00 p00pp0 0p0p 00 p0$pp(p,pS1 0Sp 0pSppT0U PE4T&  P Q86P/[  00010SU0Sppp C C0S S/R 8Up-0SCUa(0S0S 0 0 |Up ! 0: S UH/[0% rU0: S0( 0 000JPU   ᠶ0P0 0P 0)0P @/P050CS"$ `<   `00吷PP0S T弁0Sq 00   B R,\ L` V `,Q$ /0 !P@`0 !P` J/R  S/R/   C  R: | ` 9 3 0S S/R% 0 SR' T0sX0 0H!LR\0X!\R\ X00: S vh C C `T0: S P1: S ,T : S!  Sn  Sf W S_ S L0S !sYPM,0SL  YG0(尥 0Z NZ80 S80p1p!ppQ OTP!P1: S 00Z0S 80 0CS!800 -WPR X0|7S 0S !kY0S !FY-_VP&CT&0|%,W%4(.ikc9&CY n6l n?O-@Pd84;$&"Bp6f@ FZP50`UZ0S0 f `lRP 9Z4P0805H`40ZP0|%.,0@ZP7GP0< 858%H`BRP8P H0 0%43/00P08004 (Z` 1V0!ZP ,ZP 0000/0 \$0 \P0; S D0( @, "1H `86/dP0`4Ssp2`` `0Vs0 CS /1#SZP0 0, (S* Bu"!!0 Z8PH0U 03/p0S4iH0803/paP`Ȃ0 &lh 0 S * X  A0 $03/0 0 -Q0  T 4m7M[0  0 -1/ ]7P0 0 0 ,&0 &P0$ ,!$Z0 ,ؠܐPZY0   0 0&0 &  000 RZ0 0013/v ShY SAmYX`\P0Q , "PU`!0X`\PB ?TPq&0| o'S[ %8'TX'S.'T'T8   'T(O-M Mpb~9H i@p 0 Q 0  s0(0G@-P񟗙@@@@$@@X@@@@@@p@@@@@@@@@@@@0L@@d@@|0@00$0<00D00000$0100000$000,00$0;0H00L00$060(00P00 00T00080S J~PU RnR oR0P<0,㷸`P  V6P81~`P,㣸PPPPP LVSR8S;05PvPa4 1S}H @0R. PV`@0S0H0S 0  l]P P 4R㓥' FM P3mY`, 0X ,0SH 8 RS P0SPSvP4PD0S #rp0 1000C00S8 000-S30 2R(0pP EP SP _, (3U-RsP xP4 3" 3" 3" 3!00000C0cP=|t]@P4 PdR`oT$32S D#DTSQ\aPBa1S bVR3oPL2S$ 2"T] d2 0S 000S 0iP 0`PPN000!S 0  共0S 000S 㤺PeoS :Ua`0:E100S S So!0`0001d Pi P c P{r r r&@2S]`P@a)oaPW2SwZP0"lDT X?TL@pGP= 2S 80"@\'VxW&0| o&7pB-MUdx'W S^'Y|ThL'X@G.&7&6A-@MP`/P@d@P2 pttB <p=X2Q=0 q E - Pf Ri Rk R3 0!BSQg NPb0: S^"00 &{!<p10 ER!\MpS{wPePLP PPp FP sf@P,¼@H¼¼¼¼@¼¼¼¼X¼¼`hp000p0 0p0p0pp pQ |szP  "N@P0: SpGP s@'Z&0|.P MwO-M`^|O54MlrPp@` 6<pH20!1S U``$ MPju2 `[A PmP pPP }A_P pz&_@ 3` @px-d7000 00S MP"E0 0MP= 00 22[` MP/  Q & T: Lp [O0S T* `[`~Lp1 `P z&0|.-M H'O-JM MP^4@rb ;p1 PEU㥸m0 AS U  }OiP fP hP (}vP00@0@ 0E MpP0: S(! E P` !y0P 0Y/S / J>00$C`İPE@Dn0p/SP/P^0 S: p  F4}PPUP'[&0|A-`P@My] D 4 0֙ LP  K LP  K LP  K LP  KPlHh3P0`3P P$PD3( 0P+( P3( P7( P;( P?P ( PP( P P8$@Ѝ(P (PT"(0S (P(0S (P(0S (P(0S (Pq0S JP!0S0S p X建`PPa D1R`sPU 0E /R /P(QPU  00,0/00{000CSPXP0$0u00S phx0s00光꜉(&7pmP(Vu% MǕ}Iǻ'\p|'[A-@PY\2`p 9p 00S VŎP-xLP PP y``~P $L 0@MP+&0|&7&6O-`pGMP\2` `  9p 6Y.0S ЍfP WP! PP p `RP dP wvP iP0p0 `rPxPpp0p0 p$pqM 0S!R  wVGe̅PU KP$0  S0S/ 0t0@0S* /R! /00P0 .R R .R0S[   00 0Q@  0P0SP$0`S0S@ pP PX PPH0S 84Jw50C SUҜ(H0$S P P2 w00$ @1 0w0S $ ?RR00R0SV2 $ 1  <0SX  妮P +0 !!0C0 IP 0S' .0S 5S 0S 0S1JP 0 0 {X nPuH0SnЮP i0S 0Sb 0?S^ 0S%WL0S 0?S 0SS p1 d000: S0S<0S 0: SHP1 0S!  S/o" R  P SI 0SIjP P0S L0?S H0S 0S ( ҂P&0|.ҌkҬҼA-P@JZ0p` 7p 0 R1 P0C@PKpPp BHP.PW` /nP 0S 0S0PHP-0P&0|.p@-PMu 7 $ 0GcHPcH@aIUHTD GP00վCn0ٷP3 CWP 30S S! S  30I \3! d3 00L30S  R ,#6 R #!SR3% 3 2 {20S (J 2 20S 0S'002@T$A P0"@!xB00CS00 ^ 0 < @0S60016 R0S 10S< 0PR<0 01 10SO 10SK(p1\1PML10S H10S d1 X1 0S o160S 0n@1 H01뛵( 0S0F0S 00s0S 0S 00@`|P@%To(XP %( ( (( ( ( gA r )%%3(%P?(  q\G-@MP X\/2br@@0 S zX "86pC 0 L1 0oP|7x HPd|,`x HPLt,H8 GP4l,T; 0DS 00S8 @0xLn0QD0@0 0Q)@0SZ L PUZta0@S񟗷ݜ```ݤ@|LFP \Bt@@L NP 7P P 0@0 00 7@LW,Lg,0@0 00 0 fPL|PD0S hx zGPT+IP&0&0| @ tB*@th5@t@&><Q-M.K6tg[@-WEIO-M pWt}.뫽@0o0C?o`DT20<$<4@@@ 2p$4 4 00S ST [@ Y`> Z``: sRPGPP! =H@ PPPPPPPP`hP dP fPvP$@``j1 00T 00; R4 : ۭP @1A0S #S!d2 00 0 `PXL 0pL#>. ᣿ P (6p .p  Fp $s0S<0 0@0050C SR[ .Ψ@P0S? 0r$ p- ; p0 R qX  Pp P    3/P00 S *$ p- t pZh000S dHP(x%&0| -M(k.O-M MP^Jq^n^5005^5 035 ^<:p0 00圴P  嗴pP pVᅷPQ hrA@6P񟗹, thl ,8@HTd0WS }055050p 3pP P 0Xtȟ S  SSy `r050505484 P PD 7^ط  pۻ0"S qꐷ  p ǻ0"S hL  p0"S P 06qp)0z0500~00v01w 00 0s0g0e0c!%\Ɵ  R  ^%PS00 00055e46V0 oGWPE2%R U%RpUQp0%0;bP%5S 0DP80: S0550GSl$X`, U%R 2' WUz05iUr 34P$040H p`(`tPP cC\$iB%%`L'uTD00000 0BPP#2 BjCCfC{CPc`0 0S #PLpp@Y+S꿺0#S  B(D㘡 R0E?o2?  B `V4lIPP(f/L`&6 0"O-`@pP0dMԄԔԤ$`(`,`0`4` ` 0&1p0$@DTlUU!Z  *tPcPSPPPPd @"nP tP0 aP` rUdU 0[Ap0#PodU4 RU SU" QU040  :opUY [/lUT  \*  $⿤@ $ Bp0 dЍ $Ɽ $ Bpo 8⤤ 8 Bp( 8⶷ 8┤V  H⎤T@D%PP`p p `TEP 8 cBp@P`("(.!  "0`p V!  P Q !n0P0nTH 0@SxFpF'F xX8 3 P P% [PP%'`V08a8 p0PZS  ) n" G 0`||oQ-M&0|{|D~DD{(D|D}!4a. H'~&7paraydict0O-`O-222 22223220PaM$0 00//pa?  Q2nPE 0000U1dR0 U% PPL0fp L$pP  PPL0Yppd2SPGAPX0: S0d2232d2oPPS}0 =_Ppķ0S H dzPGRP 3P@/PA1@P>S@'P6lx@ P `A@P&*00I0000`Po$?p \q:wX10  Wtp* e>W DS$y>B!140(S(ppi>r037  7037Xh7 P 0@ Q S2S S 2S 2Sp 0s `i !>pD d2SM ?p W \1X! LX1\!0\'2T72P7?p#%5?p#=00OU%=pP L#=P?$(P *pU 3 Qh 3Y 3232 32lT\2S&"2QX"\2 1!8$$p(D%x%&1 SR !R QRQQS 18<4H'0  ='0\H2R0H2 1!8d CR  @  @ @ @ @ @ @  @  @ @ @< @H 000   t 0 )     Cr Rn : អPh  [ 1\ P!1S0S R) QnQoQ0 )p"pBp$0PP@1  000,"($2$"3ލ Ѝ ۬P' ֬P" ѬP  gT.@; Xp@. A!(;P9pA200 0X`V  ;p. 9`>04P)`CQښ. .a0C 2 0bg(l-M6&0|Ade6 (. 6c&7p(l 6M(l(M%5jP(lӜ 566(l(@dz(l66779O-`@ṕ̑Q (p%W㬑 0S 0S wp10`VA 㮰P `婰0S H声@`V-Z ЍyPmPPP fP 4n0@ S, 0 0000000000pAW 01CP 4P4P 8X9|-M(q9&0||9O-4$M` &:P! R9P80pD刔刴00PPPl$>(p3W00S 0S 0S 4Pp(4 a X' 0S00P  0S PY30S ЍzPOPBP4 FPo XP@*Px88888888888888@p8888888P8h88888800 :P2 4P20{00b 0 Xp>o0` 0P00e @P00^ 0 c uXPV EQ000M00J00G0 m^X1 P :e000001000-00*000&000"p 00000000P0SGnXPnW00S 0P`I%*n"XZ 7XZ(({-M(PPP&0|\ӄ (P#PJPGPMP^F%PPP9O-@MP8@I@\(qPUPE10ųɝvPlP,HP8 TP3@ ` 8p@-C  J@tq!70 S 3 < h<0@Zx (em@ PdTTTT` 4"&p(2 R Q!  R 1,0Q P,00S  0( @P@I00-SE 80@0$0 @P?Ѝ$0px1 4?$040P ?000R0Sp d```8⎗pX0S0S ~ 00 0@@`p @$@ @P Xn 03/p Tኔ :=-M~~&0| ~ Y#~妴%p@-,@,t@yr@腴(%O-@P8pM -,@G8 0f`^ p pTd6 R0 l,8 /%4PP0\80\ƽpHPPPF U18vX(G` `F0G0`0IPHPU0  %pp 5pO005S 0(0,00(00 0H-PPP%c۽PzW`WNWU 3AWF CWPHe Ip  aW,e CWe LWf aG Qk! H!0 P!0!0!0 X!0!0!0 `!0!0!0!0!0!0 x!0   !0!0!WW$ lt  $ DR -@K L J ~ dO {05xN 4Vt V ```CpM nH l$0%0 1 0 c $0@S* ocI V0 0`Pϲp 00JȲp kW {m0G S=!\\\\\ |\\\!b/b-[m㔳PH0SI0SO005S* LㄳPO0S U5S5 ( ☼pH (0S  0C#P S@P!@-p``ᢽp! eP! OP|! 0S1`!卪3/ 0▫t@ UP` PPb8@ P414!4H HR #«0 Rp- P 0 000 0S0 5pN%(%X%`{(%H%&0| %x% -M%%d *'1 i2B i iudm@-颲P tbj@儲 (`@p@-D@DYP^@(V Ugp@m(h%p@-D@DAPF@(> =Op@U(%h#8 A-|@|p `(P&,#)0`&8P@@@4,+ A/(%*L#*8G-`M4P6[PM5P0 p) P4T4@P D<5@2@P0"0 0200@X m5 H⊍p HQ "5P  @  p1a 0)0 @ p 0 @ t080<0@0D00P0 0 080$@P Q 83 HL@P@T@X@\@HPj Hf333 0400,0@@,0( 00PؕpjPPUPh0PP 0/`Ѝk +"T^7B%|ADA@T@h(O-p0`M(006外Fp0  "p6V K pV0S`v```@@0V|P 0SЍuPfPFP RPg g@P**t*t*t*t*+x*t*t*t*t, *t*t+`0P0 `0#S hP00 $$00S 4 $$00S FpP `0#S (tP $$0(0Sy  $$0(0Sl00i0P ᱥP8q 8q 8 N8` @f0KSwQ 03`3 C@QK 0cR pR= bRCJJK[[`0 0V9V 0V`, 808 0,3/8 R``W E@2Zg 2PC0 0C?oR20S^ nX[J /`+00 0$d,0$00S XV 0L $0S 0`0 00010S1 0S 0P0 0  Q00s  1000,0 028E3P8Z @0 $  ,32`0d SR @0 #  3 02  @0 R T #2Pp(00s  2pp0 @0 2Z G -M&0|(.8$Hh&><O-P@`'M Mv$P&!p6 @D 1T0 T( TZ|(WPPhf`b_AP? a@PP񟗙2\3313133333333133232242<2P5P50S $tPX (_uipPp%000PpP"P <P ,P32P.  VP)p P P( ^}p qIPq/^00 00+0 00$00 0aP @Y`P'ݍ Ѝ (P(;Z@X 9 t2 P P( !P( (}Y@Pp `Pᨣ0Pp 0(`Ȑ` qgIP 00 00$0 00 @P Y@P  Y@PY@P zY@P pxP sP nP !jpHfP Z  vP( (p}p` jP( !qI@PT XC ZPq=90p`)(0S B +ⷓ /↪Pm`` 0V@ ܍r0 00p` p( ~1P00Spp00 000$0 00 e( d1p//ᶡ0Pa0SJ+S'- 29S!S 1qW !&0|. L(-M 5 9.Py @6@dzAdep@-P@Ap@-P@Ap@-P@A"@-p@-P@Ap@-P@Ap@$p@-P@Ap@0O-nMM000`4POP 0~0 P vPG  >R~p> 0 p@7x>?a0SH>D$RT$r R  $t ~t00<4A @0<4x00<$ 0/p N <4 L!H 52`PEB@D4T񟗷;HAHAHAHAL;AHAXAHAHAHAH;;AHAHAH< d>AHAHAH>? ?D@0?AH@\AH@@00<@P} Ps \< $t  @< m 0<$$r $e \; `;$50 00 h0 | (;'0 01 00 H : 0 08 :  :$ 0 01 0  :(0 01 0  H:,0 08 P0 x :0,:@90S  P<: 000 $ @ 01 0 :0 01 0  |:0 01 P0  940 0c0 0 X v : 0 01 0 $ h888合@0S C.0 :FP[+FrؠP0@4k ѠP@e 8([(8@àPD40 t张PD40D4M T G x0P 0B ,000!0 0!8C1l7@ P00)7 000  7F:PP/P pd[0S` 0T40000PEU UZ  z0PQ 4S<4Z H$L40 .p/j?H4LP4SL$H4R0l h&)-pP TC .p @= 4S@00\S 4E~G/ᴞGLtHW00 4/᧞p5WHLt EpP ?Zk LPP;d%LPPT%TZP.p X1: S(%,4 $R ,@P%,ISP$  MP0IXZs4S04z?0$80p!x$,p = l$0MP$0 r0 4P ♟P$,03}p,p40S0X44S@0S4 x2S "20# vPr 0T40S kP 3T#0S <>T4S\ZP P3 2"pFx2ŸS L4H$Q*0Zpp0 H$L4#"1 #^pH2 C  Z0- MzpĮp  f0P 0P+ 㴢H$Lt?'"y4 S 01?0W0 Bp04$$ST RQ 0 W0  +p pWR00R104Qf ;R040 Q$ Qq*4m(&0|-M&7pU1U"&><{-%x Y# (`'Wk(5H6( Wk]Nt  %-!5O%h+Hpc{ H'LH4 Q} QQ040S[R0[ 4S$AhP 44崐S04144 0S @4S 0 ~0@4,4S $4R#1ѣ1,40 0 0Uu 6+t 2+0S p@) P+ 0d!t0>0]bL1yP=.X R04ʃ1$4Q :$4#+ 1T4S p `,d0<"tr0s+***`+\4$H1L4L1x0<$0@ 0}+ptĝP Z > KP⸝P  4Pp   T4 w o.0< H'O-0pIM M∹i4, pP_`9`4pGs04WZ h  Ya' 4S<44S$$ 4R0(\*p  h+p  4 SP,0S x 4$ tZ0 0o 4ۛ Q $<1Sf $4 $Q_*`XZUCUPDPEUOPNlQNlNlQNlNlNlNlOONlNlNlONlNlP@NlNlNlNvbPEUUPtNlNlNlPNlNlPNlNlNlQQ8NlNlNlNlQhNlNlQ6 (&p00( R0C0s0SJ p W044s04?0 00 d0 bp610 08 ,V< LT0A" 40 00 0  B0 0: ; 6 0 0: ; *0 01 0 0 0c0 h0 050 01 80 ,00!0 0!40(40S@W00; T$pH0P0<$5Wh*p 4S -)PP#\$O`P#D  8(@JP,4(0(00`V Z 00ip"#8$p = 0IP0 r0 4P P#0V3}p$p4S80S4\ 1S !10"< 0S,ڛP 3"b~11  $4 1 "ZpT2   V% vpܑ P le $$t 4r(4S 0<.?0W0  $tR $4%S 4$Y0; 4 440 W0  J(pfVpWY0:S $R4 ĔS   `(0S Z X(+  0ޙẚY0⫱㳚Y+(x-M&0|(%'1U"V5H6( Wk \ !5OG-GMM@ph ⣞ p40@D@DTQn@@5PX$W8XHXXW8W8XpW8W8XW8W8XW8X<XW8W8W8XZW8W8W8W8W8W8W8W8W8W8W8W8XYY0W8YPYpW8YYW8YW8YZZ(W8W8ZPZpW8[d304030033(t|3 3p0,@0p0H300083080(030#  3@| 2Dt 2Hl2"d20L0`x2"XX|2`"P8`2@"HH2 p0V 0 2W62 p0X01!$ 1`p0x0p0X1 a(p`P%  :`vqP0 S  0`YP  T0Sٞ0Sh`lP0 {A/JP"0 0 @x],xG@PT GލЍ ̔&0|-MLXdnzˊ˜=˨˹~6O-` -PMp L`KP'tDPhT 'P&p4o &'p$ `8P $pP$ 0{@{05S = 3# &P, C@4P`b^cccca|cc`lccc__``c`cccccccccccc^Tc^d^c^a^^cc_Lc_____``xc`Ta 09 0 P P P  Q R T 0;8;08; 00H2HpPt" P R  s{ r;RS P P R / < _ 0< 0: 0 S@0 010@;M 0@0 00 008;0T P P P R / 0P. 00~ 00{ 09x䰟 PP ` PR |ꬰ PX P R @R dmK ?A@bMR`)(H]v؍G{?zز}&0|ן׸-FX)l)$m-M)p)X 0$; 000H L 0P 0 000l ptPF  P R  $S0{{Z%PZ<;Sڡ%PS0gPW$ <nW@G8 ({*<0(+R[X= P10HJ2pGS1<+0X2 10S Xp<0H1 ,d;2S 0: 0 >00!u 028PZP ̌p ZPUpȌ 刀pp Pt , <RUp Ae?&0|P)$) h&><ٺ)P1) )־#D)pe)ڭ%%,d()x) 0@ @ |0 0PUfPh 0C Se0400000,00(00$00 0000000000 0000000 0_0p 4RC PPHM*@PWC *m8;p 00 HL0o%p- 8; 00 L0a%p 8; 00 L0S%p  8; 00 L0E%p@ 0  | x+ y+ z+d+{+ + + ; '0cy;0z;(0x;P+2(bP L0%PW;"0#10@00 0`K`QH `    ` 0$Pt3K0S PP K0$P& 0  00 3$Pd $0 )Ss``0 $P`4$$!2P(104d 0`[[[[,Q0Q4QPPPPS@d<;SʔT$>@ Uz{@ k::˟S$@ 3UVz{@ k9I:`"2RgdD' { @`30S 0 Q' @MHIN2 X0弅 #pU00 F@+@0W0 00D(PT2 ppW O P $2!$PG`AQKY$Ppjc1{{7 (H{CAZAGF@8HINT{({*X"@T7 0S3 <'0xpT0T00p0p+t"P 0S ͌#t;<000[ Y0 0 |#  (d2"SS% 0 " @$?6C-A~8@@)()x)&7ـ)P)pڊ)X &7p)%< `I1 @S! 2R`2p0Cs0WPP0dR?L!L0 0 d20   O  `0/0h0lp0h{{7{{{3{{ {  M@ X9: #Rpp: h2Y0@ph2pdb |U#<0 00H 02 0BSA (SI; C 0;'W@pCp 0h 0S h≘Y #,2嶐! 0I0Css0S 0I s0r ' 0 1帑;    0; ' 0@0 0! W |"<00 H 0@0*p0V 0 0D0$1 J 0 vP<0[NW lD0 00R ZW |"<00 H 0@0  0 I0D tV'ppl0ZpK'D0 G')%)(;۶fۑ)P&7) HZ!=Z{ܘ0CSrHsdsuutt4t\tttuu8u\uu0 cP Q9rrrrrss sss$s,s4s<sDsLsT'&k0ߋp@0ntplhd`\XTPLH0 PO (0 PF Qssss&&0 P' &0 P| &0 PX 0 P Q Q }{0 P {0 P 0 P 0 P 0 Px 0 PX 0 P 40 P 3& 0< [80Sg AS S W |p!<00 H 0@0p&H ܽ2IYj݃ݝݯ_&Htޏާ4>Nbt߉ߜ߮)߶)(ʃSIZ0KWI7P%DDD0J0ZD0  I)0K9+ 0KF  QJY0KWD03 +Y KtP WD0 %D0J C 4 ḛ ◖W\%pDDD0I0YD0 0J#1 K#+ ~% pWv%qO-M`PI@0L-S@vP. @,4 t p+40SP a`F0pP[PKPijQNpGK PN  5MBP@ \3pC d0@SzzzzzzzzzzzzzzzzzzzzzzzL@20SK@HGG 0А 0p] ZY *\LZ'E`PeP`0b 2 R  0 S  U+ 0 !0!00 X852/, )p4 ,p0Sh}X`c}` pu0SfkPz0pp@@> 0_L Vp<}`* /&0| /.&8EWP]y{j (O-PAM M@`N|P pHPh70dW00-S% @&P  PL@ p0K0\Z c`F0S0`@DDA@Dv  p .6p0StbLpPx63 Q \1 幏P -00 `@Z-00  D0B5S񟗊}}}}}}}}x}}}H}}}}}}}}}}}}}}}}(}8H}}}h}}}}HH}H a00S ~KP}yK0 0wꨄg4P rK00i00fd400b d4 ^0S LWK V 44 R00O $P H  300S P60$010(0.0,0+t0C?o 2R0S0$0P㨔`㥔P㠔Dv04+"*@DT 3a00@`FrS; RS iS/ tS xSf'뜒+" 0p 0A00@00S   0\@T.0S m<55< 80R0B(0/S q(0S 0 @-J@0S (0S p|1 0h0PS 4LA(0S (0 @1p#P+e 0 P@TZ}I*&0|-M*X%8,Uc}:&7pb8%D<@?&7 M[N(?;O-PLM)@pPph/ p\?,#@DRQ0I 4@@0SRJvP cP SP- TP0(3 LP [d0@S(@Ldp|0D003030800H00 30$30,3 Y*H  ]y !P**Z      xG-`XMP3*P PP061 (VUcsp0+Spp*h6 000Fa<0 0/0P& ! &T00 s000p :XP00G00X<p @P|X4 00 B00C2#S0d0P0 00 B00C2#d v>C 0C0 0@0 B "00P 0P0A1#10C0 0P0A00C1# 0 0P0A00C1#0  00 B00C2#0pq04y 0Q0TPP)D됈JZp3V |t`(os`F P% 0SU030#:U 5%Pg P p2' XsT&P6K/r043TvPS0 0 S/# G@Tu SPEq X: PJu"E0<6SR46SR 0&2RRPp2 01\1u#6S  P0W0`W 0 Q 7 u 0K/r0 ,6S m/+`P 90PQ!Vt<6S:46S: d1Q0@6D&S|1 0 00Rl!  H&`R\! $&RP! 8&RD! 0&@R4! 0!Q   @6 Ӎ @͍@|0P}*&0| -M-`LLl*@* *&><ps&6] (&$.F*Hf[[oA-Pp`IHM %p10PEU* ; HP h0@ S S(0d8PHHIIl1zd1T1 P1 `q 4C6P p 1!qMPP DC L<$@@p3@(@ @] NP P 0S PxV FP XC0 0000 &0|-M%(6 (*.Q ty tC!,0G-`HMp0 ',S,C, p3C1 `FS 1S 0$ ] !RSX V0S042" \xP`PAP MP2 f a0@S8HXhp 00 04044041! 00101@30@3101101101101@3S40S0V0S 0S04P+PTlPjBV ДY 000 0uHЍP PPp  KB0S  0 `PFPV qh V j`F0*-M&0|%0&7x>j*.C-Mp` PPF! VF pSPU 6 `V V 60S aP& tP8t6 R l&   p@6U@0V`F V"@T P  PPV 0S A@D EP`Vj j ftP9@PA@3P񟗹0DXl$zP0S<0S{00\0Su00Sp00Sk00Sf00Sa 000@00=00:00SQ@0000.00+0 03N $0S=<0S800S3@3T.P0$0:(U 0S# 0S 0S`V Q PF A0S 0S 0S`V UUpP `P \PPEUPh4 U3 UUU  U4 @U U0`0 0 Z UQa;PK0000 0 EP  " _$0S   %ppq[*`@}T Q 0 s#&  @ #4l$P @rP mP`X!G!*&0|-Mm! b!N&7p!k .  "%!!!!!G-@PpMaM p10S QġPE R ލЍRP fP74p*P` @WOJUP1 J`P/0: S2  S)J P0 JN@n` 04S00`Q^މ0S p J PJ @PJ0 @$*&0|.$:$D$ C-PGMM U0M#= <8=8X@8DX嶁Pp=0D80l8"=`{C0D `XdXhXpXtXXXXXXXPXXHhLhPhThXh\hxxx8叁PP   uP:?D 0e?^L  zP< <t@P |P @0P XP变0Pl Sh׈0 lP4:T{ |P :h(s\P 9T(X(i8 e,ÃP 9h(g40GDS4(8D0t`Xh hx$h(8t 8(VS h8X(T(N T8,J8 *8P 00S= 8 C>8, ,, ,0 7,, 7H((\$8p\7, | 7L(w+s P:?@ 0 D7P(74w\pP78x7 7<( 6T( X(L7 6P 00S 70  6t(6 x6P 00S 6 6@p cs68p\p0⤖80 )P 0SL6t pW 8+p(SM+ 5,0 0l5L(5c\` L5`(d( 85uX$5P հ@ y5?Q4&MGލЍx5| p,c0D\<<0P 0S .\ B6Py@PxdD8SQ\@4 [P r r_t LXCt LPt LI|t LB L\<X$TLP6L$HLD0 8L4* (L$Dd,XDPD@P=P:P7P 0S0SA  <@288S2@P R<S P 0S [ [H2 uN @+cr P: B?\ 081<Skf+r P*Oㆆ0:+wP 0YP ;@P(|O pOMT@PHO@ O0@`,rwPP0@P`Yp@+r0(@0@000,`40U0 (P<P8t\,8U0C?o20SP ,R  \0,0S ([,8S= *m,8S P+ C CCC}IC1SD)D.D8 A/Dz&6&7EX&0|E T DDqD-M%D+'k&7pDDe5jDD-MEE)E?gA H'EE00000EN*EB~YE0E0   TEE+, D EG-P` {$EthtŅP035fp2S l P;UڱizPH t各9PB/PE0@ *  ZpX40pEWQU <4 000`P L,6qPE0S#3 4# 33P XgP ;vP303 `pd \0X}PP304mDj4S 4SZjP  [;J^ P 4SqRHjPl l ^ PnR!z,1`<01 1> 11/΅01<2F01$1Fi (㨄#2Rip`d Pa Q1s0S k_`qЁБhp00o V B/o" R @jpP  \ki=`S 0 0000 l j1s0S*v`#RS S=?o20 S S li1s0S 0 S ` S S Shijx+>XX-XTXA&0|&><X`+X fVSVb&7X%<%HXX++ >X X.&>4PO#@-@``PP 1 q pt10SAPX1PH qD1C@uP 0pP 1 nPbP9P0P 00@0c0@ S VP    h0  X0  H0 T TT oyq0SG+|_2&0|BA%p &7p^A-`<1_&0|]!1%%%-MFNU-J@th,Mv&7ptgO-@Pp`LM @ p1 UV Pp  6gP uP GP000`0S@0T PUP   p  !6P0P 0S U6 p U S p T p V 0 p|6PU T TxPL@@H 05 -M&0|.5j M;Ev7L0O-@TT%0P5M@H5`@@5b 85p@],5b/U@T0 %5%U5%500[xP]F P P PkmPC DP3 fP5 CP6 tx*pP7 rP p41=<(m P00: S0S00/#p`P' pEuP 00SW p 3 3 CfC@00ꌣ匃匳pmW  pp=B`P \s\Y]Y0@ H9_4P( #sP RsZ @=:pJNm @p(@PWP,1@40(V,@q@P 0 @A00z,2"v 2rPG1QW kshO= 1 Ѝ`(T5(40S6 4P(pUr@P 0x 0U0 0 0 00 pP ,p(r40S(ktr`j,,,0,,,(!h,~,T,,,, A/&7p - ~ ,L, ' s-M,vE-D,T T ,bG,,P,N M O-pKM0 `3 > >I >^-M = =j = = > > >. >$X >~ >p0O-PM`P 00@wxP qxP\ 2ߍ*. |a6`?@P1X?/01012211B "L122RpKpDpN&KpἮX10 .0>p1F0[\18\1`0  F1|!1hQda_0  @PwX1j >0[ >+00. \18\1=0YSpVPMP 6PR ?PI 4Pp㤍N@P񟗯08000P\hfP j@PP񟗞00T00000000,=0P1`<%`F@pԌ}X1F3X1Kw0000q0X1lH f@fppcph`0 P ⳫP X1P M0#P\ F0[ 0  O@P 0 P ⏫땳 -84'0 x00\1 1pxx  '1S ᳫP 6   g :0P X1@ @ Lp  p ˛( X \10 QP819:X!p*\1 d pDT 宛먙P)(< $\11Z uPPY* 9Y) 9+ 0)t X1 ⩗P{ P 偛S U{ 0 09zpHx  W 0S L B PQ {0S(  \!X10X1808"/0  ⟌\!2sP8"/0 瑌2\!s"/ ⇌p= \1`  ⓌP%D\!X1 0X1 00 8>p 137  ␎zPtwht 00 7ޖp2{0S $\1pGW${0ST{0S {0 S \1X!8 0X!'zsp {0S &|弚fpz0S &H寚 P q  奚w孚t~㟎\1 I S0qpT9 ^p5 P <X1A>X10L1 00 6Lkpwlxs0L1 00 5LZp(gOp ^p P X10X1Q|W)#dX1 @0X1H pP  <^\1 X40  ;p` \!X1 $  $$ 43 p   ⃍Kp 00 4p@ |!R\14\11  ⹛P+p0v! P0!  R!00|!R00SRX1g ✎\1 0㌃匓 Q01X:  \1  |1PU3\1X!( ; W A? =, a X1R@T 0S 0 @嶖@ 0S   0S ẌMPpP P ( RW  R   001冖0 S   0ęPUQR%X1@0@k帗볙`\kX1$  C C C !,M G G G& $ Co Cn!-l&0|P H AI-M A/ AA AY G G!,q J ?@ H' H H)cD M!,x2 H8 HN H HH H Hj J H H H H I  I I) I> Id I{ I5< ?! I I I I C C C I I; J JV Jp J+ J J0*$ J&7  Q/0p@-x@0Ppp@ P T0%4p@ 0 0$010bxxa/O-1!bM0 Mb  [ !1 b0 0 30Zbݍ Ѝ  0 "m !l\ $w`  $; 0 0 +Hp0Gp( 80G( G(cp` x8_S0؀00 00 P00 @G0 sP x8##[`@*sP0 l8 40GPbU P0 l8n!{zGzG0ƒ S"*0@- R P@ 0\ R^D00"@ 400 0^ 00"@0/ylyTy@@-M @Ѝh  0S/ -PM00 0 p 0 S 0 0 ЍP /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b~*/{*/x*/u*/cr*/2o*/l*/i*/9f*/c*/`*/8]*/Z*/W*/T*/Q*/ N*/K*/H*/0E*/QB*/?*/)<*/{9*/|6*/#3*/)0*/=-*/**/'*/"$*/!*/*/*/*/////^*/ */ */<*/*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/ 6|*/*/ */|*/y*/v*/Ks*/+/jn*/Ok*/hh*/ie*/vb*/_*/ \*/Y*/V*/S*/P*/M*/!J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*Q/"*/*/*/6*/*///*//7 */>*/ 4T*/@-@\v@*/*/*/*/ps_strings missing %juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeara.m.pmp.m.dstmnnoonmiddayiqvwututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!csp != &blank/usr/src/lib/libcurses/refresh.cunknownbel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangeacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error unknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat1.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)array/.plistXXXXXXctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&ctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON\u%04Xversion="1.0"!((*cp) == '\0')ctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: unknown standard formatCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %u%s: can't write sector %u180320360640720123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Checksum error %o, inode %ju file %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctlatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20241129NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %shttp://parse_url: invoked with NULL argument!ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular fileusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDtiso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadtildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 10.99.14 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.99.14 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.99.14 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.99.14 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.99.14 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-10.99.14 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.99.14 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog10.99.14xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv6hfeb/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv6hfeb/10.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failed executing: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.c/tmp/entr.%06xrndctl -S /tmp/entropy-file %s dd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/certctl rehash/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICbase32dtbgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd %s cd to %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu ntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorparts->geo_sec != 0t != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interface%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.2--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.2 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.2 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid IP address: %sinvalid CIDR: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6vsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLnrt != NULLchangingaddingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIASepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressnot ACK or OFFERdeclined duplicate addressignoring offer ofignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/etc/group/etc/master.passwd: (malloc) Error in munmap(): JPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSHTVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d CL}$P Y8 ((1ͬΐ   @XX),L %  % :=&)  078 %848T8\ :8|888 L UVK\Xxx%}$}ָ]@-x>6\ z R/> >.ĜAĜGĜ}ƄNƄj4SXҨ # _ I* pushdnepopdne`I@@4 #0x@@$dq c@ P@@_n@@$unblock and -DNO_CONV?< X100 0prtstatUsage: %s [-] [-ESsx] [-p string] [name] abcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLinkU a wՉՓ՟լ&՟լ&EZ$>T#^ ^_p^pFp<p>օ?֘֫PATH=  ^t f d sc! m l(/r  Hp7n? v Gb    EOF reading here (<<) document] 48<AFJNRW\`elsz ##݋(.ؘ aLݹݫ}-+?= @ @_`kbehabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'(0(D1$(01*(84(0B(0q(0x(0(p0t[_[ zqJ WCHOs_s`L :y #< j k\ &1 !m i`x                  R M ļp HoP003xX(8;0` L+m"Jm%w+/(5p $_0_X= $xE4 H40ܿKhLVpP-X1uW  ! Y0^}ezDk 5Ws2\d jn PFsy } $  # e TV: <@K>R; 1(>=p>V? Z>dw<k;t==>#3#3233#& @@.QYha &@-4Y:AH C$CC$C$@@  @ }|w~ @z@`@@@@@@@@@@ @@@@@lr 8&08?FL X@_@disyYȁn΁Ձ݁CThx2a0=l VpQ`pw1~-4:aAF+N1US\g lptQ~X`fkry$-8=DIPY^flra0=l VpQ`pw1~-4:aAF+N1US\g lptQ~a0=l VpQ`pw1~-4:aAF+N1US\g lptQ~5'''''((-(T ( ( ( ) )6)F)]()r)))***,*B*Z*v *!#$*&12*345*68*9*9*:*;+<+/=+G@+VA+jB+C+D+E,F,$G,$H,$J,:L,WM,hN,oO,P,Q,R,S,T,U,V,W-\-a-8c-Bd-}e-f-g-h-i-p-qstu-vw-x-..*.T.s......//3/K/h//////0020B0^0x0~000000t0011"111D1O1Y1q1131111122*2L2L2L2e23222233#3>3Z3b33333444_44 =644?4455)5L5_5r5~55[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]  %  %w1~-4:aAF+N1US\g lptQ~returning to single-user after filesystem check readDosDirSectionreturning to single-user after filesystem check returning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblock         @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_read ?1O%@qTp%QY% r\ %@@w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-qyyyyyzzz:zDHzs֚% 0%@w~=}}}}~~$~2  (w1~-4:aAF+N1US\g lptQ~=,% @5'''''((-(T ( ( ( ) )6)F)]()r)))***,*B*Z*v *!#$*&12*345*68*9*9*:*;+<+/=+G@+VA+jB+C+D+E,F,$G,$H,$J,:L,WM,hN,oO,P,Q,R,S,T,U,V,W-\-a-8c-Bd-}e-f-g-h-i-p-qstu-vw-x-..*.T.s......//3/K/h//////0020B0^0x0~000000t0011"111D1O1Y1q1131111122*2L2L2L2e23222233#3>3Z3b33333444_44 =644?4455)5L5_5r5~55V%$@<t%(@D%0@%4@%8/%D%H@`l%THFS0eC1OUFS0eCt!haHdInotNeedEFI*s(ҺK>; )bQn|n֏- q+Qn|n֏- q+ Qn|n֏- q+$-Qn|n֏- q+>IQn|n֏- q+W=Gry=iG}[fM;t?q|WmCĄ 3KOOyD¢<#*=(РD3h& \M}-ޔM@jy֬-ıܹчHl-ܹчH%IZܹчH %?I􍂱ܹчH RI􍪱ܹчHw]I2ܹчH1~xLǠ6 %?a'S@ۿ )Ѹ1*@ە )Ѹ1ۏx )Ѹ"%`@%hbackupstore_gptstore_tbl%%l@in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercapsm{setifflagssetifprefixlensetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandsetifmetricsetifmtusetifnetmaskusagestatusaS @printallmaindo_setifpreferencedo_setifcapsQiz%(riymmm%%okmm% Yx% \6%%8'%`%T%%D]%g%n%f%m% @ 0@%.3 Ra8 CI O@S @init_current_mediasetmediamodesetmediaoptsetmediasetmediainstG(3 TaS( T  T`:B@:B( T3media_statusmedia_constructor % %  %L %h %F F%paddr_match P PxdP<PsettunnelD%J%print_link_addressessetvlansetvlanif8%o=%no"XPsetifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchansethidessidsetapbridgesetiffragsetifrts@%8?/%G% FG0%%?h *%%PL%R%TQ/`% V1% V1? *% M%7%ph>jj==%Аinvalid major numberinvalid minor numbertoo many fields for formatffs@ \ Ah  @      )?Pr @@  %   %# m'+W        +H@ bnorripbgensbextattbnojolietbnocasetransbrrcaseins        @  +Ho@ @         @  +H @o Ah@\       @        @  +H@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirror       o +H@"GLF TV \@eltz `M 1@ >C#-7 B@bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacrecvrpcrpc_getportrpc_callsendrecv +H       @2j*]z ?f:a%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS  -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinit@BCFI3L=NJOSvȧb̗c̢e̶fhik'm5nFoUrdsuu͆@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:k@@u@h yp}p ӁpӅp Z `Ӊӎ @ ӓ $1м|^t0 Non-system disk Press any key to reboot _q|qxqtcqpqlqhhqdq`q\DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY . A Z      : Z z    ( H r UPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefFPFP*0 XXX,,x<<bitmask_print -:@lO|]xu`$ 2>Q]>j| 6T\TTT %|6U`glbitmask_scanZ AKRW^hw.disknamesfetch_url@@AsendrequestrecvrequestPGNGRGVGZG^Gb***************************************************************************************************************************************************************************************************************************************NetBSD gzip 20240203  " $#!%Z^\`[_]alI lM : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataPj\ H,x , P, P,L  ,  *, ; C, ` k,, , , P, P, P,R , ,~ ,` P,  %,4  ,  &, 2,  ?, P ,, Y ,,+ g o,*  ,+  ,) P,G P,F  ,T  ,,S P,R  ,T  ,Q P,o &P,ncollect $      w1~-4:aAF+N1US\g lptQ~NAME=  # mount_disks>    "#$%      "#$%&'()*+. str_arg_substget_available_cdsw1~-4:aAF+N1US\g lptQ~ edit_fs_type_ext b(  K4 K KH ^ _ m m1L K`d Kt Kedit_and_check_label w1~-4:aAF+N1US\g lptQ~disklabel_freedisklabel_set_part_infodisklabel_write_to_diskhiy $ 0  l 4   ̴ | T X H Lj ` H 4 xdisklabel_change_geom!\!!0!'outer_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_default,,,L,,pm_from_pepm_whole_diskgpt_freegpt_create_new!$h8(|\XL ̴0T<d %1~ )b )b [lw W! :qyzyz:H w1~, :q :v :{ % :~ :+ : l :]NQ# m'+ : :Wgpt_get_part_devicegpt_get_part_alignmentDetails for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - HFS0eC1OUFS0eCt!haHdInotNeedEFI*s(ҺK>; )bQn|n֏- q+Qn|n֏- q+ Qn|n֏- q+$-Qn|n֏- q+>IQn|n֏- q+W=Gry=iG}[fM;t?q|WmCĄ 3KOOyD¢<#*=(РD3h& \M}-ޔM@jy֬-ıܹчHl-ܹчH%IZܹчH %?I􍂱ܹчH RI􍪱ܹчHw]I2ܹчH1~xLǠ6 %?a'S@ۿ )Ѹ1*@ە )Ѹ1ۏx )Ѹ0 < < <0.s <gA <.k2 < = = =% =3mbr_get_generic_part_typembr_init_default_alignmentsmbr_create_new!!)H!)<ٔTpDHۘǤǔ,T˼ Ȍp ̴ ltȄLΔ mbr_get_part_devicembr_read_from_diskwrite_mbrmbr_write_to_diskinside_ext_partadjust_ext_partmbr_add_partmbr_free***************************************************************************************************************************************************************************************************************************************PGNGRGVGZG^Gbcontrol_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_reportssiddhcpcd_readdump2m,,dhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2025 Roy Marplesmain duid_geteloop_event_addeloop_event_deleteeloop_q_timeout_addeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_option AbYcadnre Lf Rg Mch Miaj k Rl Yxm Rno Rpq7pr Rs RYt Nu R Rmv Rw Hx Rzy RA RB RC KD RE SF S G SH NIJ S K S'L3M S0N S6O S?P SLQ3S !T STU S^V ShW SrX S|Z ?1 S4 S6E S R|~ S} S S S S S S S S S S T T  T T T   Pe T* T3 Y PI T; TC TM TZ Td Tu Ts T| Tz T T Uz T T T T T Q T R T T T T U Udefault_configread_configrt_compare_proto$$rt_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrt\\rt_buildrt_deleteddsa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_initڀ Ye H Yl Yv Y- M+ Yscript_buftoenv Tu S)} T| Y]make_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_os [ [ [ [ [ [if_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @DCHDdhcp_openbpfget_leasedhcp_initread_leaselog_dhcp eZ ee eqO edhcp_bound e c e e [g c< e ^ edhcp_informdhcp_start1dhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifapXpXplplpHpHUVJqfg]UVNI%DE@<=85340.,*('c%$#P"#! BrBbFCV{SJ\B i+` i1 i7 o4 i=T i_tNN iC ih iIBBBBB@@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ iX&>D i\!H!P ie!L!P i+` i1 i7 o i= i_NN iC @ ih iI"`"\"X i+8` i1\ i7 o i= i_NN@ iCh ih iI !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: -o %s: option not supported sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU makech #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef5MS7) %p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZHXo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;plpn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X `%KC00`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      !1Aa  0@`@@ #+3;CScsM inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  氒j%b}Dg׻jD~pd'MG T-06/{Z1i*lևM_zN7.N^NrB0* ,<C˦ǐ<Ԅ[S's4K| O݄aY,2Qh$A3}Q>R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9, ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5k   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_cstringprop_string_create_nocopyprop_string_create_formatprop_string_append_cstring_prop_object_externalize_append_char_prop_object_externalize_append_encoded_cstring_prop_object_externalize_empty_tag_prop_object_externalize_end_tag_prop_object_externalize_start_tag _prop_object_internalize_find_tag_prop_object_internalize_decode_stringprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_number_externalize_prop_number_alloc_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dict_keysym_put_prop_dict_keysym_allocprop_dictionary_set_prop_dictionary_iterator_reset_locked_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equals_prop_dictionary_internalize_continue_prop_dictionary_remove_prop_data_externalizeABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_equals_prop_data_internalize_decodeprop_data_data_prop_data_internalizetruefalse_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_remove_prop_stack_push_prop_stack_pop_tcsetpgrp_tcgetpgrp_tcflush_tcdrain_cfsetspeed_cfsetospeed_cfsetispeed_cfmakeraw_cfgetospeed_cfgetispeedstrmode_unsetenv_int_strtouq_l_int__strtoull_l_int__strtou_l__strsuftollxpermute_args_getopt_longgetopt_internalunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s_getoptatolatofmemstream_seeksetbuffersetlinebufsetbufmkdtempfwidefsetposfpurgefgetposfgetc_regerror__icheckhost__gethostlooprshrcmdrresvport_af_addrrresvportresrcmdorcmd_afrcmd_af__ivaliduser_sairuserok_saruseroklink_addr0123456789abcdef_ether_ntoa_ether_aton_ether_line %x:%x:%x:%x:%x:%x %256s _ether_ntohost_ether_hostton_MD5End0123456789abcdef_MD5File_MD5Data_SHA1End0123456789abcdef_SHA1Data_SHA1Transform_SHA1Init_SHA1Update_SHA1Final_RMD160End0123456789abcdef_RMD160Data_uname_ttyname_r_timesaddcmd_getmodecompress_mode_sethostname_popenpopenve_pclose_initgroupskMGTPEBKMGTPEKMGTPEBkMGTPEhumanize_numbermatchcompareg_Ctocg_lstatglobextendglob3g_opendirglob2g_statglob0globtildeglobexp1globexp2_glob_globfreeskip_getttyent_getttynam_getpassfd_getmntinfo: _getfsspec_getfsfilefnmatchxgettype_getdiskbynamecreatTLS allocation failed, terminating ;Zx0Nm<[y1OnSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec_tcsetattrwcscmp_stresep_setenv_vdprintf_lsetvbuf_regfree_inet_networkunvisAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~fts_pallocfts_sortfts_statfts_allocfts_build_fts_openfts_maxarglen_fts_close_fts_read_fts_set_fts_children_closedirkhwcschr_strcoll_l_int__strtoumax_l_opendir_initdir_alphasortinsertionsort_mergesort_rsetup_seekdir_unlocked_getdomainname @_strncasecmp_initstate_setstate?getenv_getenv_r__freeenvvar__canoverwriteenvvarauthunix_destroyauthunix_marshalmarshal_new_authauthunix_validate_authunix_create_xdr_authunix_parms_xdr_array_xdr_rejected_reply_xdr_opaque_auth_xdr_accepted_reply_xdr_des_block_xdr_replymsg_xdr_callhdr_seterr_replyacceptedrejected_strtok_rip6_parsenumeric_filenostr2numberget_portget_canonnameres_queryNres_querydomainNget_aigetanswergethostby*.getanswer: asked for "%s", got "%s"res_searchN_freeaddrinfo_getaddrinfoaddrconfigip6_str2scopeid)&_yphostent_gethtent_getservbyname_r_MD5Init_MD5Update_MD5Final @_vasprintf_l_getifaddrs"_freeifaddrsNBCDB atoi d'B@;__dn_count_labelscharstraddname0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuv__ns_sprintrrf__ns_skiprr__b64_ntopABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/__b64_pton_inet_nsap_addr_inet_nsap_ntoa__ns_format_ttl54<Ҳ؉9I#ը32D=%[όh(doC_posix1e_acl_entry_compare_acl_differs_acl_brand_as_sl_add_sl_find5_strsep_int_strtoul_l_int__strtoll_lfgetsrewindmap_v4v6_addressmap_v4v6_hostentgethostbyname_internalgetanswergethostby*.getanswer: asked for "%s", got "%s"_dns_gethtbyname_dns_gethtbyaddr_yp_hostent_yp_gethtbyaddr_yp_gethtbynamegethostbyname_rgethostbyaddr_rinet_pton40123456789abcdef0123456789ABCDEF_inet_ptoninet_pton6inet_ntop4_inet_ntopinet_ntop6_fseekoisescaped_fparseln__fgetstr_xdr_int_xdr_u_int_xdr_long_xdr_u_long_xdr_int32_t_xdr_u_int32_t_xdr_short_xdr_u_short_xdr_int16_t_xdr_u_int16_t_xdr_char_xdr_u_char_xdr_bool_xdr_enum_xdr_opaque_xdr_bytes_xdr_netobj_xdr_union_xdr_string_xdr_wrapstring_xdr_int64_t_xdr_u_int64_t_xdr_hyper_xdr_u_hyper_xdr_longlong_t_xdr_u_longlong_t__dn_skipname0123456789__ns_name_ntop  __ns_name_ntol__ns_name_unpack2dn_find__ns_name_pack_int_strtol_l_vsprintf_l__getdelim_nsdbtaddsrc_nsdbtdump_nsdbtput_nsdispatch%02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04dmn-00Etc/UTC _strcasecmpbsearch__cxa_atexit_internal__cxa_atexit_vsnprintf_lfreadfopenferror__swbuf__sprint0123456789abcdef0123456789ABCDEF__vfprintf_unlocked_l__sbprintfexponentQ_strndup_strdup_gethostname !#&(*-/14}?@$@Y@@@È@jA.AcAׄAeB_ B7HvBmB0@BּC k&4CAy7Cv4WؠCmgNCX`=Dx@DKPDMՒ<Ҳ؉9I#ը32D=%[ό (doCCAy7FnM8O?ZwH02uOs<_fdopengetcgetc_unlocked__sflagsfclose__srgetlflush__srefillhash_seq__bt_openNEXTINDEX__get_bufnewbufNEXTINDEXNEXTINDEX_mkstemp__gettemp0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzVcrypto_prng_bufQcrypto_onetimestreamuޝ3r(Ѿ唵V dj٧IY:Jp,.*ap+ѿ#K`_arc4random_addrandombt_rrootNEXTINDEXbt_psplit__bt_splitNEXTINDEXNEXTINDEXj ggQR1m'ȿY էGcQ))g' .!8M,mS8 e sTvj .r,表fKKplQђ֙$5jp7l'HwL49 NتJ[Oh.otxcoxPlqx6|0pY9 1hXdOj ggʧ;l٫Ak[~!yB/("q7D#e͵M;/ۥۼ9V[H8Y?O^mB[Epo$1N䲌U }r]t{oޱ;%5ti&iJG8O%Ƌյ$ we-,oY+uJtn\ܽAvڃS>QRf߫1m-2'Ș!?YǾ =էG %cQo))g np' F/.!8\&&M,mZ*S8 e sTcvj &aц!}}Onxgro c}ŢȘ? q 5G(w#}2ʫ{@$< ɾCgĜ LLԾ>BY)e~*_o:lDJGX˻]b)*6|YZ0p/Y9g3&g 1JhX . dGHO_getpagesizeqsort_r__sfvwrite__sflush__swsetup__swhatbuf__smakebuf_tcgetattr_int__strtoi_l__sread__swrite__sseek__sclose_int__strtoimax_lCisalnumisalnum_lisalphaisalpha_lisblankisblank_liscntrliscntrl_lisdigitisdigit_lisgraphisgraph_lislowerislower_lisprintisprint_lispunctispunct_lisspaceisspace_lisupperisupper_lisxdigitisxdigit_ltouppertoupper_ltolowertolower_lc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB _citrus_NONE_stdenc_mbtowc_citrus_NONE_stdenc_mbtocsdl_iterate_phdr_setup0123456789ABCDEF0123456789abcdef_vsnprintf_ss_fwalk__res_nmkquery__res_nopt__res_nopt_rdata/&_hf_gethtbyname2_hf_gethtbyname_hf_gethtbyaddr_nsaddsrctomap ]:[=                       DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::clearerr__rec_dleafNEXTINDEXNEXTINDEXputpair__delpair__get_page__add_ovflpagesqueeze_key__free_ovflpageugly_split__split_page__big_insert__big_delete__big_splitNEXTINDEXP$%,%%  ,4N@'`{dH<PX\ d DP`\dh px  W                       ( <E x9h {0 X , h[ '  L X7    h  L   7  \N|   3 l` 0r       <j( x  $ (, 0B ,4,8 h<h@ DH LP TX X\X` Xd X l t x |     L  .  W|   \             $ ( 0, 040< 0ht|       ,4<DHT   $,0!~4!9! !!h!@U     `L `L!X!!!!H0stng5X4nmbr2(1 0|01dictEKPxSD$CCDD [dkeySxJB!0!4a  datab4`,bhboolmLmmT!!!!araysdywqq$T|`a ,,,,- --8-D-\-h------ -. ..( .D.P .hM4 .t......//(/4`L/L;X;\;d;l;t;|;;;;;;:;:T4;;;;:\:h:t:::::::::::::::4;;;;T;;(;8;D;T???????$?(?,?4?8?@?D?L?T?X?`?h?p?x???????<???????????????@@@@@ @(@0@8@@@H@P@X@`@h@p@x@@@>@@@@@@@@A AA A4ADAPA\AhAAAAAAAABB,BDB\BpBBBBBBCCC,C@CTChC|CCCCCCDDD0DDDXDlDDDDDDDE E !לXؐ88@<lؐ8@\!|!l!!1NhP\PdPPPQQQ4QXQQQQRR$ONh1Nh1Nh1PL.`PT,PX)PLPT^^^__ ___]YtWWWXX X$X@XHXXX\XpXtX|X XX X XX XX XXPYYYY,Y0Y8Y<YPYXYlYpY|Y.YYYYXYWY[YYYYZ ZZ$Z(Z4Z8ZXZ\ ZZ!ZZ"ZZ#ZZ$Z%[^(&][ '[([0)[L[P*[T[T+[X[\,[p[x-[[.[[/[[0[[1[[2\\3\\7\0\4c\L\P\h\p\x\\\\\\\\\]]#Z]4$]L%[]\&]h]l'[(U(]|])[L]]]]]S`_(_,_4_8]_@TPVVVVVVVWW WW$W,W8WLWTWdWl WW WW `L`LWWWWWW]]^^ ^ ^$^4^8^^D^P^T^l^p^^^^^^PLPTPXPXPLPLj$j$PLcs_pathrXs< bc_base_maxs bc_dim_maxs bc_scale_maxs bc_string_maxt coll_weights_maxtL expr_nest_max t line_maxu,  re_dup_maxut  posix2_version u  posix2_c_bindv(  posix2_c_devv  posix2_char_termv posix2_fort_devw< posix2_fort_runw posix2_localedefw posix2_sw_devw posix2_upexD stream_maxx tzname_maxx atexit_maxy(%C"4"4"4"4"4"4"4!D%%%D%,{4{8{<{@{D{H{L{P{X{`{h{t{{{{{{{{{{{{{{{{{{{{{{|| || \|,|0<8<|H `L`L`L`L`L`L`L`L`L|T|\|dQ||||||} }$}<}P}d}x}}}}}}}~~4~D~T~h~~~~~~AD,Pp$Dd|8H`8\p,Dh|,DXl 4D\podod k,_A0 PL3DPT,\PX7@PL3PT-PX5"4"4"4 `L`L`L`L`L`L`L`L`L{ &>0v" @%g-E-D&/-D-Mc`-݀eb&>&7-h&;,&<-9%g\-D0-M&7-D&0od@_-Dz:\h-4[`&;-X(&1 -x"`-0- -X Ȍ--D-D-l!-9u,&>4%g&/-D-DH-D&0|-D<-M-%-M-&;&/-9 --Dy-n-E&2`j-9&;x&><-D-D-D&=,&1--Dd-ݸ&>0-9"T-J-D" &8]t%s`kP\&>Y!&9x-D-Dx&6-D|%-yA-M&>8Y&>˜%4&S 'UHhP%h.~ ƒbŽj$jQc f–h¢k±lmooppàpqr +Hut"vX5w*w7x' x >.zGz?BC5JPOZPiSpTmV V{XÊZÈZÓÚéð   X(s,u$s ,wss,tT({L{<|s {D<ss,FD  ð5/dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbin( }-+?=###%%%}(x(|a EVeFIX5i$Ll1m9C nCfJPpWb^ufozq[ sh"vVVx(@=%%d ˜7p #r 3ut ^'r yw _[r %rD r( cq q ,P\ PPXP 7vP'0IPZ0'%'x X7i ... ...I[ [%pp3qrrP{{EP4drnS ׄD<4 ޘ% H%AabCdhlNsuvW:w:z%%%%% %4% o%P #   # G T> %  # p2 %% u%% %<%$ %d%4  (% 4B % -% (% %< p% %%`%4 %<(%X %<(% %%%%%%%%% %x%%%`%`%%4%%% % (%' %'' % %<(% g%g (z% %' '% ' %  < \6% \6  Yx% Yx  0%D % $% |% %  % J % %< % 8 x% "Xo%o !v% = % % / %0 )@%@ 'R%R &7% 7 &h M% M ?h% *  ? V1% * V1 0G% G X% %tBKHHJLH@IHH.yG ):GIHI&H,H1I6H X7i  '@@        @ +H@...... ...... lost+foundAd.##.׊ ?1  Aok     '  ڀ   " P(1 \61 :!A"H# Uz$Q%U&\'_(/)h*3+q,u-y/11234{556%<&7p # cjpw}. (prog_root)` Z%0x'&_[+ʘ00000*~Y00 U@  w0  `  7T Z  6! E%  50 _p  bm  K0  i|  ]4  _) ba JLok  Ml  Pd0  _) E0 f0 f0 f\ H _p0  u\0  Cx R  6   . H'  @PE I $ Flw(  d1  ^@  51 L}  qH1 p$1 Y\  Pd1 kt1  N  R1$  @x  Y*$  R1a  Pd1)  uF  6|1.  nN  qH16  9'  @x1;  91A  o*  Pd1G  c1L  bt@  .1  qH1S d1[  Pd  Pd1`  Pdà J$_ H~Y HX5  `17  7T1  X _p1f  \\Y* i` T r1l  @P'  @(1q  vt1y  O1  1  j41  ^  Z1  o1  f;  7T1 G t 1  \t  m// r  D  7 1  f׊  k(&  6L1 i` FD  4Te  ]` t1  d  W" G/6 r7  d@$!W f0H 1N | { ~<<cQLQS!ں @<QX T>Qv VptQ UpQ W|Q G$Q LxCQ N +Q N cR A.R% BR% BR3 R\RN R\sRg P?Rt j#R Rw(+ްEYFPVc1alsVhV+޴ !"$'(+-.03569:WuWiWx % :+t+++x+++|++D+p+X+T+P+L+H+ltip.record  /etc/phonesYY&d$Y/+Y2$Y><YCaYK+YPaYY+|ja+~Y^a+ToYidYM+` a+dYsa+~YWi Yz}Y %saY+HVa+hYY?"YQ%hgAYsR0aWx+p TYdY+@YdY+<Yd' +8Y ZVYYak+lY/bin/sh_BPbUb[bfb[bab[b Zb Zbbbbbbbbbbbbbccbcbcbc#bc.c9c@cKcQcYcccncubc|bcbcbcbcbcbcbcbcbcc0xccccdcd dd"d-d2td;dHdOd\d;dcdj Zdwb[+$dbdcdc9dcKecYe+cneIceke|eded-eeetff+dOf?d;fWdjfx0xfcf%b%,%Ѥ %z  * . ` d f o404?sz _###)#*######%%&&&H&S&&&&&&&&&&&&&&&&&&&&&&&&&&''' ' '('('L'L'N'N'S'U'W'W''''''+++P+P+U+U....////0000>0A00011/11111122 2G2PMN`|ף0RTfhk`oooop"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp|  ( ( ) )oK_pp0J#%')-Y[  : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----0*0-00ooprt} %&,,&-GQ).1256CCLL||װ /vz       8 : ? ?   $ 'FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB4@4@4G4Ujjk0k6oOoOoooo-0Fgi{тхыѪѭBD6;luuڄڄڛڟڡگ!#$&*06DJ%%%%%%%@%""%%@%@%@ e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ    l h b  w  i x X       0  $  k  j [<lVl\lale is a directory is not a regular file (use -f to see it)%x%x (o$ooooo"o>a oooo;p ~27p p p p-#p:2pG8pY pcps p(pp!pp9ppw(p&#fp)pp5qeq :qs%qq'6q04p%q< qJ+qX,qj-qy.q*qq?ںqEq/q/q'qFn}q oHokS Yo+o9 o>#foE>owoOo @ oW of oro|WmkRkRkYcWbkCkc kG ky wb YMYrWca%,#yyzb%@,#h z7zWB%,#lzvzc%,#zzzd%,#{{3%A,#{I{eD%( {ze%,#{{{f%,#`{{F%,#| |3g%,"|W|v|h%,#|||i%,#t ,}}/}Gj% }o}}J%!,#8}}k%H %H K%x,#0}}L%p,#4~~!m%h,#~9~F~Tn%`",#p~`~w~o%X X~O%P ~p%HH P%@ $1q%0,#~~r%(",#d&G}s% !,#S%!,#Tt% TT% u%,#$NjV% 8w%",#@x%(  X%A,#L"Gy%,#xe|z%,#\"% ,~%!,#D?% #% /%A,#H;K%,#(a%,#,%,#$%( M%,#a%x,# %p,# %h,# =^%`$,# Dy%X$,# %P,#%H!,"$%@!," .J%8!,"`%0( %(!,"% ,"%,"?a% %,"%,#%," /% S%!,#Pi%,"%,"#L%,"c%,".:CRfFoIx֚ $06BJXdlw(v|on}{%8~Y^&2>KWdr~o(Dzgf,$ (press RETURN)!!!?%8%8%Dtags643{}abcdDgGhHilnNpPqrs tw xy !:#=,C,Cp-e^H-i^C-k^UK&& [l & m$ &P& L<P& opP & Ll(&L Lt|&, L & &L PXPF & X f\PF& X h & &&PF&L PP i,PF& Y iPF&| X jPF&, XL j &" & &|PF &K PD cPF &LM P8 e # &; && qP2$&, VP2$& P2$%P %\P %P %P %P %<Z%Yb%tPF%|i k,PF%e gPF%i P, k o p p,t k P P P U \@t m pP pt Q t _d mc _f mg _[ mh] mt\ m^ m O) Oq OrG O % P P O< OP Od Ox O O O O(s N{ N N O _ m< mH mXV VP pQ V R _XSW Ud U V VN WO WP VQ W R WHST UpU _$w N Nx N< m= m> m? m,7 NDO N`X N| Q Q\ Q0 ^ \ o o, NR l RL R( R Q ^l ]( Q X$ MS N  M M M7 MlO MX M l l@ lf l  l R R R R l ST S4 S n n oL l St n n nj llk l| S n< n` l` M4 % MP  l4 lD lT M$ l l( S S o o o m l T T T Tp TL T ^ ] S W m l Y| Y` YD Y ZP Z4 Z Z Y Y Y L M M Lt L Z Z Z Zh k k LP L\% [T& [<' [$( [  [ [ X [ [$ [p \0 \ \ [ [ Ah J  K$  KL  Kt  K  K  K  Lp  H)1DL5U)9mK`cf~ Qn{zD7`z>5*  ;IPhxi1\~oC>r%9Zi%C 6K*6HTzvÌY/jŮmTjɇ:e-˪MRv̵̚%3BQ_u~͓ͥͯͻ #1H_q΋Χν`ϞϼKѽ%Ӡ97ճ*Bau֑֯3?L^oׁבלײ!<q{"X؅z؏؜ؠإة 4I]Cjyَ٣ٲ}"/8G\"htڈڏڪڵ۽ߎ[ R A#D',6BK` 7LuAY*A;a9O_U@CI| 5bs1~%)3K &.Abvb $t %0LQY =6]nyBl5I*zrw3%)3?rGDoxZ <c~-CNo??9]RY>yf_ T?9bz q"DTjs$19CHR[l #)0;BIR\m}#z4>Sdv؅    $ 3 G S ] b g y bz4   $ 8 P a i t        O   , = K V c o t        & K  4         , g   6 H X     ! ' * . 2   w / p t %:\ % %  & % % 4[ & & &w0 & & &! && &,10 &4&S' &;( &D) &K*a+ &P, &X.1/ftp )9@ 8: %7 % % @@ " % % % % 4 D5= " > D6? tP |@ A B ,S C  D  E  F  G  H 4PX $P ڴ p  1t 1d t 1k 1y 1 1 1 1 1 1 1 1 1 2 2\L[8\[:  J [q| MPPPPPPPPPC i i i i i i [g$B i iH i ? چ  i i i i  i i0?+ i i j j c< j  j jjb jb j j j#lt j'c j+! j<" jK# jW$ jc% jp& jz' j( j) j* j+ j, j- j- j. j._/ kz/01 j2 j3 j4 j56 j7 k8 k9 k: k ; k< k$= k0> kB? kP@ k^[[\ kr\ k] k^ k^ k_ k_ k` k{ k{ k| l} l }v~ l! -dd-ddTdd:dd:dd  p  |@ @ `   #####$$$$$%%%\%% && &('4'@'H(T(`(h)t))***+++,,,,--- -. .,.4/@/L/T6`;p;|00011<<==>>?2223(343<9H7T8d:x44455  ! " # $ % & ' ( )( *4 .@ +L ,X -` /l 0| 1 2 3 4 5 6 7 8 9 : ; < = >( ?4@ @@!L@"X@#d@$p@%|@&@'@)@*@+`&`'@,@-@. @/ @0 `( 0@1 <@2 L@3 \`) l@4 x@5 @6 @7 @8 @9 @: `* @; @< @= @> (@? 8`  H`! X`+ h`, x`" `# `- `$ `. `/ `% C C D D E E ,F 4F @c Hc Td Xd dee h# p# |& & 0                  ( 4 @ L \ h l       |  @@R8   @@ @@ @(@4`<`HLT\dl t@x 33333333`L`L+++, ,$33339l9p9t9x9|:LUTC33%wP%xPnoh\iPnhnDh33-339gt>QNPaPkqj,jH6T7YqϑI 7RǤq)>Oq9NNL(Kɲ@KCS[kA&1&1&1&2 %yX 33UU33UU33UU&6<\&2&7<\&3 &7p<\&5X&7&6-s_ _H_P_X_`^:d:p _h  _l_p_|x   @ 333333333333333333333333333333333333 33 33&;t "4"4 0000000000000000 -33333333ѐ33&<&<&< (root)`33%C"4"4"4"4"4"4"4!D%%%D%,%<"X"\"`"d&>$˔DʤL ɨ ,08t<ŤŴ@D|ˬ˘<8Service unavailableP<A0aeabi&6KZ  "DTV7xܫO\QLG):1$5`0ʚ ġ++4AB`*T}ji~ds8<.x޴3W*_KHmvK[RcђsœvYc.7\Y[J]giC#un17-{w57v]=Y%=3ss u;szSgnؔ܎ϸ|q>_ˆ_ʰ>k2}'^&3_^^xrVӏM'y=w㠹OPzq=m\O#3\/F/<2_i"2Gܵ:/FWUr>fr>ԩWNJ? EQ 1 Dso 747d ̼qpvp-M}qy!p[\+HU h8gl{x 6 j;#!r]x:F|f1ɠɇ&ndDJPj,r!, Ur>vU+0.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf / BH)P%g\!7\V%g\!7\$b%g!7g%g!7&Tt%!],y%!`&>"&>" -"p"1"$~"MSGTXTS626 5024 5049 5066 5088 5091 5096 5104 5111 5119 5127 5130 5133 5136 5140 5152 5161 5174 5203 5218 5762 5796 6479 6767 7475 7531 7605 7701 7748 7771 7794 7800 7809 7831 7835 7839 7842 7845 7950 8153 8392 8833 9271 9306 9321 9333 9339 9351 9370 9390 9430 9447 9464 9479 9526 9564 9612 9694 9818 9954 9995 10033 10070 10105 10115 10164 10314 10320 10325 10329 10349 10459 10479 10485 10499 10511 10522 10559 10593 10617 10719 10756 10778 10877 10932 10990 11001 11017 11069 11237 11444 11615 11679 11731 12003 12553 13082 13514 13852 14185 14298 14313 14322 14482 14653 14803 14967 14990 15014 15029 15104 15244 15421 15576 15588 15668 15769 15815 15841 15911 15922 15931 15944 15970 15985 16001 16014 16069 16080 16095 16299 16532 16561 16576 16645 16719 16792 16822 16860 16914 17368 17394 17423 17527 17633 17818 17930 18045 18149 18836 19095 19235 19271 19441 19482 19618 19641 19678 19723 19974 20070 20124 20223 20234 20271 20308 20335 20344 20378 20385 20410 20437 20472 20486 20500 20529 20543 20560 20569 20591 20609 20626 20637 20656 20682 20700 20723 20740 20755 20770 20788 20815 20842 20864 20903 20921 20953 21181 21255 21298 21344 21491 21647 21691 21970 21997 22356 22540 22692 22873 23020 23178 23199 23247 23257 23265 23276 23287 23297 23304 23319 23331 23369 23399 23438 23491 23549 23570 23577 23596 23617 23624 23647 23669 23689 23711 23742 23779 23801 23815 23861 23890 23924 23964 23999 24027 24075 24084 24093 24098 24107 24116 24133 24137 24142 24146 24184 24193 24220 24240 24263 24282 24309 24331 24363 24379 24384 24394 24417 24439 24456 24473 24486 24495 24504 24510 24537 24544 24568 24589 24613 24626 24645 24670 24693 24709 24715 24727 24757 24765 24805 24816 24827 24838 24855 24872 24886 24903 25119 25423 25871 26087 26351 26623 26675 26711 26747 26798 26815 26853 26867 26874 26891 26894 26899 26908 26920 26931 26940 26961 27003 27019 27035 27066 27083 27098 27113 27128 27149 27169 27210 27239 27287 27520 27555 27762 27781 27818 27879 27917 27956 28112 28127 28173 28200 28223 28259 28269 28279 28290 28295 28358 28406 28450 28511 28544 28591 28609 28748 28770 28893 28907 28917 28940 29045 29101 29217 29248 29253 29279 29318 29328 29371 29381 29397 29412 29430 29453 29483 29504 29530 29727 29770 29774 29780 29786 29791 29802 29816 29845 29877 29889 29936 29986 30026 30053 30069 30078 30121 30127 30135 30139 30159 30176 30188 30219 30475 30524 31100 31127 31159 31187 31239 31245 31251 31256 31277 31293 31315 31344 31485 31619 31632 31768 31770 31772 31774 31791 31804 31822 31849 31853 31859 31864 31872 31878 31918 31920 31930 31945 31962 31996 32028 32066 32095 32124 32146 32189 32215 32259 32395 32397 32477 32523 32571 32676 32778 32817 32884 32891 32952 33016 33020 33027 33149 33218 33506 33644 33785 33866 33913 33919 33942 33988 33991 34017 34060 34125 34187 34257 34325 34418 34637 34662 34666 34702 34720 34748 34790 34834 34898 34948 35024 35046 35098 35142 35181 35215 35245 35276 35301 35310 35322 35330 35341 35353 35372 35396 35445 35462 35486 35529 35851 35854 35868 35881 35893 35900 35911 35918 35925 35934 35944 35961 35977 36027 36035 36043 36053 36064 36082 36099 36120 36142 36151 36161 36188 36194 36204 36223 36239 36257 36277 36286 36297 36304 36321 36340 36361 36371 36388 36394 36410 36425 36440 36461 36483 36502 36512 36517 36522 36540 36559 36578 36584 36603 36623 36643 36661 36666 36672 36689 36705 36726 36739 36747 36767 36791 36808 36816 36827 36848 36854 36866 36888 36902 36911 36932 36950 36959 36993 37016 37043 37075 37098 37118 37129 37161 37177 37188 37201 37224 37246 37754 37784 37815 37843 37857 38058 38280 38447 38534 38551 38569 38586 38615 38662 38673 38692 38714 38793 38985 39013 39131 39153 39294 39313 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-10.99.14. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-10.99.14 ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-10.99.14 ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-10.99.14 ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-10.99.14 ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Die Installation wird abgebrochen. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-10.99.14 InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-10.99.14 ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPNFSCD-ROM / DVD / Medium mit AbbilddateiDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzDas Verzeichnis, in das die alten a.out-Bibliotheken gesichert werden sollten, konnte nicht erstellt werden. Bitte starten Sie die Aktualisierung erneut und stellen Sie sicher, dass alle Dateisysteme gemountet sind.Eins der Verzeichnisse /emul/aout oder /emul war ein symbolischer Link, der auf ein nicht-gemountetes Dateisystem verwies. Der Link wurde mit einer '.old' Erweiterung versehen. Sobald Ihr aktualisiertes System gestartet ist, mssen Sie das neu erstellte /emul/aout mit dem alten Verzeichnis abgleichen. Sendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd aktivierenntpd aktivierenntpdate beim Starten ausfhrenmdnsd aktivierenxdm aktivierencgd aktivierenlvm aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte PartitionierungPartitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen?Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden? Wenn Sie von einer Diskette gebootet haben, knnen Sie diese jetzt entfernen. Kann den Bootblock des Filecores nicht lesen Kann die RISCiX Partitionstabelle nicht lesen Keine NetBSD Partition in der RISCiX Partitionstabelle gefunden - erstellen eines Labels nicht mglich. Keine NetBSD Partition gefunden (eine Nur-Filecore Platte?) - erstellen eines Labels nicht mglich. Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm rmdir sh stty sync . .. dhcpcd.confgroup master.passwd netconfig protocolsservicesMSGTXTS626 5024 5062 5079 5094 5097 5100 5105 5113 5121 5129 5132 5135 5144 5156 5168 5177 5186 5212 5223 5759 5786 6352 6652 7293 7340 7453 7546 7580 7599 7617 7625 7634 7659 7663 7667 7670 7673 7795 7980 8208 8728 9079 9108 9121 9134 9139 9159 9178 9199 9258 9275 9289 9311 9356 9382 9423 9501 9619 9733 9787 9816 9848 9887 9893 9926 10049 10056 10060 10068 10092 10174 10180 10187 10199 10213 10222 10255 10274 10286 10396 10458 10477 10596 10647 10699 10711 10730 10782 10986 11194 11385 11445 11494 11761 12220 12886 13309 13631 14056 14188 14220 14232 14410 14607 14768 14902 14922 14955 14969 15038 15151 15323 15458 15478 15590 15682 15705 15728 15787 15802 15823 15838 15859 15879 15904 15918 15942 15954 15972 16182 16432 16453 16469 16522 16590 16663 16700 16726 16802 17297 17323 17345 17452 17559 17760 17833 17917 18017 18512 18750 18901 18935 19070 19114 19253 19294 19339 19386 19630 19763 19825 19919 19924 19958 19992 20007 20035 20068 20075 20100 20118 20144 20151 20166 20181 20201 20241 20258 20278 20299 20321 20336 20356 20378 20393 20406 20420 20432 20444 20458 20481 20504 20522 20565 20616 20653 20838 20901 20937 20986 21077 21207 21260 21520 21567 21928 22078 22247 22387 22507 22639 22679 22726 22736 22744 22754 22762 22773 22784 22798 22823 22865 22898 22931 22966 23020 23045 23064 23086 23091 23097 23127 23144 23171 23189 23210 23232 23251 23261 23291 23317 23344 23393 23421 23448 23501 23511 23521 23527 23537 23546 23566 23570 23575 23579 23614 23623 23654 23671 23698 23719 23739 23758 23784 23797 23805 23821 23852 23883 23904 23930 23943 23951 23962 23968 23992 24002 24014 24032 24043 24063 24079 24105 24127 24143 24155 24175 24201 24207 24237 24251 24265 24288 24307 24326 24344 24362 24585 24891 25309 25510 25750 25934 26012 26067 26134 26174 26197 26231 26242 26250 26273 26276 26279 26285 26296 26308 26321 26351 26395 26408 26421 26458 26472 26483 26494 26505 26522 26533 26580 26603 26652 26893 26926 27181 27202 27235 27288 27314 27341 27497 27503 27546 27566 27585 27614 27621 27628 27635 27640 27689 27727 27761 27818 27846 27891 27908 28009 28014 28091 28105 28115 28139 28262 28343 28453 28481 28486 28502 28531 28539 28580 28587 28601 28614 28622 28641 28674 28694 28714 28930 28961 28966 28973 28980 28984 28998 29010 29025 29058 29071 29126 29184 29220 29238 29256 29274 29311 29317 29325 29329 29350 29367 29378 29400 29578 29622 30324 30348 30382 30401 30446 30453 30460 30464 30488 30499 30504 30567 30688 30811 30824 30958 30960 30962 30964 30974 30983 30996 31023 31027 31033 31038 31047 31052 31079 31081 31094 31106 31121 31149 31193 31240 31256 31278 31289 31322 31342 31391 31491 31493 31558 31607 31656 31760 31858 31899 31990 31997 32058 32122 32127 32133 32242 32301 32552 32693 32820 32888 32925 32932 32959 33005 33008 33029 33074 33125 33184 33253 33300 33405 33548 33573 33577 33611 33628 33652 33704 33755 33827 33893 33991 34008 34039 34075 34109 34133 34157 34190 34210 34220 34228 34236 34246 34257 34271 34297 34345 34368 34388 34429 34728 34731 34745 34757 34764 34783 34797 34804 34811 34820 34830 34847 34863 34911 34919 34927 34937 34948 34966 34983 35002 35022 35029 35046 35063 35070 35083 35118 35135 35154 35174 35184 35200 35213 35231 35251 35272 35282 35302 35322 35335 35354 35367 35391 35414 35427 35438 35443 35450 35468 35487 35506 35514 35533 35553 35578 35596 35603 35610 35623 35632 35653 35666 35674 35694 35722 35739 35745 35756 35787 35795 35808 35830 35852 35861 35882 35900 35907 35930 35949 35976 35994 36014 36027 36042 36063 36077 36084 36098 36113 36132 36677 36710 36738 36767 36775 36812 37124 37301 37378 37395 37413 37428 37450 37500 37510 37527 37549 37608 37766 37790 37920 37945 38071 38089 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-10.99.14. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-10.99.14 ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-10.99.14 ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-10.99.14 completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-10.99.14. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. La instalacin ha sido interrumpida. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-10.99.14Salir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-10.99.14Ejecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si ha iniciado desde disquette, ahora debera retirar el disco. No se puede leer el bloque de arranque filecore No se puede leer la tabla de particiones RISCiX No se ha encontrado ninguna particin NetBSD en la tabla de particiones RISCiX - No se puede etiquetar No se ha encontrado ninguna particion NetBSD (disco solo de filecore?) - No se puede etiquetar Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): NcleoThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Set up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS626 5024 5060 5077 5092 5096 5100 5105 5116 5122 5128 5131 5134 5137 5141 5153 5165 5175 5205 5217 5647 5674 6250 6610 7295 7356 7434 7529 7569 7591 7609 7615 7624 7650 7654 7658 7661 7664 7786 7971 8199 8728 9146 9175 9188 9201 9208 9228 9247 9270 9313 9333 9352 9375 9419 9448 9489 9555 9667 9781 9835 9864 9896 9935 9941 9974 10052 10058 10062 10067 10108 10245 10255 10263 10282 10296 10305 10337 10378 10391 10516 10574 10593 10712 10768 10820 10831 10847 10886 11136 11308 11480 11535 11570 11820 12224 12523 12791 13152 13332 13651 13671 13684 13873 14017 14213 14347 14367 14400 14419 14520 14675 14863 15050 15070 15149 15247 15285 15308 15398 15419 15442 15461 15485 15515 15559 15592 15615 15627 15645 15913 16232 16263 16298 16362 16437 16507 16538 16568 16660 17151 17181 17198 17338 17479 17676 17795 17942 18109 18667 18963 19144 19189 19352 19406 19541 19577 19637 19687 19978 20087 20144 20241 20246 20281 20316 20331 20355 20388 20393 20418 20434 20457 20464 20481 20496 20515 20547 20551 20571 20589 20601 20614 20632 20656 20674 20693 20720 20747 20759 20780 20810 20840 20865 20898 20933 20971 21224 21293 21348 21409 21527 21686 21740 22001 22052 22428 22583 22727 22867 22975 23160 23190 23233 23243 23251 23261 23273 23294 23303 23309 23341 23382 23418 23456 23493 23541 23565 23577 23591 23599 23607 23635 23652 23681 23702 23725 23734 23753 23765 23809 23847 23874 23918 23946 23973 24026 24037 24048 24055 24065 24074 24108 24112 24117 24121 24156 24166 24196 24219 24248 24270 24292 24314 24341 24353 24365 24384 24418 24451 24472 24496 24509 24521 24534 24540 24566 24576 24587 24611 24621 24641 24661 24678 24704 24728 24741 24761 24795 24802 24831 24854 24877 24893 24908 24923 24938 24952 25140 25445 25876 26067 26302 26490 26532 26582 26636 26684 26706 26747 26758 26766 26790 26794 26798 26807 26818 26829 26844 26875 26921 26934 26947 26977 26991 27003 27015 27027 27045 27068 27113 27136 27196 27448 27475 27737 27755 27782 27831 27861 27892 28024 28031 28080 28103 28127 28156 28164 28174 28182 28187 28240 28289 28329 28395 28428 28472 28495 28596 28601 28678 28692 28702 28726 28849 28930 29040 29068 29073 29089 29118 29126 29167 29175 29189 29202 29210 29229 29262 29282 29302 29518 29549 29569 29575 29582 29586 29601 29620 29646 29655 29667 29721 29779 29814 29833 29850 29862 29897 29903 29911 29915 29936 29953 29964 29989 30167 30221 30912 30931 30966 30996 31042 31048 31055 31059 31083 31099 31105 31180 31330 31449 31462 31530 31532 31534 31536 31546 31559 31576 31603 31607 31613 31618 31627 31632 31659 31661 31674 31686 31701 31729 31773 31820 31836 31858 31869 31902 31922 31971 32071 32073 32149 32204 32254 32353 32448 32496 32586 32593 32654 32718 32723 32729 32832 32884 33130 33291 33446 33517 33570 33577 33604 33654 33657 33678 33724 33779 33838 33907 33954 34059 34202 34227 34231 34265 34282 34320 34373 34413 34489 34554 34648 34669 34707 34747 34783 34807 34830 34869 34899 34906 34915 34923 34931 34945 34961 34989 35041 35058 35079 35123 35465 35469 35484 35495 35503 35522 35534 35541 35548 35557 35567 35584 35600 35654 35662 35670 35680 35691 35709 35726 35742 35760 35767 35785 35802 35809 35819 35850 35869 35888 35908 35918 35937 35950 35970 35990 36011 36021 36040 36059 36069 36086 36100 36123 36147 36160 36170 36175 36179 36197 36216 36235 36240 36259 36279 36304 36319 36323 36330 36340 36349 36370 36384 36392 36412 36438 36455 36463 36474 36505 36510 36523 36545 36560 36569 36590 36608 36617 36661 36685 36712 36727 36744 36758 36789 36813 36844 36851 36865 36880 36899 37444 37477 37505 37534 37542 37579 37891 38068 38145 38162 38180 38195 38217 38267 38277 38294 38316 38375 38533 38557 38687 38712 38838 38856 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-10.99.14. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-10.99.14 est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-10.99.14 est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-10.99.14 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-10.99.14 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-10.99.14 Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-10.99.14Excuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si vous avez dmarr sur une disquette, vous pouvez maintenant la retirer. Impossible de lire le contenu du secteur de dmarrage Impossible de lire la table de partitions RISCiX Aucune partition NetBSD trouve dans la table de partitions RISCiX. Impossible de crer un label. Aucune partition NetBSD trouve (disque filecore uniquement ?). Impossible de crer un label. Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationditerGroupe umountMSGTXTS626 5024 5065 5081 5099 5103 5107 5117 5126 5132 5138 5141 5144 5153 5163 5176 5184 5195 5220 5232 5741 5773 6265 6554 7099 7145 7249 7335 7371 7386 7404 7412 7420 7447 7451 7455 7458 7461 7572 7757 7985 8461 8795 8824 8839 8854 8862 8876 8894 8915 8966 8982 8992 9012 9058 9088 9141 9198 9309 9430 9474 9507 9546 9580 9587 9620 9697 9703 9710 9717 9746 9858 9864 9875 9892 9909 9918 9947 9959 9969 10070 10132 10152 10272 10309 10365 10379 10400 10437 10647 10822 10971 11006 11058 11275 11589 12113 12475 12765 13158 13293 13306 13317 13463 13642 13773 13907 13927 13960 13979 14062 14177 14318 14443 14457 14565 14658 14687 14707 14783 14800 14818 14834 14853 14873 14890 14902 14928 14940 14958 15159 15398 15425 15442 15498 15560 15620 15651 15675 15734 16110 16140 16157 16265 16375 16515 16589 16665 16743 17235 17455 17566 17597 17724 17760 17888 17915 17955 18001 18217 18341 18409 18509 18514 18550 18586 18600 18623 18656 18660 18685 18704 18730 18735 18750 18765 18784 18809 18821 18843 18860 18873 18885 18903 18927 18942 18959 18972 18983 18994 19014 19043 19072 19096 19131 19166 19193 19380 19429 19461 19509 19606 19739 19785 19977 20007 20329 20458 20598 20738 20855 20990 21034 21077 21085 21095 21107 21119 21127 21138 21165 21199 21235 21266 21301 21337 21384 21404 21421 21439 21444 21451 21477 21493 21514 21531 21548 21566 21583 21596 21627 21652 21683 21714 21749 21776 21829 21839 21849 21855 21864 21872 21887 21891 21896 21900 21935 21945 21974 21990 22016 22033 22052 22073 22089 22102 22107 22115 22130 22156 22175 22203 22221 22232 22238 22244 22265 22275 22286 22304 22326 22343 22356 22377 22397 22417 22428 22441 22463 22470 22495 22510 22530 22542 22559 22576 22596 22615 22792 23076 23386 23566 23777 23965 24031 24078 24133 24177 24197 24226 24238 24244 24260 24264 24268 24276 24286 24298 24313 24332 24368 24379 24390 24429 24441 24451 24461 24471 24487 24505 24554 24575 24620 24864 24890 25144 25159 25185 25242 25276 25311 25453 25470 25519 25540 25556 25585 25590 25595 25601 25606 25645 25680 25710 25765 25798 25844 25858 25937 25942 25996 26010 26020 26044 26130 26178 26284 26318 26325 26340 26367 26376 26415 26422 26444 26463 26479 26497 26529 26548 26565 26722 26753 26760 26769 26777 26784 26798 26816 26835 26845 26857 26898 26943 26972 26993 27016 27035 27073 27079 27087 27091 27112 27129 27138 27157 27303 27345 27855 27863 27887 27905 27949 27954 27959 27963 27994 28007 28016 28062 28188 28279 28291 28355 28357 28359 28361 28371 28385 28400 28427 28431 28437 28442 28451 28456 28483 28485 28500 28511 28526 28554 28598 28645 28661 28683 28694 28727 28747 28796 28896 28898 28966 29006 29051 29126 29192 29227 29308 29315 29376 29440 29447 29453 29552 29608 29884 30008 30119 30181 30219 30227 30249 30298 30301 30322 30367 30422 30481 30550 30597 30702 30845 30870 30874 30908 30924 30949 30997 31033 31094 31148 31229 31251 31290 31327 31359 31383 31410 31436 31450 31458 31468 31476 31490 31503 31515 31539 31580 31606 31623 31652 31976 31979 31993 32005 32011 32027 32039 32046 32053 32062 32072 32089 32105 32148 32156 32164 32174 32185 32203 32220 32233 32259 32266 32274 32291 32299 32316 32340 32359 32378 32397 32407 32418 32432 32450 32470 32490 32499 32522 32542 32553 32568 32580 32599 32618 32629 32639 32644 32650 32668 32687 32706 32713 32732 32752 32777 32794 32800 32808 32818 32830 32851 32867 32875 32895 32915 32937 32945 32956 32979 32986 33000 33022 33039 33048 33069 33087 33096 33127 33143 33170 33189 33209 33227 33248 33262 33282 33289 33308 33323 33342 33887 33920 33948 33977 33985 34022 34334 34511 34588 34605 34623 34638 34660 34710 34720 34737 34759 34818 34976 35000 35130 35155 35281 35299 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-10.99.14. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-10.99.14 zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-10.99.14 zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-10.99.14 zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-10.99.14 zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Instalacja zostala przerwana. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-10.99.14Wyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-10.99.14Uruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Jesli uruchomiles komputer z dyskietki, mozesz ja teraz wyciagnac. Nie moge przeczytac bootbloku filecore Nie moge przeczytac tablicy partycji RISCiX Nie znalazlem partycji NetBSD w tablicy partycji RISCiX - Nie moge nazwac Nie znalazlem partycji NetBSD (dysk filecore?) - Nie moge nazwac Instalowanie bootblokow na %s.... Partycje NetBSD na dysku %s wygladaja teraz tak (Rozmiary i Przesuniecia w %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766:  . ..zerowd3pwd3owd3nwd3mwd3lwd3kwd3jwd3iwd3hwd3g wd3f!wd3e"wd3d#wd3c$wd3b%wd3a& wd3'wd2p(wd2o)wd2n*wd2m+wd2l,wd2k-wd2j.wd2i/wd2h0wd2g1wd2f2wd2e3wd2d4wd2c5wd2b6wd2a7 wd28wd1p9wd1o:wd1n;wd1m<wd1l=wd1k>wd1j?wd1i@wd1hAwd1gBwd1fCwd1eDwd1dEwd1cFwd1bGwd1aH wd1Iwd0pJwd0oKwd0nLwd0mMwd0lNwd0kOwd0jPwd0iQwd0hRwd0gSwd0fTwd0eUwd0dVwd0cWwd0bXwd0aY wd0Zurandom[ttypf\ttype]ttypd^ttypc_ttypb`ttypaattyp9bttyp8cttyp7dttyp6ettyp5fttyp4gttyp3httyp2ittyp1jttyp0ktty01ltty00m ttynstdoutostdinpstderrq st1r st0ssd3ptsd3ousd3nvsd3mwsd3lxsd3kysd3jzsd3i{sd3h|sd3g}sd3f~sd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2a sd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2krwd2jrwd2irwd2hrwd2grwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1erwd1drwd1crwd1brwd1arwd1rwd0prwd0orwd0nrwd0mrwd0lrwd0krwd0jrwd0irwd0hrwd0grwd0frwd0erwd0drwd0crwd0brwd0arwd0rst1rst0rsd3prsd3orsd3nrsd3mrsd3lrsd3krsd3jrsd3irsd3hrsd3grsd3frsd3e rsd3d rsd3c rsd3b rsd3a rsd3rsd2prsd2orsd2nrsd2mrsd2lrsd2krsd2jrsd2irsd2hrsd2grsd2frsd2ersd2drsd2crsd2brsd2arsd2rsd1p rsd1o!rsd1n"rsd1m#rsd1l$rsd1k%rsd1j&rsd1i'rsd1h(rsd1g)rsd1f*rsd1e+rsd1d,rsd1c-rsd1b.rsd1a/rsd10rsd0p1rsd0o2rsd0n3rsd0m4rsd0l5rsd0k6rsd0j7rsd0i8rsd0h9rsd0g:rsd0f;rsd0e<rsd0d=rsd0c>rsd0b?rsd0a@rsd0Armd1cBrmd1aCrmd1Drmd0cErmd0aFrmd0Grld7pHrld7oIrld7nJrld7mKrld7lLrld7kMrld7jNrld7iOrld7hPrld7gQrld7fRrld7eSrld7dTrld7cUrld7bVrld7aWrld7Xrld6pYrld6oZrld6n[rld6m\rld6l]rld6k^rld6j_rld6i`rld6harld6gbrld6fcrld6edrld6derld6cfrld6bgrld6ahrld6irld5pjrld5okrld5nlrld5mmrld5lnrld5korld5jprld5iqrld5hrrld5gsrld5ftrld5eurld5dvrld5cwrld5bxrld5ayrld5zrld4p{rld4o|rld4n}rld4m~rld4lrld4krld4jrld4irld4hrld4grld4frld4erld4drld4crld4brld4arld4rld3prld3orld3nrld3mrld3lrld3krld3jrld3irld3hrld3grld3frld3erld3drld3crld3brld3arld3rld2prld2orld2nrld2mrld2lrld2krld2jrld2irld2hrld2grld2frld2erld2drld2crld2brld2arld2rld1prld1orld1nrld1mrld1lrld1krld1jrld1irld1hrld1grld1frld1erld1drld1crld1brld1arld1rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rflash7rflash6rflash5rflash4rflash3rflash2rflash1rflash0rfd1prfd1orfd1nrfd1mrfd1lrfd1krfd1jrfd1irfd1hrfd1grfd1frfd1erfd1drfd1crfd1brfd1arfd1rfd0prfd0orfd0nrfd0mrfd0lrfd0krfd0jrfd0irfd0hrfd0grfd0frfd0erfd0drfd0crfd0brfd0arfd0rdk7rdk6rdk5rdk4rdk3rdk2rdk1rdk0rcd1crcd1arcd1rcd0crcd0arcd0randomptypf ptype ptypd ptypc ptypb ptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0 memmd1cmd1a md1!md0c"md0a# md0$ld7p%ld7o&ld7n'ld7m(ld7l)ld7k*ld7j+ld7i,ld7h-ld7g.ld7f/ld7e0ld7d1ld7c2ld7b3ld7a4 ld75ld6p6ld6o7ld6n8ld6m9ld6l:ld6k;ld6j<ld6i=ld6h>ld6g?ld6f@ld6eAld6dBld6cCld6bDld6aE ld6Fld5pGld5oHld5nIld5mJld5lKld5kLld5jMld5iNld5hOld5gPld5fQld5eRld5dSld5cTld5bUld5aV ld5Wld4pXld4oYld4nZld4m[ld4l\ld4k]ld4j^ld4i_ld4h`ld4gald4fbld4ecld4ddld4celd4bfld4ag ld4hld3pild3ojld3nkld3mlld3lmld3knld3jold3ipld3hqld3grld3fsld3etld3duld3cvld3bwld3ax ld3yld2pzld2o{ld2n|ld2m}ld2l~ld2kld2jld2ild2hld2gld2fld2eld2dld2cld2bld2a ld2ld1pld1old1nld1mld1lld1kld1jld1ild1hld1gld1fld1eld1dld1cld1bld1a ld1ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullflash7flash6flash5flash4flash3flash2flash1flash0fd1pfd1ofd1nfd1mfd1lfd1kfd1jfd1ifd1hfd1gfd1ffd1efd1dfd1cfd1bfd1a fd1fd0pfd0ofd0nfd0mfd0lfd0kfd0jfd0ifd0hfd0gfd0ffd0efd0dfd0cfd0bfd0a fd0est1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drvctldrum dk7 dk6 dk5 dk4 dk3 dk2 dk1 dk0consttyconsolecd1ccd1a cd1cd0ccd0a cd0 bpf0 bpf ...# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # Rapid commit support. # Safe to enable by default because it requires the equivalent option set # on the server to actually work. option rapid_commit # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin  . .. dhcpcd-hooksdhcpcd-run-hooks# $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use fi done # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  . ..20-resolv.conf 30-hostname else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime [ -z "$rdnsstime" ] && return 1 ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers [ -n "$rdnss" ] && new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime [ -z "$dnssltime" ] && return 1 ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search [ -n "$dnssl" ] && new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf return $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" # Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dkctl drvctl fdisk fsck fsck_ffs  fsck_msdos gpt halt ifconfig init mknod mount  mount_cd9660  mount_ext2fs  mount_ffs  mount_kernfs  mount_mfs  mount_msdos  mount_nfs  mount_tmpfs newfs  newfs_ext2fs  newfs_msdos ping reboot restore route rrestore shutdown slattach swapctl sysctl dumount ... ... . .. binmdecsbinshare . .. cu ftp gunzip gzcat gzip less more progress sed tar tip Htset ... . .. chroot . ..misc ... . .. db log run spool ... ... ... . .. lock . ..