ELF(@4 J4 (@@``PM!"\\@0 6QQ O@@@( @0 fH!@P@Q?H3tР -LM&/PM]main() returned_   ! X(@@T @@ 0/aaT (/// P-Lxv@-@PL00S @0080 0 0 0 h&Ѝv``LH^P/00S 000/v2@-@iMpNP @iߍ0s PP 00 0`V  h#@   0R)0R OoB__edAjH^\ 4S/0!8 00 (   !/Hzhzlz@-끁GP|%0 !!X0T0P0H000, !  !O^H^HzhzlzG-aM0SJpP  @T   pP9  P@1 nP jP hP5 DP@ eYP%W -  P PP 00 B4R 0 @a0C0 P AK&ЍG, 8@cP|^PlYPP #P  8"$ 0@ @F__8FH^H^m+_H^^H^@-<@8P$2P,@ K^H^?_H^@-l00: ST 88S!~0YG@g 00 勋]@B@-0@0PS@!@.P 4Sʀ0! 0    !B? SSPj0 !! H"D"<|"8!0w"̀2-HzhzlzI^=I^_I^@BmI^ P00  /$@$0P  000/dPd<0 P0/S/0CQ/]s@-@0S7`P`P) P' P P0000 8PЍp@范dqPX0` P0RЍp@a @P8P0ЍpI^I^I^p@4I^]` @ @O-M2$pPt弄 ?W|L$岄!7GR  EP00l'0d'd7!`' \7PX7+RJL7尤ᴴḔἄ e U `P& 6  ::Sf0\6P X "01%6PQ P!! *!& 1儆 !&f0|6#6$1  1" @P *Lb#H&H6HfUTS$1)0C$10!10C0PU0S 9#9S  @P :$1I)0C*$1,1,!p1c001 1 @P :|5*$10C$1 1 @P :$1Du*0C$10! 10C01 @ P:$1t*0C$10! 10C01 @ P:$1t*0C$10! 10C01 @ P:$1lt*0C$10! 10C01 @ Pl:$1*0C$1t1! 10C11 @ PZ:$1)0C$1bP#Gq㰃 uGW#G#Gx#xGp#pG$p`3`` \3!XT3 0C 0p 0G! 0I 0I ~G": vG": nGt: gG\: `G0p09 XG 0p0 :NGXp!#H!p0 G<J$1Q 1!0!>0>00!1 ! B"&$! 03/03/03/ 03/xS[+ 1XH0SHOH010! ,1,! (1(!h$'뢳! 1"7 E ЍI^@[@0 DSBO]2ﾭI^0`AiPI^??,,li`?I^)i` I^@ihaaTaa^^ _ _@4_H_\i@`__ _o @ @P@@- @0 PЍO-`p㨱LM P 1 0LЍ001!4 S6AT1S1S1S* o@ lTTW    ,00< @0p08 @P\  0<0 0^*0 00 \S 0 W@(`,P08PP0P80PPX0 q @0X" 3H"0`0Pci,9VDPUa8 ⴹ 80 < P P8 PP 0E?oW20S` X0 a($ ``06/Tp0$ 0P5/`P?>$ 5/0$ 0P5/ 08`$ p@#8/]` p@-d(PT$U@ $ ``06/Tp0`$ p@//p@-0 P T@``06/0 ``6/`0p@ /p@-P@@0 T000S 0d00h00p0x0h0x0p@ S0d0i0h0^0 S0d0i0h0^0p0j0l0]0t0` ]p)@A-0PST@ Sq X Bu 00 `0*b6/`P G  0@  0`p7/< `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0`pS0   0 7/0 `p 7/ `pt0 7/`` 0 6/ ``D0 6/0S000 0 00$0Ѝ@!K^8K^p@-P0 ` T@003/U U ,  p 003/^K^X~@-00 ~ Ѝ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzA-0`@TP Vp V h900 3/P0T00 T0 `@4/A0T0 `@3~K^|A-0@PT` Tp @DT0S $ 003/@08$ `@#84/A~K^ 0o/x_/0@-0M P@ 0P 000 Ѝ0T.@p@-0@Tp@tt[z$0dP 5/0 dP5/0]~0Z~ 0p@V~x_`[K^A-(MP@D1P<4P0100: S# 0A㫀p` 0000 (`0w?C$004  p,00 `0@ 6/0P (ЍA05p`WV ||t AaPdq 0 0@0 0(Ѝx_]I^]K^pA1@K^\.@ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz@-@:A-1@TA0P`dp 7/U }} 0dP5/}㱀0dP 5/0 4P5/}U} A} }U A}x_j[K^p@-0@TxxPpPP0 4P5/ 0 4P5/P} }}x_x[K^C-1M@TЍp_0` dP5/ 0dP5/P j}h}p}@pPP p d09/0 49/ +0 49/ 0 49/PU ;}9}7}0 dP5/0?<#x_K^[A-1@T  ,PP0` dp7/ 0dp7/ }|}0dp 7/0 4P5/ 0 4P5/ 0 4P5/P|x_[!L^O-,1P@`({,{0{4{0p,u|(r|0o|4l||| | @P0 | (| |(| x[P0| | (K| ,H|0E|4B|OO|x_0S@- S S@@W5L^00@o/]` @-`@PЍG-@Ђp2PRp`0CR`P2R 3C7CR0 0 $ G~2RS 3C7CR008#8S800 08 &41414$00L00P0$  Q  !%!b$ R!X $ %$ h0l0& d  ' !0 !  011<P008#8S308#8S0x`0 p h(`8p<۲151``5008#8Sy308#8SsSW HdHd]L^f_ wL^@-@`'P@h `0 0X 0P0 P0H000d04 4^P$Ѝp[J[L;@;@K^@-y@-@m0 0R/  \]` [lp@-@ 0R * R< RU !0 1dPa05/x1x!dP 5/d1dP\! 5/<dP D!5/ {0d,!p@/ !0 1dPa05/0 dP 5/0dP !0 1dP!05/0 dP 5/0dPp 5/=dP !0 1dP!05/H0 dP 5/5dP[~ _f-/0/-/-/-/-/-/-/A-PpO`0@ 2/ p 0S0@0 @0000@A-P M@`Y0 0 0  p7/0P * * p7/0P  "( p7/ Pt 000 00@0H1 R `   P | Ѝ@0X@p0$0:0d0 00!S   1 0 0S0h006Qd  |0000100 0000 8/0$@0\0` w,L^]I^L^L^L^|_#M^ i^ 0 /|_/$ R/P//C-p0MS @*`  5@P" Pd@ 001Q0000!T0    ᄙ40 00 a6/00P@@Ѝ0S   00C0/$ R xR R  /X R P0R/ ! !  _W@@W@AW@EW$o  R0" //@- oJM^@-@(00 S@@][QM^A-QP@ 0S @T`V pl`V @@DT@S 0S T@ !|` 00 p@-@P@0`000```0P0 ^P=0| ^Pd30X ^P<)04 ^Ppp@]I^[_E@zM^E@@F@F@@-n@A@-h@~@-b@y u0 0@-V0 0@k0 0@e0P/__@-<0@TP T0 0 @L_0P/QC_p@-0@T/ 0S S* S& P 0 0 P PU% Pp 0D0P0000C00 0P  pp_RW SW 0o/_///<0Q 1CQ/ 0Q0 /00 W@W@p@-PP2S>x@P@:xP,@ @T,@ tpG-M`@P2`0p븂XPg 徹0* Rq "Sl ph2h P00 000!h<" p-PZP00$P(0SIP㴑ġ0SKP 1@/wP 1@'wP l1@wP L1@wD10S h 0喌00h0 01@0`0!{dЍ0!p P_ a` P0p 0VwP0qw Mw0* R 0 @vP S T0@_]I^] L@` [L@K^O@H@L@`H@ |JH[O@@-//G- s@dVʀ 0! $"0""   !P 0x MwTwP0S zP0SP0SDP0SK( ]0T Q0S001R0 P "00 S^0 ?0y w !w y0S w yP0p vP ,0S -0S (05#0x vvP0p wP Q 0R(0l0S$00SPXX0S`P\ d峋$0Y0 0 0?c 0!D d08 0   !Hzhzlz_X?gfffA-X0P@0`0\00`P @  @jЍ P@- R OO_0/_p@-`PpPDTʀ 0! $ 0    !0 2/P 0!H D0< 4  , !pO:_Hzhzlzp@-HP0PSp P@ `6/;:0  0p@/_p@-p`0SpdPP@0 S 000p0CS0p0 `6/Tp@<,_G-pP`̐P@ P% P# PV `FPE @P P #P P00Z0S P P`4  `@ ]I^N^N^^/@-0,\ @T 4/Ѝ_00S/ R//_00S/ R//_p@-@P4`z/ t/0p@80/_ 0 S)p@-@0@` !P0 R  P RP V0S0@@ P@@00 , !p/A-@0@p !`P0S#P ) R00 @T tt@PA0P !!P  0S R00 i@i@ 0  )?)/ 0  )?)/^/@-@q dR Q0P0CJ q 8E  q (@ q ; N^N^N^N^N^0@-LP$M@ ,  000 0$Ѝ0]I^j@0@- 0@ ,MPr           0 040$0bP 000 j,Ѝ0i@/0/!//A-pQ`.0  P@ x0EVP Hpp`@tT:80[+0 'J x>@\@-q N^@-m O^///1/8#81/1/ W  R/ R/ d 0s S40@o//0@3S0/m/H N^p@-@0PT3/.p`R0p@8/4! $$#  p@/1O^&O^h[,O^5O^Q0 Q Q // ^1O^>O^"_O-P`M 0 3/Ѝ03/@zQ [0$  3/0 0Sp "R 3/ 0A0CS000l 3/u0d 0Q 0H 3/, $.!4 3/!0AYS}p@dy@w@dy@dy@8y@dy@dy@dy@dy@dy@dy@dy@dy@dy@dy@dy@q@dy@dy@dy@dy@dy@dy@dy@dy@dy@dy@dy@dy@dy@dy@dy@w@w@r@dy@0w@dy@dy@Lv@dy@dy@w@dy@,v@dy@w@r@w@w@dy@8v@dy@x@lv@v@v@dy@dy@dy@dy@dy@dy@ s@u@v@Tr@s@du@xu@u@u@u@v@t@r@r@r@v@r@u@r@v@hr@x@r@x@x@x@0c0C S+q@q@q@q@q@q@q@q@q@q@q@x   0\3/ 0L3/@ 0<3/W  0$3/ 03/W07 1p 2/0 30 r#03/0A CR@S> 000 0R8L3/4$$(0". (:$ 03/$&0$0$3/0 0 &6z R'zppF0$0x3/p60S `6`&0S T&ZP0H3/083/ jZ0 03/$r0p0pO8OS $03/50S 5Z 2/%5 0|| 3/Zc 0L3/0X3/p0! 'R0,3/0 nK RS 0 3/  BR03/Z  03/R$0Y$0 t$tO0J$80 0C2/ $0!?3?3 2/!;?#00@q 0s0 0$* "0  : 0#$90"? :$#: \0LH#0$"<0,,7S0 S003/ 03/ 03/ 03/0000$3 0$2 p0$0`$40S$HH 2/$03/!t03/0t3/0h3/W_ 0~0$03/$($0p 7/0z0l3/200p\$($0 7/6$8$&$p(0 0[AO^x[\MO^»^^O^]I^YO^2U^z_`_^bO^h[`O^fO^O^/q^1O^sO^/yO^͠^b_M_+_~O^@O^O^O^O^O^O^O^\O^O^X\h\O^N^^O^O^^^`_;P^q^û^FU^\P^\\O^O^O^L _O^O^O^O^O^P^ \//`!//` `! /0/c 80/c#c4 4#0/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ 0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/ R/c 8 R/ R/c#c4 4# R/ R/  R/ P r00 / R00/bs_notimpl_%s: args at %p$O- mmap- r_1- r_2- r_4- r_8- w_1- w_2- w_4- w_8- rm_1- rm_2- rm_4- rm_8- wm_1- wm_2- wm_4- wm_8- rr_1- rr_2- rr_4- rr_8- wr_1- }wr_2- wwr_4- qwr_8- ksm_1- esm_2- _sm_4- Ysm_8- Ssr_1- Msr_2- Gsr_4- Asr_8- ;c_1- 6c_2- 1c_4- ,c_8P0 PQ 0@o//- /0/-/-/-/- /$0/@-`@P (pW @/ ,pW0  `//p@-@$0P`P &!0"8`<` H @ , H H L  H  0  (0pwwwwp@-@$0( S 6p@4 ,00,0/0 R,00,0/p@-(0c:0@ T:PUpp@-2@02 P<0#0P20C22S ˆUpp@z; p@-\0!C !2 Q02(0$!  (0$!p@R/L-, 0((((S l R B|R/xRi-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R  /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L-ȩ 0((((S l R B|R/R}-0 B RE@P`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p R@P / R@P`p@P@P`p R@P /@Pd R@P@P@P@P@P@P/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L- 0((((S l R B|R/wRh-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/ # ($0(000(/ # ($0(000(/< # ($0(000(/ -L R l\000Х000 R 0 4 8 <0 R  /R000Х000 -L R l\000Ѥ000 R 00#40#40#40 R  R000Ѥ000R/ 0 R0#40/0#8 80 R/R/ 0 R 480/0 R## 8##,0/R/0@-0#88@$HHP%XX,ȠȌ8 R0R/0@-0P8$#H$8#0@8%#X%8#0P 8,#, 8#08.#.8#0 R0R/C-R :08PHpX hx R R:x08PH R R:080 R R:0 R0#40R/}A-R:#H#8##H$%h%X%%h&''x''(,,,,.Q R R :#h#X#%h&$$x$'( R R:0 R#X#H#$X%0 R:0@ R480C-pPM`0SZ 0 S S SQ !SV 0 @0 R =R DਸP 0=S@V6ꄙ@@ș@ܙ@@@V 0  SR0T=S0(0 P@Ѝ   P   MNP 7@- 0@P P0P R S @ܚ Ѝ0@-@0 }P  BoЍx-2`? @C @P(PP`5P6(5?3`x/x-2`? X@C @(0000]ߍ`@P X @P0`(0 0F?PN@ @0 4/@K?T4?P @> 4/@;?G8H1 !0R$04$0/o/s@-`P@P!0P0sJX03/03/0?00?Ѝp 0P 0S00S 0@ S 0@PQ __p@-A0S! 0S\X l\0_03/UA 00<000S: #: " ! 3\ #30 00C 300%& %6 " ! \ #30 00C 300000C0Y$00pBB_Ai!i YS^1?/ //?0 0!0S 0@o/ //0/////?  22//-P/6  N?  "2/!N80 Q @-*O@P O /65/ N N N5 N:6 N: N 1,   P QOO/l  0 Q!N:O56!N:O6!N Q* : QO N Q* :65 QO N Q* :6 QO N Q* :5 QO N 6 Q N N//$04s@-0@S  ⍘(00(0/O- R\bY I* b$\" hin_cksum: out of mbufs p 0 A2$$pgQ/pWq'2'/QRppA@Q@`  `  @  `  @  `  @  `  @Q@  @/ Q@`  @  `    Q/0@cQ@0  0  0  Q@Q /0a131 /!# 0(0000(0 # 0(000000(0 # 0(0000(0 # l0(00(0\ # D0(0!0(0, # 0(00(00(0H00S/@-@0  "!$0p03/0 !!h`_03 /0@-$@4 ~< 4 @ 8 L < @ 0 < /p@-P$@4 g40 <080" @0<0 L0@0200< @  00p/$ 0L 0 00/-1$ 400 001!00<p@-$0` @ P         $  ( , $ 0 ( 4 , 8 0 < 4 @ 8 L<0@0UXp<0001X1070 0 0\1pO-81MpC0 40$P刢!.!n@0` 1017800q=` !.pY=W  r0000 0 00 `L<`划0@0 0S101ߍ@00S/A-P@`q& @00S8$0            $ ( $ , ( 0 , 4 0 8 4 < 8 @ < L @  X/1=1011018= 0\! 6 SSO-0p@`0M 46CSЍO+t 000 0$00 L04`0C0C00nЍp!```Q 0 Z0cQ 0 J<!PP81\Z 0   PP  P0% 0  3/ ZPu U  u L0 0C0CL00" 0 0 0P0P20@-0t 0@@$!0   80$ &08@1011@2/L00C 02/ᔬ@ $0 " 00000 0 0$00(00,0000040 080$0D0(0 L0/S$!6  P 0@-ZCU0 lPC^ 1 0 L00L06&0 6&0/0pP 0@- @ |M l Q \\ QQSH0t S0  !0 @m|Ѝ00!R 10/`p@-@P Pp `0 S   0@-4 0S$ @ ` G-82p&xM &  , ! L   PALPRcF0@!104C T*0FPALPRc0^S t {0  !0 PmxЍH03!0%@ 0 :/P> 0t W0 !0 P$@\mxЍG|0@ T03:0 H@      "RD$  H0XY ,xS@ Y `S^^@<@@l@@@BO-`P|T&o /@- 00@P 0S$020 0 P 0S 0 P 0S 0 P 0S 0 P 0S p0 P 0S 00|P 0S#020 0oP 0S"020 0bP 0S"010 0UP 0S|"010 0H Pd 0Sh d0> Pf 0Sj @04 Ph 0Sl 0* Pj 0SnЍ0Ppr!000m0 Pn0 Phj`!0@00e0Pfh0!000c\0Pdf!0:0a00Pbd 000_0P 0800Pp 0800P@ 0700P 070_^2U^#U^-U^4U^@U^`^`^`^HU^o^^WU^ U^'U^*U^1U^=U^EU^NU^QU^TU^^U^@-H00S<00S*0 00000 Ѝ^^00/G-Sp@` @ S( S11P0 @D`Fp@03/ L03/X(@`pGP@@0P3/ L0G/RdP@03/L0 D03/ P03/ZPH03/T0``_d`O- 0@4`lTD r0P\qX pX>  R7: R3* P N Y  L\!TWX# D p(p W*Y ) p 0S p    0@[ ЍpWr P@@- ^ 0P \0 B^0\aU^A-Pp4`@P 0Pp 0<0`@P00 (@0 0,0 r4G-P(p0,P0PS!@!`!*Ѝ V1Z 0 00 0:P  `FP@VU0,00,0000,000000/O-0 `0  P2d0 ЍO/@08"p0 S )4S 04PSz@@d@@@V @D P T*S0IY!80 0 @ `FV @DP T*0Z*IY! 0CY!-0 0 A3A3C?o20 0g @ `FJ0V @DP T*0Z*IY! 0CY!08 0 0> @ `FJ$$  Ѝ_\\~U^U^C-@Pp T  Ѝb2"0S@`0j0O-M 0S0>W:W: 0(% "S  R 0 [0!> zJD x>\U^p@-PN@N@M 0> p@0 \x>@-0 PS@0S 0#G-p`@00hTЍ PZe 0 YUP! 000 P`@D@-P0,00000`S3 :RP00p 0p0@80$0p00P0,Pp`0 ЍrO-p , 0  (0MP @0800T0R0S R(0p,0001000ЍPU @0A#AR ODD P P P;/ \H0H00HP0` B0 0 0 H`P0``>0 BB6*a"*UbY 0 0  0 P PE\ 0 H0P0 B$0 00007 rO-@P0,08p`00 SP Ѝ0W0P0S` 0 W10 0  pG0P,00000O-M Sp@`Q:LD0  0P0 T >P%@x P @[H0@@ j:S P%0:0PD0@S  Ѝ2 O-@MLT) Pp` 㸰@0SЍ0S   0 00H0  0D0 0@00 0P `@H@ D@xP@-@P`U^p^0.b Q  0 0 ^ *4 0L0\!>00P@-//G-)0PS@XqM` $ R  (0+0  PVV0P00 0 Ѝ R  *0PVV0P00  0 | $ R  (0+0 PVV0P0 0 0\U^V^HV^//@-M`@PPT#TB,'H>0'<:UH/, 2?0Rr pB```@Q```CPPP T@%PP `1l p 000T0  @Ѝ@Ѝ{V^V^V^``$a(a,aaaV^V^W^A-HCM`PTYЍARI  !pŸ *Q   0"D3S0P 0Sl X!\1- L < ,  WT3W0pW0! 1   G R#T3T3@~T3  typwl1l!0S `1*B0S P1F@T,,`T3   !1@TT 0 0 0 0  |W P01GT Ѝ <W^ _\͠^b^Qb^db^qb^na^ya^a^C- @`p(P  0S 00PAP 00(0Szp(Q 00(0L0 Ѝ@0?  0 L0 00S 0 it   p$`}b^s@-@ \ TP`t ҷ 00 `$PЍp@-1@``QP R& $ z? 0    ! 0t0$0`040(L00880L00Ѝp@_ b^b^b^c^0c^O-,D,M0Pc3/03/10100S  !pp0G?o$Ğ  Ďß2$AT 0 4/PW W, L  <@0 q Q* ß\(\ R&BR "  R t (00 0(00,0!0 *R J L ,  W !T"< :  @ P7 L>+ T R2 RLDLOoB@   P 4(S0" [04[W  P P P  P A@!T@@@0 (0 w0P(W W [ 0(0L0Ѝ 0 0t  0姶 0 S{ S S 0, (0A`pPzO0@ 0 x 0(0 8< 0\ '_\[c^_x>c^c^c^O-PM1s0100S , !QL@5xxxT6 T*h10S0 1  00 `P6 0 ?wP/ t 60 [0 0a`Pzo`0 0  0 0 0t 0 0 0$  00@4@@0  P0 @TL@0* R @+Ѝ_c^O-p1pd0P@3/tXXaWTʀ 0! $ 0    !U U+ U5 t?oT20S00 0!t!0   , ! Ѝ h?oT20S00 l?oT20S00 _Hzhzlz/\d^00P (031000Co// !:!P/ 0  P/@0. 04S/Q0 /0  @-RC.@-KG-08M@pl00 00,(p$@ @@ @`Pw0,0L0 0D000000(p$@@ @`kw8ЍA&_ae^0S;0;0 / 0 R/<0P/0*4S/0S0 0 /000/_*4S/@-0@03/0BN0_Q(QP0\0 /)Q/R0 S 0@0D0/S/0H0_Q@-@ (4S80BNX03/00)4S0<03/0)4_p@-@0Do A("(RP p$$Ph$! ,$" \%R 8Aw00CS0p0 p@ l bd@-@|0T0S$D 0SXN* 0S@@*<0QD$   D$ @@DD @a0 04Ē Q884/0H4S/ aT H$R z@-@@8P 084 $ 00G|4a x>@0P/-    B B  P^^ $ B$ ( Q !! B B!! 0S@0P//O-PP4LpQTX4Q9 @䀟䠟fU*%*1QP \ : 0010?0@03/@X0Ph%!1XLP L0뚟@03/@Za_ e^p@-0PXdT4S N@l $60L0V L0?4`003/03/+ဳpa _p@-D@[P\y_0``003/03/`p\4P_pa_0O-P` @P\Q pQ00؁U00SG R㼑= Ѝ ^^p Q@` WW0p0U0 WU0 `` 0!&Q0 !SL   0-  @T00 ЍO/QᤠT ``  U [  R`` `s!& 1!T0L  @ _aA-P @`pTQ 0 "A9P 0`PR  V`p@V0A3100A-`Pe@p(<@([dP_\[_P`h003/`003/03/`hMd4P\4P__耮a_G-1pS@0!R00R0P  \  \ 1!aV0`0ó?0`PQ 0 ^ ` 0S 0PR! S YY S 0h0hS 1S 0h  PU0S0`000<\ P/0S0S/A-@P Pp/ 0`00 00  0 $  B$p 0V !SA  B!! SA  B   /O-P64M@0$0p o6`H4S 0  000 \R0(0X0勱h' 6T&0P0 '6000 0 01,0 0Z P 0P P JP0S  0S<`d'X00 000(0S X00 000X05`5T4 0 0S0U0S 0 00C)4S ( `00 4H03/e'Pd$0ST Z 0 X000404. 0 皯,-0?T 4x4ST$0S  $4,'$ 0020P 10? 0S & 0 <$'"'iU hK@.''PU LPP P 0 0000Q@  0P 0R  X0  & @LiYU Q 张U(06 <`  (0  00 ` 0  P0 0000 0000 1T!R110011 0404<Y|&&X0 |   @h4ЍR 0000 00(0$ S000T0R0SX0 0T4U <`-& P  b&` 0 QX0 @0`5 X+ 0 1?  _a0f _dbe^e^O-@4M` f% TU2T 2x4ST B>0PS0 4pp0V :&yhRW @@p&: :6S1!f0P ` 0 &5?00 V:U 000 Uc0SP0P 4  4 0C4Z% rP <00%  (T%[ 000 U00 1  Pj 4p pS  U0 0?$ 0?, 0?0?0 4P00? 4Sf0(4S   0t S4Ѝ 0fO-@p@7P`e4$% ( *60Q000  谟 @03/00 3/03/F%  0X4% 0?UW 0<0>Og̪PP <`T00  S  S80d5 ,0T42 S0`5 _a`0@-0@D0PSMzPЍ00 0rP 40 U0*0Ȯ!@O-@p6e$T:$003/O:g$ZZVUP!2`$5ᔠ?`T:0 0C0]P @0  <@0Hh 00?@03/003/J` _aA-p@`Pd\$$4$*$00S$f(DF0@00V@U($<01S  2# Rv$f$60n$fX 0S(H$HJ$J@L W000  00 p@- 0$@0P000Sp`H4S d0)$4$dH P4dh5hE000D40@@DDpa f^O-`MlP@jd#0I 0000 T : 0 S:0SM$ЍObf$jjf V `!ZP@ p$5?pT*. , 0  ᚯ뚯R0 <]#0    )d#0  R!* Jp +4S 0,03/0+4Ѝ耮_O-^PPE@pc#댐匠ZT:O# `fV`!P@ $5?0CV0 GQ!803/@Z_O-@p$M`!c2#'<01S 01 0  000Y' ^'v00100PqW X [  G EP D# <P 0 :#P7#e$Ѝ @00@0 00 0(#0皿  뚿$,$$0 !R3 0?  PXP " <P 0 @00@0 00 0"0皏   뚏P R0lœ\l% 0S 00 H0 <  0p 0 ꀮa,f^_f^f^0 #!R/080/_s@-@Pb\" %60/`P 8N"0 00<T""Ѝp@dꀮO-q3S$100@-4S0,4T封勰U !0 PU ,$$#2$$0 SQ 0T(4 xDTE|D ЍU0000xdV B.TxX 2/ 0! 0R  2/ 2/  / 2/TT$$` 6/03/00  !!000T(4xDT U 0-40-4|0 3/VBn __10 P0  044-4/@- 4@S 0 4;P $0T E0(4 0@0/ _@-(a  q @! 0 4$(4!@T 0R0D4 p000 00S 000D40P0D4!$TPp,tq0000'0$4$0!*10,$020 0 Ѝa@_@-@a0 4cp@-@Pp 4S d0 4 ≥P Pp 1T 0(4p1q*$g$T! 0S0Q D$,$ ,$ B  B  Q@@TQD$h0 0T7!X0x$R x$ p@ 4DPD$ _@af@g@-@P{@!O-0P 0UM0 0@p 0 00   P@H!P   q PUЍ 0    D+600 001000 SZ `B 0&`  1` T4 00#Y0 皟  0뚟  0 Z 0 Z  0d V! B!! !  B     0 ꀮa p@-P,> @@@ <a@u p耮p@-P,- @@@ <P@d p耮O-``| PhW Ob@@@ @Q8pW0S   @ XQ @T0,03/03/XPw P  ' #  p0 0  v$ B$ +60$ B$ @ 2 -ꀮ _0fp@-@0>00' 7D h@t1q $4!*$010D,$020 0@01 0(1C0 0@@ @@@[1 0000 @@0 0000@@ @@@B+000@0@0 @@@4 \<0,ЍO/ af^g^#g^^g^_g^8a@f_@g^@g(g^0fl@g^d<@g^b@-b0@ g @Gf0H4踁aO-$M,($ 1@`ۅPQPۍP(PEaܐ(Vᖨ(:$Ѝ0 >o@Pv0 0000009  Ppp@W T:`ᯒ 00JpbdH?^x>g^^g^@0!S@0L4 S00P4 S$0;00;010?/ap@-0`S0@TT!* Sp0XT S`0dUP0SHVP,$EO0?pah^Hh^@-@ !:0? 00$ 0D O-n0PP04 `nR@` R Rph1ě{`1dX Ѝ@18!L{T(1 !P{X X[#0$  M /FVH0Q   P  |($"(XR#  UB뚿HXH :/JZH{h^a|\h^h^ !:!/ " A- p@P` X0 X000 0pmЍ p@-@P`++`%L 0+T$;;L4;PdkXd ;/0SPLdkTd+;+ ;;+ ;0+0 ;;x;p;0+.l;0+U.h;0|+.d;,0t+`;$0\;0?00?p踁a !i(@@G-`@0匀pB00>0>0PT0?0?0000?$:=P($5?[J h^O-@ᨐ娀zT:00ЍO/ 06Sx`1`! P$5?PT:0?L0 HS @03/003/ qJ_ 0$4 / 0  ")//0 !Р!/0 ! !/p@-PMP# @,`>~0t00 \ 1(Q$  ,0(&#,0 <@0?6/ߍpʈ^P002'0 S#3/^ 0P/^d0qp/@-鞨P P8@ 0BS B 00PO-`2`BM<03/ sr DR0S0,,"S  & P@ЍO?:៥`Pp 0Sm [@.tЍO(jP;0Q@1į0 00S|F0p00 I06SP<14A 0 @1:0 0 0 00\ @X0`@Dp@ f00 vkL0000L0i^\ O-p1MpR00P `PH0 P@  0S1 S9% DF Fd˂0 01/1/ Y 1! IE@TSP S0  003/03/Y 803/`J$JQJd$Ѝ00?\_i^0/\0/x0/xT0@-@0 @RS ,0 Ѝ0000x\l0P/0 S/@- ^@LS:0 0CS(0 Sxl0P/0 S/@- ^@LS:0 0CS(0 Sx@- @ ~00@0p@-`!P û@P$P`q00D@p@@A-餀`@c0PU |p R0P R 0L  l0$A ⊻@0P P3` l0P ` 0 p$1$@ WJX0H0/ @ d ) B$ H$  ))`, 0徲4 #(08 <#L! H2/H! =< #`H!oV0p@@0u\A-H1P`l0Q C`PP]VLY@DDpDV4 !O@TAH\j^j^͠^YO^^_O-(`pၟ\@_[00H1^H*0ZH1H1Up ᱠ4 d$t"<402P#  h3`S002ձ02ű@202(0@H<4L103/DQFAFAFAFAFATP D@<(00`j^]I^j^j^j^j^@-@ P@G-pPW`@(  8 S@D (,$D00PT`H00#AD  (,W00 02P3  D(0h, 0 Q0000P0S202l4S H10  W0 202 0< 0m4S H10  0S2<2P3@20202P3 0<2P30 0 2022<20mSp40p4L1H03/GG-pኞ@mH1PjgH1p$0 S 0!R*$ h0 PP_P SPOyP0 4y#X?GAp@-]@~x#Rp@d0x3T.p@-]@m#Rp@d03T@-@`Pp<<0$M(\(0 00kЍ\C-@ Fp0@`MCPP P X3\#0 P3A> S9@A WT00 00pЍ\p@-L(0H@P#04P3 @l3$0S$@p@\@-`MtPpᛝ@ᘝT 10'*"*0*00(00,00 $0$00Ѝ\A-PP@^00$00u0H1K 0P$P M0H1D 0009SaSh" 0C023 0lQP0S 030 30303:303:33030400,0.04 ,$0 00$00202120080$0<00L!H 2/0H1c0m' #p  *  H1 00A raS_S<00SS #l     H1 p `p , * " # -  "$.* H1 `0H1 0\k^Uk^11@@p@-l0( h@"6 0TP300$00p@qPœP p@\G-@œt2PY H1ЍGm D0T`0L0SqRARA0RAQARAtRA8RAQA r0 00000ڢ R!NLY 0S<00L0S,3d00!C=VwЍGhq 0 H1 YH *0T H1Q qP R  qqpx3 d00xC000 2@0S *"*K0S 0S$00H1 ^p40Cp4ЍG`k^H^k^]I^JAj^k^j^k^k^LJAX?k^p@-PL1H @0`3/P P P2pL1 0H3/L1 0H3/P` PpPH10S( L6}k@00;000000 e66H1 pk^k^0@-M@ PP *p0B8#8S 00ߍ0:@ <000l$RH!     8@-M` PpP`-*0B8#8S) ' Q#H1; 0,00@400300r2L10H3/H1<4 H1`" ߍ-`0u$\@-@0  ⧜6> C"l3t$(0W?0,0U?000P3@>040@Np@-FL1@0H3/PPP3#P DL1HP03/pP30P3P3;P3'l^O-Mp`P@ @a= 0pTL10~H1 H1% H1  xSSu=uuDPE  pPh%᫡¡~ H1  * 5EP u `F~<00,(`$  PQ^0P 0$WЍa_P@0  kQ Q P\  4)0 t Q9D1S /0T l#~~l oD1 0H!00H16 ?0UW P3<P3>0 P3@0P3P3 dd"> C H1sh3 l @mP0D1@h O"1S0!h3?0 * R//  p#* R lt# 0#t#/>0) R9#9p3!<#` lJP3@ H0 ? H!l3$l 000000t3S lp#R 0|l#p^0   " ""   00H00D000h0\p@-2RP0@`2 R0 RL00P0L00P0<0, 6#p@ /0 x[o^o^p@-P@`Pp0D02( 02<06# 2/p@ , 0    , /  A, 0/ @  /O-@pDMT(h0P00 `<0 $0z [H 0 \0p 0+ t0S 3/0 $ _02\ 0:/ 2@ a`8@7岐P 82@ @P7夐P80!0d R2  R00p + 2\ h0<(,0040 000$0$ 6哂" 010000S 2< 2p`(9`X002 p  2( t x@0'x 00 S0!< 80 S( 2@ ŠĠt0S $3/,0( 4_0 $2\ 0 p^Kp^A-0<`"Pc&@pS 0S >000  0 0S0L0? |c 0 00X0'<0PX `' Ѝ000(00 x0S 3/ iP 2  0   p@07/8(0< ,0(000,4000 04 @ 0000CS00ӝڰ2n Wp^p^p^p^p@-@PB0 g  pR/ 0 0Rs00#/ 00 0/Q@-@  p^p^Q@-@ 0 q^q^A-@PᩓD0S0D08 R0p`8 RSj .< `V< < 0< X X <00<00 R p0q^A-e@p 1SD R8 < #" R0Q ȭ`P\pv `00PP ~% 0A; 0 xp@-0@ ]P0 R p   ܿ00@-@MXP 0T0 00p@@`0 @0)  坿Ѝ0x1q^8q^ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzp@-  MP@/0 `00 00 0@ Ѝp^tA 0/@-@) 08 000!3R@- /@-@<P80080<0A-`PDP@p80S[ 0Aop0 0ATS᪁P <00Q@Q<00P ᖁP οA-80@SP <0Sxp!ᮬ`<0S<` ᥬ0(S8P<  @< 00A-P@h003/P` P P;A⋿h003/pW h003/O-0P`0P@T p p 4e ЍO  <02* 0S0 00L 0S      R<02*QA    Q!P X PPC <082*P 0\ R 2/P \   0  0;; 00X0S000 0,\ $ ` @$( ?Ppq (    IP X 0Rt| R\ ` $ @` \Aq^a1yp@-@P`, 0B 04@0 0ľp@#0`0S 3/ 0 pp@Ǻyp@-@P  0<X00X 0@0 00S` p@!00X0S0X  0@ 0 0 04⟽ 0 0 00 R0S 0=@Sp@A-`P@0pSk"lP 0\ ; 0`0R`0$0`0\ 0( ?S0010(000C0 0 <FAA-@p`p0<00P P h0 03/<0P0  A-@`帀0,! ,1Q 0 @DX?Mb-  2 05S=00 a`09#80 8802 0<<0A-@`Pp<`3  AȹG-`@PP@  㒧,p]0S S8 @ᅧ@ D1. 尓 ,/ 408p<003/3 3@ }0#S0RR00R0S @ 00R80KS 40\ $$\ 0& $$ S ,@ "44Q0y NEFXPi'TDG-p`P刴@PP 0,00202?Sb40003/S3 PP;yO-P0M M @0NpP00SV000S/=,HPo E000B0岧bS00x2Z4 2  R+00\ [^d R  POW Hbd R  Q@000 0# = R8*X0 @00R X@000S0S00ąӋp 0p0p00S ۍ ЍOp[*Wۍ ЍS`S'pW*p W W| Wt W h0#  8 `@Wz͠^r^~^]I^r^r^r^r^r^r^r^O-|@4MPp 80S<0:l=S8708(QD`V< #" R=ZdD`08 R){80 S-d0S 3/ `80SOhp 0pR00 D Υ>w< #"0^0<` `00SQ  00  `0v0 00 00rz< `V 7<0 0` <0 0Q Q<0` 0 xs^)s^ytAHs^p@-P@`& PUap0S \P0 P/ 0 /p@-@P @Hpp@-@`P0 @T:p0S \@ Pp@-P1 P#UDP360 P0 0 00(005@$ ,00G$D4A<>pVs^\s^as^hs^@-@6442<0@D@-@ ,A!Ee0Sos^p@-@P 00P`ie>eAp@A- a@TpUʀ 0! $ 0    !e 0  @ 0! T0t l   ! 00 0h0 03/@T \p P HzhzlzC/0S0!?S,0/8#8S00  R 0 0 000C00, 3,0/?Q0, 0,0/00 ( 0 ( /0( 0 ( 0 / 00(/0/O-@ZU0` P ^pp =,0帢,<zpsL!DH1003/b#-  Ѝ_?0Q R 0h唾100100100 0~-/@@@us^s^G-@p`NzMd1 0 : 0h0 0$3/UP0V/R $0Sh0 03/P@ h0  03/0V0 ЍG@-MP`@@ѿ82`0000 0 00000000 $ 0S882     㬸 P Ѝ@iP04P800@PD00P0t2 X0l2t0G\@`PdPP H p(L>w"p0  ym!0  pd!0 F g[!0 N ^R!0 V UIt!0 ^ L@T!0 f C74!0 n :.!0 v 1% 0 ~ ( 0  $0 Pb0  c0 Pp̾ 00 0sTЍ@s]I^s^AAt^^t^!t^+t^5t^?t^It^Tt^_t^jt^yt^X?AK^|AO-`00@0Q0z P_ PppJ R/U? T嫻2L SARD 420r,, pWp Sp0SpU  QD pW? 医 Q!C0S 傻倻U z PR  PqU p2T SR@PR( 4[Q ЍPR L0Q 0W  B?P90|`tpJO PRS \-St<' PR @0T @@YO^^t^͠^_t^t^t^M3_t^t^t^t^@-_o@-PFd0`@ P0@@d0<0 000`/P Ѝp@ӽЍp]»^`At^p@-@PH`O 0S 000 P0D0L0@@D@嚴p@}A-@pH`P6 0S Q D 0 0 00@eU _LT0S UWჳP @HG-`PӆHp@0L0N<0S73;jyP,$0 ᶶា$0 Paa t XCp~o⍒ዒP P⇒U⃒ ,@-鉆 0X@[A-@pp0 03/` PYV 0ARaX?0   Q @-0 03/P0S/A-P(Ms<@P@(Ѝ0`P0$0(0 `0 03/ 0 $0 0008q/  0P: p 0 `p*08/0P*0=0 888/P< 8!P r? 8 ݵP (<03/ 403/еu^p@-P@ 0 $0 徵ѵ(<03/400 43/孵p@#"-d}P0.X X%,à1 0")!0 <"#1o\Q  " =MbX?C̀.u^@-XM@X   010 H0XЍ6$p@-P0@$0 3/L`V 1SSpp@-XM@P`X ῆ701H0T@9C>H0 @H0P  0$ 0 0 XЍp@-XM@X  ᜆ< H0XЍ0@-P$@\M hO\Ѝ0X ᅆ 0 010408020H0P 0209u^2p@-$0PXM *`XЍp,0@S Q S 0R,@`X P010 H0nTP`  HX  <0108020P,@hu^u^@-$@00 3/ 40S 3/00 3/00 2/p@- 0@ `4P4P0480(0p P s `PU 09 0PA-@p`0 03/ 0PY4 9 0U 09 00<0S 3/ P0p03/7/PP 0 4pW  7/PP P$0 0 c9 0U} ЍA03/$0  PP$0 0 4PUݺPP$0 0 0 $ 0  ^P 徺 0 P 峺PU4P0S ppU 0 9 0( 0 9 0ЍA`0 0S $0p p00 00 P.s PЍu^u^u^u^v^v^0v^4v^AA-@`)HoLp@PU  0R0D0 0 TP$03/T60SG 0P  P

0 1PH\P ?o 2? `V<?oT20S 00\ЍC'C-Qp 0lM∀@0D`+>+ 2@PX @5020X00,@LpST0TTP@P@lЍD00 04家,0X0 @P 0^ax^rHq_A-`MpP`c@P*U@x 0PN0X TBPÂ402|0PSd020P0$P@P(00 <T 8 U400`0 0 j`Ѝ2@^Hq_x^@- 00 00 00  0@P =P 00 0PЍp P 00 0%>0S(0 0TP P0 3/ `PP, PP 幷꠆x^x^A-@00PP 姷0000P80P0800 03/pP` H号`0p`0808(0Sx^y^@-000 00<Ѝ@-1 0 /ЍA-@00pP0 3/$`Q\@    0 03/P tA(`P X90001q  1\1\1 R004`V 6/P`  Y@T :0  B03/t:yPp`P$"y^:y^PMy^ey^Mbsy^y^A-00P0S@S 0# YPP`Pp0S 00B0P30PU*< u7X?__0S/p@-0@0P) 0# p@.@-0 03 0Ѝ@-!à0 0  Ѝ@-0 03  0 Ѝ@-!à0 0 ЍC-Pp`@X T 0  Ѝ0 P`@DC-Pp`@X T 1@0 0 Ѝ0 P`@DC-P`p@X T 3@0 0 Ѝ0 P`p@DC-P`p@!X T !3@0 0y Ѝ0 qP`p@D@-0000  0Ѝp@-0@0PT 0# p@Yp@-0@0PE 0# p@JG-p0(0S P@P |P` @| `OP 0S00(0 3/0000@00Gp@-P0(0Sp@` 0R000 Q0 (03/0)p@@-~0(0St@p@-@`PU0 p@,0/0 3/Pp@-0@Q0Pp ` 2/P D$ @p 0`( "4`#/ 0 /\!\R TR /\@ Q/ 8 R //᠆,@ G-`0$ MP0K p  pp0@*4/@PD00p8@0 4/@PF<1@ 00@P8p0 X (f0 Xd000p0$00(h`X0l`射z@P$0 00 0 P@P $0  <03/ 403/Ѝ rZp@- P@@@4X`TQpC-@$0\MPp`x( X  < YD00010<@1`1d`H0$0 00p0 0 P 2"0 2"oP \Ѝ@ 0b0?o0cS2   $ $0` 1011SX ~ 010 80t0H0P X  ~ 01$0 080H`P 0  rr2 6$G-@$0XMPp`x+ 0/X  ~ X00,10D <11@`H0$0d`0 0p0 0 P% 2"0 2"P XЍ?0 SX  ᣤ*J~0G~0141 H0uP @ 0b0?o0cS2   $ $0` 1011SX ~ 01|0 H05P X  ~ 01$0 080H`#P 0  2222 6$21BP31 a1/G-0M01S`P`1  V~$0] p00 pp0@0*@4/@P PUЍ00p8@@0 4/@PQp1@ 0@0J@PCp@0 YX (}0od0@0h0l0041(0D00p0$00X0@P$0 00 @06`@ }V $09@PG@$0 @ <03/ 403/T@ rG-`0$ M@p0c   0P*5/PP@008P< 5/PPB,1P 0<ūPP4< ԫX (}0$d01S\1 R0 Q0Sj 04PUX  5/PPZ %`1  00PP VU  0o 0$0  p  00lPP 0 8姮YPP  08 0$0        ppp Go57#0娂\1<X0 3/P t5堀7# 000$ 0T p  pp0P*@5/PP/00p8P@0 5/PP14P 0@0㐧PP#p@0 ៧X px00@000t40 08$0p 00 PP{ P $0 ~@ <03/ 403/U  @_P0 0 n0 pc0 0 0 R0WPX# شґXpX XL W014J0{  Z Y 0S ߪW ۪ U 2UЪΪPP+ $0 00 @0p@ 0xW $0vW01(妪W㴁$1S  p0P p Y#t帱ZW W:1S 1S !p0pPt1<1p!A?pP0  <弫 0Np00p  0 !020'> !RR p0,  .x0 S01"90 1!(pp00p  0 !0r匫000VMy^){^ rC{^d{^{^{^\{^{^|^|^|^"|^(|^.|^{^8^{^6|^]I^L|^{^e|^|^|^p@-P`@v  0 DS P: PJ0 0(0L  rPH TXX `[1ap P0!?A1c L\1q`0P!2 SOp 6e `'``` HLaX夬pP  rK 6HF `'A`` HLa9P5 T0XX, `['<0ap P0( ?A1c\1L!4L1\gfff|^|^p@- `P`@0  p `l XpPtHu@v8w`0xya | pH!R0BS2l"p ` XlPtHu@v8w0x(y z{a |  p `l XpPtHu@v8w0x yzaz|^C-lM@d p$X _v02X~P*00 0`40 ` 0 0 `h0&hS `Pbv$0P 4劫$0 p4P0`UlЍ00S00P080P$0P8PX0 0 3/$X vr08,00X0$P  NP 000P0 M bP C}^@-0000000EЍ)}^C-@`Pdpܐ܀\MX  u$0H010 0 )0 1P$  U   `\Ѝ0 1?o2?pW<UG'p@-XMP`@X uL0 H001`?oT20S $0$0 00XЍp2W@- 0@8 0 0$0dM 0 03/$0P$ P 0 R0 0a PPPE_oR_0]dЍ$0 X 7u:020U0?$0;P0QP,000 03/ `iP0`$0 0Q pm zP0SQ0 03/T +P 00 X t20P0 02PP 08 00@-\M@PX t010 PH0\Ѝ02p@-$0P@ ,Pp 0 5P000pDP pO-@`pMP0 0$0 p0  0 wP`\Y Ѝ2 0 P00SF$00C 08 S"00 Zf 281 000 0P00 00 6P ’+0 00 0d P00 0ޢ0  P00  0Т00 0Ȣ0 P00  0Ṣ MtO-P0M@ 0p` 0 0 03/P 勩 Ѝ$0 P0 ?0 7Ppl W 2 0 ZP00SF$00C 08 S"00 Zf 281 000 0:P00 0G0 P ’+031 00 0*%t `00 00 P00  0 s00 00 P00 0h}^C-P@$\M@>R`>:pX  's 0@ #0 01020D@H0=@P X s 0` $0!01020d`H0(@P X r&0160 H0@\Ѝ@A-@M@! `Pp 0 1pA?!0@P !0@P 1 4卦ߍ0 ~@y}^!0RP/TX QX !X T T !X T !//T X0RX01X0T 0T0!X T !0P0//@-Cq O-P0 4P5/0 4P 5/YP 0 4 ;/U ^ 0 !0  8/` PE(_CSek(/C#b?0E,\xkPᰢ1  P !  {0P00 P(00 000 000ZP 000 P (00 000p000ZP  l0 0l0 0V4Ѝ@\@-媟^@-妟^p@-@PPpH0. `@@@Dx$0i p@053\x>00! $0 /Hz 0(0S 0@o/Hz@0 !!/@-0 !@@-0 !@p@-Px@x(P喠 $0dP$0 ,0KO R0(j,04S00!pHzE^\B@-@DF0DS 0 ! 0$ 040]^Hz0$/HzG-`0p$0PUGU !03 0#(1R$10C2r"0Cr!0CR@C@C1,Pk10, TP2/Hz @- 0 ! 0^ Q    D $ 10@X@@@HzQ@-0DPTp@-$0D0P !@8pA-@@TT垞@pP!@@aQ00, ,$041 0,q^Hz` @-,00@10CS@{0@!,1!,0,@Hz^\B $0 0!0 00 /Hzhzlz,0P 0 Qp00//{@p@-@0dPH 5/,0p@ /p@-@0dPH 5/00p@ /P @- 040@/00S {^P0@-  d@/  R 0{߂^@-P`[h@`00@:00  p 07/PP70q 2/U/,i 0 4 8 < @ D H L P0 L P< Ѝ@賞,P P@ Ѝ@^^{$%B,^P^0@- !3 0 !0@- !& 0 !O-rP`Q@U@Tp  q[0p@ 01@U0 0000TX Ѝ  0 @[T Z≐<0  Pڸ 2/p[ n^p@-P @@@p0/{A-`0@P0c  p   021   0 0Q000S$ SAȁ{^ă^A-p0p` R0P0Q0C 0@ E@s @{G-x1TP@Php L幜X 0HS4,0S 嬜め 0 p0@,0T`0,0 BX!0q10 X X@ T0 t  @AL ]@AB S @D{^&^U^^!B SJ @  f r > R"4AQ43 Q!, 8\, ,0@8 @8   ** * 0P0 z @  f rS 2/ma0S8080001@bqR^C-M`pa@p0000g 00 P0 5/PP `ЍCpL2傟@   p@W ("(000 00 $(0,0 0S?3 b0Un0" nU]]PLRPLP*00 PPp008/P  1 000:88/P 寖)>0:! P!: P<: R? p@ P 0j=0:* 00 Ѝ胅^^|^^^^0:B0A-SPp @ሀW@0000W0Sbv000S00 0@H 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzhzhzA-1P 0(0C*s`Ѝ0 d0@ L`P pWQ iQ ,Xs`P,XQ iQ0<00D00 87 H0R0 R1 WH01H0XH01H0 0ps8 4\001  @ 08 0@@0 0s S#4  4 Z2H02,00@008000@@0 0S%40040|A-@P2PXD`q@pWA60@008SQp 0sK 80SQ88   x븁DjXDS< :R!D01 "0D20LML q @T0@0 0s S#4AQ48 ** * S#4 BR4 0R", W S#,@ 0S#,8Q, 0 ,0000001  @ 08 08 @@0 0R", W|?^/-0*T00/-0 T00///- $00/$00/@-@$00 3/$0@0//@-@$0 03/s@->0`@ P  B` 0ŒQΌ Q @圔0T00 P05/P  0 Ѝpz^p@-0P L儔00T0@4`X 6/TX0d` 6/p@ꖆ^O-,M^x0@ d0SS0 p(а d0S ,ЍS CS 0C$0PGJ(0``03/Pu^ 0PP0  (0`P  1p깆^PKB^p@-@$0 03/$003/0$00) 3/ $003/$0 03/ x$0 03/\XP$003/Pp}PUp3/$0 0 N'p@-0P`@ ~_0 0T @ ` BT0 0p@/0@-@ c_ T A-0@IDqDDa`PU P Pp0  R00 C1$003/P00P$003/P0` 00p(d0 U T0X 4P5/T0 dPX5/P^X?^/O-@,M d1!Q єgd0S TX00 P0H 5/pP X,ЍO?d0T 0C?odP2X5/x0d0SS0pd0S LI,ЍS CS 0C0(P` 0pPP3/0 0 0 $La h p@0 p# h00͠^û^^^^x`HB^$GB,GBp@- R 0@P5/00 \p Wp@-@9dP8 5/0dP 5/{p@ A@-@@s@-@00 P0 5/PP \夓00Ѝp000(` 6/ 0000*^O-p0 bԂ009 d;/d0";/0 d;/)`0 d;/d0\";/ 403/ 0d;/ 403/ 0d;/ 403/d0 ;/б 403/@C @0 d;/ 403/ 0d;/ 403/ 0d;/ 403/d0 ;/ 403/ 0d` 6/40 3/=d` 6/ Ѝ[ [ Yf9d`T 6/d`0D 6/0d`( 6/=d` 6/'O-0 c0 09 dp7/ dp07/@0 dp7/g`0 dp7/dp0"7/ 403/ 0dp7/ 403/ 0dp7/ 403/dp0 7/r 403/@Q 403/T@0 dp7/ 403/ 0dp7/ 403/ 0dp7/dp0L!7/ 403/dp0 7/q 403/@ 403/p@0d` 6/=d` 6/ ЍpW pW ZX9d`T 6/d`0@ 6/@0d`, 6/=d` 6/'O-0  q009 d`6/ d`06/@0 d`6/`0 d`6/d`0x!6/ 403/ 0d`6/ 403/ 0d`6/ 403/a 403/@ 403/`@0dp 7/=dp 7/ Ѝ`V NY9d`T 6/d`0@ 6/@0d`, 6/=d` 6/'O-0 0@d@t0"409 d8/d0$8/@0 d8/ `0 d8/d0#8/ 403/ 0d8/ 403/ 0d8/ 403/d0 8/8 403/@  403/@0 d8/d0"8/ 403/ 0d8/ 403/ 0d8/ 403/d0 8/H 403/@a  403/d@0 d8/d!0 8/ 403/ 0d8/ 403/ 0d8/ 403/d0 8/X 403/@*  403/(@0d`!6/40 3/0d` 6/=d` 6/ ЍX ;ZX 6X 1[ 9d`T 6/d`0D 6/@0d`( 6/=d` 6/'p@-@9dP 5/0dPl 5/\0\ dP5/08 4P5/90d p@/G-P@ep|0 4`6/`pW 0;@@ 0<@@0dp 7/@-0d@ 04/d@-0d@ 04/dQp@-@P00d`@ 6/0d`( 06/ p@@/A-@P0  00 `0dpH 07/ PP0 4p7/p@-@P0d`D 6/ 000d` 06/ p@`bO-00pS&Z)d`0\#6/40L#3/d`B?4#6/`$0HSC 403/CBPi XASZ` ` Ѝ0d`"6/d`="6/ `㈲ 403/P `V <d`D"6/400"3/`I  40"3/C0@S Z=d!8/00d!`:/Xd0|!:/ 403/ B?d:/@0d@!8/`,,40 3/0S: XZV40 3/0d 8/3/?d :/ᔠ唰40 3/0S vZ4H 0:/d`00 6/ `d 8/'G-P400!3/o>`d!:/0 0 0 40 3/?d` 6/00 40 3/0040 3/dP <0l 5/ 00dP=  < <R000( 0"(H\B^Z^p@-@ 04P5/0 0p@-0 d@4/s@-`P}W@`00\00 ` 0 6/P BWЍp@$ X@0`<S3WH=8008080(040,0Ѝp@P4 0 00$0v^^^hBgB4eBleB@-@OWP0S00 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzA-P 0 3&*?=0 `p?x0@xp> x0@J4 F@".PpP0d 8/0 dP5/A-@`0p4P 5/0P4 8/`{?0 0%3?0 00 02000%VP4 P0d/// QX0S/X0@0/-0d$ /$ˇ^ Q/0^D0S <//L0S <//H0S <//@0S <//A-0@ 4P5/ 0`( Pdp403/0( 7/0dP 5/P\`\p0 48/  U 0PE( U AnjX?/^5^ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzp@-P@`U 0p U ό0S Xx@x0tdP 5/0dP 5/@pI^p@-@PT@h@@pp@-@P0d` 6/0d` 6/( d`\06/T00T0spp@-@P`\00\0dP( 5/p@`@-@$X H00H00X0@ ep@-@`gP\00\0d`( 6/p@AQ G-@PQ10 d`?06/4 d`16/18 d`6/H0` ``` `@h0@`SlPZDpPp5Q  ŋ0L0GP廋0 d:/ 0dp 7/1 dp7/P0<0#!H 00`@00  00004040P  <匋0L0H00H00X0( $00040(0(@ P T0`^T0XP0T0@`0dp 7/ d`x06/0d` 6/@``p`X0V0C?o20SX0S<0 0 `Fn^^^X?È^O-0@4P, 5/0P( 4`6/P  PX0S   P0_ X0@0S X0<0X0H0@(x X0L U l X` H04p+ <0p 0< 4:/04< ;/ 0 'W0L00 4p7/H0  <0! 0L0+ < 8/04< 9/04< :/H2$p 4 < (p,pLpL0S@0SP0<0aP [PX0S  `  X0L P0 X0<0X0H0@(S?V\n \8PhV C/P` XpP X` `0HP0H0@% V P0S+9`P I YE0T,0@ T09/`F0`F\T0 T 0D 9/VX0d`$ 6/@C-4MPtS@PU嶉 0P 0 P05/`P  `4Ѝ0p"GP `0P P5/N02p0ltNP$@T0Ѝ,pSBp@-@`NPLD厅@00000 81Ppp@>]I^K^p@-P@N01SeN8 p@. R $ R $ p0Nj^@-,0D ,@ 04/01/@-,D@0\ 0@/C-paNP0A嘐T <1S 0,03/000DXQ01 01ف Ѝ͠^YO^^^p@- 0PQ@ `M ` 8ɄU < 0 径܍p»^;^G-`@ pX@ 0sP<WP@ @H S0s  SPW/QP MP P Q MPP Q MPP Q MP W U QPP 7/P@-@xM0@00/X0 @- (/M^@-gM<1 S  x [V [ [C Y fY @Y 0$000000[   ,03/   ,03/   ,03/0    ,03/P   ,03/P   ,03/   ,03/PY   ,03/   ,03/   ,03/0    ,03/Pi   ,03/P\   ,03/   ,03/PC0 01P000P:00 0 00,p7/ 0p 00,8/0P000} 0Sz 0 00,p7/ 0,, +  P1+ _ 0 00,`6/P00 0 00,p7/ 0p 00,8/p 0 00,8/ 0 00,p7/Pꠂ  10 01>  0P 00 R0So  ,0   \73/0PP1>  X  X,0   L3/P0S  ,0   \c3/0P 0,0 0\ 3/   ,03/3/   ,03/   ,03/  00X 3/   ,03/3/   ,03/   ,03/  \ 3/   ,03/3/   ,03/   ,03/  pO-M$( E8@@  03/ P400\00@; P5/P  03/Pߍ80`0<0d00X000 0 P%6R0P0$0(P3/0P 04 043/P 083/`d,03/P\0P0 P X \`,,0 d3/P0T CRꈲBBBBBBBBBBP0[[n <1QU! !,@p!;!  9/U\0 0\00 00^@-@M. D 010K/0  $!(! 111 1014!, p1>  ލ蜙BO-PeCLDw  Q&R4 R(9w@TC3wQ.wJC(1$!'w0aVKO0S 0800P 5/P Kw @ 8$D0<4>`P2帢42 4HV6wG 0 P Q CPP`P$0- PP ,2 ,4$2<0424242$42(484,;/P00@4$0 0S( R !0R "0R 00  1, 04|1<4t14p1$4l1(484,;/P00@4U@$R0\`6/2 ,`6/PP2 ,`6/pP0,4004040$4 %0Pv tPv0 jPv0X4Ѝ]I^B&^B^,B\CB`^lCCCCtCHCtCCCxC8CCCԒCCl[C8[C^^ 0R R//@- 0 R0  R0 R0 R0QS 0 P ЍR0/\p@-P`?2S @(Pp pp@-a@0 sP&vPp`PP 011D 0(1S5Q   ~C^b@-@h01p@-`PO?@P z P p@u 0t(0 'P p@|0H1x0p0p0@1l0D1?` vw0P0P P咻P@u0H102p@TB&^ hB(B»^lCؑCCK^ 0R  BR//0P Rʬ  R: //C-P @hp\ 0s'T Ѝ@0 T`1k#XD  &T09/P@D P 0C-P @hp\ 0s'T Ѝ@0 T`1k#XD  &儐09/P@D 倐 0p@-P`>|4S @8Pptp@- 0 R\0S 0 000P00 Ѝ/\p@-Pz>00S PpU@t 0  tOPP xQ tt0x4< 0IPxxQ tcxTPYCO-M`pG>@t` tpP  k P ЍOt 0A(P0000h0 00S0404РE>L00 8/P ЍOY04 04 0S E> L00 8/PB4X 00 0| \6/P p `$ (, d  0hl 0W*0p4W Q0CpT=X \S3: 8t `#8;/T=X \S< x `0;/X=opT=``S> 0| \8/~0@-01 0P Ѝ`1\p@-@T=X PS0@  ``\6/0  T-X=\RB  0`6/T-00X 8RB  `P\#85/L 0 kT=X \S`PA0@  5/p@0  [^G-BMPpU<U@a 0h#8P$  +PP $R0$=1S 0 # PP r PԢԒb0 T-X=\R ( 08/ PX͔\T=' S  ` 08/T=X \S  `08/T=X \S  `(28/T=X \S ( `98/PUS  `P05/T=X \S  `P05/T=X \S  `P05/X 00`P \5/dQT-X=\R0 ` 0`6/PUT=X \S4 h `P05/T=X \S: t `Pb05/T=X \S< x `P05/X=\@PT=S0> | 005/0 SW0l l 0.POBߍ$Q $]1C/]^^#E5\G-`@a;Phq@ X P G@q 0( 0X= \ R R! R pWT-0R@  9/APqpP0,=T};n 0\ R`0P xq G^ ᄷP 01q]I^B&^8BW^^K^G-p@ `APCQR p U010! A-P@` 0$ pE\:n X0 A\ ^G- P$`(p,00 N\:n AY Y@0 G V @ AT/C-@P@@0$M,'c 0`巈Ѝ\P p@-PH0 & @4' P l1  0p@p\@-@xPt`$0M\p'P l1 0040 000p`00 Ѝ\G-8A4 FP0@p0k'1`W G1C7CW$" 9x@|A"P!3qTp 0 9W0 G C CЍAT40 0 0 p偉0 0 04/p \d@@-@( $0$$"6 0'@\@-@`Pp<<0$M('(0 00Ѝ\@-@dP`p$0MH`&P l1 (0 00ˊЍ\0@-P$0M 0 0 ,Ѝ0BB@-(0 0600ЍBB@-@9 1R0@-80( 4@"6 0 &$h@&\A-`pP@b9^ T!0OR000 A/@-J9@☑s@-P@C9aV 0@ (6/@P@Ѝp@nvd~^@-o/@-p@-9@]Hl1`>p@-P@mٮQpl! @-0@( >P/ Bl1/G-}@Ṯ`PQL1S  BdP 5kᕅ.99`B7P1QY 0 0`0 0VP቎\>k>ᑄȳ cGuX?^A]A]p@-@]؄oL1!0CSL1Qd᥮p@p@螮0S$00 0S 0S/0 d=;d=/0S0 d=;Ód=//Q9 )R4 -09/00@-DM000,00(0\0 0T0@00P0<$  0A<0 P jDЍ0^/Q^$B]B^A-@PT=X `S8 0 `p\#87/T=X \S8`p 8 #87/pT-X=\R 8 08/  pW0 tVm9<l=D=S  z60 ,Wj9l=hml]衆g^^O-@0P `phPh=Sl=SX=pT=\S6 0l ;/l=0l=d=   P Ѝ T=X \S6 l ` 0;/T=X \S6 l `0;/l-k9T-l=X=R6 l 0\;/ P DlT-X=\R6 l 0;/ 0P4xV^@- PU `h=@Sl=SX=PP@pT=P\Sl 06 7/l=0l=*P ЍG-@`pPT-X=\R0 ` 09/D=S+NXT-X=\R0P  5/x0PX0 `l<T=X \S4 h `08/ 0 ll蠆ʘ^^000 ͓0\S㠢p@-Ph@W1 01  hp@WG-@}`JƬ1吀011S #S3P11011S 0bPP 10CS1bPp@-@mPᘬ 10CS11bp@̬=  -0=X T=\`S4 0h /D A-@P`}X= 0\8/  D=S1pWk<T=X \S8  `p#87/T=X \S  ``06/T=X \S  ``06/X 8 ``\#86/^p@-]p@1-P Xk= S-<<h=0=0>03p 4^.B]A^ 0!< 04 0 (   !/HzhzlzO-P@`0ȐpW #  Ljh` V 50000@@ T Ѝ\^\ P/0 !8 00 (  , !/Hzhzlzp@-@P T⹖9S 9S 404 0@a 0 (>p@BX?gfffBD=S/p@-@=P0C==0CS=>3;3p@hBA-=PS`p @PVD=S@ 0 &=@S蠆A-@p !P`P  0P Q- 0T  \jЍ0A S  ,j 0  ꑙ^^@-@00PPЍ7@-P@@=S 0 7 00009Sd=000 PH=SQ  OZ09S$B,B,B B,B,B4B,B0?0?h70?|7S 0 0@a 0 ( |7S H/ox""0 \  R # 40~Yq 4B^X?gfffBAp@-PMM@x#cP00C0S0ۍЍp S;0#0Q0e  Q  QH @=SA a"Q{  Q: @-RX"QN ["Q[  Q* BQ@-\ RE"Q 2Q*2Q-0S00?600 {@2QQ 0CQ0Q 5>8#8So \|T` 40SS`  /  ("(  "d@=S d= 0 CP6M0000@=S d= NR d= 6M0@=S d=N0@=S d= N09S >S$Q:0SKL  S* 0C#1L 00 3@=SH0QN0 N P%F*+:iA-όp` 0P@aP 0 `YP Ѝ!@-0  ЍA-`P0@p8=3/h7 T 5h72A9#9'@s@-HMPT0 S( S S@@n R 3 0ttce h@Ѝp@S@ S S@ S@@S@@Ѝp=B]^O-@lM@=S D=Sd?`< ,02=0>0$0=S >S3;3lЍ9S9 YU 0S990090C9Z0 306 p 0 P 4 0 03/039Sb.030@]  \P303TW ?9STP周U MPU 0S000000C0_ Z0(P 0 S30 03/ApPG2 0 ɠ#t PP\"(0傿)R d- 03\ʔ#G   0 妦D9Sㆍ P0S ` P 0!:> *00! 420a08/ᠾ(0"0D100 0$00KC195 S) 10170< :0[(0 501=0,0P(  0\!X g.d=  P 0 H0 0YXZ Z!0  b 0   0 PD10=   =0C== S-0>0>pꨌMB]^A-0=@S 3/`pD]U ` PP `V|fPT=X \Sd 2 0``6/T=X \S4 h `` 06/  N4v^A-S@\`M 3` <3 1`0 `ЍP bVpP 70E?o2P0S P   :1W00`pPVP3<30A-MM@p$ `PPq`l$A0Vn  V7* V  V @-R ,zx $VG ? V Vr  V@=S0 S0N0D Sg*$AS0N0; S06M05 AS0N0/|#VP+  V* BV X RVd=B @#V  ;0#VV  BVd= 1A 00 Ქ0 ۍЍ \ R\P@-R 6  -0 P Pd= 4S0N0 S0N0 VAS06M00 PrP 0C. P 0SP@-:R .0?T0:@=S >P@=S 9S H=S S S!Y0>0P30 00PPz0 00@=S2Po 9S#Pk 0P Pd P9S9  09Z gPP S9i*F%-? S/@-@pP`,M / @/"0 @,ЍC-3@@DM > H=S  CR)N <G a3@ > d=;d=9)"" 2PP 3@. >DЍC> P@ H/[0 l U C/@PV0@0 TP3@ > U DЍSP- 1R >  =H=  S9S `P^ PP0 S 30| Q ;S3 #d`P{0 PP` V@p * !(#j]$ 0d- /p7/@=S/D=S/=G-@@=S`떟p  43/=S-D]UT=X \S2 0d `:/> P=0 .:^^XW3XR=3 ,=3/@]G`O-@P@MY,=3/`P0@= -`*H=S989d=0d=9SCCCCCCCCC`P  ?< ?989H-R9  ;S ږo #}> p ;gQ("( ;px0} 0b.0 @9  )%$ ~  d=   d=  d=6   d=  :S0?ӥ=t /9S H=S)> L <H=S $> CN0\ ; ~9S 3   s9 : 00 x0======H=Sp3iYh3f 0>>0.>0R 3;@030)9R3S2T=X \S2 d `P05/Y 9S HQ  9S9tR:k@+R0 0m`Ѝ  H=S ?  00C0S0020ӕ fڮ۾=-  P  mb `ibT-X \R0 ` 003/ T1XHTb<`T-X \R" D 003/T=X \S4 0h `8/= [0=S0- 0"-@Q PH=S 0 yꊚ^  -%3$B]2D 1g]8 7^m^[^p@-P`S4P@@MT @:刺p0p@-@2@=Sp>PS 0CS>02l^p@>S 0CS>H=S >S02p@O꥚^C-PpM*P@ n`h@P $Ѝ1Y0CYD1Ye 1Y 9 - 09 fx94P@4 =#@=S M\1Y7 1Y. ዩ@P#@= S7 9S    @N S 6 ṯ4P@3@ @R0 @0 0]T@P4P@3@ WH=S@2iii9iO-@=@SdM  n*P #X=\@T͔ \4 h ` <dЍO/0 000T-X=\R0 ` 0P5/P  . T-X=\R @ 0`6/<00p  0P 0t+t`2 9S2"ἴ'804;[:9S { T-X=`R" D 0p\7/=-0C==0=1  .& nT-X R$ H 00\3/00` (0P㖯! 0@*4`= 0.#3 ;3& ET-X R$ H 00\3/<0 0` 0 P▯4 0)n`= 0.3 ;3 T-X=\R  0P5/` 0p`1)S q S  BS T=X \S=4 8h `P#85/= /3  d=0S P 0=00 S0( 0=T=X \S`02 d `P#  .*0< 01(320@@00` P! (ǟ:|"!(.$΃$ *00! " ( (.@70 p07/0)0RSЪ 1P 3 5*8S00C8u$ ᝇ*Յ0 0 0iX"tt\2 `P [ 0_ 8⥻P 0/+)` V0%.F'K+~Qp  ➟0H(མ=[)0@%\W_= -JZ %,J_=0= ؆0F&>=~)0 S$bWP /_X ?\ ;\ 7\ Ttᱫ .\Vt)\p'\ )pXG&n` K+Q 0 /؞w0H(མ=[)0#^= -JZx#^=0= r0G'>=np S0 0 02_0CS񟗃,#C#CP#C#Cx#C#Cd=0d=9S9Stv `43/+jd=0d=fH=S >Sl"PZ 0>W9STd=0S9`S 4Q`PEUP#D뎄 U >^pP>PI 0$ 0 0$ pI-00 02` S02́"0000H-Q0R RJ RD2G  0> hP``:g>  (L0>YP 1>#F&U   0e1  ?& )22?2 ?"LP0C.>2>2?5?# R #.)t^oDkB]^B]B]̨vB]К^ޚ^^ ^48|'^1^H^i^}^^]I^^O- @ $MP( Z $Ѝ] ^'ST=`X S2 d `P0\5/T=X \S4 h `Pp85/0D= P0D=U_}0 4"P  .PXB  (7Z0p 00 pp&ZH}0wQ R*Z0H=H=S10S"tZ0H=0 000X0 0d1!42# 0L= yZ( A0(=v pnZ0H=0dp0 0 1!ᬆ2# 0H-P=R0&SS+ 000 j P0@S0.S0-S0 S0H=0 00C 0 B2# 0 B2# 0 B2# 0 B0P=A&H=S% S% ZH=帥帕S L}d=d9:9"a0@gtZPd, (:9ȏ"a@h 00Y & ' )+5),|04p@04\r0404043099!= 0 &P \:0㠠 0I10S S2 ԊJ베YH0D PG0  SBQQ Q"< 1=0:H=S0 d=  0 P0 d0מ0d= d-H-R' R R;P d-Qb?)d= lQژ0d=\3Q8<9 9<9< !S:SG\/d-P-R2R9;998<9 9<9<  : (0 P0S909 0 0x 0 RPl 0SiڴyX &>02 t=$2(x=6=⾀ᰀKu*44=4!8=141:1:141=1=1=1 =vM@p1X 0>9/  u&>pp1a  8l&>p0T8<;Kj>0d=$1R| xH0P-d= 1R9 <9 p@-@o$P3 3@0 X-0\`PT-R2 d 5/T=X \S`P4 h 05/pR2 d 05/T-X=\R0 ` 0P5/ T=X \S`P02 d 5/p( /,4S //0l#R" /04S//G-@0Rbi?0ഐ(0 :/03\"0:/(0 :/0/ 00\"0:/\#0 :/#)4\:/(0 8/03"\08/0/ 08#8R0003ЍA-B肐P`,0 3/,0 3/,0 3/p,0 3/tpO-P8s@0S䢐Mhx&h'x0G`+0 L`F HH2$43/02002T`Xp!: b0@0005C(4CEC4CL5CL7C(HC@CA^@-@4S@/G-3PA@,p0 <300Y SHbVHK3<3㯥> - 2X>00`V  )P 3<300 UHG(O-pPBbM?spHs 0(:/03"0\:/ 0(9/23H0\p$#7/0\p#7/0\p#7/13\p# 07/0\p #7/,3S 0\p#7/\p^3"׿7/\p0"7/6>\p" 0`37/0\p(#7/0\p#7/pp0 (9/03"A0\:/p(p0 7/p0 0\00 p:/W +pŸ0 \pp0 (9/03"0\9/p0 (p7/  ,0 #3/,0$#3/,0(#3/,0#3/P7 Ba0\p#7/0\p#7/,0#3/P0S xB,0#p3/,0"( 3/0  0 Y00 従3 0$ 0 0$ 0 0 0Y3xA00C8#8S0s p3/0 0 0   43/hG-p@}PP7 3T(@23 ` fTჽ0& +V000CC B(0"(T1!T@ 0 :/ D Hp$HT 0P `>P@-@P@e@/O-@RbM0 (p7/03\p"B07/0 (p7/,0#3/6~0S_ 0 (:/03\"0:/(0 :/ׯ 0@0C  43/1Q 110 0 B0 A B0  P B B 4 S R R0C("(00 0C0R0ׁ\"0C0;/0 SP 0 0 S4ЍV^@-l3@S 4S 3/P U0l3艟^l3S/ 4@-S@3/0l3A-@Pp%P1`T 0CT= 0CT  ѣ@1T@P 30300SE@ b@P3A0@S AS S@P3@03l3S@  ᒣ4P@3@ 2iiX@-@}Tⱓ-0@ p@-@(4S 3/P79_ᚕ&⒭p//O-@`pM<0@P( 0 08DPE/0 S ^,JCKCLCKCL9C^ԒCCCCp@-@P&pp@- @4P PDp$0 0!0 00 /Hzhzlz-0 ,0/-0\ /@-00l@ 4/Ѝ@-0 4@4/-0d /A-Pp@`T d08/< S   S Co    / 0 /8$@- ? \p@-d0@#0?HnP᧐0 0110  00p@ڐ\hp@- T?P@H1`S GP 0 p@0/p\hp@- T?P@xH1`S )P 0 p@ 0/p\hp@- T?P@ZH1`S P 0 p@40/p\G-,0P#0?<H1S@P0#`ΕPh勬n0tp000!1-1-10-1-!03/0 P1UP!؀0!8/10C1101G0\@-~M@ P`  880U VA0$MЍ͠^û^^@-<0DT 0 !0  !0@- ! 0 !G-L1@pT`,A- (\0@ R'3/# \03/\0P$3/00S "YZ x0| 00++R4Sx00x00 1 PxPh\0@3/ PU`0 83/00 (P 05/ЍG̀H|8_I0 0 0L \00P00T0[C\CD]<\Cp@-@P 0X %S  05 0pp@-@`P 0X &S  0U6 0pU 0\00`00d0p Mh\C\C\C:^ B/o P" RA-P`P@& p@" p@OP@ 0 ??00??CS0cS@@-@`08 3/ `0$3/\083/P\0$3/8-lM 0 f lЍp@-81@S@00tP-1-!03/03/81SEt0\` 6/t0\` 6/t0\` 6/t0\` 6/t0\` 6/t 0\` 6/t0\` 6/t0\` 6/t0\` 6/t0\` 6/0p0-181S-1P0 0CS-10-1-!03/*10*1*!0p@/A-P` 0p9@@ 4D1S H!R 3/0H10@ 0 0 0Z`P 0/'0* PunW pH|_PD] *08'1Q0@   D-1/p@-@x`tP03/ `V81 0CSp03/ 0 3/p@d03/Pp@-@tP81S@  03/81S 03/0 03/1!03/81SS/10!tx4``8 #86/,!03/*! 0+!3/0.!3/81S t#0\` 6/t \`616/81S*!0@ 3/ 03// 03/*!03/0`1 S 03/-!0p@/,!0 3//!03/0!03/,1Q@00,1&10/!!R !10!&1/d21S/*!Q00*1&10/!!R !10!&1/O0| 00Q  Q  BQ*!0 &10/!!R !10!&1/*! *!*!0*1,ltG-@ p?p(,`PP H1SPЍP  0$P 05/pP 0  opP1T 0K?PPᨌ00᠌1TJ t1T0CT 1 P 1?A3c0傌\\t]t@{t H1@Xt@jt@mt1(@1(Mb31S/ !t       000 `0/p@-@^` 10 1@1  ``0d 0 `0d 08!@0 0-10BRS-10-1R-1@0-10-!t3/+D1Sp3/0H1pp@- ?`P0@ @003/ỗH1S P 0@0Sp\G-P0`#0?H1S@dP 8!(pR' pP⨏YȀ6$0( S S00@ 0990`1S @1S bpP,@ g,0B 00351 p"  4!  *!?   *! +m R*!4 1!4!0)1(0S`1kS*12!0k8!0GtpR/1v00q R0 00 (0KS0ږ S~0A0R.1.10.1(0\1`10@1&10!!RF !10!&108A00 1 10 10%1b 1 10 1281S'000003/08m#!Rj #1fR*!1!4 *!*!*!  }S*12!0*1 0 0 0\8O-t0 vpTM`? @PpTЍ0  1S aP P0 pxP 01=P0@0S`̐@1S 3/P ,Ipv0H1`0d 0h0S ܂0` dQShP0 h00&0-1@1 -10-181S-1P0 0CS-10-1t-!03/03/'(8> O !n l0$@=L0K<1h t0L L ,0H 9,0,08,0,06,00`1V1810<1t1D1傏o  111@1 01 10 1 1 6 0 ⿒pP0  03/pP3 0@00S-*ՉaSt Rh00SZ=9 R =?A3c2#d S 0"#!0 "#1R 0 34EJ\^MbHH|+8X?]p@-0 `"6 0?H1Sp@TP 31S ^ጉV 1  10 Ép 10 10%1 1 10 1<\O-H!R &P %!PR %! A(0q 01pBR0  R<" 0"  @W`0@S @DWc AN3!  BR!V: !K !  !-! -!8!R:-! -!90@`FS AV    R<1! 0 03/p !  !  !0@`S @D` BR-!`t6/ ! !  !$!R ~$ˈ'a(A(5!@ 0 2/4!  #! #! , 2/"!R "! $  h0AE0,0 ЍO/ Ѝ8X?`CO-H1S~ @LPy  tPↈ03/81` SP4f03/\,!03/03/`81 S 0S @0P 3/10u03/ 5 R $ Q Px |  Q $R0x0 x 8!R0 !e `V03/03/`h0Sd`VG P Ѝ3/0>  3/,!0 3//!03/0!03/,!03/ 03/t03/ pW03/0p3/ 0KG0 3/0k,! 3//!03/0!03/,!03/W0 03/  &1S 0!&11!aV 0V`!p0!7/10C110103/`1 LJ%1$"!0 o 2/<20S  $0 R Q x0| 00 P04S x00IS 0x003/ Y 10%1 10 S 10 1 Y 10 181S3 0CS-100-1-!03/03/'at!`&`'  Q)! (! (!)! 0110$1-1-1 -10-1-!03/!1S0!10"1^Sj'H|_X^^H@-@M<4@A-p@ `0S @S0C0\0@3/\03/\0P$3/l00S "SRH x0|00Q4Sx00x08H|_ H|A-`0@P0 p0 7/pP pzVB `0H3/ cpPKP 8 `8/ `0<3/V `0(  (3/V`0MC <3/ `043// `0,3/ `0<3/ U `0H3/ `0 3 %pP V8 `#88/0FS `083/ `003/`08 3/`0 3/E$`0 3/V@  3/ЍC-`ph@(h _0 `PP 404 x F(Nlpph`t ЍH|_Hˠ^C-@0`pMtP0 0``D  Z  V R4pTQ  ⫅081@0f-10-!3/tI>P0 | Q S*  S  h LH60S t0h,0P B81 0CSt,0S孪 0S0@00000810C S񟗽,CCЊC|C`CCCCCCC000|e00 ㍪0K  X E0  0D0 Ej454eAl1,5Pp1$5t1 z 0 1* *10*1@ i 6d#::d` 0l$  $00Dt "@1S0H1T0< 0Q0 Ѝ000d00@000d00000c00000 0003/c000 0003/ct Pt0 4`x6/  `R006/(cZ0 006/ cR0 003/d٩03/Pb03/Pb`0`0081 S= b81 Sx03/0` 3/ 03/03/ 03/,,0 3/ 03/03/ 03/ > < @000;0a>03/ 03/ 03/03/P0,, 03/03/0P 0     0 03/0S` S`0 3/0@S` 03/C]I^^^ˡ^ȄCH|_ݡ^'6^^^`_C8xqCyCPD]i^zCB^R^\^i^t^^^^ ^^Π^%^נ^^.^^0@-@PtM0 0 00tЍ0p@-HP0S p`@i<P 0ST00pH|@- 0 0 t3/p@- @tP 03/03/pp@-p @^ᚃփp@-A-4@@000c"`\p0P7/2",p7/$  #002#,p7/ @&& 0\"A/p@-4@@000S"P\`06/"\`06/2#,`6/l"?0 \` Q- ( "(R0#6/2#,`6/l2#0@000\`6/"\`06/0\"p@/A-@0B03 \P05/2 ,P5/2P,` 6/ `~? 0@S! w? P03\` &N6/0 e`xp0 `xVA藙HY?$P@ 4S?0P,O?#P-^[^l^2C2CD]r^{^#^O-P \h ( ` ,@,4/ R@ Wḑ0 0 ,P5/0D(0@0O-P\h@RpC$Mx102c000`0 00Y PP 00$10 0S[Ѝt0S 3/0 \$8/  ,0,3/[ t0S 3/0 \`$6/ g ,0,3/ 0`S  d0 z}0X?^\0O-@M0Q05php  P@/ Pt0S  3/0 \P$5/ )0 ,P,5/t0PS  3/0 $\:/  ,0,3/I YʠUUPPPPPePS UXt0S  3/0\ $9/0\ 9/0 ,9/P0\ P9/0 ,9/P0\ P9/0 ,9/P0\ P9/0 ,9/0P ,P9/PPZU00ЍPt0S  3/0\ $9/0\ 9/0 ,9/P0\ P9/0 ,9/P0\ P9/0 ,9/P0\ P9/0 ,9/0P ,P9/PPRU |0 3/}H0 ,9/p +40\89/  {0 00 l0P U0 $0\P 5/0 ,P,5/rPt 0S54 t0S  3/_0 2 \$0:/  ,03/ ,03/ ,03/ ,0 3/<0S ZP 2"0   X?$0$P 0#! !0 1/X?MbG-P\ `@0h0p@$S T @@p@0 4/Ѝ  \`8V@0\t$1D 00:/P@\' S"PT0E 0 0`` 0 6/@D @ d 0D9/`FVH0P@`S"PT0E 0 0`` 0 6/@D @ d 0D9/`FVH0P@`G-P\ `@0h0p@OST 00@0 9/0P@T 0 ,@ 4/Ѝ  Q`4VIX0P@PT`E0 0 8/ 40@DQ T$1@00DD9/0P@T@$10 0DQ& S `VI0P@PT`E0 0 8/ 40@D@0 4D:/  `FS `@0 4D:/  `F@-@pPi}`P"0 , Ѝ@>0P > Ѝ蘢^^R0 R R#+ H@-;@=#+## #/#+## #.w걢^ܢ^O-\0@@hpTwP3P p@K O e  P |0 ,,;/,0 ,;/*0 ,;/0 ,;/$ 0 ,;/"$ <"0 , ;/"( 8"0 ,$;/3- R p  34 8\ 0 08/0 ,8/2 420,8/", 4"0 ,8/$0 0$00 ,`6/$04$0p  34 8\`  0 06/-00-03 03 v3 p0  ѣ O~u 0 0 0@40 \`86/ 㾣TG-@`hp?}|03/<08 PPUPR40S0P U`  l= X> D>@>p +\0x!40\8G/^^^]I^ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzp@-@`) 0p@{P7vP\v 0T L0D{: 0 0 0 00 0h0 03/+^T^^%^c^O-\0`pQh@P t0S 3/ 0\$;/ p +40\8;/}0 ,8/p +4 0\88/ آWx0S 3/ OT(0,0000/@-@0\QshA-`p P @{X0VP`|`hp3|\`/|{  C0 RD   R8  | R, |  R  X R X ]sCCC\ܭC@-@0Q !@\0@00A-` P@0S P 0q@P ?PJsPp@-P@sp@p@-0`@hPP 0 \00 ,@,4/pzP 0 0 0 0h0 03/P 00 0pp@-@P{p@0,uO-Pp@004{Y 0 S0 0 ЍO0  `P` Ѝr@P`  T0 P  0ݼ@@ꈣ^O-@MphPR{l!s`P ߍOK{rP! \0W%p  P@<0 R80S@p<0$Rt+{堡80SOʅߍr80S<0Qt0S 3/0 \p$7/ メ ,0,3/p<00St0S 3/0 \$9/ i ,0,3/<0 R@ 8 R4S@0 uw0|r0Sz<00  z<0S( 0 wP z0"Pwz < wP z<00 Rp    z`mt0S 3/_02 \$0:/ X0\ :/0 \:/ ,03/XP<00 ,03/P@ 0p<00 \0(0 2 \$C\#<;/. 0040p1 P3 3 p +4 0\89/3,   $r -0P00 pP* 00 0400Ba 0"3<3$Ѝ 4à@  P ^8pP pP#8 ㌞MbX?CA-P\ 0@ph`t0S 3/_02$\p 07/(0\ A/p@-@`w 00 0wPP 0S  0  0` tt08 jtU P 0,q p@mq꟣^\ A-@P0hp`T T0  ,0A/0 0 8/@D@4S/-2 \#90/@-2 ,@4/p@-P@2 ,`6/”0P\0p@ /@-P`p@(@Đ0A\ py ЍD]@-P`p@p(@Đ0A\ pXy ЍD]p@-@P0 \`6/㸝 0 \`6/㯝U0\ p@/PG-p@d尐PV㬀ʀ 0! $ 0    !&x 0!d!0    !0GHzhzlzX?7@-@ &^#0202020 DR2|0嬎@4S0000 |v2S " ᲎" Ѝ0@ҎꜾC|CȽCC2C2C@-@ &@w@-&wPp@-@P&w2020p@-@4@SS&tw 0@X?@-@&@w/@-00 x ЍD]@-@8Đ<0\ @/@-84< ,@4/@-00  x ЍD]G-p@d尐PV㬀ʀ 0! $ 0    !&@w 0!d!0    !0G5HzhzlzX?7@-@&^ b0202x02p0p DR2h00000 u2S " " Ѝ0@C|CCC2C2C@-@ &@bv@-&vPp@-@P&v2020p@-@&v 0@X?@-@&@vP/ 0\R/@-@ 0^   \R@-@0U. V? M4 Ѝ@3ꦣ^ۣ^A-PQ+ t@pT'P P (`0d 3\0 @P 0t000 3Ѝ@ ^^!^]»^ 0`( "4`#/0@-PϠ ,@ / 00@-P@M0 00000 0 0 0 0R 0R 0R  0RPU @Ѝ0E]@-  Ѝ@-  ЍO-M@p0 (P $   `0 S p  .(Y Uߍ      0 (p @0p@-@MP `y  @ @@ @@ K }zw t.   ܍p@- < Ѝ@-@ /ЍO-MHR@`L @, B?<00p (008 <040,0$01 @L +!0$ 00,0 0400<0 0 (00 000 8 @0 $ 0 "$ , ", 4  "4 <  "< 0 0T p (08 L @ `  @L $, 4<\.@N JߍO-MHR@` L@ 0(0 0008 00!p000 (S08  } zw.@ ߍ_00! X ( S 0 N 0 p$008,0040< H @L B8$`!;00,!4 *4!. $<! (@p@-@MP `  @ @@ @@  x  .   ܍pO-M`@l `hh2 00h2$p00h2(P 00,L  @ H P 0 X@\0T0L0D0@ `lx @@!H!P!X !,0( $ OZ`@ h$(,.` @ߍP$0 (040,08 40<00<008%d @`0 H[ P W0 XR00 D 0L40 L0F8 TA

$;(8,5.` @ߍP$0 (040,08 40<00<008 @ 0 H P 0 X00 D 040 L08 T

*P0&4#000#0PeU1! 0< <0  P `F@0HV@0 00o`V 0  @02 4  i0<0 Ѝb+v 0P0000#000&<#00&8#00&4#0 00# 0C-P`80<@0CQp80 aX!0 P<$0 I<00S<0,@0 0`pPE<0U @00 0 `pPU 0  %$- @00 

0  >2  >2  >2   m  &ލ0 0 000 00pG0  |0000000 00@A S " /@ 1"à ?; 0 0  0"  0à "! 0?$0P0/O-0`hT ctPfTPnT' P%#lT% P%n'.* *nDjX%(P *hT$h*P%*bT%b*lT% P%jX%P.hT..aT%a.P%b.bT%l.lT% P% nX%!P. P".@$iD$a.@$i.lD$). @$ @$ .d. (i.f.f*. *b.*l.b*@& .**.j.# 0#i4#0#&iT%a.b4#bT%f.l4# `&lT%0#P%e8#00 !.a'b4#b.b!0# l!l.l$" !l4# ".!0# "a.b8#0 ЍG-` 0 ,Pp.p p!!!#0# "0# 0@( ,,(.  0!p0 P`,``!!#!0# "0# 0p' p',p  0p@-P`@PEUp@#! 00#0 00#0 00#0 00# 0 00#0 00#0 00#0 00#0/@ "1à ?< 0 0"  0  0"à ! 0?#0P0/O-p@`X:[OTPa!e%a*ek!l,l., ,a, i)i!l!b"b$.0 " "a(" c$#c4.0#0#b8#0`4 `$"c("  b$"a4#.b8#j.0~000/L00 0/LG-@`pP0@M 0a800,($@ @@ @奶008 <0a,($@ @@ @営T00L00000S !&.L\PP &> 0S !&> г&>ş 0S " &> P0p0 58/5 0S !%t&P p5 0S !P5<< ⚳$ş45 0S " 5 ⋳P0p04 8/؄0 X " $P P0 PU " 0\\ b0@ğ 0S " (  SP0p04 :/0 Z "  P P0 P U " 0xx )0\ß 0S " D< P0p0 $3?:/ 0 ?R !P 0 0?S ! "0?X0#00tl P0`B0&.088/&.SP &>0 в&>/˲P&.00!08/!5P 1 Ⲳ1!孲P&.00l!0p8/T!8P <1@$ ┲(1 ! 史P&.i00 08/ P 0 v0 qP&.K00? 0@4/? HP ?0P4 X?0 $SP'ލS]$V]^T^S]_^S] 0@-ALM0 P0`5/(@ @P @0 -@ 0P00 (p7/@ 8P @0 @0xP0 (P0 p7/8 PP 0@, PLЍ|X]\S]^TX]^LY] ^p@-`@pMP' ) %`a R @Thh pЍp07@-7P|@~ Q@00#47 b0 P Q0 Ѝ0r00#4p@-@P`\08M 00 00 P  ~8Ѝp@-t @v0p0p@-0M 0@0 $0D0 (0H0@,00070P` P `@0p`0Ѝp@-@P7`ptM000 (, 8 40PЍP$` 8}0 p0 P@`pPtЍC-pp0MMPSrX@`P `o0 (`(0o7 `k `g`⵹ N 7 (CpWIKp I7 (K♹ . 7 (h `/0 `0/7 `+`yp 0b"!4b4# 0(0 7  (p0h 0p0` Mߍ7 (O ( pG 0O-MP$0?0AP (0p00l  07 00010D \n D0Q`l7D\` R 婰@hR 0T ``Z0  ( l7 ? 0 , l)0l P0Y R ``Z0   l7 v0 , l Y  07\S0lpS WPUZO*ЍQZ]d]p@-l@P  N ,ap0@-,M@P"4\0    000Z?v,Ѝ0<(^ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzG-pP7`4A;"T ߔ, LaT@! PU,QP N  0 0  0< 00M  ,QЍG\@-$M"`||p0 1@P D0!4a000l  K$Ѝ<\0@- $NK@ (4D\87D@- Ѝ@- { Ѝ@- Q@05/cw^ p0do00`0S PX 0p  0벰p W` 0S2001n8^0 Sd0001c00fN8Q0S00d0Q00@Sg/1!t115+J`!01\A  1ES  0310@0/1S01 ЍO16&!6&0- R    R    R   "-" R   .R 0  S0@008Sh0 S,/01 ꨌ^g]}RD,^0.R  "-" R   wP/P/////R\^D,^DT^Dx^Dp^D,^Dx^D0X 4\ !8/P x7S0S/g]O-`@0u_0Pw>0S4 0!0p눐到0S|@TP Ѝ P @  0 0W   p_>^͠^;^]I^M^p@-`@PPp@0!0/00007wnS000q 20|7S S S0< 00CS`D`D`D`D`D`D|7Sx8D!0 0<00;080p0808070B;0;i]X^O-@`p0TM^ 0=0 pWzp{ 3 a0 Zfp7  0 Rfp7  0 Jfp7  0 Afp7 0 9fZK0   0P> 0p "fp7  0 fp7  0 fp7  0 fp7 0 e0 0RP 70A \ 0Y0 SZpp0S (DeY 0 0PT TЍ `P( 0 S0 `` ep7  0 ep7  0 ep7  0 ep7 0 ep i]@B00 S   P 01@/g]A-P@P"q.\8 8S+ S! S w~ⴀXa` 0 SD200S020R  ?PbS S    00P Qu?0XP `V0P/ P^P2q?0^ P! PQ000 P` X#0SP`h78h7JK400   ` ``0S 'P48S|74XS 00|g6 h78i]X^J0000 000/s@-X 0@^! S R 0 0S0A:1D!0CR< 0 D10D1! 0!0 0 0 00 0n\ SЍp D!R 0S00 000 R 0D10CD1! 0!,0 0  00 ̎^^΀\Q: / AA!  ////p@-@8 MQ 1P 00#!" 0 0000 `0V :3/P 1 0l t 10 18003/@ D08003/0<000 Ѝp^i]^,^j]G-@pl0l`^:d0媎`8`:/@PsEsEᾓEU,0:(0:$0: 0::j]}@iDiDiDiD0S 00 , QQ  /i]T^}^0S 88 4!RR    !/j]T^}^P0P//}QG-@p ڐ1 0" $10$1Ѝd`PX$1Q2S(10(1("Sh 0O u-X 1 0! Б p7岠`71 0! `W p71 P!l `80S0S `03/P 1 0  베,10,18003/ 0`R ᤚ0 9/P 120!S 0! 0X x W㲠`0`4!S 4!n 0 Hi h0000j]^}i]ͯ^^H^"^Y^^^^p@-@P:3/P:3/p@-@:3/~:@/G-8p(MW 1@P` ᴐᲠ X0 0#!"!0  03/P1 000 0000 101(Ѝ \0R 1 8 @ 101 :(ЍG/^^Lj]A^x^C-`@ 1RP~P1US^1 W0 0p1p 000P Ѝ08 R<<  0 RppSh7p0pp 3SH0L RP00H0 00@Q$@0 00T 0(0 0(00S*v@P  T# 0 3/P u@j]dj]^{j]ͱ^C-Pp(0`S!R# S 0@ q0 0R@@@N@80S*uPU 00 0@ Ѝ (0 S*!R $ $ $03/Pj]߱^j]/A-`P@HM pc&40%BV   0EP0D00`0 0(0 0 00000 0d0HЍV 0 0>0?P0A-<0P 0S`M 04@0S00Qh0000@04@0  # 3  4  4 "$  <@ p! !(``F@#j0 p  +P`Ѝj]ͱ^@-0<S !  4 0 \ Ѝ09^j]<g@-@ XP0@00j]/O-P0 @$N$aA$P 0[ CpG  J pGW `@ |: v0 G$@$N$aA$0PK 0Z  KS%P%G$P$@!@d!@!@0!>#`1# $ ( #$0  #(#< 0$Ѝp0R@-P@0  <0`101(0 0C` &ЍpG-R@P<M0 % `1 01(ppG0G  0l P 80R %Ѝ/l$"P//O-<`@ P1IM 01p 0  0 0 000 S0 0j>1Q X 0 0>0SC Dd(0HL@@00C pTS0!@D0\pW)T* `1  P0 :Y  ZIJY ^ ..!.0@P^ ΂ a\aNL^Q !^UIߍq]ճ^A-0@`1Q X 0 0>0SC0 (@ B@D0R !@D ^P+T, P1  *P0 &IߍP(PQ !%^QY00 ZIQJY PP^PQU(   PU@T00q^qENQUQ!$ճ^q]p@-.0( 4?L00L0S 40040Ѝ, T80d0252 5n$YX0Zp0S1 <>4.Fb0|>!\D00D00J S*1 =-Fb0(>!GL00L00S S|DDD(D$DDDD2St *Sp 0S ! 0D=D-HP00P0S0Pk xl00phQ1 <,Fb0 =!L00L0yx7S 0450!0P0C2X00Z0Q1 <<<,Fb0<!L00L0Wx7S0X0Q1 ;+Fb0(<!L00L0@0`0H5Q0[0 1 ;+H00H0Q  04 8 <0,S0S P |0S! *0Fb:!H00H0l0S1 :*Fb0:!wD00D0 R1 T*Fbd:!eH00H0X VY1  )Fb:!OT00T0YQ xQ 1  )Fb9!:X00X0A=P:1  `)Fbx9!'d10d1xW !/ 9&V101<00<0101|7hwSpm2Sj W   VPd d7![0R 1  @|K[ 71pw. h7R7!66h7[071?%0#  1  @\K ?qw>0S㺟)  ;5?|Q 2  Pi<`0S ;!0:1h7 0 000T0)08W l7 M#l78l70 000T0(5   P! T $P 0P`00 0P  mx8Xh'* 13/?S pT0<$ dS|g V 7S 40040 0 RY-1 6\%05 'D00D0BP*1 5 %0X5 L00L0P 2P P00S ! $0L5 H00H0pZ1 5X$04 D00D0_0 S ! $04 H00H0NS x R!P 1 3  6`00`07h7 1 3p#03 `00`0%x8W` V , "`pW 1  T#J, ;0 00 00E 1 2"02 yV !% P   A#p0P Q5/1 HR  2"0, T2SL00L0㸑aἡ  @I 0 `:S  0 3/P1  101"-000|7S0 Q85/h7 1A T10T1!l00l0|7S0 Q5/Y 1 000! 0 C c ! 00 000 0|Qy`h0` Uu^^^R^:^H^+^6^c^|^^^^ʵ^^^h^^^^^^)^S^e^»^r^^B^͠^^޷^^^ʷ^^K^@^^>^^t^~^@@^ĸ^y^׸^^6^?^P^X^^^^^;^^^»^Pʹ^P^^Y^O^^^^^0S20HQ! 00C000  10000FP Q1 d10h18!Q S ! 010FS|7SD DЛDDЛDЛDDЛDD! 01!7S !P 0$28V V㐁C  $2$"`0000 0>  C  !``$VH,> X> `0N 4P 8P < Sጾ0 0C?o20^3baE0`0>_ >!0>U i V1.N ?`/`0 4S !$0L00000h 0 0[ dDDDdDDDdD 㠅  P 1 4B$> >000c $P$Z 1 =  0 =  0SG Q1Sx=X 00 0 0S8x 0 $0P 0 P 1 $ 4A0P HA< <P0[0Z0S  oP   PPj 0000I|7S0C00S0S !R 0;0X909!5# ȫ" ##Z#\Q ^ Rʐ 0  0 Ph;h+j000101%0S S S;`4pl!0 l! 1*  :*00 0~4p00p 00(00`P _P 000 04 00|7S.DDDDDDDY 1 :*l000 03  0   P1 909R0000pY0@ h71 \909L);$00$0101Yx8U1 90@9(%000 00 0 2S1 808|( 0 a6/ 2" p0 S!-0002021 H{@!= 0S!-00C02021  He@!= 0{PQ1S} 3/z1  HO@P1 `f HQ 0SH1L1 P10CP1S0 900S000000 0P0101B 000 @  0c0p0  |00q0궱0 $000SG X^0 40倀0E4X 0! [  ,0P,0  P h^$0S 101`^000Z( \(0Y0 0(00嶱 pY Fp|W0p 0S 0080 R ,03/P1 40$4101000t0p0S*D^pP0pz  H0SX0SU0SR0SO0SLXIFuZI0 0S`B SE SLXݽ Rٽ00 4(40$0[46] pY (  B8#<40W0p2 2z08#S ! (  0"3F000101F+ZL➽ XX♽ `Z8Y`P]000(00@S. 1 l20,"|200000101QEZ0 KfR0 , Y0, H0\00Z000CC@0 SY`Pe] 0 KfR00S 0 Y0$0$``n0h'?o2< 41R (00(0101 h10p!0h1(10/1!|7`S h7 0d d`P8Wi 2S30600_Ԛ^^^Ż^^D_л^^ ^%^I^S^^d^^ ^s^^^^^^!^9^-^c^u^^^^̽^»^@^Ľ^ ^_^.^^@p0<0(f2*R5\0 0 0 2\@h004 p0/004 h m0P " x(S GW@lЍ  ! !:000Sp0p0p0a2 R S 1! 00 0. @X Xh'0@)4t0 0 0040a6/4n\|'R42 H(p= 0  lz0@ X 1 2"02(!.40040h7 1 202"$00$0{04 \Pq 40 0@00p10p180080|7SA00S<2S1# 30#3D10D10 a6/% S   03#H10H1HaV1 HY=, q⮵ L10L11S 3/0SL1H100PHPX1  H5= M1S 3/   H$=0 ;09000000 0S``0` 0001S 0 0x5q -0@-@PM0 0 P< 0Ѝ0@Ѝ/ᠾ^0000S0004 R 0 000u/@-0@|7S2S 000ЍA-`|7@S2Sg 0!1Rc 0pS\:P020100010020 0083/ ? 071 0 !GR # D1"022222221 " 8," ZN292S988-#87 0C2c70r0Q   ٺ0   04Q   κ0PP0C0Ѝ3254g]A-P L0R8pL `@g|'R"⮺(R# #0 83/G?G/ @0?@D00Q0000L00 ⊺00 R  ₺001H0G-PpaFđMT> 0 Xi (  00 4S! Q0 000Q0 S0#+   "0 000083/? 0? 071 0@!GR # 80S/S10C1ߍ ()0( 0" R 0Q   0   0" R 4Q    $P0p`F@g]p@-1BMS@BߍpP` @P  `P 0,ᙹ0Q  R ,޹!0 R1Ł!@p@-2@SP 0aS 0 6/p@03A0AS@-@e ⴹ/C-@p Ax8TMBRUtDDDDDDDDDDDD0#8S >!0R1ā!!@RPPa|4V@  PP` 8. 0000000Q<<0 0 0000 P'""#"0 乸0S00 స000U L@ PFVQxc n⚸ 0 ""0 DxW #_o`/R χ166S1 000P U0!01S 1P# TЍC`TЍC1S  YPP  `P 1ZS01ā! B`P2괁X :PP  `P 2 01 SP0} p l01 R0PUQ m# `,0PE("(!p7 0/A0S 0(( %=>000QPDXD`DhDxD00000r"N90r":9?o2|N8z?xh728s"}0p:S| (0TЍC/u]DDA- MPp#%@`P0%`Sb BS` BSJ? S#* S~  S< `02010?0x8D!0100"]00 k"]0h78h75^0x8?00h7#2^0n^0`P V C Vn@`U0"0u"]0h7=$`C000i;0X 0 RL 000Y*-O|GDG- M@H`!<(P6`P 0R&!S (Sp1=: S  Sp&!`'S p, BSp'S?;C0CSODDDLDpB!Spk GdS:dS^ S P'SW0S p7 h70J ? S* S}  S|7S pG  Ꮅx'W/o"  6R| PX?;CS񟗨D|DhDDhD|DDD|DD|D|DD|D`DHST *,AS@S#R @0SC00P0S Q>⪎0pⲐWC嶠C F ᐵ@0Xp8%S BS6 BS  S / BS[|7SU cPB 13/<0%S r SF`A0W SQ`8#=0    (R03A0AS)7S4`%W&0S#!V&R! 1?0|8|7S3A0AS13/4P` W 3   R<   ЍR <3W0SDD|DD|D|DDp'  |'S|7 x'Rp' p' W0S08 w~0S 㴀u?0X  R0\ Y "q?0Q  \ W "= o W "= i W0S p7  h78h7|7S7STh7  8h7<{ h7JRz0St vRt0S7moWm0SWh0S p7 b h7 ;[h7wh7 V ;WU > h7 L iRL0Sx( 0•Fh7@ 0R?0S.0‘U9W7 W?B0CS1"= IW1u00S0 ‘V1PP6P 00 S C  RW0-% EOO-?@Q`|M? p3C>6CQ m3>6Q  ?QK 70Q4  |ЍOl7h?Q:0 00 0p0PPx0@FSDDDD\DDDDDD$DdDDDDDDlEEEEDEE,EdEEEEE0EEEEE EDD<EDDED<E<E<E<E<E<ED Et EEE EDDDDDDDDDDDDDDD E E=Q  =Q F0Q0 0CS04PP=Q7S|'R h7   +h=Q \ Qa T=P=QL=|ЍOWa0.|ЍO@=0SVSS$ Et EDDDDDDDDDD@E@EDDEE1S S Sh740 03A0AS]7SZ4PYh740h7h740@S+"P( 10CS DDDDDh70h701!x8 h750h7h750h75!0B8#8S"= Ñ P1Sʄ7w>0S3A0AS13/p7  1 CbR.0‘!1R7P|Ѝ!h7R00h7!h7R44!@R8PP<0 SP:XK=0S|7S xx⏬ >P H1P > _ pP[ :3/ 0= 8(PP < `R # $"0 # 6< XW >  PP 3S>ñ:3/W Xop᚞!Rh8_PP8Q|7SxH5 9⟸Ppo 9  @PPhQD`!*R<83PPi80SS*1|7S.9 iR B0<yPP# P?0CS|7S < @P 80S$ < |'R R0<G0 S < @P 81#3/ 88  |7S P/pP P !PP Ax!> 4U !h7R 331Sh75h7!R R R5p|4z5x1S p7h7:ph7:l!h7R33f!h7R22p'P 502 10h7EP!0B8#8S ȕzpt1S7 Wp7 WP pP W [ pUPY1SU$ "0pN!0B8#8S ȕhF!18p7b1019q W8 .PPd 8ڰx7 ?o2x`QQ 6P  x@Q @A0 S |Q80 Q_P|X x0@`P|V` e 803A0AS7SP U x01@0S S2|7S cPP  13/P!zR8PPW pP 03/P z186S003/1ZS$ 8#8SU $03/SU 0:03/U PP 03/P Z0U 03/!R8|PP 8 5 0Pz > "&p7t  d1/@0SX1X  &%-  P4 E\ E E E0 E.  P$ EL E E E0 E B"P9 919"d B"0i9790000 9100000 910iiii9ii:ii87ii8i(o?) Du]v]v^* *v]g]ɀ^hzlziHz0000 9100 910?o200|7SS!0B8#8SN(ĕ|7SS1 C=R.201:!h7R 0 0h7w>0S108p'10!S"-08H#8,C("(R! 8PP8` V#=0 Z h9⣯o! 8Q7S (#8 9┯! 8Px 8  0BS !R r39S0S0 p Q ARQs0W@ 88 R>Wp:3/Pᚾ0S 0H pH0P,PpW@:3/Ug0S @ X0 0CR00h'4PS4400Rh7K  PP E0 0H80-HP h7~N#2000@000S@@W`"; 0PP0T0 TPP  > 0S p7  h7 ;h7h7 ; h7N50000> 0 Ǯ $h7P:: x⻮1T%SX58 S!V&R! 1?08|87Sq|'R8%S x(0!Sf|8R8a x(0!R7S|7S|y|ЍO0 00 0p0PP |ЍO,tx!?"P   03/PG"|ЍO^Yʀ 0! $&0    ! @aRa/#U07PPWa/ 0!`'0 !    !I0C-DM,00 `p\(00 00a00$  P<0@pP0(0`0$  0T00<0 a ,oP<  DЍ賾^p_־^^ ^$v]@- ,@0xQ S,@0AZn Xx( Ri x(Ri. Q - Q UTX P$0F$0 3?>4L劬 D↬01"S o`% 0CC1%50 V00XW0q71G y027=02c|000bD1 9?9Z3 :5<:M?0:610<10ePb00000C0zJ0 R@40c@,04@T \FP,0I iRF9 RxH5 V' \P,0 0! 0     ! 0S 0ЍP4@ ,00 1S\,40G  P4@,00 p0QpHzhzlzg]0S/pEO-@TMP8 <1#0p`0c_80$   ,p(`mP0$02 0200,p0(` @408 mP'> 0H2$,p(`0/0,2  0408 mPv 0 00졟!18 $ 0,p(`40jmP`0 00!18 $ 0,p(`40VmPL 0!X18 $ 0,p(` 40CmP9> 0 00!18 $ 0,p(`40.mP$w> 00$ 0,p(`408 mP0N@$ 0,p(` @408 mP  <<$TЍB^EK_^EH^R^^^i^t^^ ^Tv]co@-@פPɤp@-@`PUp0S00`00C0 v `J-@-0 0 Ѝ Ѝ/኿^p@-PP UlU`F@P G0000 ( iH@P@p菿^^/A-1P@`p x(0Qᔀ-, 0)x8 S Ved0 Y"Ѝ pV0 lgY͠^¿^ǿ^@-1@P` x(0Q|pp+ 0lx8S 0 fY Ѝ@p" A0 hY Ѝ͠^¿^׿^@-1@  0@ iY^»^O-1020`003/0900*= 20T1#00 0!` 0@0 00aS0@`PpЍAL w]^g]j] ) @0) 8408008,08089!= 01/&E%EKE$$E,$E2 029 0/202/@-8 040#Q0l78l7 0.  ( ( #- x Ѝ1@-@ h70 0 ,00( h7=h7l78l7^ ^)^w]p@-@P83/p@@-PP @Q Uxw w> G" !`  Br 0 0# Ѝ B7SD10 1  #`0< <`mGG?0L Q^%^6^5w]A^A-`P8p3/@P\00\0  s@-`8 P3/@P\00\0- 1 ;'0 6 ⏥x ⊥00x822x80!L0003/090020T100`ЍpHw]p^j]A-P`8p3/@P\00\0  x8 0 0x822x822xMx80!x8 99p@-@P`X@ pp@-P@P xG G%1S 3/pA-P@p`000     0?0?x80101 M? 061071 N? (Q 4{$Q 0v 0 1SA/@-P ` pk@P 00 0s ЍA-|7PSS` h7M @ iN@pN0 R0S P@xH∞{A-|7`SSp@ h7] P i^P'0S TAT10 R0S P@xHX0S i V1Sp1 &0D D0 0P=A/Ѝ5[w]{^A-@y}`|7 pS 0 xX!U |7SS@P PLP1 %0 000yw]^C-P@@@`pAT ݐ  VP01SP1 %0, , 0 Ѝ@w]^G-`X  pR 0S R@&OoB@gPU@ P 0R01 S  R 0S RP0 P0T@`C-p`@P3 P@Th Ѝ0S שPe1 %0t t 0    AT  ⼩P0S ⳩P @w]w]^A-P@U+ pbP ЍA!0S0S i V1S1 $0D @ 0!紅:P ЍAЍw]^@-@xP 0x8i  <P 0<8HP0H8p@-|7@SP yn<089,8xxXP 0 022220000990w>018|7 S13/p^A-1@` !fy~W|7]S11 P8889,8PPp ᨢ(# ⡢x8 """" 99>0?h7?0?x'RM?6!|7Sh7!QGtQ >ARw]^ٽ^^@-@xQ `P ♨P P 1  <10<1Ѝp*P 1 #h\ \0   D@  ,h7^A-@M|7S;in  `⮡VU 1V6 S2 0S! q , !RRPq ܍A83/0p<0!SPRqC57S &1R6'S "Z|7Sh7 8S|i^ P@6S {h70h7܍Ak0SU? #~Q A1 x 0 `t0Sp7  |7S 1 $!$d2+~Q A1 Q 0 M0S1  Ch76h7p7  1 l |6h767h7vV @AXA!@^^^#^mx]U^{^^^^O-P`|7MSS00 0ppp81 p0"0W  rЍO" @T 00Ѝ0W p|7S2  0S =4"|0 0P8>00x8S| 0 0C8C80Q Rn P1S: 00! 00 00HP 0SH1L100P10CP1>H1S 0 R B0 Y 1  0 1P 0Q113/0Sʐ1  0 R 2S 0 ᬑ9/000a)Sʐ1\  T0T 4⎗ NS@]x] ^^X?^8^x^X^»^C-2@SPpM !Ⰰ8#8X 0 a6/ЍCa< ` 92<2<! !000w>0SB !T20S` ` 42hǔ00 㲒 Ÿ  @1S 3/9-8C800ᬁ0 8/: 0S 3/ ЍC? n0001 0 0GP+n0001 0 7S 1  h76h7?!   h776h7v202r1 ``V t` 00r@͠^%^`^ ^^K^^^x] ^)^B^A-|W`U U) U@w xP 83/@ ? 83/P@pWU!3!@PwW 83/Pp@@PwW 29S 83/P@pp@-@1 0, ,P 00:p@Cx]}^p@-PiN@ @P`cxh9VxHp 0^ 022220000990?p@^s@-!]1 @R0Ł<>HP1 00|!|1| yG 07D180$881m`Ug,884X ^P10X 00 0in  F ~ 0(' 0' 8' j^6D'@7<7Vtx8 p  p'    L ( @ ) x8 Ѝpx]ٽ^^0PE^T'E A-pʀjPzQ` 0ES  B2U U U ,U UPPH$H@Wpx@'x@@@p*0000>0h'0S0000@/p@-P@ ps000 0t u"    @v w 0  " @x 0S @@px]A-0 0SP@0p `.|'R]E]EL]E]EL]EL]Ep]E0 04  0 ,003213030 0    0   t0/C-@`M7PP000} Ѝp0 `ݐ0=0 H02 |7S0000(001011 x`Ž X0P   D j00L7SPP7HWLW0P7^ _^@-205 2S 101 , ʠ,ʠ\ 101 S&0#*R0 BR00 \   0R!  R  (R  B/o"S0|'Rt@ R R  R R  1 0S "N)Rx]O-0LM SP@` 8Ph7 |7S 808 8Rp>0pS s39S~p$H8R.p㲢 $$8Rh7 4@W80 & #RH L0S0P !0 >0'S s3)7R1 8>0 0\7\0000H  0C IRO5@P000S Yڸ 460W 000040  B    04@ 014@T7 K6U 0      $D"$  (0 0' #RH L0S0P " 9@P$000 W 0 049P 49@9@q 0H   CX0C00000(00(00000|'ReEtdEdEeEdEdEeEdEcE0 0\ > X 8T0 0 00ZT 060S  S  S#:9S00w0 00#"!# #"0( R:W $4RN 0@0080 Rm1 !0110/1!LЍ 08  > x 0 08   >32130300W7? o#嫲Qh' |'R8"Q S* h7 |7S8 2 R 0@0080 R (03/P1 8[h X81081%[ 80S 000徠S (Z !%*0$@00 00 0J(0(0 0C 00 0J00 00  Y ! Y: $pY  >6PpPG4 IQ50 0c 0 010 1 00 00 I0, 04, 00(0080$0p0 C0000 000 000((0C40 8000000C00 Pp78^j] y]^^;^]^s^^O-0S h7 #  000   0  8H(#8CQ,[SSSx Jo᪢R  0 0PP 0< [㰠岀  T%0 @, ޔ0S 1 x4 t0:0(101R(101 |7S  #RH L0S0P  4PP G0 TCPP 0ᰀ00(0101@8S>HHPP |7h'S000 (  0/  p' ; W00  . x `000G h7  40S  Q A0 00 00C0(0x3rPP h'00  0  ;X00  岀0  " 101Gs~h7  40S0 0C0(0o 1010H   CRB0C00000 `(0 0(00000=000  , R :01 q1 m0@001 PW|'R  ]0Grpq禶 0 1 0100L7SPP7HWX0P7080LW2@$ЍԚ^y]M^^^3^^y]9^U^A-`p/@P 00(0K0P 000pr  np@-`P|/@P 0; 0(0 `  WpG-!=⼐p7# 50`Gp@- PP 1S 0(#(000Ѝ ߒ0/ |'hR    0  + h  000 fw0S 00000   00  00|'RI00 0 ! h7   Vh72h7h7 M0S5 ) 00@10 @( #RH LQP  2PP    N  0 00H   CR0C00(0 0(00㲐0w  s o붑9y]q^^O-@fMP|7h'S000 0 0  ;0h7  9)* S09h7  h72h7|7Sxhgpe\ !PUP00!  ! 90 9O9S!  d!h 90 9?PSH(Q PU$ Q0CS*e!0 R` `!  0s ``` 0 Ⱑ PH!h75h71 0l xz08 S0R 0C00 S 0S00Ѝ0`y]^^^ ^@-`T1P!pR@MX1\!^0 X1\!1S E200 @E@>1 0 6Ѝ@1. ?1S_PP00L1EUS0 `HaPE0PLaPa`Pa1 0 4`V1Ѝ@/Ѝ:^j^-0 /2S/p@-@Pa0 6/p@/ 06 08880 8077090(10101/* * lE@DqE@-:@0S 3/ D:S@0/p@-`@0SP0P    00T ,P1S 01Bpp} z]P0/}P 0!/}@-@ 0@^0 R   ^p@-<@P0S,@T RP@p^ QA-0@P PS t`lp0FUAT B^R D`0d!!p740!h  i j9k9 0 g901!\01|7S!=0S* 9'w>0 01 9i9 00\0 |7S 93/1  |7X `S499Ѝ@x829009h72h7Ѝ z]{]^E^\^p7/p@-@f_qp@p7/G-P`q夁夑Mw>@VAM VQ V!I|10@|'RJ 5) 6) 7) 8)099!  089 079 069 059000N9 O)PQ R   0 0`VPpx8S   19ЍGd 0: 0@P 0590690790890Ѝ<|]^@|]*{]^`{]{]@-h7"1 @ [|Q7S8(00S8. x (0   Ѝ 1(Ѝ@/@^^O-pM`0`  P儌0@0 00P 000 0_o`@kJRPPU!R:"R :"R:0ЍC-MP 0`p` @H0 0 00  00P 0 0@3J?o2P0S R0 Ѝ0G-@M,00 p@P(0|10A0p$  <0`NPJ<1$ 0<0  A,p(MP91$ 0<0  A,p(MP)0'00弐$00 00A,p( < MP0$00 0l0 0`0A00,p0(0< MP  ,,@Ѝp_^u^E^E~^B^|]G-SP Lo `0@4p8à St# 00000SW 2 0` 01`P1 0i`0 d`垽Ѝ@0@T@AJ0^0P0᳐0Y:0^@-  0 @!  Q3  4Ԓ000 P1#9P00T0iX耖C@BC-P`尀p0@ A0 ൒0S H[P ` 0` 00? Ѝ}^O-P@0TM00p1W:[I (5PC 1 0CЍO0S`0 S00qp0少  A$0 f[!  P py 0PQ`1P  0 iPP0p 0 0Ѝ}^^O-@0P00MP@pP 0S S S 0  RG*101aQ> P P 0 ⊠001*  0h 0  d叼000! PA0 0S2 P 0``p0S# wP ` ` G^㤰@J VGo`!0R pL X@Ѝp0 p 0lh 0 (9}D^=^g^~^]I^^@-@@|]@- ,4 4 8 #8F Ѝ^p@-@0M SЍp@P` 00 0-Ѝp^-$M840, (  0 $Ѝİ@-`plM%@P@ !0 0  ( 0  P0000C0 p0!0E0 0C0000 0d@S2 001 00@0C(ѩH0L 0 H0L ܩlЍ~,İ2M0P D@PЍ/00S H00O-0@!DM 0 0 (P}@`p\ 0  a0,@($  P;K 0  a 40@,@($  *K 4 l 0 d    a 80@,@($ PK 0DЍ^İ^^Ee_O-XF,MPp J0 0 0 U0#ddh&hV *80 0 0 C,ЍO(0 0S 0S*)PP 0 0 0 ,ЍO%00C0FEP 0 0 0 00C0000`P' 0S S SB 0$ 0 0$ 350ZT$S ֨(0, 0 (0, o(%8 P!îP 0 01`S0300 000 l P@t J R1,Ѝ0V 0S0S 04S ɣ25 @ 4 0SʠF < @T 0S 4S 0 SR00CSꜩEEEܩEE0 S噣 "@  @00O004 0 004 Z30 R S ;80< 0 80< c 0S i0P`0 0 Pv 00@0D 0 @0D (0S 0CSd00a0 0S0ν004 0 004 3 J0 R S 80< 0 80<  Ͻ 0SP`0 0 Ľ IP$ 00˧@0D 0 @0D ֧0SS Sİ0p@-00@4S 3P1 00'R0 0S0St嚭P 000 01S0H00`p`形2)@ap p耯  BR/ $R/ #/0 0S/Q@-P@1S `p! 0 @1 @T  Ѝ0S 0CS0@q 0S0 0S(00 @ꀯ~@- 801S@ R  R 0ꀯ@-@ D0Q  0TS   Ʈ@ ꀯ03!"/03" /0M0P@Ѝ/0M0P@Ѝ/L@o/!4! #4! B#4!0 P/60S/p@-@P 0!>000pp@-@PቼD`P@᥼p00S DsP/vp@-@PP #p@-@P #:@-3@ 0>Bp@-@P$#p@ QeO-$M`@Pj pP j0$ЍT@ @ ` X0@00S @T  P00S 000S00 0T 00@0P` ` @Z 0 [0 T@0P0T @0P ` 0 0`0/G-pP@$`P F#T 4 06 S H0S 4 R30 PP} @P8 0x00PPH0#^Zv 05 06 06#`SH0Y 0S 0C @\  " DE^!>00000 0/6 0@-MP@ 0 Ѝ0/,0/@- 0MP3p0ppC`h~P@_ 03  !(,0 , @ 0  Ѝ@) 0#000W2 0,0-Ep5 03  !(,00,0 03  (P,00,0,0 0 0)z"Ѝ-}E0A#$#"$#"4#/l0Sp p l p0 0S  0 00/A-@妌|`pP1hSl l0p 囌AD嗌0P1p00`0101S0@@gq}@-@Td$,d,lH,l $. O-@pHRH2DM p00 @@%0A10bA &I>   EF? `pP!1 00a0,P($@ @@ @1F000D1 0<1 00a4,P($@ @ @F1  00a40@,P($@ @@ @ F0'40张0  00a80@,P($@@ @PE040p0 00a80@,P($@ @ @PEDЍ}^^DE^^^^@-@0 0S P@\0X0S@ P d0`0S }p@-P@ẹ0 0DS P@ 00S \0X0S@ǹpDP 00Sd0`0S D0S 00P0#///0  S /0C\ B /p@-j @dPPRL0$!p@聹 0S  Q@D0R0 1}p@-P@ 0!S <S21pp@-@Pfp@ p@-@ PJ00p @-@ .@\E0@s3p@-3@ P D Dd@P$p00S0S 0S h0S 0S d0S `0S X0SpD$/80S/@-3`A0ASM=p̸DPP@Ѝ@00S%۸0 00P0 R0010 0003/ᙸPDЍp@-M@`ሸDPP@ᤸЍp@00Stᗸ0S 3/00001cPfD@-@$1@) Qvp@-@P 4)001Pp0S 0Sp}B# p@- @P8@P@p@P@A-`@QpP000L@PЍ0 000 ` oP tPp ̉1S0 d ĉ1@0Hp ༉A0, ඉ(10(1}1i0@-@M?00CS0 pЍ0@x J L #0@PS   (10C(1x┩Ѝ02i}C-0@SM 3/C 0`# P 0$ P 00ЍC@}p PPXU%l᏷~%k 0 \  PS U R X lU U W% }p@-@,0P `0,0ETt x0Rx0t 1x0 0S  0 00 000p@} O-@,MR||`SpPp踰 0S YP R R0 00R0P0 008Y PK80SC00004Zʀ !  , ! p !|3x3 t3l300  !ḠW㸠 00踰,ЍY 30S00ø0Ŭ 0SP0 0 00Y00帰X `P帠3 00 0S|24d\0Q\d00\00X0d00`0H04038 $d0S00 0` 00\0X 00h0` 0# 0 ]/P0PP; vP,X 03 6 #pPR,00,0,P0S  ` 0S{0S  S # 000 0U$ ",0 pw3S0S00lYL 0I PE 03/AWHzhzlzd} O-<>PQtM 7 .0S@ >Q Y= @Q==X"26XG0SW`T 0.렵p {=0P@8ᵵVp=X @`\=Q 3C5CQYK RC4 oYE U -Q60S=`V:7p4@ T1<X0 0CX#0X 1CX0`0 0iA  00R 0`HDpP@8d1`Q -`0 @ T` P~ 0 @[  P!>d6 00 H`;X 0 00 RV  00 S D@ ~@:S00S P0 @~ 0~| @~3 P ~P ~ 0`0 Y 0  tЍO0 0000 5@P 6060X`\00` yF``}`nY @ 09@X9X&Tp 90S񟗛0EpETExEExEE90 S񟗤EE4EEEEEEEE8000000/i`7Xn /1CX @70 S`^ 47`00 0 `0pPJT1`p` S8ExEExExExExE ExExEExExE(E60S1| =W `93! \ 3 D 00  03  P  `P p'TppWp`,0,Wp  <E0t01ؠx0@pt01Wؐp pW0 ؐ 0_#V w    3 PW`W0  &`WZ V[ 44 PP0Wd00 P`00S 000d00  !QR ` `R` `W00 0 `3 !0S P 0SM  l|000T-2 (%&W+ ` @0p0S 0S000S 0 _ܠ>pspYp/` p`p`0"X00p003 P R00}ᠲV 1X0S00}0S`V|00S1X"0SY$Tr0|`Xk| ;|S  4| 0QN R0`10`_tЍi iii i}'i i^ii@i%iߖo?oi@oi!i#i"i Ki=^P08 P R/ !  /} !  }yO-MP@Dp `0@0R@@PWP@%1003f 0 `P H03ƱHDP@L0S( D 03 0  ̱110@0 Ѝ迱80S 3/@P ᯱ0Z00C?o20S 0S zcP @Pᔱ}0Q(@- 0@R0S 0 R S [ `Px 03 0Ql/}p@-`P 0@0L0`0D00@0 0<0(080,040D00040,000@p蔰EEİEĴEĶEEEE@-@@ݓ0O-,00pS@(,M(@P 0 0 0"d1d00hS&h@P  00 ")a! 1 00 $a$" 1040  0PP  0 !H 0 (",0 $  2 .(,(  P! ! 0"8SP 0 ͒P (00 0`ЍD0 X 10R@1 0S 0 2P.D0/ X *0S 0!P  (0R R  @!@1 0RD0  0 @1 H0(00 0Z@-0S 6PS 0SQ@` 0S  @(000L0!P00!P00Ѝp0SC-0PSlM=0S/90S_ 0` R@( RU dr   R R S$0 0 0S0C00匀XJ2#212(0 (0000p08gpP 0S100lЍsQ000S 0CS # 00g000<P d0 W(6 1O( - (0060 0,P.L0+0SQ 0006l0S (000L00 00!1SPQ $P /0}A-p(`@pP90S    0R, 00! phP 8p0SP 㦲˸&0S0 ;A0,$~0S/@-40@0006(01@$@-0SЍ䛓S !>00 000080Ѝ8g@- <0b",4b4#  #$  #(  #< 墥ЍZ^p@-@0M SЍp@P` "448 #800℥Ѝpf^R=dadQ 0S0C0CS0#0/Q 0S0C0CS0#0/p@-@PT 1 !RR # BYyPpEp@-40 R@  000 |  VЍ@-40@ R  000 e x ?ЍX0 0&-$M840, (  0b$Ѝ0C-M 0P`` @rxp0 P 00 00 0 0@0?o2P0S B~Q Ѝ`C-PMp@ 0` r`0 P  00 000 0@l0?o2P0SP @TP@P T@P00ЍT `O-@`Pp3DM ,@0P 0 0p(`$  243ᄃ 0P,@0P 0 4p(`$  4 0 0 0'!,3 4P0P,@0@ 0 8p(`$ 40 400!2 02 0P,@0@ 0 8p(`$ 30 0 0!2 0P,@0@ 0 8p4`(`$ 30400 0 0!(2 0P,@0@ 0 8p(`$ 30 0 0!1 0140P ,@0@ 0 8p(`$ 30 400!1 0x1 000P,@0 08p(`$ 30400 0 0! 1 0P,@0@ 0 8p(`$ }3 0400 0 0!00PP ,@0 0  8p(`$ d3 .1T@T1DЍ^v^`{^ E^^^E^Ee_^^0 Fp@-P @lh 0S Q 0P @@@040p@Pp@ 0`0 20O-PMv0@0100C0#21 2 P  0S # 2!12Ѝ 00`x010[аK X XJ 000S аC[  R R  H0$0$0SS DC[O[ P P= !>800( p<0@D\Tp40 0p084pX 0 0뢦~x01(0([аK-Ầ딦20000S DC[$ᮦV H_냦`0408080S ذC[ᜦo 0S VL 0,0,0S аC[  R? H04040 # 0p0p0 \SvS Y]  YZ#YDSS  S R 0  n0 00 IY AC0s0 cR0 R0006  BVT HP \ 7|H  \0S`3a `P  `P 0 "00 0S0  "44 0C(",400 000 0 B0  B(00C(00=n 0P,0,00  !B P0#$$("(B+0 0C00 000PPM# V2!12   \ụ  \HO/oP" R` 3 2 0 [DK ᝥ~},@- 804 m,0?A`"b8"#b ЍQMbO-p`PLM @ n *p`n0(p)`#ttx'xpGW Vs 0$ 0 0$ ~.$W$0S 0 3SH0L0SE@P xEQ 0$ 0 0$ \LЍ00C0D+P U9(0, 0 (0, 00000C00(Sqd&090! !.00CS]FFTFPFPFdFPFPFPFFFPFPFPFFP@4Ѐ 0 0 0 ?P#W 00S00 R0S 004 0 004 pPP0S@P`   0Q ,DD(00830#0S  $3/ ch20S 0  婎H0L 0 H0L 00垎80< 0 80< 00! !堎5@W冎004 0 004 ,20S 0  vP0T 0 P0T t00 1 0S W0 Cr 00&p$ P  ?Z; 8   R # 0 0%P10S #W  R1  0S R 0$,00 00(000(000]P 0S  ls `P  8Q0H8 ❠4P I $<0~]`0}]E^p@-0P@1 01  p@0C-ᶐ`,M# @P 400   0 P  Ѝ PP XXomv   @1  p6W ЍC )T TX%XU d"44` 8#8R** 1S0!PU:pWPX0\p JU:H @D P *0X0\T  0 @TЍCS0RH0@0`0d 0S S :\Z@0D 0 @0D e`Pdp03/@DE~]`00 h\ 0SQ HP/P %/QS  1 //~]~]@- 4o`8O-QpP00P B 0 0 0 02"0`0S 0XA0C?o20S  0R:!R\2S2 HB0 0 0  ЍO   `P "44!8 #80CS@@0SV:V`!P U[èańPU@0 P(P2(X2 hf 0`h P(Q圌1 01  奌0( XP00 0 X0 XZ[ 8#< 410 m0 000!"440000 0 0 000w PP H A v0`^-$M840, (  0)$ЍDC-MP@p 0` k`0 00  00P 0 0@ )?o2P@@TPQPP@ ЍG-M 0P` @pk`0 00  P 0 0 p@)?o2P0S  0000 0峓P00Ѝ0O-,M@S ,0 ƋX0\ 0 X0\ ы ,ЍO P 0S尋(1,!0 (1,!廋0  ,Ѝ!>00 $02嗋0 00 pP2型剋0 0 0 唋0 p0#$$ (0"(DRD `P Z `0$"0C0H0 S=40:0Z @ 0 0#P00S1 L 0d` 0S*@00p ! 0S0!0 pp P 3X0\ 0 X0\ >V+ 19@ @ H0L 0 [H0L  `0d 0 `0d V 0 V  (Y 7Y@  0P H0@ 0 0 0 @D@!>@-M00pP `00ъp 0 @PڊЍLt ϊL@@O-=Mm @P=ЍO5h3P 壊 1$!0 1$!宊^ T=<@0@0@0S S  1$!0 1$!嘊<H  ꁊ0 0 0 匊<0 <   y <<Pi0 0 0 0SL P@0@S U0 0 0 @ATH 0$ 0 0$ 0T+ PP< 0S20 0 0 ;`( "$`$"",R a(!"4a4##<S3 <1, @000@S S0 0 0 3 ;0S &P "448#8T(0, 0 (0, d<(S0 0 0 W Q0(0 C< <0;00 ,000P 0<P 0<0‰1!0 1!30S P<G <0 0001S0_0 R P0< 0T 00000S <0 @p0(P0$400010C00STx 90S@q 0|PPk  |0<0Z ZZ 0S@100 0SRQDZ Z 0 0C0PZ Z Zh0X00Y080Sx $0S @E0S [@@D 0\0$Xp0P0$0Z.@0 hG00 0 0 # 0R* +Z 40P $0h$0J* 0$0@K@ \hZ| XP \0 0h \P \0 0h |000@@@T@ @ Z'h0X00Y0(0S|0SN Z~ 0R: \_h|X%0PJ0\|P   Oh |h0000(0<0  Ah@gYI00C $RYIY0 #"  02R0> 0IS  S< SUD @Df000 ~g0|00}00 0S4000P 00S +|0 g 000 ~g0|00}00 0S  g|^0P0 @E@ӝS@T 30S@CA@$@ 0po201H0H0S 0CS # 2 P0P0SD0CS/ ϝ 00SI gPkՇX0\ 0 X0\ F W T  Q     L #I0L0L0Q  R W7 hW4 `W1 XW. Q+ H0T0T0S D0C@p#@10S 0<S 0 0i倇X0\ 0 X0\ 勇h,00 S Y 000S < P<0S 0 00010Wp0t 0 p0t b, 0 @0<01# 0<3/~D}~~0}]O- LM s@P`pp8 eh8 (p000`,P$@ @@ @(' 8 (p0@04`0@,P$@ @@ @(4 0 07(p008`0@,P$@@ @P( 0 07 (p008`4P0@,P$@@ @P(0 0@7 4(p008`0@,P$@@ @P|(0 064 06(p008`0@,P$@ @Pf(0400 06 (p008`0@,P$@@ @PQ(0400 0L6 (p008`0@,P$@@ @P<( 040 0 05 (p008`0@,P$@@ @P'( 0405 05(p008`0@,P$@ @P( 040h5\ 0\5(p008`0@,P$@ @P' 0405 05(p008`0@,P$@ @P'44 04 (p008`0@,P$@ @P'040|4X 0p4(p008`0@,P$@ @P'040 0 04(p008`0@,P$@@ @P'0@ 040$0 03 (p008`0@,P$@@ @P'040p3 0h3(p008`0@,P$@@ @Pt'040$303 0<(p008`0@,P$@ @ @]'0402 02(p008`0@,P$@@ @PH' (p||24  0pD08`0@,P$@ @@ @2',2($0 200pD ,` @ @'p1$01D 00,`(p @ @ '1010D 0,`(p$@ @ @& \!\\0@S50@ T08!0@T , 1d@RE0 LЍ RPP CB! ,0H FD^^#^.^7^F;^E^X^c^NGk^w^HF^^^^^^Fe_d^^G^(G^lG^0}].H@@-@' @c~ A-p@PP0S vPP 0 0100a10 `0 0 0b 0V *0HHQ0C00 00@-@0S 00H 0 /H@-P(0dp`LM @ @ 0 P@  0 }P@PP"   0 (02,0(0jP@ `"0  ````()0 ((VLЍp@-0P@=1 01  p@FD03!"/03" /P/0P7@- Ѝ0P @R Rjg00P0S0l00S @-9 P3D8#8 ("(P "00 /H!> 000Dc2M0P D@PЍ/00S H00p@-@`᎙P@P ᪙pA-p0PS@0S0 tP0S 0\ Q Rc0 0!0;0^`GP|1P 00sb 0!@-`Q00pPg8'#TgT%%< &@P@ ЍVPlkh00100S 0CS W @#RP 000~A-@M`p  X@PP"0 RP00S)T@$ ( bD@P@P 00@ЍHP PPҘTP1PP sP00mޘA-PS@`  pPl0 A/4@ق8!< 8!<DhP/A-p`0PPQPEU `f @ T T@ @T@  \b0PEpO-,0,M00@010 44PQ : 01 $000pBpWS兂0 0 0 吂@(,Ѝ0000 000000#![ 0C 0 (08#<400 00000@U``PbG0 0 0 RU7`PT70`0000x20 00 0$() 000S O000 0-0"> 00$ 000K1 08#80!$$ ("(Q:0ɱ pB "4400  8#< 400P 0( 000@ $a؁0 0 0 000], ,0@ 0,0 00800,0@0,0e*0C SV :ql`嫁0 0 0 嶁0 0 0 %VF Z`PX@UD~O-QM 00а 0 p@ `G"448#80SP:0P0 P 0 0000MC10@00fx0| 0 x0| qX( `뀀$nY 0S 0R @Pk@Pf$ PP$` lp30 0 0 >@ 0S003 3SH0L RP0.PP 0 0C00 0000(<@0`(0@ 0(0` 00"440(",40wH0 00@V0g0 0 0_P0010w 0K XpP@[pʀ0 0 0 Հ3Pp `@0000l0P0T@w0 R s 0, 0S80S X|80$3/pP X`0 0 00S<LZ厀0 0 0 0 sR 0 J [H PE D`P @0X00p sR PP3 P`hPT@P H0S TYP0 0 0 [AP`@0D `0@040 D 0PWX0000T@PHp*0 AP0 0 4@pLZP LXd`04PD S0@00@00 0@000D W00P, 0 [   V W0 0 0 3P0  #R  3 0S#lPP @W014!0 014!1P80S l80$3/PP l}0 0l 9P* [ 0S%  PP 00SPP ,0 ,00,0000$ 0S 3` Uu0 0 0  0PXD0X'0S D,ЍU6 3 DUL@1D!0 @1D! 0  U?@1D!0 @1D!J P @"44D 8#8Q %0%<#*T%@1D!0 @1D!0(P 0<0 0  0(DQ ,   40#0 @0A7fW X0  "50 @000PP R cp~1 !0 1 !~p04 0  00X 4wpP 0P  R 0/`-3 20S ,0@0,0 !!448,P#8S7 5g04x 0R0  ~0 0 0 p`T" R  l8230"01`00l0z~0 0 0 ~V1PD00,0P @ k ,0@0,0 3  10S x10S D ,00,0 0 $ 0  PL3  10S 00S " ,00,0 }PP  Q Ul`~0 0 0 !~U  0  0$ PD~H`d]^ C-Pp@p0M00S0TЍ0S  S` BS0S 0 00000 000B00SQ QR h]0 P R 000*A-PpU@(M \uPP7@4 000,30P0 0CSUFUFUFVFWF @P0S@ D`0P #R^1@0S  2R`V\u`(Ѝ20H0S0@0 0@ 0 00S"00 0 P@* Q& 3S#`0VV;@ aP 0007@00 0 ⼝ ^ R `1@ 0@ 0S 0 P@`0  V1@ 1 0 `aR0C000 0zS S Q ` -@Vs@-0@ SP% S( S- T 0S000 @Ѝp0Sq`ZP 0P0@000划P00P 0  0,0O-,M00P`Sd@ l&S `6Rh *5P Pa00CSYF@YF[F[F[F[F[F@YF ]F ]F ]F ]F ]F@YF@YF@YF@YFx]F8]F[F@YF@YF[F[F\F[F[FhP k0h0[8 <pP7,Ѝ`  [[`#0Z)[# `V [ZZV0 [ `F` ,R 0 [`hpd@(V&` [pfP00CS[F[F[F[F\FZFZFZFZFZFZFZFZFZFZFZFZF\FZFZF,\F[FZF\F@\F00000 CR0ŕ0S@@0S@@0S@@0S@@0SKK각0 00+0 0p0㋃Pk0SJJ P0SJJ  PV$0S 00 ]`$FP{1GP 00ropP:iP40SSf @]S @Z `P$P0 CR^F@YFL^FL^FL^FL^FL^F^Fp_Fp_Fp_Fp_Fp_F@YF@YF@YF@YF_F_FL^FL^F@YFL^FL^F,_FL^FL^FhP- 0 PP 0CS^F^F^F_F _F^F^F^F^F^F^F^F^F^F^F^F^F_F^F^F_F^F^F^F$_F000000D600D1356 R R D0$00  0np&j  0$ p@-@PP`p0Sp@\IsPp@-@0x`S   !00C000C0PUp@ R0 0 z PO- PZ`pG@T`@V <00CS @p S0Sĕ0C0S0 z@0D 0 @0D z @1!  \PDP 0O-@pDMP!0l 0 00,@(p$   0!0 0 040,@(p$  0 400!X0_ 0'> 0 080,@(p$ P @DЍP^^3^p@-@`M0P0@@ @0 ㏅dP J <@@T 0200 R00C1 2"Ѝp@B^0?P,?@- P98@pXA-@+.0"0R S  B! "2 2R2S0p`P"0#Q00S qPP@UP#00C?o2PA9P,?XO-Mp "44 8"#8!`ǟ C\4LGy0 0 0 6CS 0C:W 0  0!"  "? !AT,fT< 0pR4 ey0 0 0 py Q :lFTy0 0 0 _y; 0C S   !R  Q \  \ @ Q 0+y0 4崥 0 45y EpP 0y0 0 0 $y\ Ѝ   1T! 0 !A  Y"RR$0@P       !<  0 00! 0 0 !000 11S0@0AH4000S0p0 pp0 pWa   R^  !Rbx0 0 0 x,0p101X 0 !1R!AQ ڴ! Q Ƞ,Ƞ B! R00< Q   …! B!  B XY 0R p pp! R p0 0!p DR  B   B  `  p刅W+ p 1(",400 000M 0 10 0 1C00S,00V(p`o x0 0 0 xd0  0S  p 0p00Y !!AQڴ!Q !! !! B! Rn10C100C0w80< 0 80< w(M  fDPXP-//-/-/@-@om-@-p00d0@ ` P d0 (00  0 ( 0P(EC Ѝ1M  u@--K^@-)U^Kp@-@P0S 0S 0Pp0Pp*_P pd!>C-@pPM0 0@@ 0 !44 1C 0"440X1`V T, 0p Ѝ0S0S S0S  S0S ST@`P 0 ^, 0  02# |0R0@l@ vh0l 0 h0p0l t 0Sp0 t vd0}]mFD-/ 0!< 04 0 (   !/HzhzlzT0M000S ~S 0S/0S001Ѝ/\ P/0 !8 0 0 (  , !/Hzhzlz0@-S@ @p0`000S ~S 0S/@=P0P d0  0S U1@ Ѝ0J0@0A-@pP`@P oA-@P@`@pY~dp@-P`@ Kpp@-P`v@?pp@-@`jP 0001p,p@-P\@ &pO-@`p\!DM 0 ( a0,$  @P0 00( 0 a4,$  @P 4 p 0 h (d  00 0 a8,$ Pm DЍOT^__LG`^dG-`pP$@T0S0S S 0S0S 9/P@@-0S0SP`0!0@PS R \ 808 0  Ѝ0 ]Ed@-p`( PSQMp $ @T0P ^PUd (0C0S* .0H   CR00C0000To 0(00(00 !$$    h 00` 08 PЍ#RH L0S0P  @SASC 0 #RH L R    @P+ 0 (Q((",$ !$$ 0S(0DS 00 0 0`P0 0t0 0 0 t7P(P PP~DO-`@P(Vq p8@ @P  0 7@T000 P\ Z9@ 0 !@,s@-aPU0@ QPd B% / P P d0R0;;d0ЍpU   Ѝp@P P\P d0R00\d      0`( "4`#/@- "44!0"441@- S Ѝ 0<P   /  ,G1S0C 0!0ղ/0M/ X 1M/  p@-P`8P@Pp0Sp@ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz@-@0:0@@-@0 :0@@-0 00   00wЍh^p@-Py@p萂p@-P@ ,{p@ꐂO- MQ( P '    pWS   RK 000  0R010 0! R010q0;Sx@Tu 1 Rq00 1`@ 0`R00 0R010 00C 0 01 = i Ѝ HR@T  R 00 000 0R010 p RJ C\aC^L&\dr! ! !$ !$r ' T G`^L}u\CQ B C0 00000 SE0 000' 0R00 0R010 T@ 00C 0 2 b0R`yr1 !0 1 !r 4  0 0H  000CSp`V 000 R a 00 000 R00 0R010 T@ 00C 0 p`@0p0 @p0T@P 202r8!< 8!@!<D @![D (!, (!0!,4 0!40r0W0 p0S0@@@p 00 00S0@@@ 0- G- P@$p哇`|0P= Y YH ᭇ,  Q. Q Q 3 ,10S  0r PR00P 0P ,(#(P0 8#<48#80#Q0P @rq0 0 0 q,0 Q Q 0@ 00S  0EiO-@PDMhppUXDЍ`0V V X `XV0CS@FFćFFFF@FV  0 ;S0000 "440HPV 0 ;S0@000Sg1 0#2S S . (. Wg!0⡃g. At V0 0P P 0 ;S0<00h1d00l1V 0 ;S800S0 <00 0r^|^ą@-00SJ@ R  a``  B BN00C0@0CT\^p@-@a@Pp80< 0 < 80pP!R< 11c TR S0cA1C0S0T10P!0S 00S 00S0`1S *0r6PaPT1P 1XC1H!UP1S01S0#+0N p2P11T1d\lX?O-CM0M00;p0 0 0 Fp XO0 <<0f0`0SP%0%* h0>P h0 QP%*p ҃PU p1!0 1!pCߍ   PP0P 0#2S S1 00S) P"0#dd0h&h`F0L00,0000 0#21V$000$ R0S& o1!0 1!o0S 0S0S0S 0S 0(``Fr 0L00,0(0$ R`F 00 RP0 $ 0P 0$  QwPPUx $00C<0040<0 S  0SX :P  0@0X0N\K4@` 0 T0$00,0`0P(0(@,0 SȰ0 00 P&0KyLo1!0 1!Wo $ #P07h ff 0h00RoP  R0Q]:@(pT@400o1!0 1! o 0 HqP0V 0 0@0 @DT 0 0  @D0V R/H00n! ! !$ !$n@000 `FV GnX1\!0 X1\!n0# 000 0  n1!0 1!n60S T00SZhp"   p"44!$$8(<"( #8 G6 ]P  ! 00000000 0nP00UuVn1!0 1!an 0  HApP0@Bn1!0 1!Mn50S T00SZhp . pq .lq p"44!$$8("( #8 . . R  0Rptn(!, (!0!,4 0!4 n'-0 p0pGW/0DmH1L!0 H1L!mmm0 0 0CS0S& 0R"m`1d!`g0 `1d!m0 000  0R-7vY 0000 0000092 xP000`00;S T0d1R0 d 420S h90  h0 0ቀ0 00 S.+0sP20  hL L,0SG!>6 l 9&0009T0 Re _  h BP 00000 '0 3SH L0SP0\ 0 <  0CS00S0 0000Llp0060^ ^r^ ^^X?H?ą Rb ` 0 hpPX w6 @TR  d130p00D1;Sڤ0`1%40SI0  0$ T 70L00SE S0701lP2T"0P2 1 T"lT0@ 0!0CS103/XP  `0S 0 1 000Cp!0C 0 1R ^T00SP h!\00CS 18008 0S0Q0S 1 S01\P t AQ\l\hVLQy0LSv41 Sr:;So 0SC H!R L10LS2A0``F l1x!0| x!!| 1!l1!0CS0X110C10    BR901!Va0 BR1011 01R$0S ,0S@P40S0#P ḁT0  000 0 =]P 0 ᠁@ ᜁ 0R* $4RkX00<0 04000hP] [ 0R 0@oP XEk1!0 1!kD QoEuk1!0 1!kX0000< 04P$\kX2\"0 X2\"8$Pll60J$c0 Q 0zQwSu* Qq0B AS0Vk80 !$!01(k1!0 10! 00 0 00/ 'k%\0S `0S ! 1 2 0 @T00T080;(0S0  ; S1 ,0S1100S 0S ,1 0 0;U0101h0hh P>00000`0VsąX?@-0  0'S(P L@e1!0 1!e$0 ?Mq 0`( "4`#/ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz@-@0:0@p@-P!T1PB1AP \!yX1+8T@1D01@ xSx0 S 0U; S0Ҳ;p;^]X?O-0pMS@(0I S/`;W= P*P98&P5|60S`P0  0 !!R: !B\: \~*  B Rx X0S1 P0;0l0800000S P8P ! 1`P0H&  0z$ &!$$&  @ f1hd40S?0bd 0P `(VA00 00t4p1Hh@1SI  [) 1(00` RA(  `(VA0|   ,0wt,0K |ሁ[%( 6 )X/5`0S 0 00C00 0#Ѝ1 @0 40K, =,  5 4000:g<0U0402 a00S0U0S- 0 0 0 T2a`P 4 00S<07{ba024"0 024"a `)X00/0CS202000000 000000 0 Z00400 1S 1! Z!0 01 01 P"u0S0A101QQ0" 3SH L0SP0\ 004]GL^~`^]p^ąX?x]<  0CU4 00 "0000Zp 0 ST S,(S0( ,0(N0 PPa0 0 0 0 0a`P@ 4 00S$0 P1 0 0 0 1 0CS0 0 0 0 0 0 0 004000, (0Qxt <0Rqt< d@+R 8" R   !BRpĠ! U 0 BRU RZ `X"\ X"\` (  p@p 0% 0 0   X  `@  !  p @0 "!R 0,S0e!@QP00S"0("(R"" "! BR ! R !!$! 0SO SX 0Smp000Sp00!0 CR001H1S4刄L0H1`004 0 004 `RPk 0RVUe0Sb 8EP^[Z%p !Je   0r8/P0 000 S$0 40< ,0 000 S $040<, (",$("( R,B B!8P 00!0 CR01P 01R 8P 0;d6040p0(pS S: /`x8( #<40(p0S&0000 00!0Sh R0 05P P`3 7P 2PAP @PM;SJ>`S9f(00, 00S:f,0 ,0, 000 0S0P 0≄1 XSq5._0 0 0 0 @0D 0 @0D 0_0 S,!0 CR,10t00 0080S: !8RP L00SL0L1`(`@-1D @0C100C0 0R100  fA-@0p0!R蔀0 0RP`|dP 1T010`00 0 R 01 @ @! 1@-0 00   00cЍ|^0 /|10|1/O-4M I F SPPQPU>Q: Q6 @ Q1J0 A\-Pap > >0 c(#"$ c$"a8! #4 a4# CQ 0 CQBQPE`FPVpQ[4Ѝ Q A0 B^0"Ap10GS1qS BPP q*0 GR IQ PUIPGQP0p CR00 0AS0 PP 10CSQ0 CR 00 P 0CS0BS0P 0 BQ000 CR 00p@-0@P CR@Qp00CS00CSp0@0CS@p@-@Q0  00/ 0 0C0 P 0 C\ C\ 0 0C0/1S/ AR/- 0 S ARR A^ 0  /|1 0/P/ 0`( "4`#/@-0(@+R@ A3QR> R+R. R h1M  =0MX @5p@-PUp@`c0P 4 tW0Pp` d H Q1Q44![010p@p@-PUp@`\0P 4 ]X\0Pp` d H Q1Q44!]010p@@-0 4< 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz@-@0  :0p@-T0@00SDP@>p sT$3Sp0p@Y~~^ F@- @hFA-0pS@ S P0S S0S0S0s0S0S0sT( PU  0R 00PP 00(0 ; 0R` R: 6P 06 00001 @  00(100p 0;00S0 0001  (,!( 0"8SYV;P 000B:000{(X(0, a0 (0, (Y@p(@W@|`@P 00S X@ 0<1P0 PY 0 00T0 PY 0 8P 0 0x0| 0?P0 0y* ?P03 ( 00j 0 0? 0 bꘄ~Є =zA-0(pW% ;@SP`0;(hX0 0 0 (sX<U>0SPTA/(TX 0$ 0 0$ 蘄 00!/ᘄA-p`勭PUAŭ@T P P (-X0 0 0 (8Xm0:0PP~@-@01S001蘄0SrC-0`S,M(P@%0@P S FpFF`F`F`F`F`F`F`FFFFF\10S UL 0 SpH ( 0R*T ,Ѝ @7 0T0!  00WP@ 00SP00S h00@ C3SR L0Lp 00 S00/ޅ]F:H]0S,4! x!/@-@0M 6<01,0 00 0S0Ѝ F]@-( (0 尾OЍTF0P \P 80P1/Q Q \P0 @\2S 0@\2S (00S@0Q,00P1Q00P1G-@0SP`(`XqP`2Sa 0!QQd2S01q1S10S(`V`P`2SP ̐ P<P>d2S01pp1S10;`U pt00{W *0G >0 W1Gh"R l2S0垲Pp2S<0h2S l2S0FHPp2S<0X?]p@-@PPpP1S" R X0o@ 8fS0S03X1CffPa 0 08 {4X!F1T1S01S00p@Cz@-@tM0t2p S% `0PS R     82tЍ~QF@-0S6& ЍS6&i^0b? S /A-P(pL1X`8@@ TL3K@D0S;@D0S<@DV$ '0 R0@1:D+=0 P1XVL0S*@L0   @T8A%8150S<1*A0S0 S(00 b/ R /0SA-0`S0MYPW2PqS 0@S0@?oR20S@^ P0@S WB <2 PaQ:M 7M0000 0 P 0 0 0UP! Q 0`0@S010@Sʲ0T#TT1X%XS !0P90D0Ѝ  10CSa0Tw00000090P W R0( @Q 0p0Q0 0 ;P|00S @0G3WS "4!>20 2 0 $0(0 \/]FEp@-0P@( U1 01  (p@UꘄA-8pP(`@T1!01@@(AUꘄ 0`( "4`#/@-0l@ S \0C# 000S  , \0C#  B =0C=Ѕ@-@P 0;@0:P@ @ 0 \3\#   ]X?FO-m0@SM S( /V`P@$00#.0#A0@.H>@$00#|D: 0 00 PU `0S l8P  8PPЅ%@-0@ 0@00 00@@V$$00S@ Ѝ^Ѕ%O-4b@=PSMMm0S S8 > t00#.0#8.> p00#`9 p\V 1  xQ6(R1!0 1!3R 6 T00;c1S 0 0A0 0g!P00@0@00=0=Q1!0 1! R ЍO-0R:Q1 01Q 0SH 0 A SS0!\ 0 Ѕ%A-P`ATAAp@O-Q<TNP0T 0 P0T _NPT1X! 1C1S01S01S0# 081S ;S -N0 0 0 8N01;SP!T11T10P1000110H1;S0;0103/^~TF]X?p@-@QE0  p@87P +PT1 RX` D B R*1C1S014cR :Mx0| 0 x0| M<TMX0\ 0 X0\ MO00q00~ą@-@aM0  Ѝ@3`pP HQM`0d 0 `0d M;S6S00 ( 1( 1S D  B0R#*Mh0l 0 h0l M00  B !  x01hT01\Mp0t 0 p0t gM<~ąX?p@-@P咢0  p@̢`P 01; S !R D0D00CR:001'~ąX?@-T@dSHH 04004 000嗢@0~|ąX?x0 R   R-  R   R   R-  R/  / b /X?gfff@- @@0 ꈔGp@-@TP0==09#9S p@LP 000m~@-@8`@0S-//A-`@Q31`pP!P+0B8#8S1; SQ0A?0vR  0?!0X?C-MP00`0p0 0` @ , P  0`  00 000 0@?o2P0S R0 ЍO-M04@3`rXVP 0 S0DS0 0000p20@4_@`T0V2|p3員5@DT00`0 S0 00(0 0000SP -(P+0[@D0 [e 0 S030#X0S -([P 3\ ߍ(0 @ D  H d L 1P0 0T00S0+0X \00U  (@,0#( #(0 0&(  t& T0 p Qq0y1x!&^? 0|10 (B0 0 00$P(0 8 00$P}(0 @ D  H d L 1P0 0T00S0+0X \00U,  (@,0#( #(0dx0 `0(0lq0h00p0670t00T0S_0yx1&^? 0|10Q0 (B.0 0 00$P&(0 8 00$P0 =00 =C00Hs }@=~-$M840, (  0L$Ѝ7@-PQ@ PP O R #ZP Ѝ000@-MBc0 e0P (P W PU 00 00!0 0R@P5BЍ Ѝ@@ꨄO-GM`!XP@D1LqR @Gߍ RP@ S @  R!HoQ 婒Z X 00Ο 0@YЍX?~C-p0MP0 0`` @Q)0 P 00@00 0 0??o2P@@T 0S$P0ʞqЍ4~C-MP00`0p0 0` @)0 P 00@00 0 0 ?o2P@@T 0S0 P0哞:ОЍ~G-M`@ P(0` ( p0P 0000 0 0X`hp@oTPPU 8;@P ,pZ @唞Ѝ0~\ \ //᦬o<0O-\M@Pp0<` ,(p000P$@ @@ @< ,`(p004P0$@ @@ @4'D?D 0 ,`(p 008P40$@@ @T 0!>4 ,`(p 008P0$@@ @>d> 00!T> 0L>4p,`(p008P0$@ @(> 00!> ,`(p008P40$@@ @"040= 00!= ,`(p008P0$@@ @x= 00!d= 4,`(p008P0$@@ @(= 00!= ,`(p008P40$@@ @040< 00!< ,`(p008P0$@ @ 040< 00!t< ,`(p008P0$@@ @ 0!0< 0<4 ,`(p0@08P0$@ @@ @ 0!;0< ,`(p0L08P40$@ @@ @u; 00!x;0<0L 0,P($@@ @` 0 !(;B0 ;L$ 00,P( @ @K 040: 00l!: ,`(p008P0$@ @4: 00 !:4 ,`(p008P0$@ @040@: 00!0: ,`(p008P0$@@ @0409 00!9 ,`(p008P0$@@ @0409 00!9 ,`(p008P0$@@ @040P9 00D!@9 ,`(p008P0$@ @0409 00!8 ,`(p008P0$@ @0408 00!8 ,`(p008P0$@ @0 400!L8 0 <,`(p008P0$@ @@ @0408 00!7 ,`(p008P0$@@ @i0407 00!7 ,`(p008P0$@@ @S040`7 00!P7 ,`(p008P0$@@ @=0407 00x!6 ,`(p008P0$@ @&0 40D0!6 ,`(p$p008P0 @ @040`6 00!P6 ,`(p008P0$@@ @6 00!606 0<,`(p008P40$@ @5 00\!5 ,`(p008P40$@ @p5 00!`5 ,`(p008P40$@@ @$5 00!5 ,`(p008P40$@@ @4 00!4 ,`(p008P40$@@ @4 00!|4 ,`(p008P40$@@ @u@4 00!04 ,`(p008P40$@@ @`3 00!3 ,`(p008P40$@@ @K 0!30^8^G^Ge_dS^l G'_p`^i^m^x^\`^h^l}^^^}G=_^x0 0<,`(p008P0$@ @ @&0 00!0 ,`(p008P40$@@ @!0 400!1 ,`(p008P0$@ @ @\1 00!l1 ,`(p$p008P40@ @ 0!100T 0a,P($@ @4 0400`SC0Sb=pp0S p@-P%@5p/A-0`SP@p0S9@@+0S ;2XR* 0Rl 001000@07@A-`@pP>000S S/@X=1DA>4Yᄝ 庨@b~G-p0M0@`0S6@ЍZP V V @{  "@  aY`v YHXHGHG8IG  R78 0S34 0S/#0R+#0R'0 0 0 004 \1@0545\1@55p P PP50305 <,ЍOL   @P]ĖO-,MBP $X 0 C0 0qW `2`P1!0 1!N0000$0VZ0 S: p0*b 0`& 0 0$0  d1d ! 0!!WPPL ,PB  R;#0R7#0R3 DyP- 4sP'0 0 0 004 \1@0545\1@55p P PP50305 <,ЍO@   @P]dO-$M@ZPP $ЍO!10 R0 01"0 p Wy 0 b0880000 R V R  Qd:^"p 0&O 6"0VIt 0 0 00 H1 !0!!PP4 vP3 = R$#0R  `  b0 C P 1 90C P 190 Q 35 5Uzw   `    4 P000@`]PO-%0 @ x#000`0$PQ 34 8Pp0'r0sGs 0 S*06 $ 0"!" ! "  R' :#'(0( 00 0   QQ$Q-S$  (( 08800000$0 PP 34 D}0 P:v qPPp匡'r0sGs 0 S)05 $ !0!@ ! Q&#7880000 0   PQQ+QS+  (( 0880S000%0 0%00S0 0C00000 00 Ѝ0 P:@]\< C-M@pP `؀0S  S*Ѝ% %0 0R q\UP RQ 0RW0 0 0 P0 /@p@-PP@p`0@`TV@@Q> @%0% P 0 0%0P!0%0C0000}>/0`0"#0 0 /01#`00S 0S@@hV=9C =C00 0 0 Mb@BA-P` :@|pG L @H(PU@T D0D 0?8c`Ѝ 0@0$@~ĖX?gfffO- S @Pp0$DM0aV[: R7 0K 00p`00! 0  "  p 0pW:S' '078!800$0#1S<0P%1P%PDЍ00a]p@-@Pt `0D0034 0 0 %0 0%0p@p@-@Pt `080034 W0 n0 f%0 0%0p@p@-@`VPPpP 0V 0 10 V& [p0% 8 4 &#&#( #  % ( %    % (0 @10(0D`04`06% 36 3(00300%0(0% 0 000%0d0% 5 00%0(0@10(0QO-@PlM8 $05 8p%P %!  !  ( 尃Დ P& 4`8p FPP 8<% 0 !0 ! % 0 8p4`岓ᰃ(0:$00$0lЍX 2%`p&bPP` 8<DT0 4D0%0 01 0102%00岓ᰃ(0C-MP 0`p` @0 0 00  00P 0 0@?o2P0S 00P PSS00 ЍSP @-@ H101H00H0101p00p0101000 20 2000@0040@][P @TwG40!( ( "P @@ /-//-/-/@-$0$@ dH3(ԗ-$M840, (  0( @$Ѝԗ@-_F^@-[F^@-@^\-@t1M/ A-P0p`0創@P& d0 0  0 ᰮ 0nPP@-+(d2004 0 004 (o2Ѝԗ@-@(0((0M @XD@-@0S 0S <P0 0  0 9P ԗ-/ 0!< 04 0 (   !/HzhzlzQA A-@,pP`Ḋ10 00S S S ,00S PP(0",$( "(0P x@(10 0 0 (1ዊ3 40 0S 0 P/ԗ\ P/0 !8 0 0 (  , !/HzhzlzA-@P@`@p@vl~ԗA-@pP` ᭜@PWA-@`pP o@Hp@-P@>pp@-P`@T2pp@-P`@:&pp@-@`P101` 000`p,1S/- G 0O-@P`DM!2 0 0 0`,@(P$   0p!t2 0 0 4`0p,@(P$  40 0 00'!2 0 08`0p,@(P$ @0 0 0!1 0 08`4@0p,@(P$ @0400 0 0!l1 0 08`0p,@(P$ @m 0!$1  0 08`4P0p,@(P$ @W0400 00!0 00 0 08`0p,@(P$ > 0!x0 0p0 0 08`40p,@(P$ (DЍO9^^^^^^ԗLG`^DGe_\ 0 \ /IzC-DlM (`N00 0 0 (X0 0Sp * 00ZP  00 Qp%p *TCW (,00 0 0 (70lЍ  &P p 0S$ "44 8"TT#8X%XU (00 0 0 (0 S A40  PP 岯!> 12! P0 P $00S "(P,PHpWh P 0Xp  L0P L0 Qp%p :W 00USx 28 ⰃP'0 N3T⼄F'04` 0L 00yp 0(P\j /(0, 0 (0, C$@P2!0$0PP4(}/80< 0 80< (/"$TTPP$P0S&2R0S $ S0S  S &1R (0  (0P0u pqtpW x00( 0 7/p P 0 0R: (0 PX ,/ 0$ 0 0$ (7/ 0 P P,ԗ^@-0S0SP0!0@SP R \\0 00 00Ѝ 060]GԗEA-0p0`@XP X/@0S  O0S  ?@ЍW0dS*@`"@P0S S @d0pP H]? pP啀ЍXpꀁ]~@-0$@ `TPM Q Q @|@T@p !p  7/P0 #P 00@0  P00C0Ѝ0]0 QQ$/@-40, ($ jЍ0@-|Mp0@P`` Y H 0H * 00X 00 0000D|Ѝp@-40, ($ 9Ѝ4@-|Mp0@P`` ( H 0H * 00X 00 0000|ЍpO-@pᠰ堠M@P` T` ` @ @`  1 010 1@01PP``0 0Ѝ老]_C-` 0R0% 0 * 0 >P 0Q0%0 *0=S p0pQqS@ @ 0#P Ѝ0 Q@@T PE0S& U  R @)0 0 0 )ᣩSPEUp0 I  7p^hف<8 @-8 <(@<D0 L0B0*"00C0p؁G-P@`(pTG 0 0 0Z 0  $"@ R0 D @  ~p؁O-PTM000 S  p * ,0⍫PB ,0 Qp%p *t =W7 d8<8400 004@LS0P 0L0` `"44R8#8 0 ( i0 S     0 V |1 000ߨ됇9G$)0 0 0 /)V |1 x0|0x0| !44,8#(#G)h0l 0 h0l )V |1 000 0  夨TЍ3~6 6RQ*@@0000l6T$00 X00T0 H0 ST (V~V |1 000E( 0$ 0 0$ (y 0R  P (P 8@5 0RS*0L0 @P L5<0@080<@@@ @@00x000(00@00D00H0Z$ @0S0 0 00S%$ P 0[00000000P#40 000000B 0T(0I@0 S0  0S} 00 0(0$0T  @00 0S0$000 0 0 0 0 0$00 0C  R0T Q   R$v 5T   R 0 0  "000D00D00T 0 0Sp 0PP 0 0TP$K 0 E RE": P R (V} 0 0 0 0 00SŤ$%  P8#<400(00UI  00000C00 SE ( ; 0R0% * 00⠩PP 00 Q:P @r'h0l 0 h0l }'V |1 000hh|0p 0h ǥPP{ ㌣ڤ0 ^؁hفp؁x؁@-) @0PЍA-`Pt|r|@@Tp!p@ 0RD0S|A|00C08@<00S  '(0, 0 (0, '<LT&004 0 004 'D=~p؁hف 0 /p؁p@-`|PpT@TP`@0Sp@4c|& 0$ 0 0$ &@ꀱp؁hفp@-,@,P|0S 00p@E|~p؁ 0`( "4`#/P/Sp@-@Pt<]@P<p@-40 R@  000 ͩ O 姤Ѝ@-40@ R  000 㶩 8ɣ 吤ЍX0 0&C-PMp@{ 0` `0 P 00 000 0@?o2P0SP QPX@P QsP,{ЍjQ 8-$M840, (  0 尛$Ѝ؁1M/  G-PQp`{PW@ޡ0 0U0 p` Pᰥ@0P 3SH L0SP0\ 00< 0CVh!` V UD0V SA  .QP VPpX.XBppSI>X p AL\ AL\0A QPV .RP AL\0A-Q \AA\  S^0 B |G@-`P@M 8p.( .h`( .( `p0a7Ѝ^0@-ASS0CSG GlGSh I%B -Q0GTGxGGG>%A 0 0 0 B5%A 0 0 0",%A 0 0 0 0#%A 0$ 0 0%A (0, 0 (0, %A 004 00 00 Q Q%B 0 0 0 $B 0 0 0 @%Q Q Q$B $B $B $B ؁P/:O-PM'U@|50S p50h5h%h0(000a7ᅤ(Uv p0( 㶠(E0/S0㠤@Po ( p_((0K0:00`P\(p)j 2PW 0c`00:0p0PP|1d4p000( :0,PR[0 <040 P0#1 PIP0 S$ |!  S |!  W SW pG|!W^̻GG G0/S00@PЍH3xtp09pxzP* :340,0( HD  PH0,(PHޣ U 20 SM .pQ'p"Pp06B0` 9k G  RpG|1W2LGlGGG̼GG G,GLG  [ |1 000 000 000 000 000x 000p 000h1!0 1!`0!  ! X 000P 000H 000@ 0008 0000 K^]^8i^O-M P0(`@P|pPP 060S $60S 0F00V #Puߍ0`0@@0 i P{iP 0S!00S 50S  .I&$050S 40S  .8&00$05DP5"C 0$ 0 0$ "`40"P2 0 R 0S 40S 0  G#0[5  P! 30S  .%0  *t#0=5T30S 0  4#0D ߟ@0S  30S 0  "0| @0~00S P 20S 0  "0fP 100S0 ((CTUP820S 0  "044P< R 50 00Sၡ  10SH  .v%0  5J!0450+000 0VPd[=dqd\wwT10SS8wʡ fg c  ^0086lBύ00d0 sP E*xbwH0Bύ1@0嬚^؁ ]^^^s^^^@^^^8GO-(PWM@PE9{P |1 00U0! 8$(0 8$(!|1 0 00  0'S(s@P! 8$(0 8$(!|1 0 00 @0000 0 0S0% %` * D0|P D0 Q`%` *5@V   R@P 0 0`0: 0P,0 8>0S 0P. `t$,00.0P3%!(8,(0 (8,(!0尝B?! !"!X:0HS,l=0S 0p. B$0J. <$200- 30SW0H S񟗖XGGGGGGhGG(GGHGxG|1H X1LGlGG800S 000 R0  0ۢP 0 Q`:Y 0<0fPPn 000[ 2GGGGDG/Up  8$(0 8$( J|1 000 0040004 0$0[ 0$C [C d 8(0 8(o (0,0[(0, |1 80<0[80<HPPP @ 0 R 0 3SH0L0S 0 D`P`@P0 R0  H09P H 0Q:00S U  88<(0 88 4<($$0 4 $$ T(|1 @0D0@0D[ U%|1X0p t p tP Mdx | x |M|1 000U084(0 084(ZD80S U9 UᴢP 0P0 S0%0 * L0⿡P L0 QD: 000S 70PR5`uP+0S00S$ i5`~0S[ ;PP 0  3S H0L RPp\0p0pG4pGWsD500$0$ #44 8#80(00C(0C0S0CS"`p0<000SX SX  0* {`P  eP( B00S S5PP `V0S0`Jw ̞ʞ6$0 SXp\5```P Ppt$0 S 00CS50i 0S񟗞GGGG@G 0Rp% p *  P0P P0 QtppW 0 X0 PI YXé(00C 00R0 RQ0I400 \ ?^R# \' R0\4P< 80P{< 80 00 CR H4 Rk(00CS \eIYb3|^0H40Spep}p8`'PPN ޚX((  (0S0  R R)02)024 80s0 (0b288<(0 88x4<(|$0x4 |$7(GR0嶐 <(0?o2R0S (P`&p3100T0T`Vk 009 ~oF40V03`P2X00PX$0XDHX$0S8 Jgz0308 Xp00S(0`S 8P$008$0pcP P P  0 40S PH0\0\X DH  0001`0``V ~oF؁^ Ӂ]^ ^xG|Glف|]Hhف`p<`5q08)0 280p0xPw 0S(0 0q(0B8 )0 (  00E0 #R HL R\0P  0800B00V0080(00 Y "38100d0dY~I0 $0)8 Y "h hpWDpG00 3000S 0$0 S0S 00H0l0lpW DpGWV0`1p0p0S~?C0S`040bP P P0  0 80S 0S2<202Ju,0800z0 0 0 400 < f40< P0040]40CP10! ((0 0`c(00(000C0,00,0$  "S  R  0$ ppEpW3( 0Wp` (\ 0  4T04pp(p2a|1 H0L0H0L0S|1 P0T0[P0T0US ၟP 06[4[|1 X0\0[X0\UhP nXlX|1 `0d0[`0dUPP TTs|1 h0l0[h0l'Ur8P\[Ub00`0S0% % *0 t03P t 00Q:00S 8$(0 8$( IWߍPp00,W0{ AWC +W_ p0V`0 0 0P 00 Q:``V %PK H帰 00   +bP 0  bP W (3W <W R00  x0P x 0QF:00S  3W Q  Qp R00  |0⣝Px | 0Q(:00So  [00  0⌝Pa 0Q:00SX ,R P ,00l{0@`:0000 00000PpS00,9  92#0Sl  3/g9`V!U d 90S(00  0 <.[( 0P(gF֚Ԛ0S80:S50S0S0S0S  P#0S0S0S0S  P R 0!0# U ۝pPP`d D;0S(00  0 -( 0⺲P(xv00KlP0T 0S P0T [ 2 0O-@P`DM!$7 ,@0 0 0`(P$  4 0:p!6 ,@0 04`0p(P$   0!6 06 004,@0 0 8`0p(P$ H6 00'!06 ,@0 08`40p(P$ 0405 00!5 05 ,@0 08`0p(P$ ٻ0405 00!5 ,@0 08`0p(P$ »0 4008!45 ,@ 0 08`0p(P$ 嫻 0400 0 0!4 ,@0 08`0p(P$ 唻 0400 0 0!4 ,@0 08`0p(P$ }0400 0 0!(4 ,@0 08`0p(P$ f3 4@,@ 0 08`0p(P$ P 0403 00!3 ,@0 08`0p(P$ 9 040<3 00!,3 ,@0 08`0p(P$ "0402 00!2 ,@0 08`0p(P$  0㘢40 0 00!2 ,@0 08`0p(P$ 040 0 0 0!(2 ,@0 08`0p(P$ ܺ0401 00!1 ,@0 08`0p(P$ ź0400 0 0!|1 00 ,@0 08`0p(P$ 孺0400 0 0! 1,@A00 0 08`0p(P$ 唺F n"n0T0弗Xn@DЍ^9^Ge_^tG^ ?^ I^S^a^o^~^ ^^^8^^ ^^^؁TGp@-P 1@lmh 0S Q0P@@@040p@nPnp@ 08PG-S@`pr0 0 0 } 0  b0 0 0 mX 'R 3SH0L0S(7@PG  0  RV WV R R R R 0S 00) 0,P,0:S) 0R% * 04P 0 Q% *D+Q  8$(0 8$(Ѝ0 #0C?o231 ԈP (MQMa%  #RH L0S0P  0㣗@0 0 0 o0H   C/R00C00000T 10S q?!T*0( 0 (  /R 3SH0L0S0㏗@P  V^ T^(`)p0, 0`1 01  ({؁^Tف ]^O-0p'S(,`(V@P  P ] P ]P  0 ЍO@ЍOЍ@-0  ؁C-0@p4M|d2`PP Q7P1HvlD2DR取420( ll凖V 0SS*4ЍCll u1`1 V@P  f]P  4ЍE@Ph 400   0  P 4 ,l@T> glpP XX㑕"@l 4pRlWT 40 Xpp` dU0030# 0S H0$U0*`B 004 0 004 `Pdp03/@8G؁O-pV P>1`U F<pMY  @Qd<P $0S(Pe8ApWqcd3S P81 0 00 >pPX00S . 0` `0000![ QI ]8^|^^فhYP"I8] ]^X?xG|Gف@-p@`]0P p@3 Ѝ@-@^d @dp@-dP@Td0SA?C p@@d!R1S A?CSP فف@-@D P0QQ  00S 0R  4Q DA-@p`$P@P c$A-Pp$A``P@  `P Ub$p0S Aفp@-`DP@Tp0S  PUP $4RPD@A-@p`>$P@P 6cY$p@-0PS0S0S 0S, 0S00S% $A JP@8$p`00#d00#h00# l 00#$pA,فp@-P#A`h@PT$p `P0 #pA @ف 0 S 0#/00P/Qp@-@p@ L P N0 SRp00k01p^]SRG-M!p4QP@ $Q !BQ -Pg  `VP_ R R RRQQ`V\$U9  BUU 84U 09  ` $?$0 0$0 (0$0(0 ,00,0 000 00{P<#DjP`o1PW#R0P9` $ PL1PЍ`0@V$( R, R $V7p H 8H X0  SX \  d 0t0 0x0 $3S d  00 00008 900 P!U   $0S DZ  S0 $00 000 000 00 0P1XU p H5 8~ X Hz/ d sd o00"08 0 X bRPP?#0  WRP P2 ]00' d/^iiikii G-9PQ@`Ma V9Q] ; 6C0CQX 5CjuPio iJi( i i Vi?Pi ߖ>Ni0iKiǯ> ~$ni i ixji >Ki Ii %i Qi >!i O-pODP@`UT D P5TX@@0S0 00SDPSO PT v ` Z` `$4R@@00S0 800S DT@ 4Q@80S/A-3`A0ASHM^p:DPh@$TUXHЍ00S1%^H0 000S)0hP% 00000S .`   00 00sd0NGP]D-@0 `]U^X?@-@9@A-HM`pDP@T |1S  00 0HЍ00S!]G00S .` + P P00000志P]D@ o]n^@-@|1@dqQCp@-@P P oppp@-`SPSS;1N p0@0L0`0D00@0 0<0(080,040D00040,000p@pGG\G4GG|GGGp@-P@3q0@`0];]SS Np@S~0008C00 0/p@- @P!>00000pp@-@P 00000000p@-@ M Ѝp@-@2SPJSPp@-@0Q$MG 'R`l P'RX("($( 0t0  0 \ *P- R00S"!10!0!0!0!0 0$Ѝ@\@P R000CS1^^A-`pP@x200SD0CSX 40GS* S( #S_ KS% Ѝ o\Q\ X ^ QPQ `P H000S D0CV`#0F0 rP  lP V 00#S0  Yo`%S000 00 00 00 00 00000V0S  0000X`QRI p@-`@M 0 C.^^ P?R1 ϴ 000 C0PU'X qX X XX ``0 0<000 QMP`ЍpA ER PPC/C-40@SOM S $ R0#*50S %0OߍCd R |1 0 0 0|1 00 0Oߍ@D  Q :S S #3R t40S h$l0|1 0 0; HT, `P2 p ?4Bύa`a`001411 0``1@P t30S 0t#t|10 0(0 ST#2q12L PP ` 2P<2034P09}P 20S 0"XT lPOX20S 0h"l,20S 0008"@000000 00000000 _LP1B110 0141P /P d10S 0!y3"p'qr\10$0$PU ~_EUX `'`51` @`<g<0@ 0000 0S 0 |T P0 L00S P0\ P2y1(0(PLZZ ]^^]]];^/]z^^8^]8]o^^xG|G^^@-@ X4X @88H0O-,00( S@(M E@P 0<S=@P 0b 0 0bx"#2't1040bt' 0寃PP 0 K0( 0",$ h((Q"dhd& @ Q         R/ R !! ,P 2 0!&Ȍ 00 #8SO-`\M@8T#80$0p0$00 #44 8 #80  QU T 0$ RP\Ѝ Rg&0RcQ R rd  WR[ RS RP r6dD RA R> r;Q R r[ Q R Y  R% ZA[ RY Z R Q R R R R rd   PR R R rd   PR R [m ;/000$ R  2/P [Y P"0R R; R8 R5 ppWp Q0Q-Q*Q'R R R R p W Y  "Z  R W  pR R r $  cP R RG-(@Pp,`PM00pxxp'p0S.0S0く RF 0S 0S 0s 0 iP' (00 0 P" (00%0PЍ#  ! Q#3 P 0P 40 X 40 X 0S2 P0S   &"44 8#8 !R   0 1 &"44 8#80 A&"44 8#80 1 06i0SA-6PS0M0S  0Ѝ0S0Ss0SQ@p) 0S0S/1hFPP0S@ 0S=0s  RE`0b P1(0@00Ld-0S  !> 000S VPd0210S d0VP 0 S0S / ]0SE0@-@8P<$MP 0S$ 0R PP0S0S0s!.0  P $Ѝ0 PS0S ,0 @@/8O-p$MPhX$ P $ 0 00帤&h00 00000 0 #0 " "0# !! * ! &!   ATX $ R  0 8/$Ѝ R9&R6& R3 R R R R'  P! R R R R  nP0  {R 0  0sRd   @0O-M000S `Ѝ0PS0S/`0S. 0@Sp(00S% 4EP`0SK 0SH0sEd0 0S0S0S0S090sP3#21208S, 00P0<0 P 0 PPQXD XJEP W*0S0S0s0S0sPU n-!>6d0刐 p0(0l 000bP0S100 0 8,P0PS3Z sS,PQ <=W |0,%S 0S0S0S0 0XPm0j0S0S 0sS0SQP 56l0S (0l00L0t0 l6P5kg 00000S w0`( "4`4# :000QX  V 0S100`P6Uy ~ aP `1`0` O-hp&h &TT$M 0X ' "%X " A  TpzWpp) PAQTI$Ѝ R R d  &R&R Rzd   0P 0C @ !018E 0AT 0S0S d0 6S 6Sd0  P @0S0S d0 6S 6S W d0  P @0S 0S   0S0@@P]0S/ 0@-S0S   Q Q> (0# ,0# 0#.$$ ("(0  !R   0 1(0# ,0# 0#.$$("(0 0 (0# ,0# 0#.$$("(0 0 10)0# F0# ,0#.$$$("(. 0  " " "0  !R   0 1)0# F0# ,0#.$$$("(. 0  " " "0 0 )0# F0# ,0#.$$$("(. 0  " " "A-0@SPM0S0s  0 0h!0ЍP0:taUP1\ Q: 0 CT0C2T* S 5 A%CPU^\Q:ࠃÅ0S:3P50\Q0ࠃÅQ:0CPRQp Å0P0RS5W0P0R^#05W0P0RS5W0^P05^ ]p@-@08M S8Ѝp@vP`.q "448 #800#8Ѝp^ 0 /@@- s@(ㅟF=aED{>A-P0H RP' @0D 0 @0D `p\ Q00P0SP 0S @@XS  00فG-@Q MPp@`I YF 0S A`0d 0 `0d /@ Ѝ  0{P 4@@ V \{ l{pA0 0 0 A@ H/PH0S |1 X0\0X0\0S/ 0S,0s)  0 r{P T @T  R H0C@Q S``V |1 X0\0X0\{00@hفO-x8M#2尀崰1(20[H`00p00DlpSX00Z 0S P T@PA [@pPUXHT0\00C?o20S, T@P' [@ZXp00 [ApP00$0,7 0@00000@P0 0UA_E0UY 1p@ @l0D pP [BZWX* @0S0S0S 0S pplPHvH0=T40@p 3pApD]z[(ZXT@SL0 T NP5SL0 @WZ@pX5(#2!12ЍZ@aXTzPU @X0S0S0S 0SM  n4t`T6 lPP =1p @pP [pp`[@$ `< H@PA<0$ R=`0l3t 00x0S/ 8 l~@P)4 lx@P#8 40R030S `0 H,0P` 0s k0@0P1D0DPU A_EY `?`X0H` 0 00SHq?`n? 0`S  SVX`b?` 0P0P 0  0S0s 0s $0@0P S0@0P0s 0@0P0s 0@0P 0R)T0Ss0<0s0 Xk 0<< R<RZ | r%! !Q$ RnTR  V` 0>` 0SX>0 Rg0 `T R QRM  #  RC H`,0&0P,0;R ف| P P/Q|1 00/p@-@PL0@ 8Px P H@xpp@p@-d0,`P( 0 0@M 0  0"` `P P!PP d0!3d0"44 6cЍp(0 @-HL H * < فC-騁M@t`W0ʀ 0! $t!0 l!d!  , !Q#PTPV  R0S  0T@ @ @H@T0 SPPPPPU 0 0! t0 |  , !ЍQ H0R:H *P0H000H00@Hzhzlzف|10SQp@-HMPH <0sHЍp$P 0 R0 $1aUH@, TP0CPH @L00PLP P ,$P @  PP ,$P @T-/0U0L0 ꔊmuHف0-C-@q`^M@P@0D 0 T@0D 11 IXp!Exf?!0Hp . U. PPT 0@@00p@p I ^ߍCЍ/0 0 0 |1 80<080<hف^^0O-,00\Mp `0S 0S  0S0S0S5 0S0 5 ~+ww\Ѝ50C0( 0MRM.jyh5PS0S H5@D<00 ,0<TAw@P+e<0 0 0 GU0@;v@Pv@PD#0 0 0 .U 0 0,(000 H( $k=P H= (00$0 4 U0  $ S=P$ (0R< $ ($C=P H=(0 0$0 h3 H( 3=P$ (0HR0@( D0\0* c<,0 <,H0S |1 000U H0@0%4`#000Q 20S5 00``'H`3`J= H=80H _hP r z<,0 <,Ua (Y 7Y 0 W)P 0  R W<,0 <,bv=@0HP H0S |1 X0\0X0\8@0D 0 @0D /80< 0 80< :H0S |1 H0L0H0LZ H0L 0 H0L #U uX 00Uk!^,^8^hفB^_^lځ-$M840, (  0gzk$Ѝhف@-(0@ R+`p 0qP3T( PPQQ0SvqPU@q0 000 3SH L0SP0\ 0 r@ ЍP< 0CU* 0qPO-LM  h 0@P`p㬌!< 000P,`(p$@ @@ @. 0)!X<  0@04P0,`(p$@ @@ @< 004'!< 008P0,`(p$@@ @; 00!; 008P40,`(p$@@ @t; 00!`; 4008P0,`(p$@@ @Ֆ 040; 00!; 008P0,`(p$@@ @徖*0@ ,j 040: 00!: 008P0,`(p$@@ @墖040\: 00!L: 008P0,`(p$@@ @勖040: 00!9 008P0,`(p$@@ @t9 00!94 008P0,`(p$@@ @]040`9 00!P9 008P0,`(p$@@ @F040 9 00!8 008P0,`(p$@@ @/0408 00!80< 008P0,`(p$@@ @040\8 00!L8 008P0,`(p$@@ @8 00!8 008P4`0,`(p$@@ @0407 00㬇!7 008P0,`(p$@ @ѕ040d7 00!T7 008P0,`(p$@ @底0407 00!7 008P0,`(p$@ @壕0406 00!6 008P0,`(p$@ @匕#040h6 00!X6 008P0,`(p$@@ @u&0 400!606 0<008P0,`(p$@ @ @\5 00!5 008P40,`(p$@@ @El5 00!\5 008P40,`(p$@@ @/0 400!505 0<008P0,`(p$@ @ @'0404 00!4 008P0,`(p$@@ @l4 00!\4 008P40,`(p$@@ @ 0!40<D 008P40,`(p$@ @@ @є 0!3030 9)0 9)|1 0000 0 0  0N >(   p RJ0 0 0 |1 0 00 0Iu9)0 9)R @ i=02F?! !2SY2V8(0 8(N8(0 8(0'S(1p0`Q :0 0 0 E|1 0 00 KQ6 Q! Q Q^ `00  aP Pd <,0 <,P0 Q $Q Q" Qq90 0 0 |1 0$0 0$ o_\( \ q Q$Q Qq Q P q Q q Q q 0'S(oP  0 p00! !0(  CoP <,0 <, 0` 76P p0 0 0 )6 P 5 P50P09V0 00S1|1 000}PT9pWP p;0 0 0 @0D 0 @0D @|1 80<080< n88LD00H00 \0 $0Do$0pSB p|1 80<0<80|1 0 000  F0)S(0 (0,pP 0Q*t00 4d0 0 0 & ,0s 40S `0(( AR*c0 0 0 |1 0040004(0Q Q0(0 Cj0S%T3<0S  P lm@0D 0 @0D .Y@0D 0 @0D Y  Om0 S  0lb0 R R r  R R 0sy0 0 0 |1 0$0 0$BfP0T 0 P0T q0S |1 @0D0@0DW  mp^ሡ刑10S   S =9)0 9) 0( (0R.0 0 0 9|1 0040004?+[X |1 0 00 0 0 0 ,[Wp, 00( ⒣# 03/ Px~hف~Ȍ  ]v^^|]O-(0P` @M @00`Sd0  32. 0)0чP@d0 0/ 0)0ćP@d0 1 b"!4b4##:0= )0㱇P@d0& 0 R"(`P A0 0 0 ЍO00Q El)01 ቇP@;ld0B (0`V +0FS: 236  pP 3V 00R 0Rჱ3VV +V ЍO l<Vd0)02  ` ld0 )03  BP@ЍhفA-R(P M 0`0 &2pP)0,  "@P 0  P;k Ѝ1M  @-(Q0 'QPttp`0(@TD Ѝ0 g,W0 03W0011p@…]^@-`P,Mp0 (0PS3R(RRA ,Ѝ) B RꀜH0H8HH0H0H0H0H0H0HH<RQ'S 0( gW0(0@S: 0 g0<SW00 S: 0 gW0000(0S S: 0 qgW0000҅]^s@-PS0`@0P00PT @ @Ѝpp@-0P@P1 01  p@Yhف-$M840, (  0`$ЍpځO- v@Q| p0S Y0 0S0A  ЍO@ @T `V x0S 0CSx00`0j0'6V80< 0800U < 0C0E006ꔰ~tځX?lH߁p@-@PP `0 ܂P 1M  сpjp 0!< 04 0 (   !/Hzhzlz\ P/0 !8 0 0 (  , !/HzhzlzO-ȗ`P#pQ(lM73P} 85<085p0<t0p0QtP730S 5S @0( xl@PH 0'S 0 3SH0L0S(Bj@P6 0dS lS3 j@lЍ0Pp06 * P R# NT640dS lS! 5%0 %L 5<Ph5l%0 h5l%7@<Pp0@0Tp겠PT/ "R;( ,Ϡ ( 8 ,< 8 <`0d 0`0 h0d l 0h0 l ,0<0  @0@P :0@Pd@ T0 0 0 z $Ϡ  0 $4 0 4: 1<02 88#8CQ ##*3'$ ,0P C0 0 0 @` 8#(#Q@=( </P $0R (0R(0, 0(080 , 0< 800 < a ((@e004 0 004 p$eP "0 00(00TlP i0 3SH0L RP0H0 0AaT iP (@(@@42P@TL000S00:S{|0S*@37pWG DA+e,aWuןh7h'W0S0A@ЍOV L={@P ?Xc0SP@Ѝ?PP N@@# 6VR  t3@03430 @PN0 30P""##4 R00Ǒ3S86@|0,6 | @E@ T -@ |z@P@\ |z@P 0倅0# 0# 0# 0# 0# 0# 0#01Q5 %0 5 %U5%0 5%0``&0`&0`&0`&0`&0`&0`&`1q\ HP $BP0S  P 7PD $1P>0S;  U+ . LPc. _00; $ 0P0|;<3 0&&'0 x000C0吠Z PᐠpWUe 0q`W0P:7@"Q  <e 0 P" $P|;<3x0S00C0xPp |PP;eP 0 RPP0 0 0  ЍU 0  R 0 0 0 0S00 gP 0 0 0  [@ 0$ 0 0$  0R*`-/W0 0 0 (0, 0 (0, 00`S 0S 00 d@P| ^0<< 0 @pЍr@P9WW+0 @@0 03@P d0R55-pGWxHxH@HxHxHxHxHxHxHHH(HHHHxHXHxHxHxHHxHxHxHxHxHxHxHxHxHH0  RW0 d0R88d0 A/0K d0R88 d0R77 d0R77 d0R66 d0R66 d0R33V  d0R116S0S0S0S0S  d0R99 d0R55 P(r@P_ A0:P(r@PS A0 (PY  r@P (= A 0 @`@`T (@P= 9@`0`0000 0CSHH0H`HH PqPF`PP  ,6P `0)3SY10" 0S20Q0S@8 0R;0S8@T5~(@1PqPP0  R00sX800 qP0S0ĕ8#2120 000P $0 P @$0( 0 ,0s po_ P5 x `V 3S100 $e#PpW0 $m P 0S 0 000V $P p4` 3qPr408 0<0sp(_fDP  z5P O X !#PMpWJ X 0X PQ pD0S85XpTP05Phw"P2-0Jp@P0S S Sd04^d044Zd044Vp@P妱WW > 50S+W$,# GR@zğ \ Rv19@ 488`40ⰰ .P 0 9`60S .d P63`&`1`00>h5`0d 0 `0d @W |1 X0\0X0\V1@SN0D0SMx1S500F00< D06@PPPD0H01D0PS<W@P `0d 0 `0d 000BU@ |1 P0T0P0T6@ DL P@ D0 pL+P D`0d 0 `0d 0@0940= D0 SC 4@ R<000000> @ 0<01 SP<0SD 3Jύ$ 1T0 P08WP U`H00XD@v  Xl*Q 5WJύt0-P% _`$<0R00@ U0<<0 |1 0003SBU0 0 0 `U |1 X0\0X0\3@3 uP x1S 0S  @h0S! 30S00S20SX  @ :P $R*X&Q V X0<V x0S  R SU@0S 0S L0(0@ 1P>LP@0 @H@P@0S `<,0 <,}F (,0V <7 4 [ l@0 0 0 (@}^ ]^ lځ ~hفS@D0/ Q0*$ PP0<10.~O[R0S0Z0S[ F0@0P @ $(  $Z@1,@@0 3  10S 10S @ ,000,0 $00 @D<U<0P V.0S .0UߍvS A,0 0 0 7@ X*A0 0 0 (Ud |1 h0l0h0l[00S 0(00=0",4c8<0X00[@00(00S0 0  , @,00 #  # R 30S @ ,000,0@8#8 0 0C40 XU, |1 `0d0`0d#0S ,0R  0    0sQP@ C`0d 0 `0d 7@`0 `@0YU@PTECS0 :,0P00%U?0T000y PP(10@T ~ODT~X? I @-4 R0R 0 08 Ѝ I0S"p@-PX0\ @06S ~P `L6S006=M00C0p/@-0@0,M`S6S 6Q0C?o20S =,Ѝ@L@0 P pt0\ 00 00P p$p^LrLoL|1,8p@-0PM@\`P ^(0(S00 N 000 |0 00@X0<8@400 `4 L@P^PЍp0  @`rP]C-1威娑1!$M0ˇ$#2a12p1P00@TAOD.3"`&abG$$Ѝ10p WAG{#0s &v0@0P P#"P  m#$$aP@Tb#0s v0@0P 00 L PO#0 00[] ~X?t IفG-|1P`p (M0N S*200S D0CS$@ET4   p  0  0 0y 3 200S D0CSY@'Tf p(Ѝ  R   ` Ra R H000S 00 03 @S #212 00 020@T D@DT 3"(00S"  000"H0 0 @  R` Ra R H000S@^0@-M+> K埆圆00000 0|0c00@P  ``eXP0P $喆0@ Ѝ0@菆 ]I^]^X? It Ip@-P@0@0d000?00:<0?00 0400S 40S3 !0 0p0uh0p@-P P@ƬU0 @@@D@H @Pp@0Sw A-@`pQ@ DR HQ0PP ᧬DX=Q:C 0 0 0 DP ᔬ01 0S@0@Hp0C Q6II IIIIIIIIIIIIQ! D R   0L S H0`S@A 0 0 0 D0S H LD R $ ,H0S / ؁$]'^^R^Q|Q/P/h5p@-@P E p@U8H0@-@PP0$M @I|1 03/P@J$Ѝ0p@-0 M @`IPI|1 0@4/@!JU IT06 Ѝpp@-0@SP M 00SsP  P0@o Ѝp`"P 0U:6 P II0P 4   H RII0P/@- Hk@o<@-|1@PL2`PM 0CPj 0Pp 7C0CPVP 0P00PЍ1PD (7C 0CPC 0P p0 \PP 3`PP 6(06 06$0Xp\00p tsp,pxI<1P 0P,0S0pW 0W p0'u?0040 0S0$O8  0-00,0000 0 0$0000000 000S0`V 0V `0&e?00400S0si WiHliHC-@P0,M 00px0嬀P`0PPTPx0P$PIVHx00Cx0,Ѝ PP 0 `O- #H H @P P @P  .P P0,J7@ `0!:Z@ |10]^4P @0SL0/P @o/P/// O-HPM@0`Y5 ,PU h38@`  P 04#4Ѝ0  2 0` -4 p00 Y Y 3S08@02 804@00Fp  ZQ- 0Cot$"0( 嫲@0, /p1` P0@0@ S@0@$0 0S032@ P) [ 00p  0S 000 0 00 @0@ S@0@$0S032@0@ ^؁ ].^^ ^^^4^^^^}^^^H]@  '8G-0P8M ` . 0 0r8Ѝ` R008ЍGP 03 Xxq@ `P ;T X8ЍGT 0.`  00 xzP0`` 00``0@0@0S `p.` `0 pY 0h |1 00T 0H @a[z<0 $ $^8]^ ]^X?Mb5I@p@-@D -PPp@ }p@q@O-@Mp`,PP4 0S 0# R @` .pp0d. `  0"22X" `X XD P~20S ",@0 00$ 0( 0  0R p0CP p0 QP FKA 8$(0 8$(,hЍ0S00S t1|a0S .@P!h@0LH!000(1 0R  0BP 0 QP F | R 50 00Sa  l00Sa .@pXl005 `FLX, @0P`0 00` ].^؁^^^^O^^-/1 -$01019/]/-/-/-$M840, (  05$ЍD@-@??-@-p0`0d 0@0S P(00   0 ?<( 0WP(`@)W??(0, 0 (0,  Ѝ1M  VD@-@-H@-80@0S:P ^00@+ @-@>W@-DW-/p@-@8P8`᷼Ᏸ-p~H@-0SP0`000S1P Ѝ~S 0@S0bPP0S 0S0s A0pS 0S 0S 0S@S0P 0 1P -/ 0!< 04 0 (   !/Hzhzlz0O-TM$0`1`0(0(0SP ~SN 0PS/@?0S@;00100@P0#212$0,p<∀0 p 80@P $0P0 Q S R` 7V $#2!12TЍ LP @1@  0O-@p`\DM!h! 0  0,p(`$  @Px` 0!! 0  40,p(`$  @Pc` 04 00! 0  80,p(`$ K` 0!| 0 t  84@0,p(`$ 6`  n8X$0DЍ^^HLG`^TJIe_DO-dcP4Me0 0 0 o 30,]pP0@ 0M >4Ѝ0SD0S S?0S0S0S0S  4P-0S0S0S0S  "P0s. 0 0 0 " (0Q0 0 0 @TW P 0 0CCP εPWp@P 0 ؽ0 0 0 0  ˽ 0$ 0 0$ ֽ;Y =@弽P0T 0S P0T ǽg{`dpP |1@ (0,0(0,0 @Dhف0SGC-0`SM3PP00@PS/P@ 00S% T, 0p 0S0U0S   0∽P Q Ao `0 0 0H 効Ѝ@0(p0p/ޅ]H:H]O-M0(000406#@21,20pSP  0 P  PPP00 <P<P16 `PP`00$000:S0` 00S <@P7P@00`0 0 h0H   C'Rj(0C00(00T 0(0(0(080(00 0<0040000 80zPPS4$0Q00SG000`00040<4J04000:S8P0S^0CS[:0(P3 80<@P ( 0j 80|<@P#RH L0S0P  (=<@ PP -<JPu08 80 p  ( 0P0:S80S& |!  V V F|!Q2H[Ih[I[IP F|1RS[I[I\I(\IH\Ih\I\I\I\I F RB`%1 01  /0S4<02,#2!12Ѝ  R|1 000 000 000 000 000 000 0001!0 1!0!  !  000 000 000w 000o 000g,@去004 0 004 h ؁Dp@-`1@P M \8@0 0 ,P@\9@ 0S/@0S@ ; Ѝp7@-Q@T0 QP   N Ѝ0P OP0S)T   Ѝ0@9@iTdTT Ѝ0@k@DT\ Ѝ0@\ Ѝ0@ A-Pp`V00 00000@P& dVʀ0! 0     !0 0T@Ph$@P wЍs0Pp0 Z 'HzhzlzHs@-@P` 0R0%0 * 0<P  0Q0%0 *ZS @嘺0 0 0 壺x R ! Ѝp@`债0 0 0 勺 0^hف@ ҙp@-@@r" " @-0@S00S SS000C0S@  0GP0S]]0S0S0S R @-01/pp@-P@UQ PP 0S  00S`P pS 000CSp8#<4000p@-0@S8M  ./00 00S 00S0#TTX%XU `P S 8Ѝp 000CS0P0] ^@-@1P P @0S00S 8#<S000CS/@-|1`SPD PP 10SЍU8 0 Sp* ( 0R*Tᡟ 02T 1!00 Pዟ100!L< 0,01 0 j>?<⇴3Q#3?P [@P # [P0  R= 080#80C?o2S>^0 7/,0@ 3 #R(0\\Lp媆0 0,00 <0aX?^ܤIA-@( 0  R    RA| ` p  AP ,]@[  [Lii0 8/,0@ (0LP^0 5/(0LPV0 A/H]^7@-@(0HPG 05/0<0(0LP<0 5/040 Ѝ07@-(0$  Ѝ0 @ Q 040HP 05/(0HP0 5/04 0R40 8 Sps@-,0@!;90(0LP 05/}_(0H`0 6/0Se"PU 0S , P(0L`҅0 ;6/Ѝpp@-,0@080,00  "Z,p3|; S 0 1L#h|\STc 0 #=L#,@M@c3  00 .#>pc3  0 &".b3  0 "pb3S 0 (l"HHb3 Ss:  P 080,00,0 0 +"a3S8 080,0p0,0p 0 !|ܻ|a3   080,0@0,00<0U 0 0D!a3 %  080,0@0,00<0: 0  妻3,0  05<0! 3   0yp 0剻W p `͠^^]I^IK^^YO^^^#^^& ^^%^+0^?^0I^ ^ ({Q-/@-,0@< J_p@-P @ Pp 0P0 C2?0S Dp @7@-,0 , @(0HP. 05/(0HP&0 5/,0 010010 0Q+R ; S@R   Ѝ0;   S@@@ 02#/H]3/@-4Pp@-@4RD00@00pA-p 0@(P@pD0(0 `H΃ 08/(0Hƃ 08/0@00@0(0Hp幃0 7/0  D00D00@0Ѝ D #D  j 0 D00I (0H`圃 06/(0H`唃 0 6/,0`p@6 3 3 (0H儃  08/(0H| 08/ D0   6    60  R  D0 R  <D0D0  D00D0000  6 60 60@6 0 600@-P 脈]A-@,P`V(0Lp$ 0U7/ꔊ]A-@,P`V(0Lp 0U7/괊]7@-@(0 LP0R0S0 5/(0HP 05/(0LP0 05/ Ѝ0 05/(0HP 05/(0LPق 00 L7@-@(0LP̂ P05/(0HPĂ 05/(0LP异0 905/ Ѝ0pA- 0`@(P@`D0(0 pH姂 08/(0H埂 08/0@00@0(0H`咂0 6/  D03D0 M (0Lp0 `0 7/(0H`x0 6/0D006 (0L`k 06/(0H`c 06/ D0Q Q Q0 D066D0 5;D0@D05< ЍQ0D0 0 00D0G-P`V@p喸  .`<0 000` 0C2?000(pd000,0:P0l0<3P0m0,6S t ZcPp QcP常m0S x EcP嬸| hIIdIIS8  0"S4 ЍpS  0"S (0HPz 05/(0LPz0 ;5/$03 (0H`z 06/0V>00(0L`z 06/S  0"Slp@-IP @]G-Pzp@`9  ⊱<0

w0 8/3 03G]W^j^7@-P B@ 0R III@I 0"Sii 0"S (0HPw 05/(0LPw0 ;5/ Ѝ0$03 b 0"Sp%A-Ppw@`Up<0 00(`00$00,0< R At堭p0,0#$003/(00Hv0 8/3 03QA+W^^0]^p@-@(0LPv1; S 0 0//Q/p@-0@P 05/0 00 p@/@-P@ $`$ 0 00' 0 0,00$(00400p 0$7/P 00 004`$00 0(0`0, 6/P400 Ѝ0$0 0(000,00 0S 4 3/BQ;Q%Q" 0Q0 .0 /<AQ4J4J 5J4J4J4J4J0 .0!0 .00 .00 .0/5Q0 .0!//0 A Rh0 S / l0#"l 0 S 0;Qh0 $Q  /A-3A@Q\6J\6J5J\6J5Jd7Jd0SЍ`0 p 7/P0 U:D0C` 6/0` 0d0P`d`VpPPPEu0V:0` 0d00 00CR00p 08/PED0 P0 5/`@ 0  E08/`0V:P 0Up%p%*`Pp@-0@000\P 0\0`P 0`0P 00P 00P 00P 00P 000T@4\Q@- /6Q@-/%QJ 4A0&S2&Q/9J|9J9J9Jt9Jt9Jt9Jt9Jt9JP9Jt9Jt9Jt9Jd9Jt9J|9Jt9J9Jt9Jt9J9Jt9Jt9J9Jt9Jt9Jt9Jt9Jt9J9J9Jt9Jt9Jt9Jt9Jt9Jt9J9J9J @-0 .0!/  /9Q/Q$Q !0AS h00 S 0h0@-$&Q>0AS h00 S 0;Qh0h0 S/1 l 0A!lTX 0 AQ  R 5` R  R  d    BQ / d /G-<0@@`p  d0P3 5/0pW<0@  d03 ЍG/P`]PEUa p00(Ap,Ap pp@-PP@ p`E(0 0 000@$080 \ P`dP     x Ѝ4@-P@0 080\0`0d000000_Ѝ4p@-Q@<0 Q Q <0pQ *Q!R0 ,R0!R0 ,R0!R0 ,R0!R 0 ,R 0!R@P ,R@PS00 `@06/Q/!R<00 ,R/<00<0/A-XP@Q`1`!PEU0T  p07/`0S T G_0Tp D07/`P T0 Pf``0S  0S 0d00 00CR00d0A-X`@QP1P!`FV0T p 07/`0S T  _0 `TD06/`0S T +``0S  0S 0d00 00CR00d0Q@-@( Q`Q Q>d 0D32aP2"5/ PPEPEU+0 pD07/`P!  00_ D0R P5/`P  _0Dd 0P2 5/`0S  0S 0d00 00CR0 Ѝ0 PD05/`P  0d0Q@- Q Q Dd 032a@2"4/ЍD0d @02 D 0 @0C-0 @480tS$M:?SF@0C4SBMJ|NJNJDOJxOJKJKJOJOJKJMJ(MJ`PJ`PJKJKJPJKJKJ\QJtQJKJKJKJQJKJQJKJKJKJKJKJKJKJKJHRJ`RJKJOJRJLJKJKJKJLJRJUJKJKJKJ VJKJDUJ*SS ʘ*S ʌ*SU  SW $Ѝp*S h8$ЍCT*S ! BS;  SPh`h0S! AP*S7 l$ЍC7Ph`h0S, .PPh`h0S, ]PPh`h0S! RPl$ЍCl$ЍC37 l$ЍCAl0S 8L 0iyQ \PQ R00 P [  81 0 l0d S031` SP1 P!01cQ2 `"6/Dd 0`2"6/\0T lR Q3 CQ0C` 0C0R 0S 0d00 00CRB0@0d0=X T0l0 0CS 050C2Q30CQ  `0 S d031bl0CQ3S   l 0R 3R0C0C0<00<0l0 S0C BR 0l0<S03 TX AS` R  R p0d S031"S0!0C0< S0!C TPR:X`R*l0S03@S10B!0FL\X0T TPX`0ld 0l1cP3 PP1 P!1`Q2 `"6/d D02!e`!1ClQ3$ЍCDlQ3$ЍC{ld 0Q3D32`S0!2P"5/0S l0S ! 3\0P0C0 SS0r Qn\0Cl0S <djl0 S0C BR 0Zl0S SU \$ЍC]\ 0K hHPLPpL\@0 0` ` 09/P3 `` 0` `  0` 00 ``009/P0@0 070S)S)TJTJTJTJTJTJTJTJPTJTJUJ UJTJUJTJTJUJUJUJUJUJUJUJUJTJ(UJ0UJ0UJ0UJ0UJ0UJ0UJ0UJ0UJTJ^l?p$?#^4g_͠^)^5^.^8^A^Q^h^L^Z^a^p@-PUpU- @\z\0  RS\ 0  C00p  /R 0 B P S@S00S\ 0PC0夐 q^A-@P` 0!0`3/V0p4`e%n 0!0p3/ Wȏ]p@-@P 0!0P3/UPd` 0 0P3/ UP8` 0 0P3/ Up@]]; S 20/ <8#8SA3=8#8SA@A210/</t2>08#8S P2AAP00/<0 /<0 >8#8 S 1A0A`0111Q 0CQ 0CQ 0Q1 A+AQYJ`ZJhZJpZJxZJ1111|1 p1Q 0CQAA Q񟗼l[J[J|[J[J[J\[Jd[Jt[JYJ[JZJ110/>08#8 SAA Q\[Jd[J|[J[J[J[Jt[J[JZJ\YJ[JT[J0000000000x0t0H]^^^/^^^^^^^^^^^^^^^^^^^^^^^p 0S -S"0A(0,D R!#(,0/0A-@M(00 00p@P A<00,p$  `< ;0PL  D    p A ,(p$00 0< '@Ѝ^ $^<0S/@-@0k@ӀSA-@ S  pplP`pP   03/@NT@I @AWꠓ]^ˀ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzp@-@p`P p@@0S/p@-P @ 00 R PD  {s@ 0P; 4p $|]J@0S/@-@@fs0@04@l O-D0Z S(@3?:pPa0 S.  S lc`Bv @ aV`@ 0  >0@0000@X Q@ T`` 0 @)`@X J#@0 800@P <^A-@PpMA@` 0 RW@'A-PU 80p`h0@4p^踓] @-@U80S 080<0S4@ A-P0 @R <"p0CS3 : `F"pWЍ0@ 0p00000P Q D0S/0D00/ 0p P/P //p@- 0P @@ @ @  0@Spt Rpl p 2/ 0t@p@-@WT00@-W002p@- MP@l T`P 0 R V ,T ЍpRV RW SW lp@- \`PD0S@0 00P00CS0p4pܪ@p@- 0@PDPP  p@pܪ8@- (@DPP @ܪ0 000/G-P`kWP0@x000000.W0Sp 0pW80S1h0$;h00h뜐 2 \\2h0  @0l0 0p000000t0h0IP Ȍh0|0000(00,000000S 0$@[aTP VNWax P h埍0\ ePL OP8G菍$^LzJ^($^}^]I^^dJK^)^A-`MpP0VD4@V >44V (4V 4V@ 4V l00 03V 3VU 3V|@0000 0 000g3V P< S0< S< 0ShPQX3V] 0L3V $@3V X 0l p`P  f Xh sX2Vn 0V`P2VA 2Vp 2V |@000000000 0 0 000`1t l00| 0pЍA/g 0     0 0 000l000Af0 0000 0`PdA Ѝ? @000000000A00000H0 0000 0`P@ 0 R 00ЍA芇0-h0 00P0`P5 PЍA ``W W @W@W @W W@W @W@WWW W W W WW($8$@-@p`U0P000T! 0CT( 0T 00 0@0TP0S# 001@0P R 00S0<0@00CS0  ЍP R 0 0q`@ @T@@~fvtA-@aP( {B0 pAܪ40( R/$ R R/  /L-4( \0^/LT0Sp@- @RP 00l0p0p@//@- @ P@A- PEB@PP 0SPPUPX0S PpWP0`P`pPP PpܪD@- 4BP@T  P ܪ 0!< 04 0 (   !/Hzhzlz RP RP {//C-QP `M 0q<0 0V@p, 䀖XW Ѝ0 8/P 0S 00p W0 0CW) T ,6W 0WT 9h0 0 : STP 5W'= W: =G<TTh Tp 0: 0: 0h T 0:: 0h T 099>08#8 S=;G"0C S sJsJsJsJsJsJsJtJtJtJX4W00G?o  24W00G?o  2|4W00G?o  2 0T00 0Y  00 e @DoQa Q^ > Q[ QXe @z 0T0 0 0T 00#T 00# 0T00 0T 0 0 0T@0@0 0T00 0T<<T 0<#V T p{' pTP {mt0WppS l00p3/tpT TP 4 @@a0D8#8S @DH$H0S;K; S< S {:< Sx@k1Tp0+ 0k0S0+ 0Ab c0C S@0}p@ 0; 0; S 0 8T .T T!  0@H$H 01AU/0D S`xJwJwJhxJPxJPxJPxJPxJPxJ,xJ@@0D8#8:S@@DH$H@@01 $'* @-@(0S2 $0S 0S, P`p40 CS4 ,0 0, !; S  Ѝ0 0 3/Q Q 0 0 04,0 L$A-PRU@x0S( P$ST`T0V S0 PVPRTpT0 0X-l00p3/PPT`TpV@ 3R 8kT0SP `%R L^0^\ P/0 !8 00 (  , !/Hzhzlzp@-@0Sp@P0PS 0p Sd :!,T0S` 0Sh0T0`!X?Mb@-MPQX0@S `,,x0S 0$ `P`V% 00S" 0p0CS00 00P k< p00` P QH\<*T@Q0 KЍLX?^^e^̓]Q @-午/^p@-`P0@ $  `P0(0pLnJPnJxJp@-P@PPP(PpL@-Mp`P~Q0@S 00e,B0S$  hPP:TP0S4 S P0 0!! !1Ѝ@;,h0*U h0T$PP @ R 00`SPU0P00 P Q 㱅ЍX?Mb^p@-@P T0S @ܪ@-$ $@T 0T0L@-@<;>P X0SP0S@sܪp@-@PPP@p@-P000p@-@PPP@p <8#8S@ /P/ 00S/]@-Q ꌀJJĀJ܀JJ<00000000000000000C-0S"@P`p0 RUREFQ ᶐR0S BⲐಐḐᴐᲐ#@TP`p000P@/ "`Vp`W0C2? 200 t$  Q != ^Q‘ @@HPTlLoV  \Qڰ 居A>^p@-0@SP S`  ` < Rp؜0000 0O-,M @p P@DQa|뼑t',Ѝ0PU T_PU0 T 0@  0^LAoY YPQ ` 00V@D"* ; S >08#8= \S 00 \ `*0Co[ 0 SQڰ  02"^^p@-Pl@PTpP0S003/\@@-P@Tp@-P`l@TpP P0R003/P`\@@-@PG-(`p#OPl@TUЍ0Z 0 :/PP\@p@-<0 0QP`?o2CP@p)@-  001P)@-  001PG)40 60 0 1PJ/)/@-P`x㩻@f㥻p0lpp000 P$⏂0@@0 P0tp0 Ѝ)^)p@-PP@0S `᪻`0Pp0p)&^s@-PP 0XP\0p0@`0\0p0T0S 00SPQЍp3/ t0S 0 d `0t 6/PQ 003/P 0\ X0`0R`0p0`0\ Wp@-XP@T0S 00S 3/\ `0R`0p0`0\ 0X0pP0S 003/O-`$M@HN3PV '>C 0CV 0CVP x300 l3V P0ST0S g lpWX` ,3V0t03VV 3V! 6C0CVP 0VlPUQ 0 0RnM0Pi2V`lPpU``PP trttRdpVʀ 0! $ 0   , !0 00 0Y 0!d!0   , !$Ѝ0S S S $ЍOPR X0SP0S0 Q X0S$ЍO$ЍO\P Vp 0`00;M\PP $ЍO6P R 00S0<0_P 0 0q`V PP0S 00100  0;/P\p3vt`WW~fdWcWHzhzlz$ 0)p@-`P f`t@P   pPU X0S P0S 0PpppG-PQT@TP `L `lpWX`UL@ L 8ڂ00S 3/`P\pL^,^@-@LTT0 TQ S S @Q @-厃/G^p@-@PX<PpkLP 9P X0SP0Sp@pT^ 0`( "4`#/R/`0  B"11P/  R  ,(0 0//C-Pp@(`V Ѝ 0䐕9/@C-P@pW Ѝ 0䐕9/`p0S@`A-pl `R$:Pp@Q:AQ  A8/ 0| 00CS%p 0 B BR%&<0 19 Q*Ѝ0 A-`l PR :pp@Q: BR B8/ 0l 0AA%\a&P0Q0 R*Ѝ0P#!- \ X:#:^:\:0Qࠃࠓ\^/D]A-Pp`@@0@Dp@0@L$<#@`W K0pG`@A-PlL0pLALA$ `@`W K0pG`@O-T@ L P0   lA 0A`Pp2"0PS0VpW* Ѝ pA0 A   Q  0 Pe `Fh !$ X F!Y P0!`pW:X  QY Q  L 0PD]S/G-` p P#"Y@PX  K0S  L00H@PR/G-PQ0Fh pY@p`V8h ZL0S h SL@pG-Pl @R`T  Vp P匀`#801U 0S  /L0`0PE V hp `G-@ p,Ƞ 0P  XPW 0S  K00pGPp@-@P0P $R@P SC@ 0 S 0  S@C R 00pA-`T0@Pp 13/UT0LpP` 0T01A/0T0A-@p`0S  dPO p A d Q0000000P)QO-P`p@@DT 0 >p0 SX Ѝ0 )p0XC-RP`p(@@DT00  000 0 X ЍQO-P`p@@DT 0  p0 SX Ѝ0 p0XC-RP`p(@@DT00  000 0 X Ѝ 0!< 04 0 (   !/HzhzlzO-p`)@4`S0ʀ0!0)0() )   !@V`WPpP 400 $c0@04 00$00 , 0 4 00CSP ЍTrc4,0P S@0 00 P  [  H ^  L X0STX0 000Wp V `0`p00S`0`p V `d``PpQ o lQp1qhpPL|00 10000000 P 0 Tp ` 0h`Waf`` Q`Fd 00C0c& 0R0 0C G(0`G00` 0RS0C2x05A05t0505050505110Wl%01 W ,PT% RFDHN\A \ \ 0 A0a00 Q3 0BP R X:  \0 c)0C2#8#<4(",$!8Q(L #8"(!PE  ᾐḐ ḐP0 \0 [꾐 ᾐḐ Ḑ弒01 `@3 90  BQ RZ    0S ax@I}t( Ho@`pMPlP!0W 100#00#0A0S ( E0`0P^ <T"48"$0,04#$(#4 <  !48!00$31##4<  q  0j3 #  $ (#4 <0 $ !0 $ !00A1@00V@`@P0S 1 0 1000 C00Cs0z 0S M "<<"$,00 2#̠$̌(#4< 0 R0#  #4<0 a31#  #4<,<  <,Ġ 0Y.4<.̠̌0Z 00#€` 00#0R B000 0b$00 S\0S3 0 48 0 02##4<00 S0 b##4<032#$(#4 < X!0!  0S  D0`0@PY   j! 4 8!00 0 00R! 4 8!002#  #4< 48 0 0$30##4<uꘘ]]]O-P`pV101!00 `#8010 S(1@BpW* Ѝ 0"00#0 R00`00Y b DBB Z Y ? !1pW:Y  ! !QZ ! !Q  C `Aꘘ]]]O-p4S@,M@0S[70 G[3* `101!P0P P#8",V0 !`1 W㜠0P  Rpsʜ%YJ*P0 0t 0c PRx `RQ,Ѝ S $p RÑ{'U$2 0 2 $0Y:0!448#8400p0P!##48 0S0`0P !  " Q  ` P꡿( ;00 B0c 0! 00#0Qa0 !  R hNP"    "\!  qc2 02 $00 p 1bR0YW:0 $"44 8#8$04  p r  (00!Q" "$,    Q\{ u r  "! RH{  ! R  0B 0` PY*P0 0t xp0c PR`0W 0PE0s00 #  "0  SM{  !  " 0S 0`F ~BpG0  (0>  P""$,(00!Q"<< 0"$0,000S  FB0`0P8ꘘ]]]00 00000100/JJJJO-MQ@8@Q\2 C\.*P`!!)( !p), !V㜠P` S(P p "(& 0$p(|'"([$* 0t 0c xpPR`)W:ЍpS0S  A0 `0P[:00!448#804pQ 0S  A0 `0Pό\00PE0 S 0S 0 `FApGO-Q@,M@Q\ C\*P`!!P PV"! p` P P S", )* $0 * 2 )    0  0 XQ:0 E$0<R0S  EA0`0PX;:0 ^0# ^0 n0##C$X0 0cR#0[垳#CY00c[3\;:  "BZ  bP"]000$0Q0S  A0`0PP0 0t 0c xPR`)X,Ѝ0PE0 R 0S 0 `F@Hꌕ]T00  ,0X00500\00/JPJO-@PM@P\e C\a*PP!"UP8 S0"( !i8 剈`", !)$`p l& (ተ0pW0: 0 `S0S  @0P00 $"44 8#8$04  ` R0S  k@0P0pW*80 0t xp0c `RPWЍP00`F0 S 0S 0 PE>@pGO-@Q,M@Q^C^*P`!!P Pp"!)V` P P",  S(ᇠ( 0$ *2     0  0 YR:0 E$0=R0S  ?0`0PY<:0 ^0$ ^0! n0#CX0 0cP0[垳#CY00c[3\;: @$Z`R ]08#80$0Q0S  ?0`0PP0 0t x0c PpR`Y,Ѝ0PE0 R 0S 0 `F?Iꌕ]X0S  0R   Y  Z0X0[ 50 0\00/JJ,00S/  R 0|A-`P㦪V0@P0# (㝪( @?0`0ᑪp $4?0$pC;↪P`<; "0`000  @@|"/p@-P$0@Tp5/@|\0P/ L  \/-  , "  |)A-p`^@ PP@@@ @S PU$R : ^V WQ B=P@^T0 N^@D@D\'LD@D BR@D@D\ @!N N'O-`pP`08@T U00400 Ѝ 0 VP`@|p@-P` 0@Tp 5/@|@-P0P0P`@P , 0< 0 00 20Ѝp|O-dcpT\\CUX 0S0 + <@D Pr!QbU00PC10c4#P Be" "1Ct p R 00 0C##< #"02#0 dR0 <#/00 0oQ98|7@-P@"l@  0 0 Ѝ00C-M 00Rpx@XPh` (   P  Ѝ R 00 b?( 0S 00S=P   PPX7@- @Pw9 000 # 3 @ `,3 Ѝ00( x00/0 <#<0@00( x0 0/ /@- N9 Ѝp@-P@` ` ` pp@-`@P X0 &U  0 060P000p4 06000p@-@P0`` 0 000pp@-@P 00   00000CS p $p@-0P@ `0%R @h @ 0X  @ 0x0 000p r8h0R@h @ 0X  @ 0x  P8h0h0p@-0@SS+JtJJ|JJ`P `PPE S`0P( 008#80"$R*0( 0000C@0$0p`XjR`P`P U8$0V0$0000p \^xG|G_p@-@Pej p@_O-0pM0 0! @@0P 1S 0l0`@ 0Y":0S0  H j0` Rp00 R SPSP2/`0S0S-  R*  8?\0"0,@0/O^@00 C)@C)0c"<3_P 00@0@ 0S@P  0SЍ 3/0@-0MP0@ 00P!0000(0$ P$0S S Ѝ0.00(0P(0"0 B (0 \^O-@( $Pp0`ȡ [ :(0$Pp0`0S3000/V"R/ p R+R*JJJJJJJJ,JJJJJJJJdJ` pW0( 00$00C$0 Ѝ`  R [i"  `PE  p ,7 P   PEp`V03 ,0, ```  \^_xG|G0Sp@-P` U U@ TL=P  @ 8B=P0 <0p/p___0-T# ;T@ p&  Ѝ QCM? @ R P? &? H$H`pG@00C Q4#0@CV` pU@D 0 p0P6&0`FS A CR T a DR @DH$H@DX W@;@T@;]O-8P@Up=0`P00a040,($@@ @/<Ѝ._;5_@- #5 Ѝ@-0 R  b@ @`@ 5ЍЀp@-P@,000 080/0 0 !""##$$/0/0 pG-@ MP 4`Ё0[@ 4P $(` 00 c2s~ C1|8Q \fFp Ѝ4, RX\X! 0C#000 ?5 pP \f0, 0 0 0S \ 0 fdH `L0 0P0001@00frh0SA 0;  R8 0p 0A a320! r0  P VS8 #61S0SS$ 0S 0`;`0H @R000@0@v00 NSX000L000)|0L >;A_e___]]P P /Oq;!)p@- P#@P`0S 1}DQ N\@Kh000:0pp@-` MR@@P30  `$!1/@P 08SKF@ Ѝp7@-P 0 HM@PP@P K00 Ѝ0s@-P@<`,` 0ЍpC-0000`oO-P M R R  P8(:#:$ R- PR8(:(#: 0   ᐰ3W0S"0 I  0.``p 0`l 0P;WЍp@-P0@`   x000H& R*0X6p\6S `&R \&`P`60C`6H&:+PPfTVeNpA-B^ @R -4=S` B `0S!>00CSʺ0 V0  =# C!f. R4P 0S = C!P0S c> Pc>O-P 0X&  ( , P B R   ,0),0 $ Bn 0 h0 S0 2 20S09(  0C  ?o 2  !0  20 -4S S 200h0SP 0_S [ Ә.0-400 , <K00SP}`& A 0h \^P0P 00\/@-01"\A@P <ļ]@-@Q0ST RN^ 0A@D^ \0SQLSQ \03=?00S00Q0S0SࠓࠃQ^\ ?6?000-A\\^CQ Ӂ0ѳ 0ҁQ/0G-@0P00pU5` w 0R (: {>C 0C"4W0  !1 /@+b! T l0<# \0r#|4ux4ppЍ0T00W0;k_kų@-@PM`(p! P `40{> 0020 050 02?0@  0 @ $v@PodA40PЍ耖@-0S00R0100 P @P R0S*@? T .@@D@0 Q RP00萷]G- @P0A S0 00.SR0 .QR 0L0SZ00UЍ P.P Bp0`^;ZSU Q CB \A R^:^0C `4 pC SRQ G\b*R^ 0S00`p Ub 0 B Q  GcR0b~  0V`: X .XQQ0p`bW PV ` B` R00 0S B Q.Q  W ^` Q.  ^ P^ B`_0R_0 0S00P U]c @3(0f V1P UO  Pꐷ]C-@PM0Q s.R R 0E $2S KA p R0 0 2`P 0P 庁+   +  +Y@PPĥߍC-`M@@r PS Pߍ 0?``FW - @ T0@ @D T * * 0* 0`W@F`0! ᲀP XPP zpwWV\ !PV RPPꐷ]C-P@?00CSLM`LЍ@0 `p0R * * }* 0 0S*h0 pS 0 A\0S/Q  '0\ \Q^ AB 0  ("(R ! @ B( A*\ Q?,? Q, ? )  3000Q/@-0Qs.\ \ R 0 #@aAON/0S/S 000/0M000Ѝ/ 0P @/0P0 @-@tPt`t0 0x0 @`@NP0 00 @`@N(M$ Ѝp@H%_/_]/@-@RR@=@-Q|L &CЍC-@$M` )0pS rXL SUxO@x 2) !08p 00$0$0 0040X< 0L00!s0X0P0"L0(X0\00M0400X0St  0Pqd 02\0 xAXe001@0 @0`&g< 0T0@0P@ 00$  0 PP 0,Q$ЍP @)0 H0 0I0 0J0 0L0 0M0X(0\0800sX L000 00X0S A A000Z!!]9_ 0Q0A-` @ P80 rGLppF\P:\pd@ E 02p `0S7:0 00P 0 \-Ѝ\` 0\P/0 00H0 C2 000\0 >0>00C000\ /ЍAZ_O-@L8`p0,MP 0s H$ Z,Ѝ0 u/\0S* ppd0Ep7s0GU 0X0XP 000Z\P0c 0GPh  ZpG $ld0T 0C@ BÌ)0@ @3)`<0"$P$0p 00 B '0$ % \P0G 09-P= r 00 0Pd0;0hl0 Qm AH0 C2 000 0\P0 0000#Sns_p@-@PR P ?0 0`eU`咝Op@-P`F@"@PM@90 000 001 0!r"00hЍp@-PL"@P4XЍ "P|Opp@-0`P@ R@ 4 Rʈ0@@\0S  0@0$ 8@0z@0 0C?o20p@@-D@؜<!P$FЍ0 0 pA-0Px0 0徜l!@\`FT 0S <Ѝ ["pz"O@pG-P|@xp.D0"HC \ ! `.V x.x 0 -   11 1`00C`0`0  0`0 11 1/@- & Ѝ0M000Ѝ/0@-`@TPPtPU \ PU*x^\  0O-`0ts4M(00P000X 8@ERk X0S04 p000 0 0 0JS 0\0 00h00000p XR:0#S(P hY l0d G BT02000Vp`dp2L0.L00 VX0S0 R d0\QV l 0CP 230Y l0CL3000V00R d\01CpS04Ѝq000 0SNW\0S*(P  -$00,0 0[ (P 0(l ,0 B$"|P$0, (S:P ꄰ0{0 00^ H0[ (VP Hhlj h00\ %S/G-@PP`M/ `0S 0"!0#0\.0l 00p02 B"0$0Ppp`0 00z%0 {0%0 ?080:>r0"\!o0C00D0l `$0 B"0$0'$ 00U%0 0P   mWp.0Sp(( P ZWЍ贺]__O-R4MXP0r\0@Sm: , 00$0 0(l $p0 B$"`P3( 0 z-3 0 0 1Q+ q1 :CQ0 ( !4 0 (+0(00t0(P 4Ѝ| Z  R 0 0%RP0 0RP ,,P$`@-M`pP0 0 0u@P ЍU 00@-@  11 c0?o0c0CS1! aQ\51:  P0#03Q0#S 1S c0?oAQ1O-P`pR H0p00?0Ce\ 9+ P 0[* 0R3:U& H0Z 0 0p Aq  o B X0 H0p00$ЍUP11 Aq  o B  X0H0 0p0UP1 1 mNA0C-P@`q嬁,M00T\0S*Q[,Ѝ *00 0 8Y Q  0l 000 0 B"0$0P `K0S s S00 Q0 @0:02#400@00 >0@020000 * 2@$ $0" 80C-@$M0\ S :0P(a`0\0pS*W?5 0 S*x*WQ 0p0w#PW p 0 p l0  0Cp  $#0,P $ЍW O-X0M@Sp@8` 1hh q h l  l 0 PP ЍL0P!h00h0h0p0l0t0WP X0 Ql00vPP0[pG00X RX0 00l PP h  0C h  00Cl0 L0 0 CS  dT00l0$ BL,p 0C#0P$ 0!XPM!Ѝ/O-0lM P00L0 `圠  8@0 rJ@P)0$     CRv     P 0@OoB@lЍ$MP@M@0  4 0.S1R R-0.S*p0Dps 0S7$0S] @0LpS.$0S0bX S B/o" RL 90000 10\P+ P2 P0,0 0$`00 C/oQ" 0R pp4 0`(` 0\0<`SLH00 0D0P P PA @  D0,0  ;0l0TP C)CL@H)0c"$<3P<0 L`H0S10000000    QQ Wp(`Q@40SH 40SE  I@P?Wp(` W( 0KK2(0(0@,0010 Wp 0S0 00 0 0 00 8P ,0S  \3'P 0 00 d)'P08 ,`SRpp pK0p 0B    0C tr  B   C $xL R [ D   pD R`[ W`DppbL0 0Wr LpR$ R v  I@PX0[0C?o20S( 80@0b$  R Q R   @v0  H@PX 0 B/oS" R@ 0D$p 0D@P tO-8@LM00`\0pQd :,pA0001 0P 0 \ LЍd \002\0d800000@ pP00lSh0 A)A )0aD@48"03$P4 h0@0P 0 PH0 0I0 0J0 0L0 0M0 0L0< 0\0<0800s@0 00S00p0 0$0p00(000,00 C00 , 0R$:04S *0Sz L0 X0r00L S000 S<0 0P0<0 00]h m04S4 d8000@ 9PP,l@ A)A)0aD48"03$PP4 h00P 0P80 0($ 00 0 I00P 00 PP pd80@ 7P^l@4 A)A)0aD8"03$PJh0 pG 4000 0 Q 04S= 7 PEPPi h/04S& d0@ 7XPl@ A)A)0aD8"03$uP 40h 00 0 pG  P  0CO-`8$M000 $@P @DOoB$Ѝl A)A)0a"03$<P0P Y Q ppQ @ 8$P $$P   P__A-@Pld Qpp0 BT A(`P15"^h05L<0 L)L)lp1<"$PV 0h 00P00Ѝ@- 0$ 8 ЍO-8@@AT .i0&3 ?@AT0  @P@P Hd3 ?A.$ 0R 7000 0vN]G-@0S0s!sr"sr00s(sr(srx0s` 0Ps8p  S0s  S0 SЍ(,0sq 0   0P08< rqHL rqp 000 &V@ 0>P00 8< rq 0 R 8v$sr 00 T0V HkL0 0L00000s 0 0  V,0@>P L000L0000|0s 0 0 U,0@x>P| L00 0L0000ЍG0 r| rSh fC-0@p0S M  RP- 00P S 80 \p`H<@X!V0 P 0`F`80l A)A<>)a21, Ѝ8 d0l 0C 3 ?SR`O-`@,M0pS8@,Ѝ 0S@\ Q00S) 衟 PU \  0 R0U0 R H0C200 00 0PP 000 0 = SP @P 0d hpP R b0S"$   PESQUP!\ P R0R0P0 |@Pl A)A)0a$"03$@P p00 0CS0! 0PU 0RSU@pO-p P0` S8$M S@ `H  \000 0 P0S@$Ѝ00S\0S0000 @00\0/0S00-p0d P l0  \RQ B01@ 0 @PZ 0 \ \ >0>00S H0A00 00 0H0  C200000 A@P0S> 0S0\ T000 =0000 000@ 0 0 >0 .0 0?0@P001 0 -  0  H0S 0 dd@Pl _ 0* I(C8RP 崱t000 #8 *(80( 0?P @0 S=$ЍO5@7@5`_M!Ѝ/A-0 @p0`SP , PW,+G-` P@U+@P pp, @P 0 -0N0@ +B@s@-@0P000CSG#SR`88 d0l 0C S c10PQ0`P 0##sr$ 0?00#sr  Ѝp@>8l A)A0<)a21 #Ѝp_@-0P@"XE0@8 4#, #$0E~EЍ__]I^00\ <k00C S0}KH}KH}K}K$}KH}K0}K0}KH}K0}K<}K 0 ! /+ 0 0 0nSG-0 SS   ЍS P 8pL  PS  Pk;0S2  I00 > `!$Q 0u;mO-0tM0$0L0P 0<00S40@ P$08p40!0,~0`0S0000 0#200~ 0022 0$0X0S rtL Sq@T0x0ᤂ0X@0h0sL0ld0S A A! a,3 1T 0 0 #0X 0000xx0,, ~0`00SD: PPD0 @S  @   0 R50d Q a30RQh 0D0808 p00CS0!@0$0\0HXL00$P0X PP3l\X0 A)A T L)a"31$PPJT L00CS0@08 S  8 T8 000X :0PD 0T UQ. (0< 0,0 0004 0C0$0\ 0@T0T0 00 00S U   00c}0 00  0Z}tЍQ 0S0  0 0J02p40 @  O 0d00e0|0  0S 0d00e068L00S ldA A! a,3 1T 0 0 #0 0m P$  d0 dl0 0m0 0n0  :0X400S*Tc?002 0 00  P TZ PL 0(00,00S ( ,     0 R TBP40t0000?(@,D000@0(@,0@0(@,0PD \^ \^A-@pM0@P`00 R@@00V T0ML0 0L08 0 ! VTj@`00R 50 W@TX@M00N0P #000Ѝ@-0`P pMX0S, \0R@#0*x ~P @P&00h@l@!0 0\0!" 0080H00 0 0p 0, a@P  0 000 <Ѝ80 000 m7@-@P$@&P ʄ^ Ѝ080 000 V0C-0@P8`rr eL  h X0S ld0S A A! a,3 T1 2# $0L0!10P  000 00HpX0000(0""p 0 8080F  0M  00|0L0 8|0080xp000h \0000000 Ѝ 000  0SL ld0S A A! a,3 1T 2#$0mA-`0M0P@ N80 000p L040S cP3 @PH0 0I0 0J0 0L0 0M0 0L0\pp800s  CЍ@- `P@ P 0   0L 0 0<031008 0P ЍpvdG-0p` M8P0X0S, \0R@#* 0]@P~x 0PP(0(wl0dT A@! 0C#p00$?@ p 0@ 0 00! e XpLP:!0.e2-8640q."@* _X @P&0d00t@p0!# 0, $00{@P 0 Ѝ 000 |p@P  ] 0`( "4`#/p@-@(0Sp0PSϮP 0 R@TpO- DMhR/@lp0.`p0P00`$,`@P!$ @P#W$k`Fhp &h$ 0@o V㨂X@P x@Pc,a$tDЍ @P P0`V< 0P0 8  \$ }$ #  R( p0(@ 0,00(000 $00 @P(`0@T \PI@ PP@H@0 @P M0@SI@H@ R Bq(0W0 ,000,0_?@X p, Lp , ѧ,00X 08@@,0S 0"@H00x|ЍT㜐L L Q! Q QAt&0800?@PH R $000C H@@ &408040 =%u<00<0%$3!00 8J0VP 0@80 3!8G@T$%t;>0 SC&X02+@ 05:"0P0 @ 00 000 000,0000C0@pC 0 SQ, 0$R00S 0{ /@㌄ 0Sj @$!X$$(08L0(0+00, 0?@P,p00ʿW 0!"Т3" R 0P03Px 30p 0d@P 0b" 0"@0 { U@ 0(D , P\Ԧ 0 ,  @  00 00@,0  0@0 0_T@D$p 0 ~$0/0 0 !P"$0/0 0 !P (p$,0pW @ 2$ 30p 0d@P& 0$S !@ ~ӦH@x0 RȦ@ X0R 0! 0p! ~峦P1T 8@@808 0  &!1T+Z ~嘦+0S !8 0S劦G0p 1~!! k~!0\ Rq 0  8@@808_41uO-DM,0h08 <00Sy 00P08地3$00S 0SpDЍ00  01 $0, '%Q  0 0\:Q`@(0 0? Q  , DЍO<0 $ ,pP Q1' 80080000070 `P 00 ` E`8S0RP '000pQ QM Q&Ж000800400S 0 Q:p0S0 0 upQ Q QVWc0 SR0S S 1H0C200 0040tpP  0 P0*% 00000$0 0;00t@Pp1`l 060pP $0 ;cS0!00p 0`$0 0:0 Q@P 060 %pP  8YW M00 $0, `$0Y (R   Q\ 8G0p$ I QX#Q X *Q Pڸ  Q\   00 $0, p H I 0 I R031005 000(0<0040(0X*0( 0R{*  0 $00CY\0X(00 00(0)!00 (0 00 0 0 0(0 % 0`0 %(SR0 (0 0 p0000G010S0|0S8Sz$0p 0 qP 0 ; %0600P 1 Up H   X  R   l40S )!0 0 A000  0 . 0p  \I`l8q(0 000S} V 008w[8rpL=_O-` 0S X厣@0U !0Bq  {P0! @0Ap H@o/@-M@P` ( q0 0P  @P 7Ѝp0@  4/@P2V@002d0  4/@P Hj7 kV 000( (0ऺ?_i]_i{_X?_KC-p` 0TM P pƷ@P B7TЍ. " !>V4D`Y2!>3`04\@ 0$p 4/@P 8!7 "(00 0]_i@_X?_8Kp@- P0@@` <04 @ 04/@P 6 唷G_ig_@- 0 0000 0Ѝ @-0 000 00 0Ѝ@-!>000!44 0ЍO-@Pp`LM$@WphP6X zP0 7 |8/P $+ LЍ ``  4:/P ,6 $ $`88000`8 `` 0( $;/#PZ@T<P|p0 3/Pt0 Sx0S $0x 00$0}__ 0aKp@-@P% Cp@ 0`( "4`#/G-@P`P000 C3(10S@0  dU. X(3忠@@0 0U>003000 8Aᜠ4/P#P  p000@PK R> 0R  CU700000008A ᜰ4/@#0D?oU20S 0 #T T0S0S0w2T0 P0C0b @0 0C00g te P0 T0S$Y @ 1p6儀00008A ᜠ0 4/#P@H  @P #T 0 T0C007S @30 00 S00  P  mx5 0R ,%(10(1P|u5@T uP~$$10$1M 0S0Y @0 0000040S: 8, p44\:# 80   <0L\0C1 01008 T 0`000d0嘚*0<00L 0  !  0003 000 s 00bR0d`0Y   P:dd0 00 0`0<8 <00#<0040D0SC % @<@j@h@f@d@b@`@^@\@ZB@XE@V ,0TF@NG@L0  dz@D<@B@@V@> @<,0< @8R, 9981!p`00h0 !0+@ 0`( "4`#/O-p845,8p /? <*Xy([X0rd0HSa82 00?_EY;00 0S  $0  0 48<8<@|@0(, 0>0P03.: R Q# Q3#8#(, PU0 :8:&0 0 0*( :60S<Ѝ8< z8    08 08  0`HD]8d]]<0@-@ P0 M0   0CD T ,P  0 rЍ00@-PM8  @:8Q:ę0 00 ' FЍ0@L:Ѝ0S| O-@$MTP`L Hp RQ4PP0UPPӈ U0@/S  0Q PT`0QSR$1 1@!pW?W0Aq1 U.181q0P0PPS P iq1 1 W?Q00 00U0P00H0 00000`00X0-181qq$Ѝ\0P/Q ____C-DMP` p f <  0$ 00 0@ "4n00 00 0  &0|0 0 P0 S  f P fDЍL\ 0 \0? 0 0 90G0 0 0Zf 0@-8@ h0l P 0P3<P<#/G-@0 qd `00000`P`0d P Z000Pp"SR \ R3#. 9 9 8   088  H@ 0`( "4`#/O-$@ ^p%0q00]p0a@S 0F  `pF` Op0 S  0 `@pDpPU- 00}pH:po?0尡Z | Q ! |! BR!&cp p0S 1S10C1Tp0S Np p p0S hEp 0XS  0 ;p9ph%o$?/]_%_<@-@ o000p@-<@Po0@Spp 0R@C-@M4oT@#(a(Qq@ 0R@ o 0 {\@oT0 0oЍ00 0R圐 0R@T0 ǯ0S   0 o00%o00C0@0,0000ⲯq刐! !  *P![& e! ,++:10 0 4 NP !*! 0 0 4 =( 40  ++!mX?<_3_G- MPp  @` ?R@T Ѝ Z @0(01ʟZ R00 00@@dTP0R00PP $ P0Q\(0 S @0 000O-@,MP0p T0P`X 0 T0 0C S 00   @P Y? 0  P0SR0K|0C!0 SH080@ k  004005000@@?0 S0 ?0 ?@?-Q P@ 0P 00T 0,Ѝ@0S   0R00   R  @P ~0' 0(T (@ T 0@0 0 @0 0 DR2320   (T7T0S  $'0  '__O-PMp`HPՐH4P@0S#  \* P$IV  $  # $  L0Y@2P #101#0 00 #P  #   B d#  P@    &dtX  L R @ R  P " #   0 3SH L0SP0\ 0 5 P <  0C S00S      S PHFQ4tK|KKKlKk  #RHL RP \ 0P0, BR    PBVL0Y@PЍ  #RHL RP \ 㿏0P0, BR V   2 % ~~@-8@BP(0, 0(00 , @7@-@ Hi d  \P\00P0 D00(0 ,00p0 Ѝ0 LFn_^__@-4@HhP(p@0/p@-PH@h00p@i@-Q0   0P0"3 e 0ЍA0C-P4 $0# @ 0唤@P y{0  000000) 0㍨@P 2"1u@P 00' T9@  ᦮1 4W?o20S 4 j@P 1011 Q 0@4Qq0 A0!0!0(0S+p@x0tT@1eeO∀@ ݬ@P1@010@00 @1:\@LHD@X@T@P@d0`@h@<ЍS p@x0tT@1@eKN∀ @(0S [&  000000t 0 R00tp@ሀ@M@X?o_O-P`1 @pᐑ吱!@P4|qdVʀ 0! $X!0 P!H!   !,g0S2g 0! d0    !tT# 000 坧ꑹ@P8/P  R (@- 0@X?oHzhzlz_G-0@@p` ,!4#Q !PP0 @0 ̄00LW\\0XX00400O-,p@0Q0P`( / R 3SH L0SP0\ 0 0@0 <  0CS00S 00018000 @(ЍOdR 3SH0L RP\0 ׃0@0 ̄0 0L\\ 000P0400,(H PX`P P /0 R0@o/0S@-0 oO-@`pPlM㘀" @  K@P&  04 a 4 a bb/ 0wP+Jx 08 0,"*0\191%]3lЍ0L@-04 $  4 4  4 @ ^  \ ñ@- 4@R 0P@- 4 @$R 0P@- 4 !4@T  R!@-@4PU@` PpTpPp!@T`PPU@- 4 "(,4 @$R""R 0(,@-@4(P,U @$` PpTp $Pp"@T`PPU0P  H R L01x0 R R// /bQ 00/]@-,@D0SD@)P @UO-0P ZppW`g000 3SHL0SP0\0%0@0 W (< 0CS00S@ 00 L0H   0 04 Z Z   #RHL RP \ ܁0@0  #RHL RP \  , BR 㽁U0@0     EQPE X    #R"HL RP \  B/o"R  #RH LQP\  ,gfZ㑁 @  K Z 1 4W 40 0 40 JZPGUX R PPO, BR  RO<0 S<0  00 #8 ,8[808 000CS  R 00@0(p0D0p0 0H0(p@ Ѝ0, 3SH L0S P0\ 0  0C?o2S f[PP@0 3SH0L RPP\0PP 0  <\0 0PE[ P1  <0K00<00<0]_@-@W0 (0Aoᨄ00Ѝ 0`( "4`#/d0SH /-//s@-`P80Q30 : @0@(LЍpG-w@  Z181GZ `$PPWPdP RPP YW Y181$Z1p圀 01PPB4JƁY; 9o7v5z0 X?_p@-@0` PH5@PP (pG-MP`px @PЍP   H/o ``" PP|7LO- 1C2 |2 0<0:t0p0x00008|0l 0 0X 00&Pk4p 0 (00,0'S0 c0?o0c 0$(0SP :000 04PK0 TPJ!`0  0Sp a ` _^]\0 o~J P0S00000 \0 Pp0p D A  P { u|wT  o v z~(< _ _ _ _X?<" _G-PR M 0GSd2p`0 V Q 40p @P!00(0 0,00000  t p $ x ( 8 , < 0  4 | <08 l D0H0@ 0@ Ѝ0SK@0 J@ VS  7<$(, 0 00@SD@I i @P6ZIY `0 @P)Z ` ZIY 0D@PZ `000騠@P 000 s@ III@@A-1Ms1WP@ɥ<P0< !0 0屧BP@P BЍ0( ,(0$!    y@P  0p0X0 0(0"@P ( (  (l`p0@` `!(W@T 4>K4g_Fn_<( _J _n _2z _ 0`( "4`#/@-0 $0S\ 0 B @B24 b1> 0S& p@-`0 CSR!0@P P  0 P  0 0# Pp 0&p pG-p0M0`0@8 ;8"PPd h"\D00D0D  0oU@ (W 8$ #R Q!0P0000|000A A1(L HL RP \  BQ,L (/PP00$ 0 0 0 0013PP Q 00 0,,PP. |0Ѝ #RH L0SP0\ 0 x(0000(0 <  0CS00S( 0 00 0 0,00S00  R,0 O-00\(lMP0@0|0\✀0|0 D 0 p,0 U`<Z 8 F #R6 QC0,@000,0000A A1(Ls< 8 Pu Q0,@000,00A A00010(LQuHL RP \  BQ,L ,<`@P J|Pb0 3SH L0SP0\ 0 !x<0000<,0 <  0CS00S< ,0 00L 0 ,0 < 0M 3SHL0SP0\0Dw<0000<,0BHLPP\@  @Q}@ L ,<@PY3P{?@ X808 00U0@00S0T0S@lЍ<  0CS00S< ,0 00 0,0 0P<0 U #RE [R ,@  0,00 0K1 1C!  @004000080 0 P@P <AU 080 X0000CS000% (  APP(  4k{@PHL RP \  B[, 0 ,<e@P P 0 0 XPPX0 080 P000CS (  `P(  4.{@000"8 0\0$300CS000 (   `P(J`X\` E`BHL`='S R00$00PS;#S R7800C?o2080 Dp000CS000 (  `P( PP" 0 0DV`PDp[`$0S0S P00`X0 `?o2X HwP 4zP0%'O-0dM`00,00 0p0SPdЍ|WH$%圀t00t0 $0   W@ 8G 82 #R" Q/0$P000$0000A A1(LH0SQ?PSz 8080)HL RP \  BQ,L $8IPP 3z 808 #RH L0SP0\ 0  v800008$0 <  0CS00S8 $0 00 0 $08 C PHLPP\ : $8PP,00(004 00 0P33PP QųW 4( p000CS0(0*  P ! 0y P808i  @Q0$P000$0000A A1 D"4 0\(@100CS0(0   VP @P T@X@D@'SR0000HS#SR8@@DOoB4( <`000CS0(0  P pP 0 0<P}<`X㜐 0S&T P00X0?o 2P @P 0&y W808 0% ,00S0U0SPP0%'0 /7@-QP@0 P0 4 8 RP 0H0000 v Ѝ0O- 0 `M00000090 00 00CS@0S@ R0.S@ .@P0 0C?oR20SP@0<0000P0 @ @P P 00 @P 004 Q\80 R] X 00 0ᅴ <08 : < L  L H $ 0 $0[p8 < 8v #Rf Qs0$@000$00A A1<0(L/X# C,0!0 0 0-803!@@P& 0 8ЍG0 Xr7@-P@0LP! "m0S, ,00 13/a Ѝ0 _ ]4]I^@-@0S @C-`M @P- 00 0SS S pq0 S2 I00>00 P 0  ' 0@xЍO-p0PDM,sr`lE0V0 $P00P0H $08 `8\ #RL QY0$@000$0000A A1(L80 L #RHL RP \ Cn800008$0>e0 P@ QX@ @T@0T Q@DЍR 0HL RP \  BQ,L $8@P zrI,000BS8 $0000 $00R# @06 R S 0(0400 0 0 0423@P A4( <000CS0(0 ,  `P,  00r@ T0RSfP 0 0<`P<T04( 000CS0(0 ,  `P, A000 q @q00S% ,sr! 0S 0T00K 0 @GDЍO000 0SS @8S @ꀙ 0@0*p@-`P@M8  ;8YP00   08 H@  - 0 013/Ѝp]@@-p`@M8 & P   P00  0H X@  0 013/Ѝ]4p@-@ `(MP0k 0 0$00 000 P@P A 0$P000$0J000A A1(L40^ p Qp #RHL RP \ gl400004$0eHL RP \  BQ,L $4PP p( #RH L0SP0\ 0 l400004$0 <  0CS00S4 $0 00L 0 $04 0 3SHL0SP0\0wl400004$0,000BS00S4 $0000$0<0040  pu Q? #RHL RP \ 6Cl400004$04Q #RHL RP \ ,l400004$0 ,000BS00S4$ 0000$000,000BS00S4 $0000$0;00 Q40 pw Q? #RHL RP \ 6k400004$04Q #RHL RP \ k400004$0 ,000BS00S4$ 0000$000,000BS00S4 $0000$0900(,40p|  Q? #RHL RP \ 6k400004$04Q #RHL RP \ lk400004$0 ,000BS00S4$ 0000$000,000B S00S4 $0 00 0$0800,(80<0zs 0ZS40 ~ ? #RHL RP \ 6k400004$04Q #RHL RP \ k400004$0 ,000BS00S4$ 0000$000,000B S00S4 $0 00 0$0408)@&H0L0zs y0ZS40 k #RHL RP \ bj400004$0` #RHL RP \ j400004$0 ,000BS00S4$ 0000$0404 0 3SHL0SP0\0 nj400004$0 <  0CS00S4$ 0000$00,000B S00S4 $0 00 0$040HP4 0k 3SHL0SP0\0b)j400004$0` #RHL RP \ j400004$0 ,000BS00S4$ 0000$0404 0 3SHL0SP0\0 i400004$0 <  0CS00S4$ 0000$00<  0CS00S4$ 0000$0000(00,00 0 PP QX 0( 圀000CS0(0] 8  w@P8 T ,mPdЍ<  0CS00S4 $0 00 0$0p0 0R01 p0 p0 ( 8@p X0B`HP0s0 $ ?@c]Mb 0 0\(p000CS0(0 8   @P8ppPTp kXh@@Dpc'SR0SH#SR8ppGor0( <`000CS0(0 8  @P8 W:P 0 0 0<~@PJ<0X` [W P00`X00P @P , P0%'0 0 0PP`Y@P $G-@|0s-P pr`0s 8<0sqHL0sq0s 00~(,圠p|^ 0>0 ^0P3l:0S#S$Pe PPe "؀(0, 00h1 3 |PP!  0 E0CSHL0sq 8<0sq0 r0sP0 0"P""0 3"srP P P0$sr#sr0s 80 Q3/PPЍPO-00#`pT0DM|0T0D  $0/WP 8d 8$ #R Q!0$@000$0<000A A1(LHL RP \  BQ,L $8@P000002(4  3@PIWK4( 000CS0(0 ,  @P, ` P 0kH@F #RH L0SP0\ 0 g800008$0 <  0CS00S8 $0 00 0 $0WA, 4( <000CS0(0 ,  9PP,  0ck@DЍP 0 0<PPT 0OkT4( 000CS0(0 ,   @P, u P 0/k?@R@ 0@P O-0 0p0/PP3LMq:0`ZP0,0$00P00[^T%X00X0p0$ [ 0 0,0Z@@T 8 < #R, Q90,P000,0000A A1(L@0 ] #RHL RP \ Tf@0000@,0OHL RP \  BQ,L ,@PP j #LЍ0 3SH L0SP0\ 0 tf@0000@,0 <  0CS00S@ ,0 00 0 ,0,000B S@ , 0 00 0,0ZP4 0!000 0<008000 023 PP QZDf <0 000CS000 4 0 <@P 8)jPf P4 _P 00 0<0D@PDU8l<0 000CS000 4 0 <@P4 9<0 000CS000 4 0 <@P4 !p0@P8iHP600 0< 0D_@PDP 00<p0P 80i0P8i0Z00 ?o 2R0S0K 0SO-M800@  P    `0 @0/\P3:< ,0?t00,0PSX040H00L000(P40$`$0SPkL+H \00\00t`$0S`1800`S   T0 q,0pSde 0 8> #R. Q;0TP000T0 0A Ay0001 0(Ld0  #RHL RP \ }ed0000dT0xHL RP \  BQ, TdL PP h0 480SOv>@0( U Ѝ0 3SH L0SP0\ 0 dd0000dT0 <  0CS00Sd T0 00 0T0 0 Ld 0 3SHL0SP0\0dd0000dT0,000BS{d T000 0T0@0PP 80S Pjd HL PP   T\`$ A# d XP`0 0C0000 00C00 0 0=000>  d B00X0 0`00\00 0 006 3PP <Q,0S `X p000CS0X0> h X `P5 \ h P<  0CS00Sdd T0000T0LH | T0d,PP g08 4|v=@0( $00h X%`X 0PE0 0CS0X0 h X `Ph <ptx |x\R00 D0<0R0 4\R8Hoᨂh lP RpIoᩒ0<0D<`X l000CS0X0 h X `VP`h P 0X 0`0lPR<0lSp D0S+X P00pX0 ?o2 p(P U`V` X0 00CS0X0 h X `pP \CgPBP0%'h{P\6gP5V0`F 00000C0 0000 0S/0 ^(0pS SPpp<0 a圐@ 0`a`<(p[ P0hH0\fU$00 V0C$040040~ 0 L`0(00 ?oV20Sr $0 F000$0C0000000 0S 0 S   P   0ia` 0X 0`,0†=`P \fPꀠ,`*<00C00Sʐb< _ _sLO-dM000%圐080p0p0p0H $ p P $0X` 4F 81 #R! Q.0$@000$0000A A1(LDZQ?@Pf 8080)HL RP \  BQ,L $4F@P 0f 808 #RH L0SP0\ 0 b400004$0 <  0CS00S4 $0 00 0 $040p V #RF WS $   0$00000Gq qG 1800,000(00  0 @P AijX 0( 圀000CS0(0'  `P  ,e @808eHL RP \  BW, 0 $4@P h("0 0\( p000CS0(0   R`P pP TpX`d'SR0000HS#SR8ppGor0(  -@lЍHL RP \  BQ,L 0@j@P TZ #RH L0SP0\ 0 .V@0000@00 <  0CS00S@ 00 00 0 00@ + PHLPP\ " 0@&@P@0Z  Q- #RHL RP \ $U@0000@00"  @Q00@00000(0A A1 ͹,000BS00S@ 0K0000 00;0s@0 F  #RHL RP \ U@0000@00 ,000BS00S@ 0000000;00@ 0? 3SHL0SP0\06lU@0000@004 #RHL RP \ UU@0000@00 ,000BS00S@0 00000000<  0CS00S@0 00000000@ 0 3SHL0SP0\0 U@0000@00 <  0CS00S@0 00000000@ 0 3SHL0SP0\0 T@0000@00 <  0CS00S@0 000000008<@ty zTY@0 Q  #RHL RP \ T@0000@00 ,000B S00S@ 00 00 000408@HL@ty ?TY@0 k #RHL RP \ byT@0000@00` #RHL RP \ bT@0000@00 ,000BS00S@0 00000040@ 0 3SHL0SP0\0 5T@0000@00 <  0CS00S@0 0000000,000B S00S@ 00 00 00040H\PY00CS@ 0k 3SHL0SP0\0bS@0000@00` #RHL RP \ S@0000@00 ,000BS00S@0 00000040@ 0 3SHL0SP0\0 S@0000@00 <  0CS00S@0 0000000<  0CS00S@ 00000002 0#0<00480 00 02 3<@PW T 808Q #RHL RP \ IS@0000@00 ,000BS00S@ 00 00 0001R011 0008w@p p1B`nHkP0s0 800C?o200 08, D000CS0,0 0  ,pP0 PP) 0 0DܮpPz 0DSp$0S0S P00pX00 00$00p 0?o2X HP 4(KP0%'@T V  00@`O- 0tMp00,0<00/0圠 `0 l< 00d00d00H $  00  VPHG 8 9 #R Q)H 0@000000000A A1(L彪0SP`J?@P`HL RP \  BRL 0Hž@P J`, BQ0 3SH L0SP0\ 0 FH0000H00 <  0CS00SH 00 00 0 00H0 D #R4 XA 0  000000H H10 LH0V ~ Lp^ Q, #RHL RP \ #/FH0000H00!HL RP \  BX, 00 H:@P s,000BS00SH 0000000;00PH 0? 3SHL0SP0\06EH0000H004Q #RHL RP \ EH0000H00 ,000BS00SH0 00000000<  0CS00SH0 00000000H 0 3SHL0SP0\0 EH0000H00 <  0CS00SH0 00000000H 0 3SHL0SP0\0 dEH0000H00 <  0CS00SH0 000000008<@tx pTXH0 Q  #RHL RP \ /EH0000H00 ,000B S00SH 00 00 000408i@fHL@tx pTXH0 h #RHL RP \ _DH0000H00] #RHL RP \ DH0000H00 ,000BS00SH0 00000040H0  #RHL RP \ DH0000H00,000BSH0 0000000,000B S00SH 00 00 00040HP<00@0004D 0 05 3J@P AD V04  00CS040 8  <@P8  @fHP` V8080<00S0T0S0U =,0043 00 0@P ,0TP0S@WW@tЍ #RHL RP \  DH0000H00 ,000BS00SH0 00000040oH 0 3SHL0SP0\0 CH0000H00 <  0CS00SH0 0000000Q #RHL RP \ CH0000H00 ,000BS00SH 00 008" 0000 2000 08@p 1B`HP0s0 !?@cD4 P000CY S040 8  G@P8  @qG 0@?SP@gGH@ P D 40 0 0C R 4  8  @P800 P01@PP0VTPT D4 000CS040 8  @P8  @)G P]Mb^[.P D4 000CSST 4 T  ᤺@P@V D4 `000CS040 8  ùP8  @F @Z 0 0``Pp@P`P P !D 0\4 $100CS040 8  D 㒹P8`d hTPX'S R00$00S#S R8HoD4 Lp000CS040 8 4 D[P8 `P 04 0DL PLpZ㜐 $0SX P00X0?o 2` P0P @bFP0%'T  L 00@PCU U ;MO-p M0`F0 00S-$@hAI3 1 H`P 0 081   E"   E$EVP  0P 0P3 00 P" [ 3 000 0:VPP PU 003 00 q 0H@Ѝ000zS0P9$ᨾ _ _ ]G-P `MpkPL0S@ aP 0003 存P@( 0U&2ЍH0S0 RP@UP @ P0SH0S300 0 CS 8:8b, _G-P@0 pS kT! S Tf``HWPڜ0H0S0S 0 P0@41 3 00000 00 0 ,` VV!0S 00   %T 0S  0T0 TT Ѝ`O-0pdMkA@dЍ%`000D $08 P@@8@< #R, T90$000$0000DA AD1(L塤80 , #RHL RP \ #@800008$0HL RP \  BT,L $8☸@P D,000B S8 $ 0( 00 0$0 04000 00 00!@P wA4( 地000CS0(0 ,  PP,  0?D@\"4 0\( `100CS0(0 ,   PP,_`P T`ZXWP@D`R'SR0000HS#SR8``Foob4( P0%'4 (P0 00CS0(0 ,  }@P,P-ap  ީ@P (@ iㆣaZ1u0@-MP@A0 00 8808Ѝ0@- Q@80 h0 3    808 0&8808Ѝ Q@-0S 00 3 ЍO-M<0@8pD40)l":  00C 040S4L3,0A`0 : S 0003#0 #L#32024P t0t0<Ѝ莼 00 00t0P s4P sTU T.] _ _@-003!z?` 0 Ѝ _0@-qPM:Ѝ0@@80@ 3P@z?00`0 Ѝ0 _C-M8`0@XP:@DŔ  8TAVp pϬQ @$ @P@ `8Ĕ< Rd`Ѝ _d _ _O-p400P@ S` 08`M ?  0帞 0QP_ p(80 00w`(`p Vw &0 &00C030S3 L32  B \%<1R.=S+T @~0P SXprpppZ ڨ t~0  0 n~o00C00 ST0T00! B!00 0`f L`` V"%P80 0SЍU TO-,M 0%!@ 0&PP``g\%1R=Sg \1R\0 嵟 p1>0S100! 0 $=$S 01000W 00p50 00Tp74$04L3 $2   :  S 00C03#0S #L#320C2T3S! !,ЍOPTU _>] _O-}?0000 ST0T00! !T3S! !80c Z ( ,400c QP04 $T0SP{$00$04 $04L3/ $2  (080 ,0aP0\00e$`Z $P $08 0C$08 4 0S4L3  0  A 0 %000303L3 0   \%(1R=ST @|0P SX`b```Z ڨ |0  0 |0000 ST0TPP101\400S  0Q  0@ȏ $0 $@hTU R] _ _O-p` P,M?@ᔠ^0 !:1\P$0, 0ϬT0 C)C $)0c"03wtP $ 00\ Ó\ p,Ѝ0 8#ZP  0!p `T$KqTU s@-`@PUЍp80 C0ST1UP!P 0T 0 U"000/ 0C0O-@P ` T0 Cc c`2aʿsᬺ 0 d0 0C R S R0 _ ЍOEO-0@4M 02$0L3 20PSX\ 00 S T00,\%D4Rf0ł!" 0 /T0 C,    )`C)0c <3.sP,0s0`0S 3S0S00 S d\%3R=Sd00 S<`0, 0 00T3pS !!![ Y 00 I T [  , ˿ 0 0 z,qp4Ѝ0 0ł." 04 ST0`Y p80 S6D0S c`0, 0 00C p?  80S#$ 0C $ $  $ L#$  14  4 T3S! FsQ p0S031 0p X,$0 0C$04 $ 0S/4 $L3$ W0 B 0!0400C40 pGa400400u/ᕂ(T3 pʏS !!! 0S  031,P CopSTU T0 O-ML0@ ؃00@p S;  TH!NЍ``0 Cc ca5bS4D $P<0`@$!c 0 VP`U`8$<4X000 0S  ?B0 0000H0P 0 '0 0D0000 0P0 0 Rh  h    Ϭ D 0 000L0D0 D _U _HTMO-`LM4000p@ T0$00<4$0 00: S(0B(0@,0[ 000 Eܙ?0 ՙ0 00D0R ,Pr0 U*Q6P ,0T0@#P!0ᬙH#0( PS0 3 00000$0 40LЍL P* [Y LR ^*[PX P+K(H%Q!4,Z3<8  Y3R 080 !<SD0P0S0055 1!08Q< 0*0 09 0S pX!0X 3*0 R0P!0 R/0P L#" [0L,"\ Z YH# XJ0L,"\ Z YH# X0L#" [0SB 0C0?$s @<D`@M} _ _O-,0`@p(00P  ` L 0l7p0t ̠\ xQ 1K\Nt0 0/W  0㧘 2Ϡ!8 [ K P0 啘 @?ᘘ,`;@0A ᎘0V 0SⷡL#" R: Ϡ!800L#" R*080G-p$0P` (0@  ` L 0l6p0t ̠\ LxQ 2I!0Rt0 0/V  0. 2Ϡ!8 Y I100  P?,`P0A 0V 0S ?L#" R: Ϡ!800L#" R*080O-@pP4M ů 0ޗ`\Ŕ5#!\X    0 T0 L)L,)l"3PgX 0P@,ЍO ~ Z TR 㿰pP `@0S7 j 0S00 T0T3?R\0 0SP `0 S ,ЍO    @ E 0 00  0 0w  t Y @/ 000j  ,ЍO},Ѝr]O-TM|00@ 00sc000P40`0x Cs cq6rc4D $`<0p@$!c 0 ಕ`pVp0 00000EP T) (we 00 00 0 000"DT0,0 0SD  ?}p, 00`2@0(0C$0L3T 2 0$PS98$0<4Q4 0000400Sb S<0SD@$! 0 N$ 4P |70S l 00`^H00000 00nmP TЍ08SL 0 <0 ?D0 0  0/0S 0/< S T0(0 \%6R0ǂ0## 0 /T0 CL    )pC)0c <3.4mPL0<00 S 3 SL^\%6R=SC^ ?ޔ800p ST 0`S"80 ϣYc8<0D80N,00 ,Qg A!40Y0C40 A40040( 0T S"80YbT3S   , (( Li$000Sv h00h0 0 0000S TH A)A)@a #;̠S Rd X82 00 ǂ !! ^?001>00^33 0^ ?001>,00  ,0 $00C$04 0S4 L3@0 @ yLP h(j  00$0 jH000$ rH0S H0 , H0 00S  <0D@$0C!d 0 $ 40`R0 10S  }00p1` 000 0p40UP0`W0080S 00S" 0 0 0U $0 0Rh  h    $  0 0000S! T0H C)C) c1<62 8<0jH00( C0H0 H0 , H0 00S@~@4X"0, 0S HhD _U _~] _P=% _TU T _R _HTM _O-p`0P4M 0 ?Q0@00 !0\%0$01R 00@ ``&!! X0 00*P@? j4*!, ZS QS:ZkP ,l 00\ Ó\ g4Ѝ $0 R  X   !A,8hT]U O-P0@Ḡ $M0\ `#,^ 00 0T ? A)A<)a>21,, X:@ 0@PjP l 00Q Q ag $ЍH  0 0 PigT] _U O-PḰ@ 0$M⇒0\Ŕ00`0!\   ?  ?` a2! Q,S QS1, X:@ 0@P! jP l 00Q Q g $ЍH  0 0 PxgT] _U C-`PḀ@p 0M( 0\Žß0.S\! 00 Q    ` a 00T40 1<0&$40 `001`0 0p0$0d0 01010000 $P 0 PP0s40\pdT80< L31)l< QR>QR!<`0d 0001 F f40P 1`dP<040 pL `l\0<726, @ P0Hd,:0000@ (0 00XiP0~d0(_T0(d C)CR)0c\1S"8 QR!<`0d 000100T<0 &"40 `0010 0Ep0$0101 0 "p `@ H0P ЍP0805@U50P%P0L05P000T40 `001 0 0p00101 0 0PPd001Pp 0 0T0 C)C)ct00<21 ( 0P0 c0S C\1^1 U  U `  Rd ` < #.36,P Z*85@%00L 0404 00R  Q RI 00Tx)\5 S0  11@0p@00 p001P0 0p0$01 0101000040 0@0 0-PhP <0 B2 b061")(!Ř''0001S 12 Ze X0P 0 PL< l52>p, ᇱa Q0:1S 000000 0(gP%1FP 1fdb8U@e8 L0PP`P`U1Se 00P000T\5& S0 @qq p0@01 0 0#p0$01 01 01 0` 0Pp@P''000jQ0805@U50P%P0L05P000T0 p001 0 0p00101 0 0PP'Q P T A)A0<)a21 ( 0l0000 0(@+Pl00Cl00 01 0g00Tg1 P  0 p001 P@000 0 0 HzPPx0gd000 000g0T0 C)C) c1062 *(?PPd^dPP0 0ap0T000400`0  0 F Ϭ 0f2fbd000 00 00  0Pd0- bpG<0S00W0S <0S&0 T 000`p<0嘐l0Xd  0 ` 2( bPdaa< 0(bd0000000%F5eP H0p`d10 ``b040" 000 |00S)1S0!0Y8P0 c0S C\1^1 U  U `  Rg ` 4 #.36,P ]*85@%00L p00W00W0SO 00T\5$%S0c 1<00@00 (001 0P 0p0$01 01010000<0 0@0p0 0PP 40 P B2 b061b 0`` 00( 80p !0001S P 1! a X0P 0 PB2 b50>" pPH Q0 :1S1s 1<00_8U@e8 L0PP`P`U00Tr\5' S0 @qq(0@01 0 07p0$01 01 01 0` 0Pp@,Pg0p Q0@558 50P%P0L05P000T<0 (001 0 0 p00101 0 0PPP?'Q P T A)A0<)a21 ( 0l0000 0('Pl00Cl00 01Sb00T1 P  0 p001 P<000 0 0 @ PPx0d000 000p`0T0x` C)C)ct02160" *(PPd`PP0 0a0T00|0400`8PL0d000000(0!cPPrd00H0H 0ql0L R 0P00 _x0PT40<@ΟP d_R00T1P Pl0R 0 H0P 00 0 0K<@<0@ 00 (0 0><@p001 P 000 0<00@00 0PPp4ph0400 0000T0 C)C)ct0201<" ("BPP4 d_4p80slpx`40V>:[ h04Ch0h4L`PP480L s0H 8001d <`4pP0`Z_1P0OF`Pw00TH0 010l02H0 0 0p001 01 0000 0PP W4 ppt0p!R  !  0  T B)B1) b072  0(PP 40040l0 2H0H qd1_i_1S) !00h  0 0(bPP m 0T0() C C")0c7#10 0 d 000"00  ( PHd0s ἐ?00T0 `C0)0c VQQ? Q%/" \5 DS 0?!>0  0 F Ϭ 0f2fu_d000 00 00  0EPd0, a_pG80S00W0S 80S%T08 000`p80嘐l0Xd  0 ` 2( Pdt^p^8 0(bd0000000%FaPd0H 00d_|040 000?600O-@PWp(,`PT: [0 S0S ~PZ@V 0000000@@000@ @O-pTM`@ *0S1 TЍ@T@Y@T  r"! ( 0  (04 0D \ 0S,0@0H*0 0:00@0圠<0 08000  RȰ%d*}P# P `2@S8NSLQ0 P@UP!PŸI͠ӈ$ P 1/PD$0   0 U$ 0 T$080\< 0/P\00 T0 P@ \0 A!. a4,AS ?0$0 00AQP0 $4^?o2Y0S000@Q9  @ PQ;Ã9ʁ0ˁY @0 R 0@@DT@@@@j88%@5L0orAO-p|M00-P `I븰[ 000MP|Ѝ0800 00\@000S/ : mP0X00 \00&2T00PT@p00h@l00<0 h0@S < `\P/0 d U 4 Q4 @P0080\0000P n9Π ^RQR.L N @n 18E \H$@@NU0@@$0@$ ((0, IY! ? Z40 0 Zů 00:@   1`PU@5 \K$@@@ @L @ Q  N. n*< 0Π U , D   L @   D  H   @H!`$ LP@% 0@D TT{ 0(0 X  PP@Y\[V\n@Pw)Pr@-0 ^ R*@p5 R@S<_000S -/0   R Q   -//@-P`00S-@! < Ь@P@P 0@0 0 P]@ 0S R 嘅@ ЍpO-P$M`00S 00CS 00S  R 000@mY0   P A> a2<! R0:0 催@P 0ST 0S@Pu@PL 径0pI@p p G pp 啈뼰0@0 0  @p 00 @W  A K~@K0P L" l1. Q*  P0 S 0 S00@$Ѝ 0p@ 0 g pc L ]    @P   z  ܇弰帀  @-@@A-P@00S= 00CS9< ӫPP0Sk@p?oV20#S 00W: 0R R 0000@0` R ₄@@-A-P`00SE 00SC 00A0 凫@P 0S 0S@Ѝx@Pp 婇뼀 0@0 0 Tp ]@ @ A HHp ЍAm-@@@O-lM@0P800(00 0080<0000Q.80S(005 0 8(宅@Pd0`0p00 00 p 0 P6d0 45#T20T20$ ;60 0RDt ?0:# 80@0(0P0)#00UdkX`Pd`P dZlЍd0000S0 0(0 0?`L0<0S``V$` 0ߟd00 $0@00t R[dZ0$ `0S$0 00 04T0?X0t0pC  0@DpH@ 0S00040t 01,0@0D SP0H 06L0 R00S 00Sp 0 1p0 0 800(0C0 0 T0 C)Crq)0c9s400 p@i  R !00 R,  ) 080S06 S600S @" 00 00T00S01 0, A0T 0 0X 0 00 pG00040 040D00SD0H00H0,00C,0{Sڤ0 00\0C00 T0 C)C) c0<;2 0 40@P\ 0T0V0S$0 S<0S dYS @0$Oo(0BO<0S@dYV 4_A-`P!0[ @pE0 Wp0 P  $0 Q D 0! 0V`0 P ( ,0 Q @ @0D 0 @0D 0  UP0 P 0 40 Q$ H 0< 000000:00Ѝ    O-`0Mpp@P$ w  R  p0@ 00@pp\%1R,5S0 0 0 孃0 o."\哞p1`Z 0 ?  Ϡ ,2 0 `x 0㎃`0 C c00T0 ` C)Cba0)0c03"[0P   \Ŕ P\x 0@c W X0Ѝ0  ~O,X0 TTO-`0@[M80  ,00  C0CSR [ߍZ 1 0P  ;10Rh  $  $  ( \%R\ R @uD%p/L/pt{W  Ð!&4$00S$0(0?(01  0 So 0?R0:$0( 0QSc00S(pN 0)QQ 0000  L  R 0 \0b[&/ 0Z[ &/0 00 0Pt  PP8ŕ0 @L ,Q-Y!0ZS 0S 0)R 0X:0 0 0001 000$0 0S0 0hP0  c2# S,P!Q RQG S1ZQZ3PR> 08u< p0 H0pß 0YW0  0A$0 010 0 W00 0 P 10 0X g!#H0 p ~p. ?a 0 0 S$0 0100k P w08%Sw 0圠000S0  0 幊000/SP0 0 c SRQR3,00Y$0,0, 000 0Yt H0L 0SP0 0SX04800T\` p BW, W pq0S*0xp(p$ Q0 ^!((AP (( 0 ( C 0[00 0 0pQy1(( R@ 0pPn1XXϠ R 0 00p0 0R       0 00,0z0P0[0 S0&t ( 00Sh00Sl0Sp0t\%0R  H ! H04  1/ 040@  p 0T0< C)C)c208<" `0 (0P(040<S" 00 0000S0( @08D 0/@0D pW* p040$04 S000$00 rs \%L5R$00 0!! 0 $0 S000 P,0 A pa1^8970':00圠000S0 00$0 S000 P0, C pc3^09:00SX?"66 00Q00Sy 0\P 0 b32 R0Z1Q SZ ☐ pBᜰ b<  YS:0 B z'z b~3p2z0W p11 0 PS0  0H0 p55C20000 0G0 0=0 p ~p0Y$0 0(dX%0'00 $0fP 0 S$0 0100qP 8@ŕ L 0  !pt(APn i1ptpt1p 0140S(0#Sz0[ # 00p\%X0R !0 !09 4P L8 l0 ^85@50%00L508Q Q0(010 0S 0 01@0D 0/@0D 40pW08@5L085@00L0TT_{_A^T΄8P* P' @0D 0 @0D 0 圠0 0@R    0D Rh  Bh    R  000S1 ?@0D 0p@0DpO 0 R !/P !!0/00S1/P11/@-PM`0pP B2> b<1^Î0"@P 000 勀9SFT@ЍQG-p0 `$PR@000 0$0` B2 b>6<bT H B)B<>) b62l@`8`D0<000 "000`QPUC-0P0`pd@T 0 Up P  ЍT80< @31)` Q0RV `E?01R0E/ 0P  O-DM( 0{0P(`0 0s c SqQQrQ R300 0(4300 `$0V@& 0 W000 L0? @ `P 0 B20< 0 b71"@P 00 XN qKt  W?A|<00, /40$0 0R409 <P00h Sl( 0 h0 00Sh00h0 00h00009S@8@T l@L00Oo BDЍ 00h S1y(000, 0<009<S TQ0C0c <Pn 0 <00, Y9<S=Q0$ SY DPP<lPDX00p 00@P 00, * 0@PD9S0$ 80S @T 2[ 0 f000[ 1_O-@,M0` N30Pp 0ST 00 0 h姏` @ `5QP0P  004Qh0Ah0 0c?0P B20$  b510" EP 84t<$0S Z X$Mt0P{00 0P^0*`0 C# c.5,3RS" 00 009P  004Qh0Ah0 0c?0 0 $0 0 R 00 0R_  0 h 0 64hP 0h0Pp| P0PN* 0|Pp 0E00 B?~z0U00Z0 60Qd0X0000,ЍMO-p0 0008<Ĕ?zP0 C c00 0 ☜P  d׭ 0# 0 h 0S400 0`,``000垦0008 1 010I> 0008<ĔB?yP0 C c0 , 0UP `啭V0L"t0 0$ 40h00000R___&_L_MG-p0`@ PU 000W Gh R 00 0h Rh9S000?MO-P0@`H00/85L0<%0/@5D%014%0Q0Q 455405S944S@04TO- ,MRPt p$`W0@: ,0W0:F,Ѝ\0Q.0r 08T @)@)`"30)KPd 00\ Ó\ GxG0哸+0[0: 0 GTU p0Sp/0@-@0M 0@0@ @@@:|P|0 0@0@ @@@,L0 00@@ @@@  Ѝ0@7T=_D__8 p00CSp0/@- @D 坡囡@蘡T=D-M |ProЍ_@-0 R  @ @0b ` 0tЍЀO-0,M G P00 0 jpW PP@?n /h+p+ 0 $+4iJP Ὄ  0s % ! % F4\%R0004\5 P  ᤌ ,Ѝtl4RR  ᖌh0 S 0R$%$5R, ,0R`FL3 L3P3 P3H3H3=0T3T3s  s000S0P0,(5 0S0 @0@00T`0# S> ) %> 1S 0DD@30V 08P4T$0X4S E>0X4((40`AYL V$5S0P=$bt $c`P PMP/ A800pH0S40LpHT0 C)C)0c"03IPO  0 s  F80`$%!0, R0 i0PPl \2qἠ_<#| YP  0 ?<#Ή p 0Px 0q`0 C c00T0P C)CRQ 0)0c03">IPP ᳊P$ab"   Eᣊe]_8 TT__͠^_0O- ) %> 1S0T$0P40X4S E>0X4PPh04 SD4P0P0040000,8T0<P C)C4)0c"03PDHPP440$ R:0D0400 5 0 0C?o200004PAW$%,0RQ0 0rL0Zg$5S0Pŏ, H4q4dS944S@040T3$0`1c1,10 1(5 0S0@0@00P :>0 $  * RPPz$0p0,0 0t0D0t 0b0?o0cH0T0 0CL0804P8PP0r0SH 0 <Ѝ0(($20VТ0703PJ80 00S0 C40HL T0 C)C4)0c"03GPP*40 0 q4C80 4Pj$%0 , Rk\4S  5  0 !000V0 0P L弉T0PP4P CV PPP:0h塉P 㛉(Hᖉ00P]8 TT 8T___͠^_@-0S0nP@ a@P 奈 Ѝ 070@P __070c`0u/Pp$p0Y V@C^B_kK__2A-P00`SP pJ`@P B`@PHd0  `=@ЍDC-@p3$M/P++  h0$+4`P6T0h 0p0 51 50@0\%R=S04, 030304040 50o0" " 200(0\5WC`$ЍAT8 O-,M@40A#Vp PL30U/o[" R ,Ѝ800`H0S40L`GT0 C)C$ `)0c"03=P$ 0o0$000SQC8 P@G-$MR Rp`P/oAQ" R@   hP V 啇0*L)4 ]@P0 R@k0oP V 0S 0 0R\XPj0MS0 @P0&00 0@*T:040 0 00 0i@P,V,`T``. R@ T0ᆀ f0@ᅀTp`|  DKp`=S0 @P=04=S:0 0SX0SO@(0 ^@PP 0 0S 50ó 5v=S  0  @P Ѝ0 5< 0P!P000V<1 .@000C?o20000\4S Tu/Vv< 5 0 5=S# U∠T@=S 0 6C>00,x0SUTn010@U@S]__͠^%___A-@`L1pPP 00' pPB=TSAP 0 <=0S ;#= SU$%0,RL1׆hԆP φ|IȆ000:0O-@P`=MS =S  ԡf]U㐱P ]pP$n]U 0M0T R8d R5TpA=SB 00Q5CnwPЍU ᳊ P ᧅ㬊P 0   -0P|NU\pp Ph9]_Mp@-@  # Tp  Q000P05/M-@Mp#Ф!0P  ` 000X S%*9  0000'0ᤕP 9 ;909  000&00P呕P 9 ;90[ 0 }00p!1/ 0  J0S 0  Ѝ0Z } W0 0 00ЍM/O-0dMP00 0 $0) 0\&(0 0 00 )( S RT 0S0,0, (0 0 0 ^0y:,0S,A 00(p地0$0 P =<00004000@0D0000^P࠱8<œH lU?P(8, PP PH L^EpP n7~ ^y[xQ[ W9 n0 ^U QU^YW0  Pp WU(  0s40 00000 U 0 0 P40S  #0 H0 .P^pP ? ʗ$0:T0$09X00S T0S X 冤 00080P<œ0 pPEUP!U$<0S  #0( H08<Ŝ  ß   . ?t8PLY"Hࠣ࠳Yࠣ^  pR0@P} 0sxi Z pR0 0 s40  0000 hP9H0 C2 0000$0 0n'"R0 0rZD0Sj0)C( 0C8RP_  <100 #8 )(80(0PM ,000$ 00 )dЍ *Q@pR0Pm00 0 4  @  1/jZ 0\r\!p@- @P5 Pp0p@0@-@Pp%9S ʰ;S  0"`PQ 0 SL0L0娘0P0 0 嚘 ЍLPHO-pLMP4  P3r:Po R00`5L:dP @`> $ PS!QS0 @ @`98E R@(@@D@\ @@P:0@(,,0N X !$[0$ [ $ C:8@/AP80& @DXT $@0,0 $>gP 8=080[ 0 0 0 \$  0 $ R0 8P s= 4LЍ(@@@ @L@ Y @  `9 \*(L @ 8 <@@<@O-@P `R0 pM0 ЍO? 0 P0?:P= 0 6S ЍO0\0:  ЍO㠰0 00S Y  l) R 0P0 1R H0C200 00 0% P ЍO-需,0 0/\*0 ,\0 0 ) p,0 V00P `0 B2>@ b6<bP0:0`40 00`FV` f@P 4`<" 0 @P<Ѝ8e@5``L0`(04S =oobT`V 00 0Sj:<@-P`dc@P0 0@P   0 00Pg0 ZЍpvdG-0`P0 XM00 0S  XЍG ?Pg p p 0 00000.0>000 〔@P: W000 08@P-$k 0S) 0 _@@T0S3 00S00@P  0  0@3 100XЍ2 9pP 0   00l9(@ᖓGvdA-@P0@P l20 p\4SQ^Sl4L@ ^`P @Dő L0 ? 8<őH 0 ?00@-0 [$_Y:_`A-p`P렀 [@P0@@3 \@P [P T~${00ё Ѝ`]_p@- 0P pٙ*\Œ\\p0QpVQp8LP8840=40 0@p<>g_T譀x_l- P0 SQO- P4 R 4#0  /" RH @R` pA aw0y T= T @` pA aw0y T/ Tp @` A paY0WqTPp R  PP`@P P\RUP 40S40p ЍHpAD a4Q[ QVYQ@_ AQ[ a0YPPRP   O-Mpᜠ0W@ᨰP尐`00 p 0000l0@ 0 T 0p*Y   Q L B Pb<" P VU \P*PP\& 0 00 W  R@+ @ CP R ' '1/P 0000 P$8#L A1< a20! 0000P C R 01!01/P 0R0*@0 @!0L A1< a20!  U@PY<0 0P0~0 <00Q0000 0P0<00CS$0<0&U W70Y 000 &R00S P0Y00aL0 C# c 9!300 X0 6SQy00(00 0,0, (0XT 006 UF0 000000( 00,09PP 0 =(07L0 C c#3800 9!600< 042#T20T2E50P0 (6Ѝ,0( 5440SU 0 600 Q0+  $ RYW 0@ÏD0T00 S 00!1 001/P000K0@00  $ R  WR0@ď D0T00 S0 1 A1/P 0@00 0G@-0S    P (000 00 0 CЍD3N p@-0@00P`06/ 000`06/P e{00pO-PLMt0pp,00@ 0S 00,00 0"R 8 01/0eÿ `"80<n0>`0E&0S R #6:RAƠ 0401$0{PEP0W(0,0ů _t1 000040 0 0qpP ${LЍ0x 0 | P ( 01/P0@ 0 p 01/XH4QPpUp(6*C/Q @ ?QD   00ã 0QONO\C-@p`P(圀0 0001/P#P)SR Ѝ@- 0\ \ 00 0 00 ЍA-`p@P M9S$ 9S000S0(0)9+ 00000 0000 8/9 ?o209S# 0 R h0 "V_@0 V_"@ @@@P;$(Q Ѝ0 ]__@-0,@00V@"4/Ѝ茒T$T_0@-@0@000@@PD @DPPP0 0 P: 08S00P0000_ _ _L_>_p@-@`P(0P0  a P bfa000@09#60pO-P@p0KMP0`@`0/U0:Kߍ0 0 P 0 ~0!"R Q0:V&0'0S(.\S(,0S\ PQ)0.SP PO-P10DMp @0! 03z 01 0,z 0d0 8 "1/ d:41 TU2Q D$ d( /UTI, Q$ 8( 3$ \<,V  R 00PPV! 400p0A 0000000 7@P0 h 40R 0 h`F ` l 0y yDЍ@>O- p0M`,00P, $00@000000L000$ t0S@P#L0980 00 00CS@,00|00000 9P |0S080,0@OoB@ЍPM@`00`0|0S0800 0X0000C\0X0S?80SF 0000X40@0 H0X0  @00@0C 0?d00 ?`0 0`0^0P00<00000008#8D00Ch0X0P tS-40S0X0T0 P00400ST[ ?[ :\ X <040  t   @P `X\0X #30X t00?@PlY Y 00<000t0T0000ഀXT X& R  (0 P(0I Z( " Ra H HQU BRX R0Z< <  r  < R  A0 ( R* H R8 R# l0fPl0H RY  R+ 4 \RX0:<X0@U%X(0h0D0C(0(X @@  X 0S  7 BR  X0\00080P00tP ~2X0S^ 0S 08 88C?oR20S 9ST0,00 :4 \RX0;X0@@@@@)R0*#D0@圀0S0@ @000T<280S 0S`0X 0c0T0(0(儠0" SRYwx`,0x000 980S> 9S; L0$  圇P@`Y 0d `0J]0000 L@X0 0@I=@DP@@Ep0S 0@0@ @C0 00@0 R000Sk@)0S:X 0(0@00BL0(0儠0" SRvx`$ xp>@P9  0 $0Ṟ 0$`p0P @v x0*x@Px0, 0@0SbL0$  P@(0(儠0" SR@  x0x@Px0, 0 x0w@PD@>,_7_@A-M`@ p0- 0?PP$ 0 T 9 0C8C89000050TP00 0 9S00003/Ѝ0 B?PP0Q   A-Mp`0@8PP$0  @@  9 0C8C8900000H P000 9S00003/ЍO-,M00Pp`0 0 00 P *0 P0 000000 00$00 ?Z@Pm@00$0@T  R@@@@@`ᴰK [00S S% cP[ᴀǑ"$$囑 @ `@ T@ 0P@@@@@B {]0[ᴀǑ@Ƒ`0S "440 h] T0@P00 R ?R *  1/,Ѝ]H_T_O- 4MPRX0U0 `0删00Jp ((80 T @?4/@P7 0 00\ 00000).d@ "4400 00C0 0    \@ HX0 00P05/T@4Ѝ 4ЍO]`_-DMLH ,  0~DЍ]@-0"!P Ѝ@-0 \ 0 00\ҘЍA- MP8@<`P^0yᨀPPP)0P p@`Ƙ Ѝ 0 @-)@0 Ѝ@- @ 0  0)0 Ѝs@-`@0 0nJPPPP _L0 00 ЍpO-_t/ 00CS0/0QH>tP@- P O-M000@`00 psPPvPP qЍ00@0 0009 R0  09P  d11 00*:00)0 P%P 00 0 00Qd0X0 000P05/PP    0  P`+P U000 40 90000\q]t7@- 0@ 00L iPP0K Ѝ07@- 0" 00L X@P000 0004 Ѝ00  0/ @o/p@-@nPڈ000P0 5/pC-$!0PM R`p0 R R  @ ЍR , 0&ZT@P D0S2 9@I00>`9@:#:0*0  J@@P@$A-`@0P00p0 7/"!""9:#:0900 000""00S00C=S0  0(0 000/< 8000@000/L H000P00 0/\ X00 $0`00&0p00h0+40 0x00|00S; S8000000$)S 00'Ñ(0"#0D0@00"$0@0P00#%0H0`00#&0L0p0 0 $+O-PM0SZ0sW!srS"srO00sL(srH0sEx0sB|p q`0$E @10000! DLQ# 0 K#0 0 pz@PX0|0#880'00 Rd0X00,$00|0 *P\P3Ѝ {G 00圀z㬠* s00*0 p7@P0嬠0S0t0娰0S0p000*P\P2"sr# AQ񟗪$lNlNTlNTlNnNnNTlNz 00娰@[@P#sr` $sr&srxG@x00w0F= 0 (@@ 0 p@Pc#sr 00000$sr 0   00hl rq 00S08< 0p L 00H 80@04/@P 20010 P *ᓖ00)0 p~@P 9  :(090*P\P.2-@@@@A-`p0S t 0d0 0 0P0 LS@P90VnЍ@nO-`p M✐s@PPd1)R:េ@G:<1 0G0 0@P<9 08C890 000000@04/@P   0 @L@ T_Ѝ9 0C8C890000OL@tC-p @`0圀T0L T* T20S-@ Ѝ贐 垃P@00@ #V  bU 00 0` @尃 070 @ t_O-34M`)R@#*p0 Pሐ0p 0p@P 0s@P0 m0p4ЍpP0 000900 0 00Qd0X09 08C890 000000@04/@Pd 0I2(0 0(0$00S0Ӻ20Ӿ1ш000      01/@PA/ᘐ 0Q  000)\ 00vUb}@P&0 0009/@P Ԃ 0 0L 0 @ TNm9 0C8C8900000 900009mY4]tC-p P`UO 0SP9S B@$m Ѝ00"nP 0!@0 @@ 0L@P  019 0C8C8900009 0C8C8900000 00 -  01/ 00l@lO-`0 P\MS0000 00cp_[? 00 A 0#3*pGp W00m@000880DP4p<@@HpP0L 0800P 05/PP rm\ЍHP0PG0 0em  0[$0 2 #п0P @0 00 0U *Y0 SiIPS,@ 0 DQP000 00S U0 Ŀ0 0 0 )m&m0 0 0\00#0300S00 0 0  000,0$0 S:00( T ( ,0A  S 0000000S  1!  0@0PPkꫪ@- 0 RR@ @Th R( P@ @p  R0  0@/@-0`0CSxʇ8<)Q\8~PP P&Ѝp#sr$ 0YSP<0S&P`~PP0V0 ": 0S`὜`V <P 4003/P $ 40 <#1/P $PP$ 40 P0<#5/PP 0:0;_G@-`0P@ "6000 "40"q)`m) P*g0S< <00 13/([Ѝp___ ]4]I^0   000 0 01/]@0   0:0 0 01/4]@p@-P@hPڈ000`0 6/ 0p@0 1/]@0 0000 001/]40 0:00 001/4]4p@-P@hPڈ000`0 6/ 0p@0 1/]400CS&TNNNhNNtNNNNNNNNNNN 0X / 0, 0 0* 0+ 0 0/0)H6@-@`P9#61S0 S 00S0( '0S (0, 0C00000 @00D0@Ѝp]O-M@P D`pI R?PoUЍɯ U  @@H 0L @ 1/P  0 0P*)P !@UP `0S/0SS 000/A-(M @  0P$HpLP`!ЍMT T h000@0 4/0V0/oS" R(Ѝ000@_C- 0 M0p0L P)P M@`0 R"0 S (pQ0 `0 R ` 0`0)X0   00|Ѝ 0 0 0<000 0 @|T i@QA   /@-@0 (0$S, , ,0( B@2@@-@ P 0800,0$ @R(( ,,0#@S/S  !!0/G-``pP  ~@P= P P j000 Qpq0$0 PiP iP iP ii (~X 013@@H,@-! @P  !P- $MDj0< 0 4 40 , 00 0@ /|$Ѝ@N`N._p@-@ PQii i$0@sip@ O~A- HP0D`p0C ##R@`V( 01S P q`0D1X  Q R 1P ^`0Sp@-@PDA@ p@Z0! 000CS00S@0T:00Dp@G-HPp0SЍG40 0 0S8 0S4 `` I<T@P 00 P ``0{=`P T 0000C0TA >00C0 0 A<O<< 0D0 0p5_<_p@-P@ hP$0$0p 00 $0Cp@A-@P`"vy$0S000000AG-0P@Sp`P0p0S(W! !R 0 VR:0S(!0PE  1  BS !!  100C000CS0*O-`@$PMpT T0@0 0 TЍ 0 0S  F0 ' 0K# 0@ 0 0S  `G0  0K `0`  `R` V  0 0 V  ^ @G-H`傊p  V@ P B5^:4\P`R  \ #RP  aV 0S*0S  s  0 D@PH00000  o#P0S .v PPL0<0m0S00000000C0GD  !! !R   1   0 S  B!bN00CS0000$00Cs0 D0HPD0@A-P$0@S`p000$00Cs0 Ad000O-P`H@,MD00Pp 0pG'60&6`'v00 `0 B`F$0s w  BrU R$00Cs0 &,ЍXC0I0D$00Cs0  0[f[ g 10$00Cs`f`ff f 0SZ000_ PpVS f f f^ 0[0$0 qF0@s  hL0 $ 0$  YL `F!M  NL0S 000D$00Cs R0 B $0Kjo 101P f f eV fZ  ~f 0S0S 0U  00pCA  !M  ! zM0PC0Q $M0 0 !iM 0V$0JY0$00 P 0QA ;f8f 5f0Is /f 010 0C1P0S 1$00 1 00 Q4M L0 0$0 0'M 0V$0!Y0$00 0GD0 !M L $`R0 Bl 0K$0 L 0 PC0$`0 0KC-P`dMp}1āȑ@0%T00SdЍ,0(@0P,0Ѓ(0,0(0SX , X00(P\0P0 (0SX@ @S , , , P0X0S\ , \ 0P0SP0! 0 R00R0S"000P0000S (0X@S, , , 0X0S\ , \ 0UP@G_ 0 !6/ ! !`Lp@-PS`@!V 01P 0 , 0ap0 1 Q000 !  !AR !  B /A-p@P`0 00A0p@-@P`0S00p@S000 p@0j /-@ $M0 4  *( 0 0 00Lw$ЍNP_ @-RyP00A-P@T* 0S' 0pf 0S `Ph@0 LH 0S 0 ; 000C0W_ p@-@K P p pP MPh PP `P0 0:777gV cp`_@-@ PP0 0p@-@PT+ 0S Q 0`00C0000 0=00/Bp@ Lx& 0 0 0p@ 7 0S- p@-P@ 0 0 0e=7P p@ 0s/ D0( $ A\ @-4 00A A"1S@ ^\10,0//O-(0p7p"AR0PF4`0AAbATW& 2q@Pp 1PQS0@ @A J`p YZ PQW`p V000p@V00C00S0S $  r,0!qpꀳO-tMp0圀P@`@, ` T90 S6 ?9P M90 `oᩒ tЍ(P,0PU0%VZZD9 00`0 < 0#9 V%9D0J0 0c9P "SR 0 !W6 90S c9 0J0 00p9 `$6:00@ 000R  0  0 0f7P;Y% 8  xOY P3O6V 8 !I8h0S9 0Jp@0 00`vp_x_1G-p VZ`'v' dA0$pp P(00@0?o2X0S0( )0Y B 0Q G@1@AS8 80< <@@}X 0@p@0 $ AP0 pB"   40ZX0X 5d(00(0Hcb$p@p P([b,V L] @/0@-`0ML@T LPL   @A0 0,0 0X0@@nЍ0_ @-MP@NO-`$ lM@ ^0@pP 1@N@pP0 * 0tG{$p @v$zF  lЍP@p 7 I0 008P7(, Q   57 7(P, ZY Zll| Y G5 5 S5 R ᮞ( ,"&~ T5__h]_ A-?P@ M     6  %:&p@`8V `0 ЍO5445 0D0 07O-$MH L $P!AYpZ `4!C20(2>B"  YV] xf$ЍO#+0 AT   SPP QPUR QP  RQ  R R  0R>p0@P 0 |M000 A`P X0P`@ď T0,0 PaM`@$Ѝ 0s/@-@dMp* AP2k*@哽804`S< (q< # ɽ 6{ 0`6PP60  O $0AQ0%4 0V.H`dЍ6ᣝ 0  36J(0,#6f<4,`ꀴ_G-q ;@QU|vx|@8PU qi"AR0C4 RmyU001S B YXP Q00P JVU,0!Y00X0S `"V0P `7ꀳO-@M ` @VsC f %  ! . R  F  0SI!5    BR - 00> $!*጖Ϛ  ( R,,(, 8 R<<< 8 #, R0 4, @, 4 ЍO0 @ =P +3 2 73X    0 ,  4 @,  \G- P@ U `D`(00@0$V0:Pp$01Sl0 H0L 0 H0P0L T 0P0 T %R0XP5\p5`P(0p__ O-4MX傉 Dd娉0:hR 0P?)v%t(0$ 0AT,0@T.3 0B!0U QY (@ 0`0DC3f0S   $0P#0* 0巕 $0(0S, , " 80S< < # 0P 02($ Q( ((,(A( $0p1,00S8 80< 0@<00\"S040Q,400400`0 0000000\0$0`09 0 *"*0 # 30 #6: ,00$0G 0! 0 0*Ih0 d!YEl!0 \    ,  d . 01/pP6 q4Ѝ 0`0DC3fd0 R  R Z a S,d3Sx/7Nd0$0 6 000 •p,0W 7 0h 0 0,00 X?_\O- 00S #6:(00  $ (01/#P1 0B!0S@(060w`Z``0T:0忘<Ѝ0@s 0,  Z1J0S$ 0,$0n3P0, 00$0   0 ᖒ,1,0,0,(1, Y 00 0 V ,P,,20{~$Z6"0 X?_0@-(A(Q0 Mb+a]P ) Y]0,0,  P0 4S0$$ ( 0R*0 000|`0&P `Xx ,#004 ,0  ,,Ѝ0@]S L>p]_8 #x>>_XN_/O-pP@0 \9 QEp h[: W P E0 0   XЍ H,X   X tp,++, D  .X[ |V  0DAU  0 8BpMp p___p@-P0`Q@ P0! X   PPp  00CS050000 V$P s P< Pj O-`pAM$ P@\>0h0i0j00$0Xp`D>0S 8.882<082$1<0S$10$1~X:X 0x>A-@p@`@P3 ΄0 [@x>@- .    Ѝ0.   Rp@-P@ 000Sp@虖00Ꙗ@- 80000  0 ;  f0ЍP>#_D 0 7hD 0 1hD 0 ZhD / /A-D0Dp0Pc00S@}0000Ar @-,0@ ,0,0t ,0 1,*,*$&& 00S:&0@ 6, P0T8v0v@-`0`PC0h0L0anH2,@P,-0 "X?])_0 1@-t$@4@-@0SGnP O9+0  $4`aK뀒"4) 8K\1'BV7 : xЍH -_,?I_O-P$MU p0E0`#*DW`$ЍSZEQE(PEN1@@@TH# p 0 0U 0 00`P 0F?o T20S 0@ TJ3DQ! v6`PE000 pP  Vx>4 0S/(0(0 S;3S8#0/t>,,A-pb@MPA  p101U00 001 000! P }m 0 0P$P(0P 0P0<1 000  P  0 ! )1BPPp3_000P P0:PP00 ^|P00PoC}0 00x(0x0)0:00 T P=|p@Ѝt>p"?h"\'R_x"_h#_#,tTTb_&QA-, N0RǠȠ̌' @N@  0 `p0PP ||l000垍UQP(0 c00 0 P lЍ]__O-p`1P10@@@AK0 SpT0WgOf 0$P $N $% @ `X $ $FJjPp6h"t>\ _G-@ሠ@MT:@Ѝ!PpZW``U`#VEQ W@Pp3$`\@-. .   Ѝp@-N@N@`P@ s p@4  O-@@0,M^$00h10 NP  ^P  $P0$`.00@p5A00pF0Y 0݋$`0S ,P )0  7%0P 0S  $0`,Ѝ zI 5#@0 8jh"t>\_O-N@N$M@0`(zPP$p`AfX0啋000  $0PV lh)`0 P  uz$Ѝ H "@0 z\ _t>p@-P`N40@N@ 0Z p@Pzt>\p@-8PPp{@{0P3#pt>@-@ 00 v  0R ? 00G-p`䐟V@0լ 0SP%PU! 0B0 0S0S 0  B;  00S 0S0S#U `FP6P0 %_A-P`pWX %A0S0SΌ[#000'#d#pX $0 0@fp@-0Pp0 "@2#0S ";# #Rp@-@P U  p@O-dM,$00[ @dЍ,0L\D0$0H0,0P0PHPX PDPz@0 S 0 0CA4H0XPP(0( 00C\ S\05$0 000 [ 0P00T0\000D040H0S 0`(00 R0F0H0S 5DP97SX a 4IpP[ 0@ P 0  Q 0S X0D$ Ho@000p<X0 HD P r #R4 0/p Zo $0 K 6$0d@0S X0HDE0 S@y0SӋ`"000,"i"@ 0S ` X0R $@Hpk0Q D@FX0 ( I @,0< <0@ 1/PV DX0@ (,0 I @< 01/P #P2 |0/ ~D0WX <0 @< 0 'X XH 0DAP' D < !<!<!< Y 00 0 0 0<PP  PY< 0  !39< 0 *<00X0 B H@1 0h!pP0 pp0p 0v"pP 0D00 0!]!@!!00@᭪000l0\0 DID&DP T  H!X?.__)8_O-4M$0X0 P\!4@hX0T)X0 `CV6`  $ ?0\0q` 0 ,  p 0,`1/P #X$ T \o4ЍB,X  X , !U4!  "0 / a@X?A_/=p@-,P,@ 0 \p@sꀵ)]@-`@ 0 ````!PP " 0@0 0< 00 0 x 0S  "ЍpC-`M 0 ````p!@P 4 P" O# W' 0`0C0@ 0; 0Y Z" 0WD0 0<tW1 0S1  T 000:Ѝ 0; 0F p 0S:0P//0 R:P3#//p@- P@l00_p@襩 la*0 @0 -p@- ` H0@SP`B   DD00 $p@-p(0, 0 (0, $0Sp0Spp@/0C-00p0(`$@ @`p<Ѝ.O:_>`NJ_G-M 0p` @`Z3P0 P 00 0 0 `@F?o2P0S0S 00S00Ѝ R 0000 0[P >0A /R0Ca 000/P @-`P010*p@-@P` 0P ,6,P R0C P 0C0060@* 0 0T 0P3#pP 0Q ppH 0R  S01 R  S0100S/0/- 00#R0 1Q 0^ S01^ S01R 10 0  S0p@- 0 P 0@0C0000 S   B k-0Sp@A-Pp`d@P }20H10@0P 0A!&0DB$P 00S 3/000L00 @ 0@A-00@SP  Sppp 0X  S```-0X   B YWW 0 R 00W K XFVV 0 R 00VA7A-@lp`0S #S Pᚧ0S ]Ч000p@-P@P 0S p000pl030/@-fP \@-@ $M0 * , 000 00P ]$Ѝ[_0?*A-P`pP @10 1000000 @ 0@AA-P`puP @1010 000P 0 0 @ 0@A-00\ ^^00S Q : Q*0000G- P`(PЍ@p0S 0X  0S0S$0SH0SV $ 0T`0  00 J0 `000V Y ,0pGp00000@l `0T00T0000C0 00 O-M00@P`U@PT 0@`[ P

P R*0S*VPP0S0S:00P0 PSP 0O-*p@-@PTpHP 0 D B0U0"&00 $00S 3/ `5@A-P`@p<0V`!@0 T@1T@!tP  0S*0S + 0S*0S ?Q 0S0S$0SH0S00 @ 0 000$p"(Ѝ@SA-P@`pS&S<0V`!@0 T!1Q! @P @ 0S*0S 0T 0VmЍ0V* 

 ;@00CS@0I pA-P@UPP0` 0p00 @0S . PU000ЍPP00`V  D#&R 4 R @ R  00B X $6SV T130PPV40S @0S00 80$0S0 0 0m@00@0 P@0S P080 HP }04 R@  B@  0VP`Ug40S @00CS@0  `H O-P@4M0U<0UP!@0, T@1T@!0S?p,` 0 Upp23010 000C0Uf0  #p4ЍQ @ R p U 0 R H$Z 0  0 U01 C00 0C00[ C$ U1Y ( ,p  0Qp   D @J0@@ 1/p @ `D $ u0P P  $R  0S0S 0S  8  D0 S K\P 0u 0  BR A@-` Pp-P@0P  Ѝ\ 0S400@ T:p@-@P0o%0000pj%O-H0S@10 p0`$0 PpCL \ SN P00U  R* HQ Q0 Q11!$Q44P88P<<P22P@@PX  ( R,Q RV  R0 R SW H0S 0S00 S10!$0S4 40R8 80R< <0R2 20R@ @0RX3 (0, 0 RSV200S5000 S000S0000C0 00 {V D0D0H0H000000[H0SV  @P M 9P F3/V2HQOV  (P' U   U    B    5V D D H H 0  0  PN Ѝ2/LA-@lpP`$00LP0PP@O-M Q@ 0|ЍO1Q 0QSp0GSP#*XM 0P UP.W P3 00 0^PP04ĩPP4 X  a?0P`h@00(0(0V Y4t0s 00A` W1 !@XZX 0p0S  :? Xg 0 0CRb00x"hD$0%00l $\" 0000H00SU@ VC08 !N, 2Q ,0P S""D00<00+!D%"D%!D$0 00 0dh00\`0"%D@0L D0<0<,020@0400808004000>/L 00C100L0 @  0L0 ! 0L0000FN `@l r0 S0 S00P0$00 0 0H000s 00垛Ѝ 0FR 00SP3Z 0 !mPP`@GPh]]L]@-@pP`M  0p} P Ѝ@nЍA-p0@ 0PS`",à \00S R 3/000y <@  < 0 00Ey@`O-0\MpPT00,00`@L0#@0L05 0 L !6  'PL00 @, 00L000 0 P 0P$0> P@ I  Y0 S [00P0(4000000@00080PP 0S*80U0S  XT00(00 0PPX @ P0 0P00<00 S800 0 0 000 @$0S 0Z  I 0 BD @P 0D 00  0 00C0 QS00$P0$ 00S 3/(,00(,000 00080408 400408080<0 <00@0H 0PHD D B"&*@0D@20 20<0S10010(00(000C0S @@ 0  R*8Q RP0@HUPPR$*-T00(0 00@T*@np 40 00R0 R0%400P0P@ 0S* TX@@wT/ $W Y  TP-@\ЍW 0 @P0  s 0P000C0 00 $W Y  U$@TP ,0S  @H O-P`@Mp@0 0<0V`!@0 T@1T@!1P 00 0S*0T* @00Z R:㈱Q0 Z8Y $ Q\  M 00S  04S0 08pY40 R004 000 uV00 $0 S40 ?0 @0 W ,w00 0 DP  @Z 0VwЍ ]@-0f ЍA-` <@"# p0 #0P@00T@v 20S R 3/Ѝ<0S <>Ot>O>O4>OP?O 00 0C0 @00 0 0 [ V00P 000H0S 0@0S 0 0@ H0R S gS 080 40 0ct00000 00P 000HP 0 D B"&0}0D0H000 $00S 3/0 $00"00000>O-2*M00P`0T  0pP 08/pЍ@4 R @ RH0  8 $ RS 8;0㴁0 0 0 13刁0$H0S! ƿ DJ0P$H0[00 80 P[  A  H0S 㡿 DJ0P  0  0j000&j` 0H08/H0ۿ000p $0 03/ 0, `F(00 0 NNNp@-@P0S@ S dU003/p@ z!`S00CS0L᡿_- 0 ^: 0R:   0\ P00O-____P@_T@_pO-M$(04P, /[ J ?00/0 0 D/00 m/0 0 /000 0/40$ (0/0, 00/04 80/(0< H0/,0L /T P0<0DX0/@0\ p/`0d 0 Ht&xL|TX\      0/1!" # A# 0/1!  @ A)  F A* *! A/ "< A/ # @ A   A @ %- A, &- A. '. A0./p21t"/|"x212/ 1"2/1"2/1"2/1"2/1"2/ 1"2/$1"2/(1"/2" $ /$ 0/281"/3#I? 32= C A@D5 $ÍH! L(#,PT04Xa\8c<`! d1@# 0 0D3hqlHsL( ) 08@ 0  00 2 R"` ~0h0?Ux0 0S?#x03@$ 03030300dߍH hJC-MP@P`` pX0  PH1 R*Q, ! 0L CT04 ,  0000<0@0D0H008  00000000Ѝ1L0 ^ ^ N^ ȠLȠ^ !P0202 $00P210221ӀрH >0a/Q/0S //C-Mp0@`00 0` P0 P 00 000 0P?o2P0SdQ P0 04?2c0ЍQ0 a/Q00@-0>00G, R0" R:<0S^ 0 B 10^ 1300,0堰0#3[ * :#:SX  ^80@.4 620 0 0 mP Y 0 03/^X&  0!  0D %6SP0S 0P 46S0 00 0{Pu0 o\H 0ʠ,ʠ 0C00S >0 0>000@< 0#03P03 Q03S/O-@M:#:S0>0>0 T*!p#600 0  /`P P  P$ ` 0 0*Ѝ R* P R: R ! 0 $P  <R 0T :0 0000Q R:JpH[ 偺U | 0T:U ̺[ Ⱥ[U 0 (,0 D 0 P  DDZP 0S Jp`]O- 0LM\$  ,040LЍT  j&j R@ DN@@N@ 0C*,0"*R0 @< # 3 S:P03:RT0P0 008040  PpP 0 0(0S 00 0<00800400 0 @00P@0vC-0$M@؄SP`p0 0Lp@07/p `$P ,0 `00000 p00j$Ѝ@-0@SP`p0$M0 0Lp@07/L0, `  0 0  0 0F$ЍO-$MPT0`@LpP$f R R C< i S X:<0SYPZ 0H00_ 0 ! 0L @0 ."    !P@@ 0 ATQQ@H   _H !0?,!_@-X0S:0 0B00 (IR0\ H 3_A-`Pp(@3P#@.PUPD0S TI !P 0 sP'!j_A-$aP0AS k0!>00000000 81Pn 6810`U 0CS*mI뤀p0WkW000N@N@W\0/iЍP< 0 eJ>,H _,_\_O- B 2p A`P/ LD PⶊU@@p(IP@P%(0崁!S00@0D 00P@061A@0U0C@@@ r0 ᄠ0S 0HP@0   S0P   J @QP 0>0000000x (0D0 , iP\PE E뛥*@ _H !B}0?,>/p@-`P@w-0`P @ p,0@!p@-PU@Hp@x0@QX00 1Ġ  S0 Rp@H9_H \_  @- 0pt0ShJs@-P@ ` `"""&*C6k 00#  0+0 0Ѝp@A-@ PP` ""&*C6S U 0pᮉ P(,`0x S 0: h S 0; 0ډ`P`ᐉˉ]L]@-@`P0p၉0:0̱0 pw Ѝ0 /@-@0:00M0 Ѝ/"&*C6)0S/ 0S/ 00CS0/@-@<` @-@ P@ @-0@S 000` 0S/@-@x P@m 0(Pp@-0P0@*!p@@-0@ R0 @Q00N@ A-@ P ""&*C60S7 0 P * 0; 00  T0:0 08$0 00S) 0SA0S 0 00C0 \ 0 ; 0(0 0 00 0S0SPU 0⺈P `V' 0S 0x0U 0  :0 V081` 0 >>⣂R P A0S 0 `(0`c 0p 0s1Qx9 0 6 &! R  010@ 0"61@ 0"601008 00000合` !H O-M 0pDP@Hز2 a 00'603S P0 PZZ@H FZ  r PQ d"($($( @0  S  G "0` "z 0(p @,0@00 + 3  |40L PZ 0 P0 PM4 ЍP  04PZ:T  0(p,0 @@ U^0`ᰇ 0(p @,0@00 R * އ P ᗇ ҇ (R +H _]L]G-Pp`ᔐVUGA0Ds 0 0 0 0P  0  0 0U`0 00[ @- 0S Q P0Sp@- 0 P@ pqP U  0Rpp]000 //000/ S0/000/G-P0 `0LS#&@"&A6 @|pYx` @`Q*6/OoB0000Ѝ@Y0@-@t0tM@@@0 @HLP @م @4P00S 3/@TЍ0>x>0,,]O-ph1,M`\1PLL1H! 0006001 Z,A   0 00 0 $$P Z墅 0S 0 0 0ԅ0 6$0$pU0c$,Ѝ d儅0X 00L A0 D`PEz!H D0,__@-PfM`0@c0 06S V0 0Ѝ@莅pp 0 PC 0S  p0{ P |Ѝ\0,H O-`0M  R0 Q @K Vp@P Y$[ TXЍ Pp PU@ p ( ,"&>Pp@0T@ 10 R0PP٬0 0200 0Z00S 2V0 @7TA  0 Q00S; 6V 0S 0 0 0. V  00 0;O T0 P  (,,Ơ0 @ @  fYr @qҬ V4$lqV l! @-0 U`E Ѝ\O-DM `@fp PEVW0 0  V0 G)僄/DЍpC-@P`؀3Y$7p97P ePw0@@,pDVe;@U@DOoPB@ap,pGT 0 9>G@@,H _p@-P 0?A3c S 0 S<` , R0L <0`ODS0@ @@@?CD0pH QP 0 P ; B 01X 0 p@- 0@ P P 0 0gp p(0, #6 9P O-EM 市,8 5@4 `o`P  A4D#4射L 0 0堂 0S 0SE0SBd40x$0t000 p 0WV ` p-000@00 0S%1P! l!@-P _P0 `AX!h1@@400@D @ P PЍhJH 0  48 h0Q8 D 8 4P  BP 00 4000L 8 4 L T  T 0$000/း0  48 l0Q8 D 8 4P  BP 0400/ 48 $0Q8 L 8 4T  BT ꀸ@-04040@D 8 4 D P  P 00 00耸@-000CS 괜OOOȜOp@-X`PP@ P `U@ 0J,0@U D@_Tpܸ踀O-,MH3HSPHT!LD@! pqta`Ad.h1@0 @@TࠀT0Pl0 C$?0x0 Cÿ0C$?00 S0 00C$ R ? 0 0BĠ/000\` $ IY$ P5^\0@@ P P&^T\ ZO0ZZ @@@ ^8\ <03@^0\ 00@^`0`P 0@- 900H < R80L0|0@H@H0,ЍOA\ 0@Y~P0 000@hJP,ȸX,@-8@00(< R@@ 8L @ <00@ꀸP,O-$ R <@T 10`0 1P < @0R!80L0@0< 40!S<018 L 0!4 @0 pW, 0 S(fP 0S P!0000 SPP0S y 0$0 0$[ 0R0S d @0D0@0Dl"pX\W @0 UJ101圧}p耸P,H ,X,]>L]O-\MP PS 9A0a1@0<|S8<00@0@0FD@`0XT0<`JZUCV= 0 "P S< @0R8D@ 4 R8<  D40@ @p~W U   PPEZ ^ ~ $(10(1/@ `D @ V8  @ `\Ѝ耸H @-@^00000000/000/0000//0M0 PЍ/00M0Ѝ/P0P00Q0T00/းp@-@ ~P0@PD00|`HP !L09 \ 5 h 1 t- P) 2% p@ ꀸ؜O@-@ !00 0/0TX0P/း@-<@P~%0 $ C4X0@ S X @~ꀸH A-`Pξ A0S6~ A R 0PA 000p$~000*]~ Z~0 0C0QAA- 0@R1$~1$0@00P~P`0 S  Q0p}~P 0Rc1$@A(~000000~3S X?@-p@ l\ `h Tt H < 0~ @yꀸC_K_S_[_c_k_s_/////// 01>.2h !0S000C0< 0S0 00 00000/!@-@P R00 lO-\MP0 `S`S@#@2T@U U0!:3 U`0A0C 0000@0 0Y`V0#0#60W((0, 0P0Ç0S jE'(0, 0P0$@#v0#6(00#6C0#60c400,0P 0P00 ,0S $0S@i\Ѝ0K,0Px+(0Sq0Wm*"@?P@!@1#(0S`1`!@D @@0S80*PJW@1@!@D @P`10@0S 400C $ 00C 0@0D < B Q < R80CY 0D0@ @D0 Y A@0@000I00$0Y kG0S pP0T00Pp#6$000c0000c(0{|0I640 6,0P @x*@X 0 ppppP 08 0P0S0P0T0P0 @S00R0SL  00`g 60C04 0PD PEP PUP1UP10S> (00UP1X(0@0@0T@!T@!, 0DS0%#`F :0U*080  $ 80 R:0`F$0 S,00T: Y@PY@PP(3|0FS@1$0  0l  0@R0T0 0P8 00000 R0T0 08 0: @00@0P00S Vj0P p`T0S*[&*PP U P10S!1E pX*P Z PHEY p`W +[P1 P!P1oE 0  pW PPP@`A I@TH _,_ 2{,08 Q/P @- 90@_/0@/@/0 \/у0P1@p@-@`PH1ƒQL"^!^D*Q p`V`F`P\9 E@V P^@o#PpA@AQ`V`F` V P L@p@_p@-P@x2 Q*    0R p`VH9`F`V @ LPp@_O-1M0S8`Pp U@70 @66W00Ѝ-  Uڌ2Sᅢ \ J 2PW@` P @ KH _@"_]__0@-@X0S0/"R\:@\*QL0@0C?0@@- pP 02 0  Ѝ@p <0 P 0 D R 2 P///@!@-P@-PA@-P 0@@-P 0@@-P 0@@-P 0@02P 00 /@02/@02 /@@-@P02 @O-pPP夠R I W6` @#&G$0<`@`D`H`L`#Q0R* 00 00 0000|yvp@H @-@PL0"D0S 03>4000,02Ѝ000!_,@_0@-d@M 0R0`Sr]00 00@0P0@0 = Ѝ@s@-P0@D0S 700Sx TlP: X7`A P<74`P@Ѝp!<]_H ___@_@0O-M`  00P0ll500ЍpW8< 044Q0D0BS0S W7*V7P .0P W`VB70`F`@V @ DD0S@pp h @p 0p0C 0P 06# 08 P 00C 0N]c__!@__DH O-,MP`@` V.P 0p.P@00㜠N@T ,ЍX PPE%&$ $    01/b 00P@0/@- P00 QP@- P@? Q0 .S 0!  U06P`0!R0P`!R AQ:R 00P`0S6#P `0 S 8P`P`P `0 Ѝ U000S0QRA- p$@P`0vw6 00J7Ѝp0 P/0S  4\Q 8< Q < < 8H  BH /80/H P00S/P 0 (Q, Q/8/0P  /?p@-0@` PU` S R   P00 `800h <0@8@@H00H0pQ 0 P0S  00/H @-T0@T00  0 @ST0@@/G-@0Q00P00CP0wP'ิP""R,40Xq0S)4D140P !)'wL00CL0$ T00CT048P5 `w000P00P0Mw`0``FV`F`pD0RHM,P`: `  %/H /2d]_? 0 .G/0@-P$0M 0 0 /xЍ0萪QO@-(0 0600 xЍ䐪QO00@-u0yuZ  0ui@R`juU3  $0( P00CS  "!s0   aR?R0  0`0 0&0:  P U P0 0?!2r!CeĎO< 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzO-<08P4M4;T@%VZPt<tX00$004ЍOI4`(0唐PEQY" Y 2?8P<0 "0 }t5twtT00T0t`004ЍO* l %0p0 0$00Ż0TY0@ $0? 0$(  4)0P0"sr2m00000 0S P&U$00P?4Ѝ@` ? $0@ !0A S $`0 (00$000) 0  ,8@/< D 0 P  "p R `P&  H@0Pʿ 00 Isꀽm]_/x]/_0OA-`@ 0$ p B00C0 00C 00S0i&0S   R0$00 L00CL0A0S0I&0/p@-@a@81MAH@z  ysQ1 XP 1P &@P(000!@ @@@@BP P0 00 P@@r"h0 00 P@@ h" @0 Ѝp/H 2^]G_k______?"1v1S QN//O-@0CM`S$@p7H00CߍPPTD00CS tOOOOOOO7 03/@A ;60`B>  c-0 0000 0.%@P0 S 0l h WP$P6pZGP ;@0S % $0P000CSo$O$OxOxOOxOdOh`P0S %h $0T T0,0h0X 005#\,6`P hL@h@pG0S@0iP4 4zWs`P`rxPr@ r%P04p00`S 00 0$ 4rLP mrH%ur@ z]r$d 0$ $0P0 0 !h340XY Y% `0P Y,30X !$!$`P q|&rH=.%+@qp ?4; fj0S0F0Yy 0B 0@2(2P0X,20 0 4C#"#04>0CYC 0[  I&. #.,!(0a>P|0S' P!0S!   p 0h!AP XX/!ho$`Pm0 0 @0S00D0(0,`(0[q0000|0L L P P `KxKqcP\q@0@}q @@H 1?F2?__ __T_#_H_h_/ __0 0 O@-@oH0 0@o %O-$MPH0TQ@`LpP0#0@ 00S 0S尗T0S R0 0`P60 0 H00\XTPLp$ЍO'%O-Mp8000 0 0RЍTd ` 04 ` BP(PdPPP Q /CQD?C-`|M@Px Dqh0Sh             ($  ( 0 040 080(2<0}>@00   1DH0 0LP00  0TX0\0/S F0h``0d0@ "P 0000S l0`0F0`p`h0l0d`@ "P@p`@ |Ѝ`s@-@P`=BP Ѝp@sЍp@- L@P 0S 1(S3 SP; _O-0M3S P@P1S S  2S T$n$P $LЍ22$0" 00$00 0$pP $5QF$ 0`00,080402S300l0`0V L0L00 06/PL0?Y00` 0` SE V!3P Q*I I`F`00A $0Sz "R'0&b00CS$ 0000 0$DP $00CP $` "R"V`10 ` " 0VL000`8` `2$S00S,0 40s0n`n`4`800XpSD 00t`D00V P t`0t00S1 t S 0 l0 0  ALp<040S07/D040 p 0 0'Z ( 0, Rbc^pPS01 P([)D0<s0D0D P0a B 0 D0H0 0 4D0P-d 0HR:0R050B0005D00D00 p0 . Q 0 0A B40 00C Y (\ T  0,`1!00 000L000H0F V 08 S00 02 02000p0h`|0l0$03/P$+ 0@H0 " 0`0POA-PpU@` U RvP  Q 0P  R@T ]P T]0O-x02 CMR@#2` 000 00 0$]@P  p2 S OoBA Ѝ0S%P U"0P0 0$8P PEPPE0PPEw@ U @-P@`pP  0 00%PX0@0X0 ЍG-X0 P `Ѝ0@S `P 0PPPS*0 P000 S S S 0  R   R R0 R 0S `R p@ *Pp%  <Z`    1`{p 0о00X $p0 $0X  0 0%=`PX0 X 0 P<` mX0V X " !WX0`P 0X0 0\0j 00dX0"Up]W L !8 pP K _P P P?@//?@-0`*p"*0C00@ 0 `0 8q> 00. 0.0 c0 (03100 >0#60ЍЀA-`@V pp 00000a P{\P 00SP?A- $0p0 $0 0@R`P:    U@` P ~00 00$00?x @0D0@0D0S/p@-@P`0S000p P @P?A-0S@Ѝ` -0) Pp!@P0t$ 000-0 q 0  0 0@P 003/@@-$Ma01@00 0000 PP0p  @W 0 00 .  00P$Ѝ0@-PMP  @:#: B   B  X0  00. 0.0 UPЍ0@Ѝ0 -,M $001040 00000WP$P,ЍA-X0!P 0S00@0#,$04@ R1D@C(2Dp<@`C0B` R 0 00000D0Hs 0 0000 000H0@ 000 0 @@Ѝ?P$0 0!0 00 /Hzhzlz@-0`iM0 0 nDP 0 iߍ<@P p0 tp2Pd  GU00> !0(F@F0F8FedAO-Az 4Mպ(fb$sS0S b 3 D ;PD202 000*0rPP  Q0  00 倲倢 0  pAT \XDP`<DP}P\DP D0/S]0`00FD@-0` 0`Q s0!00  "0|PU ` Po0 T | 0r 00PbP;0 0C4/,P000 P0@P@ 8 8P<`JP#$ ,B00  F P0T0P0S97 PvAT00h Ѝ!_Ӏ2]t _ _ _ _] _ _(@_@U^ެ^+!_6!_G!_!_!_Z!_@-<0DT 0 !0  !0@- ! 0 !@- @0S 0@@F8Fp@-T0PO`d !0UF Ϡd 0!T@!p,,0@-0dM0@ 0 Q00 P00  @`T#ʸ@Q  9 4/0 0 &#: 4/?&6 :  \ 4/dЍ0@D2TG^!_0> 0 00P(`$ p(0,0> 0> 0 00P(`$ p'0 !d> ,0  00P(`$  p 0 ,00!> 0 > 0>00P 0(`$ p 0 ,00!=0= 00 0 00P(`$ Ӭ 0,!t t= 0 00P(`$ `徬0,0 ,= 0  00P(`$  p媬0,0< 0 00P(`$  p喬0,0< 0 00P(`$  p催0 ,00!D< 0 00P(`$  pn0,0< 00!;0<$ 0 00P(` pWS0,0 0$!; 0; 00P 0(` @0 ,00!P; 0 00P(`$  p,0 ,00!ʟ: 0 0 0P(`$ 0,0: 00!: 0: 0 00P(`$ p0 ,00!`:0X: 0 00P(`$ 0,0: 0 00P(`$  p׫ 0R!9 ,0 00P(`$  `ëR`: 00,!t9 $0 04P0p(` p嬫R, 0 00!90 $0 04P(` p哫R00$,0 0 00!8 0 04P(` p{%0,0p8 0 00P(`$  pg&0+,00! 8 0 00P(`$  pS(0,07 0 00P(`$  p?)0,07 0 00P(`$  p+*0,0@7 0 00P(`$  p+0,06 0 00P(`$  p,0 ,00!6 0 00P(`$  p-0,0;$0\6 00!H60@6 0 00P(` ت.0,06 00!6 0 00P(`$ pê10+,00!5 0 00P(`$  p寪20,0|5 00!l5 0 00P(`$ p嚪30 ,00! 5 05 00P 0(`$ 優60 ,00!4$ 04 00P 0(` m70 ,00!4 0x4 0 00P(`$ pX90(,00!44 0 00P(`$  pD<0,0$3 0  00P(`$  p0>0,03 0 00P(`$  p?0 ,00!P3 0 00P(`$  p0,03 0 00P(`$  p@0 ,00!2 02 0 00P(`$ `ߩA0 ,00!l2 0d2 0 00P(`$ pʩB0,0<$2 0  00P(`$  p嶩C0,01 0  00P(`$  p墩D0,01 0  00P(`$  p厩E0,0L@1 0  00P(`$  `CP!"_6P+"_@?3"_<"_06PC"_pܭWi_RJ"_T"_b"_j"_v"_2"_PCP"_"_"_L?AP"_tEP_p_"_"_"_"_"_"_"_"_"_ #_#_Xw;P*#_v6#_A#_,]H#_=PM#_x8Pd_@AP`_U#_]#_m#_y#_#_TFP^h>P#_#_#_#_#_#_ #_$_5P$_IP $_ 0 00P,(`$  p4 00!4 0 00P,(`$ ۧ5 00!(5 0 00P,(`$ ǧ 0!h5 0p5 0 00P,(`$ p峧DЍO- 1G-`RMAxp oP` (:$1 0 1 010P 0@Hp)?o2P0S"ЍC-鄐|M@P`` pUHR#0X 00 000000|ЍKs@-P`00@0S 0 IЍpFO-PM@`Ȱ0#U0s 0ȰĠp@ЍONX0UT@@ pwXVV2U`010# 0YC L R?0~P PV?V|pWzV,8V~Z[$&F6FhV  P  o~ &V| RVVd~# W!`JKq@hGVXQ 0`FV`G: UapP(7V  q ;?0{~`*VV UU010#`| 0YV*~Z[ E E V 4 PU|0S Y1`JK@4 Ѝ0 M@ Ӏ@ӀO-PR`@$MB @p$U0 RU@D @$Ѝ Z X       DU  (qUZ0 H @p KO-t"0,00 00!x0 0<000`(p$@@ @(<Ѝ$_ $_|MP$_<$_$_,,$_$_%_%_<%_0@-M4(@8P 0P,?o2P0S0 S S Ѝ00 000xGtFC-@P`px34M 00a,(P$@ @@ @Pٟ0(003 00a,$@ @@ @Pȟ0(02 00a,$@ @@ @P巟0(02 00a,$@ @@ @P妟0(0p2 00a,$@ @@ @P啟0(002 00a,$@ @@ @P償0(01 00a,$@ @@ @Ps0(01 00a,$@ @@ @Pb 0(0p1 00a,$@ @@ @PQ 0(001 00a,$@ @@ @P@ 0(00 0'>00a,$@ @@ @P. 0(00 00a,$@ @@ @P 0(0l0 00a,$@ @@ @P 4Ѝ'%_*_,%_z_^m^A&_T_0%_:_4%_^;%_P ƒ #60 P *R  P 0 / 0CA-0@z`P P(0p, UP1p1:PUp0S S0 0!d 0 P*0d0L0 0!d 0 P:00 2lD%_X%_@-L@P 0S  M00P 00002A-fz@p `PUpPVzC?00STQ~Hz<0 80)yn%_22l%_X?%_0000 y20@-M 0000P 0`(@PP8 @P 0 @@0@ 0 @P Ѝ0S  @!!@P @0Dp?  @Sp[!@@Dp@Pp y_0S 0000J@P O0S 80p 0 0=>@P@y2%_XP2O-䒟M0S@ Xu Oy0Sfu,0 a,0zX⯩@Q08 0(sxQ0(@8(0H> C'(@H(!,QL H L 0P BRP =)Q -HP PH8( , <@H 0L pP Q H =)A -BLP H!HP 8! ($ ,!@0<Q}x|P[0* 100S% ,(Q?0 00000000 00 @0X P D ,0a0y ЍЏ 02@BX?T?Ӏ%_2O-MQ@L @pP `VTP%@ЍH0 0D00@00 01/PP P@ `p@-P,0@TpRP @l@-@@/D/H/L/P/T/@/D/H/L/P/T/00X\ /0\ ^00-@-P0S  Po` ЍX/\/RA-PR`@\p 0!SP{ PP@  d!%X@@-X^ :S\!@ ~  as@-D0`P @P2`00Ѝp3@-@0#3 0 +30 ?3@ @ R D0\ DSR///@- 0@ D  H  L P  T QR #X z ЍX R #D00P0 00@-D 0R  ЍP 0PRpX0S` @W +P0S ` 0 D  P  X R # \!00@00H00L0 0T0000/03/A-pP `V@P P5wP wV {@000V 0 `@ 0S 0 00 P000 @  aw3l0@-@PMv0@0@ @@@0 2     t d T  D $4(Ѝ03%_0?%_%_w_%_&_0&_I&_a&_P/D0 R\0 R\lp@-@`Plv(@PTvp0`0 00$P 00000@v@3@-@Pzv 0S 0 0S0   L00C0v@ 0S 0S 00  3@-$ P P 0PЍ@-  Ѝ30@- 0 Ѝs@-@P1N`y`kN0 0Ѝp7@-@tPPPP8P 0K  Ѝ0@ Ѝ03s@-h` P0@0@PDPHPLPPPTPXP% 0PPЍp37@-P@0@@0D0@ D0H0H0L0L0P0P0T0T0X0X0\\?0 00P Ѝ0p@-P@pp@-0@S P@p@- IЍ3B3=3@-p@`MQ[1 P@0@0D0D0H0H0L0L0P0P0T0T00P6 ```1 00pP  F[Ѝ 3 3$3@- $Ѝ3@-0 0 0$Ѝ3@-0 00 0 0$0Ѝ3`` @0Q S  QS/S//PH 4/@-  @((bP @ tP@Ѝ3@-@ L00003p@-000@S0S00 L0P0p0300CS0/0M03@- NMP03/@-p0M`0 P 000\@$0x0,` 0000(0 ` 00 000000ЍT?@3P?X?@-000S ,0 R@hЍ@Ѝ0M00Ѝ/@30G-aA8Mp 0UqPU 0<1*P1?0P尟0QS0S  R00RC20@  0,00$0,1P0$1`|00 (`000 P Pp團P0,00$00(``00 000 `P Pp⇘8 U; |8S0S XI; P8ЍGE8ЍX?@3@BT?P?lx&_$mP&_\3&_H3mP&_&_T0 / 0T0$0! R!/ R  /@3T0 / 0T0$0! BR!/ R  /@3P0/G-b0S  (|B 0x R x0t0SpsP0 00SHPQ呟 K00S*T0  1SL t00CSt0ڑ,0 001 S P0T 0 P0T 0Ut0DH0L 0 H0L U 1ST0  $0Lk t00CSt0 GKt00CSt0 4S$3 2@h0l t0 h0l 4S32@ 0 0 0 `0d 0 `0d t`0d 0 `0d 0t00 0 0 X0\ 0 X0\ @3@-`@P@sAo 0SB0SD00CSD040D0p00CSp0(>00000厠 Ѝ@@3A-l0p@P`㨻?P0 1#A$'@P@Q@ X? A-@pT0 Q]P`J <Pp0 BJЍՀ]@0p@- AM@PJQp@J ځՀp@-P40 AM@JQ  ʁp@JՀ/@-, 0#@0 D@J]p@-4 0#P0 4@oJp]p@-@4 0#P0 !@\Jp]p@-@4 0#P~0 @IJp]G-@0 `0p0 0#`= CPPP `0 @pP ?0 RS W* p^3  0S 0 0 0S 0 Up 0 X?G-@0 `0p0 0#`= PPP\ `U0 @p6P ?0 RS W* p^3  0S 0 0 0S 0 Up 0 X?0S/0S/P/0PP/]/Pp@- P& p  1 0G1 0G1 0G0 0G0 0G0 0G0 0Gp@PG @PG @PG @dPG @HPzG @,PuG @PpG @h|P{PzP@XO CJ "< HHXH?@X> R;H4HM`P @ 0 0=02  @P1 (HH!FQ. 1  -@P0S 0  }HT{H@W Ѝ0S @ MT@ 8P@0SD@T80 &L0  00S 00D000H000<0 8/0(000 00 $00#1 03/@Ӏ2@»^O^&_BQ_]DDD 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzG-P@0`0@0Vp @0ppG0Ā崐@TGGJ}70S2 7 AP V @0 }7<G@00@0G*P 7Ӏр@@-@@00@0@{A-8a8q0Q:$@1Qp 0H!L1P!h1 0Sz0 Am1PP0T313fHl@o0 0!4104 00000<4?&_<<'_</00S/<7@-PQ@@0 0S0 @oU h000\ 0@ 0 00R Ѝ0@0 000CṔP<@-P@$`F1UP 1CUW 3C7CU( X1 03/?@1U( P$10S&P" @000@000800<000 0D3$0P0 000@0 0PP00P:PdFЍppP QrP@0S RS 000<clc,4?<@0/@``@o/@ /@ @0@ @P/Q-//0 60 2/@-`|0@T L0S p]F0!PTF@P P$`0 Ѝ@Ӏp@-@Pn@PoU p@E@-@ @_#'_p@-@/  E011>101?1?11` P@V@@pp@-@HPE@080C@00S  0 Ep@E΀@-!2 !@!$!!!r!E0!311Sp@-0@P0`@ PEE @0 PUEttp0@00\PS 0  P@mE403EEp<΀@?+'_B_΀2p@-P@ap@-@@Tp@-!2 A!R!!r`!U!,!P!,!001Sp!AA2S^ 20Q 0 SQ Q 1p0C0C00 SQ2-  a>Q 0 "Rq0 o`/O-M AQ( <0@@|_ЍOQY(0p S<0(000?o2?L0ISI0 00I?oR20S?0I?or20S8:YD`xW01x0#L0D4`P(000U L0S:Z0S7 0S`0 S0D0@0 P 0@DT`?D0 m`P D `=,0tD1@8004080 0S`,DeDDlP40 R$ 40h 0T0T@Tc YSl3$ 0R\ 0S030#[0S 0H0CD`0H0$33X`x `TV`@d0X `X@\` 0lVh0(0p000t040x00儀0X00X \`͓V 0 0唀 )0夀0(0SF嬀00.0S030#[0S0000Ks000~X00X \`圓 )0X X00\`咓(0SX 0\`X00ᆓ"+0V0000000X00X \`sH0000$000$00|0C,CL00 `@Έ`,CV<00Y00000C000$0Yx x@00S0f000HC<C(0S 0 '" <0 Ѝ`lFӀ@ӀlO-3M3WX`3@03?P0ЍV0@T3 044004@uPP ̍0Fd0JC\HCX3Xp`V L0S4Z0S1 :C0 0000` 0PlCU?0kP aC @= 0C1P$00,0$0 0S PCtC\kU)`, 0S,  0808@T  B00S $ 0R 2C0000?S0G0 'C %CB1k PA00S0000CpG|Cp~d13FW@ ( $(0S1 0H0 0L00P00T00X0 0`0$0d0(0h0,0l000p040t080x0(0S<0|00< |T B@0 ໇P0@p@0C00$00 H?0 <:<0 PL0030 T.PcP΀lFӀ@ӀlO-@HQ00)?Up.pp  "q EŠ  " !΀O-13A1Lp喫gPPZ넁`pU/^U Y8 Q020?SP !011QP? QQ ?10 ЍO[ 00P 0SW ( R 尐U P00 Ѝ΀s@-0Sa @1S@ @A1S P1Q0``1SЍp0S  R R    Pp@-@T 0PQT@dpT \ >IPH Z>@pV>pT 0d3IPpvtӀ1MR  !Ѝ/G-pP\3a !@P   Th@-@`Pp0P @ W#!!  !  0@@ @0 @u0 @P ЍO-upWpMC@`X3쑓1 0 00S:P = 210030 10 )11 RPP =&+ doh 0l`0 03 kU Ѝ3 =80P  T= }]'_0Q`/wt@A-@PxM␀ Pp`x Udp` P4=T HP  n,i=xЍdHP 0 oӀA-pX0X`@0 0"+ P 0(00 p 03 R3Q-//-//-/-/-/-/-/$0 0!0 00 /Hzhzlz0M0 000  c P0 000 cP000Ѝ/0M00 P000Ѝ/ M0 00#0 $0  00#$0Ѝ/Qs@-`P@0S00000S! 0U@" H<0S@ Ѝp<0S 0S @΀lp@-XP`@ PD03 1pV T( P p#p΀π0 100S/I΀̀p@-P@U<5p@<΀@-000S ណ 0#  Ѝ̀@-@0S0 R000000S 0s0000S0St00ddWPX00SLh$A@40 0 0 Ѝl΀b'_r'_]4̀ππ7@-@P  Th04t 000l00p0000 Ѝ00Pp@-@P, 00 00 0X0$00(0tp@`P@-@ @ }{`@7@-@`P0 0 00h1S\0\PZ_00J @00 0B $00@0: Ѝ0)_'_'_'_@-QaAM0 0$0 0S$0 S*l;01S< `10X00q01;W  s0 2  O;!(0,0(0,v Ď n ` 0R1!0CQS B0 00 VP t.S1! B0C 0X;0  4K{πܬP΀X?πԶPl΀2]4'_'_A-P~`P p吀H0L,A0 U P#H0LTp0    0S#;|03/0S:@l΀̀@-<0DT 0 !0  !p@-00Pr@00.pπ0@- ! 0 !A-p@xP `ɍ0 S S R00S0C0CT0J$ h0l0h0lA΀l@-00@0<π@-"0 @0 0喍Ѝp@-PHM` P @ (ӍP Ph@E:( o (a $ e  Wo:HЍp΀0@-A4MP000S !:\0S)  BR/* ▍ t@00 000X!h0l0h0l810000S)0P=P4Ѝ0 Rn4Ѝ0@(: ,aR !00!#4# 11 | p+h003/PP@pP |+0 0P+X00X0+09 P+X0@00X0X0 R)0X008 0@@0@@0@0$H$0 R 0R @TT0i ~ 0Pj+X0@C +P a+Q 0#$# AT S Q Q @ ? 11 0R!rVP|z+0@6+X0@0X07300n+ xSZ @0X06300x0S(  X+S+ + PtZSW Z U0@,0@`S 0 0C 000|0+| *000h0 0S 0040*h P 5/P40+U + + 0\00`0 PP3S0W L5310 0P3S5 H@Xp 3 C pPpӀ h0`0xP*00@015w  89@P@0!S&3S XHpP@st@ #T *@ 0S 03# @04/3 0C( P0@0p00h t0 p00*萍0S*Q*0@hTX x" S 8*8}*@  S 8s*Zo*l Q   h T8z3 S[*~X  X " X @  B@ I*|00* 0>*)X0 0Z!0X0@00C@00h0 0S[  0 @0 0X0N @ X ! 0@0#X00 @00C@0 * )) 0S@08)) 0#03 @04/@))0萍000 0[  T RI 'R 00'@ 8)) 3/  $!0X0@00C@0 !00 00X0 0 0@@@(5]@-,0 00000 00Ѝ]p@-P@Tp`OP w@G-`p3aMD)1 PUG|)P 2)p@-P@``)) 0@I @p@b)p@-@PP) 09 0p@V)00/A-@P@pET|` )h0000h0B)@]00/0 S  0S o/p@-@PP(X0d`k)P)wkX00X0F)p@)0 5@-@L博PP@ @-@X0 0dX0h$8`03$!k$H@ pP tP @85 0'z85 0z85O-p`@嘰  HQ:/PDPWe \   0 P ?P Ѝ0S 40A3/0`@00@`FO-dMZ@$ ` +U0T L0P $0(`T `P8p$p* dЍ P5`P$0p$p s1 00)`P i/FP0Sx@!PPs!(PPm00h( 0;0!PP^P1 00 0000 0 +PPMK0$ 0C0:P01T01 R S!0 ` !l  2/`PH0T S*P S:00S18 ,0 0Rn pP $ptP tX ZxP P`Sn85G-M@` 8pYP+0P@@0/S WAЍ0 0 S?@# ,* bI0 C /  C1$@ KO00<`00 宐` OV@ k`F (0W@C0`F`O-`4Md@qȔ 0L0 ?0OX) e孭%|4LP0 0/0 0,0p p00 000_P s,0/pt0Q0*#P,00 0`PP,0L ,0P0%P000 PhP|P00(0L0 C5<0X0pPtPlPxPڰ N >_PP jX0H(``QdX0S X0,X0X` 0,020(0PP`1, dQ0`1\0S l20` \(0,PPUd1, 0d1d1`l H(0000C01\1 $  BX! 0D 0TRk:D04Ѝ(PH! E'b$ $ R!0 R $0a$0P(P`10`1Q\`X00X0 P\`}X00X0LX0 0dX0o$!$$ H P apP tP \ZN<VNX0 0R0U0S  854g_+_ЀlRlRFhr00S/ P 3/>A-P0 `p00l 0 0010 (@0SP Ѝ KP'0wP 0@00 0 0CS 03P`V pZ)Pp $P'0PP 00@0G-PM" @@~M a0 @@9 vQ1 010;0 @00d!PpL(@T `X-W0AU2@P 000` S'Ѝ 00S S S 00@0P0p 01@ 01p@ 00P!0 R Ѐ8?x>85n+_&+_n,]»^C-@PM> (0S; $ X7 `V6 e0Ԑp03/ @0^P00^P 00` 0 `P m003/Ѝ ? Db0 (0p`003/x>8+_rP/(0S/P/ R  00/G-Q @DL08( Q!P( U Lp PU PU ^Lp R(0  @` jpP PU *\L(0P(@S0`(`(@0S   0 ЀnoG-PQ pHL@(`T `(耟VL=$t! 0Sv$@0S LPPpi$dwLv"(@T 0Q S   0 T_`@ЀӀn]A-@`PpU 0S IA E 0S SP@-@ῐb<P]S_#hP lP 0#@A-@i` 00Sʬ嵐#Ѝ0 0 0PP+0 0,0pp00 00 0P ,0/pt0Q0!*рH?O-$1L048<0L0 1 111<#  8#3KX P#뀀 <0<0/$,0S G,,[P帅lP`0<1x8pO4#P P0$(, 0P0͍F#T0T0(H( `0pQ h1d0l1=0c?0h00400 3 `004040pW 4p40qs~40qr}40!0R "40pW"0, P001"10 0S [0[00[0x0Sp p0t 0x@t00H05`0`Sl 505`0@1d0Sd d0h 0d@h01 R @0@g 1\D03/|"(JRu4n0004Z0e"("1S$ A"xJJ(0T5@ X"5`0`S "F*4040pWhy $?"  U @xJHJ q"BY q#@Z+_r8n_a+_<%QӀ@ӀЀO-`,MpQ #`D@Pw@T ,0〠X2 V Pp@PP  KP< FP` X !P P`:@#0SK\ԎV 0+U> :$@$ 6@PN `0V): `V 00 ` @P0 00# $ 00`00@PQ  $!@0@,Ѝ 0S S +$0(@P$$ `X m}@?рP|0S/@-@h3/0|0h0O-a04MPS@ ]!!0S 0081S IX0Y3T P0R ,00000>0#6040080>0#60D0>0#6000<00@00偈80S >O!0/1000L09L0Q!5@ 0 0  0PpW)pWL0<L0ʅ0P . .`1Sp ׵pP0  0  lpkW pbmqbm!0R  pI ;T0    [0 l 000[  [ 0H6p30pGor$  HqP $$0 1 p 0Z # 3W RⒼ$!$+$WpW /yz yD DD0ĠN J1 0f`1H!<1d1D1l0 p 07/pP\T!@0AX0  81 0<1$0@1(0D1,0 pPGX l0 0,03/l00S 3/<Il0 0$K(0So [m Zj 00Lp @07/ 0 03/3 0000  0 0pP 01I 0 03/+H0S`&HX D#7WH48 pP BtP >Y @XpWW      2/p ttr7H`1S n l0q 00S p0S$@uG$0p  $@G0tp0P  1S 8 R l S 2/l0 000S 3/l0 0 1l !D03/<10S ZG0S(GF%"# " >  R8P0. pl 000p- p p $p7M0 0Z000C0(ZXX 0 ` 0S L>p4ЍDFӀЀ85+_4g_Ԁ0@-_MP P@P0 {_ߍ0@-(000000 0ЍP@- $0000000ЍPO-dlQ 0S P0 P08P0L_A0C0  l0S/Z B\R R  B 000T00S0H0`0<1p0St t ' x0Sp p0t 0xt0l/2H-xvA0`SM XP0P:P00Sړ00P0 *   fJPMK0l 0000Z6 00C0 E w, 0 29].0 11116J0Z0N0S I81S 뒏 Dz6G$C0$0N4H?` 180S 3/*?kT0  o .l[0 00[ 0 [ 091`0S! 0S0  0Vఙࠉ䠉  [  M (0 0 0Y  (:u*5 x `V 1S!! !1 0S   $3 R @@00l`Z0000x0S p0St t ' x0Sp p0t 0x@t0L0 `Y`H0S l  =M0(0 = _1S ~'[ I 01501 X 0Z0C000000Cl zV |' 0 -4\l\g  Yi <` &  ᘽ\1 P 0P^ 0S 0S5p@ 5 =55l0Q QM00pO `<C?;x0S 0`\2p+_ԀӀzӀ+_@Ӏ+_p@-a@PP0   DO-M00SP؀  ǤX `\63q80S0r ZYY1 `x0  $ S,0O 0 0 0P,*pD P $0S,02 H0S5 `[,0Z R3 RW ,@/0SRP0O 1P00000C0X000_T-0S00S% `P (%@H0S PS0,0,@T V5  Y4M %P0 Z0S 0W 0 P0P0W0 `0 0ЍB ,@Z0S0S5@ 0000C0X ?005@000`PV``0,0 ,0p0WZ0S000VP0830NP0 Z0S000W 0 P0mP p0W 0  0`P cVa `5lP@ 0U 5 =5P@UH2PH0@S 0  0_K {T|p(<(X<((X<0S X (ޣX (0أ0020Z00S   00C0p0St t ' `%DH% a P,F=(P? P D߼ 73 )Ag%0 S Q R0 400``0 o0ZQ"04P B+ 0 0` LӀ@ӀӀ2р0@-q@M QaT0P0` ,0 2TP X OЍ00@-P0dM 0 0@S0 0S0 Q  O?o 2Q0S X EdЍ00@-@P0 SMS0R  0 0 0000Q P 'Q P  ?o2Q0S Sߍ0p@-5lP@0U5Pp@0`P * P{y5<50 Spp@@-X0C50S[0  K 00S @SFO-`$10|0L048<0L0 !80 !!L0?! 0  ?  %"0 0 ts00z2P 8DP  D +<0<0 ~,0S;,0[0000[` P055 l`0<10x080C4mP P0$(, 0P0'T0T0(V= ( fd 4R =0c?0h0d  0400h0$  0`00,00?% 40!! 140S  3/-10 0S [0[00[0x0Sp p0t (0x@tH05A ARX B0BSl|505 V@ i~$j:mB0BS  R`0@1d0Sd d0h 0d@h02 R @0@b[ 1\D03/2022! X! ! ! X! !20C22S X 20S tQP1211S T0  p(Jli?p4P0) 0 0Z 00400 [`00005A ARX B0BSo5(A0AS h5Ic 04pZ0YB0BS  Rp@0S5D0DS Y D IL4}IрH?ho86+_:_+_+_8n_a+_2>QӀ@ӀF@-0  000Ѝ@-0  000Ѝ@-0  000Ѝ@-  <  S 3    0 0000 Ѝp@-QC 1W@8h@00@00 00 !!0400000, !  !R==P 0 V@0es=Pqo=P3S L6oL6p@-X@P0`S @8<@Tp@ <03/@|oKQL6 0o_@-0@T0 3/@|oA-Pp `4 @P  p `m00 (R $@ @0@0|o+_o R 0$0 1 |oPA-@`!PP0q$0开0PU(0(0SAS 0 0 3/00PTp PDU(0 S 0 0 3/P|o8].,_H,_^p@-`PW@  ` gmm000p@-@Pc@90S   1G-@`X 0p013 0PUPU'1Y P 9/0SYP  0  0PSU0PP PPA-Pp`ն@ ``p0S0@@PA-P`@pr0S 0S   島A00 00SD0 3R W@ pAp@-@PD@Tp@-@ 0@P6,_O-`0Sp,M@PTXbP ` x` 000000 00P0 00<00 @@0`P b,ЍZ  J$ \0 $$0w[?p`p  cU 0S $  0P 212 2<22@022 02oUY 00@qr@-0C0P $p!Qd@2  TLP1S  < ,$,_,_P6T6,_0@-@H0018,@0S ЍP6T6p@-40CpP0[;P0U3Mpp@-@00S^P00#;#P0mTpp@ M-0 0/,_ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz00S/A-@`7ăPq3PX`00S -P P P4 0,,k( $ Ỳ,_P]-_y_^)_0 0 0/@р\6O-`PC1(S 01O000O~㌐0I0SOa岀p~@n0S p0I0SOa岀a ~O~pL@рG-餀PopWUpP@@ t@]!8R#8 @L A@ 0B072S S B! 0B0+@р0@o/@р 0P/,㺴р0@- 0D0R@00,$00P u C-p0MP0 0`` @寛0 P 00 000 0@Y?o2P0S  R Ѝ脽@-@08M@@#0 00@ 00@@0@8*L*0|0 0000,00 (00!P0 0H0$@ @000'> @00b]8ЍрZQZQ!-_р[Q'-_@-p p@p@0@@SC 1X01ut@ Ht@@G<<D80i@߷рopрāR.-_(q6-_prA- 0b@SPpb}b0@X4100S n0 !!04L0H0@000, !  !Hzhzlz@-@Q't T 03100|P0v6PЍjx 00SP 00S t T0 #!R`0SӀ@-P 00Sp@-P@PpTUp7@-P@}00 Ѝ07@-P@|00 Ѝ0@_7@-@00PP 000U O Ѝ000/0@-P0M0@000TЍ070 0 @1P 0 P QRp@-@Q 0S p@0Z0P01P00Sl 00C00Sp@mR?0S P00 0000@-@ 0  R0Q@R  R 0CSaQaQaQaQaQaQbQaQ0S@$d0  6p R/00/0 0/p0?Sl ?R0|S/ 0S/@-0@3S?|@p@-PP@W j PpP0 b  BRcQ8cQLcQtcQcQbQ8cQbQ8P08P0P0 Q8P0>Pp@-@`Q* P08P0Z0S P0S 0 000C0 p@QQ41041/41!0CS41/\p@-@Qp@8p@-01Q@101`41Sp\ PP/@P/|0S/@-P1SO-餓MsQ[0`J`V  00 0C0`>8AT@ 0`` 081S.8AZ/ )Oh`0 !0L @0;/2 00  00q`P PЍn㼱8APU 0R `0SNPX㥱Pܡ  2/0@ ! * 0 0nq`P X㋱  2/ `0*j`P o 0*rXt 0000@ :0<`040S0P0 PP0 0Q!R 0b0?o0c#"! 2 B P !  1002020 20C22S) O&#x>#1[  00/p@-@8aP 0PE 0Q"000P50001S 00S  R0 0 0S0@0 @@0p@ A-,2Q@Up` 0S 8v20mz0u1 00$_V;0 0 `!`0  0 0 0 004 00 0(0001S ! !! 1 00C000C00100C0 Q v P g P!;0S :Z0S YP 㮮00$P xt\W,0 +ЍGrӀрO-PM`pDT 3RU 墼@u,0 \ *00 0 0P 0NP ju* #@T  ᠰ5/L h Q4p 3 2 @,@ l p PWp t x | " ဲ"/ⰰ0S00P0 010S @L0P0<P0w+p pZ20H0S@ֵ1 13\X@00#[t  @p50100qcτ00P0P Q469390P0 0 ! !01P00 1!1111|0SG/1 !0|@ 10000000S 0P 00=P 00S h |& x p@0@@SC 1\0100Y 1<0SЍ3/rрāR.-_6-_0] Ӏрр A-0p3a 8Q@T0S 00(p 8081 0*pX,@x>03hl2/@-@1 0S@ A-Q 2@s 0  BR A00 1@0S 3/2ᾲ偽Lo 5P0PS P0   1hS!!1 !   P01 P  !J>x @P0#᫴f0$ 0P+t00C00S   WM0 S ZLX(1S,1S |`V ;Y:LaёӀE-_<-_G-@QdqMP00`P  衔& 建P03P0(Z F7S  f>PM ^@ X 00C0 : R0 K $  0 000P00P0Ѝ O-`pA000,P0   P   W| Ps 01P90\+ W !W V$ 0QU  0OW(!0 R (R3 \!Q, QB V:  R \S; Y.   PW P (1 S0(100C00,1 R0,1(10X 0C010Mu P  0R PƿPPu PPA- Pp`3@2::P@1@!<`JPP   B0@D@P0Q @@>p@-@P0p@S@p``FSPP  f@  B PR / t0Q   0RL     / Q `r`6p@-P00@Tp0 妒P @`rp@- P0Sp8 P`@0 QV  Pp!!0p@-P@@0$P0p`6@-@000P Ԭ@@Ь`6C-MP00`0p0 0` @ۓ0 P 00 000 0@Q?o2P0S R0 Ѝ7@-D 0P0PP0@EU Ѝ05V-_0/`6-@-,00 ЍЍ/f-_]I^O-P`С,M @TpPP VPp P @W0 hP,ЍQH 0 P @3/ PPP9  )! 0S ,S0PU,UPP K R #@b0S 0 PP 0x P 0 000!R00! 0V0C0@`r~-_`6-_-_O-0p@!T?Tr P `1 !R  !1 `Vp〱喻 `10 V$PQ0T0< `  Q      Y@10Q@Dp0 =P* `0   `P 0 0 Y0[V `P `T@{ Ѝ`d]`r`6x])._7@-P p 0ݫ@P X Ѝ0Q000 $!@ Q._b._._._-@-<00S 0,0| ЍЍ/р/_]I^G-`2Q " @PpX  p$0S00SpQp @W 003/pP  X 03/p80S 8V$0S I0 0C0!R 00! 0S% P @$`X!P ͪ Y0000000@0@@000000!00C0//_*/_5/_c/_y/_/_`6/_`r/_G-4Q4q ``,@T lK ۼ@$0S- 0* G}<0P000@03/ P R00S $ 70S (0, 0 .Y"P<000 @ 0"  `6`rH 6X?р/_0_0 /$/@-@RP` Ѝp@Cꙷ0 0 00 0=P Ѝp@-Q`M P0 ( 000+@P޹ @P ЍԹXp PU@ 0  墏@P0P S  !  00C0`r`6O-DMB,0RbS20,0 002@000"S2002000C xxڷtBT:0(00p<`@PH"0  < 0A ,0p,`$  6t6T0_6 `6 0 0}`60 0`6p@-`P]` P@00@0  @@0000PUp6/0`6`rp@-@L0PU  R8 00 p@2 03/P`r`6@-@0 400Ҁp@-@@`P00 & p@Ҁs@-@`90P000@ SЍp Ҁ@-$@  Ҁ5_O-M 0Y0`0p ٤XP)/ P$ 0 $8~ 0  AP@ P ᾤ0 lЍ0$0 ᰤ@/߉P@t3t#`` HQ 0  @P ᔤ,3X0$0Y@X@  つp+ZᬇP`'@  P 帇rPi  @ 0 ʤ^`2VW <(Y` (00,0  ```Q@P r9 T~(0@P*0!R00`@" 1, 3 01(00 0000 0 0@P`,0S$ @ `((\ ث trTX }P P \v@} ~`P @ۣ$ 0Y0R0S`vvYD»^5_͠^5_65_ ^5_6_ 6_26_H6_S6_0  !rQ6v6_$0 0!0 00 /Hzhzlz-  0  /6_/20C22S/JB@- $0 C0嬤 Ѝr6_']@-<0DT 0 !0  !p@-P @0U00p00000P0p-0000/G-`@#202P̠ X4 CX$S\U  PlU P0 Sd plU d 0 dGy]@-0  \X40SX4 0 !H0  !Ѝp|0@`V  vl00[dPPPnl00Ѝp@cd `fl 000 Ѝp@d̀P/0 00@o//@-D@ @X4 CX$S\#C@9loA-P`@pJ@0 80000]ȣZA-P`@p7@P 0 $0000]ȣZ⁃@-@ lↃPl(@P/ 0  0 x0S0 0l0 h0S0 0\0}?r0}?}r00<0 R / /6@Bx 0/6 0 D6@-0000(0( (0$10c00Ѝ]Q6_6G-P 0$` T@`FUH0 00 p7NY <804 0R 0s00 000000  B 00C$0XG^O-4M$0h4, 3\`1`p@00S 8˥XX0600ǡ0 P ! ` h$00ڳ $Y0P0D0V ^0 d^p 000S00(000 0S0@f0僡000S00 :@T 0R@0T nV@Z@000 0TP(0$0,00H000000070|2 00 4;80 0$< Sg0;;00S8#$0000\03/$0" 000 0 (00QM0P  40PH 00 00QM0 000SY  0S0 0S  00S 00TT ]X -0V 0`5000700 04Ѝ m0S1೛0 00 00,03/0 0C00 000  000  0C0?0@ rQ6_GQ$0S8$0/$0 0!0 00 /Hzhzlz@-M xP@x`xpT  xU \عЍuP U͹ȹP w@^6_]I^G-`plllPB<@0S 0SUЍȅ0 \  堹67_ 7_NwQ 0O-p`PDM!2 (P0P<00p,`$  @<]I 0!1PQ0<0 ,p(`$  II 0 0 0'!p1< 0  0,p(`$ 3I0 0 0!$1< 0  0,p(`$ I 0!0< P 0 0,p(`$ I 0 0 0!0< 0  0,p(`$ H 0!X0P 0 0,p(`$ P < HDЍ=7_^6 ^$:_A7_y_K7_p@-PT0@Tp@@ٮ 0R0P 0S 03/@r7 1S/00`6X?@-<0DT 0 !0  !s@-@P0@`Q Q10S8 Ԅ0 R    ᬸ,T Q S`0 S#0@0S 0 Rt    X00S  0S800 00@Ѝp R6V7_ 7_7_7_0@- !r 0 !p@-u@P3 p@0303/P 医t03/7_p@-cu@dP03/pp@-Qu@R @0Q  !1PSS_p@ ٞ68s@-@P@`0S S 0SQTP00S 0@ \($@00Ѝp6 7_7_p@-0P.@@Pp0(.Pp0 p@'8_K__@-PMԹ fv`@pT evȹЍsP PP ̓ᴹt@P 孹` u@-8_^]I^?8_00S/A-P圹u@`p刀TᨃᏹsP` sPჹ,u@|tP YH8_(8_8_8_|8_s8_p@-4`@0PSvPp p@ser@-00P Ѝ dP r@-@ss@-@tRt@sp@-`00@0PP 0 X0P0p]8_A-pa@0PS =TFsPPsP p0.DP Ps0S 0.1P 0 *P 0StP 0SdڶsP 0S4ͶsP68_'8_8_K__8_8_8_A-M`PPPЍUP00S 00S姶݆P妸 8u@p刀T 7ux嚸ÂP ᩂᐸ]Pቸ t@YY8_o7^[j_ 9_^?8_jI^@-Pp0`Ap00<@00S V Ѝ 6P0@-MP tP@! tT 0S S S P  P  rЍ00S HtrP A-l@0pS ;PDrPPr`P !.GP Pr0S .5P /PP0SrP 0Sdٵ!rP 0S4̵sP69_'8_d9_K__/9_?9_R9_@-M`PPPЍ康 Lt@pT Lt寷U EԁPցP ḁP ᲁᙷh@P0咷P껁P s@u9_^jI^?8_p@-`0 MP0tP@@ ፁU s @PtT 3 Ѝp0000/7@-@PჁP 00hP Ѝ0 Pp@-M`P sP@@ OV Hs<@P sЍpp@-M`P sP@@ 0V )sP@ sЍpP7@-@P 0 000 Ѝ07@-@PP Ѝ0P 0 0000@- 0 0%r Ѝ|QQp@-`@PP 0S Tt ـ `巴p XP@}0SpT  Ā 墴69_9_9_,0 0S @-唴@69_A-Pp`@E00$0p ` P@ r0@-l@P0^P UPU  PU0^00 0@r7@-4Pq@P $000 q Ѝ0QQ@-` @etPp1S`00`[1S0@<0 AA0,000 xq Ѝ6X?7ıQ@-0@`P 00 0@0@婦尫|0t tt@`P0P``X XX0@P Hص@Z 80Ѝp@N[9_7Q9_H89_Q!:_L8,:_8Q@-`0@0 0@0 0000 0@00C@0Ӏ@Ҁ|P/0D  \0\0P/] t000 S \/0`0 S/Q/PQ//Ӏ@-PZ00C0 -@-FO-XbM L"0H@0S 0\* Q00S  0 0Ѝ 0@PgP@  p0U   0倐 00000P0 0^ 00    0# 0 0 00000U00 @PE B P‐IcpGc0@@DT00@@00@d @0\0弶P P P@~@ҀrӀӀ0uP8 g;G-MP 0`` @p埀 0P 0  00 0 0 p@>?o2P0S 0000 0oP0S0 0Ѝ@-p0 0  ^8 0@0000@00C@0Ӏ@Ҁ@-@TZ0S[00[0''d@ p@-81M@T-  &Q  0  P@@  `  t!00P  w0 x0@Q 0l0300@ @@ƫ DDЍp@ڦ]ӀP8Ӏ0u@ҀrQ:_0?Qu:_Q%_0O- a 000p(P$@ @A0찟,00 000p(P$@ @ @PA/0,00 000p(P$@ @ @PA00,0`0 0X0000p(P$@ @ @PA<Ѝ@uHQ|:_\8Q:_:_Q:_000/00CS0 HKp@-@$P,DU LTpp@(FӀ A-0 0 2#@T 0PSpW Ax$`p0S RpP$ 0RA~@TAӀӀz@-M`p=@P00a 0 0  00@00T0S@1 0 0S D@Ѝ? 0S 1S Ӏ@-@P0`0ca 0 0  0 0 @00T0S@q 0S@Ѝp1S1S Ӏp@-P`d  0 0@0T 0R0S 0S @P4Pp@QG 0SӀӀ @>D 0  !"P/ R0S//ӀQp@-@ @PXTd0P1@0P !0@@T@IpӀp@-P(@p`:pӀp@-`P`\ T `@00  RAP @ppӀӀ `0S  0  /Ӏ 0 ͫP8p@-@Td0QDSh h h0d 010Sp@p@zӀA-l0P1@Q`p 0SR 0 0 0[00[0xPU1T  R Z BRQV [  [  pP0CS 0  BR O-S0@` (㫖`㧖p0Y,#0 0+Z  R` R8 LP P`Q l TV7Q R pP Z RL  \d PW k ЍQ@ZSP0QS  Rz Pv QV >P(GoYQcVZ U Z RY Z&PU V000 ` @ $   1 000015} [00[0`0`p `p  d Rhhh d!QPP Rdd h@hu PVu $V (ޕPpPIӀӀz@-1PM?@?@`pL0P?oP20S`ߍL 0RP S@0@6/P0S   0Ӏp@-L0@3P1S P0 00S*Q000ppp@-P0PSA,00S 7aPpɡp@ XwG-0PPpa|@P @T P03P0!ATAU ᤡYL0<L0FWݣTGأ 0 ޳P80 P80@P8s@-xR   @ H8E | (2(BRG !"|0 ! " 0QQP1 #"10"RR"Chh0 1d D03/ᣣ  0 R0d1`0S00#0H1``0S/00 /0 g/6& *P 1:g@ 0"z0`0/0? ?,0l`00000.At0*|`lQ4  IЍp@Yr8n_a+_oP8p00p0P >p00p0>p00p0[>p00p0T>p00p0`0t0<1x0哞厞哞厞剞匞帞(0B(-R #Ӟ- . A. 001Vq1`00` Fd`y>1 1mR'y qV#y00 0 Z &h!Z|2x1[k1"04P B+ 000 0z G 1 G0/h2p0l"/`2 Z0Sz pCSWppp'pr00 $! ! ! ! r"&" 0r &0B28b0V/p2t"0 0p0`00` d` > 0,h1P=p00p0T0000 0S00@00ip0j10S  bF0V100`00` d`=00  1 |0 S)W 0@DHLPTX0\ (!@0@J0@0,!D00D00!H00H04!L00 L0fx PNbx10S7 $0 |01f0010 0Sh00h0100Sh00h01IF1 0=[0 100S R  V 0X00\0`00` Xd`r=Z 0BRS000#0s-( (!!( 0!!0 *00X 080`00101 01(01(w` @"D !HL  $ (,8"04<(X0h\ l00  ` p  R00=9B =C00P20T2Ѝ0`` d`< 0` `00d`<$0` (`00d`<(0` 0`00d`<,0` 8`00d`<00` @`00d`<40` H`00d`<1` P0d``00< 0%(0` ``00d`<q qqqqqqq  ppppppppp1p00]]$]@]T]`]@B@-`P@v1S0 PЍpwP`L0 00000 00PP v 0ӀO-Q4MX@dp|4ЍOs8QT@@Z`PF J[o@QZ6 @PG 㹏>0 0O0$@ 0[;00 U@ T VJ 0 Z 01m1@P0Z@@y 0}ᇏ6  l@P DATy j@64ЍrV 0X01 <1@P0X@@y M6l P% [00 @@0 0UP@ 3 VJ0700Z0 CSRL0 @꒟ gP@0J0 2@P Z$0,0 0000@0 00 0p`5@Ӏ8QC-M p @P0S !PU  A` 0 's@P`P ֎Ѝ@@-@,0 000 0@0՝oЍO-LM00|0 P<00<@3ppU#`v <0 p|000xtpLЍO:70 00S 0S# SV000$0`0S0000$00S 0U `V U00=0 V$`U@ 00?05 bP ]1L0:p@ 0@A400(0080T(0Ss |:ATo 0(0L0SZ0S 0 000<0@ 0BP ! @VP|Q Q(Q4QDQQQQ Q` PP110$[0y0S 10 R 0S(0S5 0S0p0p@,0$0Z,0 0S0R0S$  0SX ! 0 000 t00 t tX 0 000000000 0 0$0$0(0(0,0,0000040408080<0 <0@tH0XH0L0L0P0P055[0[0T0T0Z0Z0\0\0`0`0 d0d0h0h0l0l0p0p0t0t0x0x0|0|0000X0000000000000 0000000X0000000 00000--....////1X1 1111 1 111111111 1 1$1$1JυJ?X$ 8181<1<1@1@1D1D1 RRRt1 1JtX 11222/X22!2? !. (2(2,2,20, t0Z 014 <.L[ ,0SDS 10 Ry ?R Q 4Y.3.Ќ ͌3( P(00 '9 s0 90  90 90 90  90$ $90( (80, ,800 0804 4808 880d d80l l80p p80x x80| |80 80 80 80 80 80 80A/A80B/B80C/C80.80E/@8@0F/F1080G/G80.80N/N8<1Q/Q<1@1@10w80/q82@0@ 0 Di80e8(2/(20^80, U00C040 040$0 0C$080 080,0S @T00 V0S  400C0 08 S * @800 U=0ị ḋ2 LЍ0S   @ҀӀ1`00/1`<10/1<10/p@-@$PaE100pӀp@-PP`@7V11 P@ 10$00@gpӀp@-PL`@V11 P@ 100@OpӀ@-@ᤗp@-P@᜗囗p@-@ᔗ@-@ᑗp@-P@቗列p@-@ၗp@-@`Pᩗ PpR0p@pp@-@Q0` R`00p R0Q`R D/O-MP`8圙p^u@;vux lM  /Puv\+P ᚙu P OO널IiO Ox vc _  P @ P  0 嬙P[  ЍPvxؖP KЖUv ̖Px  P  ὖPᴖPx|uvr ᬖPn uxᬖ c  ᘖPf   ᔖP_u ቖPv O-MP`8֘pu@'vex :  oPuvLkP Ԙu ix hvg c  QP @ MP  0 P^ i Ѝ3Pvx+P ᘘ/3 UIv Px  P   PPxuv P~ gux s  Pv   Pou ٕPv Co@- 0  x Ѝ"0@-00 n Ѝ@-0t`qᯕ@uᬕP᧕$0P 000S Ѝ7@- 0   Ѝ"0@-00  Ѝ@-0t`qᆕ@uვP~$0P 000 Ѝ71L0#400/s@-@`ỗ00 0Pᘕ@PЍp@ᐗЍp@-@PT@#D`qM1   p ЍӀ0A-a(M 000` 0P@P p0 !@P ?T@(Ѝ{1P0 ` $0R  I\P 0p0z/`00 ⵢ0 00=Ӏ:_(0310S/00S/a<@-d03" " R @" B"2S @'@T*P p@-P@Tp k000000@p@-\03Q0S m @T 00@ PT?pG-@`PT1 TG TGUE h1*FRA:0CU= 0p81P3  1 0SP|% P$ V* W%003A } @T@ 0V00CS  @G@@ @00E @(vA- P@`N70 0S\Z0S=Ɍ ͌pWX 0 S RQ   ЍS@-M p@`P 70 0S ^0S PQ S 00U0Us00Ѝ@-pP`#@P∀ 0 |0| 0 00 h0 R\0Q VK}0 M$3SEެ^̀2̀YH0@-M 0000 0@T0P     吢P ЍBA-@ `$P B  p{PxUV#3lPkU V VX031S ( ,02 0P03#P qp@-`Q3 OoBBP @H]PP0@p OoBBӀ@-QM`@!P0T  R 0@ 00 0@`ΕPP PP pW pWP ЍMO-QM@p帰Q @PH0P @@0P 0喕@P:00CS@5 aL0` 000 0m0 00P 00 0 0 p}+0@?o2P0S` 00 0e@P 0SP000P0<J Ѝt]O-QM⨠崀:p0PS5` 8@P0 @@0 07@P⒟ % Ѝ 0` 6m0"00  P 0 0 #+?oZ20S@ @@O- DMPP 0!@/ Pq B,$o 0   0,p(P$  .0 000@!. 0 .  4,p(P$ @.+0$ !00/>t.  l.00 0 4,p(P . 0!0. 0   40@,p(P$  . 0!- 0 4  80@,p(P$  . 0!/>͟ 84 0 0<0@,p(P$ . 0!/>4, D40  0<8@0@,p(P$ u. 0 !, 0   84@0@,p(P$  _. 0!/>x̟x 80  0<4@0@,p(P$ H. 0!/>$ D0  0<8@4@0@,p(P$ 1.0 400 !+ 0   80@,p(P$  .0 400!/>\˟\ 80  0<0@,p(P$ .0 400!/> D0  0<8@0@,p(P$ - 0 !* 0 4  80@,p(P$  - 0!/>LʟL 840  0<0@,p(P$ - 0!/> D40  0<8@0@,p(P$ - 04 !) 0   80@,p(P$  - 0!/>4ɟ4 840  0<0@,p(P$ w- 0!/> D40  0<8@0@,p(P$ _- 04  !( 0   80@,p(P$  H- 04 !/>ȟ 80  0<0@,p(P$ 0- 04 !/> D0  0<8@0@,p(P$ - 04  !t' 0   80@,p(P$  - 04 !/>Ɵ 80  0<0@,p(P$ , 04 !/> D0  0<8@0@,p(P$ , 04  !\& 0   80@,p(P$  , 04 !/>ş 80  0<0@,p(P$ , 04 !/>| D0  0<8@0@,p(P$ , 04  !D% 0   80@,p(P$  s, 04 !/>ğ 80  0<0@,p(P$ [, 04 !/>h` D0  0<8@0@,p(P$ C, 0 !4$ 0   84P0@,p(P$  -, 0!/>ß 80  0<4P0@,p(P$ , 0!/>\T D0  0<8@4P0@,p(P$ + 04  ! # 0   80@,p(P$  + 04 !/>Ÿ 80  0<0@,p(P$ + 04 !/><4 D0  0<8@0@,p(P$ + 04  !" 0   80@,p(P$  +8 40/xx! 0  <0@,p(P$ + 0,$4F! 0 <8@0@,p(P$ s+ 0!/> 00  0  4,p(P$  @\+ 00/! 0   4,p(P$  @G+ R%_:_ER:_6R-#_:_:_:_3R:_:_:_;_;_=;_;_+"_);_5;_<;_'-_ RG;_P;_Y;_0! 0 0  4,p(P$  @+DЍA-AP,p`0S S% S=V W@TAV NP )@0S)T @D@!d0T@V`)@\0PU L0S fP1T@PӀ@ӀA-`Qp@N0S S0 STT PUQ > @w,uT P= PU@.$ @]T"dPT岍0PU L0S 妍0P CP r@:T ,5X0@,@Ӏ@Ӏ@-` V@Q,  Ch WЍp@-@P80< 00 #3  0 0 0 004 00  23 48<0@S- 0~JHL 0 P030 0 0S 0 @0 D R0 0``#`0  00000 0 Ѝp@O-`ᑿ0|0@0C0000   0 S po0?C-@`Pᰐ1qS21 0! 28. h R R R ' 吗딌X0@00P0#*1S0Ap@0 0@00002S000000SP ЍCD000@;_@<@-@q0( R (   B "R    B \!R A 4. R Ѝ!R b /o" Q AG-0@Sp00SW GSP0` 00Q2@E`　T`W p gW 3U  G虑ꥑP 0S<@vp@-@P p@//// 0\ CSR0d 00P0Q#7Ó7P00d0\0Bp@-TPCċ%0C0\0(@T@ 0S 0ABC볋Xp@- 0!0@@0  /;_0/000S/@- 0 00| ЍY6_bDv]00/00//O-H`Q@S 0p0202  ΙX0D3" B"2S1 ЍOp `00S<<0 ᥙX <0 40<V 00S 0 Ѝ]G-0P@s pp|D EY }UPX<`P WVV `X_D 0G<VD0 XMD0 QA-Ppp `D0@c`  ?T4D@A-P*D`@ *@V`<pX0# @ < S" V@0 A<;p@-P @H0c   0S@Cp0 S pP/0# S/P/ 00@o/P/P/ /p@-@Py@0000p]Ӆp@-@Py@P 0000p]Ӆ[@-@C[PC@y/O-1p {P{W%ȀN@ \[`R03/@ Ѝ @PR  03/@ 0 @O-1p {P{W%ȀN@ \[`R03/@ Ѝ @PR  03/@ 0 @/00/0@-003/ ЍC-0`M00p@PUЍ 0R P 0` `0 P 00 000 0@?o2P0SH00S 0 00,,嗒03/P uEPv]<_<_@-m6<_@-P P d``|PTLw Ѝ (,mhEN<_]_<_q<_@-e\]<_@-@ xxSt4Qڀ  !P H@, ! 7]<_Hzhzlz<_A-@M0s' p`P@T#0@400000 ,00(00!0$@ @ @00 000'>0<0!@P h@@ЍS^P p@<0W(0 00PSPPvE8GREA- @M,L(1 000p<`@P0<0A0,p(`$  !0P  ‘@Ѝ<     '.A 0 ,p(`$00 0! P P\妑PT@<`PppP  嚑PU@E<_]<_Pv=_=_XvK=_s@-`P 0@T4T0@T  S  0D 0 0 "P $Ѝp aEEPv,]y=_h0#(1< /@ ρP PQ00@0!!#/ 0S(0, 0 (0, (0, 0/ B@- @ ЄP 0S,031!10Pp@-P`|@Tps 0SP0 `00C0}A@- ^p@-Q@Z0S P0S00C0P0 0aH0 Np@T \/ Fp@-@dP@FAp@zp@-@803Q 0dP 0 0/F,jpp@-@00C"0!300 P p !A\  Q` s^000PUR0(00@@@#p$0P @- /F0S co `/P0`o@`/0@-@0M 000@0@@@0xP 0l00@0@ @@xDPN7 07 ((Ѝ0@NRZ>_Ԁb>_ӀxeRMR%_p@-4` Q[ WpT0t@  0P8+]`Ԁp@-@[V@WPpQ@u0p@ ~Ԁp@-4`8SpP0P C@  Y+]084@p@Ԁ0O-4`@ q@0D0H0L000000000111 1P    @@D   Sတ 8  S%  0 Q31?Y$ ( , 0 4 P00P00!!!! !$1|0(!,!0!4!p!!!!!!!!08 0@Ӏ<]p@-@T 0 R X0 嵊PP T x ;]0000@pt \0Ԁ0 0S/0 ƊԀG-PPp@U3P @T( 0`S 0V00 U00 t  \V  0W` S `0W P x \0p0p@-@0PQp R00  mԀ@-@P`P" RS . 0 000 00 000 00 0 VPP  E2 1"  yP0E"0A 30Ѝp0Qp@-!0 P`00SpQ LBA L ^@P00000 00 0 0 00 00 0 0p@-@`P|@Tpg AG-@Mh04`pP(0 000"!       P0?S$P(P,P0P4  L0QQ 8QQL02 SR|0p!!!!!!!!0S Ѝ<]@-Pa@Y> i?,10!(1T00!41  1 00000110010 0 p@Ѝp0D"! 0#@0A-q01P0c?@0010!(" !0 & 0`0(0o dA(10101A-0P`q Y( ݓ@T  0@P 010 10010-A!  !!! 1P $P pA-@ 0S Pp`P0 8P0@0D"0!!#  0SW00S@ p0>S?, 00CS' ^R$^R]R@^R@^R ^R]RT P@G  0 S 0 0000@S P@@ -@@O-Z0M0C21@S FP4 q<00Jp"@03 [P`+ q`P -PPP  !QP PЍ! 1 0S P 1PS01ą`$ 0 00 0  (  0S @1S Z RP Rp Q+  忿0P pQ   BV 'V  `P [0  ᤿@P7 gPP< 0 B "Vx1Sp` 06Z 0p!x!ZR|||!xuZ0S*P0SU <|@T@P`?o22PP V Z  R ; 1UP0/1P0X Z  R  ZS 0Z0P0U1P0Q 0Sl 00C00 0P?o20SA Z1UP0 <]@ԀԀG-P葐tp@RU" PX1@T, L0S` ZR`@ 0  ``喁PX Po@T PdЍ@T\U `0SL`` 0  ``fP X Z0 CSRxP:d@Ӏ@Ӏp@-xM@?x ` PY0U0000`0 0~(0$(P lP, 000P0 KxЍp@-P0@1P00Z00l 0000l@ A-`pP@T L0SP0S@0SPUAB2Ӏ@ӀӀG-1`pAZ0PS&\W Pqo0SP0SP5;0S|PP0S G0 fQU 1ӀӀ0@-|M@t PUX00P4 o|Ѝ07@-P0@60#R00SP  0$100\ P P P $  Ѝ0@CA-P`p@TW [0  d@p@-xM@`Pt X0 0 0`xЍp01 10/O-1M`p0ApPpXP0  @4/SO54c@㇒) l 0R[0"? R (`pap0` 1RW  PZ 1 ` ^0% ЍO/0G" 0# ?o\20S d20 d2ЍOYP k` 0 Q 0 0  2|wЍOsЍӀk>_O-p1唑|MSA僿P0  `l^XO RX劋%@S8|ЍOO R (alS E t W0! Rp 40堀尐1!` p$QW0  [Wphp`0STP 1`@T 0c/ 4/|Ѝ9yӀv>_p@-@HP`50S p@@!p@{ӀO-`PA$MZ0S P R 3Z 0 1SW [i?Z!00!00000!00000!00 0000pPWJ?Zn @3         0000  00000 000 000YP'8P04P0H ` ta$ЍfP @ p `3 `X2         000긕@  5@0goG 0J"0!!#V p Q; p0` 1RdV J2  p  RT Z [ [  l P V1    ? ᰠOP. `0 !402S S1 pX 㨑U0HL1`0S" W[0  lP 0 E?ⰠP0  1P0!\Z Ӏ<]A-`@Q` 4R{pU2! !! ! ! !! !0 0F"0Q!V31 $0110102A<]p@-@P0` $㥈` wp@ >_>_@-APP0  7P08P0ǻEw奉  oe!p' :P0|`V0S 0 00r 净00C0VP08P0a7P0去ᙻ/000X U 1XHqL1# .+P"  03/`400S$ P wzz?V` 0 `#P0 :P0P`LP02P0V >_>_<]v<]]C-@1PC|MT!atR 40T!md2cX0d201S" H1Sx  T` RT1嬁p0P  1 ` X 0 8/wY* gP  0  ~|Ѝp@-@ 314020SS`@P`Pp 03/p@S Ćp@裌@>_p@-@P@`iPN@  03/@qp@p@-@P@`UPN@  03/@]pp@-@P@`APN@  03/@Ipp@-@P@`-PN@  03/@5p耾0A-PpZ0P01P0?`0Sl 00C0|@T¹ 0SP0 Ϲ Rb AV  Z ` p000G-`1SxMpA 1 0t S001Wpp00 0 0$00(00,0@ 0S0( S :P0  Ჽ0 R (! xЍ%@ S_`40` 㠐p0`1RS WP 1 `@T 0c/ 4/>_A-Pp@ ḹ0`V S R @0᧹Xڰ0`00@@@0`0S 0 @p00/ 0RS/ S0 0 0!< 04 0 (   !/HzhzlzA-D`DpP@O0S 00U@`00ՀE00/p@-0@00S00P00R -  P 0Q 0 p@$tb 0 |&0C0d03-P ]'30 0`Lp@0]p@-P@xU QOp@-TC\  P 0 P  &{`@T3p@-@P R` P0==Q`PP0  p@P0=P0/C-1Qpc0S@ XP0E 4< <> P0P<7 P0P000# #$ "X  q {P 01 QP 1402010S   Ѝ<WP0 @0P0+00l00 W+P0@ #F<]A-P@`pQ 0嬀S @TAp@-@P Tpp@@-@ᙷ0S ,0R@褷P0@0P0@腷p]p@- @dPVʀ0!` 0X P   !wuTU pHzhzlzpQx0tS|0|I 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzG-pc~ࡖ 101APU0 0 0 0 XP0 0 0 0S@00:#003/G-@`pPԠ ,1{?R c@P @ zO |fP`P\00S 0x,!##)" !qaZF>_R0>00M?_]z_v?_1^U_@-L0!C !!R@ 2 2~P@~A-l0,q@0 PN `  0*  @X @R X A  Q ,1\eP ,1! / x/ / /@-̓z?_////p@-@ PN  NpӀ///N/-////@-   Uo Ѝ@-  Uo ЍQ@-@ @;P  ,VP ?_?_@-@KP @Z@@C-@QMPЍP`pP HPP M P@PPS D0a0CQ R P =O0@pDPP lMP hMP 0 aMpPt#MPMPYM0y0 cRY0 0@ÑNM뉙! &ခ"** 0 ?M@@LPL᷀@U^?_^__?_?_ެ^S^?_A-83@M` TV 0  n30S& LP B0 rs #XOPP  N0"0 !& 0! "塀 @PPLPC`LP>PLP9D2,b0`zL@wL7:!#:  : 000@0QjP1dLnULPLP LP?aYxWЍ>@DT>Tz ;L ^O`Ps2LP/L0 40 0000LP!LLP VPP px0 p w`j veV`;LP =@2F?_?___S^?_^]I^zd@?_O-@0pSM800880S NP8 830: PP>@HPP t8lKP0ST KP//00 000 `@ hT KyKP KPKPah fd0=t?oT20S vK 0.0BIQگ0 0RA*S 0 0B00 0+PP 0 00 0"PP & $00CKPC 0"'Y AK 0s`P;Y H&0 *t6 006 #:: 0( ,0 `586000S ~?CS /00%000b#a 1003KP.KPV01KPG   (00`P l", `500Y7L H~0sP8 $KP50J@PcJՁJPJP JPP4?a⿁4PD`D R JP hPP0JPP00JP 0F0P D Ri~30S b~P0JPD R 0S~0h000].I~p30S ЍPTUET5 YJ |MPP.HJbPdR)yJP$tJP?J0w0  cRW 1J 106!#: : 0000PJJ 6#::0G (0jPPa& " I@PWJIP)JP x$JP41h?aP1 LP p}PUv^ 0P0000i p0 02220l0ܮ@0#0$@01S3x0 02P22 0S P @pSeTTp0 0 0SP 2S(@LQ222@0#0 0@0YxW282vDF@-0C6@ @-(0C+282@G-pȁȡCRU 0S *Q t!@0D0@0D*2@ *dVʀ 0! $!0!!   !0S0S B 000FP10 0 0 ᇭ282202+20C2Hzhzlz20C22S/|@-$02020CT@-P@[0p@- @0BQS$\RR\R0RRRRR5@ ?0S Y000 R 0 0p@*P08P0000s|{2R 0 0p@-M0 `'0 0Pp@KuA_A- 1aq@T. L0SL00 7@Z R  BRl  00Z0|PU 3S ׬P0 P R {Q߬8@,`T  @AeӀ@ӀO-$3$#$c[3$M10100S0#0嬼2@T L0S壼0p|P0U0"W50a 0S0z/` 0yʼ@P0Iz40\ 0S؃0$! 0Pz/ 22 x40T000T00S P0  0S 0CS _0!Q500 ) 1Nd00500pQ0S,0 P: ^:pz_Pp0` ry`0 )xW   M0S L`rP$ЍOBdd 0@c5T50D3vX?Ӏ@ӀA_͠^_A_OB_,B_ ],P000@-0ll@lP R P00Q# R" 0RR 00oİR RP00G- @`p PĀPč㰀尐P᤻PU߻U@  `R0s#0"s#R Q0Vs# o RİRӀр/0$ R @- 4/F 00S/(Fs@-80`SP 0 00,U`@P  Ѝp @P ,aEP` \E0`0P40P0 R8@0`m B_͠^h^cB_@-0 =000404  R4  000@>1t A 0st@@@ 0 P 0?P8D. !  11W000PPP Ѐ 0 ( W# W W 000P`1PP0@p400 80<8`PP  8oYߍЀ԰10804 P00D0p<0,VP@B;P H1R0!sR u woPP1 00 400@ 808`cP8` `404SR40 8✦$@TR4`SLo` `0Yp8p @T2o@P @jPშ0Sp1S X@T01X0| 9Q@Pt  <X@070l@ <00 0@0QS P0S p0 0R  R 0$0S !0(0, 0P$0 , s<$0 ! <0$0Y 0(0 0 0S[ X Q B & 0 0C 0! 01PB(     P0SQ 0 P0S@nsP 0 0C_C_tD_FD_#D_-C-M0000P Uy 0  0 !0s  0PE( 000  0o@P iT@ЍCЍ/X X` p ;4X001 ``\    p @`$0$@VBPP804 \@\CRQ f%PU Q@R0 0P,@@`  R XP T0@8$Q@P 0$ X; 0 X@' ?@A-`t1V`04S mAPp`8@T 00S8@P @4p0p8pPPUV  0P 20p0 XP *Xp`@4 802#T*0 R0 R P8@hFvD_G-P0 m0 p堀堐堠 RGm sA S shmT  m@m@0p`C m@D_^^O^D_D_O-`PM PU (`  ; SʦȦ004Ѝ    p @$G 1( P,00 00R P 0 10P0 00`0 0@$0$ K 00 0hFC-` $MPS0@@ 0Yp00H0 0D0@00@?oV20S @T @@U00$ЍA-pXP@(`m00 T @ 00$R01 @00-D_Q|J-//0 R/ 06S/`WvR@- 0 ?X ЍHF@-@0 00 #3  0 0 0 0 00   0 À/ʚ; 0 À/@B 0/Hp@-P@03/0@0pp@-dP@0S03/03/@p Q \ *@$0X{@-@=@-@a0,($@ @ @<08 ZDЍOF_RZF_C-Mp 0@P`` 堐G4t0 00  00P 0 02?oY20S 0S0ńЍ80< 0S 800< /`p@-@ᱩ@0`0@0`,PU 80< 0 _p@虩_P_@-@PP@L@-P@ᆩp0S 444a 0S@0 Z( 0R0000 ᪩^0 na㠖^ 0S 00"#! "#1^PB3 $103$!Oၩ0 3/<0 00000@000MbX?@-gbF_0p@-`Q@P0 /0`, eup/0` p@e__7 _0H-@`,M0P0S@ XX$PU? ,ZU80< 0 80< 4 `P @ W^H D?Rp pӷ1 000P1D H墕pҨW  ` !0  t2^@0 %^p00 0P00000p_p,埨0Sᚨ 0R 0(0 0 ,P0$  R 0(00$P 0Ĩ,P^弨zv Q 0   P^F_F_,RX?F_C-@,MP` V0 $0(  ,0p@0000 HPD` @]?U  t000000 T0 PP ],,Ѝ+00^eF_F_Rp@-@`PPfK PpP^K00p@-@X0M 0@0@ @@@ 6^  00@@Ѝ@F_H0SA-@p`@T!`*K Ps@P `"KH0V P@̧@0T@SP P0PT TPX0\ P0 X0\ U `J@@H V P@H@-@l壧X0\ 0S X00\  @@اP04ST T % ЧT@`J0SA-"<p8`}PU 帧J0@!`R R0S 3RJ Ѝ0V PVP0UPS 0 |0@ 0@0 T0 0 偧T  RJP V PHRRRH@-@p'0 0S 00  @D\08S   TTQ@XJp@-@QPQpp@-@PR@p0-@- p@ 0P` 0c0`00R\PЍ@Ѝ/s@-P@٦00`V `?\ 0  0Ѝp@,6\RF_p@-@8P峖 3 $!– + ]00p0S/p@-P@*ᤦ,0S  (0 0@0(0\p@Ԧ0 0R0000 000 @0S  Sp@-0P@0{ 0R 0(0 0 屦*P\pp/p@-@PPp0Sp[@-@X0HSwi@ Qip0S/ R/h l00hHD @-(+ 0   ?0@H SD0 ,P100S//@O@A-xM p@TAxЍ&Rl00& `吀0S p Rt00CJQ0S\00\0x /t0000x0(0\0\P0 ӀH0@-P0 4MQ003#:@ 0 0S$0 ( @P0S00  00U  0@T4Ѝ0IV0 0000 0@0WP H0L 0P0S 0003/(@ʚ;H0@-@,Mh0003/80< 0 @0S P00$,Ѝ0@YX0SP 08jH \00\0`0SA,Ѝ0'p@-PH 0@   S+0S@)p&H@@- 媥P@X@-@ hP _Ѝ \QC/ɚ;0@-@MP s^P0 Ѝ0P@-@ P P0 L0S003: 0 -Pʚ;ʚ;@-@ PQ  S_ЍO-`DM00  0hphPP <UW 0 00 PDЍ 0S0 0W@0@C@0 #PP ?o2W0SuPP "hPP 0$  0P0 ( BR %0Sk) ,0 0SHUigP ʸPQ( ^0S (0 AQ 0S00  00S000 PQ ^0Q 0 AQ0S000  00Q00F_ʚ;0@-@,MP ]P0S00 0EPQ 0 ^P,Ѝ0p@-@(MP` g]0P 0S000$ PQ 00 00(Ѝp e^0P @- R R S12S1`01 0N^ Ѝ@-0@SM 0Q  00<^  - 1^P Ѝ0@-R@P$M 1` l`T U  ]P  @04 S#*/00$Ѝ0F_@B@-0 ЍA-@QP  -n0!!,`Ap0 ,R pW=) -` p`嗣USP0 S00 10\00 1 p 00 00\ @@S0P S0."? Ak6H@BZ{c /H?B0p@-0M 00000` 0PkU@PP  u\0P@0S!Q Q  {]@0ЍppC-P `0EQ@P XP\ ` x HUp0Sp0 0@S((0,0,0p0 pT SHH0`0X00CS/@-@8X0S000S(0S, , " @@-@X00CS@N0@-@00S &R, l00& 00@EHA-X0@0CS8UPH0L 0P0S  0S'H0L 0P0S 0S H LHPL`PR3PPpX2\C  R  @p S@0 00TTS  SH L HLP H LPPP QP H LP0Up RH LPPPL\P RH LP0 R  @HH LL RH LPPAQP R H LP0@ʚ;ɚ;6ep@-P^H0L A 0S PH0L P$0NSQP8@<`0@0SP0 HP80P00SP0UZ, @T` P H@L` 1ppʚ;@-P8@X0 CR3   R* S x0 RS ^0S 0 AQ0S00  00 2S0 00!Ѝp 0S 0ll RR H0L`00P` Q00 ʚ;ɚ;6eA-@T`P9V`8  0((bS \J S HL PH LP Q H !L P R 0@ 0aS \/ S9`p1S d`$V0SF 0SC0S@0S=0ABDHLp P Q 0HLp P Q 0HL PH TLP Q H < L P  R  0 Aɚ;6eQG-PЍP(0p`V W`CX@ p 5/PP Cp0SSt00C>SCs $\RmC#P0SRX Wp W xt 0xt00  0xt00W W @ _ 0 00⌠A9 ZPh]@-0 Ѝ@A-1`P F?o2!R0S0!RX00CS 0S 0SxxS 0kHHL@LpH@L@PPp^P@HL@P0ɚ;6eG-0M`P0p @?o2!R0SPdP dP뤡P`AT 0ЍW 8H0L 0P0S@ X0 CRV:S H L0 H0P L0 RP (0L00H0P0 LV oH0L 0SH0 PL AQP0SH0`0 L 0P0$ P0S p fS0 $0ɚ;6eʚ;p@-@HM` XP P1U(P0 0`PU (YHЍpA-p`?o @2!R@@TPP,P+&@-@ M P Y ЍA-1@p0Do!S``V@P1S0 S 00Q)p@-` MP@0S PP  0!  Ѝp 5!!04 ?A3c00?A3c0/Mb0@-@Q$M  ( P MY$Ѝ0O-QM ЍP`cP{c@Pp0 0[W 01S 100[%T A@WBpU0 @ U 0  0t pxP 00匀P@@Ϡ0H0L0P #0 RQ @ U U' p IT A*HLcP H L H PL  QP H LPɚ;6eh]C-`PV@p,M0S,Ѝ WP0S K p00PV10S/p@-@`1PU V @T h00P 0003/@T ,00P 0003/p@T?p@-@`Pӝ0SpG-1C0(qƝ@@XP`X R00G 00 CQ;Q Q 0d 010d0 0 01 C40dC?10d8 0C?Q C80d?10d0 0?#<d?10d8 0? 0000 0 00 奝 8/a @R 0@VA-0p @P  0 0S0 0 \00X00\0@\@Av (aU0 000000屝P ` 000000\00X00\0@\@UO-@`pP0T! 3R V"0< 00800 80<  m 0 `s 0t ` %W  ЍOߜ0p 0 ` 000 Ѝp]G_@-e<0 XX \   ` R`d00(@-(APT2 ?@F0-XX0\0 `0000Sm p0  HY ,`p0p>10 \ ZWp0SPT ;@H O-2BDM0S@3 #0u1`p\0! (0 0 80a0,$  P1倱< 00 0a0,8 ($  P<1< 00a0,0(8 $  Pm0< 00a0,0(8 $  P[0< 00a0,0(8 $  PIp0 00a0,($  P<08 800DЍOP14?H@I_HI_dASPI_WI__I_5;_=SI_O-`p@M0娰  PP ` "0 P BG)AP 0" 00 00000 0Ѝ@T]@-@ @@-@@ @-@@}G-@pP@B $`rY030#T00S d`M!40Ѝ/0M0000# Ѝ/@-`0F S#*@\Pb 7=0 0900@0<< 0QP@VЍpA-@pD`@DTP=0U090E0U@000E-0,M$00 0 00 00 00 00 0 00000000 S,ЍfI_-,M &  tS,Ѝ»^7@- P@00E!00#4000#40000 P  S  Ѝ07@- P@*!00000000000000000 @  S  Ѝ07@- h0Pb"@!4b4# 0!@=000 P  S  Ѝ07@- P@  T0b"!4b4#0'$000 P  S  Ѝ0h R/!p0!?aAS/ӆC-0@`p\!DM(0 0 <0a0,$@ @@ @P<@<0S+ 0 0 ?A1c00 00< 00a0,0($@@ @P`00X000a0,0($@ @ @P< |DЍ^_X?gfff@<_tg_P嗊A威80S-ЊQ0SL`PPULV0\a0PPJNCT1@0 X (v0S (PF宊T1TG! F= @0R:<R0P!``!6/Р8pW 6//0t"#0? 6/Tp3/P0 3/P` R0T0  z-HMb^2L_͠^û^L_X?8TTL_^]I^$0$$08S 0  2aSHHp@-@PH T 0S 0AT 0 0 @9p<@-@LE.G-P`Up夀0S@ 0 @T 0 0d0S\0S #S`0S $2?ᾉH<IG-P `p@PH 0S0 010SH 10SD FVCBH=GI01,XJ"#}0 03/DwL\?0岉1 nP`嫉V<0H; 3SpH gH HW 7/pP 0R  P0 4S 0S pL_H̀$M_IeL_H IM_.M_A- Mp` P @P 0 P@ ЍU H00S <00S *F5/01,HH̀]»^@-$M@P8 `p0 #$Ѝp@-PM ` @P 0S0 0,0 03/8嵈00\0 ? nЍpHIH L0,HG-@pᘈbP0S`PU23`0̈t刈0 0 \ˆL倈P`P>8廈P0=PP 岈Ѝb 00 0姈50S0S<0K 0SH 3/PPD0e0<00<0Mx!L0|,h凈>4P 0(0S 3/,Y.0S  G.0`0>h 0U0C 0   S($0S%p-P  {FP  0R P 0S0 4S  +00H<I|^7M_p@-@Pp@>@-@P 4@-@P +Ѝs@- P`@P 0 0@Ѝp$GfM_@-@P @-@qP@@-000 ЍXS@-000 ЍXS@-000 Ѝ [@-000 Ѝ [ 0Q/P /@-00 0P ЍXS@-00 0P ЍXS@-00 0P Ѝ [@-00 0P Ѝ [0 Q/S/< /< /0@-S@p0S 3/P <00<0/<   /0@-S@t0S 3/P <00<0/x0S //x0<0pt 0<0/0p@-@Pp0t0<0`0<00Sʸ0Sp@+?=X<@-@0P|0S@/|/A-`@ӆpȀ<0P 0S#Q003P0 000-<00C0 =p@-@P᫆00CS00<p@//<0 0S /0@-S@0S 3/P <0 0<0/<  0@-S@<0 0<00S 3/P/0S //00 000/0S/@-@3/00000/< 0@-S@ <00<00S 3/P/<  0 /0@-S@0S 3/P <00<0/)00/0S/@-@3/00000h0S p@-@`Ph0Spl01S 3/P/G-lP 0h@S q3)0`S0Z 3 #pG Shl`T  ) P0!!00A-P@l`hpT1S S@ R Th@l@A(1GQ @p@-P @P0P $    $  PU  U p@p崅Q P  80R 0 Q P 80R 0 <p@-PR0 0S S, S@@儅p@P`F``V80S@@P``` 0V80S@P<88@T V pP0 W 0 Rp@T Vp@V + S+ B' f}0 ST  `ۍЍXT 040 0 #P@03/O_Ihr`0O_6O_0/0/0/0/p@-@P0Pp$ P \p@-@4P 03/  00C 0p@"I0/p@-P@Ppp@-@P$   u40 0pNO_@-@m@4p@-0 P@h0000@0@00p@p@-@PX`0S0S00 R00 00C0p@4A-@`p;000vV P000CS05gP U P0 3/0PP0`$0 0!0 00 /HzhzlzA-`@MP3 ` 0Hp @00;t>" 9"g07 "P <R=8 h1 S(0Z?00Ѝ ?_WO_rO_'_@-@r"P 6= "t@ "O_@-<0DT 0 !0  !0@- ! 0 !@-PDMp@`Z) 7FA)0 000007 L"P <7 0`DЍO_p@-P`!0@`  )p S8SO-Td"0P 101S@0T<@0 @0<) 0 @  P011 R@0 0@0<@000Q@  S  R@ 0  R S0S 0S09T 0S@0@0@0T @0 00000 0 0SЍT 0S 0R:`P嬰  0:p6Z:@Y q Wh`:V HPZ/ЍO:@:<P__,P_0P_P_O_:p^4P_h^]I^KP_dP_-PÑx|0x|120C22S@-82cM0S-$$ecߍbpTUʀ 0! $!0!!   !W/W@ 1200Tcߍ@-|!202VE 0^/B` ` ``  $`$ ($,(,`0(04`,4088<`4<80P<@ @0<`-OB(x]P_p@-@P`u0p@MuKqp/<0M 40000P0000Ѝ/Ԟ؞qp/<0M 40000P0000Ѝ/ @-T0@00@ 0   PЍ  Q Ԟ؞@-T0@00@ 0   PЍ  Q  @-@tT00Sڰ001S 000 \^  R @Pt@ 0DP8AT @tKԞ؞  @-@P@PctL0H0 0P@\@t 0K @-@P@PFtL0H0 0P@\@wt 0K O-PP' `@p't0S000Z.  P% 0 R 0 B RPUlDtPh00S\001S V  `0@0D.t ЍpK Ԟ؞O-PP' `@ps0S000Z. I P% 0 R 0 B RPUlsPh00S\001S V  0@0Ds ЍpK  p@-P@ Ts00S001S 00 0P\ 0S @P@lsPp 0\ RP !R P< J4L @sK  Ԟ؞p@-P@ TMs00S001S 00 0P\ 0S @P@lpsPp 0\ RP !R P< J4L @WsKԞ؞  qpO-M Ta dP3<1@0V ,1000V3PЍ00 0 010pW 0 000S aV 0|3 @T 4/p PV x  i3`$@P @00 0;/ 0PS  ^Ԟ؞KA-pP`P ^ 0pA/A-pP`P p0A/@- w@P00$0 0000/dA-pP`eP p0A/A-pP`SP p0A/@-EP(@-?P(@-@90P 0S @/A-aP*P a0A/p@-P@Pp 0Sp3/pp$Ppp@^qpO-M Ta dP2<1@0V ,1000V2PЍ00 0 010pW 0000S aV <20@T 4/p PV x ,u2`4@P @00 0;/00PS ^ KA-pP`P ^ 0pA/A-pP`P p0A/p@-P`P 0p@/pp@-P`P 0p@/pA-pP`~P p0A/@- @ mP@0/@-@c0P 0S @/p@-P`UP 0p@/pA-pP`FP p$0A/p@-P80P p@(0/pA-aP+P a,0A/@-P8@-P8p@-P@Pp00Sp3/pp4Ppp@;/ 0 6/O-@M(0嘱p#09ᡱ ⃡P@Dlqa` d*.`q0\!PT100 0@7/$08`5/p@pp@-@MSP 0 PQ( 0S 0S @  Ѝp08@0CPo0S0S0S0SQ Ph@`"80 Q `" 08YQ_Q_@-gMaŸp VPA!  V Ìnj V"00@lpn PUoV@gߍo :@ <# sw 2V9 3C7CV% 1Vk 0Vl @1VQf/!@1VV 3C 5CVH 1VY  gߍ@SNQ f/ 8S@E/  0 S0;30?pqW!  R 0"  0000000:10Sy0Sv R0q  gߍ@mLgߍ@=N VO_ 4N[ @dd@hd d@edA|dA-0pS<00@$b /o bP c0?o 0cT0 `$0 ," S  R Q $!P  R ("( R ("(~$ R 0x~ leW  XV P   0TUAQ_Q_Q_Q_Q_Q__ R_0 60/80S/p@-(0@S ;;S0`s- P S  R8SP peo(0aSR a#"P R 02UXf/p"2P 0R*pWEVs@-P %p5 `@%PA@6 #:@$:@ P  |+x @P TL0340 ,)Ѝp__M]R_@ 2R_0p@-M0@P0( ` P0P P <2 CP*P0 Ѝp00 0 Pzd@hd @-`0,M p@0`Px P/ 0` p PP(j'd 0'&p pq)p!a  l l)P 0T pc)! * *x P,Ѝzd@hd NR_)^p0S/@-l0@ 0P 0 kP0p0Ѝ]@-`DM@ZPP `& l0 00S p0StP p0pS0l0@0 0p0,pP$00004 `P0tpt0DЍ00@-l0S Et0W ,Ѝx 0Xa 0S0 0Z 13[ 0U0``0` 0P3 @ 0 !000000100V0P[0:0  k  1&kZ0 0R 00S0 xk0$ @K0  00$C0K00@P#@=hLp@-@4Pqk00 0 @@@p@k@=hp@- (Wk$@$P$`Tp(P @=_X_L00 0A-@p`P ^p`PA@-@<7k 0,R(  00  000@hk@=hLs@-@`031 `10PP1SЍp0S 000S (ϥ@A-P10M3$Pa 0S] 1 0 00S60\!' $F+@P0pPE 0  @@0@08@P  *0Ѝ 0(   1  *PU$0S |jl@j`PO%0 0z?00`0 z?80'j j@ @^[R_]ӀeR_G-0p @j$PU 0S   0 Y 0jTa(PP00X `  P j0L   @- @0 R   $ R 0 $0 00 0@ 0Lp@-SP@Q0S Q-  B  0S0@@PpQ" \ Q P BQ R   0S   p@ B   R @@0p@-0 00   00ЍR_0LG-@Sp P$`0   ,P00(@$ P$ ERPဠ i)0@T@@@Z0 000p0 $Q0$00$a PPR_p@-@Q P0U P1i0pp@$ 0  !O-0ASD0@ S@:`pP P) 0ci0 R  p!0iP Q 0S:    PP i Ѝ0 #Pri0 PO-DM@tP`pp 0P @0 h0l 0c0h00C00C 0(0i(0l @^Ei@DЍ0 RgS Q:lh @@@@ @t@$ tl,  G0g4E8h A<RG E  # 3  " Y  R W $ R B g B ^s ^q @#3Y3^@g t000#P00St0  } @P h;Q*0  Q3# Q3 "\ W& 04 L ^J Z@#@3 Q@3T @ 0<@@l@S0 8 T \,AQ\'PP\   T \ e t RQ P  P R  @  0   dhx0@@ \h#@@ 0@-,( $ Ѝ@-00$  0  Ѝ@-($ @0 Ѝs@-@P|[&0g0```00 h$PU0 Ѝp@h Z$PЍpR_R_R_G-p@`PG%PP 0gQ 0g  1$& 0S9: RR S 0S   6U# 100X00S p 3 #X  R S`F ` p 0`F 00 `S0PP0 g S_0S_P P @-%//NS_-pcPP @ 8@P@PW<@-@p" ``P`= @` @`@PT=IDP MD /0@BG-M0S` QPPRp`100Ѝ  H\!U1#H1@ U00T0S `i  ၻH000P040h080p0<00@00D0#""$(, X\ 0$0 0 #%@D `d 80<0(00 , h00 l00p00 t00x00|000_`P0pJ00@$M(MO-@Pp$M彊0`VP @$ЍZ0SW,@@`  U   @  R PP0p@I 0  0(M 0SP// 0SP//G- 8M]0@`p\,00 0000a0($@ @ @P幮0,00 0000a 0($@ @ @姮 0,0\0 0T0000a00($@ @ @P哮8Ѝ(M<TS_tTS_@TS_p@-P<80@T$dpP @(MA-p`PN@\P ab`H⼴0000 @  0009$Mp@-dP0SXP @Ӊ 0<R8 00, 00C0p@$MS_(Mp@-@P$`᷉ p@(M0@-@,MPsx0 |  R0 0CS 0 R=9 =  0 0R0 00?!0  0 0  8 R00=9B =C0x@,Ѝ0@BA-@(M`2Px p0 | U0GS  0 R=9 =  0 R 0B000?0  0 0   R00=9B =C0xh0l PUp0P0GS 0PU=9 =P 0 0R0 00?0  0 0  8 R00=9B =C0h@(Ѝ@B@-@,MP`pẳX h0l R0p 0CS 0 R=9 =  0 0B000?h0  0 0  R00=9B =C0hV W? 8 < 0# 0$ 0 0$ ,Ѝ@ D 0$(0, 0 (0, @BP/004 0 004 /@-@pT0T 0PS10``V q03/Xq@T Ѝ>s@-`RP1`0@E0AЍp@VЍp@- <W`80,v $01000 Ѝ,M=T6^S_p@-@H`PS0S(0p? S@<>p@-@PT`-`L0!RQ41`d`p@ T]`@,M=S_s@-d000S `@8P0d0?oT0cЍp!C13/=A-@`TPp WPhd圀PVpʀ 0! $ 0    ! 0!d!0    !Hzhzlz 0 <0G-P0p@}|0|`cP@  z!P  Z0 0 0 RZUPG >>p@-`<0@@P@MUp0p@/p@-P(0@00C0>Up0p@/ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz G-0 M P   @p X@`lP X 0000 ЍG@1 * @P>0MA-X`PpW0S8 Aq P@m@0MT_p@-@P0 p@>p@-@0PD@Tp>@p@-@PUDPpPUp@00@p00S:/>00S:/>00 R !>0 p>0 k>0 >"111/"111/ 211/ -L0!0\Q S0>,0 0R/Q0 />@-0 o>D0 0R/- 0R> <0Q/1S co `/ > -@0^1 0 co ` >40@0\/- 0\ >40@0\/- 0\  >40@0\/- 0\ >A-@`P$0pW筶@P> 2t 2A-P`@$p0SQ z@>A-P`@$p0SQ Q@>A-P`@(p0SQ Y@>O-`pPа$M @T$Ѝ0S:?T@Q; P 0 ?0@4'V`1  L     P T: 0I37@-@0@T t0Ѝ@\P0 1 8*b0 凯PЍ@>)p@-P@P  p-0t  B^\  ŠP0 !.0 . 㙯@>)p@-8`8P0+[$@ 0*Tp>X]@/-s@-`0 04@P0 0*Ѝp@Ѝ/A-pP`@k0P U @0p@-@`PX@P  00p@-@P@|PB /R/rN/@-rU_N/@-rU_@-rU_@-rU_N/ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzp@-`P@0 0/0 p@p@-@`[PP 0 000 p@\0@-@0as@-@0 PЀ `\0 <-N-[0 000Ѝp!0Tzp@-@`P50S [0 0S 00 [p@0/pMG-`MpP@ᰐP!0 +3 0000X0P3/H3 00P00 ЍpM~U_U_T]I^U_p@-DPt` 0 Q@B[0 Q Q 00B0C0/T(0@,  p[pxM|Mp@-@$P`&[@ @@a[pxMp@-TP`[ @T@ 0 001`00 0R@@H[pxMa0|M@-$0P 0 0 ЍxMp@-@ `PZSp@*[xMp@-A@ <`PZ0 0RS@ [pxM|Mp@-@0R, 1R >0R( >C 0CR$ p0R >0R >C 0CR0p 0S00 \PZ0P$PBU 0PZPp p@$j0 p@J|f~fxM|MMA-pMP`Z| 0R) p@T1 00S 0E0C@S@1T( T@# 00S0 SZ r@]ZT W 4Z#@Ѝ@P ZxM|MMp@-@T P,0,h0>Z SyZpp8]|MMG-頁@0MS㠠P# px1 R0S! 5S-@Z@W 00@ Z ` P@U`1HZV @ၤ0@0Ѝ 0`` a0  00  00P 0 0M@PEUP!U @ ]0@S 0 㔔T0p`FP@xMa0FQ/p@-P0 @AlP Q PP  @ 00H0pxMa0O-@S @T`臁 13/ pUVG-p0 @0 0 P  (`,Z(0, 0/X(0, 0Q (000C00Ѝ 0$ 0 0$ P@  13/P lV 0 'P]\A-@Px`K@pPEP?E804P"8%< 40R:ALUp@-@Px`KH0,PU< 40R*p@Kp@-@Px`K0Pp@KA-`@xPpK? 00+0`@`PPPEP0pE8AK//\00S /@-X <!t  L  R0S p@-PnK@KpMO-PP@4M?p4ЍO/lR` pR cR sR SR0 RS 0S# 0,0,pW4/X0Z0l $ $00 0000000L0 0H00<0 0 4/4Ѝ0`t(X4/X L4/<0D0804 ,4/P0,0@$4/4/0 0-4/X 0S 4/t 0S 4/ l0S 4/d0SH4/V4/W P` 0FNQ  0 `$0P ZP4/ 0@4/4/Y 4/̀QȐȠU{  4/`p0W:P4/ r 0 4/p` 4/eX_X_X_X_X_X_Y_FY_zY_Y_Y_Y_Y_ Z_]I^+Z_MZ_qZ_Z_Z_Z_Z_Z_p@-P` 0@Tp @A-PxpYJ`V  `V`V@J @P`  @P` @P`A-8p C  1@0@/Q Qq QaUB  JU # 3Q R.Zp W 0S8U: 0 S00R0S0&W8 p0 @CT20S(U* 0 @DS00R0ST `x4Yw7   xP0 JZ 00,    Q  [ p B[ RU  KR  Q R|[X} U mp0@  00`w0%G P0JD*0J&``  00``0@ "8`; `7 0`01@ ,G000 0i0SQ000IB 0C0  J R(0S0P103/LЍ  pQ   j[puX  R%U  /o"QQ 0P RP P E  ,0,0KG  0 00 ,0  ,0W0  0 0pGZp0  0 0J W  Tp  @D ]Z_]-0@-M P0$@ @ @800S @ @Ѝ0@Ѝ/M-@-T031[  1 0S 00 00 ЍЍ/-@-T031[  1 0S 00 00 ЍЍ/-@-0 000Ѝ Ѝ/s@-P@`J0 `{Ѝp@I-@-   Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/ -@-  ЍЍ/ @-00S@Y@-@P`00 `*TU 0P0F%07Ѝp -@- 00 ЍЍ/G-PP`M <u!1 @P >h`Ѝ c00 U00S`C 0S. z,@T@p T @@⹕ 0R#T d  R  /A!b CQ00 0@!@ x @T 0 0 `ЍG ?@1c  p U 0 O^gfffZ_@-m@ @@ 0 4 00"  |@cY ] s@-@Q@U-?@-@PH0 @ @ @u800S @ @k;7Ѝ0@ Ѝ/M0Q   Z_Z_@-`@P 0 PK000S   A ЍpM-?@-@P@P 0  000+Ѝ0@ Ѝ/ 0S GP P@@-0`Mp@  P}0 Ѝ0-@-0 000 ЍЍ/-@-@M0 4 0 000 Ѝ@ Ѝ/኿^@-P`|10S A3S  lPT !g#T212@00@00A0S<$10SA0 00S 0 0Q00o0 Z#p0 Pa 0 pp0 [0S `0` 0Q01h]P.0 `toYYMxMa08[_Y»^]I^[_-@-`00/s@-@P` T 0 ,@J0 `IЍp@2^-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/@-@x0P0`ppT 0 H@ 0 ` $00S Ѝ@ Ѝ2^Y-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/d008S/s@-@P`T 0 ,@0 `Ѝp@2^-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/A-0@0`p ppPW0T00 0 \@~0 Hy0 xH0SЍA?Ѝ2Y^@[_-@-  ЍЍ/-@-00, Ѝ Ѝ/-@-   Ѝ Ѝ/@-0@0Pp` ``T 0 H@/0 p.$00S Ѝ@ Ѝ2^Y-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/ 0SA-aS_@7X@@(p@01 010101/A-a(P!R Ap@1!#880Ro1@$1 q0$12020A?@-`Rq' _@?T (0  !R@D!!!R Ѝ@@A@@ *P ?? Ѝ0 002P ?Bp00S/@-`0`@0S@0D 0 @0D ?@0D 0 @0D @?Y<B|0P-  !T LD.!      /Hzhzlzl 0CS@-T0 !< 04 ,   !/Z[_Hzhzlz@-P 0Pp@-R3 0P@N3OoPBp$0 0!0 00 /Hzhzlz@-<0DT 0 !0  !0@- ! 0 !p@-@P` 0S@ p R0@@-@P00/p@-P`@\ >0Pp@-@'> @00/A-@Pp` U00$0@p#0 ^AA-P@`wp >0S00  0S00 Dx0SAA-@PpY` 00@000#0 (A[A-0P@`xpx00Q ` 0 * 0S0ЍA> {>[00@-[_G-@R`pp> 0SP!R PPK Q PQ ` AP0 00 0q+>P舧Tp@-@P=0S` p@>0U* `V 0a@-@@ =p@-`P=@Tp00=`0S   0S=p@ p`p@-@`P=@T 0S@A @=pP/0S /O-p`P=0S R 1 ЍO==n=@X:= 10@]=@T R A==  ЍO R !  R   t=r=T  Ѝ[_@- M@  0 R0 00CS0 R=9 = 0 Ѝ@- 0 ?A3c 0ЍMb@- M@ ʏ0 0S 0  AQ0S00  00 Ѝʚ;@- M@ ၏0 0S 0  AQ0S00  00 Ѝʚ;p@-P@P@_p@-M pP@V0 `\0`^Z\k` 0 R S Q 0 Ѝ\ 0S AQ0 0S00  00iʚ;A-qP M3 Bh<T t13AT \<@ ЍH@U<000 ^<<0 000@0 0@P! /00B! 0㨀!!3Ba+<T +Pa<p@I^Z0pU000 00 0DH0 1,0,Z/H`P H p W P0ST  0 00E010404000``G0 0000Q H }d$000 D `P $01 ( (pE0808000u NPpp0 %P V00 `H9PJ0H  j1 00Z0F0 LL  2c0 0 0G0 1 0<0<00 0 $0 J0 0 0!% Dd P$ 0 `PEPQ 0@0@00 0O-PpTM0 <00 0<@P  0000` `  0  P@TЍ00040400C0D R 0$0$01 @ !( ( , , !  1t0@ kJg00010 BD <     0 0! 080800C0D: @`p@-@Qp0P @lA-`p$Px0VP`P@p `FP$@0,v0 H4]<0P / C/p@-@`0,F&p@$X0S 0 0X 0T00T0/ R0d0 /0@-@PN T!^! ^: Cb CT A, bCC^:N^:00 00O-P`@qX@0WG HT T0S(7 AQ5 Ѝ1&Z 0 0 0 T T00CT0030#T03S 60@S 0  @@00060 0S 0 @0@S 0  0S   0 xH[@[D[ A-P1,a@6c0-V`6P0SqpW P0P0S   0 F0QPw0P c6A 0 @[0P S3 #81S41@2s2@s1@S@// @-1001!dP d 0p@-@P36p@n6T0SiG-@'6QqX 0SQp Z6lHT0S1(0S @N6@1(6T^H BQ   XQ X0 T0 0T000 0 65 `6 5VT0S 01X0S 0 0X` 0T00T0/@[ @\|>p@-P`GT0ST X0S   0 T00CT0puP  0 up[_A-pP`@P PP 0p`1010p`0d00@d@0S0d@"101A- 1@0C 10P0C00S   0 01Q 1S 0S   0 0 00 00Q 1S0S   0  0000000pP0S 1S0`V10C1j@ P0\A/\A@ @-00p04 R0* 40 \@ @ 0 0S00 10 1ЍO-P`41,@TtAB5  ЍO聘000P3P#00PS\0P0$Aa0Xp40 S 00CR %05萔耄[H쀄4 10C 100C00S   0 QY40[ H\ @[A-pP@`j4 XVA4!X0`FS0 X@ T0@0T0@-@0Q4$1$S(!(!(1$! 4@H\/O-P2TP Ѝ000 @ 00@- X( b0A*(P Ѝ @- X b0*P Ѝ-:$M: 00A 000   0$Ѝ7@-P@2 X0P4 R0* 40 Q Ѝ0@W0U -,^ :!!<  12X0 0( X 0 p@-@P2`Qp@21S$A-@pP`20 00@2ЍO-c,M@0pPW`$ 0)p B^2 Z2  U2400#C8."<`Yw#?NW4 `Ï2`8<000Td0a@PZ `h (2d0H0> T`X` 0匋P0PP0C1p@W U P!T0L0X0$ P0\0 \0q``a a,Q'1011410Q&3*`5WpF&8!U. P0`Pd PR0   0 PSD d0 $UP= =@,Ѝp\I  B(pz`1QES 0 @APx h00<  W0O< @@ Qr? P q`F pఃd0 cL1( @,0,@SI$1((0(11 @[b[_pTT[_H\L@-@`z0$MP00 00 0`0@pN0 00  0|0|`0@0p `0` (X00P0 `0@00 0x$Ѝ @[tTT[_NN[_ 0?[_-$M<840 ,(0 $Ѝ-$M<8ƌ40 ,(0 $ЍQ Q Q /1 !C//@-x\_00@-M00|0|@| 0x00c00PP  TTaゔ <ٔ80 0 Ѝ0@藔]@[T \_<]\_TX?,,00 C#' ,00/<0?00 Q0000$  B',#  /0?A-@PM` p00 0 0! 0?P W 0  \ \0P  XPP 0Ѝ$ 0  0 PF ?_DT»^p@-P@p0 P0A-@Pe0t0 3R 0SP` p!VU A0S0G-0P3x0@ 80p `V 00 0k0`03/V"00 0 0 t@-@G@Qs@-0PQ0 7 0@S /000`ЃЄJ 0S +0/X @Ѝp@,NTO-0Pp,0 `0@ `F`! P 0(0P@0 0 PP PUP@0?p@-P@/000PPp@//G-/P@p0S 00 `@/ 6// 0$ 0 0$  $0RPBB@-L@L03/@c/`0d 0 RS`0d D@/BBA-`pPK/@"^\Up `0 0 P0 @0 00ATh/D0 000  0BB 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz0@S@-E0 /O\_@-@q`PMU:,A0 ޸ . *0 @Ӹ @.D g g  g g0  00I0 0t0B00d0 0T00000<0JЍ蜂B_\_e\_Tv\_l\_N^~\_\_T\00S/QA-H@H@`PQ`.p"R0:A.[  ձ 0 03/@PF0X0>B  ,@< W10 PP@ @ЍZ P@pP  @P  OWP@ @Y X` `  @P Y  `W4UUUU U4UXU4U4U4U4U4U|UUUUU U0!, Q *" Q: @0 7@001 00100   @#000 S 0 00C 2 0 0 00 3/@P 0  "  00 0 0 3/@P 00 3/ @ @00 0 0t 3/@P 0 0 0 0< 0 3/ ,10 0 0 0 03/ 0@0 0 0 03/@O (0pS10 0᱑P@0+W@5 0 03/0 0 0 0 00 @ @?~f}f3{f@|f@-@YP p p@-@PL0P @ 003/@p@-@M P Ѝp@-`@-0P @ 040S-@  3/@p@-$M@P @, 00`V-@% 0 10 !0S! S S@ 1 000 00p q 0 006/@$Ѝ0A-@PP @ 08Q-@ b00 0`01/@Ѝ@-0@0! Ѝ@-@  pP0000Ѝ7@-@P  pP IP Ѝ0@-"0`p SB@ pP P`0 @  G-@`p W T0#03V0SlP (0S0P =p(0SV @ 1!H  @@. PU @NP-dM"h0 (00@#0 00 ,8dЍ\ UA-0P`p@0 TЍ@- #᢯0@-ᛯG-P1p SB@>(21X`1U @ T 1P Ѝ@-050b ЍO-`0x#MPܰ" 0$0P @Ѝ(0SP (0S00SS @@S V X_ @T    Ap0 0p$ %?\0?4H0PX``Pd0pA 0 00! "?,0?P (`0P40p@P  0 00!P pMATX X  &@P 0 00000 00 -P@|  @u0  @P @k0  @P,P ([1 01  010 0PPQ`v0 @ @l iT\ UEp@-0PS@`M  vP0 Ѝp0000 O-14M`P@X0`0CS*qP  (0SX\00X0 00 ` ;X 4Ѝ#  0$[ #0 #]O-0p IR@4M, [P   @P!@T  @P @  @0` @P "@ 4Ѝ?@-@w#p0t 0 0x0 @#p@-d0@P &r"0@3@#pZ#&r"0@3@##p@-d0@P h0l (00@@, p@#h0l (0, 0@@w#p@-l0@QP 1CQ 1CQ p&#h0l 00010]#p00f@p@-d0@P0S S p80`h0pP#A#p0@`]]p@-@d0P"@p@.#p@-@d0P"p@"#p@-P@PM K@"pp@-@P` "&'00F= 00'`P000@0JM "pp@-P@"A` h0l 0H0@`P &r0`1:0@4"pG-0SP'@  pዩPP srF q"h0l Y^:0 h0l 6u$A""ЍX#x0S `"P000p0t 0 p0t p0t `0Sp0x0 t S PP #`PA-0SP-@ ` "phl 0 y0S 0Q h0lt e$@E"  PX!x0S P7"Ѝp0t 0 p0t mp0t P0Sp0x0 t S PP #PG-50S`5 P`P-00p 0 0(00 0 @ !&x #S@Q00y0hl`t%+  @(0300Ѝ]\_]_0 0R0,00 0 0/6s@-P`00@t  VPЍpp@-P@H`k!U88cP@P PP@ @!pCCCs@-@`00P E+PЍpQ@-@ щ@ [@-@hP@oЍ0P :0Q:///0/P$ Qp@-$PP $@*!p@! !0/P$ Qp@-$Pp@?!P $@*9!6!C-@`00PUH@ =P ( ЍC"!귍0S 0S00!T5 0` 840S$p! (PU  * P&   ^@ ЍCx E|P ЍCCCA-P0`!Qp# `!0   jPP   PP0S ,Ѝ@@P! P0 0$pPW  0S 804P(Px,0R 0SddT0`0 pP4` 0S Gy P]_CCCG-SPM@gM PP#@D V x0S@P:0  00 0 , R0 0300`  f@P (,dH4@L@$ P  ' #@P ,Q(PЍ(,0( 4<08@ 80,0 (@P$H0Sx 40Su UVw JPP0  RS< QQ: 2  d+& &bR0@p 0S4#,S  @P @PP `10࣋#h0S00 0 ⡥@Pa Y 1p+U*UL+UT+U`+U $0⇥@PR$ 0RUp 00 0p[7 *k"*A 0 BQ+U+U+U+U+U 0  ! 0C?o2S 0S0S000  p S00S00S  pP BpN@A%]_0@- 0@SP$M  iP 0 P     $Ѝ0 0 R  //p@-`Q0Q@0  Pp00p 0@-@ 0P  DP >ЍC-@$MP P 1` z?0 0?.$ЍP`p崀P`0S X *1` z?0 0x?V 嫤PPP_X V  6]_@Bv]_@-P04Mp3     1U`00@ P P$ (0"L 0 @ 0H4/@P R tT00#T0S@D0PE0S 0 @VP0P4ЍF@-P@`P 0 Ѝp0 ` O-R@|M PP 0 @|ЍY 0,Q@! 0000 1/@P0qlX X@0` I@P V $ 8 `0P!,0#(0!0 0 X/(0S8(0 0 0 @ 04/@P( 0S tT00#T0S@0X0C 0 R   @[V (( R LP0HVP ʾ @F0@-0 0Y ЍC-4MP 000 0 P$03Up1@00(03`T 0 @ 0P4/@P 0S tT00#T0S@  T  0h:3 LPt 0PED00S 0 @UX0P4ЍӀF@-P@`P 0 Ѝp0 ` O-R|M@ PP 0 @|ЍY 0,Q@ 0000 1/@P0qlX X@"`  ;@P V 8 `0㔱,03100000(0X>d0SG(0 0 0 @ 04/@P (0 R tT00#T0S@  T  03 IL (0X0B 0 R  @>UĽ (( R LP0+UP ᭽ Ǥ@FӀ0@-0 0I ЍO-1M@`0%P 0 @Pf#΅"^0@@A-QPp Q! Q`+"p`@2` R`   Q`02@20C-Pp`2  Ѝ S @ R0P0@A\0 00](0  #8j 0R P A-`PpN S@"@Q  0" R0Q@D0 00k] 0@  "jmЍG-XP5P` ph @ W᧝ 0 PP!i2 026PP 0 ( T @   00ЍGY 3D]L]G-` R P0S0R@9@ 0+j@P)V  U @$P 0p Y@P!P`@ P0 Z@ ᚌpW O-0TM00SFUPFUJUdJUxFU 0@P#@TЍ0 0@P0 0@P003 @@3 1P00`@p$PSpW$0X3X$p^s៹᛹PYZ43Yb4P0U0,0) U 1 #$, ,0@PU00P00S W 1 !, ,0@ U00P00S V 1, @]ZTpp 04p|0$00P x``p0p$pP m``  No R<  <  FEo P T R , (⋹( $ , 0 0@P00 0$0000u  !o R<  <  Fo P T R , (^( $ , 0 0@P00 0$00NlP@hP 0 03/@NT@>P@N@`rlrĀ]_ B @-00S/A-@P`p |^00P0000 0n?@r?v_` A-@Pp:A` $0SH0( `@ $ 0R`0P cp@-P80@T ,PpAD0O-"LM@!2Pp`0 < 00p0,`(P$@ @@ @<D@[a10< 0D0<0p,`(P$@ @@ @PGaD0SU '`Q`1 P0D 0<,p(`$@@ @2a0 010D 0<,p(`$@@ @!a0 000D 0<,p(`$@@ @a 0 000D 0<,p(`$@@ @`d0P00<,p(`$@ P@ @D `LЍ ^_ ^_^_ ^_,^_;^_I^_ Q· 0 {DDp@-@PBoPPUP 㭷(PRp@z㟷 R00 A-d0@3`q@00CS0 y<(PRqU A-@p p0` PP gЍ@POP0 PP 0^PP A? P1S!!1! pW020IG ( P #!Wm@Dp@-@PM TP0XPP+@@@` V& WP0@0@ @@@0  tP|0 @T@W PPPL0Ѝp80@0a]DW^_0?DDJUw_lzp@-@P`h0P ( R ; pU  @y@p@-pPPM @P Ѝ @P0S00C>S@0`S 0S@ xⵝ100@-@M P P ⠝u Ѝ0@-PM @P p@P0`S  ~0000NQ  @ЍO-@$M 0HpB0` PP 9PP<@"3 P@P   (  , ^ !$ R W  RR R0R Pz@ @80j/ 0S(A P? 0W`0" 1 00 0 100(+嬡@`pP= @  P $⎜D1 00? 0@0 4<00000 P  Py0 00 pJL0 T# $Ѝ0S@|P^voe`rτn0X@Sk/1!pg@@PFV0ꨂ]_^_h^_o D@D0p@-P @`M P  qPAЍp/O-M p8`bPP @nd 0 S/ '(PЍ"V   0 PP  `0 20o0P"  P#PPPT R|ЍӀp@-@aP1S =@T 0S 0QU00001501 0S BpB&PPO-03pPW@`ᄠTu 8P 0 S E @ 0SPP02P0D]C-p`$MRP0P P0CP0 4P0%@ RP0 0  0@P $Ѝx0x F0 ` BFp@ #P U<@ Ꮨ@U  eD]t^_@-`PV  @P  ` 0S  @QЍp i@P 0 \C-T;M0 0H S@#* paVPuP @P U kЍ6@A-p@WqY0P @P ?T0003a @P 6@@;$q$Q%W@+@-0P@3UQa PP Ѝp$Q  &g  0R # k@-0S@P (ЍG-pW@ PP F0`0Spl ]@P0S p@/p@-@1P 0cޗ iڗ$ Q$180pep@-`R" 0P1S 0@S W JP pP0   00p2 p////// B 0@Ps //Q 0S P 40 P0@1S///pzA-@ t03@`P < |0S 0 R0`h d0P0U TpH* 0AD20Q00C0 R0 Q<ӀрpzG-0@`p @M(0 0 <0a0,$@ @@ @P<@%Y<0S% 0 00< 00a000'>,0(0$@ @YX00P000a0,0($@ @ @< X@Ѝ{^_pz0oU^_4nU _C-M@p W ̯0 P3z `㬀嬐0 V: T` V 1@`宯VЍ0`1S 0 + e^_0BRUbPEQᆢBDU"XOW[YgP @Pa X g )0Pe Z  00XWYPELD  0P P 0  0P P  0P P   0PT P   0PrT P   0PdT P  sW < 0PY 7  0P0 01 0 100/oX" R0  0/oW" R  0/oY" R_  ᕰ 0X /  +l]p@-P@U`0M  kPPP  bP P 000Ѝp@-@PP4M  LP0D S# *a/b(0 0 004Ѝ@BO-p0EM31, 0 ? S @3%:a V PP @P81 00HA@P @ U Eߍ]@-0s0 H ϠNl/ / ( 0C00 ЍMb@Bp@-P@U`(M  PP P  P0(ЍpE/08!PR/p@-SP@HatP@10D1@A `0p 0 p8:O-0@SP 0S 0`&Q X280SP81X0S K>S`0@ 0 B0p $ 000!   #88 !#4< !#2> !#1?  B pBw 0b8s!%&00   0  ?VU@ ЍXU  0 L0Z#  P21p ppp pp \ 0R 081<10<1    (PB(    ЍO P `~HDt]A-`唀p?`@T|@0C0éP@PEP= 0 F0 f021@& 0@@AHD0?@-@( u@?p@-@>0Sp 0PK R @1S@  0S00p@y@-0M?SV1``0@SP T;8)pP c@ S @Ѝ$p嵵W00SZ@@D@ J@ @@0p 00Z@P@T p5@2T0t T T0 d0 Ѝ@60@Ӏp@-@xMP` x ` 7P0 xЍpp@-P@xM`x ׏001`0 0R0$ txЍp@-n@PqeM  ᾏ N4 eߍ0p@-MaP. @P 0@  ^4@T@ލpO-p0A$M>SHL0&0R00`A 0 0S9 S7 ZZ 1SL0  3 [( L0  3Z P[0Q30S x3 8[0t0[0sQZ Z[1S 'W4P0S 31@0r 4 " y 0     X P   P L  `Q((L Q`Q''L pHp Hᢲ"!    Q QpR RGE 00000 0 0 00 2XP1 01 1007[0b ZZ[Y 10SuTW4P  ᱎ2 0200V000aP0S  2$ЍP101 1R 0  02P `P0 4P0 nPZ[|z^_@Ӏ<]Ԁ0@-P@P1o @ϡ@p@-P@`u 0SP S00C00 xP|PU x0sP 0C0Pp?U p0PS ʀ000h0S x0UP@-A0O-@`P |+1Q>C/1C  Pp@X1QE 1CQ [?0Q Pp@u0S1::8C81Ppf0 S10011000000S0S: R :SP0C BS000;KMP s@s@~f s@-@X0 0 0h0@|Xp@-d0dP@ 0\@,0(@@T@pjX\@,`(@@T@gXp@-0PQpl0@Q `0QTX\0S0010PX R0*GX0\0pp~fTf@p@-PU @d0`(0p`h02Xp 1Xpp]p@-@d0P$Xpp@"Xp@-P@PXc[z[h⚳pqpA-@Pp 5X\00tp00@`0W00F= 00'`PP嚭坭 @-0 @0 hHp$@A\  \ R/ C-0SP)@ `W耟 hp\ 0R$S$Y#P0S0 0 0 @0 P0S00 S PPW ЍP S WWP\0 xPW  ᮄP@p@-A@ PW\0S`V0p@4vWpO-50S8QpP Q1 ⩽@P)00夰 0 0(0 峠`hҲp6PIWWKK0 bZDW%+  `H,03J00 Ѝ@]^_0p@-@PP D0R p`Wp[W߻p p]@- M0@ P 嘷 ЍO-P4M`UXpPP ڻP  81R ᫻ 4Ѝ@VW +[8H0L 0P0S XX0 S'OH0 L0 H0P L RP 0 H0LP .Zp 0\0X0SPP0POVcXO]ɚ;6e@-@LM`p P P0U(P~?oU20S   LЍ B 0  @o/p@-dPp@dt| 00C/(0, | 1R@0@@1B @@VpzQQ 00 Q10C2q0Cq0CQ0C0C3+C? R0//p@-@ Pp`8p@rzp@-@ Pp`+p@ezO-M0(0P`p` @耆\$ X $  Oo0pDBP@T$ЍOЍ-@-0 000̴Ѝ Ѝ/^ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzzz@- (Pzp@-@,P080(p@zs@-Pn10@T HP4(Ѝp@ D^PЍpzzA-<1P@4"000000D1h1P[PYP UD!  _0`a00h W!F0000Ϭ00000UL!000000D12 !_0 ? R2ꨴUUUUUUU U D P 0!00 hP  U  _?0ShPS0C°0,`0(@$ <08 ADЍz__U@UI&___`_>_ `_`_ƈ_ȯU`_- B 1011 S!1 0 !q 0$.zp@-@PXc0U00 00@1B  pPz@-@$0  (@薪p@-@P LQ 8Q  _? = 0>;0p0<0崂|Q hn$p@p@-@P  cc/0000`0001S 03V (pZz_ӀzA-P`p0| @@ @@1B  lAT 4/0 #P@P zp@-@0P#PP@ m pX?z@- @$^zG-Da@ Q8# 0 4 0 T 4 T ( ,8q X( ,:T% U' . 8 < 8 $ < $  @ !    0P @14 0 LS0000 ?X#!D1  L0S81  UP hP000@1 t1S 3/P0000  P   +) 9R0\0[S < SEK1 C/oS" R 0Sw rX <0SP@4ePR? V1 C/oS" R   ^KH090KW1 S S R D15 q0L s `D15D1G!S3  U@n P; P1 C/oS" RQ1 S S R VBP1 S S  b0 :  8T!U1R3R1 C/oS" R Vv  & U1 C/oS" R 0<0߀T1PSPSPUT1 C/oS" R D15D10<0 U  P,M1 S S R# _ 0 R P /  *Q 000S0>;9 H L1 C/oS" RP N1CoSQ/ q P P ph p0a P P lyp0Q P P V  "@ Z1 S S R :L 00 S   | 1R0&,`( dP"YE U_ H1S I1S J1S+ ) U' 0 08L*0  :/0H1PC_oSRPU  P PEUP#U PE0 S = zT]p@-@AK `P C@}pz@-D1 M2D10@9000 00B P090 Ѝ@-D1@ D1L 0X1SY1SG-@LAP` p VW 0 Q(P6@QBYP1PVW) ``&@1B  U!!|0R W PP Q yV t| 1RWP 0@1B  $PW 0zp@-@pP ?P,00(@@p0?P(,00@@zO-0DM S @0 P`#48@3 @(00yD 91 Q/[ , S) \4iP[01 0S,pDЍR ^"J3KpW`<0}Yq00WX03QHp=0K Pp # d/ bQ8!  TP h P  @! t!R 2/P   B"Q8 SQY0B@0T 0R2 @A0.@!B +@) D p Q B("008  R(00C?2cO 0@CdB$@GSYL0S800ڄ0)T0S 0  |#pR 0]pTX!R#W W#W[ BfSQQP 0 S W] 0pPX?0H SQ00Q00SH uptlW>Q; 0S  R5 HQ IQ JQ  R(`!`zӀX?gfffQMbO-M|>@QP`q P\>Q 4P>0S%D>Q 8>U9 ,>U1, Ny.23i 3!1P T=U Y-23=QЍOG=0S=Q%>C0CQ X=Udl=U0 YGL=Q Kk0CQ=0CQ(=0S =U& =U2<U<0 S| MP 0 :/zh| 8P 0  9/TX<Q P<U 000<Qw $<Qs <U4 <UQ Y_ @P]  x T;0SV[ ] SZ 1 0SV [0S kPN \ a m D Y8;ZP5 Ѝo ;Uq0CU::U< LQ0CU' ? 0CU %40cSr\:*0#Vl:Ut 0CUPuG p &1 0Rd[0a PP? SUhUhUhUUhU4UhUhU8U:0SUUhUDUhUhUhUU9U908p 0;9U 0CU 0U %40cS KS V0CSt9U l90SX9UG 0CU1 @9 I0CU00 C0U %40cScU 8U  0U0{0p8UEPP[ 0Sq l00 3/ 03/P\  8/ =@8U 7UL@ 0"P  ! R[   Q!0(03/G7UD >0UR >C0CU, %40cS vS<70Sl70S PP7UK p0p p1S 3/P HX30S00004* e!|000| 0C0;PUPP 8v80 0R01 ST 0H0HS7^PP' 0D 80< 0P啝@dP ^!!$ğ$D^Z @Y 00\T 0< s0S ! S f[0 0S00c01 0R[0 0S00L1 0S[  $0@19@1e|00@1$0\1(0S`1 x{3U D1"    2D1 0R810<1D1  0;; 0D!"0D1 vi0 8P # D12D1o Pk\40D!  %<D!0 %0<0zD10S 0RS P100100@[00[0@NP x;9PP0S ! S,[0) UUX ePP 1 0RPPQ v0  [Pb 0S ЍO7j&ЍOe& Retrtht@|ft,@z0^t tBt @utt€`_Ȁ%`_tCt gtӀX?f@t nt ot st@jt@wt@HtH~ft,_zt _p@-P@qU0  @  @1B  !0p00PzH/H!/81 , p@-U1@ S S R 0\ <0 BvP 03/pT1 S S R 0<0l1S (l13/Z#/#pz/p@-P,0@TpsP @؂/@-@PD0@PP  80P  R 00 0*z܂p@-PPL0@T 0S 408 CTT 00 0p@z؂@-@P($08 TT 00C 0@z܂A-@2qP/pPP` sPa00|0p @R 0PQ 00400S  R  0?z]؂@-$PP ܂/`_K`_@-@XkT08 CTT 0S 00S   z/܂ 8080 1l1S 0 0//L 8080 1l1S 040//L 0 601/Lp@-PX X0X` 601@0003/ 000lQEpLzA-pt`P@@@ @L0 @  ARSD1 WH"@@@S@P0/@(0, P00Cz0 /@-P0 @"6 0<  $0000P0@Lp@-0 PQ"6 0 A X0 0 X0p 0` X0 0$_0p$Wp@LO-0lMS 2P"0 & q`v될@@, 0 XY 0X0 o@P@  ,Q,#NmplЍ YY 0PY0 lЍOo| R  @ X>  @P z u o@/T0@@ @phdRd #e@P\ *p@T 0@ ?o 2R0S@@#@@LzO-@`2P"0|M & tr< 000 0 @  c L Rh00+  0Su 0X#00l ,TdRd #AQ@!@1 oPi @``Q` @P R LP8p UX<`D!L"$ L\ "P R ( ( 2/@T R R TdR`1d`# oP@hh @0``D  ݝYn 000 |ЍLzG-`!1  60Qp?A@0 @ |Q   XP YQ Y.S  aY SQ@@@@ @S @ Q YQ 0@L  Q S 0 T @\QD  @Lzp@-@p p0 601 R R p@ Ph p04 p 0PL]z]p@-@ Pp`0sp@zp@-@ Pp`fp@zA-p`tP @@" |0S  @ X R@ Y@T /(0,  XP YQ 0 (0, @7@Wz@-p0Q0A T 0SlAOoB@ 8NT 0SlAOoB@ LzA-q`0S3@Thh姤0VT@ PQs0$0TS@\f R P!yq0@@I R01S`J@0Pl01S T-X`10AL`_X_zA-@0` F@PP x0x0q@l1S XPH0@`l1̀0003/D1;D1PULzUQp@-4Pp@$0S@@pLz@-@ $T@ ։0zL,sr/p@-Pl0@"6 0\ \ au $8ǜ 0$00⿜p@LzA-\A0` F@pPP84Q0101@0@$l 1810<10D1K<@1=`1\1l1S000( p0 03/P @ 0彘P \[PЍ00   0PP0C0 FzL+p@-PP0 601P003/@@epLO-졟p3`!1 ر 60P@ @` 1 Q[  S%L0S> xq8L0SI@T @5l@T L0S8L` VP1 0S [ @ @P < t#@ X2@PT @l1S 0 03/@LX?zG-`$$ 4 6 0Q 4(,V@!0S 0 X0@0X0D1;D1pЍD1  0 X0@0X0D1;=pP `3R X3Vl 9>C1CV %83Vm 0 $p 07/pp{ 0 ppr0o 2 Rk0S Y`w2V, 1\0CVh||.t2V" 0CV 0LR 0 00($2V0CV 20S0S00 0R 0 py00u 0R 0 0P0E>SpD1Sh0 000|00D1  0 1V '1V 0CV X0@0X000S80 @  UQTQR+ X @0 X 0!p0V T00SRX @0  X L`tVft_t u wt@zpt tttut 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzp@-`@PVU VBMP0P0 0`p@-@P <P 0SB3000p@-@0SP  \P 00BS0Q3\000 0S00000CS000tpG-p@`V0SS00aI"U P PEVP n0 `F0C000S000p@-P`^Q@ V0@@DT @@D8p L@ CA\@ ^@\ A\ R\Π p@-@P%0S0000p@ S0C0LU0 Q BPE0 0U RR  p@-@`0 PSpS 0S嫟  P0000`P  BR1 " 0010 0000S000p`_O-`QM@p0 SB S0S5 000 0R4P 0PPC PE0UP 9m R A00N \ᡡ:50C010 `F000p0S000Vl8 P \ Ѝ@ ࡡ0030c00 [ `_0PPQ/@P - Q^00@S0\3z X0P/-0^  0CS0\3 zp@-@ RP 0 BS 0 \0C0P 0CS0Q3\R  pp@-@PDpp4031[  10 P /-[  \ @- @ [0  P p Q  Q\1P!  S[ @ [ @ @~@@at Ӏp@-`d0@31[  10 PU 8K0 @'p@p@-`d0@31[  10 PU 8,0 ݔ@p@p@-0@1[  10 PU 0 3@p@O-@DMj p`\0@ <00  <0,(p$@ @@ @`P-*0 L 0  `<4,(p$@ @@ @-DЍz^`_7@-@00P<000U  Ѝ0@' Ѝ0@-@H$ $0S 4v 0 S   0 k zG-Pp堠堐 M @TZ |`  g  [: 0SiP$>eA  Ѝ@zX`_hr0S/(XlVA-tp@hP`V U0PD 0 p@ iP `Xz h000@-@AM,P jLA BgQ =g, Aߍ0/01 p@-L1@SP(0:0p,18`S 0,Q0Q:01 01z"PLaPU 0S 3/P 㿃 㼃0$L1\M/@-PAM@zU 0SAߍ@, c`P  Aߍ ``0pP` ㌃0PS 0S ぃ f0 L1S0Sp0LQ:03/PU`P ` ]$LO-MRQB 0$P|ߍO+Q0S 0 S0  pL\000 0k*T`P^* pߍ3@00T 00PS+ (0S(pW% 0 S!0 00S0 000$0p 0DP [030#Z0Ss 00S@0000S 0 0`023 -0Pi0 H 0L000P0@0T00XH 0P40@pD01 X00& 'QI x i0S QD   i ) @X ? 0"0 2" 2" 2" -0͙p_XEPU000 W A0 K =00Js 0( 0(P,.0( @(p,.0x0H0y001H010( ( ,.0( (00,.0( *(00,.0( (00,.p$8q0S02m)΀΀p@-D@(P|ByB0 Bp@0 Bz%V%Vp@-` P00P0T0@Tp@D0D}BP0SX@$0S 3/,PzdX?{p@-h T00T0\0@Tp@L0L 0?0c\BP0SX@ 0S 3/,PzdX?gfff0p@-X00@ X  $R|01X0S 3/P0ST0 R D 0 08 04 0c0p0S 3/,Pdz~~~~O-LMD@p`\" 0  t 0p,@(`$  @P*H" 0  0 4p0@,@(`$  @P*" 0   4p0,@(`$  @P*0! 00 0 4p,@(`$  @P{* 0!hh1 0  0<8p40@,@(`$  e* 0!1 0  08p40,@(`$  Q* 0!00 0  0 8p4,@(`$  <*D0 S @tPt`tpU:T /LЍOP 0"S %@LЍ^{^`_`_$ V`^__{$P00 !XP/ P/ R/Xzd@-P R0CoS \,0P @-@P0^ R\ T \RP \,0/@-@P @0S @/@-@P <0S @/@-PL@-P@@P0ӗ/ ]Qp@-@!@3PPP@p0S @-卛 g8]`_p@-P@eP`  H0S p@/p@G-`0P @NP D0S G/PpU 1 !mPGPp@U 1 !T Y B BR !  mP @U1!W``@- @0P @p@-PP@p@ 60`S% S S  p@]S S60\ FS! S S |xS S p@0P L\ 1 p@ p@ p@Z_a_7a_ a_Ra_a_(a_/a_»^A-`p@0@TP0SX@0S 3/,PdA-PQpT0@T0 R X@`0S0S  3/,`d,0(0 0#1P! P #/t>,,0@ S /@-$0 @PЍ\G-MⰠ P`p ` @kf0P00SS-ЍS000 000000@J$?o2P0SQ $0S S S h 0QQP<0H 坓80(0唓$00,?X|F](?$?C-釟M|@P` pep0p $  0` f2 020202HX00#ߍX|/Vp@-1@SHPL0S0L0 NHHL_P UpH@0100p@ r P(@- @a0O-rMP`@0 ``(`0 0`S`F 80000U V0  ( R(PE0Sv80 0pfW &R Y < Q<&0G 3SL <P 0F 3SH0L RP \0 = >R 3SH L0S P0\ 0  0CS fW< < 0CSSp10U 1 !j`0 P H00 < 0CSH L0S,00 BW 1U  1L`@rPp@ppWt 0q 3SH0L0SjU 0< pP7Ѝ<ppP U(0% =0S0%8000T   #RH L R!Y B/o" RY0@ 0C0pfV00 `g000 ; Y 1S  0 t 00IAQ00@0Wp!S  `000P`V PU @P@-P   Ѝ@-0000 ЍP/@-PPQp@-pp`P@Pp0 0` U P]Cb_@-@P@Ѝ@-  sP  Ѝ0bSG-@9p`PP2 0 i0 0  I,b0W`!V`! V `!0 _0pGI0000CS0000@TWW@yPX|O-PR``Ap0PPPM 0j@P 2 (`200V [ ?@P Q Ѝ00pJWp!fW\  W 1+#  $_ @PZP`F R[ 000R000 pX|A-0@S" `;(0 S8ʸS C< 0CPHPv]P (00 A2(0000PP 0 06@ ^.pP `(P0PEU0 U + (0A0PEUpP `$P/0S/p@- @PP ^pA-@pP$`V@PW0$000@$@p`0@-P@ 048900H000$00@O-M@0r000?` 0l hGQPp000D vVQ@%U -0SPpGW0pUv    0  P@ 0ЍS* v(`  B'(00C(0  B 0E 0S000 0 00HLWH0H00v p`F0Sp0P v B R ! 0 3SH L0SP0\ 00<0Cv S0!0  BR ! ]Sb_]fb_|b_@-L Ѝ@-F ЍO-P嗑 RP@  Ѝ0S@PETUT 0S     @ QHLQYUP`C !ZP 00YPZ0 P 0 0SP_pJ^  \ RU [ #RHL RP \  $ #RH L0S0P 0 , B!R \  0 I0000H  0CS  B00Q 0    \  B PPZ0 1AP? ` \00C0 00 000<00q]^G-0P 子p@P: 3  0 0  000HLnVH0H0`夀V\xPP P  0  0 00HLMVH0H0`d\r@]b_/-/-/-//-/-/-/@-@ZX-@-A-PUp1p!0@W`DS W c c|bPW(0G-`P00 00@pP) X01 0!00000P XI Y 0 000P Y J0S@FЍ-/-/-/-/-/-/-/-//A-@$`P Pą@ p00  q[XP  [W`P  [`G-4pPPP8 `@P 00 00 `Ph@ЍG-PP0 Sp`M 43Q0S Ѝ@50TW @ 00040"8P 0  0Sq20@T D@DT ዑp2W_ @\2W+ W^ $E8P$Ru2W0Tz 0Tw ` $F $"H00@$7/0p 20@ T 00C?o270 T:0 v;$00S H0 0 @T D@DT($1mT *@P$# 8 Og 0 0S0"7  $3@ 0S A >$9iiip@-@PPPU@` Z`Pp Bp@- P`8@<0P p@0PppPp@- pW0Pd00S P(0pDP<@~80 @i0]E~Fp@-P`0` 0@ 0AT 0S`0S @ 00 0pFEA-@Pp Y, 80R) 0 R) *`00<00@0 0$0t`|`p00S0x0 00P0:0"`P@@A-P@p0`,PVU  AVG-41p!,10RC*Q`= U PP<*P00 /R0S /WPPr@ (`Dr@ V|ʄ0PP 0,`8$0 Pa~<~@<7$S@P?Eb_@-@P r00@-@<7l< 0S \0LS   l,P 0dr℄@D\rEFp@- 0@0CS 0P Cupp@趍40,0S7p@-@P 0S 80 31R00 "pp@-P40@AT ,WPp@E@-0 00 0P Ѝ0A-0SPp` x@dTP脍P (0S W@ 00 0@PF0@- P,0@S uЍ@ʌpt 2Ѝ@-@ P$0 0\  Ѝs@-` @P$@P,0PS E@U (0SU 7Ѝp@茌X #!Q *@Ѝp0@07@- e@PP$0sT@ 0$0(0S n Ѝ0O-@PDM TP\DЍOlQ @A@AH1  (g @00B,ap0 !@(0 0 <00,p$@ @@ @A0 00< 000'>,0(p0$@@ @.0\00 P0< 0,(p$@@ @@PP DЍEF_Vw_~b_b__I_]p@-@P8p0 .@P pp0s@-`PP @=TPЍpPP` h0\S   @00C@0 0S"40040@FEA-p MaP 3/@Pq@P 0 (00 0<1R 0D@ Ѝ0 @P  4  P0Q" #Ȁ!0 r@BP 0 @0@ 0QPQTF 00 803/@P  P ]DRSPFFE@-00 0 Ѝh@@O-pP0$M 0*@P@P $Ѝ0 (00 01R 0 Ō@ L P03/@Pe `Q` ^VZ: UPH000 PP H   >P  勌@PP 0 0 0  `a #P *|0!0R: P@1P `0S1@01@00 P ]EF@- 0000 00[Ѝh@A-M` pgP&# Ѝ(0 ( W  R  0D@P  V #@(0 ⩁(0@P0C(0P$P @@$0 0@-@MP SP 0S 40 R 0#P<Ѝ0ɚ;0 <08 SD @R C0BP// 800C80@0~@-@ 0@x>O-ܐܠ`̰PUV |{0 00HP0\@P `N@@ p @@Dỡ\0嬤 $`<0 ,0_~U P~~\\|O-LMP0D0p0D 00RZ(Y`t    ""20x0x \20\2p0S@t0p@3080X00t004082 P x4S @t  $R 1DypwLЍ00 ?o2Y0S 9@00SL 40 S R08TC0PI@ZD Nt00001`7 DR   Y;4 10R0 D0p 3/0@S000Y1;ò10PD0Y[pYY T0P t0   z PayP00 R0S D0(0 D0S 0c 0`(0 0003 R80 R00S3Q. `# ,  , R& S 0!Spx 00 N@H0P$0  H0 `0 @P(6<00 $@ 0S@@ [fYu0o Ti h2 0{b W p00 .LK@C{0`H01`:0 @۟$06@0<0S,M0$ 0H`\p:XP#:0 P000L !4040T 00 0C0000 00C00 R0000C0 0SK (0p`D(00(0p*TY(`t0000 Y p{ [ p p0WpS@@T 0[00Sx  @@0 p04/'@(@#@ @p0ꐄ\~rVI0O-@`'~0t@! !@-@t t@ t P4:A-`TȀ@Upʀ 0! $ 0  , !|0 ,0:Fd0 0!!T0    !/Hzhzlz~@-0 @Q# ЍhQ:!<P, i` @%P 00@H 0TD@D0<0RH0~G-RpP`0<  ( 07`{ 0R<8 P0D @R, @ BPS@P P ߲PP 0L00H@40B300\00T0X00 W 00 aGX0ST0S@L@T@P=c_G-@R`1 0)K{TPP2  7GT@(0 0(0PQpXT0S@L@Tp0pWP0@ppQPp@T7Jc_A-@R0 {p0 S00 S<8`^D@P\N0L^0R0ST0S@L@T@P\c_A-`@PpTXUd 0000 0R'X 0S UQ 1QT0S0T0@1Q U? 0 @P@?0P00@pU. 0#! RQ  3SHL0SP0\00<0CR1Q0iF 00080 080L@A~xlc_@-@P L0T0p@-@QpT0PS@0L@T@0Q 0 00000 p@hQ/T RT 0 0SXp@-@QL0LPpS  Q QP0 R00S0T@@0Q 0 00000 p@.p@-PL@Q``UQV 80y`0S0C0000800C80Q 0S L`L0SP0  RpT0pPE0{*L`c_@-@@0S87@-@P1 < @#0D0 Ѝ0A-0Xp@P` U[<S !P  P71S010SP0 R0蘄p@-4$P 4`0?RL1S(@pP ,!80R 0,1010:01 010 `2@P 00000111010044P0P041418181@1@1D1D1H1H1喻00 P -00111100!1.01 0.000003/P %V 101~p@-L@Q0L00P0T0]PL0SO-(ppP U [  w@`(@P U U )PP  H@L BÌ\PTX0"( 000P `D G[D]c_@-P `@P   DЍp7@-P@000T Ѝ0`00@0s@-X,`0 ( P@\  o0@00U Ѝpo@-vP0P@-mP/ R/@- @@ᬺ@~@-X0@P0X0 ЍQ#P,p@` >o000S X0 Ao0P00V U X0, 0X0ps@-P`Q Mo0@00V pЍp-o 00S/WFй7@-@00Pቹ000U  Ѝ0@R Ѝ00BSp@-P@`rPP  $0S0$S0ĕ`pc_p@- 0PS`(M  r@P- (Ѝp0  gx@P0rV" 0;;0@P R 0  R ! s@P  s@ 0 S@ R  r@P Swp@-M0000`P @P y00Ѝp@-Pp`%x@P @w Ѝ0@-AMP@ fP Aߍ0s@-P`x@P @wЍpO-pM`P8< wP (0S qw&@Ѝ x@P fw 00PY 00 t 0} !4* S  #@i,t@Pb!401  504DT04S0S 0 P\v0H(0=0@0  0$ 0 1 ::8C81@PgPTP I0000僸Yv3 QxvY ٴ|(.  (z3 *x-@v40 34x@@ @__]@-Pp`P Aߍ0G-L1p30Ma0$000P 0 {@P/$0 (00000 0 m@P*$0r,0 WP@ @T (q@P , qw( mw0Ѝ, |w ( vwG-Pp|UUpW @0 S0S``F``T@PvP u@O-`RZPP Ѝpİ@0 T    R R @ 0qP0p sUXp 0pGp@@JZpP c_O-tM  ᜀM 0X  aW RD R(@OZp R<@P  A0$ (\?<" REP 0 0 0$ 008A 4/ 0@0BPS 0^ pP  7U ! RdY@0p o@P 00W YtЍ0p  FJ 9VP Y P@#P U RYP00XP PU@ hQ @U H R   @YT @@c_FA-PM`pTu@P 400000 0(@tЍ7@-P=u@P z@rt Ѝ0p@-`PV M  V00 R0S@"  u@P0V 0@0  "  >o@P  t Ѝp "`]@-50S@,M[3221P0 a p 0@PF0 000$000u@P& (00(0 (00(0 1:11:1010 S;305<0@T $ u u $ eu au 00$00,Ѝs@-`Pt@P19@ 00003/@sЍps@-`Pit@P 00403/@sЍp@-pP) cP@  nPT@ 0 S05 \x oPV  o Ѝ0T@000c_0p@-M00000P0` @P #0@P PsP 'sލp@-p PP`IM  8n@P0 0000 0@P # 0@P PsP rIߍ@-pP/ cP@"   nP0S ЍT@  lR   oPV  o0S0T@00c_p@-0M@P` > 000 00 00 0 0`4,0000,PP #0PP 0Ѝp@-P4M`p m@P043,0$0 S0 0@P $0S  @P P 4Ѝ 0o@ P T z n@c_O-PPlM%  (km@PmB00S@h8(8xP- ( 80,00< (0 @, Q00(0D2 , 000 s@PF0DT?0` S;# p0 @ts0S@' 10@" H%m@P↲ :`0P @X0 S$0 00  H0P #0@?oV20S@ P hTV0`D@ IrlЍX0S- 0HL@P H0 Hd0m@P`0`0S 8E(,08< SP00@ S00S p $ H!@P P000ɚ;6ec_@-@0M 0P 0#܍@-@0M 0P 0#܍G- `VpP(  R0U@ݨPP 0L00 H@$ B# \PT0X0Y P mlpP 0BSa=V@ V p T0 R $R ÕPpx0311  U`XpV 0 0F0ER4000  R`c_c_O-MP 0 4qM Q6 Q(@AU` R. 4  0$0 8^4?o2Q0S7Q=@20SF BWP? U P<8@` k@P @0V UЍ@`00\J 00 0@P  RM[00 0 @P P0 Q00 04A004/0@P0 0* R tT00#T0S  T 0 0$; | hKU T00S 0@ 0HU0K@@c_FӀA-`MpP p@P 0 Y0 TЍ000! @p0-4M$0(0,00000 000 00 00  0 04Ѝp@-@(MP` kP3`$00 (ЍpO-DM`  p@P0P S;# p0 ts0S 0 P09p0U@DЍ j0Pⅲ! 8p0P ,0 <0k0PPc_-/-/-/p@-^. ` 00S0S0000 0 0 0h 0@@0 PP00@@0P !@100D1 0pp~O-P0㄰U`!R `VP R@ R R ppG'qZY08/037@-@00P000U  Ѝ0@ Ѝ00R0 0S  0Q :;] @- @-p@-@0`PVp@0 `傱Ṱp@~p@-@P0S 1`0D0D`HG`@0L0@0pp@-@P u P Z@PS@-@-p@-@TpP0P R  RpPp@ R   R4n Q  101pd_@-C-@MP%`` 0` P 1 p`00___ _`0S PЍ_`sC-0`S' 0S$0S P@1,  B0001,0 (00C  @0(00M  XЍpdnd_d_p@-P@e Pp00Fp@-@  000S0S P A-@pP`V ïp>Rp0S 0`V`x` 0S P 0S 0SD堯@eA0ۯ6P A~΀~@-@5p@-0@SP 0S%Q0S 0S PRP0v@Pp0S@`#00d mP p訄~d_@-@P,F80 S 08  @< @{΀~p@-@PpP3 0  p@m(0 S 000~p@-@P400C40W p@*m~p@-@`Pԯү 0 ` ʯFp@B1M/ @- ^  0S 0S00Pm))d_A-@`pPP 00S0pO-6o@P4mSc0S 0S 3 GdpWp倓pW[^Pd<0880ڮXᖮqH &gp[p0 Rq  o4Rl 8 Ri g( RcpW`  2Q[ X  R  @ 0  0 圮ᚮd 0 5 Y elK [ 0SXpБWQ{(帑X 0娑X  8   8  0 0      B 0 R Nd0S 0 0@000000?= lp0Wp. 00 (0S 00S 8 R4 S 0 0S  p6d_΀~X?~΀tV0S p@-0S pP@1` 0 屭 0S /O-PM0S@i@0%@e@`0@0  Mp 70_`PR 0,0X000`%^4&%@P <@T ,bPOO,0@@j@00@0(O@10@0$0 00D0, @0_@P O\ TK0 0$pbO@00@0Ѝ @O-pDM@0%@(@0@0P'ۢ ~70`P @ T0,00`]4$@P  ߢ @00@0DЍ0S&@!_@P`V#=@ 0R )@CO 001 0P @`0S $|$ 7$0$0@0@01`0D0K\HN\@0L0@0@0 DD7@00@0 `@P 00S p@0@ 0 { 0Sls/ 0O-DM!2P`p0'>`B` 0`,` 0 08p4($ P0 00!'> 0`,`0 08p4($ P0 00!'> ,`0  0 8p40P($ P 0!'>X ,` 0 08p40P($ P 0!1 ,` 0 04p0($ Pi0 00!0 ,`0 04p0($ PT ᆬ``$@Oa @0`@奘P (FjDЍ^~^Ad_Jd_Sd_8VYd_0@-00PSUP`- P!0 C  SJ,10SF @P0S S S  @0R00 @0R 0 0@0@ Ѝ @0R00p0S S S *@@0@ D@@00S @*@ꨄO-pM00CS@t#0a 0N P$@@I10 Rk $0Q0[0!0 pj@P 0$ [TUj(@T R P P Y0 00& ;)k0X) 1 0  l j  4  B4 6 i0 S$@> 8N 0  B4Ѝ@(@~P/ ,VO-@S4MP` 53100S 86 4Ѝ x5Rp0WWpG'10 000@585< 0 SpZP 4  4 0pp01Q+ 00. 0S*#j 0p1qp00S0[7 vEiP (0Si$O $  (3( 0,,J'0044偪$ 0 00h[ &   @0 L00T X 40000 H@ 0C00P\0 0 0SP 0S0S @ p  X@ @ @0 0@0 6P d" 03/@ >T  JP @0 ,00!0C00!, 0 (00  C@Y0 ( T < 1R0 S8X P 0S ==S 0S=9pP0!@0Wp  0?@0@0 ͧP  03/@ է0 4P7 10 10S n0S Sv{x(g9@?~rd_]fd_P P// R0@-@d [30  000R  0 /0@-cMPa/b@Pcߍ0R@-@ {b0S R0a/@-@30  R 0  /0@-R@cMPa/ cߍ0P1P0S Tcp@-@`P4PPu 1^P*^ps@-P` !@P @+KЍp00]00]s@-P`g@P0 @FgЍp@-KP00KA-@`p PZ@P <O 1^@]@-P` pR!@P0 @J Ѝ0@-00 Ѝ]0@-00 Ѝ]s@-P`3g@P @fЍpA-@`p\PO 1(^@|]T @@-P` p @P0 @rJ Ѝ0@-00 Ѝ]0@-00 Ѝ]s@-P`f@P @fЍpA-@p`7 P@Pi 1]@/@-P` p @P0 @J Ѝ0@-00 Ѝ]0@-00 Ѝ]s@-P`f@P @1fЍp0@4SQ@-e0/yd_ 0(~(00~`O-QM0 | @ЍЍO.Qe0R 0 0p hW01h0#0@T_WPUY b_P^PPE0Pb|P@T d2`SPLO0 @ [030#Z0S@x 23xPh  10 U0 0 00$00(0(0,0 0/00$04 /< 800/@000D H00L000 HP#%$%U  0&H & 'L ')(  ?aP幦U0S' 00S 0/ *m0  `PZH0 h00PR0 p00PJL0 x00PB0K000|@000Jsg#Pl~@GGG0P R0 z/G- P@ U `D`00@0$V0:Pp R 01S ጦ0 H0L 0 H0P0L T 0P0 T %R0XP5\p5`Pl0pd_d_~G0P @-P 8P/ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz/P 0%%#3/~| `0R 2"-D | 1# H LH RH P LR P Gp@-P`@TQGb00_Qh@b_000S<@@ @DD  S d MD F0SpP!p~d_d_x>@-P3 0~O-3#CDM  | xZ0S00   8 < 8P`cP$PP3 00@3 YPP PP00#3[003 PP PP00}[ pRԢ(Hg V""0&5a V00 S"0  0 ,OTVYpeYW0P<"[x 02`  2?>L0 ,00! ! (0 0 00`$ _@p'1少 01 00` 0,p(@$ @lI 0lQ!h1 00` 0,p(@$ P @y5 0E 0 0!1 00` 0,p(@$ @y!0E 0 0!0 0 00`,p(@$ @y DЍO%>0  d0W~GGd_x>d_,,d_e_( e_e_Ȅ@GWd_ĄWe_!e_(e_7e_Wd_  @-0PbW~Fe_000V-P @P\^\ l~p@-@IP0  ႤpYp@-``BBp ,ʠ,V P\ 0$000 0T00pT00T0p@U< W@-@P`}YHzY 0"00000 00 t00 0oe_we_!CeGG-p`DRDX($0 S*( [@P8 -000أp S R I0$ 0C#2 BS*p@TX@( 0`00Z2003 DB?,媣 ᧣00 0?P0` |@TX 0#0L0R    /Y@Y 00 000$0l0 PSp  p p0l U d%堣G~!p@-40P (a/[@P <UP00p~@-@X`@Xp@-@000pY05000  100;0j0)000 Q :00`P =>09#900S? ) 0R9ڜ  I S `P 40083/0` =V0 %c%'?Y 0S 1pp@|Q t  | x x |000900000 0S"Yw0p@ ZxS0000 |  @|    , 0C1p@XGpG~@Gp@-@P`ᓢMp@͢Gp@-@刢0  `<00 02H PU 0 0屢0p@/0 娢p@Xp@蟢e_p@-S  P8 土l0Sp p p0l O  @P  0!P ?x E4 PllpA d0ic1p0la!姟P00G~@-pM(pp@,`PP+ 0  0V060000T0#T20T20SrP V0 0 0 V0S PЍ0S P 0 0 0 rPrP@- (pP @ P@P $0 8<`P Ѝ`U0@0O-0Dp`8 P @ Pڞ븀4@<0Y@P@0  <`P Ѝ [P  10 Vᵞ@`0@0GA-P`pᣞ 09@P 0 p 0 0(90͞AEAŞG0/~202/@o/ 0R:****$///p@-@|Pb0 dS(0 1D 0 D00@0D0(0(01@  B@ P00P0p@脞H@-P`pAT 0S *.P A030#A(0000S  ЍA- P$`@ZV Z Q+ a  0R010 X` #0 S(0 1D 0 (00a@00C@00U *A7A 0R010 0A UHH@-@0Mdԝ`2S D!0,0D2N0, N 40  N 84N8< $N$ @<(,N,(D@04N40DH<  8N<8 HL$$@DND@$LP((HLNLH(PT,,PTNPTTT X 4'0 00000Ѝ@{HX?Hp@-]@(L "Pp@u PT0QP3Q/0@-@P|@0S0(@\DLP00L0P00CP0T00T00Q0HD?H20C22S/0@-PR@X0\M0 0S\Ѝ0` T0 XSX0# t0 0 P4/0O-p048 X001 0A S *0D!000@ Ѝ  0 0i "!W]0 0NP D!00000  `D!000$YX)00`V`W`V D!@000t @D!@000g ?`V D! 00 0D!@000Q80H@-900pЍO-0$ML0  82p 0S *("D!000,$Ѝ@ FH0]`V P z@ 1s Sz6 1sP` @N0S2  1 I00>0000@001 :#:0 1!rd 0N P U ! MD!(00(0P` 0~P@ U  8D!000$pW.D!000V UH0PpD!000HO-d2P 0$MS ao@pH0S< 1s@2*L@EN0S2  1 I00>00ġL001:#:0 1!c 0EN P D! @(00(0\$ЍA81T  !D!$00$0K2 @ *0.SY Y+0.S (0000S X 0 0CX:00k"@ *~% \>@^T X0 0000$ D! 00 0 HO-Mp80 0 0S:RP0b00T @ 0 Sܚ`0cV`V``FHZSWs R` $@ 0 80)0  *!% V |娚 P0(  0P0D00`0D0yDښT a_W 0 W9 .R6 .R3  ! `1 ЍO 0=0P0 Q L  L 00 L0`V*᠚ ;Y*=!R 01a@ЍHHD?G-`0 S@Pap2 /ZPp` Qq a}Gz0S 0 0 /1M0Ѝ//0S/9@- 00 Ѝ]@-0)  0?Ѝ]@- 0  Ѝ]@-@1;P 8;P 4;p@;$00S/p@-@P$$Pp@-@$0P@;,0 R P/20O-@Q1DM0 00 @@@GX1pTa 0 0 @@@G zfL0A@(0000p0<8 00 40p,@$@ @@ @0 0<08 <0,(p$@@ @\00'>0,(p$@ `@ @<08 DЍ@e_e_섀e_e_f_A-@P0S`Pp0S  ! ~JQPW\PQ 0L 0000 0C00S  ! `J8섀p@-@TpP`Pz 04R00 0 FJ00p@(Hp@-@`T H@ 0 StPz⿗0S 0R00 0 0 8000R 0P0@@pH@(p@-@P᜗00C0p@֗(O-`40@SPp0I  0SBQ  0RPCS 4 ! I$0 0S1zh1000 0PS+圗Hp `000000 00 00 00 A 000S 0 @ Ѝ R RQ 00 0R0008섀@(A-@p`PUddG0Pp `P00S 0 000$ 000 00P8섀A-@ `PY00pQ_U0S0 R\S  ! 0< 0C0 00C 00 0C0 0pAf_섀p@-@0PS`#00\ p0S0S 0S0 0S0/P: P/O-EM0@1 `Q1P$ @1100(0,0`V4`990S00,0V@,0S  C, /  C@ UK0@TK@0(S,0 0P 8U 88Eߍ880 =P@@p@@0, (p@W=0S K@T P`= I@Pp@11 00S  pI@P xK0(0 :@0 0D02< (H00L0z_P0 PLC1 X1V1000P @0 Ѝ 0    0 0A1'1 0@000 0S 0 6 APP) MU  6P CP@U 0 0  P10Pu0 7SP PUPPT  000 C 00 Tf_ H0R  R/R20R/20@-@~1@ z1@-@ s1 @  p@-PO@P 0+*P 0#pp@-P`>@P P 0+LPP@ pQ@-@@P 0U@-0@S 21y000p@-PPEUPp@"1PpO-M<00`$008, 0000 $0 @0C@00004P@ <0$@S x?0S 00@0<00 900000@T 0S 0   f?C0 P 00P 00001$@@qY 0 >00@ /Q 0S  @/0 0P 0S  @ 0 0T 0 P /0P /0圝00倵0S 0p- 0PP 0 pQ  01 P 1PRx 0 pRn j0 D@00 00 R000 0: 00 00 0 /R RH@D  0Dp@T0P 0 0000`0"P0     -: 0 000C0+  Q  000T0 `0P `PO0 00  ' RR T/ D ` H [aH0S R 0S 00 C0H DPMH00D000S 0S0*000 0S C0S ..00000050SM /P 0`0` R   W~ UeT噴`P .0`0 0 000` PH ` -[^ DP C Rf .      $0 R   000 000000$00$0 10 0K0S `00S`0SP0`  H/P`  R Q0  `P7/P 0P 0./T0Y\.DP` -[H <C00DH0D 3TP H.SO009   R C R C0 .0D00H0C0S 0C0A 000 00C 080S0S 000(07S0$0 S$ 3000 (0@ i>P @DP -- .L0 `00K&0Lp`t0P@dp@(0` k@@[ .px.,0S50S 1 40.,0/@ 0 P@R 0  {R P0X@}T }@' 0/T 0X k@/Th HP`40  [ */T P P 0 pX0S 0X0SM 0X0Sa 0X0S 0X0S 0X0S 0X0S 0X0S 0X0S' 0X0SC 0X0S] 0Xu0Sr Plc;Y:6/T0X @/T P  [:*/T lPP/@/T0X2 5@/T2 0kP* 3 0 S* 0/T P P200/@0XO0S    -0 0 S%:-?/@/Tj 0X @/T T1P D  [ */T( P P=/@/TT0X @/T P40 1  [ */TPP/@/T: 0X @/T pP `  [ */TD P P/@/T$ 0X @/T P0 0 S* 0/T P PX0l/@/T 0X 4@/T1 P)V  [ l*/TlPP/@T1g_F@$_Og_$_6g_$_xG|G$_><:7+L4+2+   R& 0CS#H%+000000sC0S +H+00000000S: 0CS_F++00 RH R=0C00D0@P *D@D00H00 0S $0 Ѝ H R /&@-(0M00    0 00  i@ Ѝ0@-0M(0000 000000000  M@ ЍA-0@P0MP?PX/PPPR`(p,0P0,004P 0`,0P:48 (P@p`$0^:PP2804 Q0C00 0,0ɀ,.Q .R: :9,0j*0 0PS 2=00U P `0P000@0Ѝ3*0S P +*P ,0 \+/ R0S ,0 0 -`P *VA- 00S : E0pP`900@   0S P )@00WP@.@P )eg_yg_0@- DMP ^@, 0^ 0^ ^P  LE 00 07U4PP00DЍ0@ ]g_A-P`p@P P 0 P0 A-P`p@P0 @Ѝ0 G-P`ሀ#p@0T00/ 0P0T)2)P @ ,PV  6/P 00S0P00P0#*P07@- 0PO @P  V>C Ѝ0g_p@-P```@ P@圆 @☆vH  ⒆ ⎆ 0!pI8 @-@a P\<0(H0IGEP @C"8p@-P_"@@ c"@p p@-PT"P@@@ R"@p @-@I"@A-P`P 00D묀p@T}00 0S0PPP@ 0S@u hV P@I8p@-@Q `P @ P00S PpQ  ` @V opp,p@-P`'@0 R000@00P0%@pp@-@%P 0Pڅ 0R 00/ 0P0p@'0A-`@VPQpὅ0000@@@VA pᬅ 0R 00/ UPO-`M@'$Pرء$009P{8@!OCAd@ 0|P p?oU20SR XPUPrN0 S   '* pW ,PÚ `9pP : 'WP#( !<8p :WX R0 R (P I%P ڔ  BR* ('W ЍX?gfff@-@A0 !!|0x0t0l000, !  ! 40 @PuAg_HzhzlzY7^[j_ 0 F80F80(G8p@-P`6 (0P0P0P@0`\XPP0`` ᯄ0 0@0DpI8A-Ppᚄ0`VԄ@ j@P h`00 N/ V?U 0WI=.Pd0$0d0屄PP @@I0(F8 0 (F80 (F80@-0MS@PW@P@ 0  gWP W@P@ B&Ѝ00@-@P0VP0S# S  Ѝ0`.@P qp  0'P 8`&VUP0P (`@0@ R/"A-P` 1@S0101p F@ 01$@ 0ShAqAXA Q PQ1@0108IDp@-P'000@ 00岃,0$ R @@0@@pI8@-@P H4圃 0$R 0 Ӄ@&I8;s@-P`@P !0R!0RЍpA-`pP@PЍU$R0*PP*R0*C-cMP P P8 P/d3qpTAH3 sr* <"( "AS P* 5@8T ?Ѝ ?@2@ PP( PPR D0Sd00Cd0L 3/d0@P0Cd0G4Pb@H0 4R90d00d0 @Pd NArق@T8т0SK U S?łQ@TAI?e D?V P(1x Błh@h0P?h@0 P $ 00$0%0$0@SKg_[h_h_2h_h_h_譀^8i_@Ii_Ni_^]I^fi_|i_i_u2p@-P%`@P,P `A 0`  @@p@xI8O-0dM`删匐0@ p0 }4@P dЍ0S @  @<PP @13 00 00@PM80 gpPp 0 @PT0P00L@$@(02T$@T8P ?$@P >@0S 2$@@@0!@P 8%$0 8000a0A8P$!P^  PBᙁ2 RB L0S=$Y: V V4@āz V  V ɩ u᳁ $ V ṩ V # # 嫩 [ # @叁0V# # 00 #0傁WB3@P #0 0  hP0400aW i_Ӏi_@Ӏ8p@-P`\0@T Q   4 Cp@L$ R R @I8G-@VpP3 P000`@00  0'00& PP( 0@`000`A`0W 0P440PP !PP 00`0V0PW`pW <4?zV  #i_i_7@-`0P @P  P N?U.00,V? O? Ѝ08j_j_O-pP0$M`! 90@P $  ] P N?U.0  V? $?p V  V<V X<X L<s@P $Ѝ8,j_͠^j_Pj_aj_@-@< @j_@-$0C00S@Yd0P0S R 0 R 0S 0S/008@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ @- 0 0$00Ѝ@- 0 0Ѝ@- 0 0Ѝ@- 0 0Ѝ@- 0 0Ѝp@-@H0  9PH0 0\10H00A PA00Q00@@@pX"0O-DM 00(00!1@p`0< 0800p,`$@ @@ @ 0'Q!18 P0<0,p(`$@@ @0 00!018 0<0,p(`$@@ @s0 00!08 0<0,p(`$@@ @` 0!0P8 0<0,p(`$@ P@ @N *"0 T @~%DЍO1 0@0X _M^j_j_j_`O-phQ`PM@8尦P 04PP$W ~d@T`@T!~ 2P P 0 < tP { ~ PЍA @0 < tP03 0<300~0l~% @ G O-`P0M@ B2 b061(" pNG 0 00@ 0 H4pP@~ؠd@T`@Tw~)R0t0 D 70P s t0e~0pЍ  @)R0t 0 D 0P  @G p@-P@ P00CS 00 Ñ"`0St t0x 0`@x000p7@-@000 0 Qo Ѝ0O-P`㸀M v 0UЍ'J0J@V@ V d8<   0PP Pz  1/ j_p@-@P`}*p@}`H0 /p@-@DP}H09H00 Q1  . p@}X`p@-l t0@SP Sxxtx0t H0; Sd0S0000p@ !CeGp@- t0PS@ Sxxtx0t H0; S `@0St t0x Px@pd0S 0\`S S PP  0S 0@ d@z!Ce@-0@  R  R / R      + 8 R QX0;0/O-,MP0S`0Q@`,` pi|0PU WT@@hP V   40'0?` V`p|9@,Ѝd d| 17` |d V Bd 0p@I@IG-Q-PBM:p(1SP5R`<1@0zN@P@)@ O?P@D | P Ġ Z P @D@Bߍ  6PP 6PP  e @J@- @W000 0000p0`0P0@0x0|0p@-M`P@0(@0 0`P Ѝp,p@-M`P@0(@0 0`P} Ѝp,P0/]j_@-@aM R|q0U d40E H0`0L 0/0 4 $X80$S-! !Q p E8\0 0X0<8T00" "48= /80 00dt&8`P`0FSX8 4L8aߍ8]]Z^k_j_^^O^j_,k_Vk_k_k_]I^k_@-@P (80S7@1ꊿ^^O^C-`00VM@YPU 0 PZ1pQ{dPU{V0t  9 00z{ 0&R0S YP ЍP({@PT0SdP`{U 0G*l_l_p@-PH{D0@T0I{pPh@d00d0@I0P/p@-P@ pZ1Fx01000.%/&.%/& H ND+V@U +:# +4 1|0pO-`$ML@PpH NP0"VN 1U㬁$10SI  @?0P 0垢<\00 Y  $Ѝ P1 ! V0[ V I08/P 0V+cW p 0V8/P  H0UNR@4PP0 05/P +`hК@[T0@-p0MPU U@ UPPЍ0Ѝ0@ J /00Ѝ0@7I0    4 6::0070/0/0/X00/]-/0 0/00/00/00/00/0 0/O-QMp)a@P;y0` |a0S@l@@T&WXH!D1 @4z0  0S80 S 00BQ0Bk03!P 0S T( y !!P0   - y0S T  }yXX?`!_-0/0040/0H0/-L/0P0/T0S000/p@-P $0D@$@@T@pJy$@ @T@y|p@-P@>y?Pp@xy|p@-@,P2y 0 0 0,Pjyp|Q3oO-M  @ (R02@PBU1# (pU< `$  P``0 V@P 0v3@P( 0n3@P  ,h3@P@  b3@`0V %0U ߍ`PC-$M@p000 00(00@ 0 ( 0P1 0  !00 `0`1.` 0s.`P  # 8$Ѝ<  }` }:]p@-P@`M$ 7 !|`|+Ѝpp@-@P`M< &!! i+@-Ѝp@-DMp `P=@P 0P,@@00P(4@P DЍ .@C-p`M!(+PP*0@S+   0P0`'0+PK0  000`0&0*PK0S@! @+Pg-ЍyKxA-Pp@Pdu` 0/S 6@P0 Ѝ0 rdu@ 0/S ~6@-pPdw`j@ Ѝ0/S 6@P000V0@/S Y6A-pMpP`@PE?`00\@4@809(4d@P OpЍHPI0S@0!0000 00!0$0100! `(0 `q,@P D*@P 0`F0`@-Mq` P8@P 0,00000@0'4x@P 0S ,K,0P@Ѝ@0@0$0, 00:#:D0@0)@Pz@-P !M`#q @P 0,00@0000'4/@P @T ,,T ec@ЍG@0@0$0 0 00+8+D 00, @0k+@PE. G-M⨀`P p@P @P0@0R'@@P($pY ,H0SD00 SD0 .R0.S 0t00Sp280x00L0 0P0)'L|@P0d``PSx08x0V +0tS00.S @cS0 .R0.Sm 0W@V0T03/@PP0 `@P@U `PUX @5 0R'S)XD X 0S#YH 0RD@P 0 8 *0@X03/  ЍS@@UV q+o+0X03/ +zU v8 + qo@@@8 @-DMPp @P`P @DЍ0,00000@0u&4@PP0!0S U@0SU  @ , d*@n @, )@,*UC-1@3p MaYP9+ 04@P,d@P'L10S 8 B10<00@00000&D@P (0S" ,<p*,(0P(@Ѝ  P @P0P0$0,( <0P0T0< P0*@P(,Fm_@-@L@  u|O-LM05@`pP$ P.A8. $00pY[XX |0S0oS  %(p0|0|0H S4*3| ` M.PA 0S y$P6Y( LЍV0 (j3P Tx4Q ((`(Pf0((0pP 00 ((/r(pP$P `! `G |0S 5$P @ 00P00&P0 P0t0 M850|0p 0M( tZ[| 0  .|0 P0B_t0S Jts $0  @2 0   0S 0p0 0&PT PO0/t M8M( 0% 000010! 0 000 |0 PV  p Z ( M(  A +#R06tZTU 0 ~P Vm0040z   R Un 0 bPf VQ000|00 `0$PS `-](]_|w]m_ n_@- 0 0 0000 ЍA-pPMw@P 0@00<@@0-$D.@P DPЍ(`>P(0 @@0P 0%@P 0 0@ X@T(PFs0S I~s|s@-`x@PЍp0-sP @00!00@P000^sC-P@ЀАpM0 0S `P gQ! T@ /0 /!bR0 20SPU 0@ ЍܺW^QX?4n_@-@-3\M` @P 0P0 S`WWWWdWWWW,WpWWWW`W, `@P,  1\Ѝ P @P "-@$ P @P$ ( P +@P  @P(  p+@P( +@P  +@P@ `x@P@ @ +@Pp@ `+@P @P@ 0000p@ `+@Pv @Pp  ,`@ +@Pd @pZ+`t+@P RP w@zZ@D]@-@M Z+P ЍG-@!MS$ ` p! BWP0O80-PP%W$!- P?@0Sp 0寙<P0@0 P U Ѝ P@ Ȑ  rP00/S S 80SP +4@+  T4g_@-PX0M`p j@P 0 0 0{@ Ѝ]p@-@`L 0P@P +@p @-PM p`>0@P  04 00#0G@/Ѝp@-@`Lp 0P@P +@ap O-1MP`@0DQ`@ p=0 0jP*[0$0P 00 00PU@ @0 3/0P@UT@H0@00-x0ЍUT*0 0 0P@0 3/0P P P@ 4g_@-0 000Ѝ h@G-p`/@P.0 . 0S@ !t#PPY %$@@y0S&   /P  P˜P @#/Ѝ @ T  `@ TG-0Pq$@>"@`<P  PPPၘ}A"$! G}0@-Mp 00000` 0n"@P/@P 0lP0S q%@.Ѝ@!"@d%Tp@-@MP `@P U?000,@@0 4@P @Ѝp000S@@!"@P3%/0s@- Q@P $P@`ᮗ300Ѝp0 0p@-M 00000P 0`!@P0 @P?ЍpG-5(M@L` CP@ q$$/P 0 00000 0H  0 00 0@P $ u/(Ѝ $0R  j/$0  s1P$00PP$$  =/ C-p0MR`P0'mmP 0 3/@wmNT T+ /du40000 000@S -ʩ@ @P0/S -@P0  Ѝ€@-p0@ @`PP @ (0 Q@ Ѝ@- 000@0 cP 00Ѝ@- 00 0@0P 00Ѝs@-@ PR0`00BS :00S03P R30Ѝp! ! C- pሐP@``V`31P01 0 @PP  ЍH0p@-0P@0P 000S 0 p@Fp-p0ASG-Pp@ `'PP00S!3 T` TS @P0p@-`M 0000 0P| @P @P T0P00L@$@(0T$@P `Ѝp8`p@nT  g'@P`0 0S030t(@P 0S@3:j(@O-P0!M0#q` 0000 0' @PcUPd  b-@PX  a@PF@T0SG  m@P  R @P  -P 0S-@*" M 0$  @P  0m0X  X m 0 P@P" 0  h-Ѝ-@@@- x Ѝ@-M pP 0`@P @P`@Td@Ѝ@-M@ 0P 'ЍA-M P` 0pm@P @Pp@T 00 00@dЍs@-P@P< 0`00@P f'@ ,Ѝp O-P0M 0000p0 `"@P   @PpP @Ѝ0@00@<0[D@PN(`V@Pc$0 0АԀ0:#:T0: S"  S-  S0 @,<!,P6 V, ) S  S0xy,P0 P0< ( 0,-(P0< P@P ( 0 ,<B"@P ,<u!,x@-@# Ѝ@@iЍ@- c Ѝ@-!  Ѝ0 cT cp@-HMP\0  1 1 0+@P+X@P$0`800 @4`0 <F@P 0$S@0S 0R@4 j @$c!$uqHЍp@4!$ 0Pf PL]]@-; 000c0 Ѝ@- 0;0 00Ѝ0 c1 0c+0(00@-DM @P$P0@,P0000U4V@P l0S00, 0P P W@DЍ0  ,e!@P ,  0c 00 c@-0S@`@PC*0P @ 0,Q@ 0P000 1/@ *ЍpC-pM`'*PP 0) @Ѝ 0,Q !!1/@P N@@)00@-MA0 0@OЍ0C-pM`)PP 0) @Ѝ 0,Q !!1/@P O@@)00@-MA0 0@OЍ0C-SDM@`p- ` U_E_@P"00P,@@0t|Q4 P\g]h 4P@P yWDЍoX@ cl`@`  ~@P N@0@-0 c Ѝ@- 00 Ѝp@-@M` Pd@P0P,@@00P4@P 0@ЍpP@ @-0 c Ѝ0@-MPP @@0cP $Ѝ00@-MPP @0cP $Ѝ00@- 0MP 00P@3P $Ѝ0@00@- 00 cn Ѝ@- 00f Ѝs@-P@0` @P u@_ Ѝp]@-P`(@P 0 p`@K( Ѝs@-P@0` @P J@4 Ѝp]s@-P0` D0D0 0@P B@0 Ѝp]]0@-0 c Ѝs@-P`(@P0 %@K(Ѝp@- 00 Ѝs@-P@0` |@P  @ Ѝp]@-P$0` L0L0 0t@P@0 )@ Ѝp]]0@-000 c Ѝ@-PH0` A@P00 0@ Ѝp]@-P` 2(@P @0@'Ѝp@-00 00 Ѝ@-P` (@P 0 00@'Ѝp@-PD0` @P@0 @ s Ѝp]@-PH0` @P00 0@ \ Ѝp]G-M0`@S11\p @Tֻ0s_λ 0s0Sp 0PPp?X0!(PP 0 SP? P0UPP(R0 s` 0 s pUZ0!(00PW  0S  !PP Ѝ 0skP0PP]]p@-PM`L'@P @0 @0c0 f@&Ѝp@-  00 0 0030 SЍ@-0 cHЍC-LM@hPP$ l0S (z!P(0 !R x S:LЍ/``0 1S<0Q*!!? 0  0@B@- 00 @0 Ѝ@-P` &@P @0  00@&Ѝp0@-0  Ѝp@- 0MS@$P0` @Px20S@ b@P!@PY #!@ Ѝp]p@-P@e&0P @ 0<Q-@ 1/@2&pp@-PMs&@P0L` 0 0 u@&ЍpG-PMT&@P2 0 @+ 000  0- @`@0! 0 J R@@`pXP0  6@%Ѝ@p@-PM&@P0L` 0 0 @h%Ѝp0@-c 000, Ѝ0@-00$ Ѝ@-0c 0 Ѝ@- c 0 Ѝ0c00 c0+c@-`MPp%@P 0 @ 0 @@P0 04@0@0S 0 _00O%ЍF@-,0@31!$ _p@-P`Mt x@T0@&0S00P0U@PRЍp07@-<P S@P@ Ѝ0]O- ` 0M&J0 S1 0C 0 p :%@P 0  @ PT 0S@  0 @$@Ѝ@G- `@ 0p%J0!S B   %@P 0  @ PP 0S@  0@^ $Ѝ@@-@(e$0S( ( (0$ @fI@-@, 0e,0$ @R$$ ((0 fI0S ( #P QS//A-@exPx` 0S0hP 0X` &p0S Q R$0I0@-@ 0 %@eꄉI00CS0/@-@P $ 600C0@ ꄉ0M, 0S00Ѝ/p@-Pp0 0AT 0S P 0SP@p0S000 @ꄉA-p䀟3AT -e`Pge0S @000[ePU PPheX0 $3`U3@103 P000 @I@031SQ  R R0/0A-`@P 0pS00Q%P P 00 k%h%V LdDPD`P 0$0 d#I@-@M @d@ d | $0l 0 ` `0 X 00  , $0 ЍINn_Un_XX0?\n_1S/p@-P`todAT`d\@Q p0S `` ```@` $_IA-p` P0@p@pPP0PPP@p@-@"PPpx] p@p@-@PPpl] p@P\0S\/@- {P@K@-@R]@]@-\0 S00 00CS\0]P@~]n_K@-@2]@m]p@-@)]`V  ;P  U]pQ]8P ]Ud (p@-@H\Q  L @C-@MP\0S]Ѝ`0FSP ]0@؀] p 0/P 0P 7@-PP00@T  !PT{ Ѝ0@@-@\00\0\0 0CR\0 SPf\\G-`p$MP@vWp0S*lЍ~P ʄ\P vP0S \|\눠 :P \XC\P PP05\ V &@JJA-\0P0TP`S  BBC \XL>XT>X\>Xd>Xl>X90000 000 0(""'80@H0PX0`h000 0|0004;$x0| Ѝp9:: :9: P@-0C 02A-pSM 0` Ph0S@ @P   (,pZ @ Ѝ@p@-@`P( @ pG-@1pS ` PH0 00   0  G O-@ MPRࠝ0 0`0 dZ& Z? Z  00 P0S@0S@Z Ѝp0SW RXT W  R! B @QYw!T @Q@P  PD@ PQA @PO-@M pRR20P R  R X Ѝ0 R! T l"`  Q^0 00 PPP ` P`  !W   R `    R! L13!1 P[pH 0+""0 #S5000, 0Y  0/oK[" RpPu  0 t000~VH0;H03WA[ 0p0`0Pp^&p@-@P$e@C pA-P0pS`MS0CS"@AS @k0 ^ 1@PW2KV13110 @ PVT" $l1Q d%G  @P  0SV 800C00SV @Ѝ00S000Q 0S'0H0 @0Q@Tl0 0 0 ? @ 00400S@at Ӏf@zfzfG-P,0`0Q @0@L0S% 0" MKJ   pP  0 e 0p  Y  s L0 I0 0 0 G-`, 04p , - +@JPP Zb0SUZ 0SXZ  0 @0 H00 0 U 0@  0Z@ O-P3M0@ 3@s0聗,000 :00T@48<40O  L0 0 00, 4J `P @ 0 2"@PY[ PG YK8@%0@01TD00, 00@0@P=[  Rm  RW  &  ?  @P$CY 1@J ,0D000,E 0P0T0=\  @P 40S&Z5 0t@@ !01@ 20@  @@P TX  X 1U Y O@0 2Ѝ N@ G-@ p@-PP@`V TX00CX0U P)p O-,M\`ကP@`dpP/0 0%!X0ЍS@@  +@PY 0 0W@0/oS" R@X ,Ѝh0100 0SO-P@1H# 娡 0RP  0  V@ ]@-PGM`p0 @PV@P  @0 0 0@Gߍ@-PGM`p0 @PP0 -@P  @0 0 0@Gߍ]@-PGM`p0 @PP0  @P  @0 0 0@Gߍ]@-PGM`p0 @P@P 0 0 0@Gߍ@-PGM`p0 p@PL0 @P 0 0 0@?Gߍ]@-PGM`p0 N@PL0 @P 0 0 0@Gߍ]p@-PBM`0 -@P @P0 T@8Bߍpp@-PBM`0 @P@0 h@P0 7@Bߍp]p@-PBM`0 @P@0 J@P0 @Bߍp]@-PM`p:@P 00E@Ѝ@-PP0M`p @P00-@Ѝ]@-PP0M`p @P00@|Ѝ]@-PGMp`0 @P0 @P60p 000 0 00[@TT0 -T0V@0Gߍ]@-PGMp`0 \@P0 @P0p 000 0 00,@%T0 -T0V@0Gߍ]@-PGMp`0 -@P@P0@0p 000 000 @.T0 -T0V@0Gߍ@-PGM`p0  @P\0 V@P 000 >@-TV@Gߍ]@-PGM`p0  @P\0 0@P 000 @-TV@Gߍ]@-PGM`p0  @P@P0@^ 000 @ -TV@GߍA-`0 Mp @P$`00 0@PppU0PV0 `F000pP Pp!00J Ѝ@D-TV@]A-`0 Mp @P$`00 0@PppU0PV0 `F000pP Pp!00 Ѝ@ -TV@]G-P M~ @P&0 000 @PV0`W0 pG00 0sP P!00  Ѝ@ -TV@p@-PBM`0  @PP0 6@P 0 @-TV@Bߍp]p@-PBM`0  @PP0 @P h0 @-TV@Bߍp]p@-PBM`0  @P @P 0@F0 @ -TV@Bߍpp@-`0@#2000FSPVPp0PpV00p@-@PM0 \$p@Mp@-@PM00PPMp0@-P0M 0 0P@P0 03/@Ѝ0]@-000 03/Ѝ]@-000 03/Ѝ]@-M0<00  3/@PЍ8]@-M@000  3/@PЍT]@-4000 03/@P~Ѝp]0@-0M00 03/@{TP P)M<0 0R 0#\MЍ0]0@-000 03/Ѝ]@-000 $03/Ѝ]@-000 (03/Ѝ]C-0M p08@P% 0"sr`@ P`L $M0 ,03/VP T 0"Y0 3:UЍ`]@-M@0000  3/@PЍ]G-M ` 0@P P 0 pL $LP0403/ 0` Zp@@T Y0P3ЍPp4]@-( "!0 803/ЍP]@-( "!0 <03/Ѝl]@- 000 @03/Ѝ]@- 000 D03/Ѝ]0@-P0M 0 0PO@P0 H03/@$Ѝ0]0@-P0M 0 0P7@P0 L03/@ Ѝ0]@- 0 00P03/Ѝ]0@-T0M0 0 P @P0T03/@Ѝ0]-00$M0"!#!0 X03/$Ѝ0]0@-,M\!#!@0 00P @P0\03/@,Ѝ0L]0@-P0M ( @P [000`03/PP T 0K U 0KЍ0T 0K 05"h]@-@000 d03/@PЍ]0@-,M080\ 0<0 $0 0P @P0 h03/@X,Ѝ0]@-M@00l0  3/@PЍ]0@-P0M( @P 0 p03/PP T 0/K0jKЍ0`T 0K0!]@-M 0400 t03/@PEЍ]-$M0(000,0 00 x03/$Ѝ]@-000 |03/Ѝ,]0@-P0M 0 0P@P0 03/@Ѝ0H]@- 0 0003/Ѝd]@-000 03/ Ѝ]p@-0M` 00@  00 PP 0 0@03/0P0T0SP Ѝp]7@-00P00 03/@~ Ѝ0]0@-,M!80\ 0<00@0P 00 @P003/@`,Ѝ0]@- 0 0003/Ѝ]0@-L0M 00P h@P003/@=Ѝ0 ]@-000 03/ Ѝ(]@-000 03/ЍD]@- 000 03/Ѝ`]@-000 03/Ѝ|]-,M 00H0400800<00@0 0D0$00 03/,Ѝ]-$M "!00 00 03/$Ѝ]0@-X$M 0 0P @P0 03/@$Ѝ0]@-M@000  3/@PЍ]0@-X$M 0 0P @P0 03/@$Ѝ0]@-000 03/Ѝ$]-$M0(000,0 00 03/$Ѝ@]-$M0(000,0 00 03/$Ѝ\]@- 0 0003/Ѝx]@-(000  3/Ѝ]@- 000 03/Ѝ]@-q_p@-P@`P00@000000 0(0P0Pp@ 0 //00// //0/@-{@-v@-@P 0P heP v@-@0$ @ 塦@-sq_@-00q$0@@-0'q// // 1R *1 4SHP// 0 //0S  0S 0@-@@0S  00S  /00C S~X@~X@~X@~X@~X(~X4~X@~X@~X4~X 0$ /, 0 007@-@00P}H000U  Ѝ0@F Ѝ0Hp@-0@ R R p PT `h 0pPAX0n0`S` 0`V,0&f j1 Sd080P0 P?!00(0S50(0YiC2PCU\400 # (0(*40803/PPN 0S0h0 Dk" R 0 0S  0R d 0S40S   X0?o2P00 W,0"&0:808 01@0P0 000@0000 0>$0P 0S $@UkP 0R dJ<@ p0& 0S P@` 0P0 0v0S8 00<08 `PS$0Pp @4\  0P 0SW 00, `YWpp$0VpW @d 00P0 0000000,00P 0S, j0pL00LPS 000 $0 T0h731|0X0S  0P\0| L06D00D pW,0P0UpPR0pD0 0\0$pp00X0&PS&60DL 00Sl`,`000W 0 V,0"&0:H00H 1 0@l 0 0c60 RZQZ3l0000000 l0PPh 000 X0S 00S ǝPL\娼`0U00S 40S 0| D0  D / ,01/PPiL0S?jP ڡ 0Sv iU  %6`1f 0@ \0 0jF P00|`00 W`001:# `  H pW H {Pl 0 0/, A a3!<0S W 0# . RP HH L P! @=*V"*PU SP0t00x0*sr2\0 C 00040St 2n`0x >0 `S 0&fjZi0H 40V i0`0t`xpGP0 0, RS00W00S0  00  F 00)0 C cl00182T TVT0 b8 QSQT S10 8<00P 00 0嗺P 0S P 0S hP Di 0X p0 ?o2"@  8 VPWY" 0@ Ჹ 0  Ƿ`0SiP $0@!/ꙷጷK᣷ 0D0 0 AP ?W;r_ĎOO-CM@001< @041 0810,09309L0081 0D000H00p$0ᥲ0`S H000 @H0  d0S@W $0S 408 03/d hPCߍW5812 0 SpLPP) h h`?눀X `B$00 ?h0p$08P 81 40/03/PP *00I0 (0l 81 0SD7  01 V 0d 81 0S0 0 8090<`@400 0 0}PP "R 0[P)?X H0  0S0000 0S 3/H0  P d0S8 &h(0, 0#R00SjH` @i`V`fmWY $0S 408 03/5010 8S0 080D0S ,0S  L0jP0/P (`,g뗁ȸ g 0`! 0  <1S<1P P0  S ,0(`,S Xjⰸ(g $(0 L0,0P0墸000 X `*P @ pr 0(`,0 00h 0 `  01/9v0 )V. `0dS00V#6:X0\030 000p0*V0\000Q\ R Xp0A!\X00CP1  pp0)\B?l1Ph0 aX  0S 0S#6:RNƠ 0X00 000p0*X000\ X0 0X00(0`0 T0X0S5X2 \ (`,0C6` ï!g0X p0P 05/P fUX (04 ``X 0S00`04``L0pPX0\p0X 0P 0  <0P@0 R T0S  R _ * k`00S    80 0 S E # _0 S\ 101T0S@` T0S  Nf!;r_`r_H @-0 000! Ѝ 0  /A-@0MPb `,0F00 00YЍĎOA-@0MPb G,0F00 00@ЍĎOO-X2$@LM3@P1`00 p     0  0AOoBBLЍ06 ?\0*f@@$f0 0 0 PPpf 0S@PeQ (T +1 0@  @& (  6, ?(#<@$8 0(@P8 R  T 0@ P 0R 0KWPG-@0(MP3 聓0bᒷFa @ 0O=T0 0T0= 0000 0$@ b62< RW1Q00Wrp @0͸(ЍO-0TMPS@$0 8Q$    $  # Q $ R0,00S$0S 04 8 TЍO/4 8`#6/P TЍ0S0000C0D#Dc S``V 0 0 00 000000"R 0 0;;020S(00  p a 0Q2! QP#Q0q0Xp a8 QWQS1WqRk+pd0 @20>00 0  .p0 P(0 S00 ,40P1~pp p,00 00pG<010801 1!&ᱎXK:8|1 0(0` 000 :#: 000 80 y ,ȋXF00000C00 000 0C03DH8 40P*qp& D8 40 ?y#p{00H < 04 H\;r_x>H Xp@-@P<0 p@FЍ0S S S+ 0 / 0 ///0@-P M 0+@P 00Ѝ0P/00@-DM000,00(0H0 00@0P<0A$  <0< ~DЍ0r_/p@-0P@T `@pp@-P`ᅮ@P @ᜮpA-pP6@r`P$ `ቮV000000 0 0!!!!""""####$$$$|0|0Ĺ  /@-p@ P`] 0000 0CS 0 rp` 0@Pp! 0` ЍC-MPp`04@P  0 $ 01/@T 00Ѝ   @P  @P A-`pPۭ@P  0 Ӻ@T 00Ѝ @P @P 0幺-/9 0T0/ 0X0/O-`DM@ 00 0 刀匠00  `` pP 01s$ 0 0p0 13/P 00s0?o`2v0S  PP 0b 0 DЍU P \ PU˰p \ P 0 9p Wʠ$^ _G- P0` 00 00CS @0 00 013/ 0p@p Y 00 00S@X0`W  1@P  |q qq 8<q|HLq|q (,0sq 0S S 00 000/0CS///p@-P@0003/Pp 0! p0 0SS 0 /S 00/p@-0` P 00CS0@003/@P 0 2X00X073pp@-0@` 0P2X00CX0&30p@00/ 0@-0@00CS0@000/<P /0 0000/p@-@PT0003/@P 0000pp@-@PT` 0R@90003/TP P 000pp@-@P#0003/@P 000pp@-@`0P0003/@pA-@P0圀p`0S00]2X X00CX02PP 0  01/@-0 r_A-$0@@@P0`00=[p|Z Z0S 04 0 13/@fZ@]0     0 1/@-TZ] R0R0#3/ 0 / 0 /0S  0S 0@-@@0S  00S  /O-`1@PpW  z{   Pu  Pp1 Ѝ@@@-7@- 0 R R A@ v Ѝ0A@ Xr_p@-P0S0@0 0S p@0\03/-Ppp@-@04400 # #$0Ѝr_00C SX(X(X@X@XX4X@X(X4X 00 /, 0 0 00 00ğs@-000S @D41 SJ 1311p0S0 0S-00 0Q 0 031;oz000C0 00C 0 R  S \1pH100S<(11000 3pPz  Ѝ1<10# 3R0 0 Pk 3R0 0 p^L00L040Z0ԾӀzKr_s_8s@-P`00@T Hx0˴P4(Ѝp@0 DHTЍpK8p@-`MP  @P t0R R3000 0 Ӿ 0@Ѝp3000 0 Ľ0s_@- Y@P0ЍO-84PTM3p؀ 00`S 0Q Q @PD 0Q Q8崳0S 00 0000 z@Px p30) 0S#0S 0S00 0P0#00S ξP000C @P V= 0@TЍ0"弲S(4001 00 0 0 :㚽P@ `/ Ḻ@H/T @!4) /0S1 T/ @*P -0 S00 0 0 :tP@}/ m@/T&P ,0 ST#080/0S3 O,aPp13 0 !p006/P&@ 8<(1#,0"{ 0S R 0C 000C00S00>lr/ d ۼd`P]003 0D p(06/PR@OK8;s_hrxShd xSd@O-`|M[ 3#0S S@ h X TP 0 ]T0k s |Ѝ 0S0 0"X0cPKl@ TLTH㐟H2@X1100140 PĤ0j80?<00 0S 4;j0$D0?H0? @080t{p<0 @0X0D$00U, (0KD0 SH0 ?JX1!U3T0000 0  00 0@ 0L哏LP[T0( p0,0pDWp!$ Wp! }T͋[0SW04 n0!#?0 0APT000 0 0@7PEhd Ys_O-2`P#0DMS Sz@ OP 0 ᜼0 DЍ0S\ 0S0 0l! 0ᑻPK4@ TLTHĔi?0?00 ᠄0偋᫶0DpQ1! T 0 00 0@0 0D X !P 9000 0 0@廎P pW U0Z0SX꣋ %hd hs_0@-PM@ P@ 0S 00 3N0@Ѝ00@-`P @P 0S-@ Q@0Ѝp@-0P 0@P` V $0@0  " պV@Ѝp@P D D0 4S 40 60CpS//^0S@-0P/@- {@  TXI&_xs_8G-pe`aP-"? !@T0@@0 @@@AP0p0 0`0l06-TG=0 R\ \ @0@0   K8O-`Pq(2?0q ,@ T - 0R SR,P [|,,0@V 000S ,00@,,P,0@8Kp@-`P,0 @T 0?ST Th,pP@T P @o,,P@pK@00/0@-M@ P PT0@ D0D 30000ӹP+(⫅Ѝ0zd@A-P@`9,  Q 00C0 0 m, |',tPtp0S`0 2?0!0S 0 0 AO,~ 0K8p@-0@HP,0`0@,0D08,T@p@w0K*}.0VPd 0O΂+"[! |*!/#1S%P @ LP WZ 0* (!P 000P@  P 000@P QZp 㰠夰m@_pW0: 00C@_2 < 2 ,2! Q Ѝ:;,mnO-Q`0p"@ pP 0׳ <2 S\02@P? ɳ ":#@TP0!彳p!9#@TP0!屳!dƒ1#. @TP2,! 0)"0|| pP 0 0 T  (0TPp@0T@PpP 0 0 TpȠȐTP0I 0@P ?T @.0 @S0< L Ѝ:QO::mnP/O-$0(P`Т@p(0ҼQ< 0R00$00S ?⃁X *;#$+4PP Uc): 0$0@0D Ѝ(bP U8`<:$ 0 (001r00 &! 6!@-0@00$00͇Pp@-@P`-&PP`䯲 gPp@-@ )0!( :@ .@-0@0!80@)A-P?@ |`!lpR) WT00T0  WP00P0%0SX00S 3/050)A-@`PP p)⟹)p@-0@pP)@)Tp@-0PS@p 30x 0000ᗸ\`)0 $A&n)0@K Ѝ@#j^]I^0/G-P`l@b)U 1P0L圩0SG)0S0p 0SڤP夐U剩PP 1})03/6) Z#Z P &!00C0Z $00`))p@-@PPpp@p@-@P )00P 00$00嵆Kp@;)O-M00pQ  (@`TB  0 ᜱ : 0ᕱ 3źl 0U0Ѝ0 @00D0 0(} 0S<0:2<.`DhPG0 hO0Ph!ЍP@-p@-`Pp0S0P0S C\ c0RC {PTP1#p?_O-M`8 IH$⭩P!0PY+ἰ$,0( 喩P( ,0H p00Cp00S  .  x Hv00\ ! x H jHY H@H⤗P+ ($lH 0 4Hk p00Cp00S  . Z x嵠 RH8 000 0RPpPUWv  008 x哠 0H<Ѝ$ _YH^t_Dąt_A-@`@HPp吀0T:mHU0QU P P 0PSHA_@DA-0MP00p 00!l0  00 t@T`p00 Ѝ0SP* y (1y 80000 &y*, y• (`V 00 0@G-PpG@ᤐ夠0SGT 0aV X jP T )& 0 Pပ@Du_G-@pPaG@ T:tG@aV X 0:P^,G@T@@᠖Dp@-T8G@HPH`0Sp@0G0Q 0S @D@u_A-AQG GUP PP  G`P帀PpU:AXGQ  R 00 00 0\ S SDąJu_mu_d_u_X_PT41L0S/0@-@ QM F } P7 ⸢ P0G P '8GЍ0 ` P R PU 03/P   P ,PąDu_u_ v_POv_vv_O-M00P``pwd0S6 0d0h0 00  0 {&  8 0 <0$0 00  <0(,p8 z@ <~L0Sd00Cd0  mЍ  0*@uT0O-@p04P F܀0SqFT x Ѝ0aV! R 幦 P 0WSOZY T ᥦ墦  P@Dv_p@-@l Pd$`0$4SS @pDD$@P P 0@)^^ą 0`( "4`#/O-M }90000 0 -PPr00 +4 40#400$"44 8##<004 8 40 80 < 0 0`$"440#4 0 0$"44 0#4 0 04 8 4 0 8 00 $"448#8=Sp1=p#'40p0("(W$3[L X0!<30C(r*0 0r;p0C0Cs V `lP0@[2 zЍA 0P$( c 0 $ (   0 $$ "$   $$ "$ pR0Cs WPp00 00$}PP !440"440-* ' P$PT!TXX\\``ddhhllp pt 1tQ00 0$uP t0uPIP`1 QP#!"44!1"44!1"441 $0$Q 0RP (Ⲧ0 u u  8  u(PP0T8 5P 0 ,00ERv_PMw_w_`^?_w_bw_O-P`@fuM$| P0`p#00 0?PP*0P X0P P! R R0&wX8j&  !,T P00S Pyuߍ XX  ,4L HZpvPFS hy3 0[PE{pP P NΠ0 n :1 .fPP  R0#v P 0`☲c  P X & 0ⵄ& Xⱄ  ץ0 0nP070㚳#, u u $(0, 0 0S 1!3S$ ?6.~`0S S*Q #?0000.V A00 Z00 Xt P 6XMP.  Q#?0000Q 00 t Xt z PpX0 oR 000X00 0@dPb p^w_w_w_x_,x_`x_|^͠^w_x_x_T0Tp@- 60@$@PP `PUPTOpA-@Pf/p<(00`S3 #01 1@ ##:!#0<,8  Ys00 Ss0 H0<0 0008|0X``00``m0 (0 0<0`0,0$0@000(040,0A薬꼪s_WEVG- 1( @"6 0ฐPP 0S00GZx꜀00CS$00 08 pRvW00 BR`!`1Px0W   W n00C0A-` P &0)`k@P@ tp\ UL00L0  UH00H0$0SP0 @DFPY@PሽylG-`<10SYP U:kkV|- 0k`V ` 0S 0 j`P嘐r @x>@-0@ ($堊P@,꼪l<y_0!L0 0/R-/00R>0/P}ft,@|f{f@~fp@-@L P & 0 pP$ pO-@2 600o RQF 0Q0000C00 S񟗇?Y?Y@YAYAYAYAYAYAYAYAY@Y@Y`p 0 V0":P ZeUP!0S   gP   Ho RQ 0Qd 0pS  Ѝ0~pS PP Z%ZjeV`!  0 0pM QC6 R Z R 0 R0S000S 0S00i 00 Q #bDK@K\p@-l` d0 i@H0P*0,P  0@ipx>@K\DK0 60S#3//0 R@#0 Q /R0h0//]0( #&0  R /jE/00S/კO-M`0 00000P@P= 0 @@@@p 㛺PĀĐ@TT ,hጺZ ЍO  T1# E@PW01 YP0 EP @Ѝp4!  \ / : C/y_p$0 0!0 00 /Hzhzlz0S  0 00/p@-0pPd3@1`000/(0, 6Q 0/(0, "R0@@Vp@-@0 00R 0(0,000@p@-P`@P @ `T`0S $0CS@ R(08 8@@pp@-PU @`00p`h0PHpp^p@-@pPwP;p@A-APpk0S$0C@PoobT  R*  R Pᢹ$ R8@ (@T $0DS R @TP8 R8 0 RP`qVp@-40@SP 4 -\0z,0S S 00 008@Tp`0 6/@p@-@P` 9 0P6 #::0t $00000@0`0|: 0p ^A-Pp@3A`1`00 0S60S50S 0S E`LPT Q 50S0 xJy050,JY@-@BD0S OP$@T@-@50S0500S @A- pPPF㼸9@0(0@P<1``00:hxxP hNPPPPPPPPlPlB> 00 0`S 0  , `r 0@PЍTY;y_< ^@-(@,000S S 0 AP 0S Ѝ@rOЍ-\M0000Q 0S 3/\Ѝ G-`1@p31`00g 0RPZ50Sxx0550B R  00 0S#P> 0 0 0  ˛P0 0000( H/o6"Q R  R   0 0 @pPP #P 0SPU  P P O-1DM00P`p0 <0 a0,(P$  @<`<0 SB 400 ,00  0000a000'>(P0$ 0 `<0400 ,00 0000a0(P 0$ `<0400 ,0X0 0P000a0(P 0$ `DЍ;y_hRY?y_QYe_PYJy_O-QdM@0 | PdЍdЍO_Q0 00000`0 PPPV0/op"/8A  @T@DHX01H0#0T0Z 3 #W R+   6 4 8 < $ ( ( <0 , 8 0 D@  RH  H m X  ,P `J@ GrpT @DPO-造Mx@P` p᨝0` 00l ,1 0(10$10 1H00X[ 1?o2P0SЍVYC-M 0P`` @|p0 P 00 00 0 0@[?o2P0S  BP Ѝhp@-@P0@T $@DT`h\\ 0S(@0 80 0,LP p@ S| ^oy_LVYPy_A-0pP@TU,p`T`1 `@DP0y_D0S/0@-0 H ЍA-@`p`P0(@S$0CS8I R (0S $0C `PA y_p@-@P T-p\P @<0@ @D$Y x p;y_LKl@-<0DT 0 !0  !0@- ! 0 !A-@`XpPUA00`0S 00  03/<ꨌp@-@P0 0 0 0 00 0 00  p@O-pp34M1`00#2128@T s 0"0#!"4Ѝ00 030 x`d`JP0S @D R 9 R9|YY YYYYYYYYYYYY8YYTXYYYPYY PP  C\0 : q80 @0S ( <X0000< 3SH L0SP0\ 0304 sR k "Pt"P\"PH"P4PPE_o$"RQ >807PP220:00lpX 7/U P @p03/LKA-P4!,a @T @DT@T $@DTAQ0S 0SEB@0S&$V008P0(00S GpP T;J<-080(00Q;(@LKO-@,MI,00@T `88@DT`,ЍT <0RUSL (f0 0 0 q P0PP9 Vc000pppGJ0 0 Y ``0 R0V` F/ 0 PPP# 0S,⾔&0 0 0 1`00@T @DSP0P P060S500C?o2 0 0 Laq 3/ 0``S uMbA-@p `PBM 2SJ@ @(@0 0@S  202 100 0 0P`5Bߍ,TY@-0  Q:0 0(0 0QS Q   Ѝ[,TY00@-AM@0 0 0 0P00! ! 0@6 A:Aߍ0A-P@ `%0H   CR'0C0 0000S  (  ( 0Sp p A6#RH L0S0P   :-CM       rCߍG-P<pṲ@|`j PPl00P(P$P,P0$008P$S( (0 *| 0 pGLKp@-@,00,0PS0|0,P@8PUp`0 6/Ps@-D0@40P0`{0S  Ѝp@/Ѝph080/h@-@P ]P @ UA-Pl@`qT>H1x`31`0050Sr050*0S !:00000P P  P P 00P 0000_rP^ HzxBO-(@4M3p1P`0050Sxfr050`V :W 729 `$00 ᐠ90p9W 1C7CW$0SY 00#212 900pWr `$pGWA#2!128W M8W4 0CW8W 8W0CW  0W `4Ѝp80 SpYhYhYhYhY4pYmYhYhYPpYhYhYhYdpY(8W 0W 0S 00.`7W ~;C?>CW_ >0W >C 0CW H4ЍOb7W  ;CW0CWx7W 0S  `@7W H4ЍO[6WJ 57W >C0CW`즟 W 6W`VlX 㻰0 W@0}Pd0f d `8zDV  V $ 0,p(`80OPP0 00!10 ,p(`$ 80< OP@ <0< $  00,p(`OPg 1000<0 ,p(`$  O0PU     '. ,p(`$0 @ 0< OPD @01Q[P1S ~?S?11S1O@oqM|YYz_)z_dPY^z_ĄYKXYLz_^Qz_Xz_z_Yz_O-DM@c R`d` P@< ㍮ l |D1n00,($  p<0HOP@ cDЍ 0!<0$   ,(@0OP 0!0$ 0<0  ,(OP 0!P00H00,($ P 80< OP dY܂Yz_)z_z_XYXz_@-@P; 孭 Z@ ӥ؄Yp@-@PQ`2 Q   9 ,p@O   RP PP  %<0 <0x 8RR00R0S 0S/ 20Upp@0̄0 L K0S/ L KA-M@`P:p0射P00HDPP@:ЍA J.PD@-3M@03XFSpD`PP&Pa80PUЍ#`D{0S00P00C0y*,0S 3/XPdG-VM@V/ pN }? 0@c1 3"0 2Q  ! R!0S Q050 ~c, Pc8䁄刀 2S 8  0 2VRU DPEU RU& DU# 0ZHP !0 RS  R H0 3/0,PH0 PV.&U$1PU"  /78t(P Q018Vߍ40S 01Q 403/0SXP0S    H03/,KK܆z_ȂYd0L KA-~`i@pT l0S~g@DZPP 0 R DW!P@3 P 0S !PxYp@-@`GP@P @cpA-~`#PpU@ l0S~ P3 DP@ 0 0R D Q !PxYp@-@` P@P %pG-pW0S !S* 1S l Q`~`P̐Ul0 S DP@~P 0SP 0 S:V ` ,  D.P܆xYp@-@`᩾P@P žp@-@PZP@p@-@`ᎾP@P ᪾pA-`ှ~P|h tpR@ᚾl0S~a DTP@ 00S DRxYA-P`$V  l0Q R D6P@ 0S 0S  P Q  P   0S*p0   DxYA-@p`P@P 3P/@-(0pMPL0`  @P $(0, SS  3/Ѝ YQ/p@-P@d} \0`80S)p@0S QQC^T SG"A\H$H@ \ ƹ!R01h01S0## 4 0@@S@ S ^z_KjP_z_A-`pP40@TA80S 3/X@dA-pP@HtW`40 p0H0(0DQP@A脽P DK 0 0R DAPL0S H$D+갌@-@y@@-@@|0/0/0/0S/  K0 R0/܆@-Pl 0RxYA-0` `00R@S 0`8`0}? >aMCaaq Mw%a ab尽bXUT! 0$ $18!0  2 0R200 `p00S0p SV 垺`p02P0Q:0"PSp`W !w`"0 AЍAD0܆KKz_z_@-@k@0A- P @0L ^U 0S ^~`pF@hpT y 0S0@A7l0S ⬄P ~4@xYp@-@`8P!@P 0 QpK@-Q@MP@`pPP@ \ V0 0@Ѝ 0 <R0%0 @@0A- P` @0L ^U 0S ~p@ကT l0S BPX0 ⬼ 0S0@A~@xYKO-`0M#08@Qr 6^0Qp XXmP  03/vNZX^P   03/fNZoWNP  03/X0S  Pf `a@P@tW2P  0# 3/;0@WS8'S;Vp (]0 00000 0^X ("Z ~X PUP P҄1~pl`dV L X0PCP Ѝ< <0: PS_0SCDP `⣄XP Uڐ PP0PEDPp  p <׻~`XP `DŽ Uڐ PٴPPEϺD?< 崻54)454P$SN $#(u (PPL\'0S$PP4 <P <qUL0$3/PP 0S- <@P 3|`|08<N03/P |`+ ^@S"0<#S 80#S %'B BS #S #S#V6 0 0 0P 0NP* (q"S  S "S "S's |"Sx"p"S l$'a S `M BS[ BS30 P0S- P[ `0 ` 6/ NZ0 0(`06/  "  0`a@# Z  R @aP/  03/[  媃 0ृz{ S#B%B}e Sb O!"'S s[ SX *.l33&iȀǀɀ@zixiKxi Yiiiii{iFi@ui niii@ɀIii7iiiG-Ppu~`]@|T l0 S 50S0 0P80 1|~F@xYK0  K0 厺KA-p`P$@P 00S0L  9 PP D @  {_1{_0 ƣYYb 寣0Yp@-P@^40x@XPx0D#0Uw0D"0Uv0D 0t0!E'D!E&D E&Dp@-4@QPM `?1h0Q o0CQ 0Q 3QN `Ѝ3Q 3Q31 1}0Q0 00P0 0֪`P0@S?` SRp @ㅛ? p垱`P @|2Q 0CQ 0Q2 0CQ00l2Q 0Q XJ`0!  Q SS  @#!@  ! ! !1 ! ! ! ! ! ! !! !! !!,!1<13" 4`q1#  `1 3 1#>0880R 3X0`N}`H0@0< !N D!0/H0L 0/QP @0D P @њqP 0?S@ Ѝ@S``iui vi iiiG-x Qp`PM \1Q-@UVDD̵0 00 00@P ލ@U3T @P  0R !뵷DPP1@ з 0Q D @P W14 (0W-@ 41i i ^m{_C-qM@`>P)  03/PGNU# 0S  U QPp@0S     0SЍ1PpP 1 -ɀx0/p@-`Q@P R 0 0 0 )!7p000SP0PP00p*R !0 0 0 `0SP0P0P0p@-^ 0p@/RP@  p@ PpiXi3 4 RA0ACo//1S /p@-3tP@ !P0#3 R`M3  bR  PU3P%SЍpRip@-Q@$P U0$0 p0ES$0ʰP $Ppp@-@PPRp0@-@0M0S0z@P  RЍ0ϖo{_p@-Ph@᪠1 01  hp@賠@-p0$M03`A0AS P R R R0 `/@ H MRY R .@ )000 S""44 0 #RH L0S0P  ) 0 001   01^000000000 0 00000 00|6@P #T@$Ѝ3  2#0P0C@0@ 001 0 S 0 < 0"448#80CS=10 001   `1100000000<1000 004@P @j0 | 0H   C Rw0C0000 0S(  (  ( 0   v0T0 0 k0 @P{ Qw 5@t2@7@{_33@-3A0@S AS S 6<2@S 3/4P@)O-Q,M0 #21 2@P0 40S `0` " !",Ѝ0Sbb20pH2V HbVRUH0 0X0\90PPU:00 00 ~ ~P0p@-P`@Tp  P P @A-0PXMP- 00 0XЍA/`@p ~1#`101"4410 0CH00UL 800(080@`, 0 0 0 03/XЍ訌\00@-:PL@0 R 00 C0.APAAꫪ ] ،0@-PQ@M 0 R040060000 $0T l00p0 200P000 %U 0 00#0/0PR,R02\t0HLR0h00 P(05/L 0 b DЍ0ဖ{_YY8Y ^{_p@-@0|0DDx0003/HRUHHMHRQp0S  0 Ė20C2HR40SD/Q/D00S/   ! """ ^00@-0PS0 O T  RQ40S47/aC^-9S 0C570C03>C<A \0 S?0aN^ >9QC< A(.S,S :S 0S70/00@-0C QAC^9S000@N TAPNU>9^C<7A@-@ 0R R% RB G}0 B} R 9}   ^           R R  R  R P} D3          / ^ ^$ ^|_@-`Pޕ@H  `P*0& 0# " !P 00 0 | |0 024`S 0 0B02H02Ѝp`HT ᥕ@-@HPR  a`P "@P 00CS 004`S  0 2H0C2t~Ѝp`Hk</@/l2p@-Q@`P *P2Qt D2Qg <2QT  p@ 2Qi M0Q 2Ÿ2 0\00-\0Sp4Pp3" p@H1Q 2?5Q1 20$201Q( &0V4"R= 0p@00Sp3A AR00S(703P pFPpp@@PpL2!4<010 " $"S $2p@p@F8"Rp0S 0 0 8FPvpi1iii2i(#iX8i(i* ^ 2 @-$2@0$2 P$20$2/(2S@-$2@ 0$2 P$20$2/G-@ᒔpP(ᰀHA(20(2p02P0H02w(Z p@2S,`Yp)`dV v H(20C(2,2S0S,2?02HQW  IS p 3/`P  0S0S0 0"p@-@Hj,2&jPUH&p R&U R?,"02(2H0C(2@2S(2Sb p 0S0S0 0"P 3/A-@` Pp0H   CR0C0000T7@@#RH L0S0P   @0(00(00S#@P  ey0'  $ ! "$& $ "$ (?Q0@ a0600 ^@-0S 0 P P Ѝ0 $"$# &  $ "$  $"$# & y0C-M 03P 0 SP0ht`0开cS0 00044@X 0@ DC5(00X 0  R:0 3  00P  勀0P<<00   0:00h(q(0, O 0@,@(0h{0#:0#X00S(DD KP `0#DDH$H#  3  0 0IP0 0  P0S `0#DDH$H  3:#:SZ2T Tr & 1T (0Sp0 00C SF0 ^  H 0:01T7?T+ @P  y.81@ R   P0-p'  H/o"!20T  T  0T00S 0@000x0@000 04Ѝr l،G ^ Ld5݆P1O-0Q@00`pDM(00 0<0a0,$@ @@ @<@/;000< 0a0 ,($@ @ @; 0$0\00T0000'>a0,0( P @< ;DЍ^،|_Y^Z |_A-@`pP0S 0Q  6/P Pp@-@Ps0S| |0 @Pp@-@ M@J6@/p@-@P,03/ 0&@P@ D&!R @A000p6@/0S   6@ H0600C0/p@-@00`P 6/P *0S| |0 P@pC-@4 `lMP:x540"p  8PPpC 0@TAl0S @ 0QU`0S꬀&gyP`荂G-\@P`p@TG0d0S0 $9/@荂p@-PL@P0  R 80<000@0,0$0(080$0H0p 0YYYYYp@-@$P`0@0p@%80/A-@`p@TP 0S @ 3 (P0U 荂07@-@00T P |P@03/0P |@ Ѝ0XYp@-@TP~0T00  0T00H0p@/荂0@-@M 00^ XP |P@03/0Q |P403/Ѝ0`Y<0/@0/40/@0D0///O-阳DM0h0#@2lP12UhP@#U2!12P#0kPDЍSPUZY YP5 0 3/PJPUPP&0 R0S P p0 3/0P! X \ &$W P%#2!12#0 S 0,20 9/0PW  PP5  0v0 0& &&Q Q X & 尖\ W   0S Pp }0010`V `FV0 S 0T 00`,  0*, ^)|_荂~0@-@@PM@:0 0(0 00@@bЍ0I|_Q/ 00$&/Ȍ@-@0Q   R@ x Q#S #` ( P0\ 4PS 0S S /iϖoiXYL00S @-@3@03,0003//Ȍp@-P`y @z0 $030|0|0l0030U600`0@;080H0 0P(05/3@03`p蘁YYȌO-p03P@` (P 2 008/2W2 40" 40 3Ah(p80 0 000 4 000 4 h=( R Ra ,/, R  20S  10S@ 10S 0,01弑帱a崡Xʀ 0! $ 0   , ! P: h0 0 0(0 , 0(0 , h 0!!0   , !, R  00S 00S ;0,00@00p0kh夔0 0 0 h寔7S|_{_ PHzhzlz00S/!Ȍ@-@P T0 S/,P/0p@-P8P@` <* @0S@@D,` `p@,@ 00S 0 0C0 0/@-@ \ 0 0 0@- Ѝp@- 0@SP 0SP 3/P 0S pA-P`p᠌@Q0 p`000@@AA-pP`@V@D`p@-@`2P lP)` `㲥 aP^gP SP` 00PPP DP8s p@= :Upp@Aw|_|_RPG-@  Q Rx"pS`F #B'BS 0PS & P  0S 3P0 S` 1 VP  0S P P6 0PP `S  0S 0S=  0S000000000S 3/p0S* 0S*  PU UP ᾋn0S $?o W20SP P p᧋ pV0pX U !08i(p@-@P`@ {Pyps@-`@P@ 00S u  "U R `Q  `  000SPЍp0  V@0T0  L@-@ 0S 0 00h0 S@- P 2S@#@ T 00^" ^G-HbHHBTDrUʀ 0 ! $ 0  .!0Sa $ $  (0,0 (0, 0040 004 80<0 80< $@0D0 @0D (,H0L0 H0L 04P0T0 P0T 8S࠳ࠣo\p^ 0$0\@X`8pP@X@\`80T`!C`<0@0o$0@(0$$@`xX?ZMbQ^|_O-ᠣSMp00d&@ pt Q  G[SߍO@ 4a4 p Rk ZZ\ZZZ Z\ Z Z Zx  Bx 8 2/v>&RpPPU@; p&& r&R@ڰF@ 5 H|pH@, $2/x RnL R 2/ H 2/ 000 0;/8ydX 4JSߍp@fPPTX \    &[ x R@L R 2/ H 2/X \   Y R x  Bx 8  2/P  & &p& R & &pP&Rq && & Bx  Bx X0 4@4/~O-@0P 1DM@a3ph 6S06Y6S0606O6ᬐS 5  R !o pDЍ08#8S06đP0SP  0S0 S5T0岆0T00X#pW@p 40@pApX0\ 06S(X&06  o,03/@,K i @00@ 4/,hPJ0P0T00CT0 S @-@P6S@0 L0!608#86 S0\ 6X00 @4 0/03" /0S S/S /Su//N/0H00LG-`p @0SRP@ @P UL  o0D!P Pm@00@0peQ<@PPPLLO-0p#MP2`12@0t0P D ἥ@@0S  ȥzЍ1 3/@LA-P@`pGP0L S0@n|0D匥0@ \ QQ 0LP  n@00C@0P@A^LL @-A 0L|_Lp@-@x2dPS|"|"|2x" D⣥D⟥8D⛥D◥p@ =L, 0P/p"Rt"R/xLp@-`P@P #@pbtR N u $ 0@Sx2| 0|2pLLp@-@P0 p@A-@Pp`  Y  QA-`pP @  0@ 0 PP@TT 0 p@-@P pO-@Qp00,MP 0 `P 0#212ң0P0`@0Sk ,Ѝ褠D  ▤P00@0S  ᠤRT 000ᅱ  ;/0P0 R0SPLNu/0/@-@墋000@-@@呋@-@ @  L@-Lp@-DP@ᤍ1 01  p@譍   @R0S7`R0'Sp/@-8@0S A$u00Q"<G-M0@P`` pm` lDͳ0| :0S(,0 0$ \0000 00000000`*ЍZ@-0, ($ Ѝ@-0, ($ Ѝ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzA-<0Pp@`Lڌ!0 1LAp@-P@ E0DP@Rp@A-`0@SP E㏍ p PPŒX9@ ` 0\HP@DpL@ 04@SP P0T T`$ P LTZZ4ZL@-@\ P0PST T T0P  L㋌D刌H@XL0M00Ѝ/O-M8p ` @lh`d!0S X!SD P!SC H!S0 00!P : 0x00 00 000 0@hP)oPQ0 S S S S CjP @tp  0 400 ,p$@ ` @K,T00L00 ,p($@ ` @400 ;,<Ѝ|_Z^0ZQz_HZXz_0 @R/p@-P!A` ! 0RpC-aMPp@Aɰ0p 6 0` j0 0000P@``000*'PԂЍ"0000( $ #0 0A-@P`p/ 00  Q:00 ^ Q0SA P 0` `0S: 0  000 @ ``A@G-(r@P0T@`RT` P(PЍTV Ff Df0Z* sR Q HX TT Bg 0  P  nPP 0PP  0@ 0 g f 0 bpQ` PV *0`S R0B1 08C80 00 00008C8 QHR 0ꄎ!}_^p@-@Q`P 0 d0P @pqPTp0SpPO-P0M`Q@0  EpP ` @Ѝp0 0@S0VV0p; 0-Q V Q P  P P [[90   P QPP V@  `    pR5PUP 0S(0S' RP0S000  P0SP00S 0 SQPPUVy 0Sv p0S00R0SpPUea0 S0 0 PQV 00 0PJP3PpN}_A-P@k`P p   B:mP TO  fP@ 0@@T  R Q 0S  : T4 R1 R; 0P\d T0WP0S#0 `P0 Q``(0`,0` 00 0#00#0@|Q v  BR  \R\Q_ 0 Sl!0 SDJ 0S0S0 0 S0Q00 R Q RSR &0Q `U P0P0 RPPQ AQ  0 y}_}_}_}_0A-`pP0S k@PT 0 P 0 @6/P A-`p@0S KP@U 0 @ 0 P6/P <00S/p@-P@ ~0P@  p脎A-@`pp ce( `0PX 0 0`0d0(0 0 0P0000 0脎*Z1Zd$ZT*Z0S p@-@Pp0P 0p@/pp@-Q0S   Q S PpP@g$XP0   e 000P:hP`P` @TpP@ 0 00~ꄎ~_d ~_(~_2~_A-Pp`@ )xPP000q10S0@@`p@-P@0`S   00k(P}0S Xp@~1/1M/ 6G-`pP 0@T UK 0 'PAGR!0R"1S RP  kP P  kP 0SU P 3/P @P  0 P GG/0 d0  dA-PpS`  0S @1Q0 S 00 03/@P8/@h8@l9@S 0A/0S @-T/M~_ B 0P//p@-@P0@UPP :^N3A"Pp( Ep@c@`@@40 0 P/@-@M \ \S R   QjoЍ@-@P 0P P 00000 ԩꠎ00SA-p@W 0S `P0P 000/G-`܀P`U-0G < 0$px+Yp 0S   0R0 0 8]03/ឋ0S0C0ᴕ@TPꠎX~_X?\:Z@-@(e|G-`P @T@GK0 0G8E뼀80S`p;M (1LL0C(1Ha[ZY@LHL 0!< 04 0 (   !/Hzhzlz\ P/0 !8 0 0 (  , !/Hzhzlz@-Z03/[0S0C0q갎~_/A-Pp`@T叆@P70S0@S   0R 0 0  0S0C0pD( _P'`p0S 0 @ P 00@ @ 000谎~_US P/80 R\P/40//p@-P@PPpPpp@-0@SP  Q  DpP pp@-P@Qp`Pp 0` C pA-@pP`P =P U00P AP U000 Q;Zp@-@P PP XIpO-`\MpP @T@X 0tPP3@ T @P P0P @$QPPA RGX_ PL[@PPP7@n@P P3  ED0S0S) 8P  @P P@U D@P PD40@PU  L[^rPSU+TR P(04 R0 040L0(0S  3/Y  RB@D 0\Ѝ|P T" H0S pPHP[ (0S  3/THP T@U0O-pM@D0 0(5 `(#212=0P0` P,|,T T T[,PU00uj,ZPP00j3`V  @@ P  @P 40LP040,0  P,00,0(0S  3/#Z(10(1 @8WSs0  ]E0 82<"嬐YV 0 tZ8Wa P ``0S   0R 0 0  0S0C0 (@P  ]V4 @  P P  0 00S H弅7`=X  pP%LP<0S0P0$QP 0 PP 0 H0开Ɠ又1n `P ჈}H|0S `1#2!12Ѝ(0S  3/0S ,s DZ @81W P000V  @@ P Z: 8W6`T6 T T.`_Џ}~_LO-`TMP|~pP %30#P00S 0xPL0S P}@T@P'/P)4 \0P $`(HpDP0c@Q$P3lQM @  ,PFA@0S 0S40;   WP4Pట PTr@P Q㰰 2$"0 2$"4 P\x0 800 $`( TЍ40< P 040Z @3@ȐА@-@Pp`@P0$`S- P0 \PX0S0S;@0Sp S S $L"@P $0X\X\ (, /  X\ 0?0::SL PP $0P`H R R: W`$! p7/`K Fr450",p 00 yV F3 $ 0LTpP- EKP0P0<@K@i|!$0P000T00X0 p 0$L@Pn 0SPQ @f-@db@`@^LZ t^`000SW {pWPRU 01VP00H0a WVaAq\@^»^\ P/0 !8 0 0 (  , !/HzhzlzO-QM 0 ~ЍO3\ Ѝ\Q|x0 0|P ~m| x |  0d  h 0l bp t0dpWWWh R   0SK GR&7YD RA| R=d )` EP 0S U d FPdP`&V4004 0S43!"S@40$0$`0 0V1 ~oF0Vi P x m 0p lS tA0Q 3fh0S "S]2(0(0SX DSV <@0 00 00d0Pt0嘐S, PU) p0S&W W W<PP@C<9B030SB 2 030 @0 0tP/t00t0݉P2,0,@T D@DT*0000͉<@1808`V} ~oFydP PB P 0 d5/Y NYY<0S 0 0S#P0W00000D000 d0%P.t R R pQځPPH0404@ ,4 Q㸐 QԐ0Pt gPt00t0[PP^z<-.P 0 0 d3/d@PPCY y 00/@!b fgZ@^ƀ@ĀǀgfffA-P`,k,pp@%t `P Wk0040 0(0 0Ev 0@00ꈑiZp@-@`(PQ $kp@*p@-@`P pp@-P@ pA-@`p80P0 0 00#@ЍmZO-p`@PS pPL fP44喆P( P= 000E(P00  uU  E#Rp1GS ! R``B``0Z0Q  FT0QPp W(0S0P0 ЍT@Q^_Y^A-P@`pM4 Q  Q2 0&!0 qЍA-@PP`@pD0W 7H0L P0 H0L A0 `0<0SP@0P8P000000 0/p@-&@0@ PM R00P H`~$!$1Ѝp@pp@-x P 0MS`  0S0 0 0 @T  @  0P0Ѝp,-l 0/O-M`p8iPPK 405S0(/@ K40 S;000050< 02LZ0<0 ~  (L "L d@L`00dl0 0 00  00  il 0 Ѝ茓@-`0v#HXcЍA R% 03qA0AS   00  0RePgR0$!# R%000T0S p p0 >}000 0S0 0 00RT0T0S p p0 0}꜓$^#_^̀_ ^X?lZ^M_G-@P`0HpM,PD ЍG40>P P: ЍGy vPP!ЍG|40!  $#21240 0 +P 0  Q 0S (!4|3"(Ѝ5Z:400204048<0S0HP4074040 0 0H00&0PPT0 0H00&40740(0L0S 2^w__Ȍ@-`S`PR@ P $1 03/PZЍpO-`0Mأp P@P 6ᬀ 6S5 XI=@Ѝ3 V@433 /$1 0@4/@X T06-@wi0 0 0 i@F'P0! |@'P  $1 03/@T0@ 0 8ЍOꌓq_@^_q_O-M0( $$0P0$0p@0T0P v`PP M!i`0d 0 `0d ,i$$0PP 3" (He ,H$00  xLh004 0 004 i(,[Z P~0 0 P 000@T @DT)Y Z"~5 0R( @kh@0D 0 @0D h( x5 0 dx R{T d~  Q Q 44@(d @Pc~`2808@T D@DT J|~hX0\ 0 X0\ h00Ss H0<0<@0 #448#80(0SoDnhP0T 0 P0T yh`V`Z_hH0L 0 H0L jh9X0S``V (0Y SY$00 6 03 $XP` V :NP40"x ` ` @ rVp  0 0ap0  p@0z 00V0 0O S|gp0t 0 p0t h`8X0S( x: 00.40x z,0SB S*gg(0, 0 (0, g(0Y S  Y~7X0S``V(0S Yr( 0`P$1 0`6/`=[ V06 00 5 MP 0 0Ѵ6ᤦ㨶A gx | x |gL0S ( x `x0 zȠ̐ 0   (p@0y PZ5 X0pS@0<Z0 (o`P_@  R d1!01@@AGdꌓp@-\0 vp^0 RP0Ƞ@,Ƞ00   ! 0 p@4z 0, 04x^y__0 "zp@-@`P< VC  p@ O-<`Pl2M@0 0 0?CD2U5P0``3Xy`@P 4l衟< lPP q00PU:yЍ 0 S S R 000h  ?z0S4pP0p y @$04/pXy@W  @z W V h8z Rz` 0S 0 S S Rh   zUy @$04/)yZ@  z00P YV  hz z` ꨓMp@-P`PUpx@@8y @v Dm0LP0pM˃_Ճ_p@-@0@TpP P` pO-$P2M@0p@ 0lB!>540@P吢H0 0@X0xT DdP< d`PH00`VMxU 0bh@Sw Yt  $09/ yЍ 0 X S R 000h  ,by0SDT0 x $09/zxY  ,byY U hZy ,ty @P 0S 0 X S Rh  ,,ywx $0:/JxZ  ,2y00`ZU  h&y ,@y @P y&  ꨓMO-$M pp@P0 `fP 0倐hS [  $0;/@ x$Ѝ x @ ợ@MO- qdV Q ʀ !  , !p0Z@p iA00  0唀0 0$ hx R $@ !d1000  ! ЍHzhzlzMG-P`pU U7 $1pZZ@ VZ0UP d0' U+  eA aA$0h(P 0(0$0 000?x 0< }T`00`040<0  000  0ꨓM0SmO-0S4M%PP"P@4 P 10S R *R 0 S)wp<00`VEw ģ4Ѝ`` 0 bP 0h wJ0S" 0 S S Rh0  0w 0S  0R w 0 p$07/vp hw00`/ޅ]MA-d0Pxq@M0D 0S S2T1pH1p(@< /~U`F00< <0~@P~PĀv~hwhYpeY@Ѝ`0< 0C`00(}<0S `V0S @P 0 h@WvwMp@-HDP@`L@T403L0$ek@P p@MMDMp@-$@@PԵ0DL0*lp@ M0L03@o/M0 0 0 /@-@ XO-p 0M !P``  @ @P0Æ 0\ /a0 000000@P?o2P0SЍPZO-,`tWʀ 0! $!0     !`@ȐPU#` 0! t0 x   !00C0 00 0S0<03/w gHzhzlz~O-dM0!P`@ q mXp1!p0p@0c00@<P s 0  p 0d 0 x3` 0`pl!H1 0 0,p($  `<0TP 0 6rdЍ 0!<0$   @,(pP<P 0!0$ 0<0  @,(p+P 0!`0@0X0,(p0$ @ 80< P _]TZ^^xZ_^__ZXz_A-Pp`M_@0S 0 0 0 AQ_?eP 0@p 00S 0 0R000ɄQ @-!t/_@-dop@-`$P @P@p,_p@-@P@D@ pp@-P`@PU`U`/*U,8Z8Z8ZZ$Z8Z8ZZDZ8Z8Z8Z`ZLZ8Z8ZZ8Z Z8ZhZ8Z8Z|Z8Z8ZZ8ZT p@DT@DTTp%@DT @D@DT @D@DT @D'Tp@-@`P@T`T`/*T,ZTZTZTZTZTZTZTZdZTZTZTZTZTZTZTZPEUTZTZTZTZ|Z|Z|Z|Z|Z|Z|Z|Z|ZTZTZ p PEU pp@-P`@JPU`U`*UZZHZ\Z8ZZ8ZZ|ZZ(ZZtZZZZZZ@D T T Tp+T p@DTTT*T!@DT%TTT@ T@D&@DT,@DT @D@DT#Tp@-@P@TP TP 221#pp@-@P@TPTP *TZZZZZZZZZZZZZZZZZZZ00CS p pp@-@PP 0p.! " pp 0O-@plPDM(00 0<00,p$@ @@ @`V00<0 @,(p$@ @@ @GP0 0H0000,0(p$@@ @`< 5DЍ4_m_;_tg_/@- d@ | d tpd hdd \ Xc PLc @@cZ%_ P 00T@@@ppۄ_ГG-P0M`0 0` @p/<0 P 00 0 0 p@?o2P0S 0 S$  Q0ЍГ2 0O-DM(0 0P`! 2 ,`0800P$  @80 <00!1 0<0 (`,P$   0'!0tqt< (`0 0 ,P$  p 0!80 (`,P$  p0 00!08 00 (`0 0,P$ '(` `08! 0 ,P $  p` 0 ,00 ! 0 0P($ ~DЍ4_ц_$_Z_tg_@- R0R0 &*R#@ZZZZZZZZ@ZZ4ZZ@ZZZZZZZZ@Z\" \ 00Sڽ `\ \ `00SH00S0 80Q L\00SГ R0 Rp@-0@P&* R#Z0ZZZLZZZZZZmP@D T00SpT a,P X0P0 SpSp$00S000SГ 0 /Г@- ttap@ lha `\a T Pa HDa 88a,Zw_ГZ%_Z&_Z0&_\ZI&_Za&_@-0@aa aaa@aГP@- P0@ P@ dd d0 0X B@P HlЍ0GB@P lГZ__0_i_@- B 0RS d00S Q PQ @4`P ,,0NBPЍ,_Y_@-B B  \03< x00S @ `P PP0#BPЍ$00S _o@,_Y_ 0O-`Pp@DM(028 0p0 0`,P$  80<<042 0p0 ,`(P$  '~ 0쑟@P @Ѝ___׆_///0S/!  @-@000A-@`PpW0PV0SASW 0003s0#0S0  " \ R0@-#10lS0! @. TBo0PP P. /0S/p@-0@S`P `UFUp 6 600#00p@ 6 v600#00~PE@-@0M 0@d6 Z`6Z ZnZ ZP <P ZK6Z ZYZ ZSZ Z <P ߍ Z-6Z ZiP & ZcP  Z/Z{ Z{\ <P Z 6Zl ZHP & ZBP Z^ Z ZX ZX <P Z5ZI Z%P ZA ZA xt<P Z5Z1 ZZ+ ZPZ# Z# V<P Z5Z ZPx & ZPr  ZPlZ Z 3<P` Z5Z ZPU & ZPO Z ZPG Z Z <P; Zk5Z Z ;P+ Z\5Z ZjZ Zd ;P ZG5Z ZP & Z}P  Z ;P Z,5Z ZZ Z ;P Z5Zw ZwZq ZZk Zk @;P ^$^4^D^T^d^t^^^^^^^ P0C /-P, 0C C-Q`@PLM 0 6/|0 p10 0萟耟2pC0DPUQ 0#LЍ0H  #QHBFpBGBH  CHpN_R.0#HQ 0@ 6/  00\H0 00A00A 6/q_ ]»^P/Q //  00  00  00  00$  (00,  0004  80<0/@-@8M@P @ ]4C-PXp@DMp P` 0@DS DЍ@`JM@ WpO-0Pp@<4U 0 i I3il8`Y`( ZU0D0 ЍIP\80S   U@IyU@DDAD@\ZU@DDAD@P C-\MpT@T @DT00\Ѝ``HPP@LP000//o/00//p@-@M P@`@L@T@@L@T*@Ѝp@-@M@@`PpaP(00 0 Ѝ@-O 000ЍG-@XM`@@`P>p@@@DT00XЍ P@ kLPPU @Dt@-PЍC-\MPP@gကTQ  X01H0 RX \Ѝ !W Q A  0CC10S 0 Y 1 R  Q*10X @-p\M`pp`Px@TQT0# X01H0 RT \Ѝp !t R Q A  0CC10S1 01:qW 1 R  Q* 1<0T O-P\M`P`pሐT@T   X01H0PP PQ Q\ЍYT D PP0CC10S @ 0 P 1PP T*10@Y O-`\Mp`pP9T@TU@ 0)   X01H0`P `a Q\ЍUT D ``0CC10S @1 01:P 1`P T*`1<0@U @-@@PЍp@-@XM``hP0SXЍp  0Cp@-XM@@Ph`00P@XЍp?#? 00 01dPEU 0 R/R 0^0R/@-0CA @R A@BT R LP^- @A0@S0 AC^ 0 S LPR/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@.1 P//8@-@P~--8R0* \ A/Q :@/Q* @-000 0@0 ! 0#2 /UUUU3333 @-G-/ 0SAS/0-$(0@# A  A A A0/p@-@P` VPpR00- B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/\ S?/\S?- ^ S@-.o @-@oQPO-(p@@@, P`T @3,`VPW:/@P WRQp@-@@P@T@ P`Q@,PPPpQPp@-``` P@,@T`PpQPA-`` p@P+W PU`@@@-0 0(0000 0P 0@Ѝ [@-0 0(0000 0P 0@Ѝ [@-$0000 0vP Ѝ [O-pP+` zH@P Z 0 /@ Ѝ 0/0 /  `HQ p@-8R@P$3U @2C AQ   0 0#01R,# p 0 B 0#01,#  PE la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., Ƞ ľ a . `.. .. .l. a  ,J0 0##Ƞ#\#40Q <1̌ .0#,B/^0A-@R0@P0`?S  S *S R :[S0^\PP^1(R$#R& `0Sp0 R0 P P P`0SW pЍp]^ S -^ pQ[W 0]S RW00P0B?o2^Lo  S0p@- "!A0 P#.. "P!Q" Q Q00#&" p`04`@N8<#<# "^@E!10@("$"[@-@  -Ѝ@-@P $-@ (- 0"=^O-@0$M(`00p 00P0$00D2 0@00  - $b8"#4b4# 0  0%e#","0    "0 '0&f!"f+"! 0YR  @Pl.  .ɠ,),  ! b..  & Ơc, .c,   00000 00 00 000000000 00$ЍppP`wpP` 0(=^d=^A-pP@, $`QK ?PU(7  08R(#)8 b, `-`6`0pPDa(!"$a$"   -0Vh ,Ѝ@R )@ b,8 7 ),0(0G-PR0 p@q?p` @g(U: , 0$ 0 @PE 0$ (P`p(*?XG?0?PU  (, 0$ Q0 0$  0$ @H< 0$ @ ,  0$ @H< 0$ ?XG ^@-@P $,@ (@, 0"(>^ J@-@P @ (}, P,, 0$$H>^0O-P \M@00 0 0$8`00^?^p@-@@DP`QPU$  0pRPQp bj*H *@ *p@8R Q bW*.p o QL*0P0G-PR< @p@qp` gPU: *@0D 0 #@0D  H0L 0 H0L PEPP`pPS%g*@0DQ0#@0D H0L 0 H0L @0D ;  SD @0*H0L 0 H0L 倀HXG0PU  P7*@0D Q0 #@0D  )*@0D ;  SD @0*H0L 0 H0L 倐IY Gp@-`P@ ;P P @U )p@-@P @ () P) 0$$A^Vyp@-`P@ P P0U )pO-M@ `)0Oϟ0800000000 0<00<<0\0`0c$c< 0\ 0?8  " < " daa `!8 8 ahpaTa Pa.e!PPPlPede\ Pba. P`PgQ`&`pP`mete\ P@P@pbQ PpptbQ%Pntn pa bqx .btb, ]pfaa!&p| a!" `t` pe&aq ata $$p-npe.p`e!ftfl `(`(p ba.peqP``&`ete\ P,P`Pbq Ppbq'pnTn 0maQ b PP%Pbb,  4 4}faa!& a!" `` ]g&a -eQaa g% g. aDa b%g! $@ ,,@`,bA @σbA$ P @M,(P, P,Pn  _bQ@ ,P), a͌P% P%/oD `n!!  n!" ` 0-`&o&Hd! ?n1 @04l0#0#d,)?# 0 8;  +!!b,dq$@.( @`((b O@@O @( + p*i * p' n'ϠLσb $ ,뭊 "/"/"i.O@ ,(0@͌ @  $kA.i @$,@j4M )**k _,P_P )0P䝉P._%_%la 0k`& `4dAm . .$.(l$ +潋   i$ l fa͌ ..i&4 (@썈 (@  OP@kA&iq @$@DplM''' p kq,p'韃 pH`}o&$o&o&`h,oka) D`dA睉o&o&o&h$毠D毃 H+ ,, Pg$ *,齋_HP_hQ @Pi뭊_%(_%_%P_PL@g) ($@ꍈ!!kA)g @$@@jkq*_!_%_%p'@ $pLM!)})L?h*k1!,0/# 0/"0?"d! 0h!d1  6 0-   $gdg$h(, ((aaTag`d`@0mO O$bO$Xba g(p4͌ p $p nq(bqn(paqPp !p!!fqnqf pbq4 p"''lQ/4 l!f!P/n!PP ]"( +`/+, /P `!l!, /f! `D /" `/"`/"aa `aa! `ola H`-,$`,,eaaae o`aD`͌ ,*na*0Dean0`oaaH` l! )bA )Hbn@e@P@M!(P!!lbnL䍈!!0!`l`b@ o"o&o&dq/@ d!`!p/l!$pL h}", ! !/, h!d! /`! T ͌/" /"/" n!h!n /d!$@X /"/"/" g!n!gA @ /h!@T lM_"0 _%_%/0 l!g!/n!X 䍈/"/"`/"l L?`g1(p40dA`$?#p)?#p?# 0 p2lqPp,,,ph$,`q4 pn͌ ''ha.4 `&`Pm   POi.hA ! D@lO$O$O$ @i,O@(H@.ፈ..$fA,i@$@DaM.++fQ! HP%P,) ])h!!σf " @dAha$, `&-,$,,`!m!!e$ᯃh.@ b!(yZnܼb((pe"p(,@pO$O$$((@f" OeA0@nfq._$ @p' _%_%O@pL @}O"$ O$ O$h!.䯃f "0` `-&(`**ha 꿃`&L `m.._.g 埃h.4 b!((,gA"쏃P@$@   f"!g p4Mn!p !!$Pf!. "P /"(P/"/"80?d!. "f10 =00000`10<0d1 0\000Ѝ000,00(00$0 0 00000/#EgܺvT2A-0p! @` :   1?0 ?RP @Pc0 %:?0S:00 GA %-@P@-@ P0`S  !00"S  tpp0~? S U 0 # !1" 0S Ѝ ꅊ_HA^0A0CR/00L0#40L00L00L 0O-p0LM 0@084Q0Q\<0 8 0 p 0%00#0(<$ $ !l(a8 $  , ǁ@ #  " (b%  0!00#p0<, ! pa " ,ǁ(p #  " b% 0!00#,p0<, !0a4p)NON " ,Dǁ #  " (b%0 : "R?0V FA"E@P7@-@P + !? 7R8 bx b8   X  Ѝ0@!JA^0`( a!"$,a c"/G-P`8 p#T0.@``T%0  ) Z0DD 6ੑ  cZ&1000DDD0DpW@@@%T-M Ѝp@-@ P` !LN) !@ApA-`PP#*p@P P  PPP 0PL0X D0X VPD`VP`iyaratcidA-0p3@n 0P 0PV@PP @ `0*.` 0@P` WQ@P0HᯌЍyaratcid@-MP@@@`@pT:Ѝ Pp0P00 Ed__0 ~yara0 꼭0 utcid0 꼭Ql/yara00꼭Qa/tcid00꼭 / /p@-@P 0PPptcidp@-@P 0Pvpploob@-@@@-@@@-@@@-@@@-@@@-@@@-@@@-@@@-@@@-@@@-@@@-@@@-@z@@-@t@ @-@n@@-@h@$@-@b@@-@\@@-@V@@-@P@p@-@JP[ (0P pP pgntsp@-@`7PH @0P pP TpatadA-pP0 X0P `n@P  P @ဋgntsp@-@RP (P pp@-@P p@p@-@P<  p@???p@-@P.  p@000p@-@P p@p@-@P p@p@-@P p@p@-@P p@!P0/A^͠^@-ZZ@@P\DTPP P" P; P\ÀP0 P P\(:P0P0P 0P 0 P@\0 0 P@ :\0:`0` SP$0 S 57$00$0/@-(0$ @ BR00C#$0$0,0(0@-@$ P *  L`QP$00$0Ѝ  p@-PQp, @Rp$0( 0CQp$ >!Pp00@-S@ @$0,,0<000G-@P8MeY@ , `0a0000P SF SF S40 0 YPP`pP@XK FX Z:X =X *X # i@ Q l ` $0SR00#  C R00  R00  CT$@8Ѝ33 S R 0C# 0   Q b@0S00S > #@ 0  0 SbX fX ?R0@SQ)0?S R  P  c5S CP2QPx B0  PU !p  ?Rv0@Ss`p b6b` B@S7a7r  C# c,1 cp0 0FXPE  0  Y=  0 fP40FU0= 0R9 WV$0  Q  0fU0'0 S# WV U 0S Y P0  0S  0 P  l $0SR00#  C%#jo%ju%#jx00@-MB0@Ѝ0/p@-@P` TPp-@-@`P TP@ Ѝ/p@-@P ETPp-@-@`P TP@ Ѝ/A-@`Pp TP-@-@`P TP@ Ѝ/00/0-P@  P 0S RP0/P*0    PP0/0/0R/ \/S/O-P0KM0 0000000 00$0 0(0$0,0(000,040008040<080@0<0D0@0H0D0L0H0P0L0T0P0X0T0\0X0`0\0d0`0h0d0l0h0p0l0t0p0x0t0|0x00|00000000000000000000000000000000000000;04 8T`. 00" <0," @" Dp" HP"$ L@"P(  ", !X0#\`&`+d*h(lp'pP%t@$x "|)0#`&+*(p'P%@$ ")0#`&+а*(p'P%@$ ")᫿ +! ! +$ό, ό. . ,᢯*p0?0#`P@$pP% ` /`&pP_pPXP\` "P!`+q~Q^D`XP@P`,\pP.s%}S&]P``PpdpP% ``&u%{U&[`PP`,pP.wxWX`PP`*pP"zuZU$`@P P`*DpP"~%r^&R`P0Pdp`!4P&~P+r%^RP`Pp`% Pp,P%yvYVPHPp$`"LPtምP*{T[P`PppP% ``&q%Q&_`QPqp$P#g%iW'Y(pp#৒}rpp崐!p娛p+{tppȐ"p(p*'t|ᤀpp$p#'t(|ᄐppph "tp.l*|s,#,੪ሥᨊቅ .),( 娀!଀+ !)x #|媼 $ᩜና帐< .༐ ,஑ጞΌP0#T@$#:$68@P0 1. @ @$.$JA@@D 0$000.0@0@D010$0 10.0 1@$1@00$ 0D00.$0 1$@00$(00.,0PX0@\0 `00$00d00.40X0@0\P00$80 0.<00@0X00$@0\00.D0`0 @d0 00$H000.L0P`00d 0#P0 0*T00,0X0 0#\00,0`0 0#d000 ,h 00#l00 "0p 00#t0 0 0 "0#x |0 0 00 " 0#0 0 00 " 0#0 0 00 " 0#0 0 00 " 0#0 00  0#000"0 1 10 " !0#0!0 00 " 0#0 1 10 " !0#0!1 10 " 0#0!0 00 " ! 0#00  "$0# , !1Sw000 00000 00$00(0 0,0$000(040,08000<040@080D0<0H0@0L0D0P0H0T0L0X0P0\0T0`0X0d0\0h0`0l0d0p0h0t0l0x0p0|0t00x00|0000000000000000000000000000000000000PKߍB^B^-@-(00S@M ЍЍ/Y@-@ / ?!BC%! @p@-P(?@P 0P0 0p0B^00@-@0 0 hA`000S DHЍ0$@TP ل0 $A-P`0pS 26@P ` ptl$T` P崄<@A@ ᧄĭTe[ $0@- @ 㳎 0B^P 0R @-0,QSo//͠^ 0SH`p@-P8@"P }P p@4pߊ_LA-pH@P P9`Pf@` P-@- p$0 0K@P Ѝ@Ѝ/`PP  $00J V»^@-@@ Ip@-@P@p X0R0! PP  0Q p@)B^͠^p@-@P L0R ԃPP (0Q p@pB^͠^P/ 0R /B^P/ ,0R0/0P//B^͠^\ ?o@-L2^0S0  Q 0Qe0 /B^͠^P/ 0R/B^p@-@PPp 40R rPP 0Q>B^͠^P/ 0R0P//B^͠^A-@PЍPo0 RQ R0 ` 0`>pP  H0R Q0 , &J `pPGB^͠^YO^A-@PЍ 0R0 p 0P`P 0< S0p, I P`PB^͠^YO^0P -?o42 ^0S0 S/B^P/ 00R@- 0Po/B^͠^P ?oH 2\0S 0S0QS/B^͠^fP 0R0P/B^͠^f@-$0pSM W`PV `0P ⍂@P 00 0P S ᛂЍ  `P  ߊ_ 0S/-S0-S0>S/00//p@-@ PQ rPp0< 0 Ppp@-P@AQpPpp@-@P` 0S <P P p@> P`pp@-P<@P /P P >P p@ pp@-@P` 0S<P P /P >P p@  P`pA-@l`lplPAQ<Q >Q &Q |P^___@-8@lP $tP @ KC^_@-@P@="_@-㎁@P  ㉁Pᢁ@0,0 0ꘁA-pQ@P ,b  0@0S<P V3 0S !S0-S0E?o 2-R0SP/S8PEU0SP (P ` 0B0S*\30FW0 S  P0/S0$0U0$00>S`0 >R    0P>R/R R R  @Q0"P  0 @Q^ C  "R~ R  x 0"P C  >Ro0^ =P PdPa0@- PP0<PK &P @aT@mT#@pTE@;TBQ ^=*lT gTtP3;P0>tP*;P'<pT"oPsP;P'qTuPoPtP ;P"SU00Q@- [o/@-IM@pQ`V P0P P Iߍ 0 P PP 0P5/0 0P0 5/P 00  0p3/P 0 0p0 P `C^G-@,PP `p@@ 0B0S<R P'V3@  P   P0>SSS @P@@nP @@__(_KA-M p @00S 3/P0`PP V 6/0p Pލ0 03/V@ 6/T *T T 00P00S 3/`0@"P T 4/003/003/P T 4/p@-P^@P& P $0SP 0p P P PP  (PPk@p"_Z"_P0/A-PJM U0`0p 0 `` Q-0 @0  4/@P T p0  P$ 00 0 0[PU00@0@  nPJߍ0 000 003/ 0/0/@-@@ RC/A 0\R#R! R/P 0 0#/-0 S RS R RP/$0S @-40@̭8x}[%8@-@! (M P P  E@dP(ЍOP  t _F_>_p@- @P*;p8@- @ 㪈  8 D^ 00 S  \: P03#/S  \ P0///p@-P0S /vp @P a守嫈!9@P tT_LY PP J4嗈0:@p @̭x}[8_Ao/0 P R   //p@-`P |PP@p\6@P|<6@P P(0 P`000@HD^_0$0S @-]-@ԭ0[@- @   @hD^G-@pP`VU@ 0@焑PU@ `F¦`@-@)@&p@-P@@ȭsPpp@-P8@RP P p@dpߊ_p@-PP T0Rm{@P@p,00$000P00 0HD^[[0 0C0s@-@P 0U S g{}l7Ѝp1PP`P 0 0PP0 0C0]PP@A-` pP!{@P W @` ! @`/{C-@p M`P { .00PЍ0  P (0S {0  yP (0S$PU00  0 P 0 LPSP  MP P0  P S^T_L[p@-@P `\0 R@VP PPPV @p,HD^O-`@̬0SOthVP@ )P pP 00 0YP+ V7 0 S2 00R.P P' +P" P >P 0  03/P -PPW 00C 0 0S0%@J P PS^HD^T_0,S<S6H8(@-@, 4p@-P@PF 0 0 0p@蕬G-@P 0R@ p/PP`@ 0冡ᆁ!  0冁 0` 00V:000HD^0P ,0R@-P000/HD^p@-@P000p@Gp@-@P ,0R@P@8pHD^p@-@P L0R@P`ѫ0S@#*j@pHD^p@-@Pᾫ @pA-@P x0R{Pᩫp0S `VP 08`P pHD^p@-@P @0R@ P`ᅫ @իpHD^ P /o00"\ R00\y/HD^O-@Pi pt2 R0X  _PP @GpF@L0S *I CPP 4偃0Q=P8)/s P,U<UU x3P` h  @P 4PP PPPGU@R Ѝ` V P 0p000000  P [K ! 0P0 F@ B!  0 P 0 0@HD^ԭ[04H8(xD^G- `PV@x 00p >Px0 GR0P -?o<2 ^0S00 S/HD^@-@P+ 0R'P`u0 yP 0 0 B!S 00C0000RP Ѝ@詪 ЍHD^0P/?o( 2\0S/00 S/HD^0P -?o42 ^0S0 S/HD^P/ 0R/xD^0P -?o42 ^0S0 S/xD^PG-@6 @`TPp P*  0 S @EC  S 000 01 0 01 $0 0P@ @p@-P@P Pw Pp0 03/P P P0SA-pP`f@P $Q@fw0P@ AK/S^p@-P(G2@P 0P0 0pD^P 0RR @-/o//@-@0P Fw3 0Sp#G-P`@PR  pHWW(G( 0"! 0 Pa#<`P%c?P6  P0 ` P* P P$ pGP匀W%1 ``P R0P&RP ~P Wa<`= tP =oP^D^O-Pp @`QU A R<QYm L[" =QX b PC Y [ [X[[U T8*@U0 W- @ " @U0 W @ ! @U T*0@00@0`<S S CR=S Q"0S 0CSR30 R Y Y( 0<S@(0@SD^A-p`PV@P&vPPS  P `PQp@-@@0PP-vP` v@P0p  0P @ PQPp@-@PP@PP @p@-@P H0R00S  @P000@D^P/ 0R /D^P/ 0R/D^\ ?o@-H 2^0S0 RRQ Q 0 /D^p@-@P <0R Pp P uPP 7 D^0P -?o42 ^0S0 S/D^P/@-@@T ?o 2^0S_oD^A-$PU3pP@& 08!P( 0S%    00 R`@uPP 00  0wP Qu 0lPЍ 0V dP V 8uPP P*uP `+J^^/P/?o4 2\0S0SP//8E^p@-P00S $n& @U 0D@pܭ[p@-,@,P}0 0xp8E^ 0 R8_3_@-@P 0R@8E^P/ 0R/8E^0P -?o42 ^0S0 S/8E^0S$0S @-0@  /3_00C0/0 P R   //A-`P jtPP@dY/@P|tDQ/@P P4pp䃦0 P`000 XE^@-@Ѧ@ΦPG-@" @`TPp P* e b0 SS 000 0! 0 0!@$0  L @❦⛦@p@-P@@:Pጦpp@-PP T0Rs@P@p,00$000P00 0XE^8[0[A-Pp@0S`AP@T kP `P 00 0 4PP  00C 0 0SL@0 03/P DP P-_s@-P@ T R s⿥`30ЍpADAP`@ 0 0P@00C0@@ A-` pPfs@P W @` ! @`ts@-@p`P Pw00 Ѝ0H  P (0S @0 @{P -_[0 /p@-P0@Q K0 Q000pPpp@-P@P< 0 0 0p@若A-@P x0R@ %{PP` u@ 0q 0q`0V:000XE^@-P000p@-@P ,0R@P@MpXE^p@-@P ,0R@P@;pXE^p@-@P L0R@P`Ԥ0S@#*(@!pXE^p@-@P@pp@-@P㴤000p@p@-@P᧤@@@pp@-@P @0R@ P`㓤0S 0@ApXE^A-@P `0 R@pP{0@0S@Ť 0` 0a000[@XE^p@-@P <0R@ P`Q@ᢤpXE^A-P`U@ pP4200- AA-@P 0RPp"0 0a Ap 0!1 0S0C0000aAXE^0P -?o42 ^0S0 S/XE^p@-P$@P Pq2Pp0 03/P P P!0Sp@-P`@P $0S p@5p/ -_p@-@P` =Ppp@-@P =Ppp@-@P`E =Pp0-!00!!1Q100 000000 0#0, 0# 00!R0Q000 00 0 00R0000!00p@-@P1S 0p`%T 00S 00S 0P0!  T# 0 P   R   R  00000p000Sp@PP@1S 0r!000p@i000 0/A-p`PU@@ @E 8/P QG-`pPUV@@@F@ @E 9/P `QG-`pPUV@@@F@ @E 9/P `QG-P`0pX@S\@ @!  A@@ @H :/0P ?! Q@ \  !    A@@pP!R 0 000000T 0S001 S@o 000Q0P 0@/-" P  0P CR000S AA- P`@T0 \ R ^  0 TT 0^00AR"/o"!T0#00#000!0000\ !0000000T   " 0S`   T" qW qW2 8 T&aa..1000T0\00RqaaT  0S RP/0    P/-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/0BR"SO-q7@`0P pE UWpp-UPp` +UP`00UE00XS 0 A B0C QRP@`T@@Ŀ 0~  0w00E ^aE\WEAE\ 7E T0S0:0QP00\00S 0!0PT@ @0 pY ЍY S FE^_0BR"SO-``6@`0P pE UWpp-UPp` +UP`00UK00XS 0 A B0C QRP@`T@@ğW 09  0  0h000E Xa0ESW0EA0ES>70ET;W% P=Q PPS^3 .QPT@ @ 0   \Q PPS^ .[ ^F Ѝ[E^_0BR"SG-R6@`0P pE UWpp-UPp` +UP`00U400XS 0 A B0C QRP@`T@@  00E \a0ESW0EA0ES70ET P  S  R 0 PT@ @  X`FXRE^_  0S S/P/$(0#   @// / ////H-M 0ЍH-M 0ЍA-`p@P0 8#@T0P@7@-_/"Ϡ R# O,!0 P z P! Ѝ0 0RR! R/P/0@ 0A0Sv*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R*0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/ R.0 \ Bє BÔ4 B24r- B R5:@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@* / R:@P`p@@P` R@* /@@t@P B@@P B@@P R@/ R$$/ 2R $х $Å/-\{F ,DP`pL%T\&dl't |@P`p B R*R:,DP`pL%T\&dl't |@P`p R/ RA2n:,D R L@*Af,HP`pH%XX&hh'x x@P`p B R*R:,HP`pH%XX&hh'x x@P`p R/ RA2::,H R H@*A2,LP`pD%\T&ld'| t@P`p B R*R:,LP`pD%\T&ld'| t@P`p R/ RA2:,L R D@*A /R $х $Å// 0 R/ ! 0O /0 #4<0/0 80/0 #<40/ "4"0/ 0 0/ 0 "$$#4 0/ 0 0/ "80/ 0"",$ / 0 0/0 #4"<0/ "4"0/ 0 0/ 0 "$$ #40/ 0 0/ ! 0O 0 0/ 0"$,#4 0/0 #( / 0",$# /0 #0#<4"$0 / 0 0/  !<0!40"440/ 0 0/ 0(#(0 /0 #$#, / 0 0/0 4"0/  "$,! / 0 0/  "$$! / 0 0/ ! 0O 0 0/0 #4<"$0 / 0(#88 0/0 4",$0 /0 0"##<40/ 0 0/ 0 !Ġ"ĠČ#4<0/0 0,8( / 0" (#8 0/ 0""#< 40/ 0 0/0 #<"4$0 /0 # #"$, /0 0,80 ( / 0 "ĠČ!$ #/ 0 0/ ! 0O 0 0/ 0,,$ ,#$! / 0( #8 8,0/ 0 $ #< 4,0/ 0" "$# ,̠  / 0  0 / 0 "$$ #$ <,$,!0 / 0  0#8 8,ȠȌ!0 /0 ,#88"(0 / 0"Ġ ",$#< 4, 0/ 0 0/ 0"Ġ,#$<,4  0/  "4 <0,4<0!! / 0 #( 8,8 Ƞ!Ȍ!0/ 0 "$$#< 4,̠Č! 0 / 0 0 /R4 R0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/0 P0/S0/ P0/S0/ P0/C/011/A-@pP`P dPp` P102 P @-@\& P QRS  T00dLQ R S "  T  00 A-Q@`pPS2U @R'SP U @0C @g@OoU0@d08D/o?o0CS c"U@SB BU  V 0f0?o c0B0C8/oo@p !1 Q  a4Π81@0 @V@TΏPO0QU  @@a4.Ό8?o/o0CS 0 Qm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /~-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/@-+렋_A- % M222^+[P Y1A!A%bkZ-5T9?d PfRkij l 9w[.^G:{[}]{@l`0%m ;f"4;< x 3Q% 30S#* :3#Q% 53#Q% 5Q *cA*>dmiw+0M니gi뜨iui`0  \08S()u9n5kT 3R @00@0 .U pY2p' ,Nbi; @ggGj }&v 0\"  000T@P8<4Qlx lHif밶XUQBr^WP'LW,1g 2l1@T(ll@⁾U < 1 @10dx1X P. l*(0 000rs/Ǩl!( A0( ?A3c01|pW4l@[ 0[q0AD 0XPXk000"@lϻo|>D?,,@? N'2e!_̀<P{!_ӀK!_pMb@Ӏ]:_@,>@8>@P>@h>@>@>@>@ioexp_set_backlight ["$&'X4gklr'/57<?BCEGHIJKLMNORUVWZ[\^_:;<=>?@ABCDEFGHIJKLM/57<?BCEGHIJLMNOPQRSUVWXYZ[\^_,[[ m1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & '(7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FKT]  1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & (7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FPQSTXY] <d b _ ] Z X U S P N K I F D A ? < : 7 5 2 0 - + ( & # !    pmAc@܈__@`@a@a@Q^^00EQ^^LQ^^QQ^^VQ^^[Q^^aQ^^fQ^^ lQ^͠^ pQ^͠^ vQ^͠^ zQ^͠^ ~Q^͠^ Q^Q^Q^P^Q^;P^ Q^Q^ Q^Q^/Q^nP^oQ^Q^0/xP^nP^p Q^(U^Q^Q^@Q^Q^Q^Q^@Q^Q^Q^^Q^^Q^^Q^^Q^Q^Q^Q^Q^Q^Q^Q^ ^Q^ S^Q^ @US^Q^ `]Q^Q^ _Q^ Q^Q^ R^Q^ R^Q^ PS^ R^ 0R^ R^ P+^ R^ pR^ R^ S^Q^ R^R^ ^Q^ R^R^^"R^ 'R^+R^1R^7R^=R^7R^CR^7R^IR^7R^OR^SR^YR^SR^ ]R^SR^0aR^SR^@eR^SR^PiR^SR^`mR^SR^pqR^SR^uR^SR^yR^SR^}R^SR^R^SR^R^SR^R^SR^R^R^R^R^ R^R^0R^R^@R^R^P V_R^`R^R^p_R^R^R^R^R^R^R^R^R^R^R^R^R^R^R^ R^R^ R^R^^R^R^R^ R^Q^0r_Q^@R^Q^PR^Q^R^R^^R^R^R^R^R^S^2S^S^2S^ S^2S^0S^2S^S^2S^S^2S^ !S^2S^0&S^2S^+S^0S^7S^0S^=S^0S^CS^0S^JS^1S^OS^1S^TS^1S^eqnecsccmiplvsvchilsgeltgtlenv͠^͠^P^P^͠^͠^!P^'P^͠^͠^+P^1P^͠^͠^1P_C~^0.01.02.03.04.05.00.510.0daiadbibedeafdfafafdeaedsdeppmzTm@\m@T_bus_dma_busaddr_to_paddr_bus_dmamap_syncsZ^Z^Z^Z^Z^Z^Z^Z^Z^Z^[^[^Z^[^7[^L[^VAe[^\\2PVAu[^\\2VA[^\\2AVAS\^\\3VAZ\^\\3 VAa\^\\3pAh\^\\3qAo\^\\3qAv\^\\3qA~\^\\3qA\^\\3A\^\\4D \^\4D \^\4i \^\\4`Rf\^\\4 i \^\4qA\^\\4TrA\^\\4TtA\^\\4TtA\^\\4TA\^\\4T A\^\\4TA]^\\4TPT]^\\4T`A ]^\\5TE`A #]^\\5TE`A #]^\\5TE%V -]^\\5TEWV <]^\\5TE iN]^\5TE $iU]^\5TE0$ic]^\5TE ,iU]^\5TE0,ic]^\5TE .iq]^\\5TE0.i]^\\5TEAi]^\5TE!i]^\5TE !i]^\5TE)i]^\5TE )i]^\5TE-i]^\5TE -i]^\5TEAi]^\\5TEAi]^\\5TEAi]^\\5TEA ]^\\5TE A ]^\\5TE`A ]^\\5TEJ`A ]^\5TEJ`A^^\6J`A^^\6J`A!^^\6ZK A0^^\\6KPA=^^\7ApAJ^^\7AAW^^\7A/Ad^^\7A?Aq^^\7AA~^^\7A/A^^\7A?A^^\7AOA^^\7AA^^\7A/A^^\7A?A^^\7AOA^^\7AA^^\7A@A^^\8A0A _^\8ApA_^\8ApA'_^\8AA5_^\8AXVC_^\\`AC_^\\XVC_^\\?AC_^\\@XVS_^\\ AS_^\\@X/VS_^\\h_e[^a[^j[^q[^[^|[^[^[^[^[^[^[^[^[^[^[^[^[^[^[^[^[^[^[^[^[^\^\^\^ \^&\^0\^7\^B\^J\^c_^j_^p_^v_^|_^_^_^_^_^_^_^_^_^_^_^_^_^_^_^_^_^_^_^_^_^_^_^_^_^_^_^_^_^j_^p_^_^|_^_^_^_^_^_^_^_^_^_^_^_^_^_^_^_^_^_^_^_^_^_^_^_^_^_^_^_^_^j_^p_^v_^|_^_^_^_^_^_^_^_^_^_^_^_^_^_^p_^v_^|_^_^_^_^_^_^_^_^_^_^_^_^_^_^_^_^`^_^_^_^_^_^_^_^_^_^_^_^`^ `^p_^1`^B`^S`^i`^z`^_^_^_^_^_^_^_^_^_^j_^p_^v_^_^_^_^`^`^`^_^_^_^_^_^_^_^`^`^v_^|_^_^_^_^`^`^`^_^_^_^_^_^`^`^`^`^_^_^_^_^_^_^_^_^_^_^_^`^`^`^`^`^`^a^a^ a^a^a^a^a^"a^'a^,a^_^j_^p_^v_^|_^_^_^_^_^_^_^_^_^_^_^_^@d^D@+d^@=d^D@Pd^8@bd^d^8@d^d^8@d^d^8@d^e^8@,e^Le^8@ae^e^data_abort_handlerbadaddr_read@````` ```pmap_map_chunk ERROR TIMEOU DFwd_flushcachewd_trimn^ o^|n^n^n^n^n^%o^Sn^jn^|n^n^n^n^n^n^8KAJAPA_A8cA4^A]A|S\wd_setcache9o^Eo^Po^PALA8KAJAhIAhLAEABACAVAwd_standby8KAJA^A^A_AhRUSP]A|S\$iAtALhAqAgAHgACCCA@gA8gATAatastartata_thread_runatabus_threadXA،A@R@RTAhRUSP@R #(-27<FP d'SpectecSDIO WLAN CardSDW-820e @ }^a}^P}^}^ ,}^@P d' #(-27<FPpmAA~^^pxa2x0_i2c_intr_subD{ByB^^^a`f`dXY`c`~a`f`dXYJ`c`adYc`*c `@a`~dXY`a˃YYӤ`c`eEK`a`e`deFX+FY`c`Na`deFX+FY`c`a`deFX+FYi`d `"b`eԀ ̄eDeD̄|c`F܄Ѐ`F `F܄ЀdcD܄P3D`|a`XOxFE`XOx`bfDed@*``vc d`e`cd`4b`~beD`0`P`y````EĄ$`0d%`E)``d-1`d&*`d.2`d'+`d/3`d(,`d04$Ą57d@Pcd@T@U@A@B@^d@R`:e`@* &`b`zbdD>`\e`@ &`bdDL`bdDFd@A@F@G`c`d`fcdY`Av`_xu``*b`d``0`x0Dbcdefl@AC@I`x0DdrD`Rd@@܀d@@H`@: g`ed@:dpmd@Kd@M@G"d@L&D@Fe`@&:hhddV`Tl@`DdFGg`\bdۜ d@&D@F'D"@Gd! d!=D@]D|@^=D@]`>D@^FG`d0Dd@@@D@C@B@A`d@N<`jd@M`Vx0D` d@@ d@K`edd@\` x0D``O`O`6C`@C`D`RD`4E`}E`XG`G`H`GH`I`I`J`J`4K`K`XL`L`M`M`N`N`@`@`A`$A`B` B` :\+t@:\+ t@:\+t@t@:\+1``:\'1``g`d:\0`g`d:\:\@'```0`g`d;\;\@'g`d:\٘`d>@g`Lbd d@H`d@Kg`Jb`dd@Li`qd@@`x0D(`eddd@FX(`XOx(`XOx)`XOx(`XO;x'`XOx'`XOx'`XOx=`/xN`aAM@`XOx-A`XOxOfD`Av`|`dٮ0`x,E?A0D 4C)D"&:*Dt )D@I$A`eŔ A@d>D&Ad>D*b dg`Vb܄g`bdd@IrR2{MD)D@Ie*`xd@;`_x`tDt@^E^@^|`"bXOXOXOXO|XOXO =D@]@]-`xe`Gc=D$@]4@]`G`Ac=D$@]4@]`G`Ac=D$@]4@]d@&Dt@^|`FbƂXO`d`T2D+D@^=D@]>D@^=D@]d̄>Dw@^D4E^&D@F d@LLN%dKt`xaFG`x>D@^F`}`>D@^FG&C*PCF*D# Dd@@rE܄`UeR$܄'܄(*D܀X2@*]`x-D & &D@F6]'D* @G-DX67d!&*$@Gd!*D܀X'D*@G'D*@Gd!'D*@Gd!`x&D* pDЀddP`xd"F)`ddd!`xdFG d@L) :`d`E`dĄ܄?k>D@^=D@]>D@^=D@]d̄>Dw@^"c*c(D& %D`Fa^+!F (D6 cD|@^=D@]`}>D@^FG`xd`fFB`|E5[`d܄ڂ܄`xA^d@F!FFELd@L&D@F.D `zbd@*fihD`E|ihD`Ge|ihDЀdD`G% 6676n6&|"5dW.DlC!~iÔg`^b܄d'D@G`xd@6`x|@En6576&6 6Z`d܄ڂ܄!c'D@G`t`xLH LHLHDžǃDžメLHǃ'σHCCLN|МӀ DZ`d܄'D@G`t`xRJpRc(DlE.D+ eDP*&D @FЀlDąЀa(D*@'alDąЀ2D*'(D6:d8d`x@LlDlD a(D+a`@@'ANlD(D666`xa@"1lD(D:Ha6(D:MaIaAMFNd@Le-D* -DI6H:e'@@&0e`x50elDlD`x5EN#D`C`xlDlDlD&A &-D"2@*P@Md`d܄'D"@Gd!H'D@G .D$@AFp@MlD a(D+a`@@+ `eC(D@H)d"#DAN &(@@'@C8lD#D+d@C8#G?eEL!pEԀd`PlD.D"&#AlD4TlD.@ *lDlD.@&#AlD7?lD72D*bFEڂlDڂlD#Ax|eaCрFE7dCс||;H#DЀ`C `xlDlD]>#A>||e%DՀaCE56`xbрFEa@&a\adCсDZ#ՀaC7bрFEDa@&a\adCDсDz lD|FEdlDZڷdA(D@+2D&lDD}@^d̄=D@]`k=D@]>D@^(D@+>:D+`:\+t@:\+ t@:\+t@t@:\+1``:\'1``dg`d:\0``}`>D@^FG/Xd?;D@'@`@*`xA`@'d@*g`cew+d@* g`c0en@+ d@*g`cee ``xd@*g`cUT`*e0/`AdCDaGD냓`eD`Ncǃe`@+\aнPYЀYЀЀeDT`Nc~e`@+\aнPYЀYЀЀeD =`LdăgD e""dD@[dG@[dD@[`G`AE7cBcd@: cZ݁`Ea_@[eG݁a_@[Z݁a_@[``d@:``3`d?8(d@IFJd0D@Q`x@*F`@&e)C'D`A;@+`Ww_Ɂ`Ww_% &c@J`F;=F8*F`@*c@&c`F+FJ`Ww_`G c@&c@JCIAGd0D@Q>|>=FDG`@& `x=F`edC`x`x`xL/~ =F>`xd0D@Q`0` `d>>@:D;D=F`c`|`xwD`W@J*1$D$F ,@D`F`\` ddD:D&u;D@[ -EԀZ`pd܄ڂ܄*D*#D<`@d@GXOSFCfC`\`"ddD:D&u;D@[*D"K"D`FFd@B@<`Fd@GXO+FB7"fC@*`$d:D&u$;D@[ *`$d:D&u;D@['B`F /X*D*!D`F<`pd@GXOFAfC`d:D&u;D@[4@&;*D :D* ;D`Ud@Z@[=d@J5@*$A@U, GXO(FDf\` d:D&u;D@[5@*#A@U`}x5@*"A@U`x5@&4@*!A@U@T?`ha'BLAN@E`F @K`^x+D N.X%F'CսFEcEdC`Ad۾eC%DaD aF%D %D'C`F fD.X(AXO.X(A@XO(AXO&XOV.X|c@EeeD܅`F@E3DT3D`|ddЀ/XfC%FaDg<~dd# acY/XL|aXOc,F%F,F%FdЀ dFgXO.X'C%F%D `F%D ܄/XLXO( GXO.XLXO GXO^.XLXO G'D %C cF'C fCdDX`F%D .X%F @G dC'Bڂ$ʂ`F cF( %Fd 'B̄/X%F#`F xgg%Fd%DXOXO'.X'C%F %D`F%D %Fd %D/X%D%F|d/Xa%D`FfC݁3EE3D/X%FЀdC`FgddFFEXO.XfFE)CfD%Ddae<`cCÍ`Vx&Ԁ`EѽDGDHDE`dD3A@E`F`|dM3DdЀ/X  Xee 0DP@Q0D}@Q?*F\g`Xbd`.d@D0DA@Q?0D@Qg`XbdBe`A #`E`A6aDd@&d8989܄8dD$܄`\aD9da\Ad@&`@*g`c0d@*`@* g`c'd@*`@*g`cF\"d`x`@*eG6`EąŅ=`NdăagDg`c``8d^@ZdG@Z9@Za\Ѐ0`E@ZeG@Z`E@ZeG@Z`EE@Zd@:aeG@Z`E@ZeG@Z`E@ZeG@Z`E@ZeG@Z@Z `g`b*=d`:\+t@:\+ t@:\+t@t@:\+1``:\' 1``:\+dg`d:\0`:@@'g`\bdE`d@Z3`??`2xd8~`GSQ`\PQRSdT) :SdDcc cUF\"`@&@!`EELĄ!,D)dd@:O'Vc))`Gd@*. "bcL4L)`@:v`@6n!̄`Ad́SUdA6dEbá$Ƃ(ւ́(*Ƃ`C`eddÁĄcEĄ@H`Eh`b`dh`beD(DpEą`XdĄ`AsEԀ dD68aEĄsEԀ.h`b` d d@\"d` x&(E`@:`dĄpEԀ`P`Eh`b`0dh`beDd (Dh`Eh`b`dh`beDg`Nbdg`Zb`b*`dѕdA) `@:q݁݁݁%`G`Ca@"#`XOJx`dݸ#`XOIx`d)`Eh`b``dh`beD"`dڎF\fD `xdhh`b`adF\`@*g`Xbd`id@D0DA@Q?0D@Qg`Xbdۙ:D+P' g`\bdE`d@Z3``xL?~)`@:Z`Zd܄`e"d`xdD`A`G`EaD脤`AeGaE.XdD`A`G`EaD`AeGaE.X`G`E@M`G`A-D́`EaG.X"`kx0D*G!XG?2D&WdEGS 2D&N'`T `:d@B0D@Q?2D&6dEG2 2D&-O:c>D@^@^ `dd@B0DD]@Q?2D& dEG 2D&!`;x `d@@ `d@A0D@Q?(``bg`bd"dڙ0DY@Q` d@@`xg`bd"dڙ0DY@Q` d@@`x!`d@@ `d@B0DD]@Q2D&dEG 2D&`e >D@^@^?2D&dEG) 2D&$g`bd"dڙ0DY@Q` d@@`x`ē'% `x `ux(``bg`bd"dڙ0DY@Q` d@@`x `xg`bd"dڙ0DY@Q` d@@`x)`@@+%>`@& :\d@@' d@+3` `x:\d@+&t@t@d!Ĵ!!`d@@d"0D@Y@Qh`b`pdd@&dh?d(``bd!* !dN`e"``@&`@*;D+@'`x&g`bd`@*`x<`db`Fd@:pdg`bbd@>>=Fd@)@+g`XdF~`CEeDF`@*#`xdek>Dp@^=D@]e`>c`"edHdG`A`J׀h@g`b|`@* @eD@^$`x D @@d&dG?dD+ `HeD`J eIdh^`\` ddie@Qd D *666 Dش@@ D@*$@@<`bڃaۂZڃaۂZڃaۂZڃa ۂZڃa`x@DbC Dԅ5$E`2dDCE D @@dCӽ+ dIhD%CCE D @@dCӽ@D+`HdD`Jh@dIhEԀ%C<`acY1YcY,YcY'YcY"YcYYcYYcYYcYYcY `x'`x'`xI`@666(:ZӜ۸`q̄eD`usD`b `b'`xf`b̄:D@Z;n`G#̄`G"dnhsAIՀ'pEą`XdĄ@M`AsEԀ dD60aEĄsEԀ g`|bddh-DpEԀ `P`Eh`b`1dh`beDdf`d̄v`EwԀԀ(``bdd=`b ̄ =`c`dЄ2D*0h`b;h`ā3 @@*d-dd`A D@@@$`daDde * `bЀ @@*g`|b̄1/dA"D 1@* ^DB!DL!EԀXO?<`4b`F@FH`bFg`rbd@7d@7ga#X(`cd۽۽d##d"%D#$%&'ga#X"(`c $%۽۽d#ga#X8d8`G?(`G q9+:,;-./0<1=2>3)RP<.Ѐ=/Ѐ>0Ѐ`AaDB=JCd@*(d@* d@&8`\dD`G@`G)9!9+:,;-1231:2;3+,-/Xd`eQd@*Dc)s`d+c)d@@'CK!Vad@'ba8DM`@&"ÁрcE dCׅELӀeec-D,E`AԄ߃aD)d`G),C-D -D+Eāрd.X+L`@&9+`AZ`AZ`AL:`XNx N D@^ cXOv~F=D@] cXO>>Dw@^ cXO4D`夅@^k`>D``\`d٘g#X<`bʂ"d;`x<`bd;`x<`bʂd;`x<`bd;`xee`Fce@*d;`xg#Xg`Pbg#Xg#XCDw@^ cXOlm>D@^`k cXO_=D@]=D@]`\`dMdG`MdD`M`G`MdD`M`G`MdD`M`G`M`CdD`LcFCO?`G`\e/FdCbڂɁ`Lb`M/Xj` x`bр`d+t` ``b` ddtudu`b`d ?Wg`b& eEHN`aAM@`XOx-A`XOxOd"`dZ(DZe<`b<`pdfDZ dZ+ET;7Xa`FN`.aAM@`XOx-A`XOxO!adX`.cd"`d#Hedѽۥ́څ<`b<`pdfDZ dZ+eET;6E`dDd1D@Q`b` d=`/x>`x`cӽѽѰ 1D@Q |` d>`x`Gā>`x1D@Q &`|b`@:ec `@:ecce`@6e`lb`|b`@:ec `@:ecce`@6eg`rb`Nb`A&e^a@&c^Zde`Dbd>`XNx&`c`xa`dXY`rc`@a`dXY`c`adY`d<`bʂd- `d2@&`bӥ`A6́`bNB`XO`xO=`/xfDWd@FNFE<`bdfDZ dZ+`XOxO7X*4`Db`E`b`E`Hc`a݁ԀaD`DbaEԀ`Ef`beD`:dD`b>`zb>.X<`Lb`Fb`G7:66 `bF`d<`bdfDZ dZ+NFE<`bdfDZ dZ+`XOxOY`d܄ڂ܄ۻ<`b<`FdfDZ dZ+Y`d܄ڂ܄ۢ :=`/x`b `d`e aXOdXcZڅ́`b`e?`cdZրZZZ`edZրZ/X`d@A`cdЀ áۣ`cdЀ adD́@BCDACXO`X"D#A$C!C`e׀ѽCA?`ddX@O)`@&@`.x`@6 `DdXOdD`"12Ѐ Ѐ3ЀA`vx`eԀdЀdЀ&F" g Ѐ&F"@g&F)`@ *\c`@+bcҽЀ\Ѐ҃XЀUd`XOZxA`Lx&F) &GcӀ`@:Z`d܄#:Z`d܄0:Z`d܄:Z`d܄:Z`d܄ `HdXO-`@: h`XNx&FA`XNxA`vxP: Z`d܄ `PdXO @:Z`d܄ `JdXOA`rx:A`XN}x `RdXOZ`d܄:n @@&2)12ЀЀ3Ѐp܄pdq `dnd@6PZ`d܄ `LdXO `NdXO= `PdXOA`rx`Bb)1Ѐ2Ѐ3 Ѐp܄pdq `dnY` d`@" h`XNxN&Fg`XOxO&FV)=`e dd@+h`b`0dA`XN}x^`EsDd@*Ԅ砖Z`d܄ `LdXO `NdXOf`b#A`XNx&Ff`bdۺ<`b<`jd&DZ dZ+d@FfD>`XNxVv`XNxdd`Xb젢(`~d<`b(`zddJ`b`dD`dZ/X`\(`~d<`b(`zddJ`b`dD`dZ/X`bdf`b܄dd e=`XN2x`cd|̄g`ve`@"3* `cf`e`EĄЀ% g`ve`E D@@Y`d܄NR`XOxO`b`dE`dZ/X`bdD`IxdGdDJ`bd `b@`dE`-dZ/X<`b*Dʂd-`b `dE`SdZ/X`bd۾`b@`ddde=`XN2x/X `Pbg`d `Hbg`dY`tb(`dwd"8d(` dd)f`b`4erDf`cd۽ۣqpG`dӆf`cdds9`bd^h`b`df`cd(`c9`|edGӀG`Dd[NR`XOxO`b`dE`dZ/X`bdY`d܄9`b K`XN+xF`xY` bc`@:n af`b@` ec$́d(`~b<`b(`zddJ`b`dF`#dZ/X`bddn9`b`Egf`b̄ۼY` bf`bs.dD:*eD&`bd@&`C(`~b<`b(`zddJ`b`dF`mdZ/X`bdE`xf`cӁ܄ۃssd^h`b`df`d܄G`x9`cсурѽY` ebEdA݁遽ѥڂ́bE:`&ca`E66 66eD̄`EaDa`E:`(ce@*d݁e@*d݁e@* d݁e@*d݁:`&caD`eaDڂbEӽ`Gڅ́́:`2c`b`EӆeDe`@&e`@&e`@&eY`hbeD`c`cنd`dbvf`XN:x`b*d *d*ddw./0123f`cddDJ`bd `b@`dG`bdZ/X<`b*Dʂd-`b `dG`dZ/X`bd۾`b@`dddh`b`pd D&e=`XN2x D@@`b`d`b`dG`dZ/X`bd=`bac`EeD&߃́cD =`b2db`@6`bd=`b̄=` b`bedjkmod@&J`x`b`df`e"l^d`b`d`b`dH`0dZ/XI`x`b`dی`b`aZJۡZn`@&2vd)c8"d!d`bd<`b<`.dfDZ dZ+`b`dH`rdZ/X`b`aZJۡZۆ/<`(b`F%@Hd@L<`*b(EԀ`F#+* @M<`b<`(dfDZdZ+d@L-D`F I`xdmI`x,D*(F+* <`b<`(dfDZdZ+<`(b`F+*1K`XNx`bd<`b<`.dfDZ dZ+`b`dH`dZ/X`b`aZJۡZw"&dmdo<`(b`F@H`FI`xlЀ+w`Ck*ci`XNxji`XNxefDiK`XN x`bd<`b<`.dfDZ dZ+`b`dI`RdZ/X`b`aZJۡZw"iFHi`XNxd!i`XNx#f`b܄ @H<`b<`LdfDZ dZ+(Ddo i`XNxi`XNx(F lЄ#`@"d`C(`~b<`b(`zddJ`b`dI`dZ/X`bdmmdjdf`b< E@@f`d܄یd*`b`d`b`dI`dZ/X`b`dی`b`aZJۡZE`xg`ve`@"=* `cf`e`EĄЀ& g`ve`E D@@Y`d܄ `PbV`SdNR`XOxO`b`dJ`JdZ/X`bd `Pbg`dqpddqf`bvDd*`b`d`b`dJ`dZ/X`b`dی`b`aZJۡZh`b`qdf`d ddpe=`XN2xf`e`ddC߃ЀHf`bd@| e=`XN2x `PbV`Sd`cd|̄E`x"f`bdpf`bdf`ddddh`b`pde=`XN2xi`XNXxG`xw`d+,- w+,`CdF,+(F-dF-d)Gc8"d!dd.X:`bC`A脐 aD dD *dG.XL`?xxQ`XN(xQ`XNxg)Q`XNxc8d":`XNxfEa}dd@&dcYdYڧ(`~b<`b<`.d~eDZ dZ+d]<`b(`zddJ`b` dK`dZ/X`b`d.<`b(`zddJd]`bdZ&F8`AL`0x}L`xe8ՀL`0xC&FQ`XN(x~d(g@g)+..+,//,-00-d":`XNxfEadcYK`qx.&F>`XNx DL`xO`x`dd]`bdZQ`XNx DL`xO`xK`x&F>`XNx DL`YxN`x(`~byQ`XNx`c'`da`cӽa`b`c`eӥЀ@GR`XNx `bdZf`edD`x'C`XNx `Fb`EՄ`E e>`XNxg`bd`bd `b@`dL`wdZ/X'<`bʂd-`b `dL`dZ/X`bd۾`b@`d D@@K`JxyQ`XN(xd)Q`XNxGb`dcaYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dM`$dZ/X`b`d!<`b(`zddJc]`bdZ&F=&F>`XNxL`Yx`d<`b(`zddJ&F>`XNxd]`bdZL`x`dd]`bdZQ`XNxL`Yx`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx'CaeǃY`d́X&F>`XNxddgde=`XN2xR`XNtx`b`d`b`d d]`b`dM`dZ/X`b`da`bd`@da`bd `dIa`b d^`b`d`b`dN`dZ/X`bdZd]`ba`b`ba`bN`XN]xde=`XN2xf`ed`XbdۥD`x` d c]`bdZM`x/X<`b(`zddJd]`bdZd.XdGF`e`cӣۧ(`~bٌeԀ `b`dN`dZ/X`bdZ`c'`dd`Zbda`cӽa`b`c`edAЀI@GXՀ`Ea`beD:d@*7Հ4a`bf`b'D>`AЀŅdDԀR`XNx'D`AсЀYhЀYdЀaN`x`bd `b@`dO`dZ/XFG`c<`bʂd-`b `dO`/dZ/X`bd۾`b@`dd`Zb<`(b`F `b`dc`b`dM`x'C<ЀN`x'C@`A>`XNx `Fb`EՄ`E e>`XNx`bd `b@`dO`odZ/X'<`bʂd-`b `dO`dZ/X`bd۾`b@`dyQ`XN(x` d)Q`XNxQ`XNxaGddYځY؂YYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dP` dZ/X`b`dd]`bdZQ`XNxd`ZbdN`x`d<`b(`zddJd]`bdZP`x`d"<`b(`zddJd]`bdZ&F &F>`XNxN`x`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx&F>`XNxe=`XN2xR`XNtxc`b`d`b`dM`x D@@K`Jx])dA`@: 1`b`d': "`b`d:e:e0:e `b`df/X'CdGYdA݁bD́XX`c-DȄdEdAAĹX--C`G~'D˃D,A `G~`É.Xg`Hb*d *d*dd.X`ef`c'B>|Ԁaae\f`baDf`b.X'B2ac$:: `@+e׀c: `@+ e׀c,:`@'cY`hbY`jc`@*cd *cd*cdcdPQa`bQ.X'C+1,2-3.X./0` dd(.Xg`fb܄(``bd(``bd.X'CeDž`GZeDž`GY eDžӀ(`b<`e?`d`A脥<`ed́a`c&F123.X'D`AC腔&& *`@* a\Ga`bP'Aa`cӽYЀYЀЀdd.Xf`cddۣg`cddۣ'D'DЁaf`caDۣf`bсaf`baD.XY`bf`*cd۽۽۽g`bd.Xd]<`c!Dd`bdZ`*c `@a`~dXY/X`b`d/Xz./0`bg`cӣe~g`bd|d (|`E-d`dxd`bd D&d'`d @*`bӱ=`LbdeDq @@&n`ez@~)`d[`Ce @&|dGdA݁bD́XX`c-DȄdEdAAĹX--C`G~[ڤ˃ @&dD,A `G~`Éz-D8f`bf`b`Zcq\`G`VbeA`EaDԀԄ`E`TbĄ@J`Xbd `ddT`xdR`~x`Xb`Zb*D܄d*D̄d@J`c @@&dD6 :`6c*DG`bd `b@`dS`dZ/X<`b*Dʂd-`b `dS`dZ/X`b@`d dW D@* `b`d D@"T`rxz{d":`XNx<`b<`.dfDZ dZ+`bdۯ(`fb<`b(`bddJ`b`dT`%dZ/X`b`d <`b(`bddJg`b(``bddS`|x`bd۱(`fb<`b(`bddJ`b`dT`fdZ/X`bdW.S`|x`bd۱(`fb<`b(`bddJ`b`dT`dZ/X`bdS`|xR`x(`fbٲ(`rb<`b(`bddJ<`b(`nddJ`b` dT`dZ/X`b`d<`b(`nddJS`|x`dW d <`b(`bddJS`|xW<`b(`nddJ`bg`cӣЅg`bԀeDg`bAd`bf`c Y`d܄`bd `b@`dU`$dZ/X~<`bʂd-`b `dU`JdZ/X`b@`d D"e=`XN2xV`x``cÅEM'`eEL@HY`b(DԄ脢-E׀eGeG eЁGaaD,BZZD(BJJBHD(D'`cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB`Cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB D<@@`b`d`bdZ/X<`b(`bddJ`bdZ/X`b`d/X`b`d/X @&``c`d#=`Lc`EDžc\d1PY2ЀY3ЀYЀvD׀=`Nc=`Lb`dЀhÃ%dDdG123`|8 D `Bb`@:d@*;W`XNYx`dЀ2-6f`d`C X`XNx`deDЀ`>`CaD`dЀf`bdۇeăddG`E;F܄dX́؃d@Mae@*dD-ZdG-́Z2cÃae@&Y ȲdYYYЀ2eăa`@"*`@: $::6`XNx`Va`c`TbaēdD|̄eD`Bb| `Pbg`d e=`XN2x`|X`exEMX`XNx`dԀ9cD"`GeԀ*X`XNxe\X`XNxgAX`XNx-DEMX`XNxeAX`XNxf`beDX`XNxf`beD-E`|dAef`b@N.Xf`b.Df`bZZ`C6ZdE`AcD"`G`\cD"`G`EdDɁՁaDǃ߃X`XNx`dԀX`XNxef`b@N.XcD"`G`EcD"`G`G.X/X`b`d/X(`b<`b(`ddJ`b` dX`dZ/X`b`d Gg`Bbo`dXO)O`b`aZJۡZ`zb*Gg`Bbf`dXO g`Bbi`dXOOHNdAAM@`XOx-A`XOxOZ`xg`Bd`Gf:YP[`8d[`:dل[`Bd[`Ddٽ[`Fd[`Ld[`Nd[`/Xg`EԀH`zc&Ag(Fdd .+/,0-./0Cd@*`G@`G)c(":`XNx~<`b<`(dfDZ dZ+d@FHo`_x+gDЀ8{ܠx`e Ԁ`dpЀg`clg` d܄Ѐ`Ѐ]\`d ca&eҡСdDՀف&FC`Gd@&@`G)~(d8d"(+,-./0`E&F3dD2eD1:`XNx<`b<`(dfDZ dZ+g` d܄o`x&Fk`x`dfE FKFI0eF0/Ѐ)F/.ЀeF.Ѐ)F.Xdh`b)`@64:dDeԀ/+dD DdD6&6'6(6)@6*6+6,6- 6(06)P6'6(6 6$6"h`bh`cdۣj`Bxr`xq`Zxq`xq`xq`xq`xq`xq`7xr`xr`Rxh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOxh`bdp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ+Ѐ,Ѐ-Ѐ.Ѐ/Ѐ0ЀVes`XOxh`bdp`xh`eh`cdaѥрp`xh`eh`cdaѣрp`xh`bh`cdۣFJ+Ѐ, Ѐ-Ѐh`bd +`dЀ,3Ѐ-0Ѐ-8(`DbdGЀ`Ac `Fd`EХЀeD́d@'HРdD`EdDԀ*Fp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxp`xh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOx.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ)+:+Ѐ,Ѐ-Ѐ@h`bBh`b@GVeh`aeCPҡЀҡЀҡЀ'D̄@G)'.Ѐ/Ѐ0Ѐ\es`XOx +&h`bdp`xh`bh`cdۣ8FJ`Ah`b6h`b6aDs`xs`x.Ѐ/Ѐ0Ѐh`bh`bh`b@G"\eh`aeCPҡЀҡЀҡЀ'D̄@G h`b:s`x8s`xh`b6`DbdG<9c`A`FdР́d@+*Р'`DbdGЀl`Ac `Fd`EХЀeD_́d@+ РdD`EdDԀMe~`GāaE&~`Gā&`GЀ-h`bh`b`AŅh`dā*F\cҡ۽ۣh`bd*F./0*Fp`xh`bh`b@Gh`aeCPҡЀҡЀҡЀ'D̄@GH/X`*b`d``c`f `{d̄`*b`d` `x! Secondary F's~ 8   $  F@p 4 ''dd'/  d #+ `xA`x`x`xCD`xD`xF`x`x`xLN`xL`xC`x`xF`xGB`VxC`VxD`VxE`x|`d)G` x@$XA!X"X `x"`vxE!X`x ` x`x@`xA`x%`-xC`x$`xE%`ux`x=`%x?`Gxy=`.x$=`.x=`xD=`.x=`.xG=`.x0`7x1`x(0`xD0`xE0`xF0`x|`d)G0`xoo?PgdN-SV8hXoooooooooooo h0313DD031303132323x==3F44645"4546"454545"45 4~7 45 45  45 45^45p4545:45D45F4540744f45j4545vg45499 4545 45a!45a$57%57&57'57#45(77*45+44x,48f-48.45f:45g)5<5^X45454540747Y45|45z45445454-8~47t4r74545/4504K814844J64L 64ZA6444844$44`44\44v44r44>$44 %44 &64t '648E44G44NH64lI64nJ44K44M64\P44YO64X64`446464b44 h64:!h64B "h64 #h640 @44A44 Y"B45C64D64F44 L44444444f64d64f*55596^mY0$\$Y$z#\$\$b$b$b$$%{#w$HH  \ "t$& (*,.0 246z8 :$<>@BD F&H[JL)NP R TVXZ\^`b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.eg\2e~Z~n*>Rfz"6Jz;;;;;;;;;;;0;;;c;q;;;;;;;;;;;;;;;;;;$ZBZFZJZNZZ>g>g>g>g>g>g>g>g>g\^Z>>bZfZ>gpZtZxZ|ZZZZZZZZZZZZ>g>Z[> [>> $[([,[0[46ێYYٞ>يٌ٦٨٪ٴٶپ٠٢٤lnFJLNP>8>PZ\>^pr>xz|~ـقلن:Z "$&Z*Z.Z2Z6ZZڪڬڮڰڲZZZZZZZٮ>gBD8>H٠>>`j>:d"bflZ>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>gٺΘ\`TVYY ZZRZVZZZZZZZZZhYjY,28DJhn̘aa`$ P[<_xbda*g8Yg4UYYYYZZZBZZZpZtZxZ|ZZZZZZYY>gYYYYYYYYYYlYFY>g8YY ZZZZZZf~@    $L~  F@PX~Z~&~   8 č~!ZFILE: EPRIMSYM,T3.10-04,F3.10-04,01/17/2002 PRIMARY 3 72 36 40 ~~d d d d d d d d0D`x DAdd@+d@Qd@Pd@@`*b`d``(b(`d(`1@&`U`"*2:BJRZbhpz!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`0D `dȁ>cdY`Av`>c`a`f `dXY`c`a`f `dXYXO.XO0DdceXOA`x`|c`da`F܄́d`eD@^ c`XNpx>D@^ c`XNpx/X.X0Dd@@C`exDĘ0D ``@`q`>exDĘ `cexDĘ`d`Av?`d`ddD+P`d`dЀ`d`#dЀ`dѺ`EdЀcG`C`d`vA<wD`W@J*D D@@/@@ D`A`daD@@@@dD? dDd`d`d`d?uD&& & & @&`e`d$g`\`d`d@E+@E`XOxXOJfPeRaQ @g&E@F`dP R~q&\`dٶ`e`d$g`\`d`d@E+@EXO<XOfPeRaQ @g&E@F`dP R~q&\`d%F&ADcՁc`FBaDŁcEŁ`EdԄeD/X%DЀЀЀЀH%Fg/X`q̃eD`u?ga#X@DDEDFDG? $Dg$D? `dDXCaC`E$D?'` d`du?`(b`4d$E'=`dga@ D ߴ@@`f`d`AcXY`&d`AcXYd@Pced@Pg`f`c`dЀۃ D@@d@Pced@P `x`dȁ>cdY`Av#X~`d$Ega#%E+ `pca$D'ӣԀ́$dXad"%DZg ӾԀ́$dXga#XbCdC`A܄"ZbDɁXga#X"bC̄ dAՀdCeAFdXɁga#X`d@KK`A؄"%D#fEHcȄ+FXeFɁga#Xd@E`d@Fw` /`b`XN{x%D`G~`XNx%D`XNxaa\ZdG`XNx,dD`XNx&́`XNx`z-$`XN{x~`XNx`XNx`XNx&E%DԀ@E(`dU`ga#Xw``XNx`XN{x~`XNx~`XNx`XN{x~`XNx/`b`aa\`XNx`G`E`XNx́Z`XNx`XNxU`ga#X``.X``.X c?@&σ.Xc`@*```?@&dd.Xc?@&܄``.Xt c7~@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@c        < t 8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.`_d`,dE`dG`d@ABCDE ~ G` d N`@99SA01000000Primary F's F3.10-0401/17/2002~~ &~~ ~ ~~~BBB0BBBB B BB0BBBBB8BB0BTBBBhRUSP8BpmA0B^^sysctl_wiwi_push_packetwi_write_txratewi_startwi_rx_intrwi_rssadapt_inputwi_tx_intrwi_tx_ex_intr^!^3^P^f^^^^ ^,^ ,^ ^ Y^ Y^ Y^z^z^z^^^^ž^ž^!^"^THIS is A memory TEST pattern !)huCpC]Cp^ClC]CL]C^CSĵU@R ##$$CԴC@CCCC(C@ C(C@XC(CpmAC'^H]zH]H],&BH]H]zH]H]n@ *H]H]zH]H]JڧoH]H] zH]H]aG]H] zH]H]Q?}-G]H] zH]H]@ZC˔G]H]I;0hey\L*JͬQJ}k-(*q8dڅWr65)\9:;Xacfm_kaÄn7Tm]4`Y ms  ׂ%b6ߓk @6 I]K] I]8L] J]M]  ֪tүrڦx֫v d=h0tNɿlY iAG5>l2<詟PW"^9}U= kp_D MN&GC5ezT2Wh휾,NJM+0 XF\CTJXGHV\C@IMHCBXQU~AbE *K:b]fA rD~ʇ><aQi4|Q7*S |Cw~~/h`BT_#zZ=)R:`x',#خ2 3x q] sŸvĘΓrQD]@ޮhgmHoOuSsQVɧo)LlY=:uRGu'T9 ܐ_{ HRE/E`Ӈ0 M3d |Ta)yץdJ@%Aq%Zr NZfO~W+$y̿ y7xr _xx.'c&iX J?2ިM ~ig@2G0mc "`$aV]ZY  3x q]־ IMs>sh9؝ƌr}nB?TSx1WDGeGf;΍ g?}\JB:.ްy#d_V|\Iėx1<֖U`)$b/ KNMMWRIIGBII $y̿ y7}#$z4Ny1P&vkvP_>|-Fei7%7HQXM|%Ix)v:BN   !"#$%&'()*+,-./1AY&SX#bd3'A7Q tE'((EE#S`(tq5&bIwW$piYWIfv''GvH0ϦnK2%(}ӁnjCD_3V'ص@6ݴT2c*S 3%ߔz\Q,f`ΓfI"aF ΄kܛJvz ae^-RQ1tQ;:/wlpϛ?^H#W;]1vJfh?Dh 53EKWvlI ^pi*}!ԧAM_)a:uq#)*>z}}U\m }  !"#$%&'()*+,-./pmAx D!^expand 32-byte kЩ^ DDDtD D$DD@ABCDEFGHIJKLMNOPQRSTUVXThe dhole (pronounced "dole") is also known as the Asiatic wild dog, red dog, and whistling dog. It is about the size of a German shepherd but looks more like a long-legged fox. This highly elusive and skilled jumper is classified with wolves, coyotes, jackals, and foxes in the taxonomic family Canidae.The dhole (pronounced "dole") is also known as the Asiatic wild dog, red dog, and whistling dog. It is about the size of a German shepherd but looks more like a long-legged fox. This highly elusive and skilled jumper is classified with wolves, coyotes, jackals, and foxes in the taxonomic family Canidae.EYNHa,P/ ~Y*S鍍d@7[& #1< HW]M ,g;fosa'w :kXBH㩴ٍ ~z0{f31d$ l?OhD0V:D+HϦFKtB@|Cv`[hFnEu#aR ktjtFA^{*)*IWx R ?*j~h|y` HCHlˇ_ E瘚 H'QJm\bאc1]BIt8-d5!w.s+o &mZn9 t1=._Ÿ0^ASm0pxZip"˘jQƧ=v䓚!:oW o!q5W:NRDu{=-oqV8c^U(R=ؖ *w}؋If6U3mUؕ22UXoÌR )'5»;D!UhF/|,Əͳy2qٯMB#8VoD:Hm3Oj3mv[jUS_&)ûIt~._dyz,(4y:b,ia /A&"3DUfw̻wfUD3"-  J1AY'A;B'{BP}sՊtS.&df]f]]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& Nuy6Urwk=veKpm5?R/XS?pFRD+}!БwG"lF4v!/wZ}NJؓM^,|0E'w;>5tv0eF9pJ4)N~_I<@;ruf8) ^(P  <`*KO4=I|`U{V;Qdf]e]]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& ;0yfe}Xq@߾ށM"m5?R/XS?pFR|Z-*f:+KOyQ$:顂psq$c(N~czt;6DɆ'@ZzF|3@ 0bS:FȲc\Tn~.3h8}ȉ0Ͳt6ѽH$f]f]DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)]رlbM*i֦n6۪;(;q{3n[.nZH/vy,c*ڌ}8HHq f@ZsyTH$f]f]DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪlE˳#bk'ȆEœpÄEw'iR_ A0qYHuhhOިXr^>34 z3Ӑ3`X7^s50uRXȠ^(Q3X؛r%ߞ;6]6: {AD^q_eNNL4ʧ= 1@dO*T%SRQt@$f]e]DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪ6̼W:6|5:)zflQLGK5uM} uwMai[#xv%43|G- O0dz,pgR'CY,Og2[6@Pq9+4;4t?GuW{Nl>2FLQiq{ŵ_rq^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,ieee80211_hdrsize0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-tkip_encaptkip_setkeytkip_decapг^hD\DDDD$DD0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-ieee80211_hdrsize ^ܑDБD|DDDD(Dieee80211_hdrsize ieee80211_sysctl_treetopieee80211_sysctl_setupieee80211_sysctl_attachieee80211_load_module_ieee80211_free_nodenode_reclaimieee80211_free_allnodes_lockedieee80211_node_table_cleanupieee80211_reset_scan_ieee80211_find_nodeieee80211_setup_nodeieee80211_cancel_scanieee80211_get_rateieee80211_tmp_nodeieee80211_find_rxnode_withkeyieee80211_find_txnodeieee80211_find_node_with_channelieee80211_find_node_with_ssidieee80211_free_nodeieee80211_create_ibssieee80211_ibss_mergeieee80211_end_scanieee80211_next_scanieee80211_node_delucastkeyieee80211_iterate_nodesieee80211_node_leave_11gieee80211_timeout_stationsieee80211_node_join_11gieee80211_node_table_resetieee80211_node_table_initPieee80211_encapieee80211_compute_durationPPPPPPPPPPieee80211_send_probereqieee80211_send_mgmtieee80211_mgmt_outputieee80211_beacon_allocieee80211_beacon_update#^#^#^#^1^#^1^ieee80211_newstate  0 0   0 @ @ @ @ @ @ @ieee80211_wme_updateparams_locked       ^^^^^^^^^^//f/f////f/f//       ieee80211_wme_initparamsieee80211_rssadapt_sysctl_setup^L.F8F7F8FCFDE@Ep]F؉GJL8JH5J>J^ EJ$DJ;JXJp7J?J?J@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_#@[\]^_`{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%##%##%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!B^H^N^T^Z^`^f^l^r^x^~^^^^^^^^^^2^6^:^>^ ^^^^^^"^&^*^.^wsevent_copyout_events,_JH\JHoJpJdJ@RnJhR0eJSeJ@RABCDEFGHIJKLMNOPQRSTUVWXYZ4JpJJ@RJhR JS\J@Rrasops_reconfigrasops_init@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? ????@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?*&8+&*&]]o]]                                                   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~]Y]ak])̯]2]'](]ͳɿپ̴ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ᅠPXJJTFTJHJPNJRRpJCEJSTJNMJ(JCLJ0PLJ0REXJ@RRpJCEJSTJSLJRRpJCEJSTJERJCEJSTJX ]] ]pmAJ._(]t^xOW] X]xRX8]xRX|]xRXT]xRXp]xRXP]xRXl]xRX]xRX]xRX]xRX]xRX]xRXL]xRXh]xRX]xRX]xRX]xRX]xRX]xRX]xRX,]xRXH]xRX]xRXD]xRX`]xRX] X]xRX]xRX] K]X] K]K]xRX4]xRX]X0]xRXd]|J]J]X]8X]xRX ]T K(]PX]W]t^xOW] X]tX8] X|] XT] Xp]XP]DXl]X]X]X]X]X]xXL]Xh] X] X] X] X] X] X] X,] XH] X]X]pXD]X`]HX]X] X]X] K]X] K]K]$X4]lX]X0]Xd]|J]J]X]8X ]T K(]PX]W(]t^xOW]X]J8]DXT]DXp]X]X] K]X] K]K]K4]DXP]DXl]DX]X]X]оX]X]X0]XL]ܾXh]DX],X]DX]DX]DX],X]K,] KH]Xd]|J]J]X]8X]J] K ]T K(]PXD]l K`]$X]W]X] X???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()+-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ蘌"K\"KX!KlX"KPXupdatefatsVKlUKdVKtUK$VKYKUK|UK0WKVKUL]pmA`KZ_. .. T]t^xOW]X]AK8]KT]DXp]X]K]L}K]X]K]loK]sK4]@vKP]DXl]DX]X]X]оX]X]X]X0]KL]ܾXh]zK]DX]@\K]K]`zK]DX]@~K,]$XH]Xd]8,K]*K]X]8X]rK]{K ]<|K(]PXD]|K`]|K]W]X] XAaBbCcDdEeFfGgHhIiJjKkLlMmNnOoPpQqRrSsTtUuVvWwXxYyZz      !"#$%&'()*+,-./2345679:;<=>?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~sSTVWY[`cihoru      "#$%&'()*+,-./0123:e,;<=>f,ABCDEFGHIJKLMNOE{|}PQRSTUVWX Y Z [ \ ]^_0123456789:;<=>? @!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O`abcdefghijklmnopqrstuvwxyz{|}~     1a2b3c4d5e6f7g8h9i:j;k<l=m>n?o@pAqBrCsDtEuFvGwHxIyJzK{L|M}N~OPQRSTUV--------- - - - - ------------------- -!-"-#-$-%-      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~a     ( )!*"+#,$-%.&/'8091:2;3<4=5>6?7H@IAJBKCLDMEYQ[S]U_Wh`iajbkcldmenfogpqrstuvwz{xy|}&!*!k+!2!N!`!p!a!q!b!r!c!s!d!t!e!u!f!v!g!w!h!x!i!y!j!z!k!{!l!|!m!}!n!~!o!!!!$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,0,,1,,2,,3,,4,,5,,6,,7,,8, ,9, ,:, ,;, ,<, ,=,,>,,?,,@,,A,,B,,C,,D,,E,,F,,G,,H,,I,,J,,K,,L,,M,,N,,O, ,P,!,Q,",R,#,S,$,T,%,U,&,V,',W,(,X,),Y,*,Z,+,[,,,\,-,],.,^,`,a,b,kc,}d,}g,h,i,j,k,l,u,v,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:ZK4KKKnfs_sillyworkerKKKPX @]]]]]]x]^]B]&] ]]]]]n]Z]D]8].]$]] ?BEF   F''FF''FF''F'' F''''' F'''' ?EF''' ?BEF''' ?BF''' ?F'' ?EF'''' ?EF''' ?EF''' ?EF''' EF''' F''' F'''F'' ?F'' EF'''F''  ](]]pmA@=LFn_8]t^xOW] X]xRX8]xRX|]xRXT]xRXp]xRXP]xRXl]xRX]xRX]xRX]xRX]xRX]xRXL]xRXh]xRX]xRX]xRX]xRX]xRX]xRX]xRX,]xRXH]xRX]xRXD]xRX`]xRX] X]xRX]L]H}L]X]|TL] L]tL4] uL]X0]=Md]@K]K]X] }L]xRX ]|L(]PX] X<0]t^xOW] X]tX8] X|] XT] Xp]XP]DXl]X]X]X]X]X]xXL]Xh] X] X] X] X] X] X] X,] XH] X]X]pXD]X`]HX]X] X]*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?'NNlXNPXffs_newvnodeffs_reloadMMM{MM4N`"N ffs_sync]]]pmAM__T]t^xOW] X]xRX8]xRX|]xRXT]xRXp]xRXP]xRXl]xRX]xRX]xRX]xRX]xRX]xRXL]xRXh]xRX]xRX]xRX]xRX]xRX]xRX]xRX,]xRXH]xRX]xRXD]xRX`]xRX] X]xRX]~N]X]eN]fN]iN]0~N4]d~N]X0]%Nd]H@N]\N]X]8X]Xq_l^q_d^q_\^ q_T^ q_L^ q_D^ |q_<^ qq_4^ eq_,^ Yq_$^ Mq_^ Dq_^ :q_ ^,q_^q_]q_] q_]q_]p_]p_]p_] p_]p_]p_] p_] p_ ] p_] p_|] p_t] p_l] vp_d] jp_\]!]p_T]"Qp_L]#Hp_D]$=p_<]%4p_4]&'p_,]'p_$](p_])p_]*o_ ]+o_],o_]-o_].o_]/o_]0o_]1o_] 2o_]3}o_]4mo_]5[o_]6Lo_]t^]]]8]T]p]]]]]]]4]P]l]]]]]]]0]L]h]]]]]]],]H]d]]]]]] ](]D]`]|]]]]]]$]@]\]x]]]f_^0^t^}X]W]X]{Xp]{X]X]{X4]{XP]DXl]DX]X]{X]{Xh] |X] }X]4|X] |X0]XL]Xd]{X]X]0X]X]}X]|X ]|X(]PX]X]|X]|XXpX4XX4^t^xOW]X]d}X8] XT] Xp]pX]X] X]X] X] X]X4],XP]DXl]DX]X]0X]~X]X] X0]XL] Xh] X] X] X] X] X] X] X,] XH] Xd]x}X]X]X]8X]}X] X ]X(]PXD]}X`]$X]X]Xgenfs_suspendctlXXXXX Xgenfs_can_access_acl_posix1e@ @@ @ @pmAXr_layer_bypass@<^t^xOW]X]tX8] XT] Xp]X]X] X] X] X] X]$X4]lXP]DXl]X]X]X]X]X]X]xX0]XL]Xh] X] X] X] X] X] X] X,] XH] Xd]X]X]X]8X]X]pX ]xX(]PXD]X`]HX]W]X] XdevclsdeviocdevoutdevindevwaitdeviodevopnpmAHX^Y YpYYY Y Y YSąY YpYY8YYhRUSP YSądkdumpw_w_w_w_EFI PART(s*K>;Z_2IчH?_|nQn- q+?_ZIчH_|nQn- q+_SFU0eC쬺_IчHҊ_IчHpt_-чHx_-чHzt_SFH0eC쬗w_S'@ )Ѹx_*1@ )Ѹx_1x )Ѹx_3Dh&x_=rGy=iG}y_|nQn- q+y_p5YQ7Y6Y:YH:Yd;YhRUSP@R7Y6Yp5Yd;Y@R3Y@Rl=YlRt>Yt>Y=YhRU>YP@RAYAYCYBYBYhRHBYSAY@RhFYDYpJY@R@R@R@RhRUSP@R;y_LY4WYeYTPIY@HY8dYFYtP_bpf_mtap_softint_initpmA8UY;y_y_pmApqYy_ifaddrpref_ioctld n;0&AvQkkXaM* ʚ;! *" T# T$ T% T& T' T( T) T* . + , - / 0 1 2 3 4 5 6 /P 7 /P 8 /P 9 /P : /P ; /P < /P = /P > /P ? t; @t; !@t; "@t; #@t; $@t; %@t; &@t; '@t; )@t; *@t; +@0 &`vH'`vH,@vH-@vH.@vH/@vH0@vH(`vH1@vH2@vH3@vH)`vH4@vH5@vH6@vH7@vH8@.9@.:@.*`.;@.<@.=@.>@.?@. `!]!`!]+`!],`!]"`!]#`!]-`!]$`!].`!]/`!]%`!]C =D$E =F$cde@B`Sا@BO[@T6nQ%l7Jnd_set_timer<_Z|_Z|_Z|_ZZrt_initrt_timer_initrt_deladdrroute_outputrt_msg1route_enqueuert_addrmsg0}Zx~ZcZ\kZbZbZdkZ~Z~ZbZbZbZtfZLfZbZbZZcZbZx7ZfZ|^aZarp_llinfo_outputarpannouncearp_dad_startarp_dad_timerarp_rtrequestarpresolvetԐZZZin4_cksumwqinput_createwqinput_sysctl_setuppmAhZm_pmAlZ$_pmAhZr_pmADZQ_`_ phP8DY =YlqYYVRDJK^^^^^^'^^^^^^w^^^^^^l^^^^^^x^^^^^^/Q^^$_^n_^_^Os^|^"_t^^l^O^d^I#_\^H^T^~^L^^D^^<^J^4^L^,^r^$^_^ć^^_ ^H^^XK^^XL^^L^^JM^^M^^^^M^^^^Xd( L |hH$#8# #"""\"0""!!!T!(! ~^~^__ ^Hs^Os^^_^^__XL^XL^ _L^_M^%_M^._H^O^O^^^|\<ܬ|\<ܫ|\<ܪ|\<ܩ|\<ܨ|\<x^^^^h^^^^d^0^|^^^(^^P^^^<^n_Hs^5__^K^Ec__^^;__^C_^^_^%^._ _y __^K_d__ ^^_^I#__R__^^__^^Ec__^+J^^sK__^]__^XL^~^%_O^l__^+J^^c__^P^_^h__^__^_y __^N_d_; ΔHWIn(l QrYTᯨg?RPQrYTᯨg?RP; ΔHΕ#w.jRmQ3h8UQrYTᯨg?RP; ΔHΌQ3h8U 5,+Kыͳw'F3   0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfag jgrn<:ORQhك[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG_?___w____Z_Ҋ___._^_w__y_x_pt_x_____Ċ_̊_Њ_zt_֊_x_x_x_y_  gntsc[e[e[c[c[0 _ -_[3_[8_[^ء[S^[>_[ߊ_l[8~[H~[rbmnH}[|[{[|[|[P(K_tcid[[[[[[ԇ[\[L[ yekd[8[[@ X_(a_8<j_H,r_atad[ؚ[P[ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/z_loobH[([P[yara [L[[`[D[ _strtoullstrtollstrtoulCopyright (c) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010, 2011, 2012, 2013, 2014, 2015, 2016, 2017, 2018, 2019, 2020, 2021, 2022, 2023, 2024, 2025 The NetBSD Foundation, Inc. All rights reserved. Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. INSTALL_C700NetBSD 10.99.12 (INSTALL_C700) #0: Sat Apr 12 19:42:35 UTC 2025 mkrepro@mkrepro.NetBSD.org:/usr/src/sys/arch/zaurus/compile/INSTALL_C700 @(#)NetBSD 10.99.12 (INSTALL_C700) #0: Sat Apr 12 19:42:35 UTC 2025 mkrepro@mkrepro.NetBSD.org:/usr/src/sys/arch/zaurus/compile/INSTALL_C700 10.99.12NetBSDmd%d: internal %s image area match_bootdisk: can't get label for dev %s (%d) no mainbus foundwdWARNING: double match for boot device (%s, %s) boot device: %s ziici2c-indirect-probe-strategyThe operating system has halted. Please press any key to reboot. rebooting... REBOOT FAILED!!! ffuartbtuartstuartglasscpu not recognized!initarm: out of memoryinitarm: Failed to align the kernel page directorydos partition I/O errormbr partition exceeds disk sizeCD001BEA01NSR0disk label read faileddisk label corrupteddisk label write failedbad sector table I/O errorbad sector table corruptediso partition: I2C controller unable to attach PXA I2C controller pxaiic: PCMCIA/GPIO controller %s: invalid CF slot %d%s: failed to map memory %x for scoopscoop_pcic_read: bogus registerscoop_pcic_write: bogus registerscoop_pcic_set_power: bogus power statepxapcic_scoop%s: not configured. can't map bus space couldn't establish power handler %s: not configured zssp: zssp_ic_send: invalid IC %d zsspSharp Zaurus frame bufferSharp Zaurus LCDw100lcdstd: ATI Imageon100 LCD controller failed to map config (errorno=%d) failed to map register (errorno=%d) failed to vram register (errorno=%d) unable to create new screen (errno=%d)lcdctl%s: this kernel is not support SL-C1000 couldn't register event handler zkbd: pseudo power management module zapmunable to establish nSD_DETECT interrupt unable to attach MMC controller %s: zmci_set_power(): unsupported OCR (%#x) zmcivfp fpscr trapscnopen: no console devicecnopen: cn_tab->cn_dev == devcnopen: unable to get vnode reference   base 0x%x-0x%x irq %d drq 0x%08x core %dmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!cpu_mainbus, rrx, %s r%d, %s #%dlrthumb insn und%s %08x %s%s , #%d#%d ; #0x%x[r%d][r%d#0x%03x#%s0x%02x%sr%d{r%d-r%d}^f%d#%s.%c%d, #0x%04xspsrcpsrp%df%d, c%d, c%d, c%d, c%dr%d, c%d, c%d, %d%d, r%d, r%d, c%d[%c - unknown]oshstoshnshstnshishstishcpsC!csetend lesetend beclrexdsb!ldmbisbsrsXnW!mrfeXnWblxmcrr#&mrrcstc2L#vstcldc2ldccdp2#ycdpmcr2#zmcrmrc2mrcsbfxdmirbfcdijbfidmijubfxstrtdaWldrtstrbtldrbtldrstrbldrbpopstmYnWlldmXnWlblimbimbrangeswistrhtldrhtldrsbtldrshtstrhldrhldrdldrsbstrdldrshnopyieldwfewfisevdbg!dmrsmsrpFmpF2bxclzbkptmovwdZmovtswpdmoswpbldrexldrexdldrexbldrexhstrexdmastrexdstrexbstrexhSdn2adcsbcrscDn2teqcmnmovSd2mvnSnmsmlaSnmsdumullSdnmssmullumlalsmlaladfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtlgnsincostanasnacsatnfpuopstfQLvldfPRgdfixPRdhwfswfcrfccmfPRghcmfecnfevandvbicvorrvornveorvbslvbitvbifvshlSINuqwvqshlvrshlvqrshlvaddvtstvsubNo support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcacheundefined instruction %#x in kernel at %#lxbooted_devicebooted_kernelconsole_devicecpu_archpowersavecpu_idfpu_presenthwdiv_presentneon_presentid_isarid_mmfrid_pfrid_mvfrsimd_presentsimdex_presentsynchprim_presentprintfataltrapsunaligned_sigbusWarning IRQ's disabled during boot() single-skdb-k-dask-auserconf-chalt-bquiet-q-v-xsilent-z%s: curaddr %#lxnot in range%s: _BUS_DMA_BUFTYPE_INVALID%s: map %p: unknown buffer type %d _bus_dmamem_map: size botchL%u %dKB/%dB %d-way (%u set) %s %cI%cT Unified cache L%u %dKB/%dB %d-way (%u set) %cI%cT Instruction cache L%u %dKB/%dB %d-way (%u set) %s %cI%cT Data cache sctlr: %#x actlr: %#x revidr: %#x isar: [0]=%#x [1]=%#x [2]=%#x [3]=%#x, [4]=%#x, [5]=%#x mmfr: [0]=%#x [1]=%#x [2]=%#x [3]=%#x pfr: [0]=%#x [1]=%#x Processor failed probe - no CPU ID %s%s%s (%s V%s core)unknown CPU (ID = 0x%x): %s %s midr: %#x %s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s does not fully support this CPU. This kernel does not fully support this CPU. Recompile with "options %s" to correct this. arm700swibugvector abortterminal abortexternal linefetch abort (S)external linefetch abort (P)external non-linefetch abort (S)external non-linefetch abort (P)external translation abort (L1)external translation abort (L2)alignment abort (0)alignment abort (1)translation abort (S)translation abort (P)domain abort (S)domain abort (P)permission abort (S)permission abort (P)undefined insn trapsundefined cp15 insn traps: disabled : disabled (uniprocessor kernel) write-throughwrite-back**unknown 3****unknown 4**write-back-lockingwrite-back-locking-Awrite-back-locking-B**unknown 8****unknown 9****unknown 10****unknown 11**write-back-locking-linewrite-back-locking-Cwrite-back-locking-DCPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10ARM10EJSA-1CPU_SA110XScaleCPU_XSCALE_...ARM11JCPU_ARM11ARMv4CPU_ARMV4CortexCPU_CORTEXMarvellCPU_PJ4BARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM810SA-110SA-1100SA-1110FA526IXP1200ARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM920TARM922TARM940TTI ARM925TARM946E-SARM966E-SSheeva 88SV131Sheeva 88FR571-vdi80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA27xPXA250PXA210PXA255/26xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1020EARM1022E-SARM1026EJ-SARM926EJ-S r0ARM1136J-S r0ARM1136J-S r1ARM1176JZ-S r0ARM11 MPCoreCortex-A5 r0Cortex-A7 r0Cortex-A8 r1Cortex-A8 r2Cortex-A8 r3Cortex-A9 r1Cortex-A9 r2Cortex-A9 r3Cortex-A9 r4Cortex-A17(A12) r0Cortex-A15 r2Cortex-A15 r3Cortex-A15 r4Cortex-A17 r1Cortex-A35 r0Cortex-A53 r0Cortex-A57 r0Cortex-A57 r1Cortex-A72 r0Sheeva 88SV581xSheeva 88SV584xstep 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step A-0step A-1step B-0step B-1step C-0rev 0step B-2step D-0(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step B-3step B-4step B-5step Bstep Cstep Dstep Erev 10step Gstep Jstep Kstep Sstep T*p0*p1*p2*p3*p4*p5*p6*p7*p8*p9*p10*p11*p12*p13*p14*p15Fatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=Invalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abort Kernel mode double abort! %d.%d(%s): trap: signo=%d code=%d addr=%p trap=%#x r0=%08x r1=%08x r2=%08x r3=%08x r4=%08x r5=%08x r6=%08x r7=%08x r8=%08x r9=%08x rA=%08x rB=%08x ip=%08x sp=%08x lr=%08x pc=%08x spsr=%08x %s: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x) -> %x UVM: pid %d (%s), uid %d killed: out of swap %s: invalid size (%zu)Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)kmpagespmap_bootstrap: No PTP for va %#lx pmap_enter: failed to allocate L2 bucketpmap_enter: no pv entriespmap_init_l1: can't get PA of L1 at %pfixup: pm %p, va 0x%lx, ftype %d - nothing to do! fixup: l2 %p, l2b %p, ptep %p, pte %#x fixup: pdep %p, pde %#x, fsr %#x pmap_pv_protect: page not pv-tracked: 0x%lxpmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_alloc_specials: no l2b for 0x%lxpmapplpvepll2dtblpll2ptpplCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L1 table provided%s: no L2 table for VA %#lx%s: can't find L2 table for VA %#lxxscale_setup_minidata: can't find L2 table for VA 0x%08lx dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console vmapbufvunmapbuf address 0x%08lx not a valid page pmap_pv_untrack: pv-tracking at 0x%lx: 0x%lx bytes, not 0x%lx bytespmap_pv_untrack: pages not pv-tracked at 0x%lx (0x%lx bytes)%s: not supported %s: status=%s %s: (error not notifiedwddump: device timed outwddump: drive faultwddump: DMA errorwddump: wddump: unknown error type %xwdioctlstrategy: No matching ioctl request found in queue physio split wd ioctl request... cannot proceed device faultdevice timeoutrequeuechannel reset, xfer %lx, retry %dsoft error (corrected) xfer %lx ST506wd_get_params: bad return code from ata_get_paramsIDENTIFY failed SPLIT_MOD15_WRITEquirks %s drive corrupts write transfers with certain controllers, consider replacing drive supports %d-sector PIO transfers, LBA48 addressing LBA addressing chs addressing %s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors (%d bytes/physsect; first aligned sector: %jdWARNING: block size %u might not actually work hwcould not create %s.%s sysctl node use_ncqcould not create %s.%s.use_ncq sysctl - error %d use_ncq_priocould not create %s.%s.use_ncq_prio sysctl - error %d standby immediate address mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectedobsolete (address mark not found)no media/write protectedinterface CRC errorST3120023ASST380023ASST360015ASwdc_ata_bio_kill_xfer: unknown reason %d wdc_ata_bio_kill_xferrecalpiomodesetmulti%s:%d:%d: not ready, st=0x%02x, err=0x%02x %s:%d:%d: timeout waiting for DRQ, st=0x%02x, err=0x%02x %s:%d:%d: %s timed out %s:%d:%d: %s drive fault error (%x) %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: read intr before drq atabus at %s channel %dwd at %s drive %d%s: unknown child %patasplatainitq%s: channel %d busy, xfer not possiblexfer %lx freed while invoking timeout xfer %lx deactivated while invoking timeout %s: unknown type: %xunable to create kernel thread: error %d %scnfunable to create config thread: error %d %s: ata_xfer_start() unexpected rv %d%s: queue_freeze%s(%s:%d:%d): using PIO mode %d32-bit data port drive supports PIO mode %d%s DMA mode %d%s Ultra-DMA mode %d (Ultra/33) (Ultra/66) (Ultra/100) (Ultra/133)SATA port multiplier not supported atapibus at %s not configured ata_hlatabusatdrnqidlataactatafinatathinvalid checksum %x for READ LOG EXT page %x READ LOG EXT page %x failed to report error: slot %d err %x status %x couldn't create dma map. (error=%d) mmctaskqxfer 512xfer 1024xfer 2048xfer 4096xfer 8192xfer 16384xfer 32768xfer 65536xfer unalignedxfer error%s(manufacturer 0x%x%sproduct 0x%x%sstandard function interface code 0x%x%sat %s function %d "couldn't create task thread couldn't alloc memory (sdmmc function) sdmmcdelaysdmmc_set_relative_addr: SMC_CAPS_SPI_MODE setsdmmc_select_card: SMC_CAPS_SPI_MODE setsdmmc_select_card: error %dcouldn't supply bus power couldn't supply clock couldn't enable card: %d couldn't identify card no functions i/o init failed mem init failed bad CIS ptr %#x CIS parse error at %d, tuple code %#x, length %d CISTPL_FUNCE(common) found in function CISTPL_FUNCE(common) too short CISTPL_FUNCE(lan_nid) too short CISTPL_FUNCE(lan_nid) invalid CISTPL_FUNCE(function) found in common CISTPL_FUNCE(function) too short (v1.00) CISTPL_FUNCE(function) too short bad CISTPL_FUNCID length bad CISTPL_MANFID length CISTPL_VERS_1 too short SDIO function unknown tuple code %#x, length %d %s: CIS version %u.%u %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: extended I/O error %d, r=%d p=%p l=%d %s direct I/O error %d, r=%d p=%p %s couldn't supply voltage requested by card couldn't send I/O OCR couldn't set I/O RCA couldn't select I/O RCA %d can't change bus width couldn't read CIS can't change bus clock %u-bit width, %u.%03u MHz %u KHz error waiting for data ready after ext write : %d switch error error waiting for data ready after switch command: %d can't read EXT_CSD (error=%d) unrecognised future version (%d) unknown CARD_TYPE: 0x%x card failed to switch to timing mode %d, using %d can't re-read EXT_CSD HS_TIMING set failed can't switch signaling voltage DDR52HS200can't execute MMC tuning can't enable cache: %d HostHost/CardSD_SEND_SCR send failed. can't change bus width (%d bit) switch func mode 0 failed failed to recover UHS card switch func mode 1 failed: group 1 function %d(0x%2x) can't get SD status: %d SD card status: %d-bit unknown bus width, C%d, U%d, V%d, A%d, Cache, %s self-maintenancecan't execute SD tuning setting cache enable failed: %d cache enabled can't enable cache: %dunknown SD CSD structure version 0x%x unknown MMC CSD structure version 0x%x unknown MMC version %d couldn't set mem RCA mid=0x%02x oid=0x%04x pnm="%s" rev=0x%02x psn=0x%08x mdt=%03x write-protected cache flush failed Default/SDR12High-Speed/SDR25SDR50SDR104DDR50SD cardMMC: <0x%02x:0x%04x:%s:0x%02x:0x%08x:0x%03x> %s 0x%02x:0x%04x:%ssdmmc discard countsdmmc discard errorssdmmc discard busyldsdmmc%sattachcouldn't create thread (disabled)%d-bit width, %s, %s cache%s, Cache%s,blkno 0x%llu exceeds capacity %d , retrying ld_sdmmcconfig_hook: invalid hook typeconfig_hook: incompatible mode on type=%d/id=%ld != %dconfig_hook: type=%d/id=%ld is replacedconfig_hook: type=%d/id=%ld is already hooked(%p)config_connect: can't connect with shared hook, type=%d id=%ldUNKNOWNCASIOCompaqHPHP Jornada addr 0x%lx-0x%lx intr %dPXA270Kernel is configured for %s, but CPU is %s : Onchip Peripheral Bus pxaip_attach: failed to map CLKMANpxaip_attach: failed to map MEMCTLpxaip_measure_cpuclock: can't map RTC%s: CPU clock = %d.%03d MHz %s: kernel is configured for PXA250, cpu type is %s pxaintcpxaip_attach_critical: failed to attach INTC!pxagpiopxaip_attach_critical: failed to attach GPIO!pxa2x0_memctl_read: not bootstrappedpxa2x0_memctl_write: not bootstrappedpxa2x0_clkman_config: not bootstrappedpxaippxa2x0_io_bs_alloc(): not implemented pxa2x0_io_bs_free(): not implemented : Interrupt Controller stray interrupt %d intr_establish: bogus irq number %dintr_disestablish: bogus irq number %dpxagpio_reg_read: not bootstrappedpxagpio_reg_write: not bootstrapped: GPIO Controller Can't map registers! failed to hook main GPIO interrupt no GPIO configured in kernel unhandled GPIO interrupt. GPIO#%d pxa2x0_gpio_intr_disestablish: can't unhook GPIO#0pxa2x0_gpio_intr_disestablish: can't unhook GPIO#1pxa2x0_gpio_intr_establish: bad pin number: %dpxa2x0_gpio_intr_establish: Pin %d not GPIO_INpxa2x0_gpio_intr_establish: bad level: %dpxa2x0_gpio_intr_establish: illegal shared interruptpxa2x0_gpio_set_intr_level: bad level: %d: can't map registers pxauart%s: Cannot map registersSA-11x0 OS Timer clock: hz=%d stathz=%d saost_countsaostStray DMAC interrupt for unallocated channel %d : DMA Controller dmac_pxaip_attach: bus_dmamem_alloc faileddmac_pxaip_attach: bus_dmamem_map faileddmac_pxaip_attach: bus_dmamap_create faileddmac_pxaip_attach: bus_dmamap_load failedpxa2x0_dmac_abort_xfer: channel %d failed to abortpxadmacpxapcic_mem_map: bogus kindpcic_attach_card: already attached%s,%dunable to create event thread for %d pxapcicevpxapcicss: %d slot%s can't attach failed to map MEMCTL unable to map register %s: Bus Error Detected Interrupt not handled 0x%x : Real-time Clock %s: couldn't map registers %s: using wristwatch register pxartcpxamci_dmac_ointr: non-zero completion status %d pxamci_dmac_iintr: non-zero completion status %d mmclkclock stop timeout unsupported bus frequency of %d KHz data not a multiple of %u bytes too much data couldn't start dma xfer. (error=%d) mmcmd: MMC/SD Controller couldn't establish MMC interrupt using DMA transfer couldn't alloc rx dma xfer couldn't alloc tx dma xfer couldn't attach bus apmsuspendpower management disabledunknown error codeinterface not connected16-bit interface already connected16-bit interface not supported32-bit interface already connected32-bit interface not supportedunrecognized device IDparameter out of rangeinterface not engagedunable to enter requested stateno pending eventsno APM presentreal mode interface already connectedAPM reservedAPM: %s event code %x get eventapmstandbyapmevioctl get power statusapm at %sPower Management spec V%d.%dunable to create thread, kernel APM support disabled reserved systemreserved deviceOEM definedapmdevpcmcia_childdetached: %s not found %s: error %d detaching %s (function %d) (manufacturer 0x%04x, product 0x%04x) function %d: %s pcmcia_function_init: function is enabled%s: card appears to have bogus CIS pcmcia_function_enable: function not initialized%s: couldn't map the CCR pcmcia_io_map: function is enabled! pcmcia_io_unmap: function is enabled! pcmcia_intr_establish: function is enabled! pcmcia_intr_establish: already done interrupt establish failed pcmcia_intr_disestablish: function is enabled! pcmcia_intr_distestablish: already done Drats! I need a skew! CIS checksum failed %s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) unspecifiedmulti-functionserial portparallel portfixed disk(ata)video adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx-%lx; memspace@%lx; maxtwins %d mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS %s: using CIS quirks for SVECFD605 PCMCIA EtherNet CardNDCPCMCIA MBH10302can't alloc mem for enet addr can't map mem for enet addr configure failed, error=%d can't get subregion for asic can't match ethernet vendor code cannot set power mgmt handler unable to establish power handler PCMCIAAmbiCom IncAMB8002TAmbiCom,Inc.Fast Ethernet PC Card(AMB8110)PMX PE-200UE2212D-LinkDE-660DE-660+RPTI LTD.EP400RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212EN2216-PCMCIA-ETHERNETSeiko Epson Corp.P/N: EEN10B Rev. 00TAMARACKCNetCN40BC EthernetPCMCIA-ETHERNET-CARDUE2216ASIXAX88190DFE-670TXDMELCOLPC2-TXLINKSYSE-CARDDE-650I-O DATAPCLAcorega K.K.corega Ether CF-TD LAN Cardcorega Ether PCC-Tcorega Ether PCC-TDcorega Ether PCC-TLcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDcorega FEtherII PCC-TXD(CG-LAPCCTXD)(HardwareFirmwareVer.)SMC8041TX-10/100-PC-Card-V2LNT-10TNCF10Base-Ethernet1.0DYNALINKL10Cne_pcmciacouldn't establish interrupt MEGAHERTZMODEM XJ2288com_pcmciacan't subregion I/O space memory mapped mode i/o mapped mode wdcattachDigital Mobile Media CD-ROMPCMCIA Portable CD-ROM DriveNinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI AdapterFREECOMPCCARD-IDEIO DATACBIDE2 LOOKMEETIDE CARDwdc_pcmciawiinitcouldn't load firmware failed to attach controller SMC2632WNANOSPEEDHFA384x/IEEENECWireless Card CMZ-RT-WPNTT-ME11Mbps Wireless LAN PC CardWireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11WLCFL-11INTERSILIntersilPRISM 2_5 PCMCIA ADAPTERPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN Adapterwi_pcmciaunable to flush cache timeout draining buffers failed to flush cache i/o blocked while suspended lddrain; first aligned sector %u%s: not drained dk_subrLucent/Prism/Symbol 802.11 controls%s: sysctl_createv failed (rc = %d) timeout in wi_seek to %x/%x %s: failed in wi_seek to %x/%x detect auto increment bug, try again command timed out, cmd=0x%x, arg=0x%x command failed, cmd=0x%x, arg=0x%x wi_cmd: busy bit won't clear. xmit failed %s: %d tx cmds pending!!! %s: cleaning outstanding rssadapt descriptor for %s record read mismatch, rid=%x, got=%x record buffer is too small, rid=%x, size=%d, len=%d %s: invalid channel %d %s: tx rate %d -> %d (%d) %s write fid %x failed failed to allocate %d bytes on NIC timeout in alloc tx buffer allocation failed %s: interface not running %s: device timeout %s read fid %x failed %s: null node%s bad idx %02x %s null node, rssdesc %02x %s txpending[%i] wraparoundtx failed, retry limit exceeded, max transmit lifetime exceeded, port disconnected, invalid format (data len %u src %s), status=0x%xwi_scan_result: unknown firmware type %u LucentSymbol could not establish softint could not get mac address, attach failed 802.11 address %s %s: using Unknown PRISM2 chipUnknown Lucent chip %s: %s Firmware: Primary (%u.%u.%u), Station (%u.%u.%u) using default channel list no available channel no supported rate list Lucent Technologies, WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEERF:PRISM2 MAC:HFA3841RF:PRISM2 MAC:HFA3841 CARD:HWB3763 rev.BRF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.ARF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.BRF:PRISM2 MAC:HFA3842 CARD:HFA3842 EVALRF:PRISM1 MAC:HFA3841 CARD:HWB1153RF:PRISM2 MAC:HFA3841 CARD:HWB3163-SST-flashRF:PRISM2.5 MAC:ISL3873B(PCMCIA)RF:PRISM2.5 MAC:ISL3874A(Mini-PCI)RF:PRISM2.5 MAC:ISL3874A(PCI-bridge)RF:PRISM3 MAC:ISL3871(PCMCIA)RF:PRISM3 MAC:ISL3871(Mini-PCI): failed to clear NIC buffer at offset %x - check configuration Ethernet address %s %s: NIC memory corrupt - invalid packet length %d device enable failed %s: remote transmit DMA failed to complete ne2000_write_mbuf: negative lenwhere did the card go? setup failed %s: %d silo overflow%s, %d ibuf flood%s com: unsupported I/O width %dtimeout while waiting for BUSY interrupt acknowledge timeout while waiting for HALT update acknowledge 0x%x 0x%x 'ns16550ast16650, broken fifost16650ans16550, broken fifons8250 or ns16450, no fifotl16c750ns16750Au1X00 UARTns16650, no ERSOMAP UARTIngenic UARTTegra UARTBCM AUX UARTDesignWare APB UARTDesignWare APB UART, no fifois_consoleforce_consoleskip_attach_delaycan't re-init serial console @%lx fifolen: %s, %d-byte FIFO txfifo disabled 10base2, 10baseT, 10baseT-FDX, auto, default [0x%02x 0x%02x] auto 10base2 10baseT-FDX 10baseT atarst%s:%d: %s %s:%d:%d: %s __wdccommand_kill_xfer: unknown reason %d __wdccommand_kill_xfer%s channel %d: reset failed for drive 0 drive 1atapitimeout not expected without pending irqlost interrupt type: %s tc_bcount: %d tc_skip: %d atapollatadrdyatacnfatardl%s: dir offset too large on fs %s (mounted from %s) %s: dir offset too large for emulated program /usr/libexec/ld.elf_so%s-%scompat_utilinvalid AES nrounds: %uBearSSL aes_ctAES-CCM overflow%s: ctxt %u%s: tag %u%s: verify %u failed %s: ptxt %u%s: forgery %u succeeded %s: buffer overrun %s: tag overrun aes_ccm: self-test passed aes_ccmaescryptoselectedAES is bustedaes: self-test failed: %s AES self-tests failedaes: %s %s AES-%u enc: self-test failed wasexpected%s AES-%u dec: self-test failed %s AES overrun preceding: self-test failed %s AES overrun following: self-test failed %s AES-%u-CBC enc: self-test failed %s AES-%u-CBC dec: self-test failed %s AES-%u-CBC enc inc %u: self-test failed %s AES-%u-CBC dec inc %u: self-test failed %s AES-CBC overrun preceding: self-test failed %s AES-CBC overrun following: self-test failed %s AES-128 CCM encrypt auth/ctr (16): self-test failed %s AES-128 CCM encrypt auth/ctr (48): self-test failed %s AES-128 CCM ciphertext: self-test failed %s AES-128 CCM decrypt auth/ctr (16): self-test failed %s AES-128 CCM decrypt auth/ctr (48): self-test failed %s AES-128 CCM plaintext: self-test failed %s AES-%u-XTS enc: self-test failed %s AES-%u-XTS dec: self-test failed %s AES-%u-XTS enc incremental: self-test failed %s AES-%u-XTS dec incremental: self-test failed %s AES-XTS overrun preceding: self-test failed %s AES-XTS overrun following: self-test failed %s AES-128 CBC-MAC (16): self-test failed %s AES-128 CBC-MAC (48): self-test failed chacha: self-test failed: %s chacha: %s Portable C ChaChaxchacha_streamxchacha_stream_xorchacha core 1chacha core 2hchachacprng_fast reseed/usr/src/sys/crypto/blake2/blake2s.c0 < dlenkernel %sassertion "%s" failed: file "%s", line %d dlen <= 32keylen <= 32jA%AESŘOOLJ܈yLblake2s: self-test failedblake2s: self-test passed blake2ssysmonsysmon_envsyssysmon_wdogsysmon_powerWARNING: KERNEL TICKLE OF WATCHDOG %s FAILED! wdogrefWARNING: unable to register watchdog shutdown hook WARNING: unable to register watchdog critpoll hook %s: %d users remain WARNING: UNABLE TO DISARM WATCHDOG %s ON CLOSE! WARNING: FAILED TO SHUTDOWN WATCHDOG %s! software watchdog initialized unable to register software watchdog with sysmon swwdog%s: %d second timer expired watchdog timer expiredswwrebootfailed to create swwdog reboot wq%s: unable to attach cfattach invalid vap id %dvap id %d not allocatedinvalid channel freq %u flags %x invalid channel (NULL) %s: mode %u not supported (caps 0x%x) Unexpected mode %u%s: no channels found for mode %u Bad IBSS channel %ubad channel ignored; freq %u flags %x number %u vap table full.5%s: %s rates: %s%d%sMbps%s: no 802.11 instance! 11a11b11gFHturboAturboGAMRR increasing rate %d (txcnt=%d retrycnt=%d) AMRR decreasing rate %d (txcnt=%d retrycnt=%d) No cipher!%s: %s keyix %u flags 0x%x rsc %ju tsc %ju len %u %s: driver did not delete key index %u %s: cipher %s has an invalid cipher index %u %s: cipher %s registered with a different template %s: invalid cipher %u %s: unregistered cipher %u, load module %s %s: unable to load cipher %u, module %s %s: no h/w support for cipher %s, falling back to s/w %s: no h/w support for TKIP MIC, falling back to s/w %s: unable to attach cipher %s %s: no h/w resources for cipher %s, falling back to s/w %s: unable to setup cipher %s %s: %s keyix %u flags 0x%x mac %s rsc %ju tsc %ju len %u %s: cipher %s rejected key index %u len %u flags 0x%x %s: no key index; should not happen! [%s] no default transmit key (%s) deftxkey %u %s: control frame%s: WEP data frame too short, len %u wlan_wepwlan_tkipwlan_aes_ocbwlan_ccmpwlan_ckip%s: Invalid key length %u, expecting %u [%s] Missing ExtIV for AES-CCM cipher [%s] AES-CCM decrypt failed; MIC mismatch AES-CCM[%s] key id %u is not set (decap) [%s] key id %u is not set (encap) NONEout of buffers with data_len %zu [%s] Discard frame due to countermeasures (%s) [%s] missing ExtIV for TKIP cipher [%s] discard frame due to countermeasures (%s) [%s] TKIP ICV mismatch on decrypt TKIP[%s] out of data for WEP (data_len %zu) [%s] WEP ICV mismatch on decrypt WEP[%s:%s] discard %s frame, %s information element, too short, len %uWME[%s] discard %s frame, ssid mismatch: [%s] extended rate set too large; only using %u of %u rates [%s] shared key challenge alloc failed reassocWPARSN, protection, QoSie too shortbad len %uERPid %u, len %uunhandledno scan.sp_ratesbad scan.sp_rates len %dno scan.sp_ssidbad scan.sp_ssid len %dinvalid channel %ufor off-channel %ubogus beacon interval[%s] erp change: was 0x%x, now 0x%x [%s] capabilities change: before 0x%x, now 0x%x no ratesbad rates len %dno ssidbad ssid len %dno ssid with ssid suppression enabled[%s] recv probe req recv'd rate set invalid[%s] recv auth frame with algorithm %d seq %d disallowed by ACLTKIP countermeasures enabledshared key auth PRIVACY is disabledbad sta auth mode %uie %d/%d too longno challengebad challenge len %dbad operating mode %ubad state %u[%s] shared key %sauth request shared key responseunknown stationno challenge recordedchallenge mismatch[%s] station authenticated (shared key) bad seq %d[%s] shared key auth failed (reason %d) open auth[%s] station authenticated (open) [%s] open auth failed (reason %d) unsupported alg %dwrong bssid[%s] deny %s request, sta not authenticated [%s] no WPA/RSN IE in association request not WPA, flags 0x%xbad version %umcast cipher mismatch; got %u, expected %uucast cipher data too short; len %u, n %uucast cipher set emptykey mgmt alg data too short; len %u, n %uno acceptable key mgmt algnot RSN, flags 0x%x[%s] %s ie: mc %u/%u uc %u/%u key %u caps 0x%x [%s] deny %s request, capability mismatch 0x%x [%s] deny %s request, rate set mismatch [%s] %sassoc failed (reason %d) [%s] %sassoc failed (rate set mismatch) [%s] %sassoc success: %s preamble, %s slot time%s%s [%s] recv deauthenticate (reason %d) [%s] recv disassociate (reason %d) subtype 0x%x not handledmgttoo short (1): len %uwrong version %xnode %s, %snot to bssnot to cur sta: lladdr=%6D, addr1=%6Dtoo short (2): len %ubss %s, broadcast %s, %sseqno <%u,%u> fragno <%u,%u> tid %uduplicateunknown dir 0x%xmulticast echounknown srcunassoc src[%s] power save mode on, %u sta's in ps mode [%s] power save mode off, %u sta's in ps mode [%s] flush ps queue, %u packets queued multicast fragm?demic errordecap errorunauthorized port: ether type 0x%x len %utoo short: len %ureceived %s from %s rssi %d WEP set but not permittedWEP set but PRIVACY offps-pollunassociated stationaid mismatch: sta aid 0x%x poll aid 0x%x[%s] recv ps-poll, but queue empty [%s] recv ps-poll, send packet, %u still queued [%s] recv ps-poll, send packet, queue empty bad frame type 0x%x[%s] %s compat_20link-layer statistics and controlsIEEE 802.11 WLAN statistics and controlsieee80211%s: sysctl_createv failed, rc = %d client/peer stationsvap%uinact_runinact_probeinact_authinact_initdriver_capsbmiss_max%s: 802.11 mgt frame too large: %ubad beacon boundarybss %snode %s join %snode %s leave notify scan done [%s] %s replay detected [%s] michael MIC verification failed %s: load the %s module by hand for now. bogus aid %u, max %u%s %p<%s> in %s table %s: IEEE80211_LOCK not held%s: remove %p<%s> from %s table, refcnt %d %s: %p<%s> clear key map entry [%s] scan candidate purged from cache (refcnt %u) %p: mac %s refcnt %d scangen %u authmode %u flags 0x%x associd 0x%x txpower %u vlan %u txseq %u rxseq %u fragno %u rxfragstamp %u rstamp %u rssi %u intval %u capinfo 0x%x bssid %s essid "%.*s" channel %u:0x%x fails %u inact %u txrate %u %s: free all nodes in %s table %s %s table %s: %s[%u] still active %s: scan set:%s%u start chan %u ????ibss %c %s %s%c %3d%c %+4d %2dM%c %4s%c %3s%c passive%s: end %s scan ni != NULLrefcnt(ni) == %dic != NULL%s: fixed rate %d (%d.%d Mb/s) not in rate set%s %p<%s> %s: add key map entry %p<%s> refcnt %d [%s] no node, discard frame (%s) %s %p<%s> refcnt %d %s: %p<%s> clear key map entryneighbor%s: creating ibss %s: merge failed, capabilities mismatch %s: new bssid %s: %s preamble, %s slot time%s %s: no scan candidate macaddr bssid chan rssi rate flag wep essid %s %s: chan %d->%d begin %s scan in %s mode, scangen %u new [%s] %s%s on chan %u (bss chan %u) [%s] caps 0x%x bintval %u erp 0x%x country info %02xkey map out of sync, ni %p nikey %p%s: delete key map entry %p<%s> refcnt %d %s: scan aborted %u [%s] station with aid %d leaves unexpected operating mode %ubogus long slot station count %d[%s] long slot time station leaves, count now %d %s: re-enable use of short slot time bogus non-ERP station count %d[%s] non-ERP station leaves, count now %d %s: disable use of protection %s: re-enable use of short preamble %s: %s scangen %u [%s] discard frame, age %u [%s] discard %u frames for age probe station due to inactivitystation timed out due to inactivity (refcnt %u)[%s] station needs long slot time, count %d [%s] station is !ERP, %d non-ERP stations associated %s: enable use of protection [%s] station needs long preamble [%s] station %sassociated at aid %d: %s preamble, %s slot time%s%s unable to setup initial BSS node%s %s table, inact %u scanena[%s] send null data frame on channel %u, pwr mgt %s no ethernet header!not enough room, need %u got %lu [%s] enmic failed, discard frame mbuf already chained?pktlen %u mtu %ufragment size %u too big!%s: paylen < 0%s: npkt %d firstlen %d lastlen0 %d lastlen %d fraglen %d overlen %d len %d rate %d icflags %08x no WPA/RSN!RSN IE too big, %u > %zuWPA IE too big, %u > %zuieee80211_ref_node (%s:%u) %p<%s> refcnt %d [%s] send probe req on channel %u [%s] request encrypt frame (%s) [%s] send station deauthenticate (reason %d) [%s] send station disassociate (reason %d) [%s] invalid mgmt frame type %u [%s] encrypting frame (%s) [%s] send %s on channel %u %s: cannot get buf; size %u no space for 802.11 header?%s: traffic %u, disable aggressive mode %s: traffic %u, enable aggressive mode tim bitmap empty!%s: TIM updated, pending %u, off %u, len %u [%s] pwr save q overflow, drops %llu (size %d) [%s] save frame with age %d, %u now queued wlan: %s acl policy registered wlan: %s acl policy unregistered wlan_acl0x%s: %s -> %s no recent beacons from %s; rescanning %s: invalid transition %s: bogus xmit rate %u setup ostate %x nstate %x associated synchronized with %s ssid channel %d start %uMb NODS %s->%sTODS %sFRDS %sDSDS %s->%s) data type#%d WEP [IV %.02x KID %u] %dM +%d%s: %s [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s log2(cwmin) %u %s: WME params updated, cap_info 0x%x %s: %s chan [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s bss [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] beacon misswlan_internalwlan_xauthWME_AC_BEWME_AC_BKWME_AC_VIWME_AC_VOWME_UPSDINITSCANAUTHASSOCRUNreserved#0reserved#1reserved#2reserved#3reserved#5reserved#6reserved#7reserved#8reserved#9ps_pollrtscf_endcf_end_ackreassoc_reqreassoc_respprobe_reqprobe_respbeaconatimdisassocdeauthreserved#13reserved#14reserved#15rssadaptexpavgctl%s: dst %s threshold[%d, %d.%d] %d < %d %s: src %s rssi %d avg %d -> %d ieee80211_rssadapt_lower_rate: %s rate #%d > #%d out of bounds %s: dst %s rssi %d threshold[%d, %d.%d] %d -> %d %s: threshold[%d, %d.%d] decay %d %s: dst %s thresholds %d-byte, T[%d.%d] = %dexternal%hu.%hhu%s:%hhuigmpplinetigmplla_lookup: new lle malloc failed inmltplmulticastsubnetsarelocalhostzerobroadcastinvalid argument to in_lifaddr_ioctlin_controlin4pcbplin6pcbpl%d.%d.%d.%d%s:%huinterneticmpmaskreplreturndatabyteserrppslimitrediracceptredirtimeoutbmcastechodynamic_rt_msgICMP: redirect failed to register timeout for route to %s, code %d icmp_errorforwardingredirectttlforwsrcrtdirected-broadcastallowsrcrtmtudiscanonportminanonportmaxmtudisctimeoutlowportminlowportmaxcheckinterfacerandom_iddo_loopback_cksumdad_countanonportalgoavailablereserve%s: refusing to send from invalid address %s (pid %d) maxfragpacketsipfrenplrip_abortrip_acceptpcblisttcpipqepl(unknown)TCP: invalid wscale %d from %s, assuming %d tcp_pulloutofbandm_pulldown malfunctionConnection attempt to TCP %s:%d from %s:%d (unknown v6)Connection attempt to TCP [%s]:%d from [%s]:%d tcp_output REXMTtp->t_lastm == NULL%s: no template%s: %d < %dsackholepltcp_inittcpcbpltcp_new_iss: unreachable%s: impossible (1)%s: impossible (2)synplrfc1323sendspacerecvspacemssdfltminmssmslsyn_cache_limitsyn_bucket_limitinit_winmss_ifmtusackcongctlwin_scaletimestampscwmcwm_burstsizeack_on_pushkeepidlekeepintvlkeepcntslowhzlog_refusedrstppslimitdelack_ticksinit_win_localkeepinitrecvbuf_autorecvbuf_increcvbuf_maxsendbuf_autosendbuf_incsendbuf_maxecnmaxretriesglobalmaxholesglobalholeslocal_by_rttiss_hashabcaggressivemsltremoteremote_thresholdvtwtcp6inet6newrenocubicudp_abortudp_acceptudpchecksumrandom_startrandom_pickdoublehashrandinc(src=%s dst=%s tgt=%s)%s: sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d /usr/src/sys/netinet6/icmp6.c%s: source can't be determined: dst=%s, error=%d %s: ICMP6 redirect sent from %s rejected; must be from linklocal %s: ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) %s: ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s %s: ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s %s: ICMP6 redirect rejected; no route found for redirect dst: %s %s: ICMP6 redirect rejected; redirect dst must be unicast: %s %s: ICMP6 redirect rejected; neither router case nor onlink case: %s %s: invalid ND option, rejected: %s %s: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s %s: ICMP6 checksum error(%d|%x) %s %s: unknown type %d(src=%s, dst=%s, ifid=%d) icmp6nd6_prunend6_delaynd6_mmaxtriesnd6_umaxtriesnd6_maxnudhintmaxqueuelennd6_useloopbacknodeinfomtudisc_hiwatmtudisc_lowatnd6_debugreflect_pmtu%s: ENOBUFS in icmp6_error %d %s: in6_setscope failed IPv6 address: "%s" is not on the network %s: a destination can be specified for a p2p or a loopback IF only %s: prefixlen should be 128 when dstaddr is specified %s: valid lifetime is 0 for %s %s: addmulti failed for %s on %s (errno=%d) in6_prefixlen2mask: invalid prefix length(%d) invalid argument to in6_lifaddr_ioctl%s: %s marked tentative %s: %s marked detached in6_cksum: offset too short for IPv6 headerin6_cksum: mbuf too short for IPv6 header%s: %s has too small MTU, IPv6 not enabled %s: %s is not multicast capable, IPv6 not enabled %s: failed to configure the loopback address on %s (errno=%d) %s: %s: got interface identifier from itself %s: %s: got interface identifier from %s %s: %s: borrow interface identifier from %s %s: %s: interface identifier generated by random number %s: %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: failed to configure a link-local address on %s (errno=%d) %s: cannot assign link-local address ::ffff:%s[%s]:%huinternet6Cannot forward from %s@%s to %s@%s nxt %d (%s) unspec/srcbcast/mcastmcast/dstsrc[%s] inzone %d outzone %ddst[%s] inzone %d outzone %dip6keepfaithlog_intervalhdrnestlimitauto_flowlabeldefmcasthlimNetBSD-currentkame_versionuse_deprecatedv6onlyauto_linklocaladdctlpolicyprefer_tempaddrmaxfragsuse_defaultzonemcast_pmtuneighborgcthreshmaxdynroutesparam_rt_msgip6_init%s: packet to an unready address %s->%s %s: off < sizeof(struct ip6_hdr)%s: m == NULLpim6register_mifmultiple kernel entriesadd_m6fc: %s o %s g %s p %x dbx %p cannot forward from %s to %s nxt %d received on %s ip6_mforward: ip6_mrouter socket queue full assumption failed: hdr not splitmulticast_kludge%s: Cannot enable an interface with a link-local address marked duplicate. nd6_timer%s: workqueue_create failed (%d) %s: duplicated ND6 option found (type=%d) %s: nd6_options: unsupported option %d - option ignored %s: too many loop in nd opt %s: can't allocate llinfo for %s (ln=%p, rt=%p) %s: failed to set scope %s (errno=%d) %s.%d: sockaddr_dl_init(, %zu, ) failed on %s %s: rt_setgate failed on %s nd6_rtrequest: bad gateway value: %s %s: %s: failed to join %s (errno=%d) %s: detected a looped back NS message for %s %s: DAD duplicate address %s from %s %s: possible hardware address duplication detected, disable IPv6 %s: invalid hlim (%d) from %s to %s on %s %s: invalid target address %s %s: a solicited adv is multicasted %s: invalid ND option, ignored %s: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: duplicate IP6 address %s %s: ND packet from non-neighbor %s on %s nd6_dad_timer: called with duplicate address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: %s: could not run DAD, driver problem? %s: %s: DAD complete for %s - no duplicates found %s: bad DAD packet (wrong ip6 dst) %s: NS packet from non-neighbor %s on %s %s: bad NS target (multicast) %s: bad DAD packet (link-layer address option) %s: lladdrlen mismatch for %s (if %d, NS packet %d) %s: duplicate IP6 address %s %s: src=%s %s: dst=%s %s: tgt=%s nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: memory allocation failed for %s(%s) %s: %s: starting DAD for %s RA%s: src %s is not link-local %s: lladdrlen mismatch for %s (if %d, %s packet %d) raw6%s: assumption failure (non 0 ID): %s%%%d %s: no scope id for %s %s: can't set scope for not loopback interface %s and loopback address %s siteorganizationglobaludp6%s: control but no lwpudp6_output: IPV6_V6ONLY option was set for a connected socket addr 0x%x%s%s%s%s at %s addr 0x%02xi2c-indirect-device-permitlistinvalid property type (%d) for '%s'; must be array (%d) smbus-quick-writesmbus-receive-byteunknown probe strategy '%s'; defaulting to '%s' : I2C bus i2c-no-indirect-configi2c-child-devicescookiecookietypecompatibleWARNING: ignoring bad child device entry for address 0x%02x WARNING: ignoring bad device address @ 0x%02x i2cexec,i2c_bitbang,i2c_subri2cexeciic at %si2c_bitbangmii_attach: phyloc and offloc specifiedmii_attachmiimiiautomii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmiiverboseoui %6.6xmodel %4.4xOUI 0x%06x model 0x%04xmiiautmii_phy_setmedia: MASTER on wrong mediano media present HomePNA110baseT10baseT-FDX100baseTX100baseTX-FDX100baseT41000baseSX1000baseSX-FDX1000baseT1000baseT-FDX: Media interface : %s, rev. %d bgebnxphyflagsfailed to get phyflags chipidfailed to get chipid shared_hwcfgfailed to get shared_hwcfg port_hwcfgfailed to get port_hwcfg 2500baseSX-FDX BCM5400 1000BASE-T media interfaceBCM5401 1000BASE-T media interfaceBCM5402 1000BASE-T media interfaceBCM5404 1000BASE-T media interfaceBCM5411 1000BASE-T media interfaceBCM5421 1000BASE-T media interfaceBCM5424/BCM5234 1000BASE-T media interfaceBCM5461 1000BASE-T media interfaceBCM5462 1000BASE-T media interfaceBCM5464 1000BASE-T media interfaceBCM5466 1000BASE-T media interfaceBCM54K2 1000BASE-T media interfaceBCM5701 1000BASE-T media interfaceBCM5703 1000BASE-T media interfaceBCM5704 1000BASE-T media interfaceBCM5705 1000BASE-T media interfaceBCM5706 1000BASE-T/SX media interfaceBCM5714 1000BASE-T/X media interfaceBCM5750 1000BASE-T media interfaceBCM5752 1000BASE-T media interfaceBCM5780 1000BASE-T/X media interfaceBCM5708C 1000BASE-T media interfaceBCM5481 1000BASE-T media interfaceBCM5482 1000BASE-T media interfaceBCM5708S 1000/2500baseSX PHYBCM5709 10/100/1000baseT PHYBCM5709S 1000/2500baseSX PHYBCM5709CAX 10/100/1000baseT PHYBCM5722 1000BASE-T media interfaceBCM5754/5787 1000BASE-T media interfaceBCM5755 1000BASE-T media interfaceBCM5756 1000BASE-T media interface XXXBCM5761 10/100/1000baseT PHYBCM5784 10/100/1000baseT PHYBCM5785 1000BASE-T media interfaceBCM5717C 1000BASE-T media interfaceBCM5719C 1000BASE-T media interfaceBCM5720C 1000BASE-T media interfaceBCM57765 1000BASE-T media interfaceBCM57780 1000BASE-T media interfaceBCM54213PE 1000BASE-T media interfaceBCM5725C 1000BASE-T media interfaceBCM5906 10/100baseTX media interfacebrgphyDP83840 10/100 media interfacensphyDP83843 10/100 media interfaceDP83847 10/100 media interfaceDP83849 10/100 media interfaceDP83815/DP83846A 10/100 media interfacensphyterQS6612 10/100 media interfaceqsphyi82555 10/100 media interfacei82562EH HomePNA interfacei82562EM 10/100 media interfacei82562ET 10/100 media interfacei82562G 10/100 media interfaceinphyi82553 10/100 media interfaceiophy: 3Com internal media interface ignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYexphy100baseFX, 100baseFX-FDX LXT970 10/100 media interfaceLXT971/2 10/100 media interfacelxtphyICS1889 10/100 media interfaceICS1890 10/100 media interfaceICS1892 10/100 media interfaceICS1893 10/100 media interfaceICS1893C 10/100 media interfaceicsphyusing Seeq 84220 isolate/reset hack Seeq 80220 10/100 media interfaceSeeq 80225 10/100 media interfaceSeeq 84220 10/100 media interfacesqphyDM9101 (AMD Am79C873) 10/100 media interfaceDM9102 10/100 media interfaceDM9161 10/100 media interfaceDM9161A 10/100 media interfaceDM9161[BC] 10/100 media interfaceDM9601 internal 10/100 media interfacedmphyAm79C901 HomePNA 1.0 interfacepnaphy: %s (OUI 0x%06x, model 0x%04x), rev. %d : OUI 0x%06x, model 0x%04x, rev. %d ukphydmover_backend_unregisterdmoverdmreqdmsesdmover_session_destroy%s: emergency X server detach added (%s, %s emulationwsdisplaytty() on status devicewsdisplaytty() on ctl devicewsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch3: screen %d disappeared wsdisplay_switch3: giving up screen %d deleted kbdmux %d: console (%s, %s emulation), using %swsswwsdisplay at %swsdisplay: event queue overflow wswaitwsdisplay_noemulwsdisplay_emulEDIDdumb%s: ESC in kernel output ignored vt100[>24;20;0cP2$u%s%dP0!u%5\[?62;6c[8;%d;%dt[%d;%dR[?13n[?21n[?27;1nwsemul_vt100_handle_dcs: bad type %d[29~[28~OAOBODOCOoOnOmOlOkOjOMOI[2~[1~[8~[7~[6~[5~[4~[3~OpOqOrOsOtOuOvOwOxOyOPOQOROS[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[31~[32~[33~[34~wseventdefault_version%s: unknown version %dwsevent_read mux %dcannot load keymap: console keyboardattach error=%d couldn't register as input device connecting to %s wskdetwskbd_detach: %s didn't detach wskbd at %s%s: event queue overflow wskbdwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entrywsmux%s: disconnecting from %s wsbell at %swsbell%s: fontwidth assumptions botched%s: font stride assumptions botched%s: depth not supported %s: font table is empty %s: couldn't lock font %s: bits not aligned on 32-bit boundary %s: stride not aligned on 32-bit boundary ccwwsfont: font '%s' bito %d byteo %d copied to bito %d byteo %d wsfont_unlock: font not lockedBoldfacecd9660noplRRIP with incorrect NM flags? RRIP without PX field? RRIP with incorrect flags?IEEE_1282IEEE_P1282RRIP_1991ASPcd9660utf8_jolietfhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] %/@%/C%/Eroot_devicecd9660_strategy: spectag VT_ISOFS, isofs vnode msdosnoplmsdosfhplloadvnode(): pcbmap returned %d deextend: file too largedetrunc(): can't truncate root directory, clust %ld, offset %ld %s: copy FAT %d (error=%d) %s: write FAT (error=%d) . .. msdosfs_rename: updating .. in root directory?msdosfsmsdosfs_sync: rofs modRRaArrAamsdosmsdosfs_write(): bad file typemsdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %llu, %llu bind failed nfsvinvalnfs_doio: type %x unexpected nfsbioread: type %x unexpected ifupdown: socreate, error=%d ifupdown: GIFFLAGS, error=%d ifupdown: SIFFLAGS, error=%d nfsbifsetaddress: socreate, error=%d setaddress, error=%d nfsbtdnfs_boot: '%s' not found setmtu: socreate, error=%d setmtu: GIFMTU, error=%d setmtu: SIFMTU, error=%d deladdress: socreate, error=%d deladdress, error=%d nfs_boot: timeout... nfs_boot: sosend: %d nfs sndunlockshort receive (%lu/%lu) from nfs server %s impossible packet length%s (%d) from nfs server %s short receive (%lu/%d) from nfs server %s Egad!! receive error %d from nfs server %s nfsreply nilis alive againnfstrylatermtimectime%s: inaccurate wcc data (%s) detected, disabling wcc (ctime %u.%09u %u.%09u, mtime %u.%09u %u.%09u) %s: re-enabling wcc nfsiodnfsionfsiormnfsauth1nfsauth2nfskqpwnfskqpollnfskqdet%s: vp=%p error=%d nfsnodeplnfsvaplnfssillynfs_node_initnfs send error %d for %s nfsd send error %d timer starttimer stopnfscon sotypenfscn2nfs rcvunlockBad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad nfs server %s: %s not respondingnfsrvdescplbuild > MLENnfsumntnfsstatsiothreadsnfs_vfsops: nfs_statvfs would lose buffers nfs_args: retrying connect nfscn3nfsrcvnfssndnfsaionfsdisnfs%unfs_mountroot: mget soname for %snfs_mountroot: mount %s failed: %d root on %s nfs_mountroot: getattr for rootnfs_readdir: lost in spacenfs physio/asynctag VT_NFS, fileid %lld fsid 0x%llxwriterpc readonly vp %pnfsmblknfs: sillyrename dir.nfsAxxxx4.4nfs_remove: bad vrefcnt(vp)%s: map corrupted: start=%d, len=%d, fs = %s, offset=%d/%ld, cg %d%s: block not in map: bno=%d, fs=%s%s: map corrupted: cg=%d, irotor=%d, fs=%s%s: block not in map: fs=%suid %d, pid %d, command %s, on %s: %s %s: bad size: dev = 0x%llx, bno = %lld bsize = %d, size = %ld, fs = %s%s: bad block %lld, ino %llu bad blockifree: dev = 0x%llx, ino = %llu, fs = %s %s: freeing free inode%s: freeing free block: dev = 0x%llx, block = %lld, fs = %s%s: freeing free frag: dev = 0x%llx, block = %lld, fs = %sfile system full %s: write failed, file system is full out of inodes %s: create/symlink failed, no inodes free trimwqtrimwqcv%s: bad bprev: dev = 0x%llx, bsize = %d, bprev = %lld, fs = %s%s: bad blockno %#llx != %#llx%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE %s: bad optim: dev = 0x%llx, optim = %d, fs = %s%s: range: dev = 0x%llx, ino = %llu, fs = %sffs_balloc: blk too bigCould not unwind indirect block, error %dspec nodes went hereffs_indirtrunc: bad buffer sizeffs_truncate: partial trunc of extdataitrunc: newspacesnapblkfree: inconsistent block typeffs_snapshot_mount: vget failed %d ffs_snapshot_mount: non-snapshot inode %d ffs_snapshot_mount: read_1 failed %d ffs_snapshot_mount: read_2 failed %d ffs_snapshot_mount: %llu already on list%s: unknown fs_fragshift %d%s: ACLs requested but not supported by this fs WARNING: %s: POSIX.1e ACLs flag on fs but no ACLs support WARNING: %s: NFSv4 ACLs flag on fs but no ACLs support %s: "posix1eacls" and "nfsv4acls" options are mutually exclusive org.netbsd.kauth.systemffs_modcmd: can't listen on system scope. ffsdoclusterreaddoclusterwritedoreallocblkslog_changeopt%s: dup alloc ino=%lld on %s: mode %o/%o gen %x/%x size %llx blocks %llx%s: ino=%lld on %s: gen %x/%x has non zero blocks %llx or size %llx %s: dirty filesystem?ffsinoffsdino1ffsdino2appleufs, not mounting%s: dirty1%s: unknown ufs flags: 0x%08x%s %s: dirty2%s: options QUOTA2 not enabled%s %s: file system not clean (fs_clean=%#x); please fsck(8) %s: `-o softdep' is no longer supported, consider `-o log' %s: rofs mod, fs=%smfsidlmfs_rootmfs_open not VBLKtag VT_MFS, pid %d, base %p, size %ld mfs_inactive: not inactive (mfs_buflist %p)mfs_strategy: bad devwarning: mfs read during shutdown mfs_closemfs_initminiroot() called more than once%s: unlinked ino %lld on "%s" has non zero size %llx or blocks %llx with allerror %d %s: bad dir ino %ju at offset %d: %s not roundedmissing NUL in namenull entryi_size too small%s: too big%s: nospace%s: newblkhard-linked directoryufsdirufs_whiteout: unknown opufs_strategy: spectag VT_UFS, ino %llu, on dev %llu, %llu flags 0x%x, nlink %d mode 0%o, owner %d, group %d, size %qdinvalid uio rw: %damapplcownowcownowpageamapswpoanonpllkloanpguvm_anon_pageinuao_getuao_getpageuaoeltpluao_put: strange, got an out of range flush %#jx > %#jx (fixed) uao_put%s: impossibleuao_detubchashubc object hashubc_allocubc_faultubc_init: failed to allocate ubc_mapubc_init: failed to map ubc_objectudv_detachudv_attachflt_noram5flt_pmfail2flt_pmfail1anonget1anonget2flt_noram1fltamapcopyfltagain1flt_noram2pgo_faultfltagain2flt_noram4uvm_fault_unwire_locked: address not in mapuareauvmuvm_init: page size not setuvmfaultuvm_km_bootstrap: could not reserve space for kerneluvm_km_bootstrap: could not reserve kernel kmem%s: unable to allocate space in parent mapuvm_km_suballoc: submap allocation failedkm_pgrmkm_getwait2plpglivelockloanagainloanzeroloanuopguser_va0_disablevmmpeplvm_map%s: kernel object %p %p uvm_voaddr_release: bad typevmmeterloadavguvmexpuvmexp2maxslpuspaceminaddressmaxaddressthread_guard_sizeuobjwirepguvm_page_numa_lookup: failed, first pg=%p pa=%#lx uvm_setpagesize: page size %u (%#x) not a power of twouvm_page_physget: called _after_ bootstrapuvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocatedUVM: using NUMA allocation scheme UVM: using package allocation scheme, %d package(s) per bucket uvm_pagealloc_strat: bad strat %demergvapager_mapuvmpdlmtout of memory before the pagedaemon thread existspagedaemon: deadlock detected! fork pooldrainpgdaemonanonminfileminexecminanonmaxfilemaxexecmaxinactivepctpdpolicyreactanonreactfilereactexecpglac2pglallocTried to add RAM after uvm_page_inituvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX Boot time slabHotplug slab%s: unload attempted after uvm_page_init() uvm_page_physload: bad free list %duvm_page_physload: start[%lx] >= end[%lx]uvm_physseg_plug() failed at boot.%s: Tried to unplug from unknown offset %s: Tried to unplug oversized span %s: can't unplug() from the middle of a segment without UVM_HOTPLUG %s: swapdev not in listswap_encrypt%s: vnode type 0x%x%s: swap to sparse file%s: can't get vnode for swap device%s: can't lock swap device%s: can't open swap deviceswapmap%s: vmem_create failedswp vnxswp vndswapctl: miniroot copy failedswapctl: copystrswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap swapdrum_addswapiod%s: workqueue_create failedturning off swap...stopping swap on %s failed with error %d uvnfp1uvnfp2copy-cred-on-forkbufq_disksortbufq_fcfsNetBSD-CORE%s@%dELFexec_elf32#!exec_scriptvmcmdkillsextendscalls/dev/consolewarning: no /dev/console warning: lookup /dev/console: error %d init: couldn't allocate argument spaceinit path (default %s)use absolute path, "halt", or "reboot" /sbin/initinit: trying %s exec %s: error %d copyout %dDetecting hardware...fork initcannot mount root, error = %d fork pagedaemonioflushfork syncer%s %s (%s)total memory = %s avail memory = %s /sbin/oinit/sbin/init.bak/rescue/initmaxvnodesmaxprocmaxfilesargmaxhostidprofilingposix1versionngroupsjob_controlsaved_idsboothowtoboottimemaxpartitionstimexrtc_offsetipcsysvmsgsysvsemsysvshmsynchronized_ioiov_maxmapped_filesmemlockmemlock_rangememory_protectionlogin_name_maxdefcorenamelogsigexitfscaleccpucp_timemaxphysmonotonic_clocklabelsectorlabeloffsetlabelusesmbrforkfsleepposix_threadsposix_semaphoresposix_barriersposix_timersposix_spin_locksposix_reader_writer_locksdump_on_panicroot_partitiondriverscp_idcoredumpsetidownergroupno_sa_supportconfignamebuildinfomessagesusermemcnmagicusermem64ostypeosreleaseosrevisionhostnamedomainnamerawpartitionmodelmachinemachine_archncpubyteorderphysmempagesizealignbytesphysmem64ncpuonlinekernvfsddbvendorsecurityAccounting resumed Accounting suspended Accounting started Accounting terminated actwatacctwatchAccounting: write failed %d kcredplorg.netbsd.kauth.credorg.netbsd.kauth.genericorg.netbsd.kauth.processorg.netbsd.kauth.networkorg.netbsd.kauth.machdeporg.netbsd.kauth.deviceorg.netbsd.kauth.vnodehardscheddivclockratehardclock_tickshardclockstatclockclockinterruptpid %d (%s): %s write of %zu@%p at %lld failed: %d %.*sToo many CPUs. Increase MAXCPUS?cpu%dfdcloseincrease kern.maxfiles or MAXFILESfiledescfile2dup2entropy: ready entropy: best effort cpu0entropy intrdropentropy intrtruncWARNING: consolidating less than full entropy entropyentropy: pid %d (%s) waiting for entropy(7) WARNING: system needs entropy for security; see entropy(7) entropy: invalid seed length: %zu, expected sizeof(rndsave_t) = %zu entropy: invalid seed checksum entropy: double-seeded by bootloader entropy: entering seed from bootloader with %u bits of entropy entropy pool crypto self-test failedcollectiondepletionconsolidategathersamplesneededsamplespendingepochentsrclockentropy: no seed from bootloader unable to establish entropy softintentbutlerunable to create entropy housekeeping thread: %dnotifydepleterequestextract failpartialimmediatediscretionaryfilt_usertouch() - invalid type (%ld)%s: invalid type (%ld)EVFILT_READEVFILT_WRITEEVFILT_AIOEVFILT_VNODEEVFILT_PROCEVFILT_SIGNALEVFILT_TIMEREVFILT_FSEVFILT_USEREVFILT_EMPTY*fexecve*execargsshould not happensigcode kernel mapping failed %d pspawnlwpwaitnetbsdinit died (signal %d, exit %d)orphaned traced processexit1increase kern.maxproc or NPROCforkmxforkulimidle/%ucreate_idle_lwp: error %d%s: WARNING: powerhook_establish is deprecated dopowerhooks %s: %s (%p) dopowerhooks: %s done softresumesoftsuspendsoftstandbykthrwaitunnamedWARNING: kthread `%s' (%d) exits with status %d kthread_exitcurcpu holds : %18d wanted by: %#018lx pserialize%s: %s caller=%pKernel locklwpplmaxlwpsigwaitvfork(zombie)lwp_exitswapperlink_set_evcntsWARNING: module error: Built-in module `%s' can't find built-in dependency `%s'Built-in module `%s' prerequisite `%s' failed, error %dBuilt-in module `%s' failed its MODULE_CMD_INIT, error %d%s: builtin module "%s" init failed: %dlink_set_modules`link_set_modules' section not present, error %d`link_set_modules' section wrong size (%zu different MODULE declarations?)`link_set_modules' section wrong size (got %zu, wanted %zu)DEBUG: module: TRUEFALSEUnload requested for `%s' (requires_force %s)Module `%s' not foundModule `%s' busy (%d refs)Cannot unload built-in secmodel module `%s'Could not unload module `%s' error=%dUnloaded module `%s'Requesting autounload for`%s'Module `%s' declined to be auto-unloaded error=%dmod_unld/stand/%s/%s/modulesBuilt-in `%s' failed: %d moduleautounload_unsafeautotimemodunload%s: %dModule `%s' pushed by boot loader already existsDuplicate bootlist entry for module `%s'Unable to load `%s' pushed by boot loader, error %dUnable to fetch_info for `%s' pushed by boot loader, error %dDependentRequestedUse -f to reinstate builtin module `%s'module_do_builtin() returned %d%s module `%s' already loadedOut of memory for `%s'module_load_vfs_vec() failed for `%s', error %dCannot fetch info for `%s', error %dModule name `%s' longer than %dModule `%s' has invalid class %dModule `%s' built for `%d', system `%d'Forced load, system may be unstableIncompatible module class %d for `%s' (wanted %d)Dependency name mismatch (`%s' != `%s')Module with name `%s' already loadedCircular dependency detected for `%s'Required module name `%s' longer than %dSelf-dependency detected for `%s'Recursive load failed for `%s' (`%s' required), error %dUnable to affix module `%s', error %dModule properties failed for %slink_set_sysctl_funcsmodcmd(CMD_INIT) failed for `%s', error %dRecursive load causes duplicate module `%s'Module `%s' loaded successfullyLoad failed, error %dAutoload for `%s' requested by pid %d (%s)Autoload disabled for `%s' Autoload illegal path for `%s' Autoload not authorized for `%s' Autoload for `%s' status %dmod_hookLoading module from %s%s/%s/%s.kmodCannot %sload kernel object `%s' error=%d.plistplist load returned error %d for `%s'Loading plist from %snoautoloadautoloading is disallowed for `%s'kern.module.path=%s owner field : %#018lx wait/spin: %16d/%d locking against myselfMutexphysiodphysioDevices without power management support:%s: %s is suspended by %s (delegator %s) pmfsuspensortransition%s: %s-suspended by %s (delegator %s) already %s: %s assumes %s-suspension by %s (delegator %s) %s: newly %s-suspended by %s (delegator %s) resume failed %s: %s suspension %s (delegator %s) removed by %s classPowering devices:(failed)Shutting down devices: shutting down %s, skipped.failed.success.%s-self%s: suspend enter %s: class suspend %s: driver suspend %s: bus suspend %s: suspend exit Flushing disk caches: Suspending devices:%s: resume enter %s: bus resume %s: driver resume %s: class resume %s: resume exit Resuming devices:%s: PMF event %d dropped (no memory) %s: PMF event %d injected Input idle handler called pewplpmfeventcouldn't create pmfevent workqueuepmfsuspendcouldn't create pmfsuspend workqueuefailed to reserve PID 1 for init(8)procplexpose_addressproc2proc_args%s (pid %d) changing logname from %.*s to %s curprocpaxflagsrlimitcputimesofthardfilesizedatasizestacksizecoredumpsizememorylockeddescriptorssbsizevmemoryusestopforkstopexecstopexitcacheht_timeskim_intervalmin_catchtimesoftintskpreempt_prisched_enqueue: LWP %p has class %d owner/count : %#018lx flags : %#018x Reader / writer lock%s:%d: invoking "%s" (%s) crashme on %s failed! crashme plain old panic%s: locked once %s: locked twice %s: initialized %s: disabled kpreemption %s: raising ipl to %d %s: raised ipl to %d, s=%d crashme%s: failed to create sysctl debug.crashme: %d crashme_enable%s: failed to create sysctl debug.crashme_enable: %d %s: failed to create sysctl debug.crashme.%s %s: unable to remove %s from sysctl null_derefnull dereferencenull_jumpjump to nullmutex_recursionenter the same mutex twicespl_spinoutinfinite loop at raised splkpreempt_spinoutinfinite loop with kpreempt disabledsigactsksiginfotrapsignaleventswitchsorry, pid %d was killed: %s sigexit 1sigexit 2sendsig: bad version %d proc_stoptraceWARNING: softint_establish: table full, increase softint_bytes soft%s/%usoftint_init_isr: error %d%s block/%usoftint_init_cpu: cannot allocate memorybiosoftint_picklwpwedge:NAME=parsediskuse one of: %s[a-%c] none halt reboot %s%lluswap dumps on %smd0 (default %sdump device (default %sb)file system (default %s): use one of: genericroot on %scan't determine root device unknown device major 0x%llx device %s (0x%llx) not configured sched_unsleeplboltkpreemptdefer: critical sectiondefer: kernel_lockWARNING: lwp %ld (%s%s%s) flags 0x%x: timecounter went backwards from (%jd + 0x%016llx/2^64) sec to (%jd + 0x%016llx/2^64) sec in %s setrunnable: lwp %p state was %dWARNING: lwp %ld (%s%s%s): negative runtime: (%jd + 0x%016llx/2^64) sec WARNING: pid %ld (%s): negative runtime; monotonic clock has gone backwards pid %d, command %s, is killed: %s exceeded RLIMIT_CPU/usr/src/sys/kern/kern_sysctl.cp->sysctl_child == NULLsysctl_create: rnode %p wrong version sysctl_create: attempt to add node to aliased node %p sysctl_destroy: rnode %p wrong version %s: rnode %p wrong version sysctl_query: rnode %p wrong version sysctl_locate: pnode %p wrong version sysctl_dispatch: rnode %p wrong version sysctl_mmap: rnode %p wrong version sysctl_createv: rnode NULL sysctl_createv: sysctl_locate(%s) returned %d sysctl: log %p root mismatch (%p) sysctl_create succeeded but node not found?! sysctl_createv: sysctl_create(%s) returned %d sysctl_free: rnode %p wrong version root %p left %d size %d content len %d: end !!SYSCTL_NEEDFUNC!! timecounterchoicehardwaretimestepwarnings%s%s(q=%d, f=%lld Hz)timecounter: Timecounter "%s" frequency %ju Hz -- Insufficient hz, needs at least %u timecounter: Timecounter "%s" frequency %ju Hz quality %d tcdetachTime stepped from %lld.%09ld to %lld.%09ld timecounter: Timecounters tick every %d.%03u msec dummythreadpoolidle_msthreadpool job %p ran after destructionpooljobpoolthread%sthrdplcrpooldisppooldisp%sthplthrddeadjobnanoslppid %d attempted to set the (obsolete) kernel time zone calloutcallout_init_cpu (2)late/%uwait/%uturnstile_unsleeptodr_attach: TOD already configured WARNING: preposterous time in file system %s: cannot enable TODR writes %s: WARNING: cannot disable TODR writes WARNING: preposterous TOD clock time WARNING: no TOD clock present WARNING: clock lost %lld days WARNING: clock gained %lld days WARNING: using default initial time WARNING: using filesystem time WARNING: CHECK AND RESET THE DATE! Cannot set TOD clock time WARNING: Cannot set TOD clock time (busy) uihashuser info (uid->used proc) hashuidinfoproccntlwpcntlockcntsemcnt%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02xrtts%s: invalid tag (%u) acl_posix1e_mode_to_entry: invalid tag (%d) acl_posix1e_acl_to_mode: bad ae_tagacl_posix1e_acl_to_mode: missing base ae_tagsconfigure: `%s' driver %s failed: %dconfigure: attachment `%s' of `%s' driver %s failed: %d%s with registered handlerscfargs_canonicalize: unknown version %lu cfargs_canonicalize: submatch and search are mutually-exclusivedevice-attachdevice-detachlocationev: %s %s at %s in [%s] cfgmiscautoconfdetachallconfigintrconfigroot%s: thread %x joined with error %d config_devalloc: device name too longpmfsuspdevice-driverdevice-unitdevice-parentattribute-nameloc-namelocatorsinterface-attributesconfig_defer: can't defer config of a root deviceWARNING: power management not supported waiting for devices: done. WARNING: %d error%s while detecting hardware; check system log. config_attach: allocation of device softc failedFound %s (root)%s at %sconfig_detach: forced detach of %s failed (%d)root device %s not configured detaching %s, unable to detach instance init rollbackfiniconfig_cfdata fini rollback failedfini rollback unsupported blist_meta_alloc: allocation too largeblist_meta_fill: allocation too largeblst_meta_fill: filling unexpected rangeblst_radix_free: freeing free blockblst_meta_free: freeing already free blocks (%llu) %llu/%llublst_meta_free: freeing unexpected rangebufqstrategiesbufq_alloc: sort out of rangebufq_bufq_alloc: no strategycallbacknist_hash_drbg_instantiatecprng_strong reseednist_hash_drbg_destroynist_hash_drbg_reseedNIST Hash_DRBG failed self-testurandomarandomnist_hash_drbg_generateslowfastcpu_topology_init: asymmetric & SMT?? pkg1st%s has %d %s siblings:%s first in package: %s GAVE UPureadc: non-positive residureadc: non-positive iovcntdevice-enumerate-childrendevsw%s: block majors exhausted %s: character majors exhausted writ%s%d%c: %s %sing fsbn %lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)no raw partition and disk reports bad geometryno raw partition and partition table is fullsectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitdisk-info%s: can't alloc vnode for %s%s: can't open dev %s (%d) %s%d%cevcnt/dev/nullset{u,g}id pid %d (%s) was invoked by uid %d ppid %d (%s) with fd %s closed extent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags = 0x%x 0x%lx - 0x%lx extent_free: start 0x%lx, end 0x%lx extent_free: region not foundhashdone: invalid table typehashstat KMGTPE kMGTPE%qu%s%c%snointrdisknamesiostatnamesiostatsiostat_free: iostat_count == 0ipiWARNING: ipi_register: table full, increase IPI_MAXREG kcpuset(9): all early-use entries exhausted; increase KC_SAVE_NITEMS kmem-02048kmem-04096kmem-08192kmem-16384kmem-00008kmem-00016kmem-00024kmem-00032kmem-00040kmem-00048kmem-00056kmem-00064kmem-00080kmem-00096kmem-00112kmem-00128kmem-00160kmem-00192kmem-00224kmem-00256kmem-00320kmem-00384kmem-00448kmem-00512kmem-00768kmem-01024not modular%#018lx%s error: %s,%zu: %s lock address : %s current cpu : %18d current lwp : %#018lx lock error: %s: %s,%zu: %s: lock %p cpu %d lwp %pklogmsgbufsizemsgbufrunoncepercpupool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) %s: [%s] item %p not part of pool%s: [%s] item %p below item space%s: [%s] item %p poolid %u != %u page %p, nmissing %d, time %u %s: [%s] ph %p poolid %u != %upool item size %zu too large, use a custom allocator%s: [%s] too large itemsperpage(%d) for PR_USEBMAPpoolbusyphpool-%dpcgnormalpcglargepcachepcachecpu%s: [%s] page empty%s: [%s] page header missing%s: [%s] %u >= %u%s: [%s] %p already freedMust specify a pool to print. POOLCACHEPOOL %s:%p:%u:%u:%u:%u:%u:%u:%u:%u:%u:%u:%zu %s: itemsize %u, totalmem %zu align %u, ioff %u, roflags 0x%08x pool %p, alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p cpu layer hits %llu misses %llu cache layer hits %llu misses %llu cache layer full groups %u full cache groups: group %p: avail %d %p, 0x%llx %p (null)[% 4jd.%.*ld] %s: table is full - %s %s: table is full Skipping crash dump on recursive panic panic: autoconfiguration error: mismatching pserialize_read_exit()exclusive accessspecificdata_domain_delete: not implementedspecificdata_setspecificbtallocvmem%s-%zuvmem-vavmem-metavmembtvmem_sizevmem_rehash%s: workqueue_create %d static_bt_inusestatic_bt_countInvalid IPL: %dxclowxchighcrosscallunicastxcallxcall/%uaioworkaiodoneaio_process: invalid operation code posix_aioaio_listio_maxaio_maxaio_jobs_poolaio_lio_poolefdreadefdwriteeventfdfqabortfutexinvalid futex opWARNING: pid %jd (%s) lwp %jd: unmapped robust futex list head WARNING: pid %jd (%s) lwp %jd: exhausted robust futex limit sys_ioctl: _IO%s%s('%c', %lu, %lu) returned -1: pid=%d comm=%s memfdcompat_80posix_msgmqueuemq_open_maxmq_prio_maxmq_max_msgsizemq_def_maxmsgmq_max_maxmsgmqmsgplmqsendcvmqrecvcvmqparkedpsetpsets_max%d:1,%d:2direct_selectcompat_16posix_schedpri_minpri_maxsockettfdreadtimerfdttyrub: would panic c = %d, val = %d not a controlling terminal no foreground process group empty foreground process group found only zombie processes load: %d.%02d cmd: %s %d [%#lx/%d%ld.%02ldu %ld.%02lds %d%% %ldkttypausettyrawttyrawfttycanttycanfttyoutttyoutfttyreftkstatnincanccrawccqsizecompat_60compat_43ttyldisc_init: termios_discttyldisc_init: ntty_disctermiosnttytabletslippppstriphdlcincrease kern.maxptysputc: required clalloc b_to_q: required clalloc accfaccf_seqpacketdgram%s: source too long, %d < %d bytesunix: inet: inet6: link: atalk: (unknown socket family %d)bad family %hhumbuf %p already freedmsizemclbytesnmbclustersmblowatmcllowatnmbclusters_limitmbplmclplm_copydata: off %d, len %dm_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d)m_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d), len=%d (%d)%s: len > MHLEN%s: off %d, len %d%s: m == NULL, off %d%s: m == NULL, len %d [!COPYALL]%s: no header (m = %p)unixpsemposixsemmaxksemsomaxkvasofixedbufsbmaxsooptionssokvasopendfrbad initial sb_max value: %lusopendfreesoinit1 %dnetiosbappendaddrsbappendaddrchainsbappendcontrolsemi-panic: sbcompress sbdrop(%p,%d): cc=%lu%s: message too large %d mbsonamembcontrolmsghdrmbfreembdatambheadermbsoptsmbftablemboobdataunp_disconnect1uipc 1uipc 2unp_attachunp_connect1unp_threadinflightdeferredunpgcuipc_init %duipc_usrrequipc 4buf mem pool index %dbufhashbuffer hashforcing bufcache %d -> 5forcing bufcache %d -> 95needbufbufinit: cannot allocate submapbufplbioplbuf%ukbuf%ubbufcachebufmembufmem_lowaterbufmem_hiwaterbufinit2: can't establish soft interruptbiolockbiowaitbiodone2 alreadyallocbuf: buffer larger than MAXBSIZE requestednamecachenamecache_statsncpurgedirhpldirhepldirhashmemusedmaxmemdirhash_remove couldn't find entry in hash table vfs_op_descsoperation %s not listed in %s. vfs_opv_init: bad operationvfs_opv_init: operation vector without vop_defaultfstypesmagiclinkstimestamp_precisionlf_findoverlap: defaultchrooted pid %d uid %d (%s) detected outside of its chroot /../zauruskernel_identruidrgidInvalid nameiop relookup: null namerelookup: lookup on dot-dotnamei_simple_convert_flags: bogus sflags %s: failed to start extattr: error = %d syncing disks... vfs_mountroot: root device unknownvfs_mountroot: rootdev set for DV_IFNET (0x%llx -> %llu,%llu)vfs_mountroot: rootdev not set for DV_DISKvfs_mountroot: can't get vnode for rootdevvfs_mountroot: can't open root device %s: inappropriate for root file system root file system type: %s WARNING: No file system modules have been loaded. Supported file systems:no file system for %s (dev 0x%llx)cannot find root vnode, error=%dmount: lost mountUnmounting fresh file system faileddanglingunmount: dangling vnodeforcefully %sunmounted %s on %s type %s unmount of %s failed with error %d unmounting done WARNING: some file systems would not unmount unmounting file systems... filedelaydirdelaymetadelayinvalid specnode type: %dILLEGALvnode %p flags %s %stag %s(%d) type %s(%d) mount %p typedata %p %susecount %d writecount %d holdcount %d %ssize %llx writesize %llx numoutput %d %sdata %p lock %p %sstate %s key(%p %zd)%slrulisthd %p ROOTSYSTEMISTTYMAPPEDMPSAFE TEXT EXECMAP WRMAP PAGESONWORKLSTDEADCHECKDIROPvflushbuf: not dirty, bp %pvflushbuf: dirtyACTIVEMARKERLOADINGLOADEDBLOCKEDRECLAIMINGRECLAIMEDVNONVREGVDIRVCHRVLNKVSOCKVFIFOVBADVT_UFSVT_NFSVT_MFSVT_MSDOSFSVT_LFSVT_LOFSVT_FDESCVT_PORTALVT_NULLVT_UMAPVT_KERNFSVT_PROCFSVT_AFSVT_ISOFSVT_UNIONVT_ADOSFSVT_EXT2FSVT_CODAVT_FILECOREVT_NTFSVT_VFSVT_OVERLAYVT_SMBFSVT_PTYFSVT_TMPFSVT_UDFVT_SYSVBFSVT_PUFFSVT_HFSVT_EFSVT_ZFSVT_RUMPVT_NILFSVT_V7FSVT_CHFSVT_AUTOFSsymlink-target%s: failed to start extattr, error = %d%s: failed to stop extattr, error = %dsyncwaitfdesckernfsafsfstchgfstcntfstlwpvcachevnode cache hashvnfull%s: cannot reclaimdead but not clean%s: bad ref countvcacheplvdrainvrele%s: holdcnt vp %p%s: cannot lock%s: neg numoutput, vp %pxattr-listsystem.user.security.trusted.xattr-namexattr-valvop_setextattrvop_deleteextattrvop_openextattrvop_listextattrvop_getextattrvop_closeextattrvop_aclcheckvop_setaclvop_getaclvop_putpagesvop_getpagesvop_whiteoutvop_advlockvop_pathconfvop_islockedvop_printvop_strategyvop_bmapvop_unlockvop_lockvop_reclaimvop_inactivevop_abortopvop_readlinkvop_readdirvop_symlinkvop_rmdirvop_mkdirvop_renamevop_linkvop_removevop_seekvop_fsyncvop_mmapvop_revokevop_kqfiltervop_pollvop_fcntlvop_ioctlvop_fdiscardvop_fallocatevop_writevop_readvop_setattrvop_getattrvop_accessxvop_accessvop_closevop_openvop_mknodvop_createvop_lookupvop_parsepathvop_bwritedead fs operation useddeadtag VT_NON, dead vnode fifordfifowrtag VT_NON, fifo with %d readers and %d writers/usr/src/sys/miscfs/genfs/genfs_io.cgenput%s: bogus command %dgenfs: bad op%s: ACL_OTHER missing layerfs tag VT_LAYERFS, vp=%p, lowervp=%p spec_fdiscard: not a device dev %llu, %llu spec_close: spurious pgrp refspec_close: not specialspec_ioctlinvalid specfs vnode type: %dspec_read typespec_write typespeciofictitiousdefault labelWARNING: %s: total unit size in disklabel (%llu) != the size of %s (%llu) %s: %llu trailing sectors not covered by disklabel WARNING: %s: end of partition `%c' exceeds the size of %s (%llu) %s at %s (%s) deleted raidframecgd%s: blkno (%llu) + size / DEV_BSIZE (%zu) > p_size (%llu) %s%u: unable to attach pseudo-device %s at %s: "%s", %llu blocks at %lld, type: %s WARNING: double match for wedge name %s (%s, %s) wedge:%sdkwedge: unable to attach cfdriverdkwedge: unable to attach cfattachdk-method-%s: method "%s" already exists at priority %d %s: unable to compute pdev, error = %d %s: unable to find vnode for pdev, error = %d %s: unable to lock vnode for pdev, error = %d %s: unable to open device, error = %d %s: unable to close device, error = %d WARNING: double match for boot wedge (%s, %s) %s: WARNING: clamping number of blocks to 512 (was %u) APPLE_UNIX_SVR2APPLE_HFS%s: wedge named '%s' already exists, manual intervention required %s: error %d adding partition %s type %s APPLEsysvhfs%s: GPT GUID: %s %s: bogus GPT entry size: %u %s: WARNING: clamping number of GPT entries to 512 (was %u) %s: GPT block numbers out of range %s: unable to read GPT partition array, error = %d %s: bad GPT partition array CRC %s: wedge named '%s' already existed, using '%s' %s: error %d adding entry %u (%s), type %s GPTccdvmkcorevmfsvmwresvntfsext2fszfsmdidle%s: cfattach_attach failed /dev/randombpfmaxbufsizepeers%s: softint_establish() failed%s: no bpf_if found for %sbpf_mcpybpf_change_type%s: bpf_setdlt: ifpromisc failed (%d) bpf_filterbpfops%.*s/%hhu#link#%huif_%s: watchdog triggered ifnetifaiflnkstifwdogsdl%s: could not attach sysctl nodes sndqmaxlendrops%s: could not attach sysctl watchdog nodes watchdogtriggerrcvqif_detach: WARNING: AF %d not purged DOWN%s: lost link state change %s %s-lshktoo many interfaces%s: recursively called too many times(%d) %s: m_tag_get() failed, recursion calls are not prevented. invalid argument to %sinvalid ifnet multicast command: 0x%lx%s: can't handle af%d The multicast bit is set in the MAC address. It's wrong. %s-ether_ifdetachhooks33etherrps_hash%s: invalid ifp (sdl_index %d) llentrypllooutput: no header mbufif_looploifmedia_set: no match for 0x%x/0x%x ifmedia_set failed%s: invalid timer type pfilpktqsyncpktqrenqifqcurcputoeplitztoeplitz-othercpusMask for route not entered rn_addmask: mask impossibly already in tree Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: Orphaned Mask %p at %p rn_delete: couldn't find us radix already initializedrn_initrn_init 2delayed rn_inithead failedraw_usrreqrt_timer_timer: rtq_count reached 0 rtentryrt_freert_updatertentplrttmrplrt_timerrt_timer_queue_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 %s: unable to delete rtentry @ %p, error = %d mZV%[Ag%=C+ˮ{0w-0 jB;rtfree 2route_purgeifroute_abortroute_accept%s: message too long%s: queue full, dropped message %s: unknown command %drtableroutend_delaynd_bmaxtriesnd_umaxtriesnd_reachablend_retransnd_nudnd_maxnudhintlog_movementslog_permanent_modifylog_wrong_iface%s: source can't be determined: dst=%s %s: %s not ready %s: called with non-tentative address %s(%s) %s: memory allocation failed for %s(%s) %s: called with duplicate address %s(%s) %s: %s: ARP announcement complete for %s %s: arp_setgate failed %s: bad gateway value %s: failed to %s llentry for %s on %s arp from %s: addr len: new %d, i/f %d (ignored) %s: arp: link address is broadcast for IP address %s! duplicate IP address %s sent from link address %s %s: DAD defended address %s from %s %s: DAD ignoring duplicate address %s from %s %s: DAD defence failed for %s from %s %s tried to overwrite permanent arp info for %s %s on %s tried to overwrite arp info for %s on %s arp info overwritten for %s by %s arpintrrevarp%s: mbuf %d too short for IP header %zu%s: offset %d too short for IP header %zuencapelemip_encap cv%s_wqinput%s: could not create a sysctl node for %s inputqgpiobus at %sis-rootmodelsTraditional NetBSD: Superuserorg.netbsd.secmodel.susersuser_modcmd::init: secmodel_register returned %d suser_modcmd::fini: secmodel_deregister returned %d is-securelevel-aboveTraditional NetBSD: Securelevelorg.netbsd.secmodel.securelevelsecurelevel_modcmd::init: secmodel_register returned %d securelevel_modcmd::fini: secmodel_deregister returned %d curtainTraditional NetBSD: Extensionsuser_set_cpu_affinityorg.netbsd.secmodel.extensionsextensions_modcmd::init: secmodel_register returned %d extensions_modcmd::fini: secmodel_deregister returned %d usermounthardlink_check_uidhardlink_check_gidTraditional NetBSD: 4.4BSDorg.netbsd.secmodel.bsd44secmodel_bsd44_modcmd::init: secmodel_register returned %d secmodel_bsd44_modcmd::fini: secmodel_deregister returned %d secmodel_bsd44suser,securelevel,extensionsfssptmdrvctltapveriexecfwucycomutoppybthubamrlockstatputtersrtdrmaltmemtwacpuctlpadtprofisvvideohdaudiouhsorumpblknpfdtviscsitpmmfiseepromdtracespiflashluaspkrhdmicecnvmeqemufwcfgautofsgpioppsnvmmkcovspiipmivhcivio9pwwancacpismbiosefisht3xtempscmdviocongpioirqumcpmioemcfancttyphysconptcqmsofconstunvidcconsoleopmsiplofromscrfcomjoymidisequencervcodawsdisplaywsmouseusbuhidulptscsibusraidugenucomopenfirmbiconsdevsacommlywsfontagppciiopaltqmlxplcomclockctlirframecirradiokttcpixpcomdmoveriosscomksymsepcomtslcdtwewdcpxapcicpxamcisdmmcbuspcmciabuswsemuldisplaydevwskbddevapmdevifi2cbusdrivechannelgpiobuskbdmuxcontrollerindexdackintrbase%s: %zu bytes @ %p unusedv6v7v71kv8otherhpfsadosfilecorejfs2vinumudfsysvbfsefsnilfsminixfs3stringpropstng<>&plist version="1.0"?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRtunneldeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"0xaddress:%s: getifaddrs%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLANvlanif vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersaveSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHAN%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %s%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsWARNING: -G may create file systems which cause kernel panics 2eaformatsector size `%s' is not a power of 2.fragment sizeunknown gname %sexpected files per directorybytes per inodefree space %number of inodesspaceuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imagebecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%dstatvfs %s%s: mount: %sabnormal termination-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount pointrdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sshutdown~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d ./canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! add%s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / xitverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s write: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumes%s%dSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s char%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptysystemwarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s LEAFbad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d writeL%d %d I%d %d ioctlatalkchangeexpirehosthopcountinet6lockrestnetnostaticproto1proto2recvpiperttrttvarsasendpipeshowssthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxyprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinleavemichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorSO_RERRORCannot allocate memoryassuming route to ifold usage of trailing 0%s, %sassuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u/%d%u.%u/%d%u.%u.%u.%u/%d(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswdppriority=nfsmntpt=blkempty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponat:usage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s-f%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciitenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20241129NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsSHELLCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD %sMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxypromptrpromptsslnoverifyaccountbellbyecdupdisconnecteditepsvepsv4epsv6featuresfgetformgateidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspagepassivepdirplspmlsdquoterecvregetremoptsrenameresetrestartrhelprmdirrstatusruniquesendportsitestructsuniquethrottletraceusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]:%u Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'URLInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. %c%c%c421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. Reading `%s'Writing to networkreceivedCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy cC%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgatehttpFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %s-TBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymous@FTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled - %02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. passwordmachineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384)%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru"%s" ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv disconnecting...unknown ACU typecall failedcan't open phone number fileunrecognizable host namemissing phone number call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenoddbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedescapephonelinehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filebrdu%s: missing device spec%s: missing phone numberraecbetbdchfesprrcdletdvcmcuiepndiexpausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.zeroone%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecremotescripttabexpandtabverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechoparhardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234RINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgidsetuid-i/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdmbrgptre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. untitledWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitMBRGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)noautoZeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesAllSomeNoneOnOffunchangedDelete?installreinstall sets forupgradeNetBSD/zaurus 10.99.12 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"headsmount point (or '-')cylsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6StartEndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsmount pointToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.99.12 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.99.12 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.99.12 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.99.12 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-10.99.12 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.99.12 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVDFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackSendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESNODONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionendavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: N, (C)lone(I)nstall, Guid Partition Table (GPT)LabelUUIDGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): Kernel (GENERIC)Kernel (C700)KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partitionad, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalogLC_CTYPE10.99.12zaurusxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orghttp hostnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/zaurus/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/zaurus/10.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X.old%s%s%s%s%s%s%s%s%s%s%s/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failed executing: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig. net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]tmpfsinvalid%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)-t xx -o /usr/src/usr.sbin/sysinst/arch/zaurus/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 %s /tmp mfs rw,-s=%llu swap /tmp mfs rw,-s=%llu /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s-rprogress -f %s -b 1m dd bs=1m of=%sdkxbdcd*fd*udf%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001%s%c/sbin/mount -rt cd9660 /dev/%s /mnt2/dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/TZ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'entropy-file/tmp/entr.%06xrndctl -S /tmp/entropy-file %s dd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %scp %s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfiglvmdkctl%s/%s%srm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/certctl rehash/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICkern-C700base32gamesgpufwmanhtmlrescueteststextxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %sFATNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%s %s/altroot/bin/mkdir -p %scd %s cd to %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /dev/r%saNetBSD10/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdatexdmraidframe/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/zaurus/../../disklabel.c:547: internal error/dev/%s%cr%s%c%s (%u)fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s %*s %s. %sUser answered no to destroy other data, aborting. %s [%s %s]%llu%s (%llu)%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%dK%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c -l %s --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %sraid%dvnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2d/%s%*s %spartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dmkdir -p %s dd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (%s, %s) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedgesgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%lli/dev/r%sStart:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1153: internal errorgpt -rq header %sgpt -r show -a %s 2>/dev/nullPri GPT tableSec GPT tableSec GPT headerv7sysvv71kv8otherhpfsadoshfsfilecorentfsjfs2appleufsefsnilfsminixfs3vmkcorevmfsvmwresvzfswindowsefibioslinux-dataapplevmcorevmreseredbiosbootbootmebootoncebootfailednoblockio%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxApple HFSapple-ufsBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD dataVMware VMkernel core dumpVMware reserved/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2068: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1774: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2194: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2199: internal errorNetBSDWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDOpenBSDLinux nativeNTFS volume setPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitiontc/etc/group: /etc/master.passwd: (malloc) Error in munmap(): JjPUPuVvXZ ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumalphablankcntrldigitgraphlowerprintpunctupperxdigit%s%s%s 646towlowertowupperASCIIUnknown error numberUnknown signal number%m[:<:]][:>:]]NULSOHSTXETXEOTENQACKBELalertBSbackspaceHTLFVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d ~}6~@ ~ ~]@3  ~~~YY~)~#~#"~#&~&,~5(2~I(8~I( Q+>~e0D~11|Gq@GDJ~GG9NT~1PZ~T`~yYGYm~YvYz~Y~Y%f~){~){~A~~A~rŃ~#~~~~~~~=2~1E~Ŭ~*5}!6Uj r%Ϡa@@o@pa t @@z% {m  y  @@~  @@%unblock and -DNO_CONV?@pd (100 0Usage: %s [-] [-ESsx] [-p string] [name] usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp--mv/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverwrite %s? override %s%s%s/%s for %s? %s -> %s rename %s to %scan't remove %s%s => %s %llu/%llu bytes %d%% written %s: remove%s: error copying extended attributes%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too longusage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failedfts_read%s: is a directory/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidprimaryCan't read %s partition table%s partition table invalid, no magic in sector %llddecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOF gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1reallocarrOutside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyMalloc failedDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerunknownPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld DIOCWLABELCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s/%s%s: bootcode too large%s: bootcode too small%s: invalid magicInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %scannot open %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tablefatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console-sh/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbin/bin/shcan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedrootsetlogin() failed/dev-MMMAKEDEV exit status %dUnable to run MAKEDEV%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node realpath `%s'getargsrwuniongetmntinfopuffs|%s on %s type %.*s: %s already mountedroupdatemount_puffsrumprump_%smount_%s-oexec:Cannot create pipeCannot open fd to mount programexec %s for %sexec %s for %s: %sstatvfs %s%s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llu, [%s: %s]nfsOnly one -t option may be specified.Aadfo:rwt:uvrqnoautofrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@cannot open `%s'/usr/sbinasynchronousautomountednfs4aclsposix1eaclsdiscardextattrhiddennoatimenocoredumpnodevnodevmtimenoexecnosuidrelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mapping/posix1e ACLSnon-reserved portsWebNFS exportslocalwith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsv7fsmsdoscd9660adosfilecoreext2fsntfsudfsysvbfsefsnilfszfsstrdupmallocusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xmalloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular filegunzipgzcatusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREmoreVISUALEDITORviLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memory<%s>LESS_TERMCAP_%s$<liLESS_LINEScoLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000l LESS_TERMCAP_DEBUGhcxndadbNRpc@8MOUSE_STARTMOUSE_ENDticlcmsovbbc|^crsr[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE/dev/null.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) #[Press 'h' for instructions.]& There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%cSHELL-c%s%s%slessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completedownexpandforw-completehomeinsertkill-lineabortliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdebugdigitdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %s*s>rscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columns%d,%dheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifttildequotesmax-forw-scrollno-inittabshilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found/dev/ttyusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe%3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d: %02d:%02d ETAKiBMiBGiBTiBPiBEiB-%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host sendmsgping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) ...nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu \%03o --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmap??? truncated no address %s(TTL=infty)(TTL=%u)refusedunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> SuccessRefusedUnknownIPv6 addressIPv4 address.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interfaceSTOP%s: waiting for an %s addressexiting due to oneshottimed out%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.2--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.2 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dkillwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.2 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPv4IPv6/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUID%s: hardware address randomised to %sgetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid IP address: %sinvalid CIDR: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltuuidnoneptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typebyteunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatestabletemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentoption requires an argument -- %s%s: embedded config too bigprofilearpingscriptreconfigurereleaseleasetimerebindpersistentinforminform6timeoutvsiovsio6waitipallowinterfacesrebootnoarpnobackgroundnohooklastleasenogatewayxidhwaddrbroadcastnolinknoipv4llrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslog(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %schangingaddingif_route (CHG)if_route (DEL)if_route (ADD)pid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletinglink#%d - %s %s_%s/usr/bin:/usr/sbin:/bin:/sbinfalsePATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuerastatic6reasonifcarrierifmetricifwirelessifflagsinterface_order(none)localhostlocalhost. embed index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string uri rfc3361 rfc3442 request norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zulo0%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)%s: SIOCGIFALIASbridgeepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not found%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseviaNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink  Կ 9} 9}  4HEYZm# _^F<>? PATH= t(+fZdscm lr &.p8@nLv Tb    EOF reading here (<<) document @pZ`ejms!zw2h"}-+?= @@#D@,~JTZ`fls}@abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.' 01180uD00 0'00)[< !3\v`  )89z Wx& 0 tb )\w                  >>">+%lE?\?q ?9.Q%]]" '+?1UF%:A<DyIIqLqV݀TeZUU`-~ hn&%^%?v#L|U}qx~ #Z F D  :AISyEE`iõI, E9X^" f@l@pAJx>C$BCIC$HCPY$*06 @"djs07z?@@  d@t  @r !&#.36#<3E2D3J3P#*;K| 6RV\djpv|Y\TYdnxY "2>NRV\djpv|Y\TYdnxY "2>N51q{{{ |,|?|f|| | } 1} M} o}}},}}}}~<~P~e~{~~~ ~!~#~$~&~1~2~3~4~56~899 :9;S<q=@ABCD;EQFfGfHfJ|LMNOPрQRSTU#V;WU\_azcdefghipq~s~t~u%v~w+x?[l‚ׂ9Uuƒ܃ #?Wtللل!.8[n}~~~~υۇ1K[vІ9Qo/J~~߈ &~9i~Ӊ߉2[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]==\TYdnxY "2>Nreturning to single-user after filesystem check returning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblock###"        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?in_addr_flagsin_statuscommit_addresssetifprefixlensetifdstormasksetifbroadaddrclone_commandusagestatusv"J4printallmainzihyt#yiyT||#y0}}x|O"|,|#!;y!{#;y#8|#8|#1;y#1;y##### $$$@&$2$>$F$ O$0X$@a$j$o$t$x$~$ $$ $@v"J4init_current_media5&G@&5&K&R&Z&v"media_statusmedia_constructor&&$ %}&&&$ %}$&$&},&&,&&}+&&%$}&~@&Z& 5&Z&`a&i&@a&i&@&Z&K&R&paddr_matchcMVAQVQVcRWV#LVKV{Ksettunnels'Xyl'X~print_link_addressessetvlansetvlanifR(~((~((^2setifssidsetifnwkeysetifbssidF.I.L.O.u.xt.qgy|.`{.|.gy .+ .q* y...1gy.0..-r* yv.F).q--p--q ) )!ainvalid major numberinvalid minor numbertoo many fields for formatffs@t ̏@ҏݏ u F!.DUw @ʐ@ Y&-2;BGKSW]bnorripbgensbextattbnojolietbnocasetransbrrcaseins11T1111 11 11*2@2222'2+20272 11T1111 11 11:3 C3D@,~*O3V3\3@f3l3<2@t3bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirror11T1111 11 11D@,~*2@bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoac11T1111 11 11f3*2@66j6 6@6666666 @\5b5h56q5{55 5@recvrpcrpc_getportrpc_callsendrecv%s: can't read disk label; disk type must be specified%s partition type is not `%s'?=m===>p>>>>>?(?H?~????@&@F@x@@@@AWTWTbSS gog_gWOG#g?7/DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYUqhqqqqqrArarrrrr'sOsosssMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATING0123456789abcdefUGHRBD M@dmCLS1@2plbhw.disknames2fjnrvz***************************************************************************************************************************************************************************************************************************************NetBSD gzip 20240203  " $#!%Z^\`[_]a%%: SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data+Y\ a/_.ȟh. b#o.x.H#.2Z#.2Q#..xU#..wV#..vW#..J#/"/I#//~uX#8/2X#A/2Y#K/2[#T/\/F#i/&U#p/w/U#/2XU#/[#/a/G#//F#/[#/J#/.L#/.M#//N#0!0K#20~O#;02O#D02P#N0.\#Z0.]#k02^#v00R#0~_#02`#02a#collect2:2:~ʚ:NAME==@=\TYdnxY "2>N>    "#$%   "#$%    "#$%&'()*+.  a }-e2G9Ss)+1Labr \TYdnxY "2>NfgwDeMMOLOIaGN3HI1GGmX-LYUJeICHO5R%TC)UH HGGkG\TYdnxY "2>NHI----------------------------------- - --------------------   "#$%@//tmp/usr/vary#y#y#y#&XeXnXuX~XXg Details for index GPT part - \TYWWWW=WWf~WWWWBMWWY@=WWX XXX"Xđa}{Y[)1OmXeg1TY0X0X8X8X;8XY|nQn- q+'Y3Y|nQn- q+BYLY|nQn- q+YYbY|nQn- q+sY~Y|nQn- q+"XN=rGy=iG}BXY;Mt?YYmWC 3KOOYYyD<#*=(YY3Dh&0XY\ M}-YY@Mjy֬Z Z-чH1Z-чHFZZIчH`ZIчHsZIчHY~Z2IчHTYZL6 %?aZZS'@ )ѸTXZ*1@ )ѸX21x )Ѹ[XZHl`' u    [ YmX u  Y  ] eaQ 9 \ \\\\\Y\A\\]]].] A]O]***************************************************************************************************************************************************************************************************************************************control_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_reportssiddhcpcd_readdump2Ddhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2025 Roy Marplesmain duid_getif_discoversplitvadd_environparse_optiondefault_configread_config&bcDdDZexfg%hKijkl:mn opq*rstu,vwxzyA BCDE|F'G1HI;JEKLL'MUN[OdPqQySTUVWXZ146|~})75><CKPV\b̏1qzk 3@NZ  rt_new0! ! rt_buildrt_delete} } c'C.8ALT}TGNmake_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_opensockets_osdkquz~if_initrtif_ifa ( PT@P HEPT$ @CDHDdhcp_openbpfdhcp_initread_leaselog_dhcpdhcp_bound[%1-  5dhcp_start1dhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpipv4_deladdripv4_getstateipv4_addaddripv4_handleifa+ + + + + + VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B_qC _C _C _C `C `C `D `D `9D :QD "`iD (`D BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~7`l;`\dD`\l____` ```` :@"`(`qom_8__\_` ```@` :h"`(`-o %s: option not supported sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU makech #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef5MS7) %p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      !1Aa  0@`@@ #+3;CScsM inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6  (08@P`p   0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c  _prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_cstringprop_string_create_formatprop_string_create_nocopyprop_string_append_cstring_prop_object_externalize_append_char _prop_object_internalize_find_tagprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_number_alloc_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dict_keysym_externalize_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_next_object_prop_dictionary_emergency_free_prop_dictionary_iterator_reset_locked_prop_dictionary_externalize_prop_dictionary_get_prop_dict_keysym_putprop_dictionary_set_prop_dict_keysym_alloc_prop_dictionary_internalize_continue_prop_dictionary_remove_prop_dictionary_equals_prop_data_equalsABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_internalize_decodeprop_data_data_prop_data_internalize_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_resetprop_array_getprop_array_set_prop_array_internalize_continueprop_array_remove_prop_stack_push_prop_stack_pop_tcsetpgrp_tcgetpgrp_tcflush_tcdrain_cfsetospeed_cfsetispeed_cfmakeraw_cfgetospeed_cfgetispeedstrmode_unsetenv_int_strtouq_l_int__strtoull_l_int__strtou_l__strsuftollxpermute_args_getopt_longgetopt_internalunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s_getoptatolatofmemstream_seeksetbuffersetlinebufsetbufmkdtempfwidefsetposfpurgefgetposfgetc_regerror_inet6_rthdr_init_inet6_rthdr_add_inet6_rthdr_lasthop_inet6_rthdr_segments_inet6_rthdr_getaddr_inet6_rthdr_getflags_inet6_rth_init_inet6_rth_add_inet6_rth_reverse_inet6_rth_segments_inet6_rth_getaddrip6optleninet6_insert_padopt_inet6_option_space_inet6_option_init_inet6_option_append_inet6_option_alloc_inet6_option_next_inet6_option_find_inet6_opt_append__icheckhost__gethostlooprshrcmdrresvport_af_addrrresvportresrcmdorcmd_afrcmd_af__ivaliduser_sairuserok_saruseroklink_addr0123456789abcdef_ether_ntoa_ether_aton_ether_line %x:%x:%x:%x:%x:%x %256s _ether_ntohost_ether_hostton_MD5End0123456789abcdef_MD5File_MD5Data_SHA1End0123456789abcdef_SHA1Data_SHA1Transform_SHA1Init_SHA1Update_SHA1Final_RMD160End0123456789abcdef_RMD160Data_uname_ttyname_r_timesaddcmd_getmodecompress_mode_sethostname_popenpopenve_pclose_initgroupskMGTPEBKMGTPEKMGTPEBkMGTPEhumanize_numbermatchcompareg_Ctocg_lstatglobextendglob3g_opendirglob2g_statglob0globtildeglobexp1globexp2_glob_globfree_getpassfd_getmntinfo: _getfsspec_getfsfilefnmatchxgettype_getdiskbynamecreatTLS allocation failed, terminating ;Zx0Nm<[y1OnSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec_tcsetattrwcscmp_stresep_setenv_vdprintf_lsetvbuf_regfree_inet_networkunvisAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~fts_pallocfts_sortfts_statfts_allocfts_build_fts_openfts_maxarglen_fts_close_fts_read_fts_set_fts_children_closedirkhwcschr_strcoll_l_int__strtoumax_l_opendir_initdir_alphasortinsertionsort_mergesort_rsetup_seekdir_unlocked_getdomainname @_strncasecmp_initstate_setstate?getenv_getenv_r__freeenvvar__canoverwriteenvvarauthunix_destroyauthunix_marshalmarshal_new_authauthunix_validate_authunix_create_xdr_authunix_parms_xdr_array_xdr_rejected_reply_xdr_opaque_auth_xdr_accepted_reply_xdr_des_block_xdr_replymsg_xdr_callhdr_seterr_replyacceptedrejected_strtok_rip6_parsenumeric_filenostr2numberget_portget_canonnameres_queryNres_querydomainN_freeaddrinfoget_ai_getaddrinfoaddrconfigip6_str2scopeid)&_yphostent_gethtentgetanswergethostby*.getanswer: asked for "%s", got "%s"res_searchN_getservbyname_r_MD5Init_MD5Update_MD5Final @_vasprintf_l_getifaddrs"_freeifaddrsNBCDB atoi d'@Bʚ;__dn_count_labelscharstraddname0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuv__ns_sprintrrf__ns_skiprr__b64_ntopABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/__b64_pton_inet_nsap_addr_inet_nsap_ntoa__ns_format_ttl54ؗҜ<3#I9=D2[%Cod(h_posix1e_acl_entry_compare_acl_differs_acl_brand_as_sl_add_sl_find5_strsep_int_strtoul_l_int__strtoll_lfgetsrewindmap_v4v6_addressmap_v4v6_hostentgethostbyname_internalgetanswergethostby*.getanswer: asked for "%s", got "%s"_dns_gethtbyname_dns_gethtbyaddr_yp_hostent_yp_gethtbyaddr_yp_gethtbynamegethostbyname_rgethostbyaddr_rinet_pton40123456789abcdef0123456789ABCDEF_inet_ptoninet_pton6inet_ntop4_inet_ntopinet_ntop6_fseekoisescaped_fparseln__fgetstr_xdr_int_xdr_u_int_xdr_long_xdr_u_long_xdr_int32_t_xdr_u_int32_t_xdr_short_xdr_u_short_xdr_int16_t_xdr_u_int16_t_xdr_char_xdr_u_char_xdr_bool_xdr_enum_xdr_opaque_xdr_bytes_xdr_netobj_xdr_union_xdr_string_xdr_wrapstring_xdr_int64_t_xdr_u_int64_t_xdr_hyper_xdr_u_hyper_xdr_longlong_t_xdr_u_longlong_t__dn_skipname0123456789__ns_name_ntop  __ns_name_ntol__ns_name_unpack2dn_find__ns_name_pack_int_strtol_l_vsprintf_l__getdelim_nsdbtaddsrc_nsdbtdump_nsdbtput_nsdispatch%02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04dmn-00Etc/UTC _strcasecmpbsearch__cxa_atexit_internal__cxa_atexit_vsnprintf_lfreadfopenferror__swbuf__sprint0123456789abcdef0123456789ABCDEF__vfprintf_unlocked_l__sbprintfexponentQ_strndup_strdup_gethostname !#&(*-/14}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDؗҜ<3#I9=D2[%Cod( 7yACnF?O8M20HwZm1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG_getpagesizeqsort_r__sfvwrite__sflush__swsetup__swhatbuf__smakebuf_tcgetattr_int__strtoi_l__sread__swrite__sseek__sclose_int__strtoimax_lCisalnumisalnum_lisalphaisalpha_lisblankisblank_liscntrliscntrl_lisdigitisdigit_lisgraphisgraph_lislowerislower_lisprintisprint_lispunctispunct_lisspaceisspace_lisupperisupper_lisxdigitisxdigit_ltouppertoupper_ltolowertolower_lc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB _citrus_NONE_stdenc_mbtowc_citrus_NONE_stdenc_mbtocsdl_iterate_phdr_setup0123456789ABCDEF0123456789abcdef_vsnprintf_ss_fwalk__res_nmkquery__res_nopt__res_nopt_rdata/&_hf_gethtbyname2_hf_gethtbyname_hf_gethtbyaddr_nsaddsrctomap ]:[=                       DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::clearerr__rec_dleafNEXTINDEXNEXTINDEXputpair__delpair__get_page__add_ovflpagesqueeze_key__free_ovflpageugly_split__split_page__big_insert__big_delete__big_splitNEXTINDEXGGL1MyMM4  l9\U,             L L1|/h1d0`9gnts. 0 |0 1 `1 xU 4W rbmnT hS R $S XS tcidg l m | e e d |e pe yekd4p 4g Dd atad@ 4 t loobT \ yara   <Lht ,8 LX t 8 (4Xd L|8'<'D'L'T'\'d'l't'|' ''&'&D$''''|<&H&T&`&h&x&&&&&&&&&&& &&$&&&&D&''$'4'((,(0(4(H(( ($(H*********++ +++ +(+,+4+<+D+L+T+\+`+h+p+x++,+++++++++++++++++++++, ,,,$,,,4,<,D,L,T,\,d,*l,t,,,,,,,,,,--$-0-<-T-h-t-------..0.D.X.p.......//(/DWL< &H &Ծ\9l& MX M4&8&dH&& && &d@T8|X&O@̽&<&Ⱦ&\p&1&4%4& `&&\i& HL &t&|&|mV|3T:8e&d&`6 && <&,&t P&L&d@&XL &[ e`&ؾ&8&t0&<%&(&( @ &84xx&B&H&&(& D &C &&T &  &|&[ X 0&D& &d&0&&`&&zDl& 0(HPxp.~  Ϯ zbj jc(+fhklmҭoޭopppq#r*ut2vw:wGx`x~z~zPBC JaOkPzSTVVXZZȮϮ   ~(G9a(%G!9am/dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbin}-+?=###%%%}&a08EV>e"FFIiPL^ldmlCvn}fpbuqsh2vVVx@=vvd z{4w{ ... ...x~.,,,(23kyb`%wAabCdhlNsuvW:w:z8x@xHxPxXx 2"txz2{"y@p2i9s@p@28g#v@2=^#v2"`x@p@2CQ#v 2",y{ 2"TyT{ 2"|yd{ 2"yt{(2"&y(2:xlp&z(2q5y-4z(2:y(*`z |ztz(2"y jXK z(2"z jXK z 2"z{y |yyzl%Bl&Jl'Ml(Vl)[l* l+dl,hl-ll/vl1l1l2l3l4l5l6~|*v|,<,.&|`w"6@JVblt|"DHn DHuDHu#DH[~|DH[DHev|DHZDHqu2DHiwDHhDH{}DHtDH9uDHwx$DH h|#DHi.DHkDH9uDH5eDHzDHyDHyDHqu‡DHṀDHcчDH[~DHևDHf`DHaDHgDDHeDH!܇DHt<DHZDHqi~DHDHDHq@3DHkDH}DHIjDHMmDHa ~DHqDHMmMDHkDHDH][DH ~DHDH]}DHaDH]!DHDHk'DHx,DHwbDH4DH:DHxBDHkHDHkLDHkDHg~DHflDHflDH-vDH[~DH-qDHquRDH}sDH{ޅDHXDHa^DH]adDH lDHEksDHyDHI|DHtDHyrDHDH1zDH[DHfDHDHs,DH~օDHDHUdDH[DHz0gDH||DH9[DH{ƈDHmevDHYDHitDḦDH!tDH p2DHefDHDH!@$!^]ȟ b z  * . ` d f o 04?4sz _##)#*#######%%&&H&S&&&&&&&&&&&&&&&&&&&&&&&&&&&'' ' '('('L'L'N'N'S'U'W'W'''''''++P+P+U+U+....////000>0A00001/11111112 2G2P2MNƤ`|0RTfhk`oooopՌ"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp| ( ( ) ) oK_pp0J#%')-Y[ : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----*0-000ooprt} %&,,ĨŨ&-GQ).1256CCLL|| /vz      8 : ? ?   $ ' FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB@4@4G4U4jj0k6kOoOooooo-0Fgi{BD6;luu!#$&*06DJw}}}Х٥ #*1<EP[bms{æϦ֦.&-&4@KV[diq~q}<"ӧ#[m={a&@V&.dJ.auqЩDDDXXXD""X    l h b  w  i x X       0  $  k  j [< e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ is a directory is not a regular file (use -f to see it) (rҲ!  f޲  Ͳ ٲ$!-"9>DJP]!l;w 7   #28̳ ֳ (!%97AK&fV)bl5ue~:%6,4 +˴,ݴ-.* ?%Ewg,/8/F'RFұ_ WmkRkRkYcWbkCkc kG ky wb YMYrWca8"Mnb0@"ԽB("c "Cnnd"A"ƾD(e"2f|"RjF"g"Կh"Pii"jؾ-Jо!T"%kȾHH KL"=bLP"m"n""o1%O0pHPa;qp"Dlrh""s`!"C[SX!p"xtP1THu@"V8!w0"\"(Yx((X Ah"y"zx"#8"W~!`"`?#%Ad"D" ؽH"+Mн@"iȽ(!4"0",?[,"("$$" $ "51G"g!"!"]x!"p(Fh!"Ui`"X"PmH"@8"au@"0(!l"  " O"x"*";r"1CzUaku2',ұ:LUeyx+9LX]jw" (press RETURN)߅3xxtags643{}abcdDgGhHilnNpPqrs tw xy !:#=""YXZ<<HOV!0<[>>y?tY?pa@|Ű5$ְ8C):+):c1.(]2(]26==Q==sj <?wM#="ErF&Pcalshµ" !"$'(+-.03569:q?q]<^E^)``_qhugrs]Pq```e`hgQ`d]Q]Ľ]Խ]]]]<i]Eu]q-qSqyq q)aa``qmaYaAarr)sqaYrrrjsqk{qaqrrmq=5]I] Wq_qgq-]IqQqaaes}sMs+rCqub]bEb-bbahhasdAr=qieYeIeyeeeeeeee]]%]]r ]Ef)f fe/q7q\\%f&}f'of(afffdff$fgggff<[D\=\=/\>G\v_\>w\\K f P#r$ 2\2As2 \(\z`]  K_2F em2FPd-o   2FA_}o2F -eo2Fdp2F`dmp "  2F I5_il2F K)_m# P; t22$`c22$@22$2 2 P2 02 2 pS0R[r2Fbp2FP^n2Fb_p +c049v>BFPX`s{'D1Kd/XhzG"#.=ZtE *ڕQr z~Z~~&M^$8a!j2A&3$WuuZ#0ANzM 5BnEF9)BKc~?6<Ubv 2AN\ht A6*v=GOYocl{+?LXj8Wsx",EWp!'8AYcpyy-;J|/ ,J\#k~ <GR]ny%D]TYT     C    # 3 P X           vF, 29  0 < Z |     mZ  R]    "(.V2?,:X\(*6Ea"S'8FKQ[Z&4LvyV}(_=Zp,=Z~ & . 8 C U f u    "       !!'!:!O!Z!l!x!!!!!!!!!!!"""-"A"U"!" d"o"""""""""" !##%#.#C#U#^#w##########$$9&Z&v&&&&'(())()>)p)z))))z**+-+++ɔ::::::::@@@Y@@r/ ftpAG@>|IGTG\G:B@kA iGvGGGGvGGR G >GGGRG"GGG0GGG H H10H&H'H("H))H*x$+.H,6H.1/>3;?"A@<@4=>N->>0MY<?Y<@6MY<A N=B >MY<C Y<D DY<E BMY<F;2Q;25adwdY1rY1bhrYZuY7ZY.dAy,  "222222222C````````````  `  ` ` ` `  ` `fm``aa aaaaaa"a&a*a-a1a4a8a;a?a : Ba!Sa"ba#na$za%a&a'a(a)a*a+a,a-a-a.a.b/b/R0X1a2b3b4 b56b7b8b9'b:#b;-b<Zb?hb@vb[b\b\b]b^b^b_b_b`b{c{c|#c}/c}Cc~Ic    @@=   @@@@$@,@8`@`LPX`hp x@|#####$$$$$%%%`%%&&$&,'8'D'L(X(d(l)x))***+++,,,,-- --.$.0.8/D/P/X6d;t;00011<<==>>?2 22 3,383@9L7X8h:|44455 ! " # $ % & ' (  ) ,* 8. D+ P, \- d/ p0 1 2 3 4 5 6 7 8 9 : ; < =  > ,? 8 @D!@P"@\#@h$@t%@&@'@)@*@+@&`'`,@-@.@/@0@$(`41@@2@P3@`)`p4@|5@6@7@8@9@:@*`;@<@ =@>@,?@< `L!`\+`l,`|"`#`-`$`.`/`%`CCDDE$E0F8FDcLcXd\dheel#t#&&0 $,8DP`lp t @@` 33333333 L L <T3333H%L%P%T%X%,&UTC33xRxS!* + & '' * & C* & 33&4Hl339㼥ͤtgQ>PNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[Sž@ T 33UU33UU33UU   8 X P 8 X   8 X @G&JKKK KJD&P&(K,K0KzO6iׄy}Qm mͅ43_ԗ͵רҷȥvOw޻= ,4cK>.ۓ:l}ȁ~x>PAg:y| Ϟ.3G|ڮN/4H Ͼz~ZEQ 1 Dso 747d ̼qpvp-M}qy!p[\+HU h8gl{x 6 j;#!r]x:F|f1ɠɇ&ndDJPj,r!, Ur>vU+0U0.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf /B H  PMVM$b N gNtiylRRl&RpR+DRyTMSGTXTS619 4968 4993 5010 5032 5035 5040 5048 5055 5063 5071 5074 5077 5080 5084 5096 5105 5118 5147 5162 5706 5740 6423 6711 7419 7475 7549 7645 7692 7715 7738 7744 7753 7775 7779 7783 7786 7789 7894 8097 8336 8777 9215 9250 9265 9277 9283 9295 9314 9334 9374 9391 9408 9423 9470 9508 9556 9638 9762 9898 9939 9977 10014 10049 10059 10108 10258 10264 10269 10273 10293 10403 10423 10429 10443 10455 10466 10503 10537 10561 10663 10700 10722 10821 10876 10934 10945 10961 11013 11181 11388 11559 11623 11675 11947 12497 13026 13458 13796 14129 14242 14257 14266 14426 14597 14747 14911 14934 14958 14973 15048 15188 15365 15520 15532 15612 15713 15759 15785 15855 15866 15875 15888 15914 15929 15945 15958 16013 16024 16039 16243 16476 16505 16520 16589 16663 16736 16766 16804 16858 17312 17338 17367 17471 17577 17762 17874 17989 18093 18780 19039 19179 19215 19385 19426 19562 19585 19622 19667 19918 20014 20068 20167 20178 20215 20252 20279 20288 20322 20329 20354 20381 20416 20430 20444 20473 20487 20504 20513 20535 20553 20570 20581 20600 20626 20644 20667 20684 20699 20714 20732 20759 20786 20808 20847 20865 20897 21125 21199 21242 21288 21435 21591 21635 21914 21941 22300 22484 22636 22817 22964 23122 23143 23191 23201 23209 23220 23231 23241 23248 23263 23275 23313 23343 23382 23435 23493 23514 23521 23540 23561 23568 23591 23613 23633 23655 23686 23723 23745 23759 23805 23834 23868 23908 23943 23971 24019 24028 24037 24042 24051 24060 24077 24081 24086 24090 24103 24112 24139 24159 24182 24201 24228 24250 24282 24298 24303 24313 24336 24358 24375 24392 24405 24414 24423 24429 24456 24463 24487 24508 24532 24545 24564 24589 24612 24628 24634 24646 24676 24684 24724 24735 24746 24757 24774 24791 24805 24822 25270 25486 25750 26022 26074 26110 26146 26197 26214 26252 26266 26273 26290 26293 26298 26307 26319 26330 26339 26360 26402 26418 26434 26465 26482 26497 26512 26527 26548 26568 26609 26638 26686 26919 26954 27161 27180 27217 27278 27316 27355 27511 27526 27572 27599 27622 27658 27668 27678 27689 27694 27757 27805 27849 27910 27943 27990 28008 28147 28169 28292 28306 28316 28339 28444 28500 28616 28647 28652 28678 28717 28727 28770 28780 28796 28811 28829 28852 28882 28903 28929 29126 29169 29173 29179 29185 29190 29201 29215 29244 29276 29288 29335 29385 29425 29452 29468 29477 29520 29526 29534 29538 29558 29575 29587 29618 29874 29923 30499 30526 30558 30586 30638 30644 30650 30655 30676 30692 30714 30743 30884 31018 31031 31167 31169 31171 31173 31190 31203 31221 31248 31252 31258 31263 31271 31277 31317 31319 31329 31344 31361 31395 31427 31465 31494 31523 31545 31588 31614 31658 31794 31796 31798 31837 31904 31921 31935 31939 31946 32068 32137 32425 32563 32704 32785 32832 32838 32861 32907 32910 32936 32979 33044 33106 33176 33244 33337 33556 33581 33585 33621 33639 33667 33709 33753 33817 33867 33943 33965 34017 34061 34100 34134 34164 34195 34220 34229 34241 34249 34260 34272 34291 34315 34364 34381 34405 34448 34770 34773 34787 34800 34812 34819 34830 34837 34844 34853 34863 34880 34896 34946 34954 34962 34972 34983 35001 35018 35039 35061 35070 35080 35107 35113 35123 35142 35158 35176 35196 35205 35216 35223 35240 35259 35280 35290 35307 35313 35329 35344 35359 35380 35402 35421 35431 35436 35441 35459 35478 35497 35503 35522 35542 35562 35580 35585 35591 35608 35624 35645 35658 35666 35686 35710 35727 35735 35746 35767 35773 35785 35807 35821 35830 35851 35869 35878 35912 35935 35962 35994 36017 36037 36048 36080 36096 36107 36120 36143 36165 36673 36703 36734 36762 36776 36977 37199 37366 37453 37470 37488 37505 37534 37581 37592 37611 37633 37712 37904 37932 38050 38072 38213 38232 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-10.99.12. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-10.99.12 ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-10.99.12 ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-10.99.12 ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-10.99.12 ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Die Installation wird abgebrochen. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-10.99.12 InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-10.99.12 ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPNFSCD-ROM / DVDDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzSendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd aktivierenntpd aktivierenntpdate beim Starten ausfhrenmdnsd aktivierenxdm aktivierencgd aktivierenlvm aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte PartitionierungPartitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen?Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden? Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): Kernel (GENERIC)Kernel (C700)TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist.seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.th and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm sh stty syncMSGTXTS619 4968 5006 5023 5038 5041 5044 5049 5057 5065 5073 5076 5079 5088 5100 5112 5121 5130 5156 5167 5703 5730 6296 6596 7237 7284 7397 7490 7524 7543 7561 7569 7578 7603 7607 7611 7614 7617 7739 7924 8152 8672 9023 9052 9065 9078 9083 9103 9122 9143 9202 9219 9233 9255 9300 9326 9367 9445 9563 9677 9731 9760 9792 9831 9837 9870 9993 10000 10004 10012 10036 10118 10124 10131 10143 10157 10166 10199 10218 10230 10340 10402 10421 10540 10591 10643 10655 10674 10726 10930 11138 11329 11389 11438 11705 12164 12830 13253 13575 14000 14132 14164 14176 14354 14551 14712 14846 14866 14899 14913 14982 15095 15267 15402 15422 15534 15626 15649 15672 15731 15746 15767 15782 15803 15823 15848 15862 15886 15898 15916 16126 16376 16397 16413 16466 16534 16607 16644 16670 16746 17241 17267 17289 17396 17503 17704 17777 17861 17961 18456 18694 18845 18879 19014 19058 19197 19238 19283 19330 19574 19707 19769 19863 19868 19902 19936 19951 19979 20012 20019 20044 20062 20088 20095 20110 20125 20145 20185 20202 20222 20243 20265 20280 20300 20322 20337 20350 20364 20376 20388 20402 20425 20448 20466 20509 20560 20597 20782 20845 20881 20930 21021 21151 21204 21464 21511 21872 22022 22191 22331 22451 22583 22623 22670 22680 22688 22698 22706 22717 22728 22742 22767 22809 22842 22875 22910 22964 22989 23008 23030 23035 23041 23071 23088 23115 23133 23154 23176 23195 23205 23235 23261 23288 23337 23365 23392 23445 23455 23465 23471 23481 23490 23510 23514 23519 23523 23536 23545 23576 23593 23620 23641 23661 23680 23706 23719 23727 23743 23774 23805 23826 23852 23865 23873 23884 23890 23914 23924 23936 23954 23965 23985 24001 24027 24049 24065 24077 24097 24123 24129 24159 24173 24187 24210 24229 24248 24266 24284 24702 24903 25143 25327 25405 25460 25527 25567 25590 25624 25635 25643 25666 25669 25672 25678 25689 25701 25714 25744 25788 25801 25814 25851 25865 25876 25887 25898 25915 25926 25973 25996 26045 26286 26319 26574 26595 26628 26681 26707 26734 26890 26896 26939 26959 26978 27007 27014 27021 27028 27033 27082 27120 27154 27211 27239 27284 27301 27402 27407 27484 27498 27508 27532 27655 27736 27846 27874 27879 27895 27924 27932 27973 27980 27994 28007 28015 28034 28067 28087 28107 28323 28354 28359 28366 28373 28377 28391 28403 28418 28451 28464 28519 28577 28613 28631 28649 28667 28704 28710 28718 28722 28743 28760 28771 28793 28971 29015 29717 29741 29775 29794 29839 29846 29853 29857 29881 29892 29897 29960 30081 30204 30217 30351 30353 30355 30357 30367 30376 30389 30416 30420 30426 30431 30440 30445 30472 30474 30487 30499 30514 30542 30586 30633 30649 30671 30682 30715 30735 30784 30884 30886 30888 30929 31020 31037 31051 31056 31062 31171 31230 31481 31622 31749 31817 31854 31861 31888 31934 31937 31958 32003 32054 32113 32182 32229 32334 32477 32502 32506 32540 32557 32581 32633 32684 32756 32822 32920 32937 32968 33004 33038 33062 33086 33119 33139 33149 33157 33165 33175 33186 33200 33226 33274 33297 33317 33358 33657 33660 33674 33686 33693 33712 33726 33733 33740 33749 33759 33776 33792 33840 33848 33856 33866 33877 33895 33912 33931 33951 33958 33975 33992 33999 34012 34047 34064 34083 34103 34113 34129 34142 34160 34180 34201 34211 34231 34251 34264 34283 34296 34320 34343 34356 34367 34372 34379 34397 34416 34435 34443 34462 34482 34507 34525 34532 34539 34552 34561 34582 34595 34603 34623 34651 34668 34674 34685 34716 34724 34737 34759 34781 34790 34811 34829 34836 34859 34878 34905 34923 34943 34956 34971 34992 35006 35013 35027 35042 35061 35606 35639 35667 35696 35704 35741 36053 36230 36307 36324 36342 36357 36379 36429 36439 36456 36478 36537 36695 36719 36849 36874 37000 37018 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-10.99.12. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-10.99.12 ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-10.99.12 ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-10.99.12 completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-10.99.12. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. La instalacin ha sido interrumpida. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-10.99.12Salir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-10.99.12Ejecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPNFSCD-ROM / DVDDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroSendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): Ncleo (GENERIC)Ncleo (C700)TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy MSGTXTS619 4968 5004 5021 5036 5040 5044 5049 5060 5066 5072 5075 5078 5081 5085 5097 5109 5119 5149 5161 5591 5618 6194 6554 7239 7300 7378 7473 7513 7535 7553 7559 7568 7594 7598 7602 7605 7608 7730 7915 8143 8672 9090 9119 9132 9145 9152 9172 9191 9214 9257 9277 9296 9319 9363 9392 9433 9499 9611 9725 9779 9808 9840 9879 9885 9918 9996 10002 10006 10011 10052 10189 10199 10207 10226 10240 10249 10281 10322 10335 10460 10518 10537 10656 10712 10764 10775 10791 10830 11080 11252 11424 11479 11514 11764 12168 12467 12735 13096 13276 13595 13615 13628 13817 13961 14157 14291 14311 14344 14363 14464 14619 14807 14994 15014 15093 15191 15229 15252 15342 15363 15386 15405 15429 15459 15503 15536 15559 15571 15589 15857 16176 16207 16242 16306 16381 16451 16482 16512 16604 17095 17125 17142 17282 17423 17620 17739 17886 18053 18611 18907 19088 19133 19296 19350 19485 19521 19581 19631 19922 20031 20088 20185 20190 20225 20260 20275 20299 20332 20337 20362 20378 20401 20408 20425 20440 20459 20491 20495 20515 20533 20545 20558 20576 20600 20618 20637 20664 20691 20703 20724 20754 20784 20809 20842 20877 20915 21168 21237 21292 21353 21471 21630 21684 21945 21996 22372 22527 22671 22811 22919 23104 23134 23177 23187 23195 23205 23217 23238 23247 23253 23285 23326 23362 23400 23437 23485 23509 23521 23535 23543 23551 23579 23596 23625 23646 23669 23678 23697 23709 23753 23791 23818 23862 23890 23917 23970 23981 23992 23999 24009 24018 24052 24056 24061 24065 24078 24088 24118 24141 24170 24192 24214 24236 24263 24275 24287 24306 24340 24373 24394 24418 24431 24443 24456 24462 24488 24498 24509 24533 24543 24563 24583 24600 24626 24650 24663 24683 24717 24724 24753 24776 24799 24815 24830 24845 24860 24874 25305 25496 25731 25919 25961 26011 26065 26113 26135 26176 26187 26195 26219 26223 26227 26236 26247 26258 26273 26304 26350 26363 26376 26406 26420 26432 26444 26456 26474 26497 26542 26565 26625 26877 26904 27166 27184 27211 27260 27290 27321 27453 27460 27509 27532 27556 27585 27593 27603 27611 27616 27669 27718 27758 27824 27857 27901 27924 28025 28030 28107 28121 28131 28155 28278 28359 28469 28497 28502 28518 28547 28555 28596 28604 28618 28631 28639 28658 28691 28711 28731 28947 28978 28998 29004 29011 29015 29030 29049 29075 29084 29096 29150 29208 29243 29262 29279 29291 29326 29332 29340 29344 29365 29382 29393 29418 29596 29650 30341 30360 30395 30425 30471 30477 30484 30488 30512 30528 30534 30609 30759 30878 30891 30959 30961 30963 30965 30975 30988 31005 31032 31036 31042 31047 31056 31061 31088 31090 31103 31115 31130 31158 31202 31249 31265 31287 31298 31331 31351 31400 31500 31502 31504 31552 31642 31659 31673 31678 31684 31787 31839 32085 32246 32401 32472 32525 32532 32559 32609 32612 32633 32679 32734 32793 32862 32909 33014 33157 33182 33186 33220 33237 33275 33328 33368 33444 33509 33603 33624 33662 33702 33738 33762 33785 33824 33854 33861 33870 33878 33886 33900 33916 33944 33996 34013 34034 34078 34420 34424 34439 34450 34458 34477 34489 34496 34503 34512 34522 34539 34555 34609 34617 34625 34635 34646 34664 34681 34697 34715 34722 34740 34757 34764 34774 34805 34824 34843 34863 34873 34892 34905 34925 34945 34966 34976 34995 35014 35024 35041 35055 35078 35102 35115 35125 35130 35134 35152 35171 35190 35195 35214 35234 35259 35274 35278 35285 35295 35304 35325 35339 35347 35367 35393 35410 35418 35429 35460 35465 35478 35500 35515 35524 35545 35563 35572 35616 35640 35667 35682 35699 35713 35744 35768 35799 35806 35820 35835 35854 36399 36432 36460 36489 36497 36534 36846 37023 37100 37117 37135 37150 37172 37222 37232 37249 37271 37330 37488 37512 37642 37667 37793 37811 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-10.99.12. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-10.99.12 est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-10.99.12 est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-10.99.12 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-10.99.12 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-10.99.12 Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-10.99.12Excuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPNFSCD-ROM / DVDDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : Kernel (GENERIC)Kernel (C700)TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationditerGroupe umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any lengMSGTXTS619 4968 5009 5025 5043 5047 5051 5061 5070 5076 5082 5085 5088 5097 5107 5120 5128 5139 5164 5176 5685 5717 6209 6498 7043 7089 7193 7279 7315 7330 7348 7356 7364 7391 7395 7399 7402 7405 7516 7701 7929 8405 8739 8768 8783 8798 8806 8820 8838 8859 8910 8926 8936 8956 9002 9032 9085 9142 9253 9374 9418 9451 9490 9524 9531 9564 9641 9647 9654 9661 9690 9802 9808 9819 9836 9853 9862 9891 9903 9913 10014 10076 10096 10216 10253 10309 10323 10344 10381 10591 10766 10915 10950 11002 11219 11533 12057 12419 12709 13102 13237 13250 13261 13407 13586 13717 13851 13871 13904 13923 14006 14121 14262 14387 14401 14509 14602 14631 14651 14727 14744 14762 14778 14797 14817 14834 14846 14872 14884 14902 15103 15342 15369 15386 15442 15504 15564 15595 15619 15678 16054 16084 16101 16209 16319 16459 16533 16609 16687 17179 17399 17510 17541 17668 17704 17832 17859 17899 17945 18161 18285 18353 18453 18458 18494 18530 18544 18567 18600 18604 18629 18648 18674 18679 18694 18709 18728 18753 18765 18787 18804 18817 18829 18847 18871 18886 18903 18916 18927 18938 18958 18987 19016 19040 19075 19110 19137 19324 19373 19405 19453 19550 19683 19729 19921 19951 20273 20402 20542 20682 20799 20934 20978 21021 21029 21039 21051 21063 21071 21082 21109 21143 21179 21210 21245 21281 21328 21348 21365 21383 21388 21395 21421 21437 21458 21475 21492 21510 21527 21540 21571 21596 21627 21658 21693 21720 21773 21783 21793 21799 21808 21816 21831 21835 21840 21844 21857 21867 21896 21912 21938 21955 21974 21995 22011 22024 22029 22037 22052 22078 22097 22125 22143 22154 22160 22166 22187 22197 22208 22226 22248 22265 22278 22299 22319 22339 22350 22363 22385 22392 22417 22432 22452 22464 22481 22498 22518 22537 22847 23027 23238 23426 23492 23539 23594 23638 23658 23687 23699 23705 23721 23725 23729 23737 23747 23759 23774 23793 23829 23840 23851 23890 23902 23912 23922 23932 23948 23966 24015 24036 24081 24325 24351 24605 24620 24646 24703 24737 24772 24914 24931 24980 25001 25017 25046 25051 25056 25062 25067 25106 25141 25171 25226 25259 25305 25319 25398 25403 25457 25471 25481 25505 25591 25639 25745 25779 25786 25801 25828 25837 25876 25883 25905 25924 25940 25958 25990 26009 26026 26183 26214 26221 26230 26238 26245 26259 26277 26296 26306 26318 26359 26404 26433 26454 26477 26496 26534 26540 26548 26552 26573 26590 26599 26618 26764 26806 27316 27324 27348 27366 27410 27415 27420 27424 27455 27468 27477 27523 27649 27740 27752 27816 27818 27820 27822 27832 27846 27861 27888 27892 27898 27903 27912 27917 27944 27946 27961 27972 27987 28015 28059 28106 28122 28144 28155 28188 28208 28257 28357 28359 28361 28396 28472 28489 28503 28510 28516 28615 28671 28947 29071 29182 29244 29282 29290 29312 29361 29364 29385 29430 29485 29544 29613 29660 29765 29908 29933 29937 29971 29987 30012 30060 30096 30157 30211 30292 30314 30353 30390 30422 30446 30473 30499 30513 30521 30531 30539 30553 30566 30578 30602 30643 30669 30686 30715 31039 31042 31056 31068 31074 31090 31102 31109 31116 31125 31135 31152 31168 31211 31219 31227 31237 31248 31266 31283 31296 31322 31329 31337 31354 31362 31379 31403 31422 31441 31460 31470 31481 31495 31513 31533 31553 31562 31585 31605 31616 31631 31643 31662 31681 31692 31702 31707 31713 31731 31750 31769 31776 31795 31815 31840 31857 31863 31871 31881 31893 31914 31930 31938 31958 31978 32000 32008 32019 32042 32049 32063 32085 32102 32111 32132 32150 32159 32190 32206 32233 32252 32272 32290 32311 32325 32345 32352 32371 32386 32405 32950 32983 33011 33040 33048 33085 33397 33574 33651 33668 33686 33701 33723 33773 33783 33800 33822 33881 34039 34063 34193 34218 34344 34362 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-10.99.12. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-10.99.12 zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-10.99.12 zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-10.99.12 zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-10.99.12 zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Instalacja zostala przerwana. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-10.99.12Wyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-10.99.12Uruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPNFSCD-ROM / DVDDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymSendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Instalowanie bootblokow na %s.... Twoje partycje NetBSD na %s wygladaja nastepujaco (Rozmiar i offset w %s): Kernel (GENERIC)Kernel (C700)RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # Rapid commit support. # Safe to enable by default because it requires the equivalent option set # on the server to actually work. option rapid_commit # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private  ... . ..zero wsmuxctl3 wsmuxctl2 wsmuxctl1 wsmuxctl0wsmux3wsmux2wsmux1wsmux0wsmouse3wsmouse2 wsmouse1!wsmouse0"wsmouse#wskbd3$wskbd2%wskbd1&wskbd0'wskbd(wsfont)wd3p*wd3o+wd3n,wd3m-wd3l.wd3k/wd3j0wd3i1wd3h2wd3g3wd3f4wd3e5wd3d6wd3c7wd3b8wd3a9 wd3:wd2p;wd2o<wd2n=wd2m>wd2l?wd2k@wd2jAwd2iBwd2hCwd2gDwd2fEwd2eFwd2dGwd2cHwd2bIwd2aJ wd2Kwd1pLwd1oMwd1nNwd1mOwd1lPwd1kQwd1jRwd1iSwd1hTwd1gUwd1fVwd1eWwd1dXwd1cYwd1bZwd1a[ wd1\wd0p]wd0o^wd0n_wd0m`wd0lawd0kbwd0jcwd0idwd0hewd0gfwd0fgwd0ehwd0diwd0cjwd0bkwd0al wd0murandomnttypfottypepttypdqttypcrttypbsttypatttyp9uttyp8vttyp7wttyp6xttyp5yttyp4zttyp3{ttyp2|ttyp1}ttyp0~ttyHstatttyHcfgttyH7ttyH6ttyH5ttyH4ttyH3ttyH2ttyH1ttyH0ttyGstatttyGcfgttyG7ttyG6ttyG5ttyG4ttyG3ttyG2ttyG1ttyG0ttyFstatttyFcfgttyF7ttyF6ttyF5ttyF4ttyF3ttyF2ttyF1ttyF0ttyEstatttyEcfgttyE7ttyE6ttyE5ttyE4ttyE3ttyE2ttyE1ttyE0tty01tty00 ttystdoutstdinstderr st1 st0sd3psd3osd3nsd3msd3lsd3ksd3jsd3isd3hsd3gsd3fsd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2asd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2k rwd2j rwd2i rwd2h rwd2g rwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1e rwd1d!rwd1c"rwd1b#rwd1a$rwd1%rwd0p&rwd0o'rwd0n(rwd0m)rwd0l*rwd0k+rwd0j,rwd0i-rwd0h.rwd0g/rwd0f0rwd0e1rwd0d2rwd0c3rwd0b4rwd0a5rwd06rst17rst08rsd3p9rsd3o:rsd3n;rsd3m<rsd3l=rsd3k>rsd3j?rsd3i@rsd3hArsd3gBrsd3fCrsd3eDrsd3dErsd3cFrsd3bGrsd3aHrsd3Irsd2pJrsd2oKrsd2nLrsd2mMrsd2lNrsd2kOrsd2jPrsd2iQrsd2hRrsd2gSrsd2fTrsd2eUrsd2dVrsd2cWrsd2bXrsd2aYrsd2Zrsd1p[rsd1o\rsd1n]rsd1m^rsd1l_rsd1k`rsd1jarsd1ibrsd1hcrsd1gdrsd1fersd1efrsd1dgrsd1chrsd1birsd1ajrsd1krsd0plrsd0omrsd0nnrsd0morsd0lprsd0kqrsd0jrrsd0isrsd0htrsd0gursd0fvrsd0ewrsd0dxrsd0cyrsd0bzrsd0a{rsd0|rmd1d}rmd1a~rmd1rmd0drmd0armd0rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rcd1drcd1arcd1rcd0drcd0arcd0randomptypfptypeptypdptypcptypbptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0memmd1dmd1a md1md0dmd0a md0ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullest1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drumconsttyconsolecd1dcd1a cd1cd0dcd0a cd0 bpf0bpf . .. dhcpcd.confgroup master.passwd netconfig protocolsserviceswheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766: root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin # $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  . .. dhcpcd-hooksdhcpcd-run-hooks#!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook" fi done  . ..20-resolv.conf 30-hostname else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi ...# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime [ -z "$rdnsstime" ] && return 1 ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers [ -n "$rdnss" ] && new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime [ -z "$dnssltime" ] && return 1 ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search [ -n "$dnssl" ] && new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf return $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" # Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... . .. chown dhcpcd  disklabel dmesg fdisk fsck fsck_ffs halt ifconfig init mknod mount  mount_cd9660  mount_ffs  mount_mfs  mount_msdos  mount_nfs newfs ping ping6 reboot restore route rrestore swapctl 0umount ... ... . .. binmdecsbinshare . .. ftp gunzip gzcat gzip less more progress sed tar `tip ... . .. chroot . ..misc ... . .. db log runspool ... ... ... . ..lock ...I^%K4"#'(),-@K^T8@@XK^x@ @+@-@-@L(@,@,@K^|D(@(@XL^8<.@L/@L8@XC@A@B@ 8@L^[L^(7@:@lJM^C@D@ [[hO@L@H@H@H@M^pG@H@,P@0P@HP@W@(Y@Q@Q@4P@M^ P@tU@?N^[@[@O^i@dj@k@dk@hk@Pl@`l@|k@k@pl@xl@l@@X@l@@@@0@H@`@l@l@l@D@l@l@@@x@@@@؁@@@ @8@P@h@@@@@Ԃ@O^l@Hm@@@oP@earmzaurusS^S^S^S^S^S^S^@@@@@@ @P@@X@X@d@p@x@@|@@8@8@@@@x@t@@x@@@p@@@`@@د@@@͠^@t@@@ʏH^xcAWAdAOs^ @tAAyAvAtA~^@`A̟ADA~^0A<BAP^H^@^8^^ B\BBBhBlB|BB@|Bz@z@z@@{@<{@{@@|@|@X}@`@z@z@ {@D@{@ |@t|@@}@}@<~@@؁@@@ @~@~@h@@@$@@Ԃ@@t@@,@H@@D@`@@@@h@\@@@@^4BB01236789 ./"'*+J^8  B "B^,B+BBBhBlB|BB@|B`.Bh.B.B@.B.B@@@0@H@`@.B.B/BD@ /B/B@@x@@@@؁@@@ @8@P@h@@@@@Ԃ@l3B@8@^dL^/B4/Br^6B`=B KBdFBPGBhFBJBFBFBFBFBFBIBFBLBć^@fBeBlBjB8iBjBiBiBlBlB@iB4nB nBHiB^\BhB^@BԈBćBBHB^`B\BܽBICՔ^BPBB^TBlBBt^" BB BT1CCaC8]CK^CCCCC(CCCCCCHCzټ|Ff梂 &Sk@5 5\-gӿ6C* fFq{ Ց ^)>ttmk%Czټ|Ff梂&Sk@5FDKDKD^XNDODND ^q^u^y^}^^^m^r^w^|^^ ^^^^ ^*^^^5^<^A^y^J^Q^]^i^<^F^P^Z^d^^^^^^^^^^^^^^>_^^^Xm^}]~]_Z $EEXEEEtEHE}]XdX@d@ h h 8"'-T39?? < ddi(,dGaGiG `GXnGkG$XdX@ X@^ZH|]]_Z@<&H'Hp(HH)H(HHdI`]g `0 ID IT I Id II I `$K^IIII@I^,I0III'^lxIIII^lIIII^lIlIIIw^lxIIII^lIpIII^lIHIIIl^llIIII^l I>??  ` ~ ^AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy((((((())((((((())SZZys[zzRTAL9CEINCOUYrUal:ceinDouyAa L= S` Td Z} l> sa te z~ C  E D NG RX c  e d nH rY'S^'s_'C'Tb'c'tcAIOaioAEOUaeouZ{z| OP Up oQ uq(A(a(E(e Un uo7LA7lB|JJJJJ+Ъ]]]]Ъ]]]]x]h]X]H]_+">""""&n@T((T`px|~~|xp`>~~>8|8888|8fffffffff~t0xs; x8|8888|88|8888888888888888|8 003f$ff$<~~<wfllllllll||| 0 `F8ll8vv0 000000 0 0f<ffff<~~~~`0``|```0||~~0  0~ 0`0 ~p~vv8ll8 Pp lllllx0`|||||||._KxJJ4J`RJJJHJXJ|J(JlJpJK`RYXXXX`R]Z_kK]KaKaK`R^K^Kd]K#K_Kd`K"K,#K0#KjK`RYXXXX`R]@Fn_HNL7L8L|9L`RAL9L7LK8<_`HR=_=_GR=_=_GR=_=_pHR=_>_$IR$>_5>_IRq (root)`%n.core~~~{|p|| }x}}(~~~h{R@BIF_0u`XS4@HPXlRhpQTRTQTRTQTRT QTRT@QTRTQTRTQTRTQTRTQTRTQTRTQTRT QTRT@QTRTQTRTOTNT e@@g@[_/\_[_?\_0TT  @ `RĂ̂d`_̻UUUUU,UdUU8Ul`_̻UUUUU,UdUU8Udp_]]hYVb_tVVV0]] @WWlockf2  q_4{X4{X4{X4{X4{X`R4{X4{X4{XD{X4{X`R4{X4{X4{X4{X4{X4{X4{X4{X4{X`R^____ Y Y Yw_P)Yx_.Yƈ^x9Y8YbY[YTYD`Y_Y4bYDaY`YSYKYEYFY}Y|Y|Y~Y~Y~Y~Y~Y|Y~Yt|_YpY""" _xZ^^Zm0u`ZZĎZԎZZؗZDZu_L^x^ ^_TF_UK_VU_W\_Xd_Yi_Zn_[r_bw_c|_dk^e_f_g_h_i_j_k_l_m_n_o$e_?_܈_ň_ʈ_ V_҈_c_>_ֈ_ ^ n_ ڈ_H^]_ƈ^_x_zt_m+_1P_x_-K_e_*8_"^;y_ _!N'_"o^$_%_(_._1_2R^4_5_6 _8 _9_:_;"_<^=,_>4_@8_A=_BB_FJ_GGO_H&^IT_JY_Mb_Nl_Tr_Uv_V}_W_X_Y_Z_[^\\_]_^___`_a_c_d^e_f^gɉ_hω_iՉ_kۉ_l_mpt^],[]L]l]0]PD]\ ^ ^h]^]̓]]A]g]\](\^,]]ܞ]\H^A]^K^K^^^~^ ^^^Ч8^'^'^ԧ8^^^ا8^^^ܧ8^w^w^ী8^^^䧀8^^^觀8^l^l^지8^^^8^^^8^x^x^8^^^8^^^8^/Q^t^\^$_^\^n_^^n_^Ȧ^n_^ئ^n_Ք^ \^_^\^Os^Os^P^"_^^^^^O^O^I#_O^^H^H^D^~^~^,^^^^^^覀^J^J^^L^L^^r^r^^_K^(^ć^ć^8^_?N^H^H^K^X^XK^XK^h^XL^XL^x^L^L^^JM^JM^t^M^M^^^^^M^M^^^^ȧh^@ @p@@ @@AH^^M^^^M^^JM^L^^XL^^XK^H^^_^ć^_^r^L^J^^^^^~^^H^I#_^O^^ƈ^^"_Os^^_^n_^$_^/Q^^^x^^^l^^^w^^^'^^^K^ ^^[^lS],_}[_,@NetBSDpmAA(aeabi5TE  $NetBSD: locore.S,v 1.44 2022/04/02 11:16:07 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/locore.S D2025.04.12.20.50.00-20250331113646 $$NetBSD: md_root.c,v 1.19 2015/08/30 05:24:03 uebayasi Exp $$NetBSD: /usr/src/sys/dev/md_root.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: autoconf.c,v 1.17 2023/12/20 15:34:46 thorpej Exp $$NetBSD: /usr/src/sys/arch/zaurus/zaurus/autoconf.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: machdep.c,v 1.55 2024/05/13 00:08:06 msaitoh Exp $$NetBSD: /usr/src/sys/arch/zaurus/zaurus/machdep.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_disk_mbr.c,v 1.59 2025/02/08 10:49:45 mlelstv Exp $$NetBSD: /usr/src/sys/kern/subr_disk_mbr.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ziic.c,v 1.6 2021/08/07 16:19:08 thorpej Exp $$NetBSD: /usr/src/sys/arch/zaurus/dev/ziic.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: scoop.c,v 1.13 2014/09/23 14:49:46 nonaka Exp $$NetBSD: /usr/src/sys/arch/zaurus/dev/scoop.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: scoop_pcic.c,v 1.4 2011/06/19 16:20:09 nonaka Exp $$NetBSD: /usr/src/sys/arch/zaurus/dev/scoop_pcic.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: zssp.c,v 1.15 2021/08/07 16:19:08 thorpej Exp $$NetBSD: /usr/src/sys/arch/zaurus/dev/zssp.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: w100lcd.c,v 1.6 2022/05/28 10:36:23 andvar Exp $$NetBSD: /usr/src/sys/arch/zaurus/dev/w100lcd.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: w100.c,v 1.4 2021/11/20 00:17:10 rin Exp $$NetBSD: /usr/src/sys/arch/zaurus/dev/w100.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: lcdctl.c,v 1.3 2012/01/29 10:12:41 tsutsui Exp $$NetBSD: /usr/src/sys/arch/zaurus/dev/lcdctl.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: zkbd.c,v 1.22 2021/08/07 16:19:08 thorpej Exp $$NetBSD: /usr/src/sys/arch/zaurus/dev/zkbd.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: zapm.c,v 1.14 2021/08/07 16:19:08 thorpej Exp $$NetBSD: /usr/src/sys/arch/zaurus/dev/zapm.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: zmci.c,v 1.5 2012/01/29 10:12:42 tsutsui Exp $$NetBSD: /usr/src/sys/arch/zaurus/dev/zmci.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: vfp_init.c,v 1.78 2022/08/20 11:34:08 riastradh Exp $$NetBSD: /usr/src/sys/arch/arm/vfp/vfp_init.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: cons.c,v 1.95 2023/09/02 17:44:59 riastradh Exp $$NetBSD: /usr/src/sys/dev/cons.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: fiq.c,v 1.10 2020/02/24 12:08:08 rin Exp $$NetBSD: /usr/src/sys/arch/arm/arm/fiq.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: mainbus.c,v 1.24 2022/09/27 06:36:42 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/mainbus/mainbus.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: mainbus_io.c,v 1.24 2018/03/16 17:56:32 ryo Exp $$NetBSD: /usr/src/sys/arch/arm/mainbus/mainbus_io.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: cpu_mainbus.c,v 1.19 2024/05/09 12:41:08 pho Exp $$NetBSD: /usr/src/sys/arch/arm/mainbus/cpu_mainbus.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: disassem.c,v 1.42 2020/12/01 02:48:28 rin Exp $$NetBSD: /usr/src/sys/arch/arm/arm/disassem.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: bus_stubs.c,v 1.3 2021/09/18 09:49:57 jmcneill Exp $$NetBSD: /usr/src/sys/arch/arm/arm/bus_stubs.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: arm_cpu_topology.c,v 1.9 2024/12/10 11:27:29 jmcneill Exp $$NetBSD: /usr/src/sys/arch/arm/arm/arm_cpu_topology.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: arm_machdep.c,v 1.68 2023/10/04 20:28:05 ad Exp $$NetBSD: /usr/src/sys/arch/arm/arm/arm_machdep.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ast.c,v 1.32 2021/02/01 19:31:34 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm/ast.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: bcopyinout_xscale.S,v 1.12 2022/10/20 06:58:38 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm/bcopyinout_xscale.S D2025.04.12.20.50.00-20250331113646 $$NetBSD: blockio.S,v 1.9 2022/10/20 06:58:38 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm/blockio.S D2025.04.12.20.50.00-20250331113646 $$NetBSD: bootconfig.c,v 1.13 2020/10/18 16:28:57 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm/bootconfig.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: copystr.S,v 1.14 2022/10/20 06:58:38 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm/copystr.S D2025.04.12.20.50.00-20250331113646 $$NetBSD: core_machdep.c,v 1.10 2020/11/10 21:38:03 rin Exp $$NetBSD: /usr/src/sys/arch/arm/arm/core_machdep.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: cpufunc.c,v 1.185 2022/12/22 06:58:07 ryo Exp $$NetBSD: /usr/src/sys/arch/arm/arm/cpufunc.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: cpu_exec.c,v 1.13 2020/12/01 02:43:13 rin Exp $$NetBSD: /usr/src/sys/arch/arm/arm/cpu_exec.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: cpu_in_cksum.S,v 1.13 2022/10/20 06:58:38 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm/cpu_in_cksum.S D2025.04.12.20.50.00-20250331113646 $$NetBSD: cpu_subr.c,v 1.5 2021/11/14 16:56:32 riastradh Exp $$NetBSD: /usr/src/sys/arch/arm/arm/cpu_subr.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: idle_machdep.c,v 1.6 2021/02/17 06:54:23 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm/idle_machdep.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: process_machdep.c,v 1.35 2021/02/01 19:31:34 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm/process_machdep.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: sig_machdep.c,v 1.53 2024/04/14 07:56:13 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm/sig_machdep.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: sigcode.S,v 1.8 2005/12/11 12:16:41 christos Exp $$NetBSD: /usr/src/sys/arch/arm/arm/sigcode.S D2025.04.12.20.50.00-20250331113646 $$NetBSD: syscall.c,v 1.69 2023/10/05 19:41:03 ad Exp $$NetBSD: /usr/src/sys/arch/arm/arm/syscall.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: trap.c,v 1.1 2022/04/02 11:16:06 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm/trap.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: undefined.c,v 1.75 2023/10/05 19:41:03 ad Exp $$NetBSD: /usr/src/sys/arch/arm/arm/undefined.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: arm32_machdep.c,v 1.147 2024/03/05 14:15:29 thorpej Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/arm32_machdep.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: bus_dma.c,v 1.149 2025/03/08 21:00:45 jmcneill Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/bus_dma.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: cpu.c,v 1.154 2024/05/09 12:41:08 pho Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/cpu.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: cpuswitch.S,v 1.107 2023/03/01 08:17:53 riastradh Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/cpuswitch.S D2025.04.12.20.50.00-20250331113646 $$NetBSD: exception.S,v 1.26 2020/11/21 19:46:13 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/exception.S D2025.04.12.20.50.00-20250331113646 $$NetBSD: fault.c,v 1.119 2024/02/02 22:00:32 andvar Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/fault.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: pmap.c,v 1.443 2024/04/13 12:28:01 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/pmap.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: setstack.S,v 1.6 2013/08/18 06:29:29 matt Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/setstack.S D2025.04.12.20.50.00-20250331113646 $$NetBSD: stubs.c,v 1.27 2020/07/03 15:31:25 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/stubs.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: sys_machdep.c,v 1.26 2020/06/20 15:45:22 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/sys_machdep.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: vm_machdep.c,v 1.79 2024/01/15 20:35:22 andvar Exp $$NetBSD: /usr/src/sys/arch/arm/arm32/vm_machdep.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: pmap_devmap.c,v 1.2 2023/04/27 06:23:31 skrll Exp $$NetBSD: /usr/src/sys/uvm/pmap/pmap_devmap.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: pmap_pvt.c,v 1.15 2022/05/08 22:03:02 rin Exp $$NetBSD: /usr/src/sys/uvm/pmap/pmap_pvt.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: wd.c,v 1.473 2025/02/27 01:34:43 jakllsch Exp $$NetBSD: /usr/src/sys/dev/ata/wd.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ata_wdc.c,v 1.120 2021/10/05 08:01:05 rin Exp $$NetBSD: /usr/src/sys/dev/ata/ata_wdc.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ata.c,v 1.171 2025/02/17 19:01:04 jakllsch Exp $$NetBSD: /usr/src/sys/dev/ata/ata.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ata_subr.c,v 1.13 2020/12/23 08:17:01 skrll Exp $$NetBSD: /usr/src/sys/dev/ata/ata_subr.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ata_recovery.c,v 1.4 2020/04/13 10:49:34 jdolecek Exp $$NetBSD: /usr/src/sys/dev/ata/ata_recovery.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: sdmmc.c,v 1.43 2021/08/07 16:19:16 thorpej Exp $$NetBSD: /usr/src/sys/dev/sdmmc/sdmmc.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: sdmmc_cis.c,v 1.10 2025/01/17 11:54:50 jmcneill Exp $$NetBSD: /usr/src/sys/dev/sdmmc/sdmmc_cis.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: sdmmc_io.c,v 1.21 2020/10/17 09:36:45 mlelstv Exp $$NetBSD: /usr/src/sys/dev/sdmmc/sdmmc_io.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: sdmmc_mem.c,v 1.77 2024/10/24 10:50:31 skrll Exp $$NetBSD: /usr/src/sys/dev/sdmmc/sdmmc_mem.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ld_sdmmc.c,v 1.44 2024/10/18 11:03:52 jmcneill Exp $$NetBSD: /usr/src/sys/dev/sdmmc/ld_sdmmc.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: config_hook.c,v 1.12 2020/11/21 21:08:32 thorpej Exp $$NetBSD: /usr/src/sys/arch/hpc/hpc/config_hook.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: platid.c,v 1.11 2006/05/10 06:24:02 skrll Exp $$NetBSD: /usr/src/sys/arch/hpc/hpc/platid.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: pxa2x0.c,v 1.24 2021/08/07 16:18:46 thorpej Exp $$NetBSD: /usr/src/sys/arch/arm/xscale/pxa2x0.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: pxa2x0_space.c,v 1.14 2023/04/21 15:00:48 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/xscale/pxa2x0_space.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: pxa2x0_dma.c,v 1.7 2022/09/27 06:36:43 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/xscale/pxa2x0_dma.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: pxa2x0_intr.c,v 1.26 2023/07/13 19:42:24 riastradh Exp $$NetBSD: /usr/src/sys/arch/arm/xscale/pxa2x0_intr.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: pxa2x0_gpio.c,v 1.21 2021/08/07 16:18:46 thorpej Exp $$NetBSD: /usr/src/sys/arch/arm/xscale/pxa2x0_gpio.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: pxa2x0_com.c,v 1.14 2018/12/08 17:46:10 thorpej Exp $$NetBSD: /usr/src/sys/arch/arm/xscale/pxa2x0_com.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: pxa2x0_a4x_space.c,v 1.6 2018/03/16 17:56:32 ryo Exp $$NetBSD: /usr/src/sys/arch/arm/xscale/pxa2x0_a4x_space.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: bus_space_a4x.S,v 1.4 2013/10/28 22:50:25 matt Exp $$NetBSD: /usr/src/sys/arch/arm/arm/bus_space_a4x.S D2025.04.12.20.50.00-20250331113646 $$NetBSD: sa11x0_ost.c,v 1.33 2019/11/13 17:52:12 tsutsui Exp $$NetBSD: /usr/src/sys/arch/arm/sa11x0/sa11x0_ost.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: pxa2x0_pcic.c,v 1.15 2022/09/27 06:36:43 skrll Exp $$NetBSD: /usr/src/sys/arch/arm/xscale/pxa2x0_pcic.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: pxa2x0_i2c.c,v 1.9 2021/12/12 08:49:57 andvar Exp $$NetBSD: /usr/src/sys/arch/arm/xscale/pxa2x0_i2c.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: pxa2x0_rtc.c,v 1.8 2024/02/24 12:04:16 andvar Exp $$NetBSD: /usr/src/sys/arch/arm/xscale/pxa2x0_rtc.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: pxa2x0_mci.c,v 1.14 2023/03/28 20:01:57 andvar Exp $$NetBSD: /usr/src/sys/arch/arm/xscale/pxa2x0_mci.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: apmdev.c,v 1.34 2021/09/26 01:16:08 thorpej Exp $$NetBSD: /usr/src/sys/dev/hpc/apm/apmdev.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: pcmcia.c,v 1.96 2021/08/07 16:19:15 thorpej Exp $$NetBSD: /usr/src/sys/dev/pcmcia/pcmcia.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: pcmcia_cis.c,v 1.57 2019/11/10 21:16:36 chs Exp $$NetBSD: /usr/src/sys/dev/pcmcia/pcmcia_cis.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: pcmcia_cis_quirks.c,v 1.36 2019/11/10 21:16:36 chs Exp $$NetBSD: /usr/src/sys/dev/pcmcia/pcmcia_cis_quirks.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: if_ne_pcmcia.c,v 1.161 2019/12/27 08:01:58 msaitoh Exp $$NetBSD: /usr/src/sys/dev/pcmcia/if_ne_pcmcia.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: com_pcmcia.c,v 1.62 2018/12/08 17:46:14 thorpej Exp $$NetBSD: /usr/src/sys/dev/pcmcia/com_pcmcia.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: wdc_pcmcia.c,v 1.130 2022/09/25 21:53:54 thorpej Exp $$NetBSD: /usr/src/sys/dev/pcmcia/wdc_pcmcia.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: if_wi_pcmcia.c,v 1.93 2019/01/08 08:47:21 msaitoh Exp $$NetBSD: /usr/src/sys/dev/pcmcia/if_wi_pcmcia.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: dev_verbose.c,v 1.4 2021/06/29 21:03:36 pgoyette Exp $$NetBSD: /usr/src/sys/dev/dev_verbose.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ld.c,v 1.115 2025/04/12 07:30:01 mlelstv Exp $$NetBSD: /usr/src/sys/dev/ld.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: wi.c,v 1.258 2023/08/01 07:04:15 mrg Exp $$NetBSD: /usr/src/sys/dev/ic/wi.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: dp8390.c,v 1.101 2024/06/29 12:11:11 riastradh Exp $$NetBSD: /usr/src/sys/dev/ic/dp8390.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ne2000.c,v 1.79 2024/05/21 08:04:20 andvar Exp $$NetBSD: /usr/src/sys/dev/ic/ne2000.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: com.c,v 1.388 2025/02/12 05:15:39 imil Exp $$NetBSD: /usr/src/sys/dev/ic/com.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: rtl80x9.c,v 1.19 2023/12/31 03:19:22 isaki Exp $$NetBSD: /usr/src/sys/dev/ic/rtl80x9.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: wdc.c,v 1.310 2022/05/31 08:43:15 andvar Exp $$NetBSD: /usr/src/sys/dev/ic/wdc.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: dl10019.c,v 1.17 2021/07/01 20:39:15 thorpej Exp $$NetBSD: /usr/src/sys/dev/ic/dl10019.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ax88190.c,v 1.18 2021/07/01 20:39:15 thorpej Exp $$NetBSD: /usr/src/sys/dev/ic/ax88190.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: compat_exec.c,v 1.18 2019/01/27 02:08:39 pgoyette Exp $$NetBSD: /usr/src/sys/compat/common/compat_exec.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: compat_util.c,v 1.47 2019/01/27 02:08:39 pgoyette Exp $$NetBSD: /usr/src/sys/compat/common/compat_util.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: aes_bear.c,v 1.4 2020/07/25 22:28:27 riastradh Exp $$NetBSD: /usr/src/sys/crypto/aes/aes_bear.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: aes_ccm.c,v 1.6 2021/10/17 14:45:45 jmcneill Exp $$NetBSD: /usr/src/sys/crypto/aes/aes_ccm.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: aes_ccm_mbuf.c,v 1.1 2020/07/25 22:15:55 riastradh Exp $$NetBSD: /usr/src/sys/crypto/aes/aes_ccm_mbuf.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: aes_ct.c,v 1.3 2020/06/30 20:32:11 riastradh Exp $$NetBSD: /usr/src/sys/crypto/aes/aes_ct.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: aes_ct_dec.c,v 1.2 2020/06/29 23:36:59 riastradh Exp $$NetBSD: /usr/src/sys/crypto/aes/aes_ct_dec.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: aes_ct_enc.c,v 1.1 2020/06/29 23:27:52 riastradh Exp $$NetBSD: /usr/src/sys/crypto/aes/aes_ct_enc.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: aes_impl.c,v 1.10 2022/11/05 17:36:33 jmcneill Exp $$NetBSD: /usr/src/sys/crypto/aes/aes_impl.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: aes_selftest.c,v 1.7 2021/12/05 04:48:35 msaitoh Exp $$NetBSD: /usr/src/sys/crypto/aes/aes_selftest.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: nist_hash_drbg.c,v 1.3 2019/09/19 18:29:55 riastradh Exp $$NetBSD: /usr/src/sys/crypto/nist_hash_drbg/nist_hash_drbg.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: cprng_fast.c,v 1.20 2024/10/15 17:34:06 riastradh Exp $$NetBSD: /usr/src/sys/crypto/cprng_fast/cprng_fast.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: blake2s.c,v 1.2 2021/10/17 14:45:45 jmcneill Exp $$NetBSD: /usr/src/sys/crypto/blake2/blake2s.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: sysmon.c,v 1.32 2022/03/28 12:33:21 riastradh Exp $$NetBSD: /usr/src/sys/dev/sysmon/sysmon.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: sysmon_wdog.c,v 1.30 2021/12/31 11:05:41 riastradh Exp $$NetBSD: /usr/src/sys/dev/sysmon/sysmon_wdog.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: swwdog.c,v 1.24 2024/11/07 09:47:40 rin Exp $$NetBSD: /usr/src/sys/dev/sysmon/swwdog.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ieee80211.c,v 1.61 2021/08/21 11:55:25 andvar Exp $$NetBSD: /usr/src/sys/net80211/ieee80211.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ieee80211_amrr.c,v 1.3 2015/08/24 20:58:47 pooka Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_amrr.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ieee80211_crypto.c,v 1.23 2018/05/08 07:02:07 maxv Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_crypto.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ieee80211_crypto_ccmp.c,v 1.20 2023/06/24 05:12:03 msaitoh Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_crypto_ccmp.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ieee80211_crypto_none.c,v 1.8 2018/01/19 07:53:46 maxv Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_crypto_none.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ieee80211_crypto_tkip.c,v 1.18 2023/06/24 05:12:03 msaitoh Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_crypto_tkip.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ieee80211_crypto_wep.c,v 1.14 2023/06/24 05:12:03 msaitoh Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_crypto_wep.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ieee80211_input.c,v 1.117 2022/11/19 07:57:51 yamt Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_input.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ieee80211_ioctl.c,v 1.69 2021/09/21 15:00:34 christos Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_ioctl.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ieee80211_netbsd.c,v 1.34 2018/12/22 14:28:56 maxv Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_netbsd.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ieee80211_node.c,v 1.84 2024/07/05 04:31:53 rin Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_node.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ieee80211_output.c,v 1.68 2024/07/05 04:31:53 rin Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_output.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ieee80211_proto.c,v 1.37 2021/07/24 21:31:38 andvar Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_proto.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ieee80211_rssadapt.c,v 1.21 2016/09/27 20:20:06 christos Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_rssadapt.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ieee80211_xauth.c,v 1.5 2006/02/27 01:08:28 dyoung Exp $$NetBSD: /usr/src/sys/net80211/ieee80211_xauth.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: at_print.c,v 1.2 2021/07/21 06:35:45 skrll Exp $$NetBSD: /usr/src/sys/netatalk/at_print.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: igmp.c,v 1.70 2020/05/15 06:34:34 maxv Exp $$NetBSD: /usr/src/sys/netinet/igmp.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: in.c,v 1.248 2024/08/20 08:22:35 ozaki-r Exp $$NetBSD: /usr/src/sys/netinet/in.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: in_offload.c,v 1.15 2024/07/05 04:31:54 rin Exp $$NetBSD: /usr/src/sys/netinet/in_offload.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: in_pcb.c,v 1.202 2022/11/04 09:05:41 ozaki-r Exp $$NetBSD: /usr/src/sys/netinet/in_pcb.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: in_print.c,v 1.1 2014/12/02 19:35:27 christos Exp $$NetBSD: /usr/src/sys/netinet/in_print.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: in_proto.c,v 1.131 2022/09/03 02:53:18 thorpej Exp $$NetBSD: /usr/src/sys/netinet/in_proto.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ip_icmp.c,v 1.179 2025/02/22 09:10:27 mlelstv Exp $$NetBSD: /usr/src/sys/netinet/ip_icmp.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ip_input.c,v 1.404 2024/07/05 04:31:54 rin Exp $$NetBSD: /usr/src/sys/netinet/ip_input.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ip_output.c,v 1.326 2023/04/19 22:00:18 mlelstv Exp $$NetBSD: /usr/src/sys/netinet/ip_output.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ip_reass.c,v 1.23 2022/05/31 08:43:16 andvar Exp $$NetBSD: /usr/src/sys/netinet/ip_reass.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: raw_ip.c,v 1.186 2024/07/05 04:31:54 rin Exp $$NetBSD: /usr/src/sys/netinet/raw_ip.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: tcp_input.c,v 1.441 2024/10/08 06:17:14 rin Exp $$NetBSD: /usr/src/sys/netinet/tcp_input.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: tcp_output.c,v 1.222 2024/09/08 09:36:52 rillig Exp $$NetBSD: /usr/src/sys/netinet/tcp_output.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: tcp_sack.c,v 1.36 2018/05/18 18:58:51 maxv Exp $$NetBSD: /usr/src/sys/netinet/tcp_sack.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: tcp_subr.c,v 1.298 2025/02/26 04:49:45 andvar Exp $$NetBSD: /usr/src/sys/netinet/tcp_subr.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: tcp_syncache.c,v 1.7 2024/06/29 12:59:08 riastradh Exp $$NetBSD: /usr/src/sys/netinet/tcp_syncache.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: tcp_timer.c,v 1.99 2022/11/04 09:00:58 ozaki-r Exp $$NetBSD: /usr/src/sys/netinet/tcp_timer.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: tcp_usrreq.c,v 1.238 2022/11/04 09:01:53 ozaki-r Exp $$NetBSD: /usr/src/sys/netinet/tcp_usrreq.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: tcp_congctl.c,v 1.29 2024/05/14 19:00:44 andvar Exp $$NetBSD: /usr/src/sys/netinet/tcp_congctl.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: tcp_vtw.c,v 1.25 2024/10/07 23:17:00 jakllsch Exp $$NetBSD: /usr/src/sys/netinet/tcp_vtw.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: udp_usrreq.c,v 1.266 2024/10/08 02:30:04 riastradh Exp $$NetBSD: /usr/src/sys/netinet/udp_usrreq.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: portalgo.c,v 1.15 2022/11/04 09:01:53 ozaki-r Exp $$NetBSD: /usr/src/sys/netinet/portalgo.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: dest6.c,v 1.22 2018/04/13 11:01:14 maxv Exp $$NetBSD: /usr/src/sys/netinet6/dest6.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: frag6.c,v 1.78 2024/04/19 05:04:06 ozaki-r Exp $$NetBSD: /usr/src/sys/netinet6/frag6.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: icmp6.c,v 1.258 2024/07/05 04:31:54 rin Exp $$NetBSD: /usr/src/sys/netinet6/icmp6.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: in6.c,v 1.292 2024/03/01 23:50:27 riastradh Exp $$NetBSD: /usr/src/sys/netinet6/in6.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: in6_cksum.c,v 1.28 2011/04/25 22:05:05 yamt Exp $$NetBSD: /usr/src/sys/netinet6/in6_cksum.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: in6_ifattach.c,v 1.122 2024/04/11 07:34:37 knakahara Exp $$NetBSD: /usr/src/sys/netinet6/in6_ifattach.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: in6_offload.c,v 1.13 2024/07/05 04:31:54 rin Exp $$NetBSD: /usr/src/sys/netinet6/in6_offload.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: in6_pcb.c,v 1.177 2022/11/04 09:04:27 ozaki-r Exp $$NetBSD: /usr/src/sys/netinet6/in6_pcb.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: in6_print.c,v 1.1 2014/12/02 19:36:58 christos Exp $$NetBSD: /usr/src/sys/netinet6/in6_print.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: in6_proto.c,v 1.131 2024/02/09 22:08:37 andvar Exp $$NetBSD: /usr/src/sys/netinet6/in6_proto.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: in6_src.c,v 1.92 2023/08/03 04:24:55 ozaki-r Exp $$NetBSD: /usr/src/sys/netinet6/in6_src.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ip6_forward.c,v 1.103 2024/06/29 13:00:44 riastradh Exp $$NetBSD: /usr/src/sys/netinet6/ip6_forward.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ip6_input.c,v 1.228 2024/06/29 13:00:44 riastradh Exp $$NetBSD: /usr/src/sys/netinet6/ip6_input.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ip6_mroute.c,v 1.133 2025/01/02 16:10:22 andvar Exp $$NetBSD: /usr/src/sys/netinet6/ip6_mroute.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ip6_output.c,v 1.235 2024/04/19 00:55:35 riastradh Exp $$NetBSD: /usr/src/sys/netinet6/ip6_output.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: mld6.c,v 1.101 2019/09/25 09:53:38 ozaki-r Exp $$NetBSD: /usr/src/sys/netinet6/mld6.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: nd6.c,v 1.283 2025/03/31 05:55:43 ozaki-r Exp $$NetBSD: /usr/src/sys/netinet6/nd6.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: nd6_nbr.c,v 1.185 2024/11/13 09:25:52 roy Exp $$NetBSD: /usr/src/sys/netinet6/nd6_nbr.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: nd6_rtr.c,v 1.149 2020/06/12 11:04:45 roy Exp $$NetBSD: /usr/src/sys/netinet6/nd6_rtr.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: raw_ip6.c,v 1.185 2024/07/05 04:31:54 rin Exp $$NetBSD: /usr/src/sys/netinet6/raw_ip6.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: route6.c,v 1.25 2018/02/01 16:23:28 maxv Exp $$NetBSD: /usr/src/sys/netinet6/route6.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: scope6.c,v 1.23 2020/06/16 17:12:18 maxv Exp $$NetBSD: /usr/src/sys/netinet6/scope6.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: udp6_usrreq.c,v 1.156 2024/10/08 02:30:05 riastradh Exp $$NetBSD: /usr/src/sys/netinet6/udp6_usrreq.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: i2c.c,v 1.92 2025/01/27 17:01:53 riastradh Exp $$NetBSD: /usr/src/sys/dev/i2c/i2c.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: i2c_exec.c,v 1.18 2022/10/24 10:17:27 riastradh Exp $$NetBSD: /usr/src/sys/dev/i2c/i2c_exec.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: i2c_subr.c,v 1.2 2022/04/01 15:49:12 pgoyette Exp $$NetBSD: /usr/src/sys/dev/i2c/i2c_subr.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: i2c_bitbang.c,v 1.14 2016/06/07 01:06:27 pgoyette Exp $$NetBSD: /usr/src/sys/dev/i2c/i2c_bitbang.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: mii.c,v 1.59 2024/02/08 20:11:55 andvar Exp $$NetBSD: /usr/src/sys/dev/mii/mii.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: mii_bitbang.c,v 1.14 2019/01/22 03:42:27 msaitoh Exp $$NetBSD: /usr/src/sys/dev/mii/mii_bitbang.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: mii_physubr.c,v 1.103 2023/05/22 02:12:13 msaitoh Exp $$NetBSD: /usr/src/sys/dev/mii/mii_physubr.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: mii_ethersubr.c,v 1.3 2020/03/15 23:04:50 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/mii_ethersubr.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ukphy_subr.c,v 1.17 2020/03/15 23:04:50 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/ukphy_subr.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: brgphy.c,v 1.91 2023/02/22 08:09:09 msaitoh Exp $$NetBSD: /usr/src/sys/dev/mii/brgphy.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: nsphy.c,v 1.66 2020/03/15 23:04:50 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/nsphy.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: nsphyter.c,v 1.46 2020/03/28 18:37:18 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/nsphyter.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: qsphy.c,v 1.55 2020/03/15 23:04:50 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/qsphy.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: inphy.c,v 1.60 2020/03/15 23:04:50 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/inphy.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: iophy.c,v 1.43 2020/03/15 23:04:50 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/iophy.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: exphy.c,v 1.58 2020/03/15 23:04:50 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/exphy.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: lxtphy.c,v 1.56 2021/08/20 20:25:28 andvar Exp $$NetBSD: /usr/src/sys/dev/mii/lxtphy.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: icsphy.c,v 1.56 2020/03/15 23:04:50 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/icsphy.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: sqphy.c,v 1.56 2020/03/15 23:04:50 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/sqphy.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: dmphy.c,v 1.47 2020/03/15 23:04:50 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/dmphy.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: pnaphy.c,v 1.26 2020/03/15 23:04:50 thorpej Exp $$NetBSD: /usr/src/sys/dev/mii/pnaphy.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ukphy.c,v 1.55 2021/06/29 21:03:36 pgoyette Exp $$NetBSD: /usr/src/sys/dev/mii/ukphy.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: dmover_backend.c,v 1.9 2011/05/14 18:24:47 jakllsch Exp $$NetBSD: /usr/src/sys/dev/dmover/dmover_backend.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: dmover_process.c,v 1.5 2011/05/14 14:49:19 jakllsch Exp $$NetBSD: /usr/src/sys/dev/dmover/dmover_process.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: dmover_request.c,v 1.8 2011/05/14 18:24:47 jakllsch Exp $$NetBSD: /usr/src/sys/dev/dmover/dmover_request.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: dmover_session.c,v 1.6 2011/05/14 18:24:47 jakllsch Exp $$NetBSD: /usr/src/sys/dev/dmover/dmover_session.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: dmover_util.c,v 1.5 2005/12/11 12:21:20 christos Exp $$NetBSD: /usr/src/sys/dev/dmover/dmover_util.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: drm_stub.c,v 1.1 2019/11/16 04:10:33 christos Exp $$NetBSD: /usr/src/sys/external/bsd/drm2/drm/drm_stub.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: wsdisplay.c,v 1.166 2023/03/01 08:42:33 riastradh Exp $$NetBSD: /usr/src/sys/dev/wscons/wsdisplay.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: wsemulconf.c,v 1.8 2010/02/02 16:18:29 drochner Exp $$NetBSD: /usr/src/sys/dev/wscons/wsemulconf.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: wsemul_dumb.c,v 1.18 2018/09/03 16:29:34 riastradh Exp $$NetBSD: /usr/src/sys/dev/wscons/wsemul_dumb.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: wsemul_vt100.c,v 1.52 2023/08/02 22:37:02 uwe Exp $$NetBSD: /usr/src/sys/dev/wscons/wsemul_vt100.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: wsemul_vt100_subr.c,v 1.34 2023/08/03 22:11:41 uwe Exp $$NetBSD: /usr/src/sys/dev/wscons/wsemul_vt100_subr.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: wsemul_vt100_chars.c,v 1.15 2017/11/03 19:20:27 maya Exp $$NetBSD: /usr/src/sys/dev/wscons/wsemul_vt100_chars.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: wsemul_vt100_keys.c,v 1.11 2010/02/10 19:39:39 drochner Exp $$NetBSD: /usr/src/sys/dev/wscons/wsemul_vt100_keys.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: wsevent.c,v 1.47 2021/09/26 01:16:10 thorpej Exp $$NetBSD: /usr/src/sys/dev/wscons/wsevent.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: wskbd.c,v 1.146 2025/04/07 11:25:42 hans Exp $$NetBSD: /usr/src/sys/dev/wscons/wskbd.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: wskbdutil.c,v 1.19 2017/11/03 19:20:27 maya Exp $$NetBSD: /usr/src/sys/dev/wscons/wskbdutil.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: wsmux.c,v 1.68 2025/04/07 11:18:44 hans Exp $$NetBSD: /usr/src/sys/dev/wscons/wsmux.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: wsbellmux.c,v 1.1 2017/06/11 03:55:56 nat Exp $$NetBSD: /usr/src/sys/dev/wscons/wsbellmux.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: rasops.c,v 1.128 2022/05/15 16:43:39 uwe Exp $$NetBSD: /usr/src/sys/dev/rasops/rasops.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: rasops_masks.c,v 1.10 2019/08/10 01:24:17 rin Exp $$NetBSD: /usr/src/sys/dev/rasops/rasops_masks.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: rasops4.c,v 1.28 2019/08/14 00:51:10 rin Exp $$NetBSD: /usr/src/sys/dev/rasops/rasops4.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: rasops8.c,v 1.51 2019/08/14 00:51:10 rin Exp $$NetBSD: /usr/src/sys/dev/rasops/rasops8.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: rasops15.c,v 1.39 2019/08/14 00:51:10 rin Exp $$NetBSD: /usr/src/sys/dev/rasops/rasops15.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: wsfont.c,v 1.83 2025/03/25 10:50:12 macallan Exp $$NetBSD: /usr/src/sys/dev/wsfont/wsfont.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: cd9660_bmap.c,v 1.5 2014/06/14 07:39:28 hannken Exp $$NetBSD: /usr/src/sys/fs/cd9660/cd9660_bmap.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: cd9660_lookup.c,v 1.33 2024/09/08 09:36:51 rillig Exp $$NetBSD: /usr/src/sys/fs/cd9660/cd9660_lookup.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: cd9660_node.c,v 1.38 2017/05/26 14:34:19 riastradh Exp $$NetBSD: /usr/src/sys/fs/cd9660/cd9660_node.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: cd9660_rrip.c,v 1.18 2015/03/28 19:24:05 maxv Exp $$NetBSD: /usr/src/sys/fs/cd9660/cd9660_rrip.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: cd9660_util.c,v 1.16 2024/05/25 06:27:57 tsutsui Exp $$NetBSD: /usr/src/sys/fs/cd9660/cd9660_util.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: cd9660_vfsops.c,v 1.105 2025/02/16 18:38:58 joe Exp $$NetBSD: /usr/src/sys/fs/cd9660/cd9660_vfsops.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: cd9660_vnops.c,v 1.63 2024/02/02 20:27:26 christos Exp $$NetBSD: /usr/src/sys/fs/cd9660/cd9660_vnops.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: msdosfs_conv.c,v 1.20 2023/06/02 08:51:47 andvar Exp $$NetBSD: /usr/src/sys/fs/msdosfs/msdosfs_conv.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: msdosfs_denode.c,v 1.60 2021/10/23 16:58:17 thorpej Exp $$NetBSD: /usr/src/sys/fs/msdosfs/msdosfs_denode.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: msdosfs_fat.c,v 1.37 2024/05/13 00:24:19 msaitoh Exp $$NetBSD: /usr/src/sys/fs/msdosfs/msdosfs_fat.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: msdosfs_lookup.c,v 1.41 2022/08/06 18:26:42 andvar Exp $$NetBSD: /usr/src/sys/fs/msdosfs/msdosfs_lookup.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: msdosfs_rename.c,v 1.4 2024/05/04 05:49:39 mlelstv Exp $$NetBSD: /usr/src/sys/fs/msdosfs/msdosfs_rename.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: msdosfs_vfsops.c,v 1.138 2022/04/16 07:58:21 hannken Exp $$NetBSD: /usr/src/sys/fs/msdosfs/msdosfs_vfsops.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: msdosfs_vnops.c,v 1.113 2024/09/11 00:27:54 perseant Exp $$NetBSD: /usr/src/sys/fs/msdosfs/msdosfs_vnops.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: krpc_subr.c,v 1.44 2024/10/20 14:01:52 mlelstv Exp $$NetBSD: /usr/src/sys/nfs/krpc_subr.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: nfs_bio.c,v 1.202 2024/02/13 21:40:02 andvar Exp $$NetBSD: /usr/src/sys/nfs/nfs_bio.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: nfs_boot.c,v 1.90 2024/07/05 04:31:54 rin Exp $$NetBSD: /usr/src/sys/nfs/nfs_boot.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: nfs_clntsocket.c,v 1.7 2024/07/05 04:31:54 rin Exp $$NetBSD: /usr/src/sys/nfs/nfs_clntsocket.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: nfs_clntsubs.c,v 1.7 2023/03/21 15:47:46 christos Exp $$NetBSD: /usr/src/sys/nfs/nfs_clntsubs.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: nfs_iod.c,v 1.9 2023/03/21 15:47:46 christos Exp $$NetBSD: /usr/src/sys/nfs/nfs_iod.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: nfs_kq.c,v 1.32 2021/10/20 03:08:18 thorpej Exp $$NetBSD: /usr/src/sys/nfs/nfs_kq.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: nfs_node.c,v 1.126 2020/05/01 08:43:00 hannken Exp $$NetBSD: /usr/src/sys/nfs/nfs_node.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: nfs_socket.c,v 1.203 2025/02/22 09:27:05 mlelstv Exp $$NetBSD: /usr/src/sys/nfs/nfs_socket.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: nfs_subs.c,v 1.242 2022/02/09 21:50:24 andvar Exp $$NetBSD: /usr/src/sys/nfs/nfs_subs.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: nfs_vfsops.c,v 1.246 2024/05/13 00:11:22 msaitoh Exp $$NetBSD: /usr/src/sys/nfs/nfs_vfsops.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: nfs_vnops.c,v 1.325 2023/12/10 18:16:08 schmonz Exp $$NetBSD: /usr/src/sys/nfs/nfs_vnops.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ffs_alloc.c,v 1.173 2024/05/13 00:24:19 msaitoh Exp $$NetBSD: /usr/src/sys/ufs/ffs/ffs_alloc.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ffs_balloc.c,v 1.66 2022/11/17 06:40:40 chs Exp $$NetBSD: /usr/src/sys/ufs/ffs/ffs_balloc.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ffs_extattr.c,v 1.10 2022/11/28 04:52:04 chs Exp $$NetBSD: /usr/src/sys/ufs/ffs/ffs_extattr.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ffs_inode.c,v 1.131 2020/07/31 04:07:30 chs Exp $$NetBSD: /usr/src/sys/ufs/ffs/ffs_inode.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ffs_snapshot.c,v 1.155 2023/05/11 23:11:25 chs Exp $$NetBSD: /usr/src/sys/ufs/ffs/ffs_snapshot.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ffs_subr.c,v 1.54 2023/01/07 19:41:30 chs Exp $$NetBSD: /usr/src/sys/ufs/ffs/ffs_subr.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ffs_tables.c,v 1.9 2005/12/11 12:25:25 christos Exp $$NetBSD: /usr/src/sys/ufs/ffs/ffs_tables.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ffs_vfsops.c,v 1.384 2024/12/30 09:03:07 hannken Exp $$NetBSD: /usr/src/sys/ufs/ffs/ffs_vfsops.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ffs_vnops.c,v 1.138 2021/12/14 11:06:12 chs Exp $$NetBSD: /usr/src/sys/ufs/ffs/ffs_vnops.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ufs_readwrite.c,v 1.129 2024/10/19 14:13:44 jakllsch Exp $$NetBSD: /usr/src/sys/ufs/ufs/ufs_readwrite.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: mfs_vfsops.c,v 1.117 2025/02/16 18:38:59 joe Exp $$NetBSD: /usr/src/sys/ufs/mfs/mfs_vfsops.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: mfs_vnops.c,v 1.64 2022/03/19 13:48:42 hannken Exp $$NetBSD: /usr/src/sys/ufs/mfs/mfs_vnops.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: mfs_miniroot.c,v 1.1 2010/03/02 17:20:02 pooka Exp $$NetBSD: /usr/src/sys/ufs/mfs/mfs_miniroot.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ufs_acl.c,v 1.5 2023/02/22 21:49:45 riastradh Exp $$NetBSD: /usr/src/sys/ufs/ufs/ufs_acl.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ufs_bmap.c,v 1.54 2022/11/17 06:40:40 chs Exp $$NetBSD: /usr/src/sys/ufs/ufs/ufs_bmap.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ufs_inode.c,v 1.112 2020/09/05 16:30:13 riastradh Exp $$NetBSD: /usr/src/sys/ufs/ufs/ufs_inode.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ufs_lookup.c,v 1.159 2024/09/08 09:36:52 rillig Exp $$NetBSD: /usr/src/sys/ufs/ufs/ufs_lookup.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ufs_rename.c,v 1.14 2021/10/20 03:08:19 thorpej Exp $$NetBSD: /usr/src/sys/ufs/ufs/ufs_rename.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ufs_vfsops.c,v 1.61 2023/02/22 21:49:45 riastradh Exp $$NetBSD: /usr/src/sys/ufs/ufs/ufs_vfsops.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ufs_vnops.c,v 1.262 2022/03/27 16:24:59 christos Exp $$NetBSD: /usr/src/sys/ufs/ufs/ufs_vnops.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uvm_amap.c,v 1.129 2023/09/10 14:54:34 ad Exp $$NetBSD: /usr/src/sys/uvm/uvm_amap.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uvm_anon.c,v 1.80 2020/10/25 00:05:26 chs Exp $$NetBSD: /usr/src/sys/uvm/uvm_anon.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uvm_aobj.c,v 1.157 2023/02/24 11:03:13 riastradh Exp $$NetBSD: /usr/src/sys/uvm/uvm_aobj.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uvm_bio.c,v 1.128 2023/04/09 09:00:56 riastradh Exp $$NetBSD: /usr/src/sys/uvm/uvm_bio.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uvm_coredump.c,v 1.8 2020/02/23 15:46:43 ad Exp $$NetBSD: /usr/src/sys/uvm/uvm_coredump.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uvm_device.c,v 1.80 2022/07/07 13:27:02 riastradh Exp $$NetBSD: /usr/src/sys/uvm/uvm_device.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uvm_fault.c,v 1.237 2024/03/15 07:09:37 andvar Exp $$NetBSD: /usr/src/sys/uvm/uvm_fault.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uvm_glue.c,v 1.182 2023/10/04 20:34:19 ad Exp $$NetBSD: /usr/src/sys/uvm/uvm_glue.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uvm_init.c,v 1.59 2023/09/23 18:21:12 ad Exp $$NetBSD: /usr/src/sys/uvm/uvm_init.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uvm_io.c,v 1.30 2024/05/03 07:09:20 skrll Exp $$NetBSD: /usr/src/sys/uvm/uvm_io.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uvm_km.c,v 1.166 2024/12/07 23:19:07 chs Exp $$NetBSD: /usr/src/sys/uvm/uvm_km.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uvm_loan.c,v 1.104 2020/06/11 22:21:05 ad Exp $$NetBSD: /usr/src/sys/uvm/uvm_loan.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uvm_map.c,v 1.426 2024/08/16 11:28:01 riastradh Exp $$NetBSD: /usr/src/sys/uvm/uvm_map.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uvm_meter.c,v 1.80 2020/06/14 21:41:42 ad Exp $$NetBSD: /usr/src/sys/uvm/uvm_meter.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uvm_mmap.c,v 1.186 2025/02/24 21:32:26 andvar Exp $$NetBSD: /usr/src/sys/uvm/uvm_mmap.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uvm_mremap.c,v 1.22 2025/02/24 21:32:26 andvar Exp $$NetBSD: /usr/src/sys/uvm/uvm_mremap.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uvm_object.c,v 1.25 2020/08/15 07:24:09 chs Exp $$NetBSD: /usr/src/sys/uvm/uvm_object.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uvm_page.c,v 1.256 2024/03/05 14:33:50 thorpej Exp $$NetBSD: /usr/src/sys/uvm/uvm_page.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uvm_page_array.c,v 1.9 2020/05/26 21:52:12 ad Exp $$NetBSD: /usr/src/sys/uvm/uvm_page_array.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uvm_page_status.c,v 1.6 2020/08/14 09:06:15 chs Exp $$NetBSD: /usr/src/sys/uvm/uvm_page_status.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uvm_pager.c,v 1.131 2024/03/15 07:09:37 andvar Exp $$NetBSD: /usr/src/sys/uvm/uvm_pager.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uvm_pdaemon.c,v 1.134 2023/09/10 15:01:11 ad Exp $$NetBSD: /usr/src/sys/uvm/uvm_pdaemon.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uvm_pdpolicy_clock.c,v 1.40 2022/04/12 20:27:56 andvar Exp $$NetBSD: /usr/src/sys/uvm/uvm_pdpolicy_clock.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uvm_pgflcache.c,v 1.6 2020/10/18 18:31:31 chs Exp $$NetBSD: /usr/src/sys/uvm/uvm_pgflcache.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uvm_pglist.c,v 1.92 2024/01/14 10:38:47 tnn Exp $$NetBSD: /usr/src/sys/uvm/uvm_pglist.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uvm_readahead.c,v 1.16 2023/09/23 18:21:12 ad Exp $$NetBSD: /usr/src/sys/uvm/uvm_readahead.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uvm_stat.c,v 1.46 2020/06/14 21:41:42 ad Exp $$NetBSD: /usr/src/sys/uvm/uvm_stat.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uvm_swap.c,v 1.209 2025/02/22 09:36:29 mlelstv Exp $$NetBSD: /usr/src/sys/uvm/uvm_swap.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uvm_unix.c,v 1.51 2022/01/10 18:04:20 christos Exp $$NetBSD: /usr/src/sys/uvm/uvm_unix.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uvm_user.c,v 1.14 2011/02/02 15:13:34 chuck Exp $$NetBSD: /usr/src/sys/uvm/uvm_user.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uvm_vnode.c,v 1.121 2024/04/05 13:05:41 riastradh Exp $$NetBSD: /usr/src/sys/uvm/uvm_vnode.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: debugsyms.c,v 1.4 2015/10/06 22:13:39 christos Exp $$NetBSD: /usr/src/sys/conf/debugsyms.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: param.c,v 1.70 2022/07/23 19:15:29 mrg Exp $$NetBSD: /usr/src/sys/conf/param.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: bufq_disksort.c,v 1.14 2017/05/04 11:03:27 kamil Exp $$NetBSD: /usr/src/sys/kern/bufq_disksort.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: bufq_fcfs.c,v 1.13 2017/05/04 11:03:27 kamil Exp $$NetBSD: /usr/src/sys/kern/bufq_fcfs.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: core_elf32.c,v 1.67 2021/01/02 02:13:42 rin Exp $$NetBSD: /usr/src/sys/kern/core_elf32.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: core_netbsd.c,v 1.24 2019/11/20 19:37:53 pgoyette Exp $$NetBSD: /usr/src/sys/kern/core_netbsd.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: cnmagic.c,v 1.14 2017/05/04 11:01:16 kamil Exp $$NetBSD: /usr/src/sys/kern/cnmagic.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: exec_elf32.c,v 1.144 2024/12/06 16:19:41 riastradh Exp $$NetBSD: /usr/src/sys/kern/exec_elf32.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: exec_elf.c,v 1.107 2024/12/06 16:19:41 riastradh Exp $$NetBSD: /usr/src/sys/kern/exec_elf.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: exec_script.c,v 1.85 2024/12/06 16:19:41 riastradh Exp $$NetBSD: /usr/src/sys/kern/exec_script.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: exec_subr.c,v 1.91 2024/12/06 16:48:13 riastradh Exp $$NetBSD: /usr/src/sys/kern/exec_subr.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: init_main.c,v 1.550 2024/12/29 07:28:38 jmmv Exp $$NetBSD: /usr/src/sys/kern/init_main.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: init_sysctl.c,v 1.228 2023/09/09 16:01:09 christos Exp $$NetBSD: /usr/src/sys/kern/init_sysctl.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: init_sysctl_base.c,v 1.9 2023/12/20 20:35:37 andvar Exp $$NetBSD: /usr/src/sys/kern/init_sysctl_base.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: init_sysent.c,v 1.346 2024/10/09 16:29:10 christos Exp $$NetBSD: /usr/src/sys/kern/init_sysent.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_acct.c,v 1.99 2021/12/05 04:35:38 msaitoh Exp $$NetBSD: /usr/src/sys/kern/kern_acct.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_auth.c,v 1.84 2023/10/04 22:17:09 ad Exp $$NetBSD: /usr/src/sys/kern/kern_auth.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_cfglock.c,v 1.1 2010/08/21 13:17:31 pgoyette Exp $$NetBSD: /usr/src/sys/kern/kern_cfglock.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_clock.c,v 1.151 2023/09/02 17:44:59 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_clock.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_condvar.c,v 1.63 2023/11/02 10:31:55 martin Exp $$NetBSD: /usr/src/sys/kern/kern_condvar.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_core.c,v 1.39 2023/10/04 22:17:09 ad Exp $$NetBSD: /usr/src/sys/kern/kern_core.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_cpu.c,v 1.98 2025/01/17 04:11:33 mrg Exp $$NetBSD: /usr/src/sys/kern/kern_cpu.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_descrip.c,v 1.265 2024/12/21 19:02:31 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_descrip.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_entropy.c,v 1.73 2025/03/11 14:30:28 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_entropy.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_event.c,v 1.150 2023/09/21 09:31:50 msaitoh Exp $$NetBSD: /usr/src/sys/kern/kern_event.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_exec.c,v 1.526 2025/03/15 12:11:09 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_exec.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_exit.c,v 1.300 2025/03/16 15:52:18 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_exit.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_fork.c,v 1.231 2024/05/14 19:00:44 andvar Exp $$NetBSD: /usr/src/sys/kern/kern_fork.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_idle.c,v 1.36 2024/03/01 04:32:38 mrg Exp $$NetBSD: /usr/src/sys/kern/kern_idle.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_hook.c,v 1.15 2024/01/17 10:18:41 hannken Exp $$NetBSD: /usr/src/sys/kern/kern_hook.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_kthread.c,v 1.49 2023/09/23 14:40:42 ad Exp $$NetBSD: /usr/src/sys/kern/kern_kthread.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_lock.c,v 1.188 2024/01/14 11:46:05 andvar Exp $$NetBSD: /usr/src/sys/kern/kern_lock.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_lwp.c,v 1.270 2025/04/11 16:04:43 andvar Exp $$NetBSD: /usr/src/sys/kern/kern_lwp.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_malloc.c,v 1.158 2019/11/14 16:23:52 maxv Exp $$NetBSD: /usr/src/sys/kern/kern_malloc.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_module.c,v 1.172 2025/04/02 22:49:24 pgoyette Exp $$NetBSD: /usr/src/sys/kern/kern_module.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_module_hook.c,v 1.4 2019/12/13 08:02:53 skrll Exp $$NetBSD: /usr/src/sys/kern/kern_module_hook.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_module_vfs.c,v 1.19 2025/03/20 13:26:54 pgoyette Exp $$NetBSD: /usr/src/sys/kern/kern_module_vfs.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_mutex.c,v 1.112 2023/10/15 10:28:23 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_mutex.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_mutex_obj.c,v 1.15 2023/10/02 21:03:55 ad Exp $$NetBSD: /usr/src/sys/kern/kern_mutex_obj.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_ntptime.c,v 1.64 2022/10/26 23:23:52 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_ntptime.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_physio.c,v 1.102 2022/07/10 23:11:55 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_physio.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_pmf.c,v 1.51 2022/08/24 11:41:39 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_pmf.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_proc.c,v 1.279 2025/03/17 19:02:49 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_proc.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_prot.c,v 1.122 2020/05/23 23:42:43 ad Exp $$NetBSD: /usr/src/sys/kern/kern_prot.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_ras.c,v 1.42 2022/08/08 22:31:45 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_ras.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_rate.c,v 1.2 2012/12/12 11:10:56 pooka Exp $$NetBSD: /usr/src/sys/kern/kern_rate.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_reboot.c,v 1.5 2024/03/05 14:15:36 thorpej Exp $$NetBSD: /usr/src/sys/kern/kern_reboot.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_resource.c,v 1.195 2023/10/04 20:28:06 ad Exp $$NetBSD: /usr/src/sys/kern/kern_resource.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_runq.c,v 1.71 2025/01/17 04:11:33 mrg Exp $$NetBSD: /usr/src/sys/kern/kern_runq.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_rwlock.c,v 1.76 2023/10/15 10:28:48 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_rwlock.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_rwlock_obj.c,v 1.13 2023/10/02 21:03:55 ad Exp $$NetBSD: /usr/src/sys/kern/kern_rwlock_obj.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_scdebug.c,v 1.2 2019/03/14 19:51:49 palle Exp $$NetBSD: /usr/src/sys/kern/kern_scdebug.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: sys_syscall.c,v 1.15 2022/06/29 16:33:09 hannken Exp $$NetBSD: /usr/src/sys/kern/sys_syscall.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_sig.c,v 1.410 2025/03/13 12:48:21 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_sig.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_sleepq.c,v 1.87 2023/11/02 10:31:55 martin Exp $$NetBSD: /usr/src/sys/kern/kern_sleepq.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_softint.c,v 1.76 2024/03/01 04:32:38 mrg Exp $$NetBSD: /usr/src/sys/kern/kern_softint.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_ssp.c,v 1.7 2016/12/06 02:55:42 christos Exp $$NetBSD: /usr/src/sys/kern/kern_ssp.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_stub.c,v 1.50 2020/08/01 02:04:55 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_stub.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_subr.c,v 1.231 2023/01/19 07:40:58 mlelstv Exp $$NetBSD: /usr/src/sys/kern/kern_subr.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_synch.c,v 1.366 2023/11/22 13:18:48 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_synch.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_syscall.c,v 1.21 2020/08/31 19:51:30 christos Exp $$NetBSD: /usr/src/sys/kern/kern_syscall.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_sysctl.c,v 1.271 2024/09/08 09:36:51 rillig Exp $$NetBSD: /usr/src/sys/kern/kern_sysctl.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_tc.c,v 1.77 2024/05/11 06:34:45 andvar Exp $$NetBSD: /usr/src/sys/kern/kern_tc.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_threadpool.c,v 1.23 2021/01/23 16:33:49 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_threadpool.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_time.c,v 1.228 2025/03/19 14:27:05 pho Exp $$NetBSD: /usr/src/sys/kern/kern_time.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_timeout.c,v 1.79 2023/10/08 13:23:05 ad Exp $$NetBSD: /usr/src/sys/kern/kern_timeout.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_turnstile.c,v 1.55 2023/10/15 10:30:20 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_turnstile.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_todr.c,v 1.47 2021/04/03 12:06:53 simonb Exp $$NetBSD: /usr/src/sys/kern/kern_todr.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_uidinfo.c,v 1.13 2021/12/28 13:28:24 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_uidinfo.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: kern_uuid.c,v 1.20 2014/10/05 10:00:03 riastradh Exp $$NetBSD: /usr/src/sys/kern/kern_uuid.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: sched_4bsd.c,v 1.47 2025/01/17 04:11:33 mrg Exp $$NetBSD: /usr/src/sys/kern/sched_4bsd.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_acl_posix1e.c,v 1.1 2020/05/16 18:31:50 christos Exp $$NetBSD: /usr/src/sys/kern/subr_acl_posix1e.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_acl_nfs4.c,v 1.2 2024/01/19 19:07:38 christos Exp $$NetBSD: /usr/src/sys/kern/subr_acl_nfs4.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_autoconf.c,v 1.314 2023/07/18 11:57:37 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_autoconf.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_blist.c,v 1.16 2024/09/08 17:28:36 rillig Exp $$NetBSD: /usr/src/sys/kern/subr_blist.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_bufq.c,v 1.27 2019/02/17 23:17:41 bad Exp $$NetBSD: /usr/src/sys/kern/subr_bufq.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_callback.c,v 1.7 2009/11/24 20:11:50 rmind Exp $$NetBSD: /usr/src/sys/kern/subr_callback.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_cprng.c,v 1.44 2023/08/05 11:21:24 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_cprng.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_cpu.c,v 1.22 2024/03/05 20:59:41 thorpej Exp $$NetBSD: /usr/src/sys/kern/subr_cpu.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_cpufreq.c,v 1.10 2023/04/09 09:18:09 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_cpufreq.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_copy.c,v 1.19 2023/05/22 14:07:24 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_copy.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_device.c,v 1.14 2024/08/27 13:44:55 thorpej Exp $$NetBSD: /usr/src/sys/kern/subr_device.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_devsw.c,v 1.53 2024/10/13 22:25:38 chs Exp $$NetBSD: /usr/src/sys/kern/subr_devsw.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_disk.c,v 1.137 2023/05/09 12:04:04 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_disk.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_disklabel.c,v 1.3 2019/04/07 02:58:02 rin Exp $$NetBSD: /usr/src/sys/kern/subr_disklabel.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_disk_open.c,v 1.15 2020/02/29 14:44:44 mlelstv Exp $$NetBSD: /usr/src/sys/kern/subr_disk_open.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_emul.c,v 1.2 2019/01/27 02:08:43 pgoyette Exp $$NetBSD: /usr/src/sys/kern/subr_emul.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_evcnt.c,v 1.17 2021/04/17 00:05:31 mrg Exp $$NetBSD: /usr/src/sys/kern/subr_evcnt.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_exec_fd.c,v 1.12 2021/06/29 22:40:53 dholland Exp $$NetBSD: /usr/src/sys/kern/subr_exec_fd.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_extent.c,v 1.89 2019/08/15 09:04:22 skrll Exp $$NetBSD: /usr/src/sys/kern/subr_extent.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_hash.c,v 1.12 2021/06/13 14:58:49 simonb Exp $$NetBSD: /usr/src/sys/kern/subr_hash.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_humanize.c,v 1.2 2019/03/12 00:25:44 kre Exp $$NetBSD: /usr/src/sys/kern/subr_humanize.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_interrupt.c,v 1.5 2021/12/10 20:36:04 andvar Exp $$NetBSD: /usr/src/sys/kern/subr_interrupt.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_iostat.c,v 1.26 2024/05/04 13:33:18 mlelstv Exp $$NetBSD: /usr/src/sys/kern/subr_iostat.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_ipi.c,v 1.11 2023/02/24 11:02:27 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_ipi.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_kcpuset.c,v 1.20 2023/09/23 18:21:11 ad Exp $$NetBSD: /usr/src/sys/kern/subr_kcpuset.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_kmem.c,v 1.89 2023/09/10 14:29:13 ad Exp $$NetBSD: /usr/src/sys/kern/subr_kmem.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_kobj.c,v 1.78 2023/04/28 07:33:57 skrll Exp $$NetBSD: /usr/src/sys/kern/subr_kobj.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_localcount.c,v 1.8 2024/08/16 21:54:17 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_localcount.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_lockdebug.c,v 1.83 2022/09/02 06:01:38 nakayama Exp $$NetBSD: /usr/src/sys/kern/subr_lockdebug.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_log.c,v 1.66 2025/04/09 05:38:01 rin Exp $$NetBSD: /usr/src/sys/kern/subr_log.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_lwp_specificdata.c,v 1.5 2024/09/01 19:56:18 andvar Exp $$NetBSD: /usr/src/sys/kern/subr_lwp_specificdata.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_once.c,v 1.7 2019/03/19 08:16:51 ryo Exp $$NetBSD: /usr/src/sys/kern/subr_once.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_optstr.c,v 1.8 2023/04/20 09:04:45 skrll Exp $$NetBSD: /usr/src/sys/kern/subr_optstr.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_pcq.c,v 1.20 2023/02/24 11:02:27 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_pcq.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_pcu.c,v 1.28 2023/04/09 09:18:09 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_pcu.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_percpu.c,v 1.25 2020/05/11 21:37:31 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_percpu.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_pool.c,v 1.292 2024/12/07 23:23:25 chs Exp $$NetBSD: /usr/src/sys/kern/subr_pool.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_prf.c,v 1.203 2023/08/29 21:23:14 andvar Exp $$NetBSD: /usr/src/sys/kern/subr_prf.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_prof.c,v 1.50 2021/08/14 17:51:20 ryo Exp $$NetBSD: /usr/src/sys/kern/subr_prof.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_pserialize.c,v 1.24 2023/10/04 20:28:06 ad Exp $$NetBSD: /usr/src/sys/kern/subr_pserialize.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_psref.c,v 1.18 2022/02/12 16:31:06 macallan Exp $$NetBSD: /usr/src/sys/kern/subr_psref.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_specificdata.c,v 1.14 2017/06/01 02:45:13 chs Exp $$NetBSD: /usr/src/sys/kern/subr_specificdata.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_time.c,v 1.41 2024/12/22 23:24:20 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_time.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_time_arith.c,v 1.3 2025/04/01 23:14:23 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_time_arith.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_thmap.c,v 1.15 2023/10/17 11:57:20 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_thmap.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_vmem.c,v 1.118 2024/12/06 19:17:59 riastradh Exp $$NetBSD: /usr/src/sys/kern/subr_vmem.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_workqueue.c,v 1.48 2024/03/01 04:32:38 mrg Exp $$NetBSD: /usr/src/sys/kern/subr_workqueue.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: subr_xcall.c,v 1.39 2025/04/01 03:16:41 ozaki-r Exp $$NetBSD: /usr/src/sys/kern/subr_xcall.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: sys_aio.c,v 1.50 2024/12/07 02:38:51 riastradh Exp $$NetBSD: /usr/src/sys/kern/sys_aio.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: sys_descrip.c,v 1.51 2024/05/20 09:37:34 martin Exp $$NetBSD: /usr/src/sys/kern/sys_descrip.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: sys_epoll.c,v 1.4 2023/07/30 18:31:13 christos Exp $$NetBSD: /usr/src/sys/kern/sys_epoll.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: sys_eventfd.c,v 1.11 2023/11/19 17:16:00 riastradh Exp $$NetBSD: /usr/src/sys/kern/sys_eventfd.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: sys_futex.c,v 1.26 2025/03/05 14:01:55 riastradh Exp $$NetBSD: /usr/src/sys/kern/sys_futex.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: sys_generic.c,v 1.134 2022/07/10 23:12:12 riastradh Exp $$NetBSD: /usr/src/sys/kern/sys_generic.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: sys_getrandom.c,v 1.2 2021/12/28 13:22:43 riastradh Exp $$NetBSD: /usr/src/sys/kern/sys_getrandom.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: sys_memfd.c,v 1.11 2023/08/12 23:22:49 christos Exp $$NetBSD: /usr/src/sys/kern/sys_memfd.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: sys_module.c,v 1.30 2022/05/24 06:20:05 andvar Exp $$NetBSD: /usr/src/sys/kern/sys_module.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: sys_mqueue.c,v 1.49 2024/07/01 01:35:53 christos Exp $$NetBSD: /usr/src/sys/kern/sys_mqueue.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: sys_lwp.c,v 1.89 2023/10/15 10:29:24 riastradh Exp $$NetBSD: /usr/src/sys/kern/sys_lwp.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: sys_process.c,v 1.180 2020/05/26 00:50:53 kamil Exp $$NetBSD: /usr/src/sys/kern/sys_process.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: sys_process_lwpstatus.c,v 1.5 2025/01/11 19:42:04 christos Exp $$NetBSD: /usr/src/sys/kern/sys_process_lwpstatus.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: sys_pset.c,v 1.24 2020/05/23 23:42:43 ad Exp $$NetBSD: /usr/src/sys/kern/sys_pset.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: sys_select.c,v 1.68 2024/11/26 23:10:15 khorben Exp $$NetBSD: /usr/src/sys/kern/sys_select.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: sys_sig.c,v 1.58 2024/07/14 05:10:40 kre Exp $$NetBSD: /usr/src/sys/kern/sys_sig.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: sys_sched.c,v 1.50 2023/04/09 09:18:09 riastradh Exp $$NetBSD: /usr/src/sys/kern/sys_sched.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: sys_socket.c,v 1.84 2024/12/06 18:44:00 riastradh Exp $$NetBSD: /usr/src/sys/kern/sys_socket.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: sys_timerfd.c,v 1.11 2024/12/19 23:50:22 riastradh Exp $$NetBSD: /usr/src/sys/kern/sys_timerfd.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: tty.c,v 1.313 2024/07/14 05:10:40 kre Exp $$NetBSD: /usr/src/sys/kern/tty.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: tty_conf.c,v 1.57 2021/08/09 20:49:10 andvar Exp $$NetBSD: /usr/src/sys/kern/tty_conf.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: tty_bsdpty.c,v 1.20 2014/04/04 18:11:58 christos Exp $$NetBSD: /usr/src/sys/kern/tty_bsdpty.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: tty_pty.c,v 1.149 2021/10/11 01:07:36 thorpej Exp $$NetBSD: /usr/src/sys/kern/tty_pty.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: tty_ptm.c,v 1.46 2023/04/09 09:18:09 riastradh Exp $$NetBSD: /usr/src/sys/kern/tty_ptm.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: tty_subr.c,v 1.43 2019/12/27 09:41:51 msaitoh Exp $$NetBSD: /usr/src/sys/kern/tty_subr.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: tty_tty.c,v 1.41 2020/05/23 23:42:43 ad Exp $$NetBSD: /usr/src/sys/kern/tty_tty.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uipc_accf.c,v 1.16 2024/12/06 18:44:00 riastradh Exp $$NetBSD: /usr/src/sys/kern/uipc_accf.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uipc_domain.c,v 1.112 2024/12/07 02:31:14 riastradh Exp $$NetBSD: /usr/src/sys/kern/uipc_domain.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uipc_mbuf.c,v 1.255 2024/12/15 11:07:10 skrll Exp $$NetBSD: /usr/src/sys/kern/uipc_mbuf.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: link_proto.c,v 1.40 2021/12/31 14:25:24 riastradh Exp $$NetBSD: /usr/src/sys/net/link_proto.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uipc_proto.c,v 1.24 2024/12/06 18:36:31 riastradh Exp $$NetBSD: /usr/src/sys/kern/uipc_proto.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uipc_sem.c,v 1.62 2024/12/06 18:44:00 riastradh Exp $$NetBSD: /usr/src/sys/kern/uipc_sem.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uipc_socket.c,v 1.313 2024/12/06 18:44:00 riastradh Exp $$NetBSD: /usr/src/sys/kern/uipc_socket.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uipc_socket2.c,v 1.147 2024/12/07 02:31:14 riastradh Exp $$NetBSD: /usr/src/sys/kern/uipc_socket2.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uipc_syscalls.c,v 1.214 2024/12/06 18:44:00 riastradh Exp $$NetBSD: /usr/src/sys/kern/uipc_syscalls.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: uipc_usrreq.c,v 1.208 2025/03/27 11:00:50 riastradh Exp $$NetBSD: /usr/src/sys/kern/uipc_usrreq.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: vfs_acl.c,v 1.3 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_acl.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: vfs_bio.c,v 1.306 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_bio.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: vfs_cache.c,v 1.159 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_cache.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: vfs_cwd.c,v 1.12 2024/12/07 02:11:42 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_cwd.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: vfs_dirhash.c,v 1.16 2024/12/07 02:11:42 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_dirhash.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: vfs_getcwd.c,v 1.63 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_getcwd.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: vfs_hooks.c,v 1.9 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_hooks.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: vfs_init.c,v 1.67 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_init.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: vfs_lockf.c,v 1.83 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_lockf.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: vfs_lookup.c,v 1.238 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_lookup.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: vfs_mount.c,v 1.110 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_mount.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: vfs_quotactl.c,v 1.40 2014/06/28 22:27:50 dholland Exp $$$NetBSD: /usr/src/sys/kern/vfs_quotactl.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: vfs_subr.c,v 1.502 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_subr.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: vfs_syscalls.c,v 1.570 2024/12/07 02:23:09 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_syscalls.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: vfs_trans.c,v 1.73 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_trans.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: vfs_vnode.c,v 1.156 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_vnode.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: vfs_vnops.c,v 1.244 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_vnops.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: vfs_xattr.c,v 1.41 2024/12/07 02:27:38 riastradh Exp $$NetBSD: /usr/src/sys/kern/vfs_xattr.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: vnode_if.c,v 1.119 2023/06/15 09:15:13 hannken Exp $$NetBSD: /usr/src/sys/kern/vnode_if.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: dead_vfsops.c,v 1.13 2022/10/26 23:39:43 riastradh Exp $$NetBSD: /usr/src/sys/miscfs/deadfs/dead_vfsops.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: dead_vnops.c,v 1.67 2022/10/26 23:39:43 riastradh Exp $$NetBSD: /usr/src/sys/miscfs/deadfs/dead_vnops.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: fifo_vnops.c,v 1.91 2021/10/11 01:07:36 thorpej Exp $$NetBSD: /usr/src/sys/miscfs/fifofs/fifo_vnops.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: genfs_io.c,v 1.104 2024/04/05 13:05:40 riastradh Exp $$NetBSD: /usr/src/sys/miscfs/genfs/genfs_io.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: genfs_rename.c,v 1.7 2021/10/20 13:29:06 thorpej Exp $$NetBSD: /usr/src/sys/miscfs/genfs/genfs_rename.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: genfs_vfsops.c,v 1.11 2022/07/08 07:42:06 hannken Exp $$NetBSD: /usr/src/sys/miscfs/genfs/genfs_vfsops.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: genfs_vnops.c,v 1.220 2023/03/03 10:02:51 hannken Exp $$NetBSD: /usr/src/sys/miscfs/genfs/genfs_vnops.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: layer_subr.c,v 1.39 2022/04/10 09:50:46 andvar Exp $$NetBSD: /usr/src/sys/miscfs/genfs/layer_subr.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: layer_vfsops.c,v 1.56 2022/12/09 10:33:18 hannken Exp $$NetBSD: /usr/src/sys/miscfs/genfs/layer_vfsops.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: layer_vnops.c,v 1.72 2021/10/20 03:08:18 thorpej Exp $$NetBSD: /usr/src/sys/miscfs/genfs/layer_vnops.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: spec_vnops.c,v 1.219 2025/01/06 09:45:49 mlelstv Exp $$NetBSD: /usr/src/sys/miscfs/specfs/spec_vnops.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: clock_subr.c,v 1.27 2016/08/15 15:51:39 jakllsch Exp $$NetBSD: /usr/src/sys/dev/clock_subr.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: dksubr.c,v 1.118 2025/02/18 17:09:34 mlelstv Exp $$NetBSD: /usr/src/sys/dev/dksubr.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: dk.c,v 1.172 2025/03/05 20:24:03 jakllsch Exp $$NetBSD: /usr/src/sys/dev/dkwedge/dk.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: dkwedge_apple.c,v 1.6 2020/04/11 16:00:34 jdolecek Exp $$NetBSD: /usr/src/sys/dev/dkwedge/dkwedge_apple.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: dkwedge_gpt.c,v 1.26 2020/04/11 16:00:34 jdolecek Exp $$NetBSD: /usr/src/sys/dev/dkwedge/dkwedge_gpt.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: md.c,v 1.87 2023/01/13 15:46:40 hannken Exp $$NetBSD: /usr/src/sys/dev/md.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: mm.c,v 1.25 2024/08/25 11:29:38 uwe Exp $$NetBSD: /usr/src/sys/dev/mm.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: random.c,v 1.12 2024/08/27 00:56:47 riastradh Exp $$NetBSD: /usr/src/sys/dev/random.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: bpf.c,v 1.258 2024/10/20 14:03:51 mlelstv Exp $$NetBSD: /usr/src/sys/net/bpf.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: bpf_filter.c,v 1.73 2024/09/02 15:34:08 christos Exp $$NetBSD: /usr/src/sys/net/bpf_filter.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: bpf_stub.c,v 1.8 2018/06/25 03:22:14 msaitoh Exp $$NetBSD: /usr/src/sys/net/bpf_stub.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: dl_print.c,v 1.8 2021/05/27 13:40:38 christos Exp $$NetBSD: /usr/src/sys/net/dl_print.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: if.c,v 1.531 2024/12/16 05:18:37 ozaki-r Exp $$NetBSD: /usr/src/sys/net/if.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: if_ethersubr.c,v 1.329 2024/09/28 09:03:13 mlelstv Exp $$NetBSD: /usr/src/sys/net/if_ethersubr.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: if_loop.c,v 1.118 2022/09/04 23:34:51 thorpej Exp $$NetBSD: /usr/src/sys/net/if_loop.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: if_media.c,v 1.54 2022/09/03 02:47:59 thorpej Exp $$NetBSD: /usr/src/sys/net/if_media.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: if_stats.c,v 1.5 2024/06/29 02:18:35 riastradh Exp $$NetBSD: /usr/src/sys/net/if_stats.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: nd.c,v 1.7 2024/05/30 23:00:39 riastradh Exp $$NetBSD: /usr/src/sys/net/nd.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: pfil.c,v 1.42 2022/08/16 04:35:57 knakahara Exp $$NetBSD: /usr/src/sys/net/pfil.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: pktqueue.c,v 1.22 2023/05/28 08:09:34 andvar Exp $$NetBSD: /usr/src/sys/net/pktqueue.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: net_stats.c,v 1.6 2020/02/07 12:35:33 thorpej Exp $$NetBSD: /usr/src/sys/net/net_stats.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: radix.c,v 1.49 2020/10/18 13:07:31 gson Exp $$NetBSD: /usr/src/sys/net/radix.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: raw_cb.c,v 1.24 2017/09/25 01:56:22 ozaki-r Exp $$NetBSD: /usr/src/sys/net/raw_cb.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: raw_usrreq.c,v 1.66 2024/07/05 04:31:53 rin Exp $$NetBSD: /usr/src/sys/net/raw_usrreq.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: route.c,v 1.237 2023/06/05 03:51:45 ozaki-r Exp $$NetBSD: /usr/src/sys/net/route.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: rss_config.c,v 1.3 2021/09/24 04:11:02 knakahara Exp $$NetBSD: /usr/src/sys/net/rss_config.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: rtbl.c,v 1.7 2017/06/01 02:45:14 chs Exp $$NetBSD: /usr/src/sys/net/rtbl.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: rtsock.c,v 1.256 2022/08/27 08:36:41 skrll Exp $$NetBSD: /usr/src/sys/net/rtsock.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: rtsock_shared.c,v 1.23 2022/10/04 07:06:31 msaitoh Exp $$NetBSD: /usr/src/sys/net/rtsock_shared.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: if_arp.c,v 1.317 2024/11/13 09:25:52 roy Exp $$NetBSD: /usr/src/sys/netinet/if_arp.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: in4_cksum.c,v 1.20 2014/11/30 18:15:41 christos Exp $$NetBSD: /usr/src/sys/netinet/in4_cksum.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: in_cksum.c,v 1.22 2008/01/25 21:12:15 joerg Exp $$NetBSD: /usr/src/sys/netinet/in_cksum.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: ip_encap.c,v 1.78 2025/02/26 04:49:45 andvar Exp $$NetBSD: /usr/src/sys/netinet/ip_encap.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: gpiolib.c,v 1.1 2024/12/17 12:44:33 martin Exp $$NetBSD: /usr/src/sys/dev/gpio/gpiolib.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: secmodel_suser.c,v 1.58 2024/03/01 22:01:03 andvar Exp $$NetBSD: /usr/src/sys/secmodel/suser/secmodel_suser.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: secmodel_securelevel.c,v 1.37 2020/12/05 17:33:53 thorpej Exp $$NetBSD: /usr/src/sys/secmodel/securelevel/secmodel_securelevel.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: secmodel_extensions.c,v 1.16 2023/04/22 13:54:19 riastradh Exp $$NetBSD: /usr/src/sys/secmodel/extensions/secmodel_extensions.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: secmodel_extensions_vfs.c,v 1.1 2023/04/22 13:54:19 riastradh Exp $$NetBSD: /usr/src/sys/secmodel/extensions/secmodel_extensions_vfs.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: secmodel_bsd44.c,v 1.17 2020/03/16 21:20:12 pgoyette Exp $$NetBSD: /usr/src/sys/secmodel/bsd44/secmodel_bsd44.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: dkcksum.c,v 1.1 2021/05/17 08:50:36 mrg Exp $$NetBSD: /usr/src/sys/lib/libkern/dkcksum.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: entpool.c,v 1.1 2020/04/30 03:28:19 riastradh Exp $$NetBSD: /usr/src/sys/lib/libkern/entpool.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: hexdump.c,v 1.4 2017/12/09 00:51:52 christos Exp $$NetBSD: /usr/src/sys/lib/libkern/hexdump.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: radixtree.c,v 1.34 2024/05/04 17:58:24 chs Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/gen/radixtree.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: xlat_mbr_fstype.c,v 1.10 2025/03/02 22:04:07 jakllsch Exp $$NetBSD: /usr/src/sys/lib/libkern/xlat_mbr_fstype.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: strcpy_arm.S,v 1.7 2024/02/08 20:51:24 andvar Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/arch/arm/string/strcpy_arm.S D2025.04.12.20.50.00-20250331113646 $$NetBSD: popcount32.c,v 1.5 2015/05/29 19:39:41 matt Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/string/popcount32.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: strrchr_arm.S,v 1.6 2013/08/25 06:15:06 matt Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/arch/arm/string/strrchr_arm.S D2025.04.12.20.50.00-20250331113646 $$NetBSD: strlcat_arm.S,v 1.6 2014/05/06 16:02:11 joerg Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/arch/arm/string/strlcat_arm.S D2025.04.12.20.50.00-20250331113646 $$NetBSD: murmurhash.c,v 1.8 2019/08/20 15:17:02 para Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/hash/murmurhash/murmurhash.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: sha2.c,v 1.26 2024/01/20 14:55:02 christos Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/hash/sha2/sha2.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: sha1.c,v 1.7 2021/10/28 15:09:08 christos Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/hash/sha1/sha1.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: getfstypename.c,v 1.11 2021/07/22 13:54:38 skrll Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libutil/getfstypename.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: proc_compare.c,v 1.3 2020/01/06 13:21:18 skrll Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libutil/proc_compare.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: snprintb.c,v 1.49 2024/06/16 19:41:39 rillig Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libutil/snprintb.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: strlen_arm.S,v 1.11 2023/01/15 08:43:03 skrll Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/arch/arm/string/strlen_arm.S D2025.04.12.20.50.00-20250331113646 $$NetBSD: keccak.c,v 1.1 2017/11/30 05:47:24 riastradh Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/hash/sha3/keccak.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: strncmp.S,v 1.2 2013/08/19 00:57:25 matt Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/arch/arm/string/strncmp.S D2025.04.12.20.50.00-20250331113646 $$NetBSD: rb.c,v 1.16 2021/09/16 21:29:41 andvar Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/gen/rb.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: strtoull.c,v 1.6 2013/04/16 21:44:06 joerg Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/stdlib/strtoull.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: strtoll.c,v 1.7 2013/04/16 21:44:06 joerg Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/stdlib/strtoll.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: strtoul.c,v 1.3 2008/08/20 19:58:34 oster Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/stdlib/strtoul.c D2025.04.12.20.50.00-20250331113646 $$NetBSD: strchr_arm.S,v 1.8 2013/08/19 17:50:04 matt Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/arch/arm/string/strchr_arm.S D2025.04.12.20.50.00-20250331113646 $$NetBSD: strcmp.S,v 1.2 2013/08/19 00:56:12 matt Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/arch/arm/string/strcmp.S D2025.04.12.20.50.00-20250331113646 $$NetBSD: memcmp.S,v 1.5 2015/03/26 13:34:51 justin Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/arch/arm/string/memcmp.S D2025.04.12.20.50.00-20250331113646 $$NetBSD: __aeabi_idiv0.c,v 1.3 2014/01/29 22:29:43 joerg Exp $$NetBSD: /usr/src/sys/lib/libkern/../../../common/lib/libc/arch/arm/gen/__aeabi_idiv0.c D2025.04.12.20.50.00-20250331113646 $GCC: (NetBSD nb1 20240630) 12.4.0/@x}y\UoWjګ:v2>HdP a1A "b lȒ.UF1$Fq萠@"3ô3h`>n{ι#8__˹H!ğMb*eW._{!K'- qOW˟/寨_Rۚ_.PݞC}!*ZST{j===E[\M'3R8&EbzN-}B`7Å'3+ĚZ&%5/DKY\^/THo9ܿ?Y| {=y1ߡW _)Dk'QY;Pm3ky~iϬ?S??~Yzc<eGxI5Fk$: x%vN}%^ʈ]?+w{+ȼ?ۚi)h\TmĐTf ?IEb!,8AC<]_ж=*_7Ysa}{oڟzYm#58>XY^m=P]kkyzJ=IUyw!&Z Pc q_nwh3eQs[; kpt7C܎EbKHG;|HJ ]S~6 Nתk77;Kiuüc2Yq;Xz?WR?_/RSiw X·>ʄru=8)'ԭޏPdqZW3 K٧7kۃvXxI%O j㶤XWP][]KjwNq+{gGϽ8۽T gl?Jd/\N;s[74\ŷ_7(RmWoPy* 1(p@<)r FQiYߍDaW5#'9jnlzp9CCzZwIP?gZ=AR}-1.e?ܙJn}j "=~]v|g= Bk-B<'>5ϮEc)OsüIrTOܖylZBkRf{ERȀ`uߩj"{jՇOyp0tD|pzo+U|Ӈ!<{td0Pp*A_}{C}/_`}ߍD;6Xw> Sj|}◪CZN)uEG=8d Rڜ׃doR󍶇ҽݧq6`lNS3w>7g&ަ&jU>JL.W{S7x-q[ϔ"qvPq|Ac7p ~n \{} woY%sw8= }K֗" m6@Q[#oW0$|jR4 l4W^[LQo@{c.nB҈}-mð4x]1jv}UqdyH Lc9)˞hmQ368a]见=0ٞ./Ai@C+1S+JzKQeA J{eޣKsVTIgծP[.UGcHo]<BuÏDz){;8+4ghf ųxԸB=IQKsJBfICZ7Wj``CF̥Wr7+|nZi!Rf% [q5/6'w|Y iGbJQW{jG^[^w=DUϮkO9 hGu}mu]=sf0.-'몯Z8h}k'sBc}xgjˇh[bdvjyHjiC2<ppwtG}JtXjߣzPi,g_K<#=:qLB=Q(mvC Ԟf5g(gqVѵY\9"e93"p \5AސIы Qۙ< p}XʪO}zbπz~P$D\B rS+#%18-q<V -1LP "ۘ:3 Vר=m?ILEDX+5@̼_]K[k8 jÕεSXub^,#}7Y87}e-DWMUIxcj_ORy߽~P*͏"mryZI{;] {SZK{Wc@г|"b򓥋Ϟ}oO>Aep^|Ejqd~=I4c3ۦT_1yEԞU/Lq Ξ%S4sW5Z :mf\@y2W{ŞQ(yfT>E$ګ8KsΈޖV}Ku<"ԠΟ1\xEݼ-a4yL}'QAʘ3Az]dFC}=7 8h NrJY Eq+h,.woѳcqIDӯL 9uk.^Zuu]W'*!kA~i//{'OnaPE}A$l @3xSolyО89؊u7a.\K?I \aG$$;1&Ǻ&9S T31 <e^v'g_I>J p&=_.Ki{>)teKAxJ!,w{uT5xI|7ܶuWo}Չo+amlxz1~4צ? I|lG'64ky7mdZbQqqі'(mklݢ)&kXc_%J}K<*nXT{Ȫ|#zz?XXbq:"jߤdWXBgIݞ?mo477_?IyO:Tk5ZPI ~IeB$2z|C/3,5fGU#~T&:O_9W*򿔓#x>e;c˧?7PI م$۷L}|=@B0ueZKH&ړe:-S-vx7#k+ʝ6>V$3(&mSRɬ,/זXTmM~SM 4DPSw%SP2Q® vXMeg[廜MUFa}D7C߷BG:_d[޾7zOs@Ҫйg)Mf/zzmuϺ饩90`iH3.f*:`MTieMΰ8K3S6r!d3.hs3~w[eg%Zҕq6XsG[lَL0ehdPil4WvZ՛k5WH.z SҚg/k48^iiLBG[$6!)뙰B>v`woS O UnjL$fijeS= s*Q^1S"(Eu͘~FVI5#zn,PK8x0#ONQpϭXѴuҫY-=WjWiۮJI۴_)6noꊃO֓>yr/x|R; !i1kʾJBW]Bn,aڻx⏰b62(=cjaQZL3a543p}e^)d@g#Jk޶ bIM#=ʎPp[)knjUh>6{Q%#~uih=ZCrU ;u 6slOsM8< jڧ좟C9,Zm~ !RQ$[ g$Mqq|]*!-%:_57z(CV#ī|tg^eTVύ7ɑ2H4W(}/ 1 BQ$kiƚhK_~/g\_Bk lq.#QM߇/C$YfpH}ߍ~Ϧ5C@w U~:^Tã1Eւ[:^ƃ#ڰ kDÜ yx&v{CuD1=jҞʰ 4eVۯi/nEʖ6.UݯhF<o݊ir9PaUߣ4O9{ fDXFboHtFwx]$~}E2'#_듳tK3,Z$yաX"p4TK1I> $Mj_%fƷi>υE #>_LbkxpBh_(A0?iG9t@+'BQUo$m g陾ox7^zxt7,cS#Iﵵn ,/s N(zCY("6y+l6|Ħx lh$ޗ{Ojm4i\l{p4e}ANOaI mszs}yRVxDm^{z}:5|Z*qz FI#9@',5hsTh\ˉțKɢ&fZa2bR'Ѯ<eRj߫8Hr4GSa|#zU1 ~㘰= W3 s P9^k|!ֆ}R/{Pޜ:cj4i;~9uv ~(9ɏL9Lz^a# #W?U-"?~Jg&1אo]iLKP 0&zH[+|ztBr]t-K\d'i8$hCz }ܿmgw4~аёכ!?@b8UzĪ-vIz%ZW|I0oz|z˷ޚzj-4/k|gOjEIļ 쭇&SysY+)"2% crɼSWA99aRoHRi f@!X p>iN~ #{;}zH._Yg,iHse*ۡE5|od5G?Cۻcjl4$ɨC!z%G4c!i݊h' G =m<>c "oMQF~U:y+NIqqH&+\~U42ZPx74G,;$z 6F2Sb7nFYanP f[` rs5(z׮`C7#Y*r(& 8"fk2:Jaͺ}#Kb!_[۾C6vzPWgCpij!$x;؁67”ތL (oԵqm $u'gԨ`]O1nc+P]e[hpGTFKpm؏%:hI %?I0I"8*qOo׸-Tt~ބNL"LJ>,X!k-JrHGFWc\6!cr. XZ>R:8I!Vt,޿(=}U_E ~/v %R3yCf9| C0'z 6=|Tu Dz <5,]P:JQi es~H|BX 4؎i9Cx2'3x7oP|=-z Nt^2."~k"tCzDQe'縫hɸN&vZb2BPm ;f6 l}kvAiVIl[$V}m L43ζ{5iJJNĒ=; rN߶{aG-o7n# FE:ýĺӭ_FBc$w#ڎ\)j8E)[6єQЇ1/6)f1?41)@Zcw*sus@ڻ9ҹr|<39*؎k|ҋ<`~_.Nֶ9v9py*bJ_n3ӎ^m9⥙+s[1P?n:GLL1Q4q'؛–sۿJJ:{m,G嶄艗4w=N$vccA/XqD7 ?{gנgUb g9 Fi8UF 1jkJx60Fa`؞F  =K\ȰCq41u ВZKϏrqjްs w&Iy7\3b_U+Jsءh-_Tst;231tZYm*oIMp&w54擧[2 EK2& d̡~eXW?TsyF9g)Q7X!ȿv 3WmW;} V%K=g{~#s;/Y˾܎1-&JǷīP<Eߪ+ A!O"Zgg} =A5a[)Vh]ɧUB%C @aQE(yX%m/+ޕϡf=_1׳l[Jfґţ.>}|œI%<L`(c6jlYW*R-E (m;2f(b$=;=}:p k՛7\7OU7?lW*$ g/EVtM8VIt"BNo0^Wj_,E-S+||$'p"kB2X5f0;+/yz]QRdZZTnb9.az4ܝ\%{XA!$!0=E2{R'^WWÝ2I>uu/;@.}&9C`ʪ@>X3n6@OXѝݜƳ:^%"9ĜZ; ^ PS24Fd(BY'8zqKIE)FU+u@x:qJ Xe[V\<aƄQ~09ί.D~s[dPO,g'H]SfSr$k;oqg ([1K2*g ( {(z\x4n6u1gXWIYÕOY(b6ta".~#*v8&EzvZ&j_S}93ߧUȍcec[3 N(DץDsL4F(]TbpxWutBmJ }%M2Nri^ iv<أ?` %Ťd?cViA 62Ҝ)ezj !;918h2GMb?8wJ.kdêiw%RRRNx| !!owr/vD:fI6y K/0E YY(ۻNjxRP3d6Zah_9-pKpD^I+.=+Ltɾc==RZGQLAt 姇qvt$N#+ -OW$՝C6B00jc_ߥsr>zCUuC+J2/PN.[}AnZH)4H2I`K,~eX5O^_5Xcm^9XКg|StRq#/"*yn 318W E^; "8Sh5gAM4bv8LgҢ_&:,z^[zV]m~XT,qpNќ![{aH?NeEqƩ,^$)]Zvײ_AagZkD>?;{* ?9~ ?tD"AoԈ.tmzLׂ^5Oz<+"L"&+|({W Fͧ 3b>ϩ0vAs"' 9b Rp8%xKgDg? Pm}J9Ҵ8h+`0ԣxa02XqKk%2O,]z}(LްAU*QT֪4q4}X5;V_fiCnːEicݪ28I[u-; ZcZ9ղ1eɫ j]"ޗ,ߍZgiuAMvj[K^UHcy4w d٩-{ĸ%Hiz"q]jMߨd^{U(5jR~\ZEm3D`LgA w5A9%|-8PnPl &@{aM@smF:psRe@['A, .Djn⥞`85'zyКH᫽EeV[l]QTW5`V*SC#*[t蜒i}Qgi͹/QBG{ -'^#H")jIxִ8B[]WoveDڼMZ(Ww^ӎ&l,R0 ;`'9K:\mrl^zءtEڲ$Owg:k{'wpFRƶ[ŐGΤ5b _`3yڮǖdTRcdFnˠ?L>%%&” ytxB/Ve.D&rU[` <{X!=z^sb's5e"~[~F!ˀm`,xZW<ly M9S%YbPsU7 wG4](އek<+Wq'cy-s&DNEfَm{ x)1or,+iA6^X/:M'W8=H|ɾ7<%fAkp1.Bp hEΏ`t*EsZ^ QIb<XQ4O"Q/i J liڣѶM}5VTR^^M$f`/\,a{j@1o-Tx!eekwQhᐁ|KEMZ6y`(0 >Y%0IH ɸPک(odzeN2yDމXFA߻VߧG!ER=7 XޓQ@L+خewHcamΐi-d` (Z*vJ`[![ uv(JNѴ^I\?wJ;к@ٞ`!qG4BB+s<ڇcv«5_ڳ~89>i_f&b&o{H3-_-q7F`"/'#x|VlLفۯ`2K`.}Ź~sh:ub~vx݂5}JS~ +Eo=z "N7 )t`2bҶt8aN)@D{[}y D -"=vLmf)*ebZ 9D.ET8.yrl1L"M-FRǜ4,S}EUk^c):As"iQ4x%N!P_8py4Ěbĵr/v,xk32VK;h&LGgTH0s-攅E3"׉8}WӉB IAdǖ$'&="E:nn՗K\e Hd4!+8!)6FYv#BI:{G\5# HgbmVoJ[9=}{j@dh~2TzpcX*MΠe%A4Ypa6d'9ɹP~ZW,kh V__CL?􀣭%WhG> }ٯBlS61tuH9I/5ݽE@'6Y=+ pD]c %:n%N(8&Ը aAp :sXrƛ-au ㅘ#*uarVDƱ>ywn%83*y4Z={@cž-ByLYk5 KzKFT΄baz9mBpj$fr~ rR K6yqѯ{`u4f&m{ Lw\d`CnF ,8FjXvM4áJ s5|RgduVDhѼ9[44 WiWhNc!=<DzQ !&ES=G.y+)m^KZQVT/I¦ozmj?prJmKeqv`DcQ͊#ۅ`^ƀ#sSvE.+Gdm,C}GbbD=g[%wSZ͖k6&?ѤX(eΠI>Al"wsktN.g u>Bcd8G[2yk#tcc#=Jkts5^ì P{jYvfM2jH dX(M|6iU`Zfd7e]59M~3`!Qum՜SGAscfȮ.m%GKk%cƺ}S}J5! e ?T1o" mCV0PH>Y~/,{vֳkJtװOvO Fiob<8 NV|-ZHb{:0j ,;Qx9{"dgX3*^/g5N;4F5SVv8ҖZhj &ly>y=![G;fxRm[HX'|9Ucz7aN<Lj7ň~Yxx=sf o[塊Z|!Րb~($HY^qƋEa@퐶||1R4UQe(ĭĀ{"p&+Yo_@b]ں-G6Qz_ _wJXYߒy+-QEYI/KYя+EiaNOz&Q+Ɗ|H;܀$2"xs_gy qdJ9j=N:z"gmN3:Ob}Or{'ƛ-!źo{T}_X +j锜Ym`(a|2ёv]}i*ˤ<37nlƜhHG{:ܣ$;tY03|quo =DRicnɤ`o" Udk[`1c eE|`?Ss,p.,!I<VRT_W'-s^Ey01i2nAץjNɆn: /RJqh-kFb>˨)Oti }}Vtsj1zd{}"OQG5~>NJ1lWdRލ:e)υW,"M2j3zf3B>p;qC&X Íoi(3Y]T %d\ +5 H+Ǻ:[֘HKxX; h\~)]@vX~k~oO;#)N"Som)^!_*gXnkD#iU',j-hGQX\<Ǚ3g:ZossBS bQk?:g7(v1g"#b>^ob`A pf:'FRm xr؇0U$Fh]Sx-wok|y}(oItu6HM=c[9ޔ:Y_^IⵥkK"}Һ |3;?hkO([q9u %ZK\Wϋ:YӊMCcH<:lI["j5dCq\fh->XR\OsZ,=vE/?S'F5]:7M4 dgF:`m(<-62uHw}'O^Əi<umT3QGˮyiu[x(T^Vg"KXd)蔖f1XBtWѭom9Dr.oSpA3gDa(7\m#ٝ ]]$<=(^i&iҔNtђd:$$f\kPl!4=0܇al]G]G9胜7.* >2aЅUx:oE|h['ҬnIuXHs %˓n|>(j=8 c_[hU:B}ءjb/&9͌zxktŊ'I7MX^jmXZr5+7zn;#1xw`BtwP3ܨZ}L^>-7(Mbhd3̦HRѸpS$)P++/%x,A',mB5jGmwhpMW!*3f.?0~:IQ7PvWq c> \? ZߎzToւӷ&[P~Ke~s ʩATMDYK3MӼk^]NQX zSQ-0>{M3Q)/S?S]W /VlؿE9.I1#I2E%Q)EC[S?7=^8鼒,}*LWȰR h|&GsN/N 4׋@Ꟑ{F 0I?.v|D +B>MKc?h ksxzMgݨۊ,Kz')-~FNM8e2(CVWGpHTxLRc#BrG0G9.$M>s9YٖaxExjqhW d͑=6Ks0r)sk*dts dRiƗl^#hwx&T 5_#in,=~bYSQgRKމ l\ǾV^~qd$8Z=@KHՒAOy{Z|sګaW84a% m5?Պh}$rdn/y˙eD%K yfdzњ^oQ8͔%[G}UլPa42Zrpp6k% j|[q\\Qf^sk@b/E;NG1mFsjY,iqQ>B*D3/,: 29v"qvKC!G_ޠ9#k4}h+7 "ϻwQ\@3byJo"ݗmͳX;L.m[fA+L?5:lM1 GW/Pj+nqؾ4#WIwG`⒘r"_eݿhx$aU%j<3h* _a%GJ^Moux宍MVhVq^8'cW|Zmnkcux4GrU@5=r|>1/֜i"M~qA晘3qc1.D}*s۞"њGoV_3~Fg{Y~i{Yu(+ܧ227d뱷צ )GbʤD]FmO(.sAթY0{y?=H%Ÿ57R+#y&81y&K@m9. :ڑ%qDa@ϱ<ǎHU'\B,f,_z(b#L;MAtQr[k i-ĊKWc ƾ.)qx2?iIeb |[zkL>P}$챊'9E퍒F@RVcO]Q;miڭhV;uہ)ZaE6h;)IZB@mM!m)ΜW={Z" ๿9w [q6! '7Yac~í=N{}5m\rȔ,s`í+Ҋr{"J]6 29w6 [䇝4k\]'_).P/{+\-qWu?a3%̡# >jLg$ Il,OݾmJEihro5ስAd o+Q&h1ф8&:EhYs`Kt# Y (ssT,i6Yc_ɝ5-(vތ1/yaO-wg &;BM BsGKdRe|j"7"?gdY[Q, X;|Yu))bnrKk]]+Snx] d? 41~1] Wtcak+kp•أ5.Ȥe6Og(-^ՔJd `j\o_[O")"0dp{c/|C(yX_ RAywk:]{;wK^l$cq]ڲVG4cc|֣?9\[|)! Ӌp=_gr晱xڎ@jc!sH.9Qf|M(>sGz";%;[)C-nY ز4RK<^ ̉K a$cs/Xز5IHSӞ: cM{4)ǂͶ6\Րl]J22mZٲ7'qϘak@X>Y 0`tV\xYEoB|n2|I7rxNNoH<<[SGA35.s%F⌺pۃz1;pM[z6[;'"Vlf8SұlOKmUثbgka" -mf7FQu%[a]ҳ5|w"/ QmzǒV8xYDWG [/-atsZǜ׹C*vZ\_>bEض)תsXh*ae&\)IGl>XuDi!ցH=_qxU+{0Bf [m<}ֲ onԽF&+^}?Eyj3Qv_}^MDbi[x(&Oə,KDUT)F&]B̬ayf.~3]F&zOH|"wL9QLUgb^Xj6NPaaUKvK{Q,;L1}0oҕY eEnԣ+Ȓefcyc+Ҡe ỿr=[_|@guqDAVxϑ}MlE[w RIlKUmũ%gMo}Y L)Buj݈0אWklwEHL9ElcA@\ϓL o멕K՚IWg 4ҹU)wTYj|v!rhEE#/μ4({44y=}v!ґ:waB (8",¸E [?_:S(8>%%a͈8]?O54fK\tGk< J1Ky TuؠWQ dYM)28 i vE5C^Ω`d-SVDұeNm\!(.g1=dJK!6RNPқklڒ`;)SG󵏦)Vٯe aB,NiؼDsx@=Q!HϾ1Ȯo]A6CWr|V}|j"Qt_Cy5:L ieŀ`=.dqHld]4_tZ:>VO f)5ǿ4N(/7U:?Voߔ|maWv)KGhEf5>  fsV wsoڵR' CLZ=?Ac\ 1KѶVKGe^q;}1MpZlȒ1 [{'b(٧alWGYp3ܜqU5IJӑrh FvF8醃T3.;bW1U{UIۃ澝K2Dqt9S8iq(NxV[kE)`Ц,eU Ϝlz!Y B $BH}мV\E)( z+b lذa(X)3眍}?9gvΔgykҡF2tp7q9i'R|f`NG򭘤IW|7c)O&Y}hb|>!I5KoyH\j^~dqt'D9vUo0ɑJDm 8bsL?EQ0[2nfj^ u͡dƍ^ň;F 1D5rA\dZ]ؗSS[ȋYd^ }S_Y:jFfRVFzn\(A<;˛nVN =0KiP9sZ5Zח)+֚d›-7u@ܽyӱd OĹlWFQJY߂l=E{_7F-œ+~8T36dqeЍS^0up;mW*YڔcHmRfIQf'V ECA2tj9=jŸٕNasڦ xbO\K`t-v+NHjl>e6hwFmҀWZ!t$_"> W32߷,]W@9b[B9ArVu}bQy'9;Sp;ҍeR۔&G}L3v+}jg6{]uە%k+ثC-O8lv]%J\mf);F[V G'utV- h|r#bJ-g ikLΥ],<Ū%>U< )U* _sY{[Jmz 9gS k\wq4i|̱szJ%3Z|Ԟ-՜K'pf-oIsB'!}!]mi#+~ ;(+{|0pi_a]qM~G: W{zKStW2FE}~^c9rÆ5*g3G\مԾ'ͣJNoTC6z9 ep/N7iū s _n".gITR>l; ̷˿p_V$8~*V^Yz«rJ:E%%bXM>T !U'cYwg=a}Xehܫ3DiG yZ*bI[t&EGoi4xDgu3/E6fH1qJpPW=JjSdo4 iah@Ybs6)#NO:'ADlNn9I;~RSM'JR^&SKNjY1ޤl4l8+<x^ʀYoUv.5ވy9It@L0"N[ : ZSU u%0ocaJWVjBۿb4OCt&`eora?fT8!;_ar5+BFYž+bjd}7Țp[z~g3jh}1KG-Û adV1-[u^WD=#4&Ls3Z!\IRɧPnqж̽2zec|CPgP**'l7fO|t㕩 F| QvcBʷJ,̯7Ry(O %;6tJ/gRG`\KXOM RVǢ3ݏ/S\>G?Svg"@~^"Pcssܨ1:W&[]>hj:r2ю{Hji,EIKKTz6n+%$L+e0|-7:(}J}Qd;3.SɆ401GMr#i|6y N8z#"Bzy-8[}hx2)vϸqdmg~']Zx_Gcְ4Ѷ&'7hOXNv <۝v*k j8p[}w>ͱ4ךŞ&T\{Lp,#vsz,BK9m3nVts%y'g{g4\v'u ^-ܨI xI58,Bn}h]~3Cd)Vym\W16dŨH“=V]SH(_~_c-"twRiKHd#b=Wzs Bp:%ubk}-g2ӎWv|w,TP9װ[Kh^Kxϳ7f# xB,2U&Ofz W@K5m9'b,\ sj*7'+IcoT.tdǎy3ߙj$@X'0?FZ^h[ޓbxrgx8#٤8I=]c&kA wreɲE#Ajzsa-O36ԖXl2&[s}EZRxM %j:6Av@79W~yдU_rqŗsnܷaaZM1 ƼQy.\w)Y!eu1#c|[}+DU W0-DT>!b ]Ye9D9˃X*< 8YcFؒC.e>ˮm8ӄ;C:^&BԻ\({g+AC4/иphJ#~G1U3 B[ ?D+-Vݥ*:RɦV ]Y 3LtZ뒭NU}T+prkݦxbFT%+MZ$ӔR%+>=9uNCyNJ}Eup,q~`}\,@}-Iг?[iq?q+Ϫ@畦Mj u0q6K9eg4'ZE{N:l9k$JxJیjZ5+݌DbţLPaT.`?7ܖTfu׹Q(3`#v/;ON71Ë'03(!17FXdZdy`V7 fzybl˰&#"Do*)0b# :s=ni.cYyْ\7y2S1]=oUϐlQ-EXeaO }8AN+R1/Fs;`j;Pw!ieWd~q'Y#u@u/oM;t12I1Vc}n8Y()ٛc93^ih_dM\e1\%ٷx(qJx}cg]89 /f*?0fKIZ ~$=H.+dtc<{oy4r";<ڋ9af:.%*΍w[)Cb|̧ lӉym ˥oV:?}IF3x;^|r{.?Nˣs=lh?DPa$Ȏ8j2j)o祶e&*ulYgoR[GYts a[Ҷ֨_hWCͰ8?R-VRcj@;,tnk\K$%Erｹ?‘Ϣ4~IO˂qwboW7Cݶe5ik-S嫓l8+|pss O(:s'*~ ܵVZ#Fh0B٘=L6ʧ5IYt*I+!^@k)8+?SΔ}vV {M(wn*ޑ1lnMZ"PHIܖ }HI".%pA>+gf79rrn.,͉}8Ie126aDן3$ePC}%ݹ'*)湡} zZɊ$bXF=W\LYj/]q)=uOO;\F@x2gKE+@V/qmkQa;1ŗ3Lh7l_-M{f(v5H'~i>w%OEMoUY߹Fټqۨ[8^_XVۺl;ՉOϙϕfH0g?O:f4' ҴzgcYZCt;7KdqZ!I.qgQ__\b0OTGL\rct>a@5&Ԃ_BuSlWdn[`mpjxqb{ϻPY0WA_Y/D.awLA. M9ߊ66cr{Y|΃/, -I-q`3L6WB$n#2ՙ ]9~̨.iR3˗_=Z n%C#7q0*~#a/ƅ0! % aX6'¨,'N@#}c"o՜i'<'VspoNíuh_ vVGQ"S-Ĝ4_ŋk Vq[w78_Wj K!0x mڵ g-XCH30_wuh8{ e_t=\޽4ݣ :Ko{ ;R9% 뢋};L&9`fW׉K'b ~v0,wFSQaLE(o}#0j4#Vr~X8 "~ P8B,g+B 8 5uT\M75V:x¸q.=S8yK"xia޸8 ZO~Yp3gN_ "+l!r9"\4[tu#s̏Mj#h f:?֦3 ռ %,Ne]50?xt=ڴL#\!6u= p oWއ W"\5l3 ?[P4䣀U7G8o޻N΃Coͅ\c]}4 .PX TZ=&r4o}~e%8g;`3c f\@χUǞeŊ}{ꋊ^sq~B|8W;;q_iH\{&_ZM+IE^+ݭeRݿ u[/oH7d3VPIa:auJ3temCRxCxO[1)_}ʷ8\gEbe8VW  c6-q ݕ xЁ-Ws $7\;pjݓy#/ xDŧs_>2Ϫq}N}?H!x^O([T@X_328/6iH eh)iΘD!1p?hTЇV+y |/D4\!Ȋ^sη!MC>*_qO٣C|?W@V:t\'QGEt{ m$&qdt{_ކIG:4?Q'w| u6ϸg/<|,s"oK:;ҙWy YH0"1J:ҧ88t0N,[\Ƶ ;1̠j'f8|CD_Lg^޵\mz/+Ylۏ'Cc=Yѧl1 ϡXA7eRw${3pFB=?3x|2t[Y1a< Z=ďnwFۤ>-adOי!Q~2oO[7q=?%#_<40[uV(eXD2GQ@ĊL3y?z>M_z^zJqe&3uxVܿ'iaT<4:e2{R+~u/Km *[Re;u,y]N>7٠Iyli"9g-KfwL/g|N V-Ù|f0$~l)[OzHzn?%*74mb`?}gl4,.ay aDސǘ@;ȰT}x dU;g]=_FrpYw!NuV'z={OqlyYg.,ۖQ0ED`N2!draHȰd:"BX䅀Me\^؄ V2ƹ6Moe@C& 5 9.)_6b 0ـ#`l]8Vj:=.F@_K CP 9q}sx0a<}cD2a 13ƟP4Q} `orql&\櫚NA:hX ĥι8v1#y~O\?!sl.[4'b.$LguA.xNOӐg)ѧyi,GY\6-,;"w9l݀s`s̡ro.h^(aY*p 190&&>38~zxE+PZׁxk??@ F Ƌ1@+qK ul7+?KL:%Q0j"Yq,„ua>e!|_V.pο0jI~`DqMjW7>q? )FK!4iDߦKF8>2C}e?p4&Er2zN#Dꅄ"pI# W6B]Z8pLκ498kȺʁDFP{>m%2>= ^FrkDCVq¹gX؞xZRϤ#7uH_Eױ # enlLz̭i~d1ѳ{#g=|$1*f=ZƲ^m;uOY_~u C؄Cz&ȫF[7!Yv&D6G x}͟C#˩hMpbxDhPtE>iLh-#c sZƨi8:Nlh6{ C&,N4N|2.dS֔G6x6MyV5aД czLF̵MѦ!j^ x~$}[] ٞkMm +9$zYѫk;o7s}Mi_vt'CgdIT.9JS/ ~˦4O?"֓hzoޅ {4M! Vn_J]VJOo/u%"WڂChަFR^+;wXHf8ÁJ4pi36óHu2vw3Ѵ݀úMhF#BQC~ @MgsW|zgͽ>9os@w3̶4x>v7}0L"͑"m͉ދ; n. ?g)vx=:j5g(!̻l`9-x5# уPȡ-x]Oh`Gs:vє7I&eɎt&maɳ&oƚׂH-h6?Fj~:jh(/D$Ԅ0jEQ{[" kYGi90kNo9x[VhL.^|0QRȖh#*GK-pu+.ᮽZR{ tA>0=[|=V'C=خ$~r'[*˺%}Cd[˄uۨ#>X+[]"3-JuTV,R- aS{ީVٹU VЬI/1igN+e{du\Ԋ ɳ[lhjދCE٭*;Ȫuzj39now5qBM{u@_nwsJmׂZG^°x0"| QB! ߖQi#e0 Fbl[v] ٟ0l<b!L Z^uv1*uɰ*673Tz+Ou?cH_x UNS*xeɱOPG*'0?U|o1yVoa{8z qLėŬ>VvJkm"c"@.0M>Q\ƫ;0^K-Z] q90l,kc_Z:„Ǻ0j]B՛`ukKOzs<K$Cxa]= ˄ y;cqժ轘z|IgV ]@5{_]|ߖ_g[|xi^{vm^g@,=۱;)#ѹMLl逨ڟUor1s O/k:-g Fc؟v"m@'Qdf;A)c۱_ķx:ގQNykzAyl93 o^r(3k׎1 b Z1N(G{A!r< cI9 (g=rl(g9rRr_|0dvYz;l6"g=U91GFDזeGyH>7-ϢI Ѻ ޻TwGV:XAZNߋـP #Ɔ Q [*> ϼb;Q˜t ~uZ`*X{%ʕddT+zfuhR̲Jwd]k/G`*IΩE?cr% +y/_VgV2}\ t&[ X7)eN=x{=Xw+q݅ajwJlig~M{~N5ҞLkPlgu;6g-Ynqo{(ܾ8c<. {\nώ?=̣tkwxcw~ma:^\OXSZ7k1 &wp:yhf?p}Sk:y *hǞ< h7}*\a5O)\OѲ eU\?R~{UXV#i+O6zQP^OSvf̫X dOsxƺ*G>}g'O>'_EE{ ۫x/WydlҘxI=w@=!<OpVx?XhtZw祘eF%n;T ϳ+U_zz{_m*DώB v:\6r x>xFؑڹGK^y/^~~rL:#_XGAy#+/F xCIl.#iQ_Б>HranD.8tm1co#Q}avo8,2݀5Q'n[+MPZщlSDw:چx° *"^ z9Zs/Љ\yU'a0x:WBhc?L#dP~EW'I63EFCwreYm޻x_9Ct6Oz-wu~.7Vw9.+_Gm{i؉g':!M<:\k֙J +.X;}:Qk!chgc\TųCbQg'v=$[:#:33w&U>SX>x3ML1=_>gycU 5<)@ȬIiV}~ ]Y.ݫZ8c,CWol$C;O0~gN-%߰4:Xߠ|m?੭?}81 [fc5X+j޿np+5hT/oFy_TrW5;>TO\~T#]5˙f9fa3FƌY >Uq LˆN8(B4#e F(R\IpM0nRBNy #Bj aY#ͮ?+'ьtɨ"g!Ld !R}e/_2ZId^ەP#].U#zWԉDuEXW]vߟu+xVf7"pnɮ|ӈf|LjU#3si{Ƥn8W4g{Y4:<OOԞ9 y| uD1￾X2$n .EԮضjW7B<ٍyn̫~؍ݘ $mxC?SQ#P[rEi -BtbB/i_CrٽK Gxo5ʛ8QK?jP~X+p̀3jVC֐IP{_| 7>Y~u;#l| #ſ~`DUVw\$2W1iѝm˻_Fw˜8;<uY<#h?E8r-Fy]wn\ T{Mn;{Og~};q_K÷EO 1o/Զ0z0"/ɟʹ ++zx?U[+E{ЙyebPO6(ب@8 H 0QB` |cSlvMLO_FHӃevL@uˆp 0ͬR& nj S>PA/vWg x{BQUwY|UOgʟ;WӍ"y< D- {EOmJѢKO=֓uzr3zr7.2hO^V=C=z%=YeOޓe}z,w/ŎŲٽ^,]ߋebY콽XT/ŲOz,^,MͲآ|؛u@oNͲY{No^ћe,}7b_ͲCY}oSX[x b۞²^,v)Ym(дSx\r ڈqgv±?@SX6F@rl~ȃ%0\hz-}}I>5E{B҇Q1W[a90އϲ>GՇ>;ӕm}x_ A^,>܇>ȻGhK'އ_^~xPLQkp׎p}I ҭ0aEa֑ cqQ#{@0 3uf |=f,\F:]'Vyo|Jvlk}KewV13Th)lOMt{~(o&`S%Gas +[pdM c;A+$y} zz\}y}vMf}W]_#٢/Ac`W}LG?A;/?/Lyʍtq!\w./xovΰx9Z~X 4{@%{|:g -b=|S8*>J,q>X6|/!O*"E9bF2^z7(Sj rq| {)x t7N ) bpNXsλ*1p1_? 7F/[ k_p1 ӀA¹e$ufDN13&݌ ;̄x';u8⯋0ynɽ<}|oOG0miVk$l4=$JG-uLcd;f$H\.\.7s#\nr].7rQLcF10ilQLcGp5˭ӹ\R?,Q|xpbm(q"Q9eonxI5w{ Qb?=F+vC = NSr "Q>%e4Kh^ϭGjuh&f~4ńaq#aD;*yKsh4χ1<zr9Ei*|{Er6u,|7V`,T7elGg,p'&[I~X>p0;]8o'TXjEq,hĂq\q|@^3+q,EXl8AtqHͷ)||u֋w#}쇷:|cgqWj:jrZZ [~Tkr[#+E;f*qu";{6G'򅒍S4.Vuo՞j&^l[kYu[-_;ky  -`}}L_7! #H/EK@_?o:ڶW嶺2OTY)?=^R9T\2 |bq궬ՆBp,g Y _W7Jy~dEx3ƳoxeG/rVLl%{>ߗ# ? xh5q PZ مPM+dVX6iC8oE V2 +lEQvi_3,m Y, 7?5 <ޞ1ؾ ̛<uSZ>c59r5 9c^4tƻ:YUC瞎Gﴴ4[IJj6d{>6)׾ҾXdW I;t:Z4xD\"!gՀͭuL   JCr`ˬ\KE&˜+`>1^{xƝW'B3Gx <:?'3)uBdC{PE2BX!&TvWE]ԸTC\RAt4_Tcyٕԡ|1 #DP 𹈬:%&ń¸0d\K6buH":>O3ԱOþ:ixw*9\XY?ձMu|˞u$y}૛N5fHEI='al'M3Z:Vw,*-<[}ܩV? 2nղ~KJCyqayex20& $ b1hYpZa07Nb$gm :}h^6KIgfb=6 eDAX/R&c쓨șL\d>Lq哑'DdO`wXOk`= !ʑ=`R=˜Fm! K 3K #Ƶ1SԸi2w1)I}bLyHe2)c MXeQV$7mޣ{i⼎j:%9Nl)dS칵=3D/| *D)S8)("Fy0piS(f<} FgNž؝~}~Pu;1m5SF)<6OQgSx T|pRkGzW]Oט)x6 SXaN^SQЛYQuVSY^-8βta]j⩣MA<7G?W"Bs--^5C R;_ř\?_ȩꦲntTꧺ6:5\zwj 'zTWNųS;_LUɋ)i,,wOHKDçD-շҚG8Cѩ3,צlѷi-βVOk$7L>8 Bb4n^3bL!8jxia_eռ?jLcaz;aT74˜($_ RDlOЄ92s:Ǫ<k~?8}dcȳ-;<>'%/yuߒolQ@6Owl[~.}{L}y4ہ*toG|;6~D#oMrgZh2CұV߱0iMH ṡW?4ꉊɀ`ߛ5律ܷZk>t\5!qaX\=}o\4v P߽-{r/NB<5$ߙ:C3hOgAvşa{UFXڃ0! 90$F8N;,_ަi#3G7ywݬ܎Gc6t%wΌ |(a-aT_L\7BmA]x -B!׈~~~]έ'vq)V?Ex~y?ckC\G͋cKUɝ5O>`>H5^JԭgܯG~ϙJ#g6;g 4:7мtKg-YL12i36|̪kU>n,߬z|Jsv0mP{nOf\z&ǔe&뺌h,¸lJeQ{`2uؘB8ژO1VOcK^c3kpڤ&;\g=Y~>|Šg^Qkp@NC uV!"YB ^XM) .XaX}-1ht!]8qQ=jℱً>ڹ_׬Vx֑)>t]/s^^4&(Z彪j.U~GI" O9}0Z'ϓ\)51y.l\>_{scv9aX^C7.7vΥ|tF0nk=6?kN:F0'G`E=q_:k}ߨzh1o7ڝx=Ў~baȘ:u5qe8y&yq*V¸ac؟a<75ʊQ|k@xqP^,c>+집 צQ|?aO~vאּʁk/Rq_?O>r*n_=ʐ/aJ''󙞌Ϲ' o]Ogi7ux5:p YLq O_#l[qo[q Yv69,S|s!I0>]#|۰N'A( -7N~9u`eG qBಽ1_Gak~}/5sɱݸiSzx4QJ26Vqzs˃IR7aO-+ݸ}m]&b~evH\ mv\;"vTXhv\|N?MC"?Rk'^[,o0>ޮWLѲv{>a|3+lMlvmw4ͪ,sWEiE,3uyxo|/NRGB?% aXiGvL~9Z}<ya-f[lO$Ӹsil6(WB`O)LňwJv#H+]ihd1gk2ޮ^q<+ٸ}8[߲^y]tܡgS<.*oD{)߁8qq~1Xsφm3nזKЗ4J<~8C[6=5K`ach#3v '[ՙKXV1o E.Y]hk Xřؤ]%}6)s/΄z@mm1 r-pCHl^ K>%#Τ߽Sh cߧ}WTo,^+p gQV\¾B15_DKb>gEo}<gO*?h2%ߛwa,޸ҖLKsRWN|K;_~×-e筀uVnX|p<zxp\?4YR􁊊2R? 4WkRʷ,]ֺzk0Nv=?Y^QշO\ZqGԳz꙯YOyKzUմ25cO/17 {m=:7S.y~T<ڲW3bS6Ig_1/tX|WkD=te^,mα6Nð"sU[9f܏;{[m, @|2^Ka+!-0b2Z .ض=x$ǽNOuۼLqr,~pO~ظr-xŖp)/üZ  Xc;BPFqtX&f,絛첗iǩ iPory.[r+.q:&:.guB.&Yt?d\HaR~߸0jsN.M/^?c{&bvE1䰖̌,a6kaD<׉s? +  V -+(F8Q^׬`= +00o[((=SY+ئe/yp%joHXk=ax+xkv ڷbZ1ﾼ58؊ubsJkkZkkYkkб55ݚlv Nf6lנT7۰ͷmخA6s0 {Va=mخ6l G[Ͽ6}:)צmQF$Ѷ-kr9uޖՖe۲: Ƿe=im9¶_і+VEr{9K9M"|C֖!bҎωS1Bp1 +/y۠N>f96!vBC.nND]fZe'iz;$?pf7r#݀e ܛE[["^pm'B=#"ZNn}vm}!}ls[a{߾M=1)yj<}|j~>~X& 6CTáwSdr4[d WEu,=GYw>=|ONBtNtNǤS4N:E#UDsVs.&1csAs1&q0N.t.h|$'g`n<.K"Oj7-U*ng=wz߲u`[:/^qRJƼJH_M~e mvs{W4Xkhсt3߸> I1'U.؁uU#͔$B7fj$.UwIj-Uj3~paffC*T׀UT~}kG)}ܣ#yO9#y>qr|e>Ws|e;WI.'+7 c>>ody[q|=;Z[?V/Ƿ~s|/ڞ[r|[_omc9m2Ƿ-߶q|o9] B=aB?G(TB*GJU_q|%q|-k96k_y_[__?__ 7=F2(؉ߡ|oԉߡq!7}ՉyHZX(-,6S6ļ;eCBEWQr{o:|tՉפɀ<Չ[I,'XvsFe ϲo9ډe Ԡf'OUSZel[eEU̪ixBݒ֪CRwbŚrt!;TdKwDt<h'=x1ұ^B H@w -]:9/0SUazF=..yjSKwjwT}%lφ0_֐Z[z1$t߰ ŒtԫU{ij%5' !ʪyi&WA%ߙ`l 􈋀XcҪ_aD"jP, ૪[) XA(zP}ʛUTRPeT 5]tբ3}.yѫ338~-5Rc:3CY:~o %uKS7uF/ G;[Lg~Zgr3ݷ@{h]x#G|Nh7Q|7;}%~߅l ߵwt3>_j}o$NWWVQ0l>u*]x|N0 ɺ */7u{QerpЛ{]&lJWA~iP+5[U u%ZP ;՛rWq:'|?_Qkd8LJk]&]׏_C÷ln_k"s]=!:[/ytE!ЅLnu7. tM0֍tyz{ۊէ,_ n׵nh7OuY IGp% ^N= NxГP;ۛĞUoݱ|GwoYWgRwsH"Ng]CFVnPW\J!({|[ט3Px'CtN$ūac% |7|-zD=B'>{="'Co{9aa/o_IgBKC?{^jrKvo5z[k b;ajh83X́2T 3iqsߧB2_Akrۥ~҃=1Pڰ'=yԴ'}P"(nm@OZ >} @5`L ^2HړL:w$[ÄWg v!e%D&]W/u{a{EIhR/#%O::}ralNwg<6f/ǩa}_'H(d7E }?-YPŲ_{1ۉ'zby^(S1HUL4f⹸>wׇ*{{ G:8u-~p- BE7))ʭ-ݙzݕrYFoZ3-zި| 򅎽1?oo킖:7b]FX̺7>#TTg3ՠ|&m^BGk@l6A* =T~pT\pч>z)oȵuqX4^1}p!\S:{7y JaLY?ϮQҖއyQp9q !yU/zp|HǔO|ٗyQ|^m|0jwH =vǂ´_z,}"-u:XWpk{MBm{_rV } >~]`9' pihԧI{ϠgȶDq%O؇QFXދC)`*$VM* 6+&3^c dsG&otuc߷L`60[/ne&%r(#|/S$_V$ڥ\U2e(#`ۺ&g i:7,B|h?w[GwP׮Hn}B-)ޏۡt?n~Z!J5LZܗep^zD#G۸Ѵ3yxgV=h9S:?x8&DŽE HqPLQ}Ǫ~'Fed~<>~w+s * mڳJT5X8L\Op=238=gqWH!Hh*<~} _x^U] |Q3ez-.͜mdb(NMT$T?<uVúLM>Q0fkٴn뀧 g`~LDtDA#bz\0IY ]3ɡmNfɽXL?-YG")^6ꈷ溟'6ll&,Χ}4OgPքx J3>lx950S @wjI$eg;x?̫֗^C3˯״\e 1a].<׻Qbu}VBbŠȰ`a13b @ۢ#D` m<,nqJ1@S/Ձc6rM҃X_~,5Kh~iwynDAa{}8gC l}3N:2Cs_kKS.}8?m2p Nz:^AWuuU^U`֫zy0˽j r~1~rY`֫?OfMY`֫z^>{HeH}r'1C$^*C0; ϣM>bTt˛馼#[kDSCo1յSU2yTqx@kHCq 4ؗ%KI43-[$Cz)N0ihQ0sEad |?[8iAat,zY $[DHXk SK{C}>JyaP 3C#y؀&z! ݎK&u< :;Q>8JdY0Yn8u9+ 75S>wܮz鞿 &${4{=i-=3-:C=8ov *;a}v~æevW8ҕ-9eǷQup]XdGZ~kۜ2.h]M(l ݶ<mpuvv8ڪ 軠:>&F=ZTm#BJW(<]mm>!zy¨B߻w"%:FR E/zgz"e01'5ԓÓrx։ug px֭ g;Kdfwٜ"Ϟówc ;GLx&#f j?W7!%Q\K5] M*>vtkיxF~W3YS&̤R^"jo)׷fZ^%^th`&2ùӬ||%nc}zk7fh^ eqRI)HNGf>v]ĵL2#Buq-a9^Vi>meE| OZsˈ"0BQm=fm(^{ۣ~Xtw[]Q%QZы͐8X&bQB~-6穤Ex-{xFND9L3cwF>ZL:hwێRGc:#\k/WF~&өC 0ޚ5h^ڌ5h^,£tqlFs,pB(1_lv#y_tf4}у Gr,#uum~写P";X)~W1 h/~,,y[:Ca&q3Gq7Ck6{A~ֽ Qh)kY]iHO[-"ޛf-^j.n%4iR-rl,36XXe Bccx ۚk>+q#10e S]Wk[tsoHc1:7XוJjK+&>*:?@$ WZaٱ=5UzO2^kX>K6h杯^E_2cyKv(Հ_QXvecYXn<-2I3ʱ5j]*טmZ՝F;ZBsU3׾QV.cO{ۉqX_(>ύ_ܯīX\e˜Dz8ywE 3sHk88.eҮfpM/BJ{=泲V6qY^8i>ucvxĠPX - =r^gyoixP X㱼Aˏ5xg<٦=rgccSӛ㙇Zxþy<:(x,hۋO "[-OQ+z:>_ $7U :3Mrm$WsQ99r,ZI^^4B}G&ݸղe{sHs`<6Lb}i;yx=NfY1eY&|%d^MfYw,.5yW&3Ui2˺OfYw,n0ѱ1LMwX٢ J Mdv=I+)tGOfS&}96uX23bdyr|fyz2<S9e?Eq8T_yq:7N:s㤓O΂8,N~Ntq=.(y>Ek= nx , Y eͳ²ߑ/zqzO/W1YeDo|.מBw$}/{<3e)x'-LGF/[eSTY;Ŕe|CD{Pumsd|B"۵)G5uڥf0u{ -S>p%ME==HZ5}]Pխ \*z,w˩|;6i%ZO9>b׆5z_F`*8=!}$tkOq_ XFܡ܉9Tqu*ܙ:uxcewѸmtj,m> 6ɶlc-_ИLu,&J~ /OC5M7lu/([Ci4?z }?0wF{:4rN5ҹ픶5}H6M3y}{:?NNk^kcmVk3xLkf`dd_G_?+h B7wu5TLxh&n.xD,kzy&I&fr mdgKIwySS[4G-"Nz-ez6C`&uBunm3g?O8u|c>gYtlq0Mfm7.yH? c#gYl{,˽d{(wJ*ӻ/gszIv5hgf]mߗzo;|bp=l>1ukޛͶ>v>l7.\Ja8H~9wlSTY^ev~sg짏۳60IWKڤz|Kn*.r|$m&{J"2sx;G7I8oq!u?s_b'wP{G'-+??6A2mpb{9|PݔA47%ׇR[5$ΔtS7g{E(3FAL=gaF2ݑ>1I)tvA+""NM۹fb:K#KϓZZa c.EfSaKb#–-`%W0e11b%y k>&TDƘ0-"l0?)W˜|!m8Ϩva99,? 8+ϻ 8<\8"T](n(Lݣ{W>8_+5JmEzPXOn׀uG Z~p-])<`ЃAta \{S9u.Ƿ.Uߺm8qvp]ܠl7~e[1Ãl0\pY ؟ܦ{/Jl׫#;NzyLgx_E#ޭ7x{n)15,ͳ}ylb?+, WOwq$cӰ|)OY-ի 1p<p|lӀcaб9w\oPgtq /,q9יhl׮zE@.+ Xv_u  1pLȯOC4J9.mY̧'Vad.`5o¸^x Zۡq{U{#e C~>]w)/?'dޟ̗7SU?yOޫ*JWI[Bޫ|*^eB։]ub.dX"ַ+ub,b1mm YĶO/b[`b[//.f[;Y/b58d1\abh{15,yXD-y~X!7/~w@KKޥ=ٍS2K",4CeK]VNXlK 4a) 4"j wu@Y:d!u-^u;_=Pϭ`{pW=8--{M| Vڋ W5~t tk|~06 5062:o?0) +żly Wl CAq5 vԕd'̚PRV S工*d{}Vy+>w%߬d(?d6d?j 9>3o[UՍ i^藆og /dZH0핅y|vdXϴr"3M[@/ou2v麒8+E@ llBLy`ãͲWYD_ ڕlWU+.O9)7'+g+k^ykOUKB|w|w~BuǷ.֝z[p|ŷ&tۊzli^[5B>a֜0hs|8o8}'Ƿ+YP|5G-JU}j5BZ06&  +s|m p|m%׶s|-_R|=G/F_! WW ޓPߘKPQ|#0h'nG9BQs|G+h_ a#Vs(';l6֚{n368DaL]FwUhd]2ކӟу>r?½hL{ Ng3 ]ߟE?糒7B$&ba[ ~--!y8_4fC}ñ 2DM,7)򛘟{?n4|5Lz?6,¡֕ m&;aS6ɽP /[|8?<6L61tK鉬c3۩xb (JT pJ =JBߖ؆fnV:np.̉~b$ 6[36[ Wef9ULh@+773V<6өyFPۭ }x,76mFdJLoyck ^pKn=EeBH4d"U}r @q<;f/"xcܖH"(k#Ϥ[-,Sl:-x1Cl&_Bd=ieg_e%.rٝ;9 }BO[;OaPw;{*N0UZӞ#8UH'7E5!jw`[2wg>ى!~tN}vz8f'svzr'Sš73gwOa}IosNx}x.z\To/46x}}]X߲[p|oy-neyTb7ֲyS}7Ϸdzs<ݼ?8m)Ƿmvm7n-bx*H,G.< tV|oKCx|U$t+u S=7{p~{{p~AXnxǁX 0u{xߴ ?"L.0|]7Y|Z8jn~Y^G>EoTf5?`|Hm7_2:{nI!vK1  SNF-+,lg$[s|?e-Ϻj/e/~roya}.)` 7|,ߥeV}{T zؾҧN׷a3By_3$BtÀz坵˻zr_ǼYEyI:֐ [)ݎE!~}_,E)J2x&O~/j{#~ULg=O32m7"mOvd# ##lM{b|?l[%̍z8BӛyMG8_gh`u[e()ZyoaV3h0c ju+C!ޗF!ES}b=/w0`|9CgRĈL&fz6033| (Ӈ*Cjw?qrA" m>3xOt5+]y?rړ)hã-+p?6rot|Cwoޔ=zM_.禃^@#ZS], ɞq<%o c}?J6d:8>z%)/VyϹ>~ .?~0z^TQٗ/,^#xwLv=oxz^-~?p=pB89 Se!>u1ާ9ʪbm;87,N 7p1gG1~;1wex,wG=##hQ8;ziYq\}&P[8{y8q[ >>{= p!83#yz83!̐4q[g?t5ܥ 'ŏϑL+/VkM ,8y^8 /9 Ŵz;&}SX]{x>cYڷmoÇÇc `S|(ΙCxD wNN8c|)kN q)]Sl)WrSCRRJaW]9?^s? Wgp\AK^c\gYd_LXkklS6,+_<5#ʞYL'e=g Mʷ2qTƝ3gLeY>S9!qLsN9Ρ+ϜzZ9.:߻Er{D-S#9΅t&3{ vrD/}]gMEp9z =e9~v4`GwϩpM0 ErIyw,jPNsΠQ]~CZUi%eg?9Y2ل{x[g9X{0oZDHA;`LQ=3ɽ97wYCuJ=~Œ<(ܟa `y`) ysz `Q7K}j:"iS%)ߧ''_ q_ŝ Gq|u'=E߽%gݛ(\ oP/;}}'g֋H=R"[݂^7ij/;Iw}C }&~a?2u "I΃7}Ap1,W.y&&'_޲|Ԓ|\|z(׀nPK2׾H \E.7uGnp|q"KO$VZڟVrz/]b=N Tɫ y*X)~-4;39[34;o[٦Fq EZaND\+4TwŊByO&uv8̜˴BwjxÈ̺~mCy6t40%ܷ-oC[v c`C?4@gSxPu?} t,WC9M^gG6Yrd~ x%y}pϠ>kIBg}A$s46vΗqx~X we҅4&\fλK+Dk,(<`3(ט+ȣxm395+gqg=U+m6=q>U,"䟜D+\7 [,K sWvqgl4W9WKWQ'-*4r:_ kz ϯ-,oky1 \ sTL[~zʷ1lkҩ%RNoGй={hg(ΧLA'?H\|mW_vvr*S4heYo^bd9'Չ#&~5s|w(Gk<>J+ʑ'kܿq5W\rט/rݢ5'3n{yZ=kw;{CHAN=OV^}k/'ozc\\_un,׹]]L;W:}tteo[i@H8Fy7?3O35V֫luO{eJ~b(? >v&x 7Eo\4wV9y3N{Cǻ70T'7X&g'<[m5ifu-Ozmn]o,X.Lzʣ\rsN>{ܠ~Vno SV·)Sn SfwAEKƷIn~i!kYqʲ0hC hBuA:oŻS^ya3sFy"t9g zgx~&n0 {mdȾriKΛ]Q&ܥ7޸g8On]cB]L$dM72orM,pe5+8\9 npC!Y_w=NVG4/pznhnģScr.^-1ۈrɷy SXҽ>?Otb|җusqzxDm?p0?mŻs֎[heum 9Ѥ9[88Z:/ey<{ [{=nGtyrȻa9Rmfdsly[ ɎfTyqmSmW{FW;;vכuq1q6zGeBEo>DZ9Q)3o:xQY&%===L'c?`; p6}w{w؞?g;'; /=5\[0]n[>0NM0|鸋Yg('5g⼏vFYryP|.g^|%$ {}zS,_z@L\hvWeP,x,q z]6;{ݰwnإq.ٻs*{\^s+#C>z=W[UZ^uחoqS/L]rtSNޛ{5v9Kq2Cwd<;(*cq|TrJ}c8vjq8Weꃘ`er{Ge,6n}5x.gJ1Kw΄ :Hy<{E/W|[XA=D\N./CpWxE;ɰL&?`=}-DWx0Kvs"gnǧAaװގ|.x]#oɾ4~:9DGu^|BxbGS}u?b^#.[Ga\aFgړcb6:vq\aYIL3k>3,Z= /$cF~9<IOb,0@pGP3D,2ϻ̳JݐVIטޟr c{bc(!$SezyMnTeZص*AU~혪|V{4qypyy("IM#IW8'fz'LC Ӿ˹+_'t)֐55y<P\p7pliF5&O,`9?) 㔳ar68rh73( J5>*Ni} ¢i#!~Ұ7S:omX tB}؀ZPLT開S/ԯW+e6~ AP~J_C*-JHpLeyŽe|FP:4_0QU%Ꞇ/cAX^n+ٷ7g*_8?ԧE,/mvbQSmG ~Eo 3ij;I#lM}!:`Nﺅ.Ln3C䞮P΂iêE`oy;<,;Tt;x00~MaOJwr{a*Sۯl (A$8lnK~BE.&҈oifxKW.h$%t[&X٨֋sz f[U;bώAk)^.a{=b㯚S<9Pv)홷C: CRuzr_ xM-);oˋDUW.dKAKqpnu'8ʫ^O,V7#*ӽ?1_e`D)j1yQ$]o~?e1RGZaB|PKpH?PK6k5[͖(=췄m Nt\d9'A}6n̄w p*wp ?)b̿,*a< 跸S`}FUhMפMoW{LSȔ=}n}b[ b|%J^#G9uW;`|[t׽En=z|IXﵘ]SP}VJF=名;W5EI68/'Cl>0OFl7b0݊Уԑ嗿P&e'~Ա,N|H'*,.v I(bTGV:ӏ:x«thgc?WCcSr}G^pkUL9PPX()j/Wttebr}ǻѦK>,ʩ"]hDS7F"6mEl, vEUL>Va%%v2w!:yĹTA` Bf9 =xS s(@^ϣY$s')$c*tK+;2eFHq*t_6RVݩ=,+\<^s5.)^<*&^ԡwe=zz>$5W.:\ lrrhZ \gg|]7{x 0(7ȁ9s+&>gxVg%/Г0m=3]2<=͂x}yW4 sYǔ׼<ü'Z±KPaY_Mf#JPj#|3L{Q~>tu;`JPd.J>ԭȚ0iHD'>luw5m]@'jTI'*IS ̍NrBBρĄm벐zn1ӆ191ׇ6dG,ò8q=c*?3wwP" D;aC Җ{łbA]{}D]̽y~?_;s9s9:sZO!f~+h<[9fwC]<65Rx9=׎jF܍]jz 뤩/bߎ^d^[~`́,\,1cZy5wҎW0狹K:м27{{+cIa/鄷`sNn^yE7|Hc ByFsY igHGЛ1q~jv]ߍWwn|+w[jڿAiǽQZL/y}|~l)A3:iNҤ 6wac)k#E,A>D8`c6"vڅH!P>ʯ% #it^Rku*e/ӊu.U{}*fǯVKWJ8+y~*!6;T)v7W|uE_W{9圉ers$VkKD:HKuђ.=SR֥WJʺNIYN}'I.2J)v2Q1`c UJq~FmƨP޳!v !@ưm|A7J5ZoDZb hY(KCp{kz\=VJ]sd|@/ߦ>2Tguݒ2e7/u~ej|n痑!h[~e\W83N.S|ӾNt!Xwkݳʔ}&97nk;u^8ZF@O).Q;r]ה,>ߎm;Oe;8!(^\5=f_tEN{$]ڡ"n-~JWpGmSIy$]to|s0z/3c=^|}4ү?&~7M+y=P19|2ԻA&L5aA7P}N0 qkrf1U!or~o܁19`/14CsDLmsm0lr_ٮp})+c?Wjes 5(eYieen7D\4AO?&gd+e t4*IJ_Ze`yY7ʸYV +uU`Oˊɲ}bdOa!>ڟ-[}AŴ4ޭۜ=V[ڰ5=k 9Qg4;@l'f ܌N3ri+RE2_qK}Xٝ:>)^M׈wbE /ă!pNL1F93}WfY_0cbv1A<Ϧtq?=gL#?Sl>r=|{q 0rg#>ǜQiP0WKpv~T1tܢ'8Fh$mB<ʨ}gWd_s2팋?Q:."_ǐ=`}g:"3piPo1Wr9* f}Z>#Yg|T|Wtg*eb{3LBd o)w$ 2~+TqS?MrrE\X{r kߵ1ݝ>#kbc\kWNq{v*'IgaCg9'!=-glܽGs27r;V#_.'߻]IӚϦwt|jc·Η | 3ď&U<"D_j(/xiE` Ccj'{(/0լ<}ϯ:0P=j0cH.O}VS9 Om)OQui0c"~xq 'BOp_KgC;#$@+P;@bIO XOC,4B#q%2& v@R|lϱV9c b9ĻRͱ|B+/jVv"D9y8#c+N>8ۗHA)?ׯ|Í_8#*߯؇h {]0B0(GL2_A1[#%DdGWcj&D BAĭJ| ߵMm_g8篝"}s~ 87 E1驩wzJ?U)sh3;Fޠwpggg{ֳ\Teq/8KT=lي"VESN?a}3`*N5;l( r&(gR^Yq YEyKbp^v_?yis_,0*XHip!UruMFkːJ;{%"Εd/>VxQ%++ _ڊx _RQx\B5Ŀq>hw7l..Hzmp5|%;+~R,wbR'16I 6(d -ccCG>]Q~#MОM|#dt^鈽U6StdLhLuɼq8:[0-p[ÃCnWlz\ܨ2}e]|={4p Cb[~2t-}bTN'.S2ɬT5?]u*SeuL\!VYʲn,c/#hebe[LG^}'^%T5dY*0ZUd4E2: ^H P߆mͨBw,¼\]Y׺*7[E#q!=[ *wT{݉*ҞT؟MqjU%)r1̩J}^^4*[.9h d ئlW6M>nh_C¾q}'bˌeUY`n*ܪױCR.xDʥu4b- k*/ߚ?|fVw|dO~KS7Z?+Y\ˊ?z;G֟Ok[_3,b."2ןj$Mg8oFyB5-2@ӹN5иՄl@uB+bE#kbf[U2|;W PjU1˘ɞjo5;y`]MեVh\HrϨb6zU'{0w5^~W'm\~~;';׫sN1۾f 1m/0~$)c,cnI5 Ɛ?`oa{;ƈIXƨ}!yvFpqcюb[WDl $L硄~ y?ap;I  39~|t˓))=OJZJbGW8b(ѪhjqG;'3}^bwxZSWibή.szV2g=x_t \ j,G~9݈pWin8_GiĞ(|g.}\P[d+ﰻFϨ5[s,i9$QAұ! V[ug=ꊭfֵ t-2Zڲv>7 5/ͭ-Ո}{a=@ / G8 yL;F;2O8 54S?=Tָ֒Z~+#iKZ1F`(lѹr.?;WW36~/3Fnq^y+lJ?8s<7Gm{犌[.;HC7܈)G&VC HWIp~IBIC7B:l/)75qj}_ӵ>^izPU(#O!Nߧ"Wb?e(1:$1:$:CT˗Ht_1t#=o+_q . 5Uvӵت?Vl5sؤB] "W֮۬I]q }_2NU\a pC\芘w.]Su3e\X⊏[_/iѝ{I*Zu^2~M_˒_5u~7TWFĕa B\Z[LG >(siζzI;W'\Zԓ=RA=# '{d쑶ԓ=>ZO"^lzrD%D7)_4ʓs%FʻU^*CH׮χ'n~A4?gI9ByvfW(-ϭSgO̓)ֵ9?}RJLCcyrE!x׽S?"ފOP@R;ܦ{+NW,<{#(]8?4Wea>ۇd)ٓNsD;x }Gې־>kPŷm(gB5H<A| a_+ ڈNFPw ӌAd>|u>Qlo^b}PΏ b2W=|:1kx ~51ȧ[C= ^|aQ#{FI*QI͗|/M'`IgT~ ňa1(C:i C;ӤxY { ՈgA+dgg kUW;oߚ/wc|͒X s~uo`GeMx5_ҝBV#ᏍrC<)gl#;Z\F̓_k$FrnxG#UnD} =:?GpFʡ.wFߊb9cXgcjo+4FlHͷL7/1yiyTc97ֶ5ݴm?P?{4?r9uDs.뼋 d +Oeq8^ ϮXts#i4{f6ӂƢsX1'+ƋHG&Kce*xѽ5L^y]272'2w ɼ:Vyk|8/5.f:';Q4 N53̏EcYm,k2o,g1gv!DԎA7|5zmKpǏI*I*2f7/"&{t@DY@l"#>Q$7)+6';ƺ2lI-}|dJ5̧̅Xcڟ|n p8zW|+;Ux?VzF66!?/~؇xg#"м 9ˢ8}lg>Bp̍cM^lB7?&t_ Q0`k'}*_݀ +rSMAӦ|AXi#AcIgy|l*r/\vPTv(a(/~C03 W(zG{؀wڧ;d%H;=߄8@⁦RǛ ]t>GJ< =h+ҏoHp~ :}+Mg(ol+ձ -Dr6DljI3S$Yn찓.K7]"./o$>hP @b߱9-.rhr K4=,g,-N@? lNRO2zKm:[{ֻiMom ,[[X:TĞ 3=]AmAZ ܲOmIs:5-Eܮwc閊cRdw##g%Jd2ݦ RwVT쨗ی7Wޛ5. z[< E^:M?U4Su>6uy2}P--2DYP,ϠJbϸM}.dBg)n3)wnls5Ӎ=g:KS5xMlEnsP%ݓts7'[jߩڅJckb?[m[8Jؾ}Ba&@c#F޷q; w"s:K#p|1E8F(wTGh803!ۚ,,Gy5lg0-2Т냰E{cd 1ĹX}qh2o}ݴQ @kUVb_T~ s* .p{w܈t lsNuЂ4tFta;gۘІr>!]@QoiC:lAXĿ`uѹmfn(-rF=Fɵ~J$>` F-QTwLxod>ʴR$ӱg6&&QlZ\.M\(rP6rl ׺أ,3Zg:1,%q^h+Lk+VYԳ^[][WS$'ժF?;P=C;YxQ".6"7^gGG9Jr-%(JN.-9' N׮)^Sr`_D x$Hq?$c?wt33ҙCFcưю1b)Nwt9LրΊewiXbsvܙ}a~g񯲦WY@Y@,::N΢;Ytr nPn;{Z2}qgtYF$D?@c;WGO4gݦ+>yI6s/bWkCJlw"Ʃot3 nn"A[ ϻCng2޿LuH2M>Itnۍ!wv#b+M_v_2w+F.r=GInل 5و'#áwzѺdl&ۻ ;MwW$[cķ@pBRn?1AmY ~uOa9& U z%?5qNs;}郸紟:,ϳ`kuh\>4ܽ@tHǷ ~91QOq^>Ώ}Իmd) [  %nF" Y>Ro"#m ĭ~c4!c\wj111fuql_֝};c~{ww;7 ~_}ܦǏof~~E]o[]=D~!6#ttIÎ$?G8cuO  aw A:t3fs>"~@O{gzO.8oI =1%]֨KR&\OxgנҚwOv;{n^bV ]A^+KB0l%sP/g$zKҫWJzڛӫLưQoK2%Y02#x7:g ~ ^-<ޢ;tt (#>rG;?n$P<C܍ָh[m>4f ?cFdXdK$Y<`Vسā߹U;|Ѽ&tCKoW4eooAzH+">\x࿱:HGYt ҿB kua%q1C̯8f~kA #0ʾԾ$#=^}}eG8za#qaߌ#HGD8:8<҉b4L(G{/=맬3ҁ(gwD ~ =("=6I~C:?ҫ ;ҷaE/]Gg!}"{H=FZ!ǵmq{ ?Pؖ#wSJy >!2`o o w w@o;|!+ V5C`JSs_hK&jP_|.Sb %bYO;K̗x z|=rFmn 1(1e8* ޖrtƁ<8n30^>1uh0}4%GkLk뗚0l0ɫ0aSrzoCl  3X&?4Xg{b2xw0s=&Z{I'9sQG ")5DSn9{ ΍b;ODuaCDn9DCbr3"{CD'nnY!Ch|!ndNd^Axyg-߹ ?<`*2Jv,?TTJ<> 5T 71!{#iiD^;CEPgtvѼ7OCmsq(˙ 7bR!(c. #Gآfn#`zL|e䧶H~*P2GAal潜ASA_|8㇯sK3q<;X(H+ yM8كtټðPtDB=W(W %) yϿ/T(}k(QejarZցoe fI>aۆarƺo{Fm>alhJ Yr<3LJpE8}ka&iong mW7gznrfo2\|I .$ XC0qgCzOb31eisNgpk0K(oG}<3eᴞ ]Sޟz0\t?#C~yYS֑9Be3i#ΆA\Jb;!nciA#FHA2l f[ņAzM|K;-[>c#iϏHo#.>"f$NsGEQoN< u .#2 1S:iWƭQmGќ˱moeAh}C!~2QF%L= sF^V@Nz*7(yOx9<;;1ius!K-gmuqǣ˘ sv~EX:[K8Wcwp{=߁iH%f}!"[(|vN-hؓ7q?g6 X>0aљt)b)A=Ѳ^-wJg81R^<.ϓ~ü֞r|qѷG |VFƦȽ`b)OVz Ycx~'214Z%vđc f3IL22nI$}ңcn 9Ƥ=ɧӓb'_`I179u,ǷINc $'d,H/c0=n2%e %f\Nk,WA1 z)O@ʋ'R,:w{KYk?O~'hqzׁq0FmXa?'PEㄏDKcpt^=];,Vcc'ݴ~>,yԭܞEތA4txN96u]ŲMs|p <d>G~i¶Ʊ?6xOxbkۣaZYvk\rNF۱)[ m' ;ۦwc<dzIZ1'(NK+b$\ɢK &~h\_AnTEog#{f<>Be n<;qUQom5VY1|uto^d[+~[4idO[qkOPw@{{~ȧ=2"5|uI&fO W`~u~W |w?f?::«@;O1d-5->}nD;3)5Q(!J&#OtQ=&>@5C$Om&Ҟ5i >QMcDM(?{*O9hD!pKvRN,f/'f{6Iǭ:);?Y: ?{^'_;.c @`g I;ƀZ6Ib&G#Rrs`$ÓD6 74dyppO" !xbؑ?7I_$voKzWQ={]Լ2Z-Yk-YK>"kQ:7ә\J *YK yK ??97|Ħm+{;}c>1l_$;nf)cɯ :O z ^/czɄri9ohXT #d LY1qCDmG?<;jl|+Vպ'0KԽ<7X6YLߋMߋ&E"+N_NW}6S'M{`ZDS$ߚSd?EdܖSDH>0%.pس":MSD{س&mHg$+SDyk<NKD7j;+xҔǀ'[ 6 ΩԮMN|6Vsc7n}Ec@.t_K{et/:tY.t7@~NpyͿ! -u _zo@nO"cvA3y%Cy8曇݂8uIGO>mbgN-|q#N=r8 3}]K:J3)WTM)Poe,1 !xHͤD3Sl&ϔS㖙=0?+C 1޸߳Am 3G6Sey]dxIl~RΛ!]YMH 7lF ')gWt.tc7Q=1+5}yK4LglkzM>*o' Ymd:%Io-9ھmKkY3\$-f\5G"Sdt%ꞳD?:`)͒sq6~,cKz]ҫfH=7CsJvmޫ9wpڧ}dm0[b?|l㡳%`l>o6A,7͖{>f=-/Ζ6x}̣SEl9Z~Blf K}*;2bch-צ ƵM[}o"wwޤ-؛{b,0ýӎ#WY~cXF{g\'knqx'5Wf^,~4ѻ:yM[D`)|9ٖ`xN"q@?!kI?[xؘ#;0}Ti'W;{;1};鸀vg'kGR C<qs3琞o,#)p<c ӻ(?GևG J=sn#z9sDFa*OY/a5>gsJ?St<  @y+ 1ihTQ]lb,2ͣ!Cxdt7lvL:fÎDr<[=ĂFAnwmm>vܥd輘>!=yybO|byX_1FyKgDLwum>}AeR)nͦ=X7_l+QW+뀷擷Zx:v2o>x|zd==?&No 5}rqWueS)}tțpFQ5Ϡ7}孳@lZ-6lވwx74! kw2wp{o_ } !CRa]@2Wtz!KY:'oEz|n B|ٙ1я1 !eƅ،&,ɝ!mvĻԱBc1"!9[:Y'}ɏ'~_ |J0iLWr󪈾$?ܸ0wkzěPl Z,{ ŞzBX?swgZ73|nYP>m3" %K&xjW1׃To-i$ '8x&?zӌ-ˉ1&%&; 3xʽH1_DLB|1McsO 6B|'DHl.xv<퍿GL#7Vz[Hde۶H{xcE#0'l"yo2O5/aP;$>?E@~Us +F҅#1֯b 0< !XX3<{YA yO~v=ZXx͸} e glo3?vNzXkq\z_} M(|o/q5i%2n,yӊgBD1l[OPy/N*%gKݸDۖ^":?D3KDyeQO.9vCݷ|;sد㸺WL.3鷀ZڇciOu{DTv+(8=Kŗͥ.j/۵+5e_kb˖+lKVL+)-v@S/h㎈Wpug Ŀ+nqe-Yf{BcCĊ؏{m+c?v[Nh@6J9؏}8 $\̬3s]_i_u1;c'.>_\ڃ֯>Sl_)"Gn[.:}E.:\XH9M>&<Z}.']Y. ,9VC6M|/?.=%F$ 4f>״so:bSgyX9H2[jQ]Rth~kf{m+-VH{@4hU|1sÐ|5eVBl:筐qH䄎,a 9KشB#Vq^!Tsjiz8xN5No%_ucԸ6RW<@)+i^ƃt=b+徤y^p>/WRFn(~XoG?CBưcb'_1}%922v0K9f&hjw:.BՔmx7';b;dsل @4lę.{4ьgPgic:8/YJU2n]%lCc:JCRGxR7Og=x[ߋJ^MVQ\,?|Ϳ!yǼ}pf9j>3jp%>mդNj]_10406F1FI3WEmj{$풿^oaCLGmOK:qIg?%쟮3엤\vn'mQ{YIJhB52n!qӀZD=w؞]׈>S/8?׼_DD筑n[F^#k}kTwJv]Qk#t;Hc`8akOǖ[Fd_r|Q_߬ҀQ<}guU0JzN5`FE٢f9=K,ǴϢ .jLWg br-'ɵԞoboϊf~M]7׊ίژރ?Q}-er9MlS*΅Vp9JmNk,eO)čC/~?PC)G%>_d}+C )oʂlB1 )K OPukܴ.Fȸ{-de fS~Z{c1l_'zop1 녯{֋|^s 9x1QKBƀTPdR$?czwzX'W ?~V!nH\ xYC}Wb_^X!%āa.f\$,!N@;1+!J 0 !vp6!:!aI M QnETB3p !Dr ! :dHp"!2i7OneVbm$PڷNKGsƼo .ĭֽCۭ} }i;qAփ6zpq/Faހ(AkS_(e:%-jnGkmFKnFt(=6ʚ7Tg7]7[7Oa%.633mB5`F><i.^t d|?/od6}G +|A{(~X^m7!32 ol"IId鹛VR;}KWt̻|f|0mϮCm*.>_,M9y֞?<76藇|sއt UQ"U5.7νHߏm8>E21#A9wG}a="6+xgk=^ΗYr^_>櫺Y__ @|fc(j,c [ ljmfk&lz@|_afYgoy{y}%.M^AyfkzigOֵ7#c<OaA| ?YW/[HQ2.rߞcQKmޠݿE-2'"/s"`<=d#ȹۄ-sw{9/[Eb"1wo_U-""5o}[$[$k[$[Ƨ[$[G9DS!m9!S۲7DD 5ǿ b9dsHo"!+Aoh+hcAi_@sV/`V*#pt>UUb6UboǨJl+aCb<Ok iG~Rm6_"·_O|isucҸJN|$@D؟T܉?!i;nG$잍&޷0vѾҕ$c^Y׍Yxr"UX(X=Aį0}Үm݉yUbxlI#v7A(.~2ƠZ=bjm.Cov ;Z;,} ^?!#{_NϴgR̿`!t;v~-LWv8C|sI_1fk㙿L3; .6H)mPi'w_d_SzȝR;%b0)}r(DN{S!^iKzNl.r99]R>&xנNl.]R%aBʝ,NJ_Z4}ƘfG8}{سS?K_DL'8}NA۽(:}3ط$/?eMa5V.d{#Uz7}ߕϾ*'}ڳ`Cƍ7-ѧӥ-66vMbcDl bc3c-{em1Aeӑ~cMvݲz@tſþJ:!.kFi?V=r]k=oZC=~7Dy/(to{ } \O@=X!- |_eUL{jܧ`압Vj{M}G ULsZCi:ӾjiX=ީoLy=__k%k[ko{g4t>گ&Oai' K Sc^!ʹn>lE oh/Kz$F~H݇VhɁge0`c0<0y"0$}H6U['V|:M"r`'~Kui<3Ԅvv~1C~U @~9KokO?_$X聭ؿ_D>D1Ｚ_d/m~;9vignͻ YO|7+,ݕ& p#bvii$!@ޫQ\/])L Y}ذCqu9Ub~vǔ/\탳ƒ82"TAigò~3,kaYt>,ᏰA䮫/@jd5< ?w|~'I6IgV`TTTЪEDDPPQQ4.Dd (a eO{Y@YeIR~[xsssǹ{ι>hk}=vCD!B C***mA|?ӧrؘ2ʆ*4%Z*g:tլg6V\AަVT|^r&:߰كCiར+F`}Wt'Eԕ+32 POf }e%cNFGTXa>sciWI*]@pWr}ɺ:Lha"Ӝㅞrn^1\ha񴰮Sox7.SJw}5};F i6. ,HU|VcˆkYlp/;\G+;[O)brơ=2-#>$ wS8}N!!~ I Mat *>·;̈U{3(6>|vZ^!}wD܁Q_ `tڙ}[䣱B4nB#&!4i#!rSlȏ#E~c k0FFr=zÑcP1w)~-)~-"^7(Mpܑ߰d7)]t1df(€6{}^VNq꿕Fɼyt"oD*z*Z8nw1 3+=}><_bs9/>4B`\>/o-'_`%^=hb7=ϧ5!ʏɏڜyӧ~ؚiи2f<gZF,5Z(Z8GPkp?1Z|4-wGtԑT{B[f8,GLѲvz5>͊2~M{XgѢ[ϘFb'1c{я1ҏchɻݺͽq~ !v3eV{ C1dcN5f_3zOg|=Fhk{M?tC+?z8` ar3} ̃Z<~ c%d^x*\.|͐yڌ{^-Pt꫱jReWFyu7s^8<֢vn?3a,sgFi]X8CcgscE/X}s~8VӾ+痱2B{ -%e^"F's`7wg9h_夆w>NΦ5}FQ;FsҸxګ+ g_?8Nj<̈X{){!DGjm'E<8Qh|9[P⼉2=`H/p8[&e&T1`jX48] N0gvm3I֓I zz\͇>h0kN~NWvoni/$snϵI?X*Mf9v7zdJN~xfCLoNym%}49NCNә{#9}dFL7vУɓ͘,hd}^49N-x;yPѷɴoջɎEox㓅Gd\,@W3"PlhG;; |S}>>v{C&D[>/@hX;! #R{T T JoWн×\p:_… fwD}Sפ4?gГ1/JJS ħȍ@|.2_]F./ dz @܅tb\ouz/f ^W8[jlYSx#* Uywqn{ U~VrySԄ:Sd"gSGy)b7yeyeye9DV!cm".ӈMצqt0,4AmĺN J4o$7*<tOOҗSEu*!SiЩ|PP_=S̩2.ʸ*zTO5ހ)wNs?qǫ2v}2߯L3 M?$h4c"wn˳Žݡ;RQ{BUnNïCwwș7n{{8FndƠFu~Z4ҏCi'/ C/dܩDowA!鿙&şb}&x43=1p@ہ1k&(,4KosD!W+ޡ>ՃtR˙;Ϊayܳz{w_ p)מjϟ($}`OOgx/L`g\[$I[&y^f/m?pL|8}:3fiPġ&bGp𿫦)tmt pq:~q˘ΑyNCdTz34;0>cQk}z.1*@9?bӏƫ| ':DžB4.0},w_E1g '}Jf73w2{!Nv33!Ԍ3pYJ3e!{hY3>? WBnI:1A3~MuI`n4%aKc=ͤ\n6r2jYŘf-ÖV^$'?g`^ILτYlnĕTŲ6e/p,5%&%&0g,OY|>C,׈Ӑx Y4~,%0hߗ6fJ[%udD͐%rNW&S|?Pa.Yi?Eo u$6?<p=9Cpl ye>]yPZh{Y`6 A'ƶliw?İS > upLăw>خyl1[ޞ{%Ԅ%ΘC bx^sd6Gr 2}m9eأ suY=ߴэΥfsӰ}>as@bv 6?A܈ n9r)+qJVsNUf@UFw;}Z-Ľ>3{+j;C_}gK:G̕3|7{ع8 ^N*˼v9]1 oڀm9 _dzaY)͕5k's6O֢s%}d V'y^yk<9Ok>Od - <8OhJyR7d0OnY{|Tq}J_ݢyԏ'M][{ T*R:;O|&| J_lFQܕ9_hgg<_R{b(Ώb~(5O1mrc8?r;}yN͏x՛Okoo8B ۛ!t)g 3x}> Ok̗?EQ('O 3xu/^>Dm$vB4Ug= w 㿜/ 㧝G<cP3<OK"^tA 3dΰG0w[xYzĖabicpBN$"KK\wإj|ha>=\D{^I y`#dadrYvy.î"뱆q4e&ׯY]0y6ɾ0wWLH~1ܐ1c8Met?Q l#aw>S.62WоBIѐd'h~\.as,W״LRa[@[Nħ H#v^ 4S 5Lop)S{;, z Z {w0tW"Wګ 6iׯ^si.{!;]EvKˆBWw/3aK /|FK Hրgօx\~!\2|>wJo|kmd-w^at~2 .F> ͉V1et«>|И*4 *?,TDlwpXIʮ 78o_o?\_sz[ٷ~XHcc M E^b9x!0GJs)Z᷂ah*gWv 3썪bvڔq=`[T ElxW}CQtһocބܶQ,r]K " 6^fWUo/bqil}SLqs6j#۔f~3~S yQ`S>v-bXa(C˻|x7#ϊɗm?-bCߠٵU??Qku\1ݳJh./ϧ8׃D2X^>/ _ ^s"t_$r>uΈ4q_XЦ-y!mcX[62s[<~~"9\X$D+ao/+.XL~S.⓮ZDD \4Ub<>xi1??"xg1GdO [3|kgou,9`Ţ6xExxf-s"g1J&8kRD;xe/v){X2As5j DҘ!6r;wEџZ֟C|_^¶bJE5?[>X"tQ/{tKqtc0KbbkVx^~,+.3ƟK=!xݡ-={\Dì%b`3" 68 _qҎ#\\ĥ|uf.%]"k.R-.oyئzW8?;jGٽg48KfOprzB#m;`9_؏G~3+Bx V~,at_>%{+nR{rWxQg\c;ƪИhBҗVhb(L1}2qu[Xo+XQ.c=qtƪ3ñ qkӼr-q\Bu6{+^\A~pR Wb>ͺRUJWV]ՕݻRy+OsSA꥕CF3/噾L?͞RO)4f%ݧy7/+Y`4+6:l.C:5bY2VJ\݈\!ë]LJ WQD9KymO`猡9]8*S }Jqk*U`U <<3Ba*?Bݰ՞S+YS\s߽z|pO. h1]%a_E2QÿL)/3Uğk8?5a+nVtKW K.4OS'?&]{rq֘??B4dr}?#QŰ;ǽ-q9W˘UF\uݾZozp5=RoOʹ[tC+:T&@ZDM1 ejZW(UEW;;Z-wq(3:׸gq3>;=q ݃q>ZlݍjnrxY j.hö52\k ho7~F޷FATE܁s*o2'߳5>F٤5Fx[Fx%kDw=F'Z+ww=뱵dVt}]+kEwZI_VlҷkdY'6׉M&ubX'6du42ݪ_Ef3F3d fyM`['sU|fDqk yp{Hq]'~lx9@gd aɉrgCj2dWj <;owZͣ봨oC= e>58]'%x5Oh;݄x2+~w;M< ua'1+6.a [#G|g {r^àrǛϸ&" Y$mgb̷G#oӸ C_^L_^L߀x鮨2߯azEuI+~XP,?rl:lߐ[l^}߻6Yi}=؟;̔oF]ΗV~T܆ 0ȗUE 6ɒ>ۦ h8>xq7S6s28Tw|rn*Uh>迁ul`b;Lb ò盱:fmچ ~~ȺnPdLL.oTtXWΩeQ=EFg6Vk^blJhA~Etv#a:eq=TtdNUQ؍ҿS~>؟nrǯO/-KJ_65星ݫ6 ?FniQM>t9/G}F9;Mݩ0M6wG띜fb1Uc|CDf]{S[QUfB;&q;g:q.JOD " ~Xb20'dƚ6@96jsqjw:~L{*?+lTn|i.mFwܧayO$zTgpf!,DlkMe&l(շkS=Fj|MZtPEJ!ϩmUR 5ol0s37*^Pt8Gb>TWs7˻yŖЏX!iX[#>nfHgϺwYI _!Ο8181D'nB|N܇;XĿfI[851`ޒ ZoAl%UߓEܙLjJ~%wHƭ1U"g޿վFywaE%zˌ> dCgj^wUE1"|䟌>#yD~qPsFi6doE{-Qz1DwrEݾ\;;χoϣDg/l}PzyϾUέrBqVYqVsƾqDt'}ogwZz']ѶǝNUVٛ!~i_*45/pͿN[n㻭تTJoN|YF}$y)IUxE[*ߎ=[ǃ[vlPZĭaSNCiAdom|ߩ98kocx&&g=l"ն́5ƿ9 ]2n2tjz` wWr7&2gəm` nۨ~z+Ή030x~^O f6܂8-MQS{cn>3,6~ _2'QumA_{*ݨmӈq>(O4e_z9G~t>1AnCtD4_nC~Kr/&25{c'ؙ~7P-szrp+⯘vC?oOvg-r8livD,K,3B7|@>ɏx$C'C)10h;S"zIa`Yf[1muC}گ~D=H*I$Yɟt1d$;c8)k%ݺ}2;8ru01c(LJ_r"we Ez>[cm8cmAN7d+vJ9}f٩7];iAm;Yk'k3!7cщ1 _C;Yыˉ82BН"#OmR3Svp"S.yEksRoEV<@ƌԖ#qIїє=>-}vz >j;?LBf.yCb.3gN"rL櫻?-<,ɻ;,NƠn&YjT,uK,+! 9ݴ} GGr|Ec-k}G3o:^s[wr4t㰜ѻ䙈Żi~)3lK'kD՞q]p(M4p[j/"K %tnB3zV4,r|53U{b%)^lcWJ{EB=+wOvs̶5uH?G{Uyb'|O[=!(Ixq8=/W㥪[T,wױw޴Ay6 t[T6?vRָtX|؛5twA=;CUy{ٌAm~KH_ɸ\ ܠF&ǁr`-K܊[{!#y\,}lO<=pCq(CF\AKohi;A-k/3<>{aί ]jvݪ{n %}wr7݆ c#܃Xn"xpiޑ$ϡ?\nq|;)6^OU<^g+6(s]^=j d>S٪^SdG,Ae<^Q](G/(xd^zKa/)رW{˴Ol/Y !vi4xG0y>ewmK}1>]9a>ex/DjiT\.7/9sx}>!3жԈ̥(#"e ^_ʿ͸<1ݺ-N6{""󭋘7%#, @[8._1c0F h0{(OwR3۱5[FA>%+(B#bx%+lyBUE@i{U*$}ػ e2iA^U wXd| c3yQUAB>x,=_(roBٻƽKL;\u8s$?._p p@?jZ(ӏA܄D|17׾PeGbIt(I9L~ M5}3 -i^᪰9p{a[b <]!1 -/woe<;0|׺HXIzo %l*a8 q;{0ꫩ\\rDsc"!}9~Y' =ޔ#X ~]ӵd*=(DtɃ,:@.ax: hz@d_h3pPy:(ȼ!-ѝ>=RCcu##hogѯ1e k=rF70]߯2")W?)3Pd=囜}æW,1:J:Ҽ?Y7:T|;C5 AR t ROz:Iֻݔ/c=vrx'kݪpU?c75˲(oڢuy) ,|9CB~ߩ.fyKe#{X쒊]=}3w;wc1|!x{;xO!`񼮮9$k B&Ԏw=!s_2 ?;">"z~c=U8S{+Wt}5vv)w2!zͳё#7ґ#BOKj/Ծ 99>e?'$x:O)? m8;v1~a2~ zf8#b){G̥#GhIEW(XUt nGGۊD^.ؒ"[$ѨH"p|7O" T7*"~-/ ɽEcj :/'%(oj趮]%~Gi0,.*tSRq~q+tA @ptnx(dGsj]!lm QbɆ?l׏0pq{qǰK j#@~e:Ӎy1S~fAF? >&v~Y'}tJ 3G,9&t&:kfqcNc2'`cv񘬿r^|摆<"ǹq9N"y<8Qe~ ˀ`rq= @^xxhEEW攣s)2G{{rr\?=F>Wę8 cq9oL>.o)'޾bFH;.~!㤳\^2, ]>2\_3)- q'U*fՎj=Z,vTyŲ?Q,wMEu>b;NݏC_ɯ XɯM/+i ^/|"-@r ;1~eďzY=?KM ɯR~a>)o5w5Ơ&cTЄ1bj-$7w><{F^(tz3Mt'7|YlV㕮KC,!b>ECZc52a" 2`8A?@2I2$p/.G2q9d>42HSd)4\?֏gY?B< <6f3[&*)"t^Qkۛr׮Քߑ?7c\c?)σ:zs9:'眕.]0ո_h8?м"|\1\ 63_>':y{vg<73MVXɯN+ٍtsc o=c,텨LU.L.J\~kEas1RQv0|Y'sr2Opf?N#19JϔNc?rj/9R-k[*e#{c-%zz!~ q@T*~߀17jjS*~0?5ҟ6OPS?..+.b bo\ UAS%Lot7OT>4:¾yku.gSh~AcdFx#생8_s8h/i_D̸ zӻ肼6[*9 ·Jz8u \ ;}]Mt/&[^w~nfŦE)'/M&laQɘ^CvI%楡 Z1u{Ixqcy.*7dmN$3?u!Xk|~Y=M/W\~\K"{?yIQBˤdЎ];4.U]툵Zr]*d{Yɂ^t&׍ o;.#|e/Ac}Sޱcw(r42y첺;Lw ~84~igp]z4D֕0G6oN!"6?|E|C,htW"hMq߼B>xWZPrua?!6ioᰩ -eØf^3/x+{% ӴCᄒ+/"rm5JV Wi5ү%lĿ,ߎ*USx̿gr./)'^ToO1*wCp/JF]w@wBwkYs]qH&]%wUkѝ_{1EKXg/!|jݯI}I_vMg5Ɉ/{ (3P{wחo^kt툘y=xo7D^ؗ pX 9x-︩LX2;jwz]˱,E\QJ~>2pLALw$+ Ph!>8"}OcD𚤃$s]W:mk7tPK/Ydy;iLL90äXHoc"q.t!3a5u}.4 E9໎n}&Ei܌HTt?ꡰ[sA7u.<ÔNğr83{ryMƆQZ5Ʀj_ۚO t4^I_o\~{Z0 7lH3yn2[C+C "Bd]bǽOŖaS '=;~S=~xNqC}$GaVb;NM1 O6|5ԼFQ+}⵬>qfj[WPhhH2w@n_3czIF"<* קJ~}7H^& Ǜbt%c\K%B-%ޢ}FL'$ ɟ'O$>q#Hu[J~kO&I$>i'$n?91-Kl9o{Xm$H-$F$;xw!_%>OOɗ)2[S;vK])%>uħivNӮH|z·L8'qD'D'cg> 3gn<$]B^g\0n|8_[hr􄫃 wTzpu=JO#i#h|L 4|Mg&3S k==yS^cqHO#N@8kYh\Ԍp8.z MD_Z`tQE,@:O6IȫIkPqTC]SySAfoŽ:f*'xqњ%<7ŸNuEgοlP{LķͲuDNiVs*2 ulE!\N G,i}.2K-@$ݵՈ ?…-{tu)Sr53lբ _q)n2cy#P[5ZY^g h!D>3 b/1djϴ NCڪߏߛ8zX_u?'",D:/` NK('Nu]mr'`Vm^zk:DE^=`i T^X7@b{Sox'T.*Kw?@󦋚75Edo vq/ 2:#nC^Yv`}vFКKXDSHBB\0#`\OI_&7-b?KDF6Ly__Y/[ aGRkˣ'y|NVOՈrZHuu3J|XʹgMY1cMg3aD[˒k)m:2s+0%5%^*DKy>QD9Xrd MУ Cόh URÈԵҹѯ7߳zsŒ^VVjU{qW8:1!Hgrђe,cUhS(+],~m怶ЪϽ!m3cXheWOVuq=mib7铤Xy=lR"JxUZ5O]MJDTT??c7nnY$ } I7$9SF7'#Ɵ3ۧ\jLVc}XbcZ?>=9>m[( roD}ﶂ$='}mnA]Xd鞈I RUmf ^0hgtEWU~\!_+[1P^eM˽Dӭ =' dءpbNpsВBKJZR7YhIsx1:%y?BC& #YA>kt@mcPSa zic~M;<^e5==43&^7PPV5yKp%ӈ#l?b:?e% U{S3_msl Y[߲D?vrrX[/`؁lסH $kzs "]w2v{A]Ɓ4Asg-ahX؉Ѕx1X_˖Y] 1g>1Z/`䗧0{Yle֪/(Z}]/'3ނaST6|ݘGhc*GUKd[8w.+AeJ_oge9'?!+_Z_|Ȋ1o| ^17= zE ,!49m&{ZcX3,a1;Gp>FƠ.cDͭ%ě_zO~~Ơe[H|O8, %x[[?u8RW+dWIsݍ'/иGZ/T唪6Os_4@EO9FȘvc>c CgZOF֟ѯ j,kcvΜ9u#-S7;[C4G*Z׿A k =*KhG@T=՟MN%F$IguF/ǿ#ϙ*wBzҹ<R*|*Vg>>݋lC&Iݟo_ˤ^`خ/V2/tMJ;9Ei?p/=*[PqK[Px^! ރlap-U4xnF/<&H4ŋ V#/˜ 49tKM49 Kޤ Mx0#hӄ/%c_tM\!NưcD{W}ی~#c@A}%>DS$P6H~^o*KߔMaS#Be68vo oKzwpjn[QMlo&o,bË{U:l5AtL{CeKY5W$^Jj_%j0^!,AwC> wƌڟF)8I8/d|!]Rζ'Lk!bXuD>H҄&bFt>_/0ʔ>2Sʟ)W3,v~g)²[-K͜.|N<8Be MV0ʒVD;o+ Æ,V֧lAV/."[3ݨ|NWCWOPz4~`&ݷ}JKџײpkkw a؄ 31M;vWV+t+zE753گ_mEدP P.κԯZnvI}{K^bQcj]U*X[PoЇ[T3տl_`zSMл .T?!NA'?ڱE7vUc.GK]jn)< \nqD9T}TZksb߯~T^љԟun7!b5_0F;F~ai1m"3HGgq8-r*)_߄xϼdH|a<%g^3KLa{dGRF(ћH*I5sE xj2Sk1Rx(ڔÑԖYF7UAIO}_Dz~0"G? ޣaa R:|#t: ~+tWųb.1J^Ro?ɇ1Myu+&ro=zx$}Wog mmW/ s1zimN&:4|5R^>qD̄/WyWMYr^Mϒ/KEau 0Ly 2ce uxmWzykغɈe{spë{fѾ {Ixn,ңͳ͹ Y$V[A;+X* |PAd>uZɯ Dɯ-zɯک ^*,ZE ,a [}k5FHc%g'5e $LB'I%tɟJ'G$Ծ9n^(m͖̖-}_w=PRdKI^Ȧ1J:(ӆ'ˎRoީVs3qG,t9+M d qzHs{{OW#?'FZ='9ebљk],:s$^X(Z_K>VUP{JV串5GU݋뒂.vS"jվp>aٙOǜc@j*$˒C( Em&쿄2]GUlq嶑0X6oK WqԹ,w"We噢rkN^eş۶.LTc9$\hga4nUCDqveӟzyG_р֥VͿY=Yu7 UuJ .F"9r$|q]CI**(MzTU;72 m{B&;HIq%<ʻR4f+YΥF!FA`ԏ.g%<^;Ty APIX͆N`;Xk2C}zG_$l;DlmfAKPz{MH됱]MrN*$zC|LHĉQ~RjRSI/:V4_: N;97U08/҆^dS1&;|п 1H',S Q:}C۵`ӹu ԍqDe\ѕ>t@k߇ q oE!ҭ{$m[)\Z e HJlsuQ:YR$+_4!v'#v6H3u~d /,^3֑ɀy߷P˧;W|&}0NF8?爤]Y!ivke!!O`#[q1b4AI>+J!%ObJ$ھxSh'[ef!oN6\|)eA&L"}N|B%H@F,^ͣV')R\fuAMiI[:Y٦1p3tͫߘcm!e* |-Wv~s3<(,Ā*M:~ʇ[{l4,YpeY&6mgD`XʢLD9#Dr0YbxcHK2l8j fVEd.lAl%5x6 E'X;V;xPJWJ Ôm*L=(‘j(_:< FpX c6j P|@WdY eH1$G8ISZ'3M.WAhq^V׼/,Va8U|%YJPY+nJ6 Y>hqdJ#\#~LE${ؘ(㋵X7(فQ&瘗+)HW#TplzB[>Q m98tsBl&͸ n AUʯZ'?lU’||пV6]> }!UI%K % ) !ڤP<;U1epe@TjٲjUž :qʺ|XOh K9V:Va1H_$D^lQa_4TQH߈!CԔ|V忕NӒyl]֭CU,.C\Emylx`ac:pE%Sj7pRACCePHb>x9zVZOKDbhRVgsOI1ɺmh꺠>i^2B#Y9Mu_. XD|„ >T^1{R8_b%Mu !ʖ(+n_؇I^~cq2AiUKӥl!4lsc&5)W酼N@hsa)!EL+`_cˀ-c +fDǮ<5Nq)~nMؒTeVٮ0˦Tw#N49hʵA5],z˟"u4?-dZm2 5,vẓɧA>{A`h{_? MRF~06v*OЭT rc[rhQ ">~=*۱bR*)A2t}{㛓}v$W7Ë0WYNfd'dDKӔE)}dXR,n~j`iO;/{~(g(<{]0_v-;\KGK(\ ~(Xk!s|"@ %1[lSDl vX(>üxũˌIڭ"/`PMd pKu˚C.>8VD6ڣ >y`;z\'xq}/Jj2qrw洉'7,Nk#Dl m3\ Pni(# { xdPx8Z^FGX79 ]EԌș(|ӌ90E;d+-l  Z6.^*hDeۻC͟˯nn.; ڬc5Y[VC٪ÂS[ZչyNH΃ԃM;3x)z |ĝ{OCY-}RTtڒy_xﺾY]=G Oǟ [0w鋂RuWo,[,# B#;k8!!c;،ZdSH4B=ʲΏ=vR{I#NfݘAsv[D8/0v؆dƄivl8I)7x#O46荾CվA>9z&O1&NKMB/yT5o{ET+hFz/^Blt0\Wpȋ|nb+a^cj1GiéqPgar0nv6BLS3WM8mez?.V@?=C<,ɉ4+yE¡T2Jf+g!|@x EIؼ/SMc y<7a b2Hkr$ euN_23mǁM^lg0rXhW j郋Ғݘe:zn,wƐ#r>,>ډk$O\AXx$>)vvNA/s}>7\K6 QeMdVKeEnh D"nQBSL# h\_vA1-LbU Ќ8L &&ƻGk-J.Cv"Ĭi`yu1ZǕ!*l[?M}2)z8C-}( yz@3]Y`j; [*z fI]V;SoB+,\S#sNcrl (aE@:[/8%p馏`mEhX]@oh_=t|37ɘozu333C@p m"eb]hgD#4KNНb* }ħ 㦬ʡd_u=# , mvBOBRXR+>nMfGEnm["V[_W`2NpؗK覛1N +-]x \_^IsP}y=>?.D_/V߿w7w_QIv?>WW%6$/w?N}(wHw§yx9I>qJpnI?'˻oz[/xqz|8&ŷ7mn.~Ռnq{BY]Ү%Y}œA;}zi[[y];2H]ʮPP^IFcFNWv{BvE(C86NG❩ m#ڛ Ӡ@T df? qi# Q&Pd(!.aש0`KDbA66m8Vcj((RG܎Ƨ `hܷ GjJ'BkF!Ge\G-oc PzM&jls;*lBR}D-M,ol\v?pw.zpc8(ܺF;```r=֔9Jll- fjOCBZ8JEG]`VXcBUKhZI'1TO/L(kC6-٩`kpf*QOLF󓸔<9 t9D[kۨ c>e"Ǚ)s]#ĢWe1|͉X9 {hab\]).%Ut*.b)8AREN !6˼܋#K4s)g}t'bmBÍ%J ':([/c- P nTZ%[dBjvv&_Z,2$Υa e Hf*/LpiK5zX<;H.U7; EB-+7wu3eF OJY豢者sCJ>z A-2fwT΂C%eZw0a{' 4vt5R*HVrhKSȢ$< ݔwvk.{VeZ'$;Dl`aӾ'eؑNjd_=>p~Ϭ=7Tm͜h'UGҲPy7=ީ<P߭y*d},(J4bcӉ~~yT')‚ 'R~Jz7dЇ+'*:oTtp m,986%Vܦ.fweH i9!c,rzzT{0G(cU%<#J Ym!Mz`R}.M\D/Z8 H c󆄽-hx|XR#Y֝duRpY*Њh-f^)JTIu-Iߔme>{dI]v%< erɕ<ͳgE1".;zUEJA,TFEvPex\VwuΧ_dF#r9sS7ͣ Yzǹ_ۅw%R~ RxύkDE$ȔnouO{KKLf =oQjEqx}}kʼW+ABs{w}V-ߙَQrA,teQt9|3Ãh4%vx~D1USh>#vKOb/5;9~:0%)I<@Pf@ɜC!R%X4;Bd0'KO)!<iLI]s"t9{[ LH=lEK]E,3aRU<{,LbMj~ABJ'1+ [t%ᴼ$'kCVEQ9ŕ|QIu+jJH- pχcN]2;`6]5(@hӲU0=Y)ۍ`#@G:r,ePܧT pԍ=B|L:̘a^S&ME96(颕S-x[\~b_ozo]y#҆8,%@:T|Hm9,RgNllc GvF(;FOwԮ%r-B*1'낱4>K-h oEIlwgD83 颂m߾O)0w)7DSg[~õY~.A O3_˟\ G ^ߩ5Cuz#.6+ _2c )AASkcY V[cȊ+̅,am|p^#M/ ΛXT7 mCsj+ s8× j# ߡC/ ~9;?GɄ5%,x72ɷ/9yP7Vu4-:Зh)f_\%rIsNs6uR%ӗ{7Uw=3f-5H3;wYEnܨh@MYZU*!: 3& FUuV26ԓ͕h'#Ȋ;v<| ]2j0W fak]-,"|\uZQmf:-%>΂iHdb[ A Ľz'/GNjǟp.+7?͇F^Hr^.XssHu8ugTg'[\c`x@lU'Ġk.ColBF)8R q^fя&6o(aTڔ>@]oiƎW תTsCi!- ^&'SW2ST67`3yg:R%,kY߮ǹ"ǻno F&1 H+^/Qy#eJ3o.d,҄oO̠+89(}Z0P-STݸ1p ?𢩼'_wqv5.0@3:4vZ#e|q9[|yϐ.WBV;xj:GRv*fނv9"uON_AWҨޯ~:%_\_ܯn?=$ St&5d ˕;l,辁QjZ9c>E-{M̲^]+=Y꒖i滴1S'(-yxO_>3HvuhD x/1(FY.JQa[nd7avh)tT%i3Nu{q1Ca'~i_k+xtkrHAF_D>c|"EaJ[_i̲Y[6 ɂ@RI wb0ݸj3;hnڽ¥i6^ Hؑ% Hg\ծ,!D]!>!=VQ|<wWxԽA"3ǺBj݁Q&ъG=Nr9ÇοGhd S'Ƨ~2h23w)tqj?cʥcrz.ryC .ڶa`++%k9Վ!Mjo+דאkq9UKf*8uGTW}\4Wh|=v֟YH 'lD`{^b'|T߱:HDC:<)'P텉1-4/p=͛6'~ln&'x>xܯWw.Ykp!lȂ:#)J.ʼn<:U o2s6u5 jA-ź(j-rbR(/P<[Ej N|+mP x;R-[ }-#Lx>49ycހpJVLLEg=ӛEk,G&3ikÝ2pݑZFbgӒZ#1$SU`@`MqYJ(teirˋezXDvڕ C'58vf3\Jƾbq1;h̹?+_01J}MN;XOAL?A1QFRo[Q)Zt'g RO;q7P&yjp _gZ5ju$ԙEzHqv] A!" sDyU؉D)v`^623 8oՠ Ϲ .Xkpj[E>0{0߽ *8^xHɣA(bTdJRdpxluD:5FgxJ_kwv'R<D|]/H>E%,d44Z;M]2柳3(]:?0$@_e5_Vc0q3~h&<,'EzvcÅN/uXpGnUpC E9_j kZ0O8l}p-I0nD#$Z\["z+,^q[p \Ukq$qۋ8DWl?[#x9x/Y\;pL"=m6\TH"xTW7[Cy2`!JX5kLw= mΜ|~Wކ~A>k v㣠[_{M|^_qA۫.V'zZ?>|70juz/0P/;xm%9>}˻/_֫WA ~xs~:m#~q#\$n V{}-׿mǿhXo}Gw_\^MQ[=ԇ?Az^P~7͇ǔ?Z}|p>ǟ;p$emusjE.7w vT~Ž*öse;ǵ1Du8-9JsPST H'TsOO)6ԫHj(M )/qcl ,hpڬ{yŤd.^:Rt6M1F%μhH= optYf $NiG:y5dvVru$Wި`[e"Xπ2DXcB+^XuwAT9Svu7} Q"h Bd}B,wy~̢"ʿxF(8j6}9ݙ^kJQf,qqyx ݰHsdMӍQܮh)R=]ŨT v/JQ7Q%8|*)ȒJ4h29 FN+@NLDiҞa>u[o=@c6% ElʉtlP{8 v3*/gNoaOm& { FY J!V*^gf*L8'meWUe*Z&J%Ma3 0}@*?+nC h9:EQM梈[ml ܢ/5 Kff0af0U܉<A~U>-,+LoBƠ7J>S 4C@No=|F \Ћ0I 6݇g^},Zi+ rgs-\kG#1 Z|-.ܭ;1qn٦g܁3ѭsUվ 1,Py\彦nXuSVݨ$#ű!f, 1-;CBG"ZF_ TM7N/JTDcԼ G`+^Sܐl`j[K2;*nQhh[hsv-Tρ/iWl`jjNysc)t;1q|X_ft3޸LߎQyR8^QPPWj :@ڍiR u_D>F .Ҭy vkZ8:UzPE6CI)-5.;S,9?5E_^-bAT3!u+sKa1ƭ0N<;ppC|ɉ^AR PyVGa8܃w.³: {.{x[$fN CLOtĈ znttiJVvF/eKӐTkdG!5=q2l^֨/PFa28x}p`<~xqFcf[38Up9T& 4bc $?\\xOn~mUz ."6;J]f7]?vP⪡,Ɩ4rwf`[Lr mQl}[7r i&,Pa-<W5&aT5 o ͚)#+ CZ`ޚH ѥjD6xgI;Yg<5m\0KQ S_+eжYGֺfYt;U7{ozY^wiGb۹b.B:ptt aQXS0*u9jh N#uP_`&ҪM533VU0}l]q} k%f<h ֚& M٦`7=BRh9w޼z>z؏];`+s G'Vػ'r#=0>NC?B.L5@)[Й5x츑jhj8R5+TFÝ7Wj4P~mƒD:\M?>hfVK4{N"^*e q85d6,XmSCÉu~>6 >-\?W""TJ.h#o+,>ZBkjNK ?8?'k\9BTVϏGDko W:8쇈ՔTVz0| ܬ,*|MU@ٛ.F#1ɀTç,Xgm'ڕ6ѝQ:Bga5''w]7ԓxV&1a@%]T;F7`g8``kCc.^$M3puz&htʟ9njI\?^^}yB|Z߯nObbpApz?t 乸ӷUxbA ܬ4+vU|ys~,J}@*wK/ziX= ?|5I=ǯw7xu{?Rw’WUM/ԲC$ 2 4o%X"vT8y*Hڊ_a5>VM\,N@u% ,.4:ڹc.R59XrX!v}495CGAE퐚[rgl4L‡Twg~lbKU-i]ۙۡkeh,q8ΖXERxdȞ: $ 00)xU׿Ǚ<@i%tq99Փv--o9rPu !?[M>r۴}8r5Sc`}qq?ꬒix`6AaT.Ƀ"8қg gAnԏT秀l݄k8bOgp?q&@ʿ9@p=7~or'MHS#Y$w(rCDΠk(cj-82zΕݬ)cnJ.ї =ELptFLWE!6"@sSɏEg,Jw붞 džJg')fGXG@Z7\_ScާBx˭7B>\$9s@YJY:^/7ZG8XIS;.qfPnㄒ٣p_3#ΉtZ_֏ǨJ"e+SW:WxcdMt MZ tyl$Kxf^I=xՋrɱ'r{&x-8$=Gw#:g4AVY8D,[Iԧb^0I2x2< mA *3LG7ҩ K -ēJOu;Ն' ;\Α %ؒn<# b[]20zխS.L@>&$,'* )o,itlJi>.3u i+Y0vP呔`L+E=OFXZ;z MU2^UD[acy'@:L9=Xo7nba7vqT e:uglvS쳘d~N*A9IMqq_;BJ5V.0Ա;+S:e3Ji{=WŁe>?qZ}#>diqr3Uo(Ct>68\uEhڈLdنLp~uyZo#V;Ixi( əq.kz 6 S>?s::d$Ë4)u';KU%>HVAxX?GeqKqNMu׌I;ܹd2H8XOtikoK*c<SPYQ\ t{`~TَaM!, ;܂͢%6ˆV/*V]F`Gex}|CxOZGKhi-}=yg;{Ξw|",|:<㠄?00qGi~*j9i-ςUz^Wõ?>QaaAŗu& 5Nt. jPt7,LtL@cŵp)E哂ZmT\/$,?gg<\Z6o]F3`dlڧ6{ݓ6s4s9R9Wky< o a3nw=_ϗ'+ \~zq_|Y]b(> }0Ga_}/#ꋰ(4VW]}{ T,? {AY_~]{_KpdoX\.\=6Ƈ4O"(qǡCߟrT!!Gq_?n4>?\_o*~zZ"Ssw}{yX}3~A>Uo^<˿OB?|~ʩoT[_94#zf?飗ȕ&Z RӖntT~G-Ωc2tu\9(;_aC\fnxԦ˅ZK!$ 㶞stczٱwz= z 3B+?!0XD=53$ϜT#Cm)\Eƽ뱦aٳB/ƀ5gX򛩃hQo Z0&Uv]CZ%%6f9-}?*xnE@yث]XCPi%$0y 0Z? 긾C1}˛o|oxV_BҌ `aTf@\BiiR1 <zɠ<f8XAUc?# =6 U;؉={zKrc4BiHK[03 <<8Dm0G=ޣYlzf4Iz=,&6[R_WCmBvRV~lQJOoWvxB]/Vv8]:; OkE+@C_naʽ5",})?A$gӍ\opɷkQ]5H9f=+7 ,2N_]틥^<ìĜrc Ɗ;:h)07y/:xn/}İVm@yo')n~V'?|M>Z:O'9x|2 7UYX 򆤇b}8`DOОVJo:-M=8t,і*gj,SF=TJk4Ͱl)Ӱ]l=|%vd(pi^/_Vxw }p0~'o}vyJ~x\Kȼq'>]{f಩w.nq ٱP W( (mzO>}KP ަq^5^L/R,ҩtڳ@ڠv2甸ǩ(mN 7Š҅2Es'tݼ`L%`SO=(_bQ x2bLneꯄ; fئPy\9"eAswoп8=ԻРJT6AxMHwfxw۱m@󨒿a04˥).i<<'oprʄ8OB&VJޣW,qR >]m ǜCT6\da#ó]XThm!GXg>JqfAaAj*+tfMh3m鄨< Jf =YFqyhQbShhB5::~ NJl9$a[a0K#& - c;Jc떙7H['8ԁvIJZ8= pewZ-d'9@Ui8VԔ  ?D\V_?8U*S&#.S>4}~3vM ?7N)KR(>^0 ) /|]{TpY}MwV4~J+2 !9!ԧ_|B3ء,"}hX63{(g=s$|B`!6x S ="=G7/1.SǛFAkLW:c>f&>V.="B brTifRyf\7E|s0o ӗ? = = =b>iU IY WO^B<}Qf3Ԣ@֎uFN+ɀ`jMPXZQm+";O:@ZY*e!--=gu_V)ܩ8Gr 4bE Fa RQj-enqő0ZL66KކB=(kLj+C%HgNL؜>e2a/ V"3z@C{tDL*D0r;|nQK.̠`-鮅 zFCq_Ѓ]ϼϵ{guxCz'1QݗUZ>5%s{RlֺyTncBco-;;#1[;dۀ8^\^>Hd;JU%oK)nwMq4%[A,‹+QvO枙x74 }V 4Ӌm3K S /"E?ŧa  M/C`Tڗٚﴈ2UoT`h":Q(k\ekN|c͎PPWNQǍ* bCIЫe23נڵڷ6ma^A6.)V}6?0ATdQ0?Tq#D. ߭/W)55ۻ+XѺ}|uH[KHa6n@ |.2" 8.]Tz8@;D ~"[x& ځ gw2O1{I^Nr;F9,0o66l:U1ꄋ6n7.|&<Um|ʻFdЬGPS7 .oFd.IӴ.M^ $~tWP쀮Щx~x{Y0ЦM$3~MC9"um^~Rd@Լi-vٝK>"Ӫ p`5&SkAMЊZ?+':HCdb͡,k7K/ )V4i~i |D>uȟbYqQ eҐܯC5CӍ|4_nP1f7NL! O]6,y QRDwzL~,(8ҺÝϮN+> k&]ݘ6J,J/3>M1c71>1f8ZNAMU>fÔL3nwz+*&=}[[% Ա4+m?6y3p湞,q$&[ŧN=I-[^3)]/'͹ǝv8,0 S@ ,轪@9.%J [1~|uD3ugPm /- y)hS06/OS S53VR{6;͠<Wxw NhԄ%.פ;^Ee z %W7NQ,(qe:xz֦lЌ,s'eGgVUܷxV7QZ17F2؁·7e~^&t[[r`l׭ߺkm׮nH8]s;ן(j!: ^E]'`5zbzEaxH#,阕[c6vfDŽ7IZ iO4sҲ0%Rtyz|kͬ]$ %\{#{* nA6;yǪ9o6aӽ?,鍊T|sX*k:Wj*o Fg服vSmi*8.xEikx͖*_C=NN]i $Y~G|bk6 %Ǥ BOHVKMWʄK;3R*͌Ů-hOlƎʹɮ3ˣGI3/U@z:&mLO,|q Zqc'N6;q:$3}E͸9;}\qJBHuaۄ}ح}?a󲽳%Zh¶HS/9YEMzsإ&F, hf3b-]ٮI頽vPF"n@xB&J_-a_Y^4kND3nyxOy=0[E93$'5Z%!6pRR\L> L8BIbeNIy!7:1hL2_Nq $\n`H]꛹tӚSJJ$nϫhĮ`>4<;oVa9U o=u[=޾(X1BmףyYH {-&ߌ1~cGScEIeX/MG&z#'f"@ܙBq|WYHigug:Z~ #z1ۇOҘmPrucD}EvtsRӾ,)%n н6]#B:p!ڌ'(D]3B絬ɗahd uCʵSt9 &mCv2M?~tWxٵ6TaY$bn{bdLSm˶'!SP|˲*aF[O:Zy5hx6~%ݻYmd~*8\NGv5P94E-n40rޙ%=6(F k\{=\+  Hd?v \5t]/=Co _!h~4;A>&B}vH@*ڟ/V `@l#jd^+jT(|@A4Z@`}-4> m8[#7-9(NUg^U'nUJwG_gfÓ^FvY{B[d8afW% )&9?toft ܲuf+i~EF).̢b/VY%qVԫ7;rKOdƝAX]m3k*>nv%((4L7ˍ,{ehADYb1`My"6^gPk&W>܋M>l&@Sp|Q  N-EA2ߦq3ZD%9!a+K(fMK-z͐•% B Lw'[&ZfBҞZ%֘@lwKKl 5$WN1ΝJ 9:if0sHK}:?YYe|I8wG`F"\<~bfV >jANĿI'3%էRpY-t!sg ir(L_6)@̜$@VjyY׶ޢ*foO2kyO uff"G@20E9uAQE@Q$ kxh_Ě!Nb!ĄbHy=b+bP E:q `tH$3SZ;Wf>6C؉Lj{(L,5> sA̧,j ~@c ܔj}R5atO疗R n1Ps:Qh%؀4ms;= \ֵGsq5qJ*>` ԏ%"0_|V0Jɡbg:kV)/e;258ԶB@ p#l .F  ǐb~$Gz@rd78! M/=+.]hd0.}) (ͭIVɳD\P`6:-H%}8):.kKPQ}hwDEh;]/Vr{30:I]X9rK.V2X!آ!ǵ}N$AE*zYÀ&&ľ>@4ʲ4@áXm~)ZT^pxqG0!G!-IުF/oAʥ΁6ؼ_tׄ-;[չi:d IVthu7劐wdU{0HK\~\0Fhh>7CcDp33'.;һ>uE,Dcv%(DnóN{H_TLOZHm6+{אw XBL5 W6򗇻 xpx<9xb{?Ɋg8Hj@QHZ"U \^AZsnMAz;NX$DPD aB@!0` w_vP9zӪ6ᘂj >Dlw\mh|.b__|0 ? _'QMHaNQƻ! (*z,q@%a] C(rE;. < >!ƄcBd(.O("b}qHN-n_OLsw^ks}'Cp8$pU2iOkEΏU-r dpqq )bn~I K^_n-??g-:a%JBrkG˝!Axl+'طkXA~Elq,5^ kdFWKy/ KY__qgB+ |,ixiweҒx^@ c0L1{jW"~0z@ɜ3 yPH/rRl{?_{y'Re)~!CF eMI;&rZk4Awrbg)ssu>OK.m+o.Ql3/J3@BQ&HB@z4Rm$c[4ͱdQ 94kW`$, TĖ WtڅJpW/EvJ]έo-Q _%X-fPZR HN /闻_e-|Rzu}ZGBU졒MNX Aƽ 8H6ڎgQel%g΃|9أ>'W#h/"=2Hzv*^O^=>ʬzB]WN?ЧOnN~>Ec-+}Vs⇊j.fW_Oiog1N?f~Qw`_I!yZNx ]՜pwOBWF5yK?#L}Çf ]\JlEVMwOӿm+LNw{0*bb%a+6/<bM$ܷpS#t#aoCߋ'|SVr%>Pa)erk/^8D!Ԓ*~ }.]qY=ndW.z!,86+ɎdY0ve"?ᑧPT #l9uջK]9;b` Wut-3s%XOVLMS/=dZn8$h!z.@ JxXu$"=&FiC }_u8hEcАU "zF𒰝2$:~SJ*aa@͸f lDUUm 54ߛ3"E60 h|v7ypiYo5? ==7`A]@?Ë ;%q ?(@ = N*5SmNݎY 84%ʙ^G2ǛX*z9 Ћ7`RB W;x9ax\=7;fXκTwC5b-)o}j8%sHcu2LdB&:lo*}COGp.힮qu/&/~RqR;W̺| +Efyfӗզ/Zΰ˥rXpږC*32`QhY%pajk/iD-|(* (N 6X⯳aXY.g݃ӻq.O$\F ^8@RQg \ exxB  XO`1pQR>0nS`W@7v&%ARt$0f p a,X?b{WpfGǖWdy? ecI Î]&~)O׫߮*B76\?,֞ʈ_}OK'b%W Ot}, D1P@ @ begNdheJkA~z`ه䭒W E%'>{%m!c6\jCU5Fq[x rs @9''iD5 i` j(>hS(=sċ89B8o = azfp;)rUmt*l̉Xۆ7IYr U7It83(AUVPL :R dtjg##aX(])s=VMR{li$ \)"?%PC*X_(H2^dBFU*"@++Y0s.kˀ"{9ľrF,MWpy / G#nn5k[#9 36MSq1 M-C7[$TvT:65ap`Y7<^#8p`Ё|}ҕ龳; ƮuaUFomq@c{nac7bWocmSuelw̅yxEjw1~*U1Y]gu1#vuOhl,t~=e){iᩝA މ-6GyVbናn3K^G':ehWe1nCNk[, JYɰSN"r%= W5BTjw%/LP)/{*=YQlgk5!# p){wıHs6bR.q$@FOC*-"w땂⯗Vk@v2[RS% C5!AbKKЍ7 '"Ou;>LAaeX0 ͨyw\,<5B"#j^,O)CYjD?Ʀ:'.s*ƣ<;@"toΨ)ʣS2PB$ס@rd@!Ǧ-80a$_Q-<"`%ɴ~ԮOCӓpAe6K}VD$'GσZ7bsJh.ThRĀ !u* NoC@I ;^X|ؕ+_0Y3]fK"(I*a:H ]C[A`^ьYʮ:^ƔqxXЫ L`@HrD E([h-!9l6=ppE5^r/8l;j$vy6t 8{c FTE|| ^vթYתxya 4ZaI(rY8m7^'.ًC+ȗu$iu s+h͞!Y&vcx!Z~,YbkD HlN=!^=ncE6i=]O|Z :!lpm`L]ītm& J Buz}wN9vu}̓3'di'c w gzR` B7V?Ll z,w),jޞ ] RNێ9]lZIe:ukܾvVꍎtff˼r # !I>a#cD$wX#ӥ<8 zOKKKK-"$[–tPG™Wh@1KBϖqY([W! .&B_WLR @1\/D=2,FӠENa al;I-a)Hf#yU0O؆$:bDNp K>EOcZЙTOzɭ\ sl\\]vdjF(QApjͮ\]pgWy@Q]h8j!Lx T'J*w硍p3;@ @)܊!JgVAZo,*(PfK915%Eɵ4s, qșwn+z.2 * PE]O~#TNUQ+cMv:C]c;eࡷu°3E0{_~Q+OpWmU72$ ߲ K7;ivK6gKג5.?{EJ,?B]-6a.`A.GVH`W(D|%`RXcE%ƅÄ-Suӝ@3ڍ^"Z8qE1Gz[a4Ψ_k!Cn`OGЈ0'k^w6{YB+M#aeqBcanf v´fnHH I@2TY Qes5$pY&"Un5G<@PZHBUV3˭`c{$p|tএ/'Pc2h~m^grag39հ$mtlA9u?9Po)ּJ E4wJo.YȚaLsQر1O)4F}2p'x.=BQcQp@HNR@|H !|B!c(eWJ5$!w`Z rz.^XKBsj5 018SôW1ŴK2"-߭*aXv&5J:ϋ[IjQ7{rRz4Z4t:w(NNA 4O?rR+gHe;HӁ9o.+`iT&N7d҉/P8}oT 򏵬lwRKwRgg[ڌ#`^t2K0FT4v(@c⵴^EZ˲3~"r5*e}u8lyW3T }*F 8E5f6>@>1bZķt U(J%mnUH˿߸p&_cVU|[ˇ`}"?1ҧ]lx@OخʽӑKyN<A s+Ó!~Q}aa:g?˚0jtYAޣIǣH#*ho_2iRM~yvEăY yhGyXAggml7۝>^}[$yR|8{2C:yWwA=+ e l={h&]QFSǷ|QOi,(l]Iז/hS22w{/G^or5IoYva_ckU 30ĸC :ՇO~.*.uXxxI,%({?NYb=>}jk0٫͆.V9*JЕj6J#b_{)Hu)AF2 0P"Fb5񐣵&}qz ZAIG=ٖʼgd@Xk/gBךQg}=>{ c`@5oIe!p;IcWu o%a`g7<7}`+džϗH9%iCbJ9 _WFj82r:qZMYjk(61. k,[\=8؇aao`| i-T)wVЍ{@!zG π(\"_Iߺe(/hOt)R޽@Bi3y;N鐍D~.`g"Jv#}mr1cuA?ȾƩKڥӐU--,bCB QKg%v"+SOOO,8[O?|]vp6Y6vqx,sM@6S> gwšAS ݟc'=!쩇DNJulKe(0o?Z~ʕ-򽵲T1"jl{8nd  3=­AQ7 L*=Ҿ< +wl_NR,]Axr%c˥6{b zf9NW k;޲+"Z1QO9̱G 4.<#B7Tm ={ZjMB"h{{$ `$5277O3qqiS@Y{)diػj{݆&EyN1JEr x!ϟvCaii^vaIh2m/ʠd3&wr^Lc qm2^)7v?3YiD,O2;Kx84&Юj_Brⷜȃxw\A:\PYQ{z.jADy 4;0N7T=D1xSZ1h b*+AlN&cmc ErUC6l+Û*XeG묶*!o)@߅xVv(cq񠒿タ~m>Ag߱.C_~}߯Wlʖ=>/ ~a3S[dʑy'KdQy E23נX<@Fw&SyZ7΍ٽ`mqk mlL[{Oݴ#'vYuԵDʊ= NH`=w_>ྨcfg9G߻S~j-WA|+WX_s(YbiJؐ(ktبCHUPNCsj`\Uq.3^DND.sjVd3E:k,3xO3\|C1@@ڧn# y7\S%灱mK>?o'@_ݣɺ?'v+˟Ϗ=~{{b_UqxXhuwo.\I w}ߟ/yjo|OC?/v㽻Wfo/wc_aͷ?Lb' Y+x.Mpb1 ft-!lKéЪOHsfp1gfǼ2aAnH#yjG[% mu~j76̼6BVUCG}VP"bWЙ) kkM.J/!A3ŗb]܌(dʔf CƤ`7a<&$!3X2 57,V 5ou~ oru!h(qPB돺:**j*`otX^|#jv2\r a&+vi઎0;2̏HtKzx:q^uH2k~pq8[ySlfTA}pj3|jS Iv+]\.tB3l{y;OLWx%5@wO<0td'Qtz4G ׳A@{r`j`EO+nV>^-&ˤˢr,Lʱ,(Bh.ʱuz϶rK{xW鋪[_d4+SoBK|m  kš䔆qJ8r H8> ʻ<%3+x9^fͮM@66|Uļc[PH. M M+[ǂ%5'} DV7ߖ ht kLWD Sno7yaq=Bo2÷O~ 0fi aD:s]iDC`}Ƴ2(b%GVOqn@>]kfجTM8wv5a,ujO1O #@R`?<"D!Q( ’2ɂlpݕB`|%w7z=Mjw&? K$ٚ qv?Brrv,T QpzQh<4λsrNU3+jL0^5 :xIBە}W-+>'1S}yzlP]{\+nu_P YLh8L 2&?cuaʷOe {y3zY7VOkEw L)Z Ol<| Nϫ>ɬ6>^OF݄sguiX󅇎35EB'uki鄤8K4__ᬄ/F1J1?a^~;Szn쎛ΚME}z{(3!c1'kQ3񠈛pL4M<$^C l.ƫ`I^4RPL|hP/=9{+<:y<]>:gWZن[YMqҊҊ;[t_VBRƻo*T~`C.OF1vBd,F+ W AɁLZ{ڣW~l}? :86'Hƍ:lT"+٘MؕNֈ̎NTAu\G@VcߜHXy\3-\=|x͡ -].Nh2b=(W1A#j`R6"g`*z9٨p wz*n4#r/jʊ ^^6}̛q xh9:p>f~Dur@JIYxl8$Qq4wn63#BV5d{ Zv!>$;YB;TK\ݕ9!_!7 F zj_5F絢w(kup >Ki:P&EsH` w;UrC:x~!%!iT%P㬆+?=A&$5VR|yf\ 8y1[tҡ4LJU!W|&ADDy/ӱaF`S{v PXmɺ ۠BRbj㷾b'7ĩӎcl81!JN`(m~͎x J5,\^czbYb@Ğ*(b5~u|:>S.Sb/ IP_ms.&Jn|MlcM9bדzVai/<*h ^ v;tVfMr=0KT E.-@ Es1k}ۀ .w;{48dži"Fy]TG1m&v--aPFy]4D]%C& NVhÈ[px x Uz3nZ$ƥV $&Y!%+A"n-2㖳m0v|oAl#Z3Ig/*!c`cD!d9TIU7tcNye[Q ^f"gpY:БdP<@aw]~M{@Į&]J=B2"i]1xh I\<`ctμ.zdr6i8kYU$Ar]H[,1+m 3A/K06UFAu2nU yD5sPʤU8<۔3Gl/ o8\HXBG[F_NC͊Zyq|gKOx]TPOh<5~]F #Fʞӣe?+"/ d2pWX;ܱ" >>6px8*Ǐsq| $!bKŇ.\<aKg k@,@r٩ k8΄.)%ƨ$_ڀ1!C$Kd=Mq.$9&fVZzX &_rq(_d|VWZ efC*"M^Zg+ɶ mi?0\'1pا])~liLk {RkǙMäY *v]P 4 K,mCΆ欬cY8Z[2DY@*҈Q. ^QTx3> [un_{&~Pŕi_n gK프!o s/hAa.2[  MM0c h*|' iQ,*LQ* (qv8 HX?>;_.l708er}2~'D*Hd2H~9xxC8a a@Ϸw~?<ǯ_o?]|ķf(" !ڽ/|E+*|H-uk3YamQPmkGxA9: k*a%8s[Ӻ)P[DПPcȏ&x=$C0[]vK|5&MCrɌR8EQ*`܎ KF,JcNYSg&HMjo=/i |냈ֽ%u`fiٜw\_&`D_x_RdA.";<&򯋇.L~#%}Lǫ,~k`hn@_ L'aHSZAe6߄ƍF"PyS=bcl:m*3 H5]p&fxHEJ+?NٍJa5S!`of\% αy4ހ_Yhb,nZi-t0=% CPuUk̓7ZEM u!ϟbpQv~ OYT.3`2>%*Ҭ(J|[w7ሚQm-.J@eJ67CV ){yk#lC4tdG#k(mt,}}?1<1ﯮ<{ˏ={-n,χ7=\O.puvgpwz]ĀW_G#W>=xf AaФWM.ȫhҧR'@vT&f玖; 'mvԈ#6 *ðABMDž}ivxk M|5T`鳲AZ0^TP &1ap-eV7z-!NXֻT]?%l|YT]b$&PBB܎1ezy 6d<'"?+E(ZOˣ+lXˣ_ ̣΄]m< 26u乀 |\sruKU:c9n9g#_+F$_8{Fs8*"Jk+49ӍVr'1Utp $lZ!""&wɳh=vE^|"pg!\:橒 ۊD$FK)TsF,] ː/s;7yȒ@Jl67NuwG\540~yWQ" &ۃˁYH8fG'/;^vuNl_q{Gn|,`<=ana24|=F菈Ps ZqV4ŚxK$i(Igg$)!LqRw2t ^\K *2/}hP8 " ll+CChزO?zN(m\xy =A@"UyЁc J XK  UcȐ/JRr{8v(ѐ$B^}v[ cD@b1eY3p~ai \'.ito\$\}^,i͘;"V6`evL6t˖u SM$Bcq^xyT7Fd.0!l350-1:A@NgN4V9@`eG!Q\0 Q={ :O#I!ny6›:a5#c"E(dzE7lҡ7> heqꤑ]UU8,!f-Ft8Jw<>A1 ͼz܁S|htWxX3bܤz?BA1JfʼT0vّq|wE۳zj 1#{#fH0VjH~u #P%;r$8 -ķ!WU2XGf])I%?HaO:"wM`tJ]aJ\%] ufxΑa>P+Eyf*8pG3u5) '2Tэ1O"10]fHFT-;f0 2O Gp-VNdaeT=q]kem:(H-sTToo8@j R _ʵgE-{οt/| <ժKJӸ jfZ}ДnGdRhlL!tCu|EJu(flDV 5&"Ybz=^Q0o_-9:2,YΪW*F *\ZC}uPnz`oj)`SXaBbVJX)22Bj@1{0:3 Uc7k/߬}f7kLF-FNfѶKg(v%Y 3$8w%_zTsC(g}f?,$U+ RFn<1`J6U^w"&lp;^/HǃK z'4}N66!偏Ȗ RC"Zxܩs}?B~ $VzzdQRҹPRiS ]/L^ EМ1z"s|جa3Ga-==XW5Ddv `X4#&ٻwO'[G-??ՇA3oh}oڋ4 iW(P$QH=T"1%Oowe~[|{36RԨbKAP((QG "x, J,0=W,]4Fej{yuFɠv0B[=|<#n΃FZh1zoPP2ov YGZ| (z&;aMB z 5Q>hЇelXi397:E\lޮj;S$<H)T$㬁HyH5&:væ,T6?a[&Nk|Q!:0}xh-bq8n5(#C3Uph!<ăxuHRHg&ܙmStbd~[~YQ>T5VnwĄG,ULG{? 㰌G ͖x<.IKt\C$mxq()Z,=XPps+K75?x AW1HEpm??q&LߠK'ʱj0 秴u ~GQoJez_tZȈGn@ 2%8 3YeC9#=Iϛ1lc z )]V64Z~y Fˀl ck@рw2?+_tϣ/6V^j@`eoDqbɇtݶ4!*fac"ʶC1z(1zI`ös eSs/ _9,/xh2vnCh7"M`1 \}rSx[m,_$뫂`f"HI[`8X13xnѭf&şgyz2%@C mIrx(ikmD! -N= YNV3xVo׻ɐR): 9g5vMJ1p!?}gfizr#n}=V&˾ 4=xjg A?4ӔNd^yԸ8. YЁVo$my qUq…>L-;#$Ǐxi@!;kAGhLjײi0Rm":mB\P0u觏fJ‡.zXJ+ #$\ʄ-7j0E251vA(sB>9J)Îi;{ds&4bu7L Jd?PZc8]US6FSa..wsr2M]?b^GD5C0?0"*츇jzhoz5ܓlFgvs QVo/k6fg:`_9_V|v!z9@N3" &~#t炄޷DgH!me[96VxIlWݜy54BCpuaB)7Éů}biY,qqQаDNHTH<!]YUKկ\Wߍ ~9rY٣ @UZ{\D2B<,3׫(=UmVxߎ.7TEZU1P`$WhWm'N[{?3&S5DH/y\.|T е0@ߠu;]S]&p l0խXBʂg#,`.tJQisRUܻ£l( Ѷs#4Hd@!-6/-m+o/yO0a#6Y8,-K')a83$F#ڲ@]2vA)q^H&+ە`}c$`Z5XI̶ӽVj@yd%MRr_cx>g{9H_T#r1~9--tCx@zIuYZҞyMz`y[YE%Tz6ve_N(뻔Ne}[ 8 b5 {z8r"ͦ.V`\Iyt!-yOp}HyޝIޝ]f(MԪ;5`edeXà=! ¨ kf*ğ.Ip;i)L);b (gWD Cw!]nuy#f))FQ*%@$ܕlcZ59D"ڦbgo/)\\N$XNQva=&m[#G?0siKK(bE?*H}R/^vnvCJtl‡j[ЉW`S vE󶇘|+M˰/P$BlO,[#e4i4uU!hû`ּ:bA^@%~+~?G^@j9_F@_ooziu _;V2^a䚂  ZH ) /S/x>xN=.@Q%mWDF|nl1E>d,EIBN 7`eC]܀, Y^pqᷱ[_=]\Αrof]Sz0iAۛO*f6v kԻ~M^_#a_ ]Cӥ#Wb۲G;1p1k-S(FR?$@+#.˧,ruHԟ8i٬ j]1a> ׵r[:P4 H4Pi0 up)5*Iz,B΢^[a؄& A`"$hZ ":/$ʐ%j [-]c0 =v޶WY ellfQ{Yo,=3$ZKU20H֙:6%*mG,%Is Sz(hMb," )h[yl&6geHR}::UI@ 6j^ [XV YZejӄ2ymRϗ@43z!lIu\PWa\$9[cl'+'ъ;3D4wP<(X)՘; Du6iav;ƾL\~I,##"؍m8FCfK[}yD.<Z18GCmqqǏgW-װ54#= RomvJ#xA׳)b@=3]tw ޶k>gltFk@_TV=zХߨPC\dGE{zuongC #0c!S9*3NEdXDaڙ8j2ŕ! G~9acGU&3aB!ZDET]׷u)@]p]ם.NЃ9o=C4qVْbыB6DXqUS\ighƸ?0m=2;aPWx8;-)Od~45aU%:GxYƆJ6wސUMI".pDͣ'Ҿff[ɦ8?6IcoOߞ _a׶(C\޽Sdf(̈́r 0Α4vR▄l jz@ 0d!,c̸v@Fނ8V(=<@DDic"]n7m= o>޲#TgGN__eUry#lŪHIXAWbղz^YOUs|h$jNsӱL/Cc-sBk|*,1uJ351D䎅#Γ`j9[HC_o7tj\E#Б ߣiFlqs7LBXEz> `0+Kہɦ)Dw@*BTd87a5;_/(j$뇅H~]?8y/b^E1Jɞҟ[&?=Owo5{Y2L,W4`]ܭOr^Ϲ֟^yd&|6+5`VK4GZ4>.shz=}wH;D{?gơW9x-纚XLw&cqQ{gSi@V`h\:YSFLYAO3-=(`Wm th ш aWHd:PPH* JjL[#D(M2nv3c?u.O7ؾOz5/q fCq%6QqU%s~W~~u_1Hnh(Mȡɯho_bMv>M5L?Rnetbsd-INSTALL_C700.debug41d@h@#`@*] 5M <l@Kt@tn[|   4@ p@0@p@@@@82@@(@S$@f @x@@@@8@@x@8@d @T  @D - ?t_ LD(@]L(@`s(@p)@ +@p,@,@$,,@d,@t -@-@2 G<.@RT.@]\.@Ti.@sL/@1@ 0@d@1@t`[ j[x[ [[x_ 7@$ 8@,L8@:@ ;@;@$([< Nl( a <@s>@,>@ 8>@P>@h>@>@>@>@>@pC@ C@P D@D@ $E@9E@P@F@4bF@0[u[T_ G@H@H@H@H@L`H@dH@< L@HL@O@ L@O@("L@/hO@l;H[ Qh[0h[y[ <[0l[[ ,[ [ [|  #  0   ?_ G P@ R,P@b0P@n4P@HP@0xP@DP@Q@Q@Q@dQ@|tU@W@0 W@W@W@+Y@5W@X@tF(Y@U([f8[D  [@[@[@`]@ D]@,]@]@^@ `@ xa@  c@@S [)  4 _ < _` g@Ps i@ i@ dj@` j@ l@T Hm@  Tm@ \m@ lm@ m@H, h[6 x[ > \@T \@k \@} X\ h\  \ \ \  0@d د@ @     @! @> @[ @s @  H_ @D @ x@p\\ @' \@/ \\@A \@Q \@b \\@s \@ \@ \@ \\@ \@ \@ \@ \\@ \@ @| 8@  D@`( @8 \\/\ D @@T @@g @Lx l@ @@ l@\ @@ @4 <@x @d @@@@.@lK,@f@(|@4<@8@4l@@hA( A' A5ABAL\At<\@|\ 0   $ ($ b d f f  f $f #(f )0f 6(g >@g I`i bdi xhi i( i@  @ L_x x @  8AAAA$BAD1CA<DAEEASGA,]HGA fhIAsLJAD~JADJAd8KALAdhLALAPAPALSAhTAUAVAlVAWAfAX(fAT3]Ah=4^AlD^A@L^A<S_A[8cAbcAPj(dA|dA\\\\ \ $\ 0\ P\,|\ ` d 8gA@gA HgA\gA/LhAh@hApX$iAjqA<{tA8\@tA,ltAtAvAvAd\B`Npz ̄tz _t{  B<l B<z!B8"XBS" B4c"@B|"8B"B"`1\"Bl"0B"8Bh"Bd"B"BT"BD"0Bd#B#B@#BP#TB< #B *#Bp8#pBM#B`V#B(b# Bo# B@y#`B# B#B#|A],#B]#_#B@#8B(#`B#dB4&B$,B0$\B$B)$B5$B0B$B P$Bk$B<v$$B$BH$(BX$B$B$Bd$B0Bt$B$(Bd$B%B%B4+%(B ;%HBG%Be%Br%B%4B`%B%xB%pC%TC%XC%8 C`% C%` C@ & C&C&4CL-&C9&DC<B&C N&$B] .B]Y&=B]MB] d&VB]kB] vB]B] B]o&B]8}&C]&4 &8| &P_&2CD&(4C|&4C&L5C'5C'h6Ck$7C<t8Cd8Ct#',JC3'4JCxB'KC0R'KCc'LCu'PCRCdSCt[C<'[C$'\C('<\C,'h\C$'\C('\C<'\CH',aCLxaC4'ȄC (D]L(8 *(H0 2(H|x ?(| M(|P [(} k(D]{(|C(@C(C(C4(C (C\(TCl(C(@C(8C@CdCt )CP)ԴC-)$C@)D]Q)Cj)Cw)C)C$)(C0)XC$)|C$)C)D] *C6*E]*_hCJ*CX]*Ck*C s*C{*CX*C*C$*C,*HC*C8*C*C*C +C+(C *+4CA+C Q+Ch+C x+CD+C+C+E]?C,+C@+CLwE]+H]+zH]!+BH]+*H],H],G]0,G]E,G]Z,H]_,YH]!i,G]G],G]~,_,8CD,H] ,C(,Ch&dC,C,`Ch,C,C-C,C -C\-H]0-I]&-K]1-I]<-8L]G-J]R-M]]-H] -M]c-L l-P x-_-T_-C$-C.lD<.D)."N]05.TN] A.`N] M.N]Y.P]_.P]0f.Q] n.8Q] v.XQ].S].S]0.  .  .0 . ., K/ D. D.x Dx /HS].T .X /ċ_//X_k/ Dk* D s* D/ D|/D/D/D/tDt/$Dt/\%D/S]/S] FS]`/$V]`/X] /X]@0X]  0Y]0Y]@0TY] !0tY]&0Y] 10|-D?0 .DP0.DxYkY]@ d0df]m0f]0e]0$f]0d]0d],e]0,e],e]7+e]7+,f]704DD04D`5Dd5Dt086D087D1\ 1` &18D710BDPF1lf]T1 g]@x1dg]a1ȋ_1DD 1ED 1xg] 1g]1<  1H  1} 1̋_2pFDP2@HD 2g]&2d 82| I2 } [2$} p2(} 2,} 24}( 2\} 2`} 2d} 2Ћ_3ND3ND"3NDL03OD>3OD`M3QD,[34QD|h3TPD3dPDq3QD,3g]Gh} 3l} 3p} 3t} 3ԋ_3\_3RD4RD0$SDdSDt4SD@h]44h]@40h]i]H4 i]P4ET(>E@5> EPH> V> _> n>İ ~>E >0E >PE >pE >E>EH>E0?El,?E 8?E0J?İE8\?E r?E(?DE?E?E ?ĴEH? E?ĶE@ED"@$E<@EhT@Ea@(Em@ }@ @~ @  @ @ @ @  E>E @E@|EhEdHEtAElG A$ "A( 4A0EJA4E_A8EuAd:F >:F ,?:F C:FlC;F|?;F 5>;FP?Fdd] C_FCp`FD DP (DT 8DX ED\ SDP \DP oDT DX D\ D` DTlFD\lFDdlFDllFDtlF ElFE\mF(E`mF:EpmFMEmF`EmFhsEoFoFdE0pF`pFtEqFEqFDErF`EtrF0ErF0ErF<FsF(%FLxF@zF6FXzFDIFXzFD*zF$[FzF`iF {F,vFL{FFd{FF|{F@{Fd |FtF|F F|F$Ft}FtF F F G G \FtFdشFtFLF ] 0GDF\@GFPG F^G FkGF,FdTFtGF8G FGhF@G, I8  Gt G GЄ Gȅ |FHFHFPHdFX0HFp@HF,XFdFtRH0G]cHЅ  qH H H HGtH( HGHGHGHGHGTILG`"IG3Il G MIx#G]I|$GyIP%GI(&GI'G,IH'GL>Gd>GtI$?GI$@GLJp@GJ@G+JAG?JCGPJDGcJ0EGdnJEGJEGJEGdJFG@J@FGJ@GGJNG<JDNG0KtNGT$KQGXG >G >G >:H TEHTZHUZHUZH6UZH4AZH@UZHVUZHmUZHUZHU[HU`]U_U[HUkHdV\sHTVsH,VdH<] …]҅] 4VHTPVlH,_VHlHdhHtkVܠHsVԨHV]V  V  Vpځ V߁( V ( >H VH|VxH H VH(V`HlVH] >H WHWH*W\HD8WHDWHXW\H`bWHdwWI\WP W W@ W IHW0 IWD IWT IWd IXt I X I0X IH*X I:X ICXIUXIdXtI] $] 0] <]sX X X( X( X&ILQ(I X(I4XD(I Xd(IX`5IX5IJ] W]e]s]Y&] ] Y8 Y@ ]YII2YIIHJYfI  [fI[fI/[fIA[fIV[fITr[,gI [LgI[`gI[tgIFxgI[gI8[gI[hI[hIP \ iIiIdxiIt\iIh1\TjI0D\jIY\ kI<k\HkI\kI(\kI$\IPT] \  \  \II\I0\ԁIl\@I@]IT],IT&]ԂI40]IA]IP^]IHz]I$5I]HIx]I@]]]؋_]ЍI8]I(]0I]]]܋_^I6^]^_G^IZ^@Ih^$]k^_^I ?dID^\I\^8]^Ip^(I^xI$^I@ _ܤI<_H]</_,I$;_PI@R_I@a_жIw_I|_aIMaI\ahIPlaI}a@]<a|] aI$aIalIaLI4aIa]a] axI$aI aIp bI#]Hb] %bI$0b4I<=bpIIbPIWb]$^b$] jbHIvb0I4bdIbITb0] blI$bI0bI`b I`bIb<]$b`] cl] c I$c0I )cJ,h>J(h?J\h?JDh8@Ji$DJi EJdT]|hp]0.i4 LipEJaiXFJ0wiȏ] i]0i]i]i]Pih]ix]("-H iH\JhVj\Ji|]J8i]JT^Jd^Jti,_J,]j]"j $ :j`_kjLcJ0wj|cJhjcJ jdJ j$dJjeJjeJPjzJj0hJjlJ(knJPk$oJ$XpJd!kpJ80kpJ@kyJzJtRk{JD_k($ wkD$ }kL$ kp kt kx k$JDkhJk]kt$ kx$: lmJxRmxJxbmJsmJmJmJmJ`mJmJmlJmJnJ,Jd1nD]?nT]Nnh]|]] ]nJtonJd nJnJnPJDnJnJDnJnxJ8nJl]o]0 o* o8+ &o* 2oЪ]Eo]Ro]ao]oo]}o]oo]o]oH]o]oX]oY]oh]ok]apx]p̯]))p]9p]2Hp]Xp']gp]wp(]p)0 p+( p+ f4| p w& pJ(pXJppJ8pJk*J pJD qJqJ`/qJPBqHJ XqTJXkqJ4qJ,q Jq(JqJqJq(]pq]r]Prh]@+r]@rJk*\J 8rJ,FrlJXr$Jdr]r ]tr_rd_rKdrhK,rK@sK0s]!s]%s].s<"K 6s\"K0Is"KZs]hs]ys sp s s s-Ks`.K0s.K,k*.K .s.K ] sAKs,UK@slUKttUK"t|UKx5tUK0Ht$VK@ktdVKxtVKtVK<t0WKtYK@t]( u ]KXwul]Kp.s]K k*]K u`K,,ubKMu]6u_[uh_syKu ]@\KutKlu< uKKuK,uDK@KdKtKKuKu\K8uK$uK| v4KvK]](v< 0v ;v  Hv Qv cvK,pvK~vK K`]v]v KvKLvDKvd] v( v0  vP vX  wx  w %w L6w0LOw8L|bw]0hw]Xww]w] w]w]w] w]wx]w^]wB]x&]x ]&x]5x]Ex]Tx](dxn]"rxZ]xD]x8] x.] x$] x] xX]bx x y d7Ly|7L}yh:L,y;L3y@=L,Uy]>y_ayl_HSLy@WLyfLysLPuXuL8yD=M(yl>My`@My`FMDyFMxzGMzGML@zHJMgz,LM`zQM`zRMz|SMzHTMN& ].]>]R;R]Y&e] r] 4~]]] ]zМMzMxzMzMzM0{M,zM${(M${LM{M){M2{MT] ]] ] B{MK{MV{PM8V|Mf{Mu{M{Mh{M{M{$M<{`]t] ] {]{]] .|]|D |_:|p_g|Nd||N|(Np|\+N,|\]|= |d |_|t_}<> }D3N<] }\RN]] 8}lVN@H}](]}@bN0} ]h}H> v}_}pbN0}4]}N0}ND}`N|}܄N(}N@}N`~ ~ '~@ 6~ND~ S~pN,[~Nc~Nh]s~H ~  ~  ~ ~ ~ ~NX~XN~\NܴN 0 8`N*\N,8NClN LNH_ԾNi@  r {N\(N0LXN<NtNxNN44Nt$$N4]$>PNRlN$gP>$ {D  ]x" #P h#P π# & {NXNNN`L N@]") 6 H4N,^`N,rNNNN.Ol`NсXN4N0N&N3pNpANRO`O|p]]* x_'COłpLOՂ0QO(GOH\NO |_7QO@LTOtPjObkOullO,mOmOL@nOdnOtpoODă> ҃, , ,  , $, .(, B( Q0, Y4, g=, rpOtOhO|> @, ЄL, @ $OO-8OPJOPf؜OppP,X  ___OtOL<]N]6,0 J@ VD aOlOzHO`O OOdOOO@ƆOцHO<Ox؆OO<OOd(OtP5P9IPM$ N( ], k< ~= @ H P İX ٰH H H( I I  ) I =I ZI rI *I  < ShS`ȓSñSXӱS|SHėSSX ȜS`(S-` =I 9I S<H8SW SH'hSLS4fSzȩSS< ȪS\$SdѲI ۲K < < S4%ܲS@5S8E= R= ]Sh0]>]qK zK L L]M] SxSL ճL  @= H__S6STxS8{0L T4˴TT M _TݴD T( T|T8.TF T|\TsTxH _õT̵@T޵T$<T8 tT4 Tp4tTTL| Tg,M v= >  > #TP#Td<$Tt  ɶ0M  ׶PM  > > > $+T&X]7](L> W@  f@ x@ /Td/Tt\0TD0Th3T3T8ķ3Tl̷L4T4ط4T44TX 5T6T,<7TT7T8]#|M ,M 5M ?M( HM OM WM oM wM ~>TBT`,CT4`CTdCTt8DTGT GTѸHTTKT(A @A XA +NT?OT@TTOT@hOTvPTQTRT|STPRThVT8VTdWTtչxWTXTZT[T<xfTDiTD2iTG(mTXXnTuhoT<xzT ]]Y&] ] ]] ]]  Ё ɺM غM M M hUp U V uHW +X :Y BA RA c_XT``TT0TXKTpVhTXfTuXTT@TLP]H]m x py xy hz __%P U: US Uli\ U  UL| U UlUDUdUlU| UtpU08U0QULcUtUHUhUD]]]@U,<U HULUh2U8F4U(U\U0`U@rUU\,U\UtUUd#U p#U@$U4%U%U|,$]94]MC$ W=Uc=U,o=Uzp>U?U@?U@UHAUBUCUD]L]@JU4JUXKUKUL(LUP(xNU$7NUF8OUtSPU0a]Xq]@$]w lz D @D DD __^Ut8]  kU<2kU\@,lUmU0R0oUdc4nUYpz utz {xz Č_8vUHvU\vU{Uxt] HD LD Ȍ_#|z /UT:ULz ]UkUvUL}U4 UXxUUP`U(UHЧUU4U ĨU9ܨUJUP[]r] ]]@@U,lUUp`U4U4ȯUdU@UdUt:дUBU@JUDXUcUpULxU|T]h]Ă z z z U@FQ]@؂ ܂8 8 XUV4.V4>VK][]lL T <VdVtuz V@V@PVV|V|VllVvLVLX \ z 9z $ V"$V\5 ]8]?0{ L{ t{ ]_/V</V,/V40Vp1V<2V@3Vd3Vt4VCV EVPV&F]?] ]] ] 6X| @|~ N~ ]XVgXVsXV}XVXVXVXVXVXV XVXVXVlhYVPZVXZV`ZVhZV,pZV:xZVGZVUZV`[Vhk]Lx___Vl_V`Vx`VaVPbVPhcV,*cV4$dVdAdVdPdVH\4eV4fheVo hV{iVP]X ]@$L]~ E E F @F F F F _1qV<9TqV8@qV4GqVvtrVP|rV8_rVrsV`tVuVvuVL,vVxvVlwVDTwV@wV@wVxVyVdyVt0V!`]2t]A]Q]a m~ ~~ ~ ~ ~~ ~ ~ V89ԤV8FԧVvF V]]~ ~ VvVvVLdVh̺V4V(V2V;VvVvVLDV@PV],Vj@VPxV\V8$V DVV"VVV@VH V$V$HV,VHtV`V@(VXFlV@VhY8VdXlQX^XjXvXXXhXLX X$Xl%Xl/Xt(X'Xxx(XD\.XPh]w]~] ]]! + : J0 T쉂 _0 j  v$ @J J K 8X, 9XTt:X|:X8:X>X8?XD|?X|?XAXDX<*EXP3XGX <xHX\DlMXQTXaUXn4VX8}lVX4WXxXXhXuLiX8iX84{X^^$}X@d}Xx}X!}XX+}XpvH~XLv~X9~XG4X<XpXfX<w0XhX:,XtGXpXpX$#X XTX^^X<XD,XuX8@X1ԲXp(^O X|_X\oX~X <^P^d^x^^xX&Xt^$_ ̌_$^ ?TX QX_dXpmPXx8 @ XPX\HXXXtXH ^ (_ Y) Y06 YE\ YU Yd Y s Y} Y Yt YhY4YYxYY$YYh8YHYPYLYYpYX^D -H ,L 6P UT X oX_8)YP)Y`^ \_.Yp^ |^^TS( 4`_[3Yhb04Y@sp5Y$~6Y7Y\8Yx9YH:Y:Yd;Y^,l l=Y=Y>Y`t>Y@K DK HK AY$,AY9AYdIHBY<UBY(bBYHoCYD{p TDY<DY(DYHEYDEYFYThFY,FYGY@HYIY%,JYD3IY8>TY0KKYl]0LYhiLYJPNYrRYQYPYVYxSYLVYp,TYdTYx8UY'UYLVY4 4WY[YL"]Y._YD`Y9`YlJDaYZ4bYLgbYr0cYh~cY<8dYeY ^< ^@| ^" ^}h       LK ,_.Ќ__pqY*qY4qY0 ^q0_|Y|Y}Y~Y    YY<~>āY >Y >Y >$Y  DY4Y$-YGȂY[܂Y oYtpYT؄Y@Y,k$DY<YXYY(0Y$ <TY\YD'YLY4*(Y(CPYTYlehYvY`XY dYPY Y|"`Y  ^܆  䆀 솀   Č Ќ 'K 6K JK k$pY<\YiY`|YYX8Y ^@* ^0 ^@، 쌂  Y\!XY<1YAYlSYDg`YX}Y ^ 썂 Y pY\Y0Y( ^ 4_XY88 ^0VZdmZ^ v > Z  ZLL Zd ZhZ ZL L L ZZ%Z34Z ATZ TtZ]Z<lZXZLhZZHHZ@Z@Zd,ZtZL0Z^ ( L 6L IL aaZ aZbZbZbZbZbZbZbZ/bZEbZYcZncZ 8cZ@xcZ(dZdZLfZ(tfZ(fZPgZ iZXiZd%\kZ;dkZlkZdPkZHdmZh vZtqvZ}Zx~ZH~Z4~Z(Z\ZtZ xZ\@^ M^Q^a^o^ #|^L1^,? H_kԊZ8~  ZxZZZĎZԎZ4ZD,LZ$3pZTMďZYtZ8kZ(rԐZP?$Z {DZؗZ`Z(ZpZ ZxZ(,ZHZ$ lZ0Z Y&^ ^ ^$^2^@^ $L^,*  : H T< bT pX \ h l p   Y    _x^ TZ@*Z8 ~ J TM  ]@M iPZ(wxZZTZL^^ZZ8W@ZhZ-^Ek ԟ    ē ȓ ̓ 8_;Ԍ_sZHZ\lZ^Г ԟԓ ؓ ܓ  䓂 蓂 쓂 <_،_Z:Z ZYtZ{hZdZ4^     @_܌_APZ^ Z|   ԟ  ^  H>^@'>^,A^@F6[DM7[ ZJA^@W bC[vdD[4J[,J[,A^ʿ M[$0M[TM[\M[`@N[<B^c[D&c[Bc[`c[rd[Te[4e[\e[`B^ B^[C^ ĭ   +$ =d_sm[LC^C^`{[|[8x}[4|[ |[2H}[0D}[`8~[~H~[X~[ D^D^ >MnZlRf8[C4uXR #NTEx=TXJ4O,wW`BT(YHP cTF[ St7@T  4S|{ [T؏Jq[\]Hx(]0 Rl=\XRTNx[ Oli?O|R%VH &C#&8[0&xSHR[(;&o K&PpT&h^B8i&@u&ȪR&gW@&< &(P&bP<&CR`&@Sh&HpQ&$DR$&S[,'(7Kd"'Y*'\X4'@< 8RXB'T'Sc'Mny'$V'_J<'Mn'Mn'ԒC@'Z'K',B0(Y*( Y9(\TC(^K(T]pc(S o(|S$(> ((Pp(<T(Y<(<, (`O(ɀ o[((7Z)Mn)H@+)R\+t ;)&T$N)@`\)Li)Q0|)d$Z)S )J[)Mn)< )1T )8XXF)hPx,"  )B$*M0 *Z .*@>*hIdK*SVV* R4d*2J$w*J * U*#S<*8D*$Nl*A*TC<*|sL\*(Z(*P`I  +X:E,+4/N(5+8#, >+Mn_+lRh+ l[h|+<  +Y+ȫWԧ@+ܫ  +ؚT0+Mn+p]+E ,DHD>\R%,\Q5,L]@,@R,t^c,Kq,4O<,-dSF|ԧ@J-PW-@1L]W1An1$X{1ZP 1@1XF1,W1^<1p^Cx1MnO-U1` 1hM2N28[$)24S52\g[W2GHi2G(2V`2 rT2Z2G82Mn2A2 2S@33~ "3D'U@13E@3hPM3M 7~`[V3l=La3<  k3  37W03O34^3,WD3W3Mn3R43Yp4S(-4 R4<4MI4; R4T\4]Tj42 u4 e5`# n5j]05+X5ܩYD5"[D5\v 5z@5S 5^ 5S@5Mn6T6N`)6XP26L@6YR6 S `6`R"1V<z6ܹU(6Mn6HN6t;HP6", 6 >E4%>.U`Q80> D 8>,Vl@>4EDW>=W0b>@ɀ u> ]>hHJ>KV<>8 >H$>8LQ@> N>OFT[>0](xo ?< ?,5QD?lER&?Wd7?̙S(E?AVPM?Tb?Xs?`~T?\jU? D ?XOx? ?S ?pMSX?ԡ@ @D8 @xAl+@`@qL@3@Wh;@POK@Qb@0 Gt@H @E|@E@Mn@h Y@ܨ  @DV4@Mn@r @ԎY@HH AxMAU +AA],5AKdBJxLQZJCjJPxRJP$COt]PtPoPpKS PسTtPGCTPMP8YPр PȳSPh@P` P[UTPr Q_P|QMn4Q,pSGQI \Q,LS kQPoE QYQV<QܽBPQMnQPQ}]QoCQ < QQQ_ RO(R/R ;RS,JRC RR€ eR,WnR|XyRWTRMnRa RU[RYI0 R@`R[(R|QNSS0S4i[,3SJ[(NS0UDaSZSSSlAPS#LtSFS Sx L,S]<SpTSHWVDT|SV T7UT _OP(T]>ThlP,STOV ^TUhThR"TT4T^TPTUTZUMULQU OdVMnVl](VA7VG^ DV`P`PV`QL^V|]<fVxVVl]VLVT T[Vu]0VXQV| V8*J8 WMn(W 0WTAGW,Jd[WWRiW xW4BVLWt@ZLWWS[WWRW,]<WNXWA@WS[WZVX0V$X.X|MECXULXS<_XJ0jX` X XMnX[*(](XﾭXd@ XS[YܢQLY|J,'Y/B3YĕQ?YXOHWYa@\^Y fOprY|~AYYMnY|Y(Y6 Ydk@YPYMXdY,T,VK'@YBLZ0N ZSZ0Q1Z]7ZMnWZYhZSWsZYZhBZa ux ZZZ4UZNZHd[+V4[wS<0[j]0F[Mnd[T0u[ [4]S[TS8[D> [ @[Mn[Z<[Mn\tXBtW*\"A<\ @O\8yT_\`ZDj\|3Aw\ \ @(\ Bt\ \`MQ\ Q \ [R\(uOT\[L]Mn0]] =]h8 D]|WP]8 c].SHp]=V|x],Z@]Mn]YZ$S]lE,]l@C,]]]4Z ^ ^V<^%XV^Mn^XN$^[4^xVh^Ɏ] _? _^5_ >_ZDQ_DSU``_Ol_H _Mn_Q_lJ_Rp_[_UtRLRX_@_Lv ` [h)#$V`X8DAL.`\>`ThRHH`سO>CS\^`YTk`S3S[y`W$`G`Y `  `Mn`[4`^P`Mn apTa,GB$#aB2aMnFaA[|Oa4U|XayPbaMnaEa]a'T`aɀ aod alFadCaXHa W`bdQdbY8b@ W*bSpAbP.TPQb |X\b<8K4gb؍WzbțT,bHS(bT`bXAbY$b@T[b7S@b%Ahb\X cWcH .cVE@chF PcHgc\@TycS@c[c`6 cc0GcLSld dUtdWdCle8F(eTYelG8ex Ge@PeXKVYeY(ieZ~e0KdeYeXxekKpeTWxL? e@e< eKePwX,eMn fMnF@K(fDT:f@Of T[f0ZhfT0pftM,fdN0fYGfAHf:OLT[f4]fRfA|gMn gyP/g`l@?g  Ggр ZgQlg` ygX g4 g`4A$g0@\g< gpIgMngJgDSphMnhEL+hS$:h,SGh=W$OhMndhH xhfI,h4JhIX4hHdI,hT htFh\Y]TYh0 h,Qhh @iP ioD$i(St= 3iLADHi XiاY0hi ]si|> ~iBWiW0?wRPiSiIijDilxXDiCiJ8iXAdjE[j|W&j:UT2jSBj v SjWPnj[pj_Q,jS,j3SjMnj upiO8-uRtzX:X zX-Rz~NhWz!Ixz@ z|O$zN(z< Rtz+X$zMn{Mn-{ R$K{x$QTS{NO$d{PBdz{rT{ K{xJZl{]{N{@W{TRMXRUԞ a vX@l0 yVl@ $ 0YH?@(TPV _H[y̦Wp^HjPjPK,҉RKd8VdZ  MnMn=INO]\ViX~l@TSLX@@X(Ŋ(Z4؊xYB4YPDC[  ZA7tA4CWTV~ `@ǀ vMn9A [4d;X\JT`JR NDET`^Wk@RLV<r%NP|X   @V|  J[0PōKHэ@$GT@pQ`^>V0$[ 3MnJMnfT qO(OXRpWN0Îp3BdԎN]Dl[}"`Y$ ]{X(HNQ,8|@DI, Z~ r? TgU Q4UX@ \Vŏ|@(Տ%RL@̀  W0POB%,WX0AFdcUTS[8cAtr[D,V8KMnʐ@ې  \QBMn])HQ,7فH IT=p T@ nN`}K,pT4U ΀8 gW$đ !E@ߑ 8VTMn Mn1GK|K[T$}M0K|POP:WВ=MDFR$ V@S0MnǖQ|ܖHT[8T]v TbIT'S40yVP :MEOXs S<[sY|CXtA8ƗHRRHҗMnk@dH Mn$`R"@Mne؉GoJH^,xJ4X,zO(tiC$Ϙ, ݘWpPxRB\ K/D,3X?l]<RJ/HW|LW$e oEZxytX`R|4@ gPH ˙MnMn`Wh K+ 0S$;\ZZ Jdgu }p[LXp,_PL(=L͚E  F ]G р (W  R4*xq[L Z otqI~LL< P р  @|Ǜd+V؛pX0@ʀ (d@кW  lE(\ 'Mn6@€ Kd] |k[TWt[k^P~ZHX|z MnN8לH0R O "Sx,rYx S,-L @X3AH5\[z@oMnpJYT8AL@dlRf Į[X9$Q JatV,k(lD( # {TƤf ݤ \W Z8 8YRh#Q6U @ VO7K[KHpJ{wX4S0Q(ȥHإMnMn,G_U$:Vx,J[Fx?R0^;H\pB٪xLāS R\!O8S ʦ\ETئl[2C4L"J4LzXL+d\X>)T@M< XF)bP,lhfSS h Y0Y0ϧdPKT-J$ (UXtVBT)HD6  ?PW4Wt*R^3S@Ox`PnL$yxA( ^C Mnب`9HzAE^w@fH`0 @F;lRE S8K'@xU1QAH NlRWt!ApiĖ s}X}DINX dQ7S R4Ϫ$UתX@0A$( Mn)*V87@HhFDRDNd^`VPYg|SD}PXD`jU`<   Ӏ īTܫpOLePXNGhx )p Y9_Q]i.B t(ZtBT  E S"TL8]Ѭ` ۬XPSHxOW}JhL @S8+xV8YdIف YVf?Vsd~@8$ND"[Y`fH4ѭl[@UPW4dNWPh, \*X0!MnEZ4_u e tM@@ Q@ǮV0ӮWpޮWMntE(r  %lSX2OClKDR.Z]hJiJZLv]([RXd `@MHȯa ԯWpMnĜT,tP4? `=O'SD3/B>lG[WT]Lcx߁h l@> zKhh T_X\0#K(|>X$SŰLAذ` RS[$hRPLK[,^J1MnNZ4lUH}tR Ā |R,ڱ   ؘI)B()J<@X`N@A^` Jl[@xMn  gXlJPò,AYL.F` ˲0E 7ZȎY ,gX hCd$T,PU(Wd:JO$SYSi J[(Mn@Rr` h `aX[0LDʳYӳX8W,H+VG ]pWS..Kh@Z@R.O`W$mx`XzSL"K 2ZL@δMnIYTbN,EhTBS  "<[@.8nP 7IZLlXTWExMn RYhQĵFpֵ,SߵDVxLS!ćB$ (ShQX"HBh7]RX@bY4lU{@[$ T^[Dd@0ֶL MnC,8(X@HDR0*l@$:#KL(]hcY4mMnԧ@  ]N ·JѷܛHݷhR]P 8 "UT-PU8th[HJE iX? TF,cv z`C[@Ѐ  D J8,Sȸ(FZڸCe@K0x[$$WX  $ [X1-Q?[MܫIdZ|  a4 siM4xVLY0YG Ĺ [չONMn XY@D+ttV.MnSSdT0w7DHBOt[/SǺI ߺtZI,,Q߾DFN U@Mní[,TO0HZGtS YVPe$PrE]Mn`` Ŀ&Jd@dؿW4V4<hET) S S \C OT4T>VH=LYJbKZ@oX8zp@C( T[(G[|nX8 F\LLQ <]B_BpUD)@P>MnUDQdfMn~(5BMnT Zxf ԧ@O PA_BlK@]&VTR(.ZUXF0CW]gKdyh?H@`PH4_VL|R,"AiDFtJ aI bSPQXn[t8(E+$E@9Mn[-TPet.H@SLY qDU\L]C4$NP$ ODZ [`EhR"R |_  W ':S U$_EdhxI(zT4E,A]YX l;TLHLp 1WdQ4ԧ@] S1C<=hYKMngI`pJMnRlPtX, .LlI\@LW SX"PQ`4lJ0HMGpH]XhOmXzp]BWLMn̖Tg4W40I\ P4tU(aoxO$KHoJT[U0MbOuZ@ pA5E`Cʀ _NGx^NV|MX_Z<MnPl@D ` EFp?A| F*KT@R?F\(>A0i*oFdV  `sShAPhaZDMnMn |TL SD-2@fP΅>  :hO P8v `ZTk K{ O,4E(WK|]<$]~ (|G$W\A"9C0J|?Mn\C$nX)J,X`ZWl@DRP &KtZh,|OMnc@P W *6 2@<МVEB]$Sx T,ؾOdIlStT 7T[] WL bUTTN DXM`'NB`8,=TO$ YF(dUoN]P@ HlxSC0F$XL[0S4xSPrV@&4cT :DCSFhZ0SU`@Trp@Z{d$ ]\,  _I@ARtjXT)VPHK O\G4,L2MnLRW_pP]}]Q\0VbQpS!O@  wQ$  LA@t[t([d7bNBODQ$@`Vjԧ@yZ@W(`F$@xVPT[lف T,H IpMn I<xQ Mn!B['@9hSBZxSdAb$^yMnOPID XXXha XOZ,lR7QXE4lCR iYTw ZlJP@3AHPX8]@Mn]hA4SUx"DX3|VGWUtUT_`  mMn;p  R4\[thO8,NȽCLMnC Mn! 1pkDXKpI0bMnuԧ@MnкNܩ  DCcYH^RKOVpAT 2J }L(X*O=DT<K'Yb``N m #Th||@8 GGdDP@WtMnJxOlMn.d]@8OP]}XpSB@,GjUMnhr CMn@x WT2Z)S?QHDoO,XXgf {UL[0ABˀ #SdSJV0,JHfN]ZDoN]1BJxQtWx8Pf  |X$[tG MnST T[(SRM 4a tDNaP\?N\"  LBPO,]xSHK.A؞ <]$4aXMn3tX[0 @z[YZ.H ?MnUEH^\MnqP y8 xNpHH]\AlDDP<JX<~@(xXT B`$YL4 W(=h;E$[kH]QwHQ$W0eJP\QX _MrXTEU  4 {[ `Ot'NKD;Mn`PkA\z@0`VDx TV$^PzX8PT\PB$L $F.z 7 kP4S  \|SyxTWDWl@0ATYxNX aU\cC<JT%9hUBYQVhX  dRdp(Y|Z,xSAB ]([ P  PI`̀ , W$1E<DfXKMndT3 lbJL{$ |@NWp-OH(X, Z H lU8XxC`Yx]'YL3E[K_ Y]d@ yd[dSOTXX W@Mn[ FDPwOAHyXT#\E 3tAKXBa4]Lm<|Kt{Xl8UH|OlaN ZHTXB4"YQh!L XWt ?` D $A1lCLiPa(8W0tS Ff[0(SdYX\VT({ _P  G|Op[HN"NL.MnHUPTXEڜԧ@dMn>NT[4@@,E p](,CDxXiS\IT[\  R4U0 "L)|L5aJTFW\RKc]pyxA0:H |@XMn`XS4NXкK0 S\](!< *^BxCtq[iWtWlP (E0*J@(UMn[D,c@\ XP 0KT$#  3I8BMnU~@$e, exe@oXi {MnT8@<IH6 X[Xtr vX00SX7S!܂]>A@P^K`6@ M$XHl!YTlT 8a PS$]JhW@]1 ?  HL@VLN_LEmMn]Xp\q]0BSFZ(hS`V@4-J %C-dL;@TDTY`8 _HE,pW}tW8V LN,Mn#QaZ Kh8WNt NL"[L'@Y<5ܣZ`?`_C@HX\X  cHC$vK]EHėQB|@3  aPRz DGD(TL0KS@!X4+t 9QT0? c̟ITlcP{ XE8+Lx<IllR^Cx S  0I<Mn1(lX,=}@8R]xk@X}5Zl YXt  XttLLlvL @ MY8FD/ : #, DXOY](gh{QDt TSD@ RT"HNH"uX0"ijO#O4&#Vl5#MnW#( Pi#^P}#DL# JZD#L[#E(# $W #|Y#P#] $lR$L $]0$Ut=$TK$c$ ~Ck$S[,}$DW$% R4I%lPXX%<Be%$T\s% ER%l`, %fU%Mn%[%&@ %pU%lI(&;Sh&RUd&"E,'&Mn=&Ą F&O[&  d&u&Mn&lTl&0 B&.S &O&C&iO0&@'S'X'u]:'"T<H'=RZ'Wu'4 U,'V 'drS|'S`' 'T=D'4J8z 'E\'Mn(lT,"( , *($JT=(dClL(Mn_(N0p(AB(Q(t>S(Mn(T[(DQ8(lCVT(pLS(dKW@(xQ(R()@Ԁ )F[6)}SE)Pf)Q |)6EX)S))B)@)Q8)@)X:VP*a *]4+*`.B6*? I*QZ*p*K,*\A,gS[,*2 *`Jd*,/B*O(*H *+Q'+]I$6+dWF+XR(R+` b+`Xdx+T+hR"+Mn+\Z+T+J[+dZ,^0,T\>,tJ[X,VDTk,{X4z,h5N,+N0, ,HG,PK$, ,v ,,&T0-\O-,R -H<--ЧXdC- V-NPi- w-zO- X-hR"-HY-YT-eO,- R4--HET.JL.$}@4).@t<.BJ.]Z. [@i.] . .8A.X.A.O.N.@.lR/,P/Xp/80Eh1/BXD/%T0   R/Q_/Xl/(x[X/TB0/8N\/AEl/tA /v `,@/ dP,/V`/DT 0aZ4*0A\1X 1H 1 18Ud1V@1$TP1 1 2,S@2O -2R0:2lRE2aKU2@h2Zdl 2\/N02tKL2dNDD24SQ,2| 2lP2Sd2pU`3Q3 Wh3W 73 I3Kt]3tF k3 _P3P0J`3XeX3L]<3?TH3yB3tGE$3$6Z3R84 N84U[H $4*X004ƀ X T[(F4lPDV4]p4W8y4U,48Wx4\(4A$4`R4oDP4$v 4 4DUh 5($ ,>0G(>>KZ<H>HV X> n>.B~>MQ>pC>؄@ >0D\>ĆZ>R,Pp>RW0>R8>XUQ> 0A  ?;@0jR?ğU.?8@A?ZO? Y?,@`m?\E?DS,?X?`M0?Mn?EH?Df[VI4?H ?iX`@-T@GT$@@7@dXDD@Q_@RXk@h@{@d@@XT@^ @(P\@ @r`R @U@L}K@S@@g@(@HU A G@AhR"3A=W,QlfOTRuO] OpUO@DOLXO_Xd|@XOMnO OMn PG4PPM +P} TYmCVmhW nm4@tym_PmSVm8SmS(mi@m@̀ m]<m4V4ml  S|pF(p]pDpXdpĆS pZLpHiP<pDZDpMpY\ qAdq Px-q`P:q| Gq0RhUqCfq^lq, zq`OqlF[0_x q^ZqBU @ D qdPqLXDrUrfO0+rJ?rPS(RrXP`[rMn|r$@R rZrx rVrTrMnrZrYrH sHsC@&sMS>sVFs YsL]ps~@$sR`sTpseO@sRsȗVs, s^sH_s t<^ptMn?t%Q8Kt W VtE_tMnytNTtlV(t*TDt|o[tQ,t$@t^  t }tRQ}-NP}"@x~,['~W@=~ K~VTX~4[p~Y~~`C~eO4~H ~V4YT~7X~xS~C ~̐CH~O<G@< 5@BP= TJH0cSr'RpB[(T^EHNTDV 'TOx  K[(2lI\LhO \L#YlqgD  KhSÀMnۀ_@Ā *BT%Mn8MnVXp hZIP$@(MnW ādN\΁܄Lׁ[V4 S, R4 #I[FMnWx[4oMn,V$zO 4F[l ‚P΂MnXx_D` € /N`*Y8MnNP``Z4n zЬIQ(Mn ƃXC,уMn7F[(@XUp%H|UԸV/\S@B`R`R"|  gU@r.B(< NT<@R VPlT4Հ  DŽNބ$][,P,)X`EZ8$X}@(4MWlE,Z0dGTpFpXV\ w'JXWh x-JhăO$ˆ)NXՆ<@kCTi@O!, %MnK\Q]hR"uf[SԱIX`NTMnч ߇| IT@AXOL`\G4#J[?ܭW|QAW0]a jiU@w0"@4P3EDAC KʈAv BT6 xXX[00MnClHS]e[$E[@TSXĎEIXю&T )H8  l )LKP7ZZG@NS\H[m4Zx'JMnEXRƏx&BߏLAL4MDX$ $>W`g[+MnI8E_L  qDWT}lqY [(W\WUlXqX^ ɐtR8ՐL@  Mn, (4`, 3K($T\AhCLX `VLtPlDPKTmXT0` `R"őYhܑH[4T[  O hOL3|, <T@8H0v Yр, d$YX6vR{xJ[LATQpȜVÒ@"EJ[ /N"Mn8OȑW\~P<jd`Ky4Y|lF0 S'U  Ǔ ݓX \S O!.A<0(@ D@TXW\6 k4O,-X  |Kh̀ WdDFl˔\EؔDCH I|G$ $U([\  H[`2ԁ$ F4z P cH s\QH{@( JDoCPȕ$+X\ҕ`3Aߕ PܗQ @~ *\B=MShW<@0dVlL[XJN8{A]Nl(JD<WTMnDI0tUGDיS[x@h" P$V<! X00/U\9EWMPd]FmVl|SKMnHWT˚~Y<֚EAX +`SQ0;B@(LxSbcQlW{L'T̄EhOZ(8FIϛEZڛxT(LE| ^dIH"$! 41@BPS _O`r)  MQY`3SP44PR8[ T`7WH͜DS4ٜԧ@](? T[ i[<;YT8E<nYT}\*B(4Yx@\tWl=V8ʝ[,ٝAh$@LxQT[4 - ;V8_ @x@UcM@f.T s4At`@[$R lC0HxLP_К@d̞ ݞ$qPxZQT[BSpQ,  Jd( <LYTSPcG@p~R|Gt|wOADkUUX,X\̟[ԟPCpV0SST"TlX,Rw@@.Ft>Mn[, dtDDXNd}@(z]p" W ̯WXCBl\Z<ʤYѤMnz Mnt7EH8Mn]Mns]jX,N4DP@ˀ ¥l@ҥЬVbPS@pVtLQ8+F 5iO0Rǀ hMnH@LdZT|ͦ Idۦ)T@$S\MnGV8sFDƲED,Ҳp)T@4]MnIC`}T(0J;OV8F,{ U#Y0bPY`!ԈBtouBT[OhU8T,]O˳O۳W SQT,t EYW i]xaWEX  XRMnϷTJxL^S,WNXp]@Q<ξS@۾ExO`Z0 NtĄYLܑT(.<P(?MnZf@JMn`*B{X=Q KHYlJ$<Spd 0L@LT Mn  5 PF`MntL> ~LGUl|wX,HCHNXd̓]<rOllF *T@0N?MnY4J8e]{,UDCT ,@(GDHQ|hBZ2.J>À P}F0`7X4lZU<{~@0W,g[QX R4`R" ]zG< `-VK-]?X3SHPu f&A$s@$4[/Wha0 |X,dLX85[l0 eSXNOx'A6OGlrXxRTda@\lCW~[P]]T[A@ MnzK\+XO@JLT[q8[dAX S/TnS<}] OU IDxG Mn)EX9`]J(tLLWxM|i(I\[xL7S`ف d?TXSLH=T0A$hR"T[Pv N\,"E/( 8 ~] K[LWLL Y$cC^x 0~N4PG8 Mn><[VWHdh[x{MndNH|=El|YTpEL 8LS8!BN\NlV2SH<0'THXR\QMnpJR,Y4!W< S(Tu < L|E\!O8| "0B.BN>VN,X< Bd(Yv|F@DTE0}(جC`SLl]LNDP TVDRlZl x@`;A)T@:@EELN c<7WtrRUpNUO82N[[Ztځ MnO4JP2^IHjX,TXd@psT  tER4|XTH@NXEP6ZlH|@,hU`HH,]-S8TxFhXSDDC^tCq@AKT0>RaF87LHh ROT$OxpS4Mn!V.4XhDo IH@\̂ d? |  \VxJ:AJH]$M WDMnDWhGDl@DY8-Mn0 @F F\BW?T$i؟W(xA({SIR$ |@(|@XMnXRWEX ,X  ][06X|DT$VwO@iKSyPTG[PVzY4)X8Jh X, I,P| OTMn4