08u f<  u fRdt dtu f@@<@T 08u f<  u fRdt dtu f@@<@TU u fdt`Au fn+u f*u f*Au f++u f?fu f?f5A.u f+u f%Fu f%FAu fG+u fY^*u fY^*Au fW+u f*u f*Au f˞+u fGu fGAu f+u f1Gu f1GAu f!Y+u fIGu fIGAu f+u fra*u fra*Au f"+u fi|Gu fi|GCu fz+u f=Gu f=GAu f+u f%Hu f%HAu f+u fHu fH$h u f"(u fM(u f!(mDG$u fYu fDu fa* (08@HPX`hpx0$gu f c)u fޓd)u fx)PX`hpxL$u fn)u fL)u f)M$ku fZS)u f)u f) (0E$au fО*u f*u fp3*8@HPX`hpxK!u f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+4!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+ B!u f0x+u f0x+u f0x+ B!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+"!u f0x+u f0x+u f0x+"!u f0x+u f0x+u f0x+"au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+?\!u f0x+u f0x+u f0x+>\!u f0x+u f0x+u f0x+=\!u f0x+u f0x+u f0x+<\!u f0x+u f0x+u f0x+;\!u f0x+u f0x+u f0x+:\!u f0x+u f0x+u f0x+9\!u f0x+u f0x+u f0x+8\!u f0x+u f0x+u f0x+?\!u f0x+u f0x+u f0x+>\!u f0x+u f0x+u f0x+=\!u f0x+u f0x+u f0x+<\!u f0x+u f0x+u f0x+;\!u f0x+u f0x+u f0x+:\!u f0x+u f0x+u f0x+9\!u f0x+u f0x+u f0x+8\!u f0x+u f0x+u f0x+:\!u f0x+u f0x+u f0x+7\!u f0x+u f0x+u f0x+6\!u f0x+u f0x+u f0x+5\!u f0x+u f0x+u f0x+4\!u f0x+u f0x+u f0x+3\!u f0x+u f0x+u f0x+2\!u f0x+u f0x+u f0x+1\!u f0x+u f0x+u f0x+0\!u f0x+u f0x+u f0x+7\!u f0x+u f0x+u f0x+6\!u f0x+u f0x+u f0x+5\!u f0x+u f0x+u f0x+4\!u f0x+u f0x+u f0x+3\!u f0x+u f0x+u f0x+2\!u f0x+u f0x+u f0x+1\!u f0x+u f0x+u f0x+0\!u f0x+u f0x+u f0x+2\!u f0x+u f0x+u f0x+/\!u f0x+u f0x+u f0x+.\!u f0x+u f0x+u f0x+-\!u f0x+u f0x+u f0x+,\!u f0x+u f0x+u f0x++\!u f0x+u f0x+u f0x+*\!u f0x+u f0x+u f0x+)\!u f0x+u f0x+u f0x+(\!u f0x+u f0x+u f0x+/\!u f0x+u f0x+u f0x+.\!u f0x+u f0x+u f0x+-\!u f0x+u f0x+u f0x+,\!u f0x+u f0x+u f0x++\!u f0x+u f0x+u f0x+*\!u f0x+u f0x+u f0x+)\!u f0x+u f0x+u f0x+(\!u f0x+u f0x+u f0x+*\!u f0x+u f0x+u f0x+'\!u f0x+u f0x+u f0x+&\!u f0x+u f0x+u f0x+%\!u f0x+u f0x+u f0x+$\!u f0x+u f0x+u f0x+#\!u f0x+u f0x+u f0x+"\!u f0x+u f0x+u f0x+!\!u f0x+u f0x+u f0x+ \!u f0x+u f0x+u f0x+'\!u f0x+u f0x+u f0x+&\!u f0x+u f0x+u f0x+%\!u f0x+u f0x+u f0x+$\!u f0x+u f0x+u f0x+#\!u f0x+u f0x+u f0x+"\!u f0x+u f0x+u f0x+!\!u f0x+u f0x+u f0x+ \!u f0x+u f0x+u f0x+"\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+ \!u f0x+u f0x+u f0x+ \!u f0x+u f0x+u f0x+ \!u f0x+u f0x+u f0x+ \!u f0x+u f0x+u f0x+ \!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+ \!u f0x+u f0x+u f0x+ \!u f0x+u f0x+u f0x+ \!u f0x+u f0x+u f0x+ \!u f0x+u f0x+u f0x+ \!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+ \!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+\!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+$!u f0x+u f0x+u f0x+4!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+ !u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+?\au f0x+u f0x+u f0x+>\au f0x+u f0x+u f0x+=\au f0x+u f0x+u f0x+<\au f0x+u f0x+u f0x+;\au f0x+u f0x+u f0x+:\au f0x+u f0x+u f0x+9\au f0x+u f0x+u f0x+8\au f0x+u f0x+u f0x+?\au f0x+u f0x+u f0x+>\au f0x+u f0x+u f0x+=\au f0x+u f0x+u f0x+<\au f0x+u f0x+u f0x+;\au f0x+u f0x+u f0x+:\au f0x+u f0x+u f0x+9\au f0x+u f0x+u f0x+8\au f0x+u f0x+u f0x+:\au f0x+u f0x+u f0x+7\au f0x+u f0x+u f0x+6\au f0x+u f0x+u f0x+5\au f0x+u f0x+u f0x+4\au f0x+u f0x+u f0x+3\au f0x+u f0x+u f0x+2\au f0x+u f0x+u f0x+1\au f0x+u f0x+u f0x+0\au f0x+u f0x+u f0x+7\au f0x+u f0x+u f0x+6\au f0x+u f0x+u f0x+5\au f0x+u f0x+u f0x+4\au f0x+u f0x+u f0x+3\au f0x+u f0x+u f0x+2\au f0x+u f0x+u f0x+1\au f0x+u f0x+u f0x+0\au f0x+u f0x+u f0x+2\au f0x+u f0x+u f0x+/\au f0x+u f0x+u f0x+.\au f0x+u f0x+u f0x+-\au f0x+u f0x+u f0x+,\au f0x+u f0x+u f0x++\au f0x+u f0x+u f0x+*\au f0x+u f0x+u f0x+)\au f0x+u f0x+u f0x+(\au f0x+u f0x+u f0x+/\au f0x+u f0x+u f0x+.\au f0x+u f0x+u f0x+-\au f0x+u f0x+u f0x+,\au f0x+u f0x+u f0x++\au f0x+u f0x+u f0x+*\au f0x+u f0x+u f0x+)\au f0x+u f0x+u f0x+(\au f0x+u f0x+u f0x+*\au f0x+u f0x+u f0x+'\au f0x+u f0x+u f0x+&\au f0x+u f0x+u f0x+%\au f0x+u f0x+u f0x+$\au f0x+u f0x+u f0x+#\au f0x+u f0x+u f0x+"\au f0x+u f0x+u f0x+!\au f0x+u f0x+u f0x+ \au f0x+u f0x+u f0x+'\au f0x+u f0x+u f0x+&\au f0x+u f0x+u f0x+%\au f0x+u f0x+u f0x+$\au f0x+u f0x+u f0x+#\au f0x+u f0x+u f0x+"\au f0x+u f0x+u f0x+!\au f0x+u f0x+u f0x+ \au f0x+u f0x+u f0x+"\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+ \au f0x+u f0x+u f0x+ \au f0x+u f0x+u f0x+ \au f0x+u f0x+u f0x+ \au f0x+u f0x+u f0x+ \au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+ \au f0x+u f0x+u f0x+ \au f0x+u f0x+u f0x+ \au f0x+u f0x+u f0x+ \au f0x+u f0x+u f0x+ \au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+ \au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\au f0x+u f0x+u f0x+\ !u f0x+u f0x+u f0x+i!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+ B!u f0x+u f0x+u f0x+ B!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+!u f0x+u f0x+u f0x+au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+ au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+au f0x+u f0x+u f0x+u f0x+u f0x+u f0x+bpf!u f0x+u f0x+u f0x+ $u f)N'u f'u fy'6$>u f(o'u f92'u f'$u f?(u f!^(u f,)($su fQ(u fSQ(u f$f($u f;ٍ(u fA$(u fk($u fXU*u fH*u f'*Au f+u fD@+u fD@+m u f*u f*u fR*$u f +u f+u fO+ $u f:@+u fč@+u fT+Au f*+u f:)u f:)Au fj+u fGu fGAu f +u frp'u frp'Au f+u fDHu fDHAu f*+u f@Hu f@HAu f+u fuHu fuHAu f,+u fHu fHAu f5+u fHu fHAu f+u f[Hu f[HAu fs:+u fHu fH+GMN bk)0/[T yi?LMI;~U-wNVkj4[f]4zwvR=KСc&]xq#^a >G @_U5r$#/l{*|1m3`=$j:|#_S{lXb\\twM g/7vK`KG`\ah4SMuXK2b.  `1o,~24o!"06} 6u,)CKauAS^zuu ժ&0lY/^(&:!)?: Pwpj&,dcgKy`7M O~Kve[lD|dt . .. bin dev etclibexec mntmnt2 kern sbin  targetroot tmp usr var.profilesysinstsysinstmsgs.frsysinstmsgs.desysinstmsgs.plsysinstmsgs.es# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(@4D$4 (##r#r(r(TLLr#r(r(Ptd$QtdNetBSDlAPaX NetBSDearmv6hfH-MQ X10 {|@ @PP  R     0R/S SP pzP' `p`pV*0/V:`X`Xp`pV*0/V: . t'X'P'@(`''p'd'\p'ԗ'Dp@-<@@8PPU*P`0/U:ppG'@'0H-$@$P@PT*0/T:0o' 'A-@TpP#`/=d \P@PCP PQ804 0M 0 A/:)A-|tx @:lll`P:pPPU:  P (P ㎽:)F"P@H-O-M`P8&y܉I帹X Ob@Qp        x    D , BP,  号 5po`P    Czp taP \PDPP$PS << pPU (BP 0P(᡿PP" p p`P` `PP p Y P  X V @`@@@P P X% DP O@ X X% P3X;*z P{`pP @P` :XX^9h Pi(&%@8 P]`pP @P` XX$P`N$㈿`pH`pP @P` !XXM ^tpt `pP @P` X `XIgI` `p`]MXpX `pP @P` XX--FpF ``@P`pPy P XX0 )p+(`pP @P` XX^^p `@Y? AQ` p Qp Q X` X @  ` `@ W  p`d\`pPUP,ED MЍPp@LPزWpU AP P xpPqJ "zpj (  PsPPw}PpU] xpPpUvWpf Q`V yPS ` V˒P BQ  ` cxP@ v.vpP0 X 0`P!0#0`(%0#P ᐓXp  P  :  S) Z U  PvX : ZC00P%V0 UQ`PA b?2`2P5` PSH S_p2|b Rup[ P  P' rPS 2  EP   P P LP  PPpPU PP#  PPP CP0!AQ4(PP Xt  pjuPp APЍ t 06 @ p  HH H0?-?= t( |Z,G)(G)LG)`P Ȯ`U r`rP ⴮` W Pp>U rdrp >-PP 4@⓮`UP`t(8G))A-M@ `P,pqp U PrP l l P qP @ ^ۍ,P Xit( PU5!@  !pP0*B9 P` 9 `Vp  `!(P 81/p:P 8(1/p0  hX*0H11W*W*W* !O-MLP DCDpP P g  80( @0004/ @p  PpP/ 9: P`8@< \P!S(# 0@#    *"; pP̑A '%$  Q` $ ‹  O pWPWQP p Rp0pRp r* @" " A'p  p`' Ѝh ЍO|lH,D$ #$ 'W*W*W*EO W*W*{hW*"iH-MP\ p@` cl8( (03/@w9P Vlq9PЍpW*p@-(PUp@8 03/p`81/(`p@-M@(8 2/P#8  P 0( 3/P (  01/p.9P Ѝ$ O m8@@-M@ PЍ@e HPЍR70S5 0 0C S/1/.!0 R00000000 0 0 0 0 0 00/  /O-M|B p k T k0l<08(4,D"@@$d@H + zk}!,`P}$PQ@#A3(0 0S/2`r"@/@  ` |1`p!tq@`pdw T+ Nk  ` ,1`,!$q@`pdc @+ :k  ` 0` p@`pdO ,+ &k /02؃` 0!xpj& D@@ d `/  + kЍhW* W*Mb-D"]pO@-@LᘷlG-MDa 6 0pWB @0Q$$8 ($0 3/PP 5 Z$'8 ($0 3/ R!:80 B($0  @T@pGW0p@!S#( p1#7/p Ѝ$N$ R(X*W*O (B-M`A 0P`*!s#( p1#7/p"A P`80 ($03/PP`U: 800 (0  pp3/pЍp8 x(0p 0007/p U* !P`#"P $ W*mO O-yMM`H0, (($0T 8@H\I\Y  G@'QVFGOOOOO,GO8GOOOOOOGOOOOOOOOOFGPGOO\GhG GDGOpGxGGGh tL8DH8  tP;P@T nQ QoPo@o@d,4 pPP ,, PP^PUP @@W ,q p@PapP PP& RPP PEFxP{ ATL F`kP r <@pFjp  QPP -&!)P  F@Tsx PQ!  @P D 0pQ Q P PCEp=ȰF`Gp @%dP OP ,P  N.뗛%  Z pP  >.pV  @`FسpPP H@4 P +xPQ PM` (pȀk{DP@DP Q |(x( PUT `D@4 P0(4@<0,,P< !0 8 P P$0$ 4 @ 0# @$ @P (P  ,   0$ 8@P@@P8<@ P@D HL`P `k @p[hU R$dAQ! P :pP P`U:QU R ذ  U H }yߍۍX.<<T!X*Q0X*N>X*X*X*X*X*X*X*X*X*X*X*X*X*rE4)X*O dZ N"H-4 C㯪:)H-M@P Pp{k0P `PU FЍ9"0H-@`P Q P P Q$ 0X*X*O-MM pP  0P ( Jt +JO8DP0P%00 J @X`hp   @2D@x 0 |0  @02 W p Q GP P  P.'7g@ PP PPP = Ptt' 0p0 @T7 B .H \  (,,' `,0` C (Q&6`` ` Pk&PP6P  B &f0 R0 |60S P @ P哫hP\\6\VTfF   @P倫8P4((&  0uC P(@ TR` TP-PI l,pWI@0 [<8`4N [P* .p 0-`@ 0-@48 0-pPG PP\D 0 @J0 48`<(PT0XDs! =0@p0!! 548p0!! -@` .똠@@( & .48  @p%,< 0 @0T@#J 0p PЪX P*! PU5 `,@U5*J. 0h-`p0@ 0a-P48 0Z-,0Rp h0Rn*@P'. 0F- 0f`p@$ .0@0, +$ ` ' .480$P!!"  0P b< 0 @0T@uQ|P2D(PP`  T@ 0\TH H   0@ p-@@- #!P Ѝۍ 02 030X*hX*X*X*X*(X*X*X*uX*U X* ">DX*-=C-X*" X*Jt|pB0H-M@ LP0<PPPP P ᾩЍ0X*! G-P@Up ؁ `'&   vp>ڨqPUꌑ匡  U0,`00P4 `QD@@ 0㟩P JP!@*1i 1^ @1R ``lPP@X*Y*X*Y*:)cX*PZ*X*dZ*F#yK-p~P @`` Pv OY1 ̩GXP L P܃p>(?P  0PJPpP LR /0` ``0`@@1Ӌ ddⅩ`=P1ċ ((v .ԃX*Y*Y*:)c\*\*F#0H-@P@4 0  @@0\*\*@-!Q ! 0P@R00-0 BRP0P0#0Q @00QQp 00AQX0^P,W Y*PZ*(X*\*dZ*H-X P 00S S P RX*s"H- ? c@PPP;#P P/P B@pP p tP*l`P TcT<L8@k`c\*4Z*ƴ Y*Y*O p@-@P p|P``P fd`dd p8@ 0ˊ0$$ |4pY*Y*:)#Y*X*0H-@8P ͷ(PP :dłͥY*Y*H-DD 㚙np 00 P:)D]*X*Y*@-<<Q@ @0 0AQ00Z*Y*////O-M Q@` V VЍP Q3P봀` QʜPAP pP  0  0oP5PJ`PU\*\*\*\*p@-x@xxPx`t t0````/`Pp<p L(Z*$Z*PZ*,Z*0Z* Z*dZ*K-Pp@Q؀ؐl  @P `QA/ԉ ``↧X>P0$Z* Z*PZ*(Z*dZ*:)F#O-MPPP TTcTCT#XX pQ0PRGpPJQY   PJwP  R R `kPzPp*t" @ `P Pd*H"PP IPf H`P,P(RB  P0,00@PV !PPP@`Z &x! @ `\PP HAP3JBpP*J 8  P'JP @! `kU5  ` @P *P PPPpPJhЍ PEp,. ⠦XpP`  0\* 0Z*(Z* Z*\*x\*:)7NQZ*Z*PZ*dZ*F#H-HL0S0 P0^0Z*(Z* Z*A-P x xPl 0N^`pAT V@@pW`@V@@P@P Z*(Z*,Z*A-@!P<GPP <`P/Jp!P᧽-f0 `tp dPXX L`@ -H0$,   \Z*:)\*#|eO-MP@  r`2 p P 챟p@@}pP&̡́@P4 `T ` l@P( PhN) VpPW#J@ `pTY WV蠟PP T P&$ xPXOTd 0pQ0W00 pT`R`Ѝ4Z*\*HZ*\*\*PZ*8Z*dZ*:)O-MBbܲP P@P6Pu U0`/pZ Z0 <3  }PC $2 Q `x`F P᳴ R R0,P0p0}P ``PQPKY  !a," ԤP00* T@Z%   00 0Q R P0@ ,, @@⟤8WЍHZ*J,jP0P) P`]`Pu u+ u tJP dPPhJ@PP PP01 x'4 o۝P# P0 `pP !P^ h Xdd FTZ*K `Z*XZ*:)R \Z*Q0l[*4)t$p[*c g hZ*lZ*d q LZ*L]*O x\*7|\*\*t\* p\* 9H-MX @0H \P JP(%@"% P%@"%ЍdZ*ht@((H-$Q@0 E PZ*dZ*H-$Q@0 z PZ*dZ*0H-PT@P !P 8@#P /P  @0TZ* A-鰀@P`PJp 0  ;R,R ;Qp R R  Qp\*\*\*\*\*O-MO 00@ P  00@ R @p=0G=SE`眉 4 ܈̊4D 8h,h  ܈t䏟P8  W !WWP6 PPJ` QpR nR lRg   `Qt 0l0CS  QP`PPJG@oPyJVW`GWq`PpQ nQ lQc`^`pQ nQ lQa`@Q$`pQ nQ lQN`Q`pQ nQ lQD``pQ nQ lQ5`"PP J`PpQ nQ lQf`0PPJ`PpQ nQ lQ_`/ R /P R `, R@ FPP p`PpQ nQ lQ`+ R@ %PP !PhQx`pQ nQ lQ`_Q ` pR nR lR   `, PPrJ`PpQ nQ lQ`P P` pR nR lR   `d UPP@J PpQ nQ lQ  ;PP&J~蟟`PJ P XJ0 PV X``PpQ nQ lQ`8  PPJ PpQ nQ lQ PPJ PpQ nQ lQ @ <PD$3PP p`PpQ nQ lQ`P`0 A R*$P ĔP$"P= ` QoQ Q gQx`pQ rQp`` {PPfJm弝p P_J P XJ P `pPpQ nQ lQL`,Q`pQ nQ lQk`Qi "  .PPJ1@P$  <lP$"P` 4 ` @P  P ,P  嫛' P PH wRPP 嘫E PFZL L PPJ( ` P 0`qW`P`Q` QP WP P Px p*PJ)P P} P, $*PyJ, 0RQ Pf PAP PT P )P W  QGpxP P:4 ,9 P P2 9 P P*8 ! PpQ nQ lQ \* B) P P x80S<`P PVGGGooPPQ Plq) P000(0 P S   PP 'C |\*.  P`PJP\* 0l0CS  PP P P FQs oPpPJ P\*LL PpQ nQ lQ` P PfQ o%EşP0 WW HPYJPILH@ QR XQ Q4P 727Pn"\*P PTP!J PJP JP!P  P R Pp@@PJn t$0@00;P PPP]   P<p\*\Z*0T[ $Py #Y P t#Pj[  PJdQZ  " QpR nR lR     \*PPJ`PpQ nQ lQ`P PwP t  }!P  Mo oRQLPP^bX ^qY  P Q`AP P<P D` PpR nR lR   `\*!P  o oR~Q| P P P  1GP8V <3PЍ`P\*\*\*\* \*\Z*~" \*M (  lZ*@ p\*  |\*s"J \*\*\*s PZ*\*dZ*Q0l[*(_ LZ*L]*:)((K-P PP`P `p@P  0PPJpPW@@\*\*s"O-MC儳S `@ Z  @ Z A8 J6Rs0LLLB  m`Pe7 "Padd1;Z `!P^.Z `GU/Joo[`PPJ`Z7^Z; 0 @ S @%^Z-Z` pP"P g^Zp-Zp`b`PJLd P VJP<0`Ѝ`\* B)\*\*\*\*s" O-MY3 РаPpU W pWppW `P @tP  0  0P pW Ѝ\*\*\* H-4$H B)\* O-Ma圑q嘡@P PP>  Q PHJ@ <PQ Q:P.Q$ P! PT R R @P UP  Q Pd  ЍHP ` \*|\*\*x\*PZ*p\*dZ*:)H-\ R PP < <0PP( Q\*\*\*\*s"O-MP`  P! ̰PEp @P  @RpP@ЍSPZ*\*|\*\*p\*dZ*A-M$R R$r QDbL  oP] @Q5j/ e @  00@ R Rd@2@P+ !Q+P"J :.@ 0 S0 0pp pp 0p WP@@Ѝ PtFx pp⃖h;@P@ \* B)q  \*\*\*PZ*dZ*:)F#K-(a@p W\nP" PQ/+ ,BW G 0\S0S0@ Q  xx \\*TP,e@]*<]*PZ*dZ*:)F#O- M@`Pµ@ P1 Ă弒PP p@Q Q @ nPe T"Q@H  ` P`@QQq Q @ \nPH  @R[ Zt `]PIJDDATQF P  EP  Q) .P*w z2Pw k|#P T @ Ѝ\*\*\*PZ*dZ*:)F#\*p\*H-P D, aA1S000 B)\*8]* O-Mⴱq崡嬑@0 `PPA`U P p`@7 P P P P P` P-&`PpQ`p PB@€@P jd Q8Ѝ J\*PZ*\*\*dZ*|\*\*p\*H-Q:p@0 0S)  p#ʤP `PP fiP @{P/P /0 h0  hZ*dZ*\* r!H-4Q @0   GhZ*dZ*p[*O-MpqP@`0p`PV0Qp0  BQP?Sq0FPP$ `U ` PP P@HX@Q P<ЍK\*\*\*PZ*p\*dZ*O-M  pJ LEpPB <`P,U P ` jlP $Q`''尔P! !Q Q %QQ Z= Z, `AlP 8$Q`+,% XY pU U ,`#lP #Q` PP \R  PLQ p `Q> Q ` kPl "Q`,& rQQ  R& R< `kPH 8"Q`,~~  A Q P A Q   0P Q:;AUAAq  U0,`00kP `Q' DA,]u ВPpL u ⿒wP @ P!@orЍP<"`Z*TZ*\*\*PZ*\*dZ*:)F#lZ* \*\*Q\* @-@SgP 0t o':)F#@-H R <0AT B R @Q:8]*\*H-P  q\Ro MH-M (' 0 0ЍH Ѝ/L]*H-,! P P@?00 QQP@T5@1<@P- `PpP QofP @@ uP d '0<ゅWl@ @ v7t 00(\*\*t^*XZ*L]*:)F# O-MP`@ P @P @\P [Pk@PR PQ  PP\`DVPP@@  V0,p00GjP PPpP2& @P"  0ЍOB s ‑8PP X  ('PЍ\*  !|^*PZ*x^*dZ*:)F#\*H- ʌ^R ]R[Q Q]Q0.CQ    R (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@H  ]RQ@]QA-pPPP` VP2@5PP- PP%P1 @RPP 㻈P"P 4PgPP\* ^*O-MS%P R @PrTZqbr弲@Z Z 0 <@ _iP{ `"0Q@ `@`@ \Q  QQ o PP @PAP P)P P `da\  T0,P00iP PQ;; @,*@P% !r IP r <xPHЍ @@Ls\*^*^*PZ*dZ*|\*x\*:)F#^*s O-M @qQ elP 0p`VaJ@V. PVJx!p@`P2 @V  `P$ T@P3"AXh 0(`PZxPl 1  VPJЍ\*\*\*PZ*^*dZ* O-Mp`PU  P  01 @` 0t}P D `@p[; ` V8 [䓟䣟 [< 0p gP pQ刓pP  0P3  @A `pW W<0  gP Q ᠒P  0   0PnJ@`pQ Z Q  0|Pi `@ R堡報 R,0p00RgP0 dpQTLHV  P (S$P  0Jp uZ  p y1P ߍp ``hX P4 \*^*PZ*^*dZ*:)F#* O-M@0Ps弳弓弃 \P0 &Pe `PD R R 0 p00fP p$$sQ VhE 0P @^1@Q20@P. bPD R R 0 p00fPl pHHrQDV1E 0P @' PT T 0 <p ^fP> pqQ UU @JPf8qT0 a   T0,P00.fP PQ**"o w/P o ppih!P@@Ѝ^*^*^*PZ*^*dZ*:)F#G-ؐPp`Pd LP o 4#g\@q   0!^*^*^*:)F#A-PAQ  1S@pT `Vg@VAQ4 40$$ 0pp 0^*^*((\*\*O-M✢p㄂ptRd"d2P`mHPK0Ÿ0 PCpa@FT:V, V<!0 0 1`0'Q0C`!P PP Q!0@ !`PP` p`! 0 1p0``Sqp'q0P 0 1 0C`p22@@@ 0C PʔP l0 0X0DP LЍ렟(\*\*(^*p\*PZ*^*|\*dZ*E O-M`@P/ P`}P#d{prEQmFpbr㔒ㄲ K{ePrPf@PT``,KPLP PP@sP vP wP8FPp!=0`PE-00 X! R R$q,1 aP P PI  N@Q pGP  P    TGP  PPP `P %PPԈ< z9#U ^*^*^*^*^*^*^*^*4)^*"O !H- 0K㷈:) O-uMM0P`P U&  + Q P $P0 P*? ?$P  2/P, 3FP   P \P FP   P PP8P4 /P FP+ '   Pj  cpuߍڍ@+:P t#@0LFP H DFP`P $PVr PVD P( UE/ P /4P @@/.Ppp P D [G X Ta  @n  \$c 0Pc 9EPC0pP   0 ᲉqX尀 _@P`` @Pp P YPXP   PmEFP L   0ptG.NNEPeW   .EPT 8-<="#L H-L="#D4  Jc^*^*dO ^*P"^*y `  ^*^*:)  ^*^*^* \\C \ \? H-XX0Dd T  V H H0S \\H% H-XX0Dd T  V H H0S \ \H H-XX0Cc T  V 8 80S \\H H-XX0Cc T  V 8 80S \ \H H-XX0Ee T  V X X0S \\H H-XX0Ee T  V X X0S \ \H p@-X X`p@tPp`t0 T  V  p\\p@ p@-X X`p@tPp`t0 T  V  p\ \p@u O- MP@64$k`P  pDPPp`CPf 7x1@GQ                        ( 08@  HP        X|  Tl  @ş%5`utt\%00|ş|%(54u{`` 0o mDkige@$000v `] |Nlğ$T4tq^I<tt   PL4@pğ0$s00@ß#3s93sß#+  ppX#000dX@  #0000Ÿ#2s p2"PP P %\P\"\r`qL\"<V ``QT"X2p `W `P `00 `0`\`RQ X㢮/PQ P P P&"P P PP dP | H` \4` \RX EQ @Q , Q !0 S!P  F Ѝ6!^*ht@(^*^*^* ^*_*8_*^*4_*0_*,_*(_*$_* _*_*^*^*_*^*_*_* _*_*^*_*^*^*^*^*^*4)k!dxh<<_*l|@_*(^*H-o j:) O-Mp@"P Py P`P ЍOpPbGPR A娡p@PD$x$ i  `1LP \.PP$ PP  \ _P SPX  QpP@@ PЍ@㊴ㇴ^*x_*^*^*_*D_*   ^*=## 5S \ S \ \  S / S 8 RL R $ /` S \ _*<_*O-MQ ` pX0, \XTPlh84d`D@ @PLH(`$ PP $  ]x `B?  0`VI@ lP y@Q @Ѝ`P  Q _* 0_*_*!!  _*_* _*^*^*^*(_*O- d0 ᱂ P  `@P`XX X PU<Ѝۍ$㧰H_*_*_* 0_*_*!!  _*_*  ^*  _*"" ^*^*_*^*^*^*(_*P"O y :)l 0H-M L R 0 0 Ѝ0 R  @p t⚁l@l `B?P@^ @ 0Ѝ0H腁P0_*^*_*!I   _*_*` S H-M $dRP`BP`pV` AQ` p Q P X X pGwX⌂P P`U` AQ` p Q P X X `F vSXp ` 0V\ P`U` AQ` p Q P X X `Fv*XG`pP @P` XX X 6P`` AQ` p Q P X X `VX`pP @P` XX X Ѝ0 :)4_*H_*0H-@8P \P YPP\T0$_*3x"0H-@8P rP oPP\j0$_*3x",Q 0 \ ᢀ \ក$_*P"O H-q! Q <x<<<<<`p Q0AQ`0HX X @AIP X`p Q0AQ`0JX X *2$`p Q0AQ`0/X X =%`p Q0AQ`0%X X %`p Q0AQ`0X X | `p Q0AQ`0X X /X@X= X% X|X/X*W:)O- M0Q,0xQ lQ 40TT"TR  `R ЍOV$BP rGYPt   @Q  ! "     QܚP`ךpUpКWB<P V(4 P  ,'XP@E`pP @P` XXX ˀ@T@Y`@P`XX X 㷀P Ѝww_*0_*_*(_*^*((P_*:)O-M@Q,Q Q 4!1 `PVЍOR NpW9 @Q ` . [`@P`XX X Z,P4   PJ`pP @P` XX`X >XpWX` AQ` X X ЍX ЍO&_*0_*_*(_*^*(:)O-M@P,``P P 4`PP`UI xqxh, = [2`pP @P` XXX,`0 0@`0 0QPpP XX P XX X X ,P4   PUP` AQ` X X ЍX ЍO_*0_*_*^*:)(p@-@`P RSP  V P@8S~iYp   _*O ~ O-CMPY@@T3∠pD  0{_p `p V =`P?P ?` l P<W:PU:? Cߍp?)p@- M@ ` Y_Pp TR BQ P ,X0 T b`P Ѝp:)O-M@pᰐ`9P P mmP CP `ϐPXpPpATe px -:p UH:99pC0u=p p`  ` [ :p [ U:9p p9P J p  P[ /pp@up@Tk{!("Q04)3x"O H-` }[{:) O-MMP@ _bp 'mhPfP hP vP iP4  pp)PEU$A:!dPE9P  P  `+ P ! 㧫UDUzP Z/P / `pp/QP pp/ PPP  Q:hV`  #P`X@z! T_*`_*\_*X_*4)d_* H- 0G}z:) /h_*O-M-MP@P'9P 7P\ P 89P 8`8PG  ta\P9P_ @T@  PJ98IP 8P 88P8P@)`dT2p<Xd W`㐄吴 0|,@  P N7p@ F7p$@8tXA ,G8P 5t`` |c@PpEpw W  AQ 4 Pp `YPP 0s 글IQQy  6P9p⪋ `$ 6PWP  A pЀ ޯ A)d 0 L  (r 7|  6Px,$ ᄩps 680 @ $6P sTX $6P P xs@@P<s7P H{s@ws@ 6$6;@$6P is$6P d-P \s$o6P 7P `P {ЍЍY@X_*\_*d_*  :)iO"!O l_*p_*h_*)=J`_*ԒA-MP@7P3  p  ((T (s p R TЍ6P)  p   p R x`0 P  p0`r_78P p88 80@$ex1Y#O `_*msO- xߍڍ(:)h +@`*Pd*(H +ܟ( *8 +3! + A-~MHP 4PP,` @~,o2P~܍ԟ(_*(0H-Mxx @P`P 0@QJ 0ᜆpT e5@Ѝ00`*_*(H-PPT4 4Q$$0 4_*x_* +0 +`.H-@P`p 2Pp@DPTWH-@P`p 1Pp@DPTWp@-P@T0 0`1@VT0 0T @  T`t@HH@ 4( 0 4pԟ(_*(|_*ܟ(0 +x_*O-M−@T|`pP  1@PpPE`UW@T80 @  @Q *tBʙ P@C4@lP4T  0Q*J P0PZ#xP tP pP tiP eP@@_EP@@T JT @PT3T tڌQ Q llp@ 3 L)@ 04 84Ѝԟ((_*0`*|_*h +bܟ(? O- Ml@PSTPO LP\F0P(!00 !pW* 0〰PPNQJ[PWpo ` 0[ [0<QZP Pxd `   82PJ8@i3 Ѝԟ(4`*(|_*_*_*_*(m)O-MPpPPP<PU8찟P@P2:@ 0`PQJP 0go V 0PP0 S P  Pi( z3PPЍԟ(_*(_*]O-MMP`VJP@P PrUD2pV C `p~,30Pp̲bᎎH/@@1pgH/@1pt ~,0Pr@ `~, 0Pp\H /``{1pB`aW ˏWH/g1pcڼp`@UI  0$4! UC lUPa 02q! P 0sH 0P8x`p!!``pqʲ     2p`pߍۍH 1pʍ08 0 2ԟ(_*(m/0 +_L,tܟ(O-MMD N/pg($x28 B/p[#l2@PPP ЍۍcP$2PP P pWWNP 1\24222P0JhShchxp{@.P% P   㖎P  P$ 1111PZ*PtZ1@ @b<<2<W 1((W1  R111111P6J̑QAp{.P- P QrPYP SP=yP  `4p3d~1sP. D w1 s1 q1o1m1 1PZ @ @0 ^1)@P LNX dP @I1?@@1 +<`*0`*4`*< + +_*ğ((_*ܟ(7X( Nm@ԟ( + 8`*}^=!@-@(p )p(H-@KP ,( &1H`*Hd*JH-/p H 1g@-@.p 01@{p@-MPD/@p@PP NPP  P P ` '/p   P `@ЍpO-M@PpJaH0/PjJ 0/PeJ@j PTq̀㸐  X @Q @0`3/P< 0P3P2J$!P 0P)J>P$J/P PPS  0@  0PP P (0/D 8-)ЍN _0h +Pd*:) +O-MP J!LL0# pW@pLP^JQ倱pLPpWPC GP@JY@PG 4/`PJ  2/pp(PJ  2/pPJYP /pVpF  @P/L 4吲" I Ѝ耠(((*(h +O- MⴡApp`HPP'$ |2/P @ R 80 3/PP Q? WP; A/ Pp[ P P pWP '/NpP|/ Ѝ`R X<1/P P,/h +(*(xU/Pd* *O-M`P7JH0/P1J 0/P,J&P)J=i@lPP \|,P &D&7/4P $PJ@SP (0/, `+&Ѝè㸰 p @P  @Q @0`3/P 0@PJ< P   0@XP P (-P  -P9 dPJrPJ " 00 @/P P@} 88 ,P P P 0QP^PfF e PP Qf tP P@Q:P P  L @PQ @PF @pf @03/0P@, 0PPz | @P m kF  RUG  R+JPQ6P>F =  0ut"PP p @P E A<  0 @P!F  R.G  R# @p0S 0@( PP $ p8h + +( +Pd* + + + + + +p + + +( +G-AMp/@P P`PP 圀p p/P x 0pt-PP /P PW( 0b-AލPd*Hd*H`*O-Mb@PPXJUUNH0/PPJ 0/PKJ̡P !PDJ X #P=J嘑  o|NP. (0/P`s!P J$(AP C@P   )@ 0@,ЍP帰 9P   0pUP P P |!PJX "PZh + + + + +p + +Pd* +O-M⨔p ZU P.J `P+J,0/P&J0fDP !PJ(d P W 40/ `a)RP h$ `ЍCPP\$PJPU PP !PJLi Z  PJ P a.   C)p (Pp@/P dP    `TʜP  p  @PP"0%,< i P (@PP P 0g1/pcP PP/  @P #   D03/p  0P,P  @P   n q  nW J P PJ  P P J pP ,@ L  F h + +Pd* + + +p + + * + +H-LP P JPJ(H0/PJH +h +O-MMUp{`  2 P `*Ѝۍ@ /PY/P /@)p#   P'`PJp PJ"PJP PJdv P  `'#G 0$`+04T@dpGP ᰬUP(  /P ʪP *=)P:  PJPJ ( P  p44 )P` P  "Q + QP0P7F 7+.*PU @Q:P PF 'p 6|pnڰ pn hmf,F R G RzPtQ0P7F 7FX!0T*npfPf Pb  @P   mOF R] G R!0N&ꘀXPZPP崀.hP`` @RP( 0 R /P R  0` BRPZz``W J R PX `` H`P 8P $ %ЍD +@ + +DO-]MPp 4 p5pE 0 @,8勀 H2E`P 8!$pʩ0"%`4`D`$P L"0%P[Ӊ( $B ` Pl{"P%`P0( R,$   [?44 OP  Y"` PP p+@)(#px |0" P#`  P 0$`0 0?%` P & P0P3%`@0(Q,$ p!R P4p`]ߍ +( +(nG-` @P   /R dApPRT $KQ  G!p)<P' Q; P0Rpp.РȀpP$( .PJ 0:ppl 0$ P0D $PPwAPp` +%d + +p +{O-M@//Q/P? p` P`"P/pP*zp4 P   "p "PG 0/pP  "Q  PЍ/ +H-Q#J@ pP:!ph`"UP 00$P f"p0$ $$@d +K-MQcJ` {@PT@ !p\!0$PP $( UP$ R P  R  R[!X!N EF ` `CSP  pʫP 0P#!}@0Ѝ + +p +l + ((d +H-`p@ "PP P ( 0#Pp +Q @-@  P $li 0@x#p +o H-M@` P0 `.aQPP' !P D 0T# Q  800`Rp`B3Q  H0@!R!B3/  P NPP  p 0 #Ѝ( ( Mb& /H-M@( * R I.* PRP ` V  [ E!p   P, " 0ЍA-MpP@(!P  P*  `.P X  0@"Q "#!"# J"Ѝ  P XlP = p pX 0 +"G!X!)! Q/*B0 0H-M@P  QJpQ B `' & C `0 &' !Ѝ +'O-MM@( @0 <,P `DA($D {AD ,( 8P0$p@PrssduslusP P C` P8  P  [& K  ,p:  CI P8 p P p,j,j ( P# X XlP Z[pP +pl$,"0!P  P! 0!2؁Q P l0,P+Q $lPBh^P< p0PXP+DP, &< !@7Cpl?8$ Q?0P8 O $0_!0 @ l  @o` $@@Ѝۍ +L# +V + + + ((p@-M` @sPPJP PЍp  P P pPV TPEp0(P 0 P +p +"O- MPR^ 0PpP4W@@@P `T V RQP 4, | | $P ;  P (\J?  Pq7`P  h`PpWPEP( u< q 80 Ѝ H +D +P +L +  p@-MPR ` 0@QJH *p 4P$PI 0Y PЍp h + 0H-M@PJPITP EF. * @0 Ѝ0 +O-M MIq` V k#  PPp@@ PP  P`8`5@P p*$ ]pF HL  #  0``:q 8PT0L < y0 `Ѝ ۍ  !@- 0 SR  R@|P 6dP @P JHP P@C,=@ + +t + +x +| + +r!O-MLAP <08A04q4 P[Q P Q4`Pqp PV `P qP V  `P `Ѝ + +x + +| +:)(t +p@-P @P Pg6P `@P/Q\ e@0 S < ``p0p ``px + +!!|Q  lQd  \QPQ  P/0Q $ / + + + + + + +H-tP dpW `T@TP`Q Pa &apW +x +!:)O-LM@Q PPJPP (B4CE FI$0 `XclS, ZP @ Pԁl$  -PSZT M4p X    @ Q@0 ,+*pJ1  0T"$ 4"0:%P! Xp P8@0 Pp@8 <0 DP"P $!PX  P8t      & , #0 P 4  `Р   $00 0 P[ ◝ (@ ፝XTPPDLЍ + + + +"."J"f"z" + +K-hMPp@P2 ( kFzITG TLp!W0pP   `_<PH  6 $p0  _hЍKQ x_t0 _<@Q*XPD +_ 95hЍ +"!"""֒"K-8M@0 400 ī0p4`%W<800PpP$  @ 0٨P8Ѝ##p@-XM@F P 08`1G\D ;A XЍp"p@-MP@PP Q `P0 ƽ2 QЍpЍp@( H-Q \ 000SQR P* /00B Q:AB60Q:aBV0Q\ P * 0Q0A\A|.:@-A\Q: 2>. .W@ P0@3^@A  Q :1>A0A TQ:0AQ*@/@-Q0E\ 000SQR%  PH* 00@C TB"N/ A@CTB"N@ a@CT1B"N`   \&  P"* 0@0T00C!\@? S 0! S@"$ P: @-0C\^: 2>! !W@ P0@3Q@N  ^ :1>A0NQ^:0N^*@-4@Q@ @t +"H-P(@$q``Q a` S H8J`U4`-V$``````V P:VHZM|p``:PXQ! 4``,, 0]?` +Q04) +1#:)#/p@-`Pptt  P XX@P0 ]P,,&P +h +$:)% +L#O-dM/GPo2P `o @P   0U0@JQ_$4PP̑PDTPPPPPPPPPdPPPPPPPPܑPPPđPPtPPPPPPPDP|ВPP8<PȐȐHPl[@5PP /0 !PPPXPPPPPxPPPPPhdqQprPaqQ[6PڀOqoOoy qQg 9_30x)|%KI\L<,- 0 .( p' Q"*P -QQ= ? P P  p po/0 p'0X000 RQ[ R04/0#Lp'"P  唯N`Pp/  0H /PS0BJPPPPPPPPPPPPPPPPP|PPtPPPTTHPPPX̘P PPPPPP0Ȗ$PPPܖ<PܙPȗ PЗ8P8h BP XtPP R   i `{ `v  `ot lRmR oR pRaR eR8h,|Q%?Q( [QS-QJ  ! R/o `@` R? ]R# p-W pW]W Wpp#R@R*QSSP Q! QP P`*P P P  0P PQ P Q /PP +O- MM PP `@.T.Pq ")PpT Q@@QP.QP.QP/P] P %@  PPT R P2 R @  PA Pr   PP*Ĵ帒帢r@ `K jnP  P  PZP/P kP Ѝۍ .P P P  @P % `+{VZPy P 2.   +W`apW7 @/P PP S @p.WPpW @ /P P  P P -  @ P.PWXP(.,T + + +-K-{-- ----.l +"O-MM@` &pP+X  @'@P(P`'` [h 0{APa V3Q V* V3W V1: Vr P5 &Q \Q 1BQ0B P@Q UQSJ@PT IP.  :Q \R\&R Z:Jp '@` VBp+ P ZX  T 8 Ѝۍ V*' Q pP P   '0 V ` P' P   +',' P <<'0 R  RT +c.}.:)..p@-@P` 0PJ Qp   0pp0H-P@P/TN@N TT 0@ U:UNAQ:0Q0N0I.p@-@MP@d4,0FP8<040q 0:P8<040e 0.P8<040Y 0"P8<040M \@X\3\c@@ 5`0ß5 ,pP  P_J zpP  qPPJ kpP  bPAJ \pP  SP2J MpP  DP#J <PJ 6pPJB pp P @PA 2!C@Ѝp)|!LAPP PE/Q g&`V`  U s /00B B I@@P 8X' P qmP\Hmp +:)2/ + +P"(ƴ x +@`*| +!(_*/t +..:/@-hh h0@`TiHP  0P +XN + +/Z/d + +H-< +P 0%=P\CQ] PU hP  P#=0<BQH 0S  R> F:Gʁ PU U" @``Vp``Vp%' @` `Tp!``T @``Vp @  @``Vp @`V R +/>3 + +A-@PI `PVE qP= (P7 #V \V `#P` (P`$P P!=$pEaV Q P=%P `P@ 4   +/>3///A-@PI `PVE qP= p(P7 #V \V `#P` +(P`"P P!="pEaV Q P$P `P@ 4 ? 9  +/>3l0D00H-P `@V /pW PP`VXpP0 F R :,VU .V+P 'PA`V$P W`Pe bRCR MR mR cR/pP KR#6Gp Q LpUP R  `` ``0  (p RP 0 )4 )  001N121q1 + +00H-0@PS# p .SnWpk0SE`W Qp!@3`p@ QI x\<PP!@k@d  P!@P!P!@ P!@!@> p0 B)T*0H-@P@P  &P @0 +1O-MY; CJP5 \2:BZРL JaV p !  !  p`P @X#P- `qP% @  `Ѝ   +ϋ A P Q (((  +qv1H-Q+ C.: R&: R@̌@D@% L LAT 0B  P "P%  `$p% "  @Tw(Ht( +qvK-`P p |`AT Pb(`(@U`V  +0H-P@P G &P ll `PoXp  D Y0$ i @0 +| +x9x +(21O-MMAQj pG P ,wAT `P  ! 7  P5  NP5 @T c"P A` 0mQJ P* 0F.*p 0aP  @ x   F @ 0T <@ 'Ѝۍ +(@2X22p22H-M@Q0@@0@!P !Q @P`0U0B`Fvp@0ET0E^  `pppW: xЍ0H-@P@P  0%P1 @0 +2A- A`P%  ,@PqW FP p !P) pP! `P qPP `$PP 'P ,'' P +23M33H-lp`P @P ,[qW P p  +0H-@P@P = $P @0$ +t3H-B  PM-`@pW# P!=FP Р+0* R !P  `P@q $ +/>34O- M⨲0S BʀCJR`u%s=P\p@Q000#0 "  U `p'`&p" PS0 R^ @PQ PXZ  PG    0  P "> `1 0(=@LR 13'30H1S ` p'`&p 00 0   "  LP@   Ѝ 0   n P 0p p ``  $ +/>3( +330H-@P@P = #P@00 +4G-MlP =Pp aV  0 $@ P|(` Z Ѝ0 +O-M`V9 @L@8<@P!=KP ! # " # " (0@ P p P P @(q $Ѝj%ЍO:0 +/>3K4G-^ @D%C=P\@BAT $ `Ёp)P(PPЀP) p(P (P@U(  4%2%0 +/>3/G-MpPP/P` ᳐`P$ (P pP @0 @ `P Ip0H 8 $ ۍ +44 +4O-MP@T) 嬐嬠`pP$P   p pP $$@TЍ4 + + (((  Q /8 +H-l0S ^Q 000SQ8 +< +@- Q@P d  KP L<q 0D @J#X(40H-@P <P0 Q* P0PR PT 08O-MP+ P`弐@p1@P+P P@PL 0<, ,00 0Ѝ50''5U5(5@ +O- M@Ps`PJMzI4( KAQ:D"D2P,",2   d ' l , t 0 |  pe EjFG  㓭/ JQ   1Q 2Q  KQ `LQ /R5Q  (,(  `  ` 0 b<      b ,`/Q``@ ЍD +H +L +P +p@-@ Q PK`D#peRe #p@>O-EMP j@Q (eQ +@Q@P@dT   pK d @Q:P P /@12 d 0 | 0  'F!@p\ziЀd@Q :!P.1q0PPAP@WP@Q: AcA0 ,\ ql@Q :!P.1q0PPAP@WP@Q: AkA0 d0\ yt@Q :!P.1q0PPAP@WP@Q: AsA0 GIpD: @Q :!P.1q0PPA@W@Q: AA0 (\PP eQPppQ :!.P1q0PPAWPpPpQ: AA0 v1 , @EߍI Ѐ |pQ :!p.1A0ppApTpQ: A{A0 M   h,'@PJ"PJP P@366555@ +o6 +6Q6//0H- Q @P x\ wHP 0X oHP HP8Q0  0HVJ#6T +< +6O-MP@PJMInj( p |Y!R  +㚄p/  KAQ:`|#|3kF@5`#`3  + d  |  .p EFzGj  H )n H廋pt ,kp   ('pl  mJP1 @R0 X  ( cK@Q:gPxP1xP!  ,`Q\QE KP    `@   1 ,  I  3PQ  -&"&p ( @ /R     <04KP4   ЍD +H +L +P +< + 7Ax#37877O-MP @Q :P P@P# dPP  @` dQ.P%Q#d@ApQ /Q @ X+TT }T Y  X`/ P%   } d D0@ Sc`2 375p((,\1 vX 4H ` &tOI@ XAQ :!.p1A0ppATp@p@Q:& B0 >!&&WQpv0 @`qQ :!.`1q0`W`A@p@pQ:P& B0 ! ,4&0I0`< f  |QW:!.`1q0``AW`pI6pp0| 0 PK d 㯂h``@|Q :!.q1`0``A@`W@`Q: A{A0 , $p`pfL|Q :!.`1q0``AW`p`pQ: A{A0  l @70 r00F<$P !   0 L`jds`Q :!.q1`0``A@`W@`Q: AcA0 o x#e,l@rlp{@Q :!.p1A0ppATp@p@Q: AkA0 O #E0LpztpQ :!.@1q0@@AW@p@pQ: AsA0 0 |"&!@Aq:P@@Q :!P.1q0PPAP@WP@Q: AA0  "0@ߍ㱇P0 &aU P  +X)`  +\PP}PP@@Q :!`.1q0``AP@WP@Q: AA0   }N@PJ PJPP p`? P J @ PJP P@< +778X +868.8?8usta!"]8 +!g8\ +a8A-MMMPM `@x  P+1 U UX K<0 wMލڍ q\ +X +80H-@ P P 0Hn8H-MM A0 S0Q \!@ 0P `.p*V ?V.`pp\pp0` Q0/P @0@P$J P0ݞPJx @0ўP JL @0ŞO@Ѝڍ B)'929@9H9K-M-PP  ?CPP k%0 TP匀`p4P @ Q 0Aj`P @@U _RЍ:) 880H-vPJ|@UQtPP hNQ\Q0@Ru<P 0  00S9` + d + +\9M0H-MP@ 0tPP h TL0P PB ? Ѝ0HЍ/t + + + +:) + M@-M@@  0P  " Ѝ@ Ѝ/` +p@-@QPH R `AP  @@bP@@pd +Mp@-MP@P0`P X +tl0p `BB ۝T$@ 6B Ѝp@Ѝ/t + + + +:) + ͢ H-M@PLTd:$\ap h1LP PPp9 P5* P& @/P"tPoPp p 0#" 0"# ㍈@PoY@@XV@7?$o!G 4)H9.":)H-' A"?:)9O-MP@S`p#TTTg\pp 0eP qPrP vP xP0 VPPP RP fP iP! pWP dPpt p x`V`PЍPQupPW9 Pᵻ@Q  /Q@ pPP/Q /־Pp.PP .PP P ZQpWPP>㚺@[n(PU e,再p@P Q PA P yPD u?P@ qP< j87Q )# /. Q0$ R$ $ R Q  P   P  P PP P8 PU\3Ls P0p XWP@ 㼡P0@SP Pᣣc䲟p`@ Q PP|Pg X Pa *`Y4Q X PO P P] P 1$QPA p" # 7 oPQ* P, '|P$P$ P?P! X $ e" DQjPP PQP  7`ppP~rPP  voP k?P gPhmB "D0 m!h +l +9 +| +x +t +p +4)4+: + + +O ##9:H-( ?#=:)K: / +G- M@P ?A&@P$P"D`P2 P P- P( P$ `;'P` OP @POp P Y@ob Ѝp孂T PP WP4`4 0C?x + +l +9iO":)!99O-OMM`@Q  p  P p PP Ѐ # "!Ѐ # "  PbpP 0w pЀX` XPzp X GPX:lP 0㿾 pЀX` XPzp X PXAP 0㔾JЀX` XPzp X PyXPq 0ji W WXj`  PR  zXpWPIWPA 0:9РZ{`UaV`: ZP `j PZzpp`P TTpp5 ,,pp5Oߍٍ +O G-P@,P  q` H-pP pP4P* Ppp/tP PQ P  p/cM5H5 P *;!#4)O H-" =;:)r:K-P3rP  pR吐G'<:`G: B:DG!0 aS P KAd+ +h+H-@Q  0Sdd`P@' @qW P `pPA + R 0 S$A'  A/A +p@-P@U  QX`~|PP Ppd+h+H-lP@hp`Q `'VPP Hgd+ +h+H-@PQ  0S``@' D @qW 2P pT `A +@-@P@K- aK@q9P 1S ppW1 0'PR,PP 0 zTp `\r` AQ d[`@T Kq9 d+ +Gh+&G(p@-d`P@Q  R @RP'Up +O-M]AaQ8 pW4 ܐܰ@ =&P @{8P P \` AQ [ HH b\pWL ЍT+&G((0G0H-`@AP aP@00P@P o @ @ T+A-Mc@ >3pPPQqQ Q, Ql&]Q] PAU@DDDD <HDdDDDDDDDDDDpD|PP @G "p|2   Gp ppH04 G@ @08R Pp@\^QO |Q[ ~QhpG$OQcpGN =RE H G <0&S= GpG"8pG#5 G- 0R'+S'+pG)( 0R(-S! GpG&=P& <P& G =P >P  pG% G0=S ppppЍ0|S     8+ B)HD0+H+@+EGGH-M@P7`PLѕP  IRNP  ĕpP  㾕pEPP@@@8PP7Ѝ0+8+4+<+G0H-@YP )RR0<+H-  74+mHA-P$@. `p P Q @ AQ i8T@Q@ AT  QZ8P`@ QS8@&7@@v@0 0PZo!((L++F K-0M@pЀ,(e`TV F P :(( 0$@P0ЍN@PWV  F008@P( `0蘕 [@+G-@P넠 %Rpo`#&P`DW@ 0W J<+G@+@-@Qs@ (@Ph Y # qV PL 0^R R ^" #o( ?@ d2 0TQS?@2 dS TQSQ!!R .," # 0s!`p8pP P` @U ^PZ  P d`P*0N8PP9! 0V(ZЍ=+((++O-MⴣP@`^Ug P p/댳儓Q:;;<$<H<:: ;;;d<<<<<<<<<<<<<<<<h=^`P ^`PPP" ^`PPP}lP fO^`PPoP PU[P/U`aPa``]P DOO )P 6OP .Ob9hP %O0`!*(P O P O6RBQP N l``3o` A/ (/P OPTP 6 ЍQ`PP밤(+++J(,+G-M聟PPP !FPPpW A ` KpWhP\P p`iAP <@IP PPPP5P2 ,@p F`PP  wIPtP P KPPIP,Pލ A\+(++J(K`+K+d+h+(KK-@p)PP) !E!PP`V Q $K`VPWPQ AQ  P EP`QW#'`Go"'P WDNP&PWPP b^F{(PP NWPP 00  EO8OKO갤(++J(JKd++h+KO-MP@`p^P3P耟pP QP $P"  pP P P^P PP@Pp1 pAЍ+(++O-M@葟 ^Pv-UQ`p`pW  P `!00[P p paxP& XDOHO O AQ O =jO AQ  O DO Q>^PP P P [PP, @ -Ѝ谤(+++++j (K- MP,a   p@W6 P2@PU   ]P PUpW P @PxP^P@ P  @T P^pP $@@, Ѝ++(+O- M@P t%pPW7 T`P p< R &PPP VDPJD|VJ`pWQ&` RDP ЍVJ뮶od+0Kh++O-iM\ xLLD/$,? c",@_ aT  aopP |9P  @T p_W _O`_9P  pW p!P ppp+tQ t 0t1 tؽ=6 (R PpPt(ptAtQv BM|QU2 d}=` @  AQ vM @@wP @M AQ `M ``MP @UQU L`  AQ AM `MP `U @T \`v 5HP@ `TK AQ M YMpVP[ |PK K`Pp /P$PU<\`!RIpt1 \ P @pP`@ -R -RQ ` pV`pV# TP@@p\ pW@ptt }$pP@Ft V$0P D`4 `(Q @QD*` PP@P PPYJPxSi#Tlx lYp&PP? Tl!9$P lXIPa lPah@dT YP gJx xP x PP dhBxx@Q8*` PlxPhl @p 00lH,8XP@0L <P ,,P ,PT$P9 7Plx @ WJP~B뜗H8 4w||  ` p1t`0C04 XPP \PP<PXf`dPTVPL \Q@|fO0FPF`Xx `AXR4  08//LQ DPP Qx 8$@P `P<P H4 $ B#Ol ApP$| RNEepptp`pp`Atqx!ptğ4p p4/*P PTT4Pk p @,L0R34 Rq ᳇,P L/L#3 0TL P R|4, Q  8xY,p ,P,QPPN 0 P e` P CxP0  0A (P ()"Mc)iߍP@;Pxp| @!L _N0Tl!"STl!0".PMI,A QAP |P B@JPTMP!O qt`1$ p `pHP8T/ O/8P {CWiQ 0 4 L p p,;@PP  P$U`` P O++P+T+++(++(;H\Xw+hp7d+EK+`+++\+h+VKX\̥(+e++T+x+Q0(4)((`++"#hK0H-MP. @ PP@PXXXXXYYLYXY  @TP   5  Ѝ0@-MP @PP 4P  0 Ѝ+p@-@4PPP Pp PTPPP  PBp `F`pH- MP@ ^P3U1 'pp)  `7!PP ? `P,P ' Ѝ 밤(d+h+EK@-M@P$ 0 fp &P X    0fp ,=  Ѝ+\(PATHd(/+p@-M@B/PPЍphN@6@,\`V B@JK`V@M$ 0 AT+(++/+/+ /+ /+ /+@-@Pw+P@QQ( @cP@@m++KH-M`.xPP @&P2DDDpPP%P&Ѝ+T++++H-M@/ዄP fP%  P$  P$ PЍ IP P `pNP   Ps& 4PP  +K:" QU/+H-P*PLL 0 QSQS Q0 ++++//G-HMI.8%:80!<( p@ @`DP80P ( @ `cIHЍ!(KH-M@P`pW']`qpӫ@z)F  B+@   i6P0P Ap0Q P.R 0r0S , 1f@ЍN@+Kơ O-MP@/p 寃P {PP 0S+P U8 w Pp:9`P㘰WP 08UPP P  P Qp PPPw%  8`pGP> ER:UU ~$ @0 ++ H-`@PүpW ίpV R$ +\++O-MX) pR%pPPP :PW @偢`Q%P`U@  Z/P/Ѝ Lp WQ:Q:Q L@ЍO$ꨤ((+O-MtSp`@,b@Q',f$fe4f@feeeeeeeeeeHfPfXfe$f`fp`@PW2 ` RU pW P  ,RBP Pg g,g8gX [ Z V pWdpo 0P PPQ PT P PXG !pW=oT pPU PTh`hlhxhX[ Z V poPQPd|Y:T@>FP 8EP PPЍKT+(++(KK-鬀嬐@p PP `Q QQ?`PP|U:P P KBd++(h+K-M Rl jjjkp @P w`#PEUY tG!Y%&Y$ (bE$ GA`R PPP JEHEFEY AE?EF P @ AQ VE *l@ AQ HE Ѝ01LO d+h+;LALL(L+L(ELH-`@Q  0SCpa!(@r !!ApQU ᅩP" pPV `w"P U P,P vPp+d+h+8+@-LL@ 0 0KPP @W8+d+h+O-M/@`P0ʀP P` 9P `xP* pP P P p+P 'P #   p P pp @P|@Yp P >PK h  pk"Q 0&P P P&P /P  W YA P p   PPe P ~귬P P p@ pY( 0`@0 @gE7 p$p@崐`W pp@o p@RPP ZW    Ѝ@崀`pPp@op`P@Dq!'!bP pP", 9+cL(+dLd+h+lL(qL(#H-`P@P `pQ%V ߧP pP@LEH-XP@P `pQŧP pP@\F0H-8P @PP@P0\FH-XX 0P R RQ U 0|S:舤(+K-@܀`'pPQ Q:P P:QPPPP %Pv%P`:PPp@<@qVQ`UV Cq `+dL(A-销P`@T pPO8@p@T`|V:PP A;d++h+p@-`@sPP PO  PpP p@pd+h+0H-MpP@l0>00  SN P Ѝ0P Ѝ0Hd+(h+H-0P Q{OwO-MHT`p@}(oPP VP`ppP vP@0cSo  S R X s@@ `@YAZ @` QቦP4 P1P8 @ `Y CXA ~P AvCP B AQ A `Y ptATAP ~0 `@ P5 @ `pPy`zpzz/}P$ P0 ~@Y&9@YrAY|YhY <C @@@P 1WA@XQ&YB@ p  B`{@DTYPBhB@ `Lp@@Ѝx`pdd cS LLT+,=LLM(M+bMMM7M M"M!MLLLH- ~Hꤤ(G-P!`1 @`!@1q`!A`af dR\0P0X PP= @A ap` >p p` W p'ppQ*l  Q L+H+@+D+P+(`++((d+@-0 r RSA sQڈ@AT :QQ0Q 0 0NO-Mp  $  DP`~P  Qp F ␄   `P<UځE P#簀āt vp U :U U =UPqpPp P |pP D AApPPp PP|{ uppP p@Pp=P pP Pxw`P0< @Q)pQ&sP] PTSP('PpPT p~PP=U PpP FYp Ap P; P:9 p. P lp P'wPPkp UP_pTpLp Y P`pЍX+((H++L+D+@+O- MD@Pu 48r0b@` P]P @Q9:P @P, T/@ PT3  U3*@T T`` @zP% H P P `PzP PPU: ̖@ UT PP ` U: PpW pWQ P {  Ѝ`+X+(P+#G-PJ 0Q$a$(@ >RR4 *R[R?R p P  P 2 PP P P  R Pp@@Td+l+d+h+0H-P ,P@@@@Q0d+H-t@P hPh`ppP P PP+d+h+`+O-M P4 bAB2p☠P[ 9[ ځKQ:[ Q W [ [ /[  AQ 1EQ ЍQQ P YBP8 EP టpZ y P p P*p P PPPy/PU/Pꤤ(H+(L+r!DBO-$MP o =sy@ P   P&  (P. p`  * `Dp5PR0C V7 [C0 U 崵 xA P `p Q @Pd\\d50AS p*P@P p R 8pP^ R"Q PPQP긴V?P `F0V0`, PQ^HU `p P $P P PPU`F R ß0PC`倰@ c! !@PXP ` `@BQ7*Pc  0 %t̲Uo `u P Pg lPZ PPUKB Q0(؏pP P1p!W pP 8ꄁu V%- X1@00 0PA0 0P  q!a 00 A p A y R  0S S@`VW   S S00SP$Ѝ0  УHD+@+(H+L+DB(M`+D+O-M \#\TPc0P0 ß( @ pEu"Y p  2倒p唢`<E @@PʼPoJPDP  pP TPR p@X X@`VPiPV A E@QPE` `@P2P@D`T`PHPP  P p P *p P@@PJP uP PL E w4PP0P qЍ謤(d+(H+P+`+D+h+L+DB+O-$MXXSD PHP@c`@A`p崠  BQ 4< @@ 0@S "R   @ $ЍH+(L++H-hp`@PP Q Q ((`P @P`+P+K-$QPD  P aP p@@P P P P`P  Qd`dp@@QP P P`+P+d+h+G-Pq Q:PP U PE` p@@T @R:PڊP P `P' P@D U p  U00 =P=R V Q V`F xP`@V kPHDO-MQRp `%@P   pV p  (< pAЍV P (` TpLL0 0#s$$ :묤(D+L+H+((Mx<MO-M((pB`PW*(QBP B  WP` P @,`d Yp `P^V`ZpW:!pEW}: `PGZ`@P wQ  0S Q:ppW*]pEWY: ^P:GZP wQ  0S Q:pp`ET<* APZ Q@EP`0 D` CW P@tPl`@Dpʟ@@Ѝ蕠묤(D+L+H+(O-QGQLQRunning6OO-M X`P QP NPv,QP&@ p`P P T  Z  Pp`WЍX@`V `pMj ,b밤((N+++O-M좟RpP` @p-PP ThRhh"`VpЀP PD 0S8` ` pw$ Wp P pW \  \ `YPp ppWp P  Q: ``p[ RPR PU:` 0pPQ" P P 6 RP QP`  R XP0P }Ѝd+++L+((h+,+0H-dP@P R@P0P 0HW0d+h+0\  L\ \0 R\ 0 Q/Q Q p/ ,Pp//O-$M@T dP nP pP[@[  ,P C1PPp pWpsPx#0 `V ``@`0 P``P! P`P PP `PP pY P`p Pg`$Pp R 0  R Rp AQWN Z PUpa pWZ  p YZ  PP.Go" [ Q 0QA! 0^f pZ  YY[ pQ N,p[  C,l6Pp(p$ЍG4 BOO|+O+T+++(!OA-`APpiPP gPPjP pP`pPX*pPQSP@W DDTD0@ V P   Q *PPPp`Ѐ* AQ `V 0 0 )` V 0 0VP,OT+P+5rO/PM !!(OH-0P >P`+5PXQ @Q 8  AQ /0S /+++G-0BP P `PP`FPVܑP P RE APQP @:bP|p`ᚉW  0P R:IPpQ! P0`C0S @0GP%PP @,.P0  5XPP$P +++d+h+(+H-Pp`@@P t  0 0运rPA-P@`Sp B& ! 8&dWVV4&&UP*/!P'P NP UPPPVp :%7%W p6P .%+%(%TLR +gL+\+D++((N4"M+A-`@PpPUU@V  X@p8NP pV pPpL+((H-@pPp ` 6 RN`P2`Hp`P.+(+p@-@5daPP Q $+p; P !DQ [ , P Q0pT 4sPP0SQ PQ QㄏP PLP p蔏UC ,d+(N+5rO(h+04 N RQ Q  P xc갤(@-@QhQ XQP 0S 0RS Q  &++++PA-MP @|P R 0`S`dd0HXpxx\T~X. PU bPU `V RP `VP xXR}`T P < 07 ;w#~{y`V qQfo b Ph`VL_ЍAYP PPPPP0S `'CAP  0s x @z' &T.Ѝ*(ЍA+P! PPPk!PPP!,[iO"KPP3!v!PPPj P6"PPPPP!n!PPPPPL O-MŸ` 0QxR| <[ځpK W$@Pt` #[ $['[ =[K \[ @[6B"[V\@/`  PA@0@D T: PA`F@PApA  b@} "DA @ T`,A) @ " @"p0QGT@p[@Q$Z @ P@ PpWp@ @[  "=@A: }Q"A0Ѝ++Q;n!-Q%Q#QQQQp@-P H`@PT 5P<9,PUpiO"O-MP L <P ,$R  PvAp` Pk pP` QP/Qd@PJp!0REPBP@LaQ* PPP:PU aPP `t Pʎp e` P_$` AQ [$`P@ ZЍJ++l+x<++[Q((L+`(O-! (7#d+h+T+ B)=R\R|R'R7R(RO-MfS@RPP HPSP aPhcpT  pPH@[ ZP Y@P2 ᱂YP @0B PŸ0 P S*P0@BH0 @ R 0:Q@IPP 0tP|:H%Z8 4LrD  @@ P % pQ@ 0t@ 0PbZ  ]Z P2̺p= [ @P@ Pp6P3@P@ P%. 0gt 0$@ Ѝ` A$l;@5 R;RT+RR RR S!SD"@+@SF YS(dS'SR0 BS0// R/0R/@-M@0@ P ~ RR, R!ЍSS0A Q/Q/A-rRP@ 1GAq `u币`@ob6P V wP wP66TaPQN6QNFQP -PF R  P QP pbP QPy 0R0 P 0 S 0 S At갤(T+X+\++T`+K-P@ RF l|q0-S +S>P-P P8 PP-P8 -P`c@oQT poP 5PP TP Q TPTe RTDTPK,X+T+(TTt+0H-lP6dN\@P vP>S>8(0( P$ 0Hv0谤(8+!TQA-P``QP PpPp$P@@ @``+A-@P PT@ TpYP @7TX XT@R@LBLr`PE0 R`FvB AQ ʿqA ` Q E P 2`Fv]tq`Q P `VH @IX P  1 PUR@\p@ Q` Q  R `V@ AQ e T 1pW`V PAPPU RpT(TTTkE"T (T6S}!TUU0H-l 1@T PHDQ R APUP0谤(TU0H-@P P PP0H{0H-P3 R@Q+PAP `pQ ^pG`WQ P,P [ `+d+h+3U"UP 0H @-T@<QPP 3d+T+h+@-0A Q @dP  @`+H-MPDP0 \ 0 0Ѝ1`+IUO- M0pQ`V R 0S -Q`V  `-V0-`S PU 0BPp@1P?`Jp\ R 0 :R  0 R@:P R Thh P:UD  `Q1 @  Ps@@1  u ?`PP0p @ P,V` ` PPN Ѝ:U H  `@:`$PPT븥(sUlU!U!U@- 0SQ @T7 -Q40Q0 -Q@T) P %P# R@ R @ :R  @ R :R  RH 00P 4 ;9x+T+U|+U0H-@P 0P  PPn P!P P@ @P^@P0  딥(+pVH- HJ+O-M @ @ T7 P @ T*` @,P( PpQ}P pP CP @Pt nGA@T Ѝ蔥( ,=O-Mⴁ@T P   !2W Pdp`P@Q* P pU [ PPFP*rP PT!TV @T\   L1 VTЍp딥(p8H-@   蔥(p@-@`4P P`P Q`0p蔥(O-MQ[@ @` P  Q   @  B/o"D`p @  pQ  ~i  [Ѝ蔥(+BAp@-@MP@ Q `s P x "0`0` 1" `zsTUJ(8 1$ 0 P딥(<WWWWWA-pP P@PT5@DP pd9PP @`PP%Pp`P @W !딥((VH- 0Q딥( XO-Mw D @ P$PP@;5P(#(#(#(#(#(#(##(#(#(#))##))))P#P#$))$) % Q    Hj 0 P KPEP2   P5P!| P  s&Pj  `PP p `PPU pP pQ P,QB HT$P Z6 P -P 08A P0`P    ` P\P Ph9{P pQ`0     Rc   PzQJ Q0iP`p  4P1p QQ@p`0j P @Q* P QA P8   0P Q,QF  "0 00 0  @P%"%`P Pc`Pa P$PPa@ @ T Z P  @ Ѝ`zP PܰP0`p  ` P P ptp @R*PQ  ꔥ((4&HD(VH-lQ$@S PS@Q* HTP$(`,P R R R @0 @BT:R R  r R"0`8pA     F    P `&딥( W@-@P@ 0/0S/00/HDH-P@-@(    @ 蔥(O- M Q 0 ``hR@p` P'0 @  W p V @   ` R =R    QW0p$@@#Q 0XQrPKU WpC)&P |P >P #&P >P <P@@J ` ( -P(  @p PQ$` @@Qxtp 0 P*tdtPXH~<|L+(((HD@@DB B)+W=rW+XX}XZXX++KWfW<+@+>WO-M|P  P P<  4b4r4R$80P@+@T:T D P@MdNdNMdNdNNdNNN PpTt 0\T P! R0 T T  :;T" |T>|P%0p ЍO5t!)&P&P ;P    Ѝ蔥(+(++@@p@-\Ppx@xPx` P08 0Q 08 B {\P p p@q@ ((+p@-H@8Q 8P` AQ (`8  R8 p蔥(L+O-MM0$`(@0  0A,p PP!pFTW0A @0l@PP w`Vu ttpPlDlt(  P  `[P \P`[P P $P1  P  `  &`P$-p!\P `P  0 0$  ""P` P\P\@PʌP`@PʃP̂(p`EPO @PEPPtVP`[ V P   }PPu PAP`q@Z   2l똁@ 0@P\P $ 81 1SP  AQ  @B AQ TP@ @P @PEUMߍ 0 A0P 0S$0 딥(\+(d+h+((L++X@-Q @4@Q0H-d\Q T@PU U U <04 P00蔥(!+ ++( XK-MP@d 4@TepPU ` skЍ`uQ X<P ```ꨤ((++8XFXO-[M `p吡<րq|TP@P T@րL4`PD PD ,> @`@`P PhS P P Q QV  d`!V 0\X1hAp@ր8T`P[ߍf\+(x+(`+!BAY( R/0S /<\/0S  R 0/+A-pW \@P`pQ@U p QW+p@-@P PB P;p$r`5 7{Yp@-` @P9@PpO- M`P@```@ %`8 `U (pWWpP P? P @T Q @P Q  R Zl P Qf L P,P 㹤p @P:Z=P QaP Q  RW  㛤p=Tq P< PPPd ዤ@p|qP xqP? |@p8 u @p RP LW  PUV@@TPxp Ѝ  LT7q4q +<+@++d++h+Y+Y(̥((( R/0S /+0H-P @ pQ  p   p   p0  p 0 +Y0H-P H@P PP0 2/P0+@-| P@ T  DѣPZT@ң(( 0P Q10蠥(gfff+K-MS`@ T@P aaaDbLb`` a a pWJ0P  R K0 ៴`UP  R 0S T Wo!pm Pgp(0VP pXph `ɤp|   P$@xpp BP`J`W  E A  p ,+`PYJT  V P & Vo"Vp#!PP P P ЍP ЍK oP Mooմ lo@o@<oĴ d+++Yh+(+fY=Y8R Q%ꓣp@-M@ ᔣp`bP P 5 P 孢p\屳姢%o"ooo o EKp@-XPX`@KPpP p@Wpd++h+ P/+p@-@LPU T `V PJ``Pp+p@-`@ RRc  ?PZ1oP -oPT R -PP 0@p@++0H-@ P7P @ $0+@-<@P  R  @ +O-Mp#`@``pR SpvP sPV` pV G3 hP p+P -PaPXU: +P  Q PQh oᠢ Wb aQVj d%  % p@P0P`PKaPdWW]Z  0+#p' PR P  P r Qp?   R Ep9 Y  0L`VVPP J@@ 0;T@ wЍ Q}x&h#x n Tm @ Q04)YQ0b"=n"PZ+ZY@+<+ZZY(ZO-Mp`p@ PW  0p䐟`[`@  PU[ P[  UPP }0 @S[U H r<ЍOmЍ(|!n"=!F"U!b"Z p@-@Q? PAQp`R @P``D>Q <Q R 9D@Q:P P r d$ RHp@P-=! %Zp@-@PP QU,pP Q  R %p `p l pU m Upm (  ++ZpZ0H-P @PPP$P$ 0@P0[+!A-@Q @P; x`xpP  ?U U @PP@UO O-M@P PP3p~hPP/PXwhPE HrhPP#4e4u4P@P `TQ NPP h@@T@@U`GhP BhPpPU`PED3hP J:D@lPPEZU@@U%Z c T @p WWp@WPT i0 T@^p@@Wo᠂ZDP{@Z9P `V @R s,P  P# P @[*Z" X P  ! P HL `Vy@ < KP `@VeP P 煾[  r|PlP `T 8Qxlal@pP P T k T@p@Wp@@WT p`@P P fF@@T@Ѝ-PPU?Y#R ,[+d+h++[(x"([9["$[F" .[B[H-M@DPP 8U`Q U PTT TTNPP UP`P`TV T6`P`qT`P PVЍ jp Q8NQ> T<'8 :V V Vcjp U`V2 D?P:j 0p  㑝P6QHQ `6QP`++L+(X++zH-@P`pP P ]`p W:8 Q P Had+++h+K-Pp@HoሐR`P P F PP :`P:XK++d+h+HQ/8 0S 00S/ <R:/++0H-@"jPT P Q& P$!PP tQ PT TTT 016P T,P߭iP0++(,+,+d+h+(+p@-H`@PP@Pp8fiUp+,,PQ /PQ/++O- MqQ!1`Q@P(QAT  PnhPl0d `P  P  4P `00( @ Ѝ(+,+,+++0++(? R3/1!@R/,+0H-8P@P0+(%@04+H- <+8+A-JM PPP !Q $@dP@a$@[P `X@PLQ@TP@8$@EP@F `Vf x P@ PPPP兜|hF?PPPPP:h 0` 㴛Mқ/8+(+0++<+,+\+++d+(0H-@Q P@PU PP00HG((p@-@ Q!- P ,Q$`P    AR \P  R,P P@pd+h+@+@- Q @R P J Bpp Ӳ(G-@'P;PPP `w`P3 P1 @P`'#OP@Pn"``E@P_`\'PpUWG 'W @PHpV @P:@P/@P$Z`P 'P p@P`V @P'PG7[H>(0H-D@vP':P @ U0P0H>H- Hꤥ((A-RP`p@ ;P P [gP  T@:pGWPH0H-T@TP P  P0P 0H#0d+(h+MH-M  0 ЍHЍ/@-M@vP ^Ѝ-[ MH-M(   ЍH Ѝ/(Mp@-MP@ , `,0 P@PO!@Ѝp@Ѝ/@-M@ @ 8 0,@, A:ЍP+++l]p@-M`@P )P `V `PVH@H P@8Ѝp>X+ +\A-P``Q=QR`X@' h @A@pW P P @pPpX@A +p@-ؚ\P@``-`@@TU800 4T`00 p@ +\\T!QK-BMX@p`PmP   p+PBߍ\+0H-P0SR0S `@00SS @0P0PSS@DR D0HDH-M@P =`P$ pU Xp@pP AQ =U `Ѝ \A-M` @+ppTpPC PU Na  Q  ,<  1/`tP   Pc0a0  !,Bp!,U U P!P a   #<0 `5`0  Ѝ h밤(\d++l+h+H- M! 0  PP -P -P0Pc|Pfl6QiFQlHQpPs,   Ѝ`+X++(8+\p@-``PU @/6PUPpP p@ߨpd+h+0H-P @PPU0K-MP@-PP7  <P p `  P0` ` =Q =8P(  ' ` P\ P!W  =Q A | L P P@0P MЍd++P+T+((+h+0H- @P P Q 1/P @0p@-@ R 0`PU0=U=UV =7Pp PP ` Q 1/P +0 R=R/="o/A- 0S p00S0W 0R:@`pPU Q Q 1/P`PpW: +H-P`@T p  其 ံ@ @p@T`V:H +H-pW @rKPcVUHnlPl`'W W '6P p@ ^@Z@pHR\\\M"O 6[A-@`PQp5T <W 7=P @ AQ ʥ 00 =PX xd@ AQ ʋ 1/P PPE (9!O- MP@0P $`̀PPpZ T    U Wp[:L0 `W @ 0ppW Ѝ++ +A-@Q)p`=%6P@=!6@UPP@@P `P=P@P`ABꨤ((L+O- Mr`P@rUP pP nPVk@`rUfT`@ aT PZ V   0O ЍPQF pWC `   P=XPP T  =X T=X ZP% T U R =X   #pW8 "됾 T+\]H-rP ]t]0H-oP xP@MPP IP@NP xP@@4PP 0C]T+1]H-MP `;P4 @  R- pR P    zP P Ѝd+x<h+A-`@T. PW Q   Y OQ   1/ > 7@T+((H-PH P RbG]K-p`PePfP vP xPP ePe@o8p`hP /o"p@PPW DPPPg]T+0H-@P\PPE\P0U*XX\hp|00P 0(S !S p o00)S R p0!"]]]0H-MP@!PP `P Q (P)P .P U U Uo!PRP u P Q  @ҔQ oЍ0EQ 礡(̡ܡ (,(HXh(((x     @  @  @  @  @  @pt q @妔 @BD+H-M@P`tP2 Q/@P,d,,,,Ȥؤ P|̥J@P DP@ `0pV @ P#P`'0Q(Q !Qop)QQo@P P@ `0pV  P#S@`'@@n@Ph Pc 0#"\ 0"#o[k[@P e[OF`[@P@?@`&$oB3x@`t&$@@(m`piV@c`p_P@Y`pUP@@ N`pJV@@$ލ^+H-M0 -R  Q Q Q  x Q PZH P  <4 $ ,  0@Ѝ]8@ @?0?@/ 0Q@/p@-M@^ P`^P ^ "Rq*P P 00@RQЍp] B)^H-@P?P QC C `ҒVAВpPp`ƒP @QAsO-M`P@#T~pDP-PpkPPr -P)Pf lsP8 lP!PDZbZ<Y @P@DTD p@ P @,PPL PP P&PT |pMqpDZPP PXPZJtYPJZ]Pp @%Ph`P5 pv @UU)%]  V`P RP:9]P pYDA\ Ტ\客@pZ!#1^( B)^Y#w^Ny "e#"R^H-M( 0  t(+^@-M @V R 1P ! PЍ Ca^H-j¡^(0H-@M⚱@T P=0P "@T5 @0@W1 ]|| Yx@p Tˑd0d P` KPP, GH C@Ѝ0p++0!_(U !TQ__Q@-?P  G|@|p   Q  PH@HHH H0 0P  `+++++(̥(((((0H-`@@~ 0@S @@QlPlX R@@TP,P 0H ++((d++h+0H-MP @  P   nPЍ0H-PW a@PPK ȱ`ܱ``ppXXXXXXX %  pW pW 6O  *OPUPU PU Fp@-P- P`@Pi Գ00tt   @G 6 Q  00S) ! 0 00S pFP/0H-P @P PU0p@-MP @P``P`U`Ѝp0  0R  /P/P/Q /KP/HO-M-0MP @k U %.P EQT[\ q%P]%P} uj*Pmpkjp.Y@*P]@@Yj@Ys WY.aIP`t0```0000}`pP v t  pPDYEIPt:VAYq BYOpy@IPp P M0h S03 ?`Q Q 瘺`Ըܸa'&QQ" "Q! 'Q\Q P  M   Q^`b tnvfreQ^@-IQ. ('P"P Pp@TP AJ@p P @\t "HZ (&(@ w t  +S t +S  0-- sp  XflV r XY pTv`fPpDP ۬,$&P ӬPPP \R Rw PP0]S 0S MS ^R+ -R PP^S" cSW . b`%PP0@`` 7TQPe @P$PPP 04P0  0Ld`Tq 0w t  tt  k g `ῦ@T@ x X s0p v  0 0 vf  h ' 00 P P{A AQ " h@\!'  ᐝ mp  |l0ЍЍdE;^%YNW xBT h !Μ(+!+(`4)+_{ !`+H++++ B)+O +___VIA-P`p\@DV/V90FPF*@0PrP@0@APl `0Q Pd\F PnF P%D @O@@V6 "V? 'V '@8EV@4@2 @0R @& @$ @" @ @0pU``  A`GV/`aG6`3PV`3BAq PRdМXP@"@`EQR῜P B)`+_:`0H-Md@T W 1PU᜜PЍ0+p`H-`@P p R 0BR0 00p pR AQ  @+(p@-M@PU 'P"P `VP `NX ` ^W MP@`$Ѝp+`+A-P%J@AT:H+@@4`pD oEj@@X`++@-@P QH@ "W"P" `` +A-Mp@d\Q  0 P5`P8  0P,`P5 pW1 P<U uURP P P  PQpP ^U-P P?PPPHP,ЍL@4 ᄨ`ဨ\taafffffkfRp@-M@D 0h`a`Q TP ` V QȵPᲵ Ѝp@HgajFja_jOjVjp@-pP@`V mDIP :POLL << EApL+F"[!O P+ @-Q@&0P@ b%t -M0S?^S^@0@fT+!O-tM`@DΫ88p[- qa`PDU!"a@Ppp ppʓp[pP a8@ p`CpʄD ip0(d `p $ XpGP:W W P`(  0p"4Q0J 唑p`pP%P 2PpP   !P3fPzኯ0ppQ0P  Bpʨ4P  pʄw^@@ 04D7!4)4)djjjQ0O Bt @pjht@{jt@j B)jg#gtj #H-9P 4:)jH-,O-M`@ЪPtTo@o  0婴QP ePfP hP vP9KP P HPRP dP 'LP PP# pV QQ PU`Q` `X`[ Q`@p<#AWPP - p+ D:!#pP .EP pe pPP #P lV p`L@ PP,48 #)Pp@c+PtOPg Wqܑ`@ P20TT TTTTTU .P7+`P$ `  ,$ P  P00Z q XP  Xr PU P   3/P P tP _P !\+`+j(Q04)jh+d+!, O ###H-M88088 ,0P0 \"k\+`+:)Oy k@-@P #P ḙP Oy h+p@-M@`NP #PP+`NP PЍp  00 4O kO-MM@P+pk+d+kL+P{P;Dp 9P$ 9P `  pIJP Q  z蚟캟 !A@6Q x$<HxT\4dD Z ㇞`p[ V]r N_\[ u`pM"Pc  Hh 8xGF>< ~p8;"3 .`IP% IP5  ;`pM"P+ 4   M"P ` _XJ XH pP : #/ !P@>x +Q *Q3 7+pQ('pp$7 0pS70S&6 0S &AAo <7pPp PMo5<pQpXPEpUڈQWWaW&00;Pp pT&,P  ━P  PG@P* tLU` :7%@5P0 |p PPq@UB<dU PP`U0cP5 U$ CpRPP@^P! =U  pQQL  U @PTf/DT $  ӫ@P @@S#h pItp@ =$Pp TL#PP%PJPUi PJP #oRUW PO PfPKC` V PPb X$4@P > @P /p P NP P~A!XPA` d2@Pd@\/ P~YUjDc6<u*u|+uluuv +LB+L"+ +|H- 0,S Px+p@-Mh` R@4T[(賠0PЍpp4   LB+L"+T})}}H-MPRP@ p`ᶓp @T1P@0@aT=:?aP90a @R`@š$ ,\C\蠀 @!P! p P$ ?P ` @ ٜP `"V< X " @]0S  3/۹`@ " A@ mB*      p P' AP@haV :aP @< |xP4"*  0"q "Q<!Q* ᖹ, !A@ m  B*     gpK P <0 A { rL! H!Q <0  S(! ^5,,C #P $ 0 }PP @b R q R @T:t 0 ^(1ݍЍt$q"rΈۉ$[lÉ+:)lB+M0H-M@P 0\ P Q Q  G7Q  Ѝ0HЍ/:)0H-<<<@P  PQ `0Hܸ$q"ф؄p@-fMMx0@+p <4< SPƸ D 0 P yP<<fߍۍprdA<p@-M\@`X\ 0S  P nP yPPۍplB+S!B0H-@(( XP 0H:)++O- MMP% XuU `P!TpY P ?P @AP @TVP:8Z  @@@  0/p4 P  ş  MT̄t `@(p P  P !tThpt `@( p P  P (Tt `@, p P  P ,S堃s `@0 p P  P ַ0`S<\s `@8 p P  P ί8S؂r `@4 p P  {P ᤷ4Rtr `@< p P  bP ዷ<DR@r `@$kpp P  IP rQ嬁q `@$RpW P  0P YQHq `@$9p> P  P @0Q䀟,q `@P  p% P  P 'P@倀` PpT P : P T ЍۍQ:)+qzɅ# $>aņ0Osԇ5Tq"p@-M0@  0P  eۍp蚈 0 X+:)p@-Mt@xpt 0S  PC@`P H'P'H'P'NۍppB+1P c0H-Mh@ PP yPP 0[ QNۍ0辈O- M@P D.P|yX `@p`1P@pX P`P1 OHjP`H@9TP:daP `pP @P` XXX rXp A` Z*K1P@`pP @P` XX T@T A``@P`XX  <Z Ѝ돈 H*:)٘H-M@p $PP7 P`P_ bQJQ#KA P[ 0+4,+4,4,4,4,4,++kA P 0+4,+4,4,4,4,4,++D * B Q CQ GQ 3P`,gQ cQ,A ,* '  *B+   Q`|PP8@ 0E8ă4#p `V00p d%Ѝ{y@pB+H-P@$ R!0 0  0YX   0QX  0IX  0A Џ( `, T0 H8 <4 0ܵ< $ص$Ե$ е$̵$ȵP ĵT   0 l!R@p\`Pp ᩵pWx 0H'%ꬊrʊu#׊*@Obk{d#B!O-MpW `S 8@T,PU5a 0n@ !R! c@ Q/0/00/0/000@ IP P=,,3: 098G8@8"T@ 0@@8p,P8D7p8P"@ 0@p0@a T0@8"  8Q 7 <P@PPY+ ƎN@8 D K8Q TTH*TTD  8@7  @ ῴ< P @PP+88Q @PP* 0Ѝ++**   s\I7$!nvGH-`@\(PpP9 0P p 0pW:H#ꉌ@-@< 2/R f/740WEVp@-Ͽ0 3?0/ 4@04@4@04@4 2/4 < 2/< $/$$/$$/$P 2/(0P T 3?2/(04T X ,P0@?Ͽ2/5_4O4X \\0 D,PT0@8@4O_>8@TDQ5_Q  Brpp0 Q5_Q  Br 2/ PH8R?O>5_8HP 0P`@ 4O2/@ 2/ *0**/* ^:p|+@-@8P wf/3+@ 0S3?S q R3WEV|+G-MP)ڤ 0P0 Kꈀ刐@p P pa Ѳ`;`@P`XXX pGwЍtB+ :)A-: dd0@bT 0D DDP`H0pS`F v㻰:)ޒԌ K-M@`6pP Q 6p||`   ;`Pp  `2/ЍKm  +  /봍ԌtB+xB+xF+O K-MPJ@P lPC* f PA*:  {`P8pu: "Rq1*w1j:  㣜P&\:"P p# 0 ` np  ЍT  H `T0 8$0  뱎ydxF+/tB+ ɎWO- MMP@($5P[ 5P 5PCynp   P} 开帀 jnp Y Ġ (8P [(DC Q{P XT 0`pP @ppW` 0QBBR}  np X  p@  0Q(X RXmpRZ` 0㴑`1Am pW 'X9 `XP KpXP&;$1 p  0,7l P;I9! 01 0V`pX Ѝڍ ` &t0(, ⊱D"!xF+:)wdtB+Ϗxd HN^ V!3I]@-MP@  P*DD _mpЍ,0( p cxF+{dЀtB+ Zp@-M Emp9   冰 }P @`   s    l   e t  ^ \@ WЍp< xF+td@tB+ߐ! 3WH-MPxx@ lp P`T 0. `<&Ѝm xF+zd@őӑtB+p@-MP@p`)4PP X#4PHo"@  lpЍp$0  ?!xF+wdtB+ O-$M@䑟Pq` qP p eP]PW儑 @ @@|lp аP Q P* P> @p  dlp wQ# )0  p0R0P P`0p   ቯ`@V:Ld}$Ѝ(( 9㕭Q04)xF+|dtB+GWP^!h=@-MPH@D l8p  ,RЍ0xF+d@tB+ p@-MPBPP? @`T3P O3P J3P E3P)` h `h`U\*3P`HH kpЍp00, H% mM xF+udtB+ H-PM@` (I6pP( kp (>6V V( ڮ `  kTp` H0( ǮPЍ(4   xF+}d(@tB+В#@-M@ P PP2 P<<  TkpЍ 0 eUy!xF+vdtB+ 0H-*JTR0O-\M@PH5\e\p {cPQ@Q:aPl@Q DH4MH4MDH4MDH4MHdP plW ER W rGoldW uip acWoW$PdWc lW Q0 -PQWD RWD SWH@ 3  jpMpWM rW @(`5 Y   P@ @P `PUpP@L@UD`@< jp(XH@  jp  @  wjpp@XX"Pdk HMk@ %i4"0hPiyUn .iP@QiPf T |@劭ᇭᝈAT `>Q吱 `   % +P& @p +z P (Pȁ ኍ@P pX  ^Yy\Ѝ3X  T 4 `` -Q04)9}Dēғߓ3x"yaratcid:)O |D(|m{D`~DRE<MH-M'5 ,$0    尭Q:)O-$M@PH4HXA    ip= `gP7 p  ip0 P/XpP`Y ¬ZUỬDT  0XY$Ѝ jDG"hO"E \Q0H-P? @Py P P P P26q P P)׊ P0HD\@l0H聇 { 00HbJPTXD?zP0uy4 scidtcidrbmngntsyaraloobO F <_͐"?O-cMPo/00@ϟ弟00/0p⬏嬯o40,00000(t Phš@`/P @hPH  P~{yd`P /P #0pP H p9 0W[ /yP9 `6~0 CP* fP3Jehp 4` Vp~+ V+ *fP UP  f$ <`P  p ,V /-PP  p (l tRP/S@'P(0U W,Y,Y,Y,Y,Y,Y,Y,Y,Y,Y,Y,YVWQ,Y,YQXV,YV,Y,YlW,Y,Y,Y,Y,Y@RVV4RVLR,Y,YdV 0@Q&A@QU,Y,Y,YVV,Y,YLV/800P~8PyQsQUtR\RhR <Ⰳ<QppmI  R I Qq Bp `/P pb0]8 ZpVAQ*?8P8P uoOP0 ᧪PEucߍ,Ԣ!pT`$P nP KxX庢 `\X e㖨PPP'xPP hP T\Q0Q P<oPLEPP| P`@fP H  P\L P0 7<`w0 \pno"@PT Hepp5d\O0 ; ^8p&62P9~b? p nP @b? p@@Q Q@yfp",Ppd9pOd/ jfp9\<@/`fp/8f/E*(H!L1  |p@p堃   + R< 1>R B ?0|(p,00 4h.n~,4(@00< l~?P\n0m@L~LnLΟ0,>0~`B`?0 R0Rh 0 P D U,rdp   j4M|d @ T ~LP 0-P P ]Ln/)o,U  @U0,| ,P P  < | l\ PP,0p`0p`}0  P  P EQeQQ  @B>P[3 f+F+F+[:J  H r +ꜛꈕkÛO t4)Ox1P $Cc hhsP?  @0P PPP   0P PPP 0 PPP P | P,PFJPU@P !((@P QtRHbp? p ppp @P 1!P !Tʘ,(i9k+,QQQ<P`@Q|()<0@DЍX{Lxf+!i+F+z!F+F+|8i+F+n=F+j?"F+ OO i+i+Ci+gzO- Mp @ R,PᅡQ-t ЍO9PPX9@PbPPn 0PUP  Q PX 0 T * 0 ЍOP; 9tQP5|t)`p 4 W  0*P Q!@  0W   0*@plWP " RJQQt49dP ЍL ЍOF+F+{f+bi+|!˺F+$@H-M<<Pp͠<,!,1, 0@L0 $!1 0@$0跠ЍH豠寠80P@ 0` p`P圠8|||p|` 0p@@ Pp匠XX X ЍH脠F+((B $(k+k+8i+k+L)i+i+i+k+F+F+۴ i+4 M0H-MMb@@PP|幰P P p @P᧰ Y@oЍ0H Ѝ/ 밸:)G-M@Q/ Q, pP`% P%& \  p \e' ) @⅄PEZ* 0>C$R% P` 0p a1P0Fp [RQ8Q t `CHQQQ ЍgF+i+F+O- M408pQ.  P 0P0$(l@T@T`P@PTPPPPXPQ\ CPk oC`!R RR@Q QQVtS!@ $ QU=ご$C,Ap Q W ! Q 0  R Q\  ` IGR )QQStbR \Py\ Pu(!B\S BPu(!m0\" # \d  ]0CS   B0p0Spr!R< ` 0 @ sAQ ;P\8 @sP4 U ,   %Q QP P댰Pꀰ!R$ @z@0 Ѝ4۳8i+f+F+i+F+_9u0H-`P@T 2@  $K@00i+O- MLp`, PPؠ*@AP 0U $ 0 W PPPP@$ D U U E㊴` 3\!` G l$!$1p  @G Y p@A p  Q@( ?D+! ?8  Ѝi+F+i+i+O-M p> pB1!?! goP 0p  R,ЍO(TATP 0 !  PG,P  TP Ѝ($(f+O-kMM%嬵u崕eEP-0 800  ҈cPd @R/0tУHУУУУУУУTУУУ4У TPP- TPoP :` p IP @T" P" @&7   8@$,  @   7 pcC3NPQ nR R oR|pXCP   L pP@Cep# U A`@  1pPp/eP P"2 PpGNPP&  Pi p\@P D P 4P\  0P`:AT @PY.;)QpA  pwTP .qTp7  S^Pa@P/"P,*<Y+R밐(!(1`kߍۍXX [ Oxd.M.?| |>!9p+p+p+Q0!p+$p+b">p+ p+4)F"9H O zd@(p+edAݽT,H-`@P p  p H-\ 0V\:)lA-`PV @p=@( `0Sɯ``Z p@-@P3 P#P P P#`V PP `VpP \P P`V PP `V@p9Hp+$p+p+O-MM0@TP `P `V@@lPd \ Q vT p q 0$N @P8  oP0 Sp@`@ F[{`P -P = qP p   L qnpP @ @  a "V  =T JpBP 3W URp @P8 P ;q 9qV @ LUP -q +qЍڍ Ip P P!pP6 ,QP x  o @ P P7 ?0010A4,Pp[`   %P [   0SPP | p ᢕP\RZR!p+z! `@" p+<"b"p+5F"H"P"u#KE | 0/p+p+/p+/q+ M@-M0 @    o㇓:)G-p@ԐQUP Q`Q PF *t 1h<0A 41,Q,! ,o8@`P"X^@Ppxp W  AQ h P  mWNW YWyWnW Y@BߍHЍ/u+u+u+:)!G-MP娣c  QҐo L@p P  K@PJ4t P  |P vtrqPP\"QQ(\0/`c\p P:P   0`X  0p k`M PU:P (`PkP(`P^ `WP( \`KD pP  @0` ;TK ~KPЍP+`xpW"% %UV ( PP ` ` ` 0M`QkHK Du+u+u+ %Gi ,cO- M0` LP pW Pup|phPPip JpW!URQ Ytj`l @THP wPLQ M 0 Ă1@! PX0@0 ,bhP ZhPDpQD#}j {jyjXYx `@@ P ! `o 0D p Ѝ$^$(* X+HP#,30 4080 00 C VJP;L#HCPPP , (pPR #0 U($!#0Ap 00 <  JpP30P<@/l X X $P, ,  RTPL@aDPB QB* " ,B.0p40O 40   IPA O A jP3 X4A P `0 R 8 `eV#P i i "  Q)* ,PL \*  0Pdh0l PPUPMPPHPEUPBpP>b@d@ CeRRaArrAaP?"Vn3' H-MpP`g@P p00 00 " NIP0< @0!10 00  IP i iЍ eO-$M`lp 0@P PRgcP p2 P PP7 L P p@0 @P} h@0@0@@] LPLCLqC Q@>P PLp$ P @P Lq @ QP@LPPPP@PPPPP @PLPPQD:P P p 0 0  y@ 0  m@P0  _@P R *0  Q@PPPU:#hph$ЍiB"G-M@XpPxbP  d 0 !  X  HX Q $ g Ѝ0H-ML@P 0T!@!@% t T llppЍ0T: tP0T:LPPL0 t0! M 0<P  # oRP/ p5/1/[ # X#O-MPpP: `p P 2R B p:C q&: pN qO*0 r," 1H @dC p,:AS A s:A@0 PJ!AR A r:A@ d P5  P88 ,P' P P'(rs#*@R r   1S @ s:@@0 P P  Pp`Vt: ` P PЍn=[ # X#Yv!QcP?"@-R8P P *2@T@PO-MPP:`"Q2 sS p @P`Q:Q*r@pTSPP`VP:PR\Bp RFZ:Z*0 b `V Q Z :A0Z:   z(bJ q : Z ! z:! Z :Z *@ 0WP TA,  0LPpW::  0  0<`P P UPZ *  V pZpGV:PQ *"0S 0@@@Q@P0@PЍr@[ # X#K-@pP Y8P 0S *r` VP 2 S ``tP Y:P` Q*`Q `O- M`XP@ 3`P Ul L p $ P&#t S H0/LpPWPwPP    ePQI: ,L0S s2Slpplp00PrP'tppPp0000'2Slpplp02#402Slpplp02p#T PP0Q *2SlPPlPP202#20P0Q: P @X !P0 !  PE P @@ Y:@e e@ ЍO-MPpP@P;:`@Q  Q P`V:&   0\@PTgP PQ *"0S0Q@0P+ <`ql Q(@q PQ*lP P G6P PP:"R PVB@Ѝ4-0`Pl`<@4:P?"r#W lA-P W@B^`V` ^@T@ |P p!00|Udd(K^P& (KD8Q:PQ*" P:R R 0S% r:!ddl\`8P $ 2 p p p u+u+u+u+U~!p@- @T 0@00T@@Q p 0S @0S0S8P8@@c(`c@@pu+u+u+u+u+u+u+G-`x0X@XPpP  0   p u+u+u+O-eMP` 1@P S:PS*h X\4P`0$00d@PL@D 8`DT0Pn `0`0C !Pa@p 0! (@,`a qC P[ 8`p YH` HPd@` ( Q Q ( T @ YK  @P/ (D (JHT` @LP`0P_ VPa `8P0  P*  P: ` Pp@h P(` @((` dP<@@Y 0Q$P  \04PSXP P K  P d |@ Q@@ P @QtQt <X@< Q.  0 p R0 PMJ QKP G @ I0\0 oS4P0 XX`P 4PX\  PR4@@ \ @LD 0@@HP $d` X PpT  Z3q@ pq0Q \4Qp\@ XLLq   0 T P} , p0\h`QlPp3 `T4`` p p\PL`pp @LD \0`d@@d@0U  4|(]8`QRX\` P|\`\X XTb \  D $ Qa*l 0l@ A`PpWPO pE@P?p pEPT0U: @ T@:UHP8`>*  @A0`PpWP- pE P?p pEPR0U: @R:8`U*HP p0SP 0pW?p00P  Q:$X< EHP8`<Q*Xz@\ X4P Qz \P  @\P @P`\` PQP`P@\XX ` dyDZ8`Z ddP"@P[ e P L@@Lq@@!Dd @Ad@P- P < 㜠P, = ?LPP*D  QT0 ;O Db V %P v :D% ` !YP P>@H\K`HPQ<D`PX@8`w+P! Xd@@LLp @@AdPE d X \HPddAT:LPT*D  T/ HPT L PT*Dd#P @PP d @AdKdX\HP @?HPT* !0 P $ $$$A@ DLd Q: g P LAPdQ*D`P B PR:dd.Q H 㟟P) `@TE G  X P6 3<veHPPq  LLp^" WXP HPR8 QW  Ll;PH \HP d=KZ@P  K/@P HPYHPP #@?u+DQQ P LA@@L p@@d \<(d\"\D`"Lu`PHP8`rddLd @hhX\<fHPdL@dDP5 D   ,P(p@` 0! qHPeR ?P^dD `  d`T0Q:P`Q: 0Xp!\Q僒TED Xp\ PQ4@@p`=@@@ L   0d``d`@@ LDP  ,p(P 0C! R >Pi\eߍxl 0 u+Mu+ Zn%Bu+u+u+uHqO-OM@ `P ܢPC RpWdXPT `ᰒ崂PW d pW*QQWD: LrP0:PP-*d0@` 0P" $ ! "d  O>dPpPUP q $P PUPXp`SxOxMhKh K @! 0P#` d 0QP,Q 4| f .  / 0 Lp0  4 4    PW ! Dd  =d`P 0o`Oߍu+u++u+u+#u+4 @-@P ]u+A-ppP@/`P `F @DTdPU@?dv+O-M@0TV:0 X18<`倠0 p PpTE*TDpW@@p` 0D#!pU 0  ! * p n=P" [* p 0 ! l P 9=P T D 0BT Ѝu+MO-ML@P HP PP+ Dp $(1 0 0$(XXdpd012/3?7pI-P0 @ `/o>3?<Ͽ `0 即!ሳ"ჳ"D`6oD`{#@`6o@`s#H`6oH`kL`L2/3?6oLX8<\L01`\XM`Mpp` }}p0"S/"!03?0 R/O-M 0` 2/13?: 0 $0$(0 !(,/0! ,02/10 044 p 01?71p13?1 R\Q LpS tx\ 012/tx\ d 2/TpXP`0l@hd p 75_3?94O2/TpXP`0hl@p D!Z 95_7$P  13?1$5 R\Q5 0S  13?10 RPP$ 0?0PT T0pa6oa`@P`@VO@p W,0ЍTU  +0 BR!q p/G-MM`RQ:@ + T+ 0P BR!(q!(0P p!pT P/3?5_70P p!rP  P,r!_T_= ЍۍLABLK-M,(pQ@Ppp  uP` Vl# 5_ P3d  0AQ p ЍLABLG-P@ p`C P CP  !  @T@@CP CP  !  Pp@A-@Ppy`P@ P$@q`AO- MMHQP(8 pB`?0 @o?T @4  P p PP2 B R000 i>YX"XŸ0<P`6o`@`o`T@p@p pW v`ov Q p p R?rp e0qPZ !@T p` Vk# 2l@1/p7 4P0PP R000 >@ 0@@ ` *@P .^;  Pppp ЍۍQ0++p++<+h+8+@++O- M @ ` 4  R000 =p0Pp<Q  P 0PU 2`0 S9 0?sP/5PU  PP  P `bB pR0 @00 x=!00` R  W H  GP0Pr `P@`QN ULVI  dPB0P`Эp`F PY0 0  BP@ R000 +=0  R q p \ 00 P 0 U  $ Ѝ+++h+E+H-M 0ЍH-AM`p(@P/N Bz 0P@AU:P: @;P T0P ?s0@p:48 S /$/AލE +h+5I"!0G-Mp@P聟Q p`V̑Z PPS 0pPO PEUC p ! ` Q p4! 0 P,U/ pF z@PQ u y2/P ,Pd;P Q P wpЍT D ЍG8 P wppЍGh+@++`++!00(-C+D+O-|MMBNX ^P` P /r 6* R . c pP dP`5 LD:P  @V  p`$ 5U@ h$ $0Rp0d50S 0Rt01l1@0Rt0lpBHenPU'L.P<:PU 0 0T 0 H uP  R3 Z03p@$ P$`4 0S R AqR AqA"tvPQ x a  0 [ Q p  P+?PI p `@  0. t `@P:f V<S @  0! D0  f@ V.-!:P  0`@ " p@bO-t-p@@|Ѝۍ$R#X 0P/ ?@A PR  4` p  P |d1LX0 S( R- q)|}-xze 0P0p$h`S?BL? @GR q?p9?   0T- p  0wP{ wxh+J0!+D+T+0(S^v4( +}++ 2 O-$MHp) pP@ :D`@ 04  0@T`d#P ; @Qp0; `400< 10 0 @00Q1 0` 80 =@ @pQ ptR B(Q 8B r4 0S @PPPPB9P  @ pTQ p H24 P0`   4`V:P ,   PO @U`P o@?>`  0 O`p4>P .>PE 0 - `p `$p>P >P >PPP _  >P>0 0S R qR q $Ѝ `+h++P(<+h(D++8(O-MMZ:`P 0Z0*0V0: V* Hp@J@`` T)`pLWpPH<0@X@0 W t0 0ѫWt  (`_ 0; W X  Fp 0W஫@X  F@ 0T Fp 0W  F@ 0T@ FH >:G 0 <  @<@4 ([@  P 8   Y& P0 pc0 S1S1QPS z [  ( Ѝۍ8T;  d0p`0, P$`(p( q`,p4xQE  ( 0`$   p78 p(,tP 7 `X%p 0 pR"  h 2/0h p7( $0 @¿d?`0@h $h p4P@P`P a16"! QX!Q0SPN_0P[ `- L0 0  `P 7PPPg J0 ,07PPPT JT0P q0?Ds`Dc00 Q(`  i00 `V:P p` 0a731` `b4P A`V@``Q1Q`S pV N- L d0S/7P8PPZ P" p 0qbp`(@W`0P) P $` P 0 8@pP 1qh 1H!0` R Ph 2/$B2/$`P $R?0, h PƟ$B0, 8 ; G)P 5P  xd ̲QP $$! ",po ~7P P $@$$ PtX$2 p PIP $  ! R d $ P Q 0 Q  0HP $+P  6%L1P1/ @T ` P$ ,ЍۍPnp  Q@@R PPHDD  D+l+D+X++h++\+O- MRPP@pp P P GPDb8P4Q @ @ 0 0 P P  0\o`? 6\ś\ 0 00U5v\ p?p 0WH,PC va\ p?/0 @o\5)S A0 0   QxP v``\ p?L/ 0n0 0n Ѝx+++ Tm5MO-M 3@`0p$%V:3Ѐ@R : 0P@@  ἰ!?k#"\5 @++`#S !p0ϠB'`r! xpHF3 d0! T!Q0ϫQSp ee7 @"Q  2Q0BŸ U`SQQlrP 0P1P2 P lP `AP2 [l<D@`PQ p P hpⵣ ᰣoPp7媣PEuPp7塣PEu@l T;T(EP<@[2T\`P`P q QQ 1P1PP` U TJ P a T:@ 0  1<0h,Q ЍT0"++++++T+++++T++d+D+h++8+X+G-00`P@ '< !``0P0p P`H p8W P5a0<W0pT 0P `0p@ P` QP  0d"8b"+++++++D++++++@-@P {H+O-M  @p WR ᵢ0 `B? P``P0V8BP]  ?t V@ #1P(00)0?o200 $,` p( 00W @`Ɵ@P 0 U:@X 0W `P`_`0SPP`Q pp=FQ d 8Ѝ !D+h+++++++:0H-PT@ ?0@P !# " 0 0!++Yp@-`@P TQ HP`@GV*GPGp+++A-MP@`pBW(P q1 Q! !G`P H  R0Q  L P0p`` p4P , p-PPh o3T  $Ѝh+"0!+p++D+0+++H-P 0@(lU :xP:@XlTP HH Pp Q 0*AP !  Pp P 1kPP qpkP k`Pp P A l0kP(Q 0!4Hkv+ +D+h+E d#+ @-p @08@ T 2/`@0 &  t  D BЀЀh+K-@@P`V DP pP 1QT 2/ЀX:P 6oV P:pPah++0H-8 B@$|0@P@00H-M@ Pd$0  P @ kn2 AR: Q Q Ѝ0! O-$MP@` P2Q P@Hv U *@2`P P@%$y 0p j'!% U R-: Q ``W`1CP p  ! TP* F00 R0uP Ea1`$\5S !0 0 t  ?[- O嘄Q P QP T  \ P PP 1 0 p! Q\.0 p؃pG pL$  Rp$4 G  $*/lP  =*Ds  X  X  X80 p /W "pp R } z溯tQL 0P(r z溯H<emD Rzd (0XⰠKb!Z d!? T pb;wr0 RSrQ 0 Z  K 0  D p3P(& dⰠbP 1 ? T pb;wr RSrQP  0 0  ph||| 0Ѐ Q 0 $Ѝ+++(+T+h+d+U @++D++<++O-tMPs0P 弐4#@`(3\%R !0 0 S  ?, Q P QP kPP X@Xx dBPH" PpR  Pt 1dP1dh 0P t ddh `6P , P @ P$0`PQ d h0PpppP PK1P  R0V : 0 Jpp!Q\.0P p@Lp$4 pp $   $*1-`P d(P P0@0/ PtЍ(`a++T+h+d+U D+0++++@++O- ML`P0 PSVC2 c,3rOQU 0VuQS /r S00ZS  PםZP YP" 0 l? `R w Z2  R4 @ṝ00 PW`0 U@  p㑉I+PU`PU  pPs*@Z  R  pᐝQ( 0 Y *NQT 0 J w*  0P  0q@P Wp@  0qP 7@  0dP`0 9*JZ0 0PP Ѝ +h+D+:O-DMhh` pVWP ,PV@Pp0 ` W ` p   hW 0,P0  @c<D> 0SS>CQ 0t08P`PC p`T%$ 0,,8_R0PU %< R Ĝ,!S2 0TpS` $0P@㕨8+`VpP 0V P @ 0P*0p0P40 $pP@̐WJ  `᎜T Wp  ᇜ @j$PT@Q@ 0P@ Q< 4O:Q 0,( `0 0S R \ 0 W R Q 9 0 ,  $h T 8P `",00 08?R00 "<@ R 40$ !   ),@`(  0]P  0R! R   0DQ 0 1 0pp0 (4`VVp:8^PA pXL80 0/Q0  $,<P  Û 0 倁, P 8 0 4`(V5 0`F4`P@`pDЍ@@Q 04 $Tu  0D+h++Uu+0H-HP@8+  0 t(@0^@0+O-MP0@,"P ! u$4dpppp UTP!a@Q'\kk(lldoldodododododolldo mmdodododododom(m@mEP FP PP$UPl XP BPzp8Pe (P_  0pb eX p PI x PG hc 0XP@8j?&p m0  R *Netpn  ghpaLTZpTdPKpp R`Y P  `P ?`pPUW PP lP U3@Q]PPXX  0/ppJk` T@bT@\?JZ@P@Ѝ+Ls܇+8++++++++Q0 +X+++7!4(t+;8>+O++#+ s4) +H- 3eb:)p@-M@P` \Q QЍp  0*O-MM$f@P6PP @ps PPn k%P P P P xhtP hbdoPPiP<c"P(] PW P PME$@  80pa!   6XDt@d!!/00b  0 0d@!!P 04$03 0 ̳ccPe s$ @R 0  cPP 0 ,po0So7W'|c4@`/8P@`u/@p2'~P# ` X0u'  0  ~cP xcPU B pcPU 1cBP ecPU B ^cPU c$"0000pRP [\b @04*<y(0P # bP.' ,P ApQ 6> ,pW:,>1 0 S P pVlP@P& PDIP 4DP $( P (  00($0@$@P P)@Ѝۍ++`++'<+a@+*+I++d+x+ +@+P+@++h+\++(+G+w3x"`@"O-MMdd0,P< L0@k;%\5Sp0[ p0p p 0p[ `P@`_`P@V@ON @@F`PVh,[:4@e}HL$00P(Ο_^A`NP`PAUP Q pX, tt?mppRppppt p8 $xH((((@ @<4K 4mX@4!\5S 0`0 0 hOh  ?$  Q P QP  hlQH@P  X pd,`b4| 0` yb0PPVX`Az T*d@A`067P p(@p,ppu`:hp(\ l`pQ @TQ`P `P  (l0h T0  04%TP p` p1|hpPW )|POK00!  Q :0QQ: \RVO:\P P 06al`hp< 0o\@$"P Q, ,+؋V@(0 {hpPX X{PS l@0 C}"PQ0 @,/-h ,` DP1  @@pwQGZ"hPBl pR4 Q% 50# g\l`dPY`:@hPQ 0 ? ? 4`_P`LPp0 B?qJ` *8pp R`Dp PPTPPL >8(PJP  RL :(Qv P<QLq*P P LP 2 0e V 1 ]: FPf8 F0t ORt#AQ2 0Zp-L0 RP   ;q:hP  (P 18 = pd 0T`"00a#P# P`hPlp@P L 0 `@ `( vT`pPh% 8|1p P PhP `p vT  V)ʆp( P (1_0iT Xh V8Pt@ V? v pP UT! X0P @A_p- QTPp P`L@Pd :* R \D tpPN5P> *l`L@h0`P`D 0>L:0ST0= P!  P Ҕ 0.* RT * P P ῔ 0 Q_t XR 1 G_  P`L@D PB  R\@l`h0 L\@l`w PhpQ3 Q pP hp#PpPR 4P ,Q  pq0p1 p t 08P`  8p  ' R P t 1PX1d0 +++TPtXdpP4 `P TP0 `h@ \R 1Q Q  0 Pn ?PT@\TPX \Q 0PP  TP0 @P@PU  8ꘁ++++(+:) TR\ 0\% 85 =LpT ? pb0 RSQT   % R <0t p2/ꐀ+D+@TP@ P 4ᒡp  %PP l$ R ohp h+d+DhQ 0hp 0! +  0 P?P l)"`bP  PQ # R >+@+Q 0hP 0 &$( Q 2/H]x-0+0+P`r d`@0 0pYpr`:p%0&0tr[ X@Ÿ40P0003`PPS`Pad (r & %E Vt*A,6Pr pYXP*(D p/+<pP P$ XP$\T T0 P@T0AX`+qX@`q,@T:T pk@T0gp` @0b P.8Ѝ؍| GC&[X 0( 9H K++U h+D+++J(+c0+8+T+0+r++++++@+8+H++EdzZyl+O- M؁H PX`RP:  @)P d"Y\ p R <h pW8@R`P   `PL.  H`00& !+a 0 P ;2PK Q | Q ` 0`& 0#0 QL"`0`0`00  # " `pW P t`t`P d lP@PPe<`P  ЍP =Z8++++@++++O-lMPX_堡1 0 X,QZ x@P Q  pd,`x ( 0`\Q4 pT):P$ ` @ QpR Qt0\0Qt\`"P  @PpW:,X:lЍ++H++:)D+h+O- M `V7@ЀPp  PpP  ! "   Z ZQ P `Vpp ЍH++O-gMMm"AP 縕D8D v P& P *: 0S3 R ,: 7 Y P  t OT P   0#     rPYR , , MP "( 0|Y|I,x9 㶙 XT!DP8 78 X(p$А?@$P `pH@Qdu$ 0pN[p(P `P4`(PE((PZ4(`  (RY Q_ ُ]A_  !'( R   GP @@d(P@\ET(PP& (R Q ㍏Q ㄏ Q      4 a84PU [ (@a 0 @[- (@V0* ( 0, ` Q1P  0`0`0 P, Q(: 0 @`30`$ Br0 (0, (`  R1Q 00 `Q`, R: 01 Br400` @0Up@0,0[ $U10$U ?@p8X:Qz <$8Ys* (`p4(Pg  Z X (@ Ǝ X (@ 㽎 (, 0R 4 0P00,P U: (, (0R 0 !, Q:0P@0 Z ,4p p@0 X Z(t2/%1Z(t%.8Y:Pp8WV*| 0(0S `0@&P#P0s8pW:= `  @0 M|QP&  @@@ 0 0P @|0 * @pAPP`PpPQW:pW*P    " pPgߍۍd c1 h+D++L<+++Ġܠ+:)+@++Cp+ +|00@/O-IMM@ @P8P# P Q 2/R |,03? S *Q 0P H P*O  @`V 0PJ {Q 0KQ!(, HHH|+_ R  `p  QP, 0 * ( ( SPY @Q+ @pp%JP 6o  = *+ 7P4Q 0/x +P1  (@p P   A  PP@p`Y`Q 0\yQ!L(,{ (( p p> P  P  /r PA0q   p0 P0 A pPG8 @0 B S qmWpW  P/ w ppqP PP6 + 2pcPPC  pPSL  0P J 0GP 7pP+ Pl &/9Pb _1P  PN`0`0P`0C h` >B&PQ `@p  pP  0 A@ 00 R- P.Q`VP4% .P%PPD| 0 Q 0T4`V *400PPy(P* Q 0PP Q 0P P Q 2/P0t4 Q0 0qPL弃PQ 2/p`GP?*PpW \PH`PXC Q 2/ 0>BP4 PQ 0t Q /* R   * R   <P|GP:WR WxPj0 S 2/L2ebQ 0p0 P1  ! P 02/?0 ll!0 `P THPP$ PˡǡP Q 0 S 2/0p00|Plp@U Iߍۍ(  D+8+h++") +<+BYes +O+Hb@+j%9(Q/0/h+O-MpQ\`s/0 AL0 Q @K `PDdo 0`UP`(  @R@p00R 20S20S W* prP&P#J@P`  PT 10S R @ p a:dqY+ 댑PX (PXp    `" \"t!`"`!Pp R Pt1d0"ؐP#*Ptdhcw |P "Q M\@LEpK[5*ߍ+++:)+`+@+++TD+h+DS@|TO-lM@XVc,Q B Q pd,Pw  0PTQ p@U|:LL2 0RpS R0t01\1RX0d0`1R0t0\X0d0```X``A0V_ܳشܳ(`V )P tP6 h!R0 8*HP'  0`0#`&0 Q#P P  0`S ` 0`0 l. Pp@Tx:,`0@,XO:lЍD 0!++h:)(+D+h+++O-,M<(@p`P? $P4\%R !0 0 s  ? Q P QP |P(p(pP X0P YKp$P BpPo" pDa P P  "0* M Q$Pd(pU  ?\H0P?`.1$2H PR L 4P0L(p  8 QU 0L$p$p Đ$p$ 0 4   \!y-,$P p@`YpUW(A*P &P P@ P,Ѝ(@ 8P `P?2 L` e"cc`c `US&Q0++T+h+d+U +++@++O-MMLLPp@$@S$PdpQXP-$P'NP 1PXP N.$``*CP v `XPv$eVVqVoğP` 8Pp0U"q0p_~PO1.10!$P` $eNMP < p 0on 1!$eV`P@Wu_~qq P- Pp`L0pP*Pi L,pPP*  P , PZ pLq P 1PpQ؋Q$5!SPQT!ϟ`@PYDU B_ `!>P!Xa\QT!1XBPZd`0  PJLQ qATd ADG%|t?H D8 < x@+$o PP0 XPUH%@ 8 0o0SPb`/0`P`ΟONapPn@p@@D@@P@,P2 TTⴐ4pT\lXPXBL mhp@pP d>,Ph0 PQp?'!\%R !0 0 P_Po  ?  t Q P QP  FP P pP SP N x儇P @P @P 4'\P 0p`dPh@ e?4r5 pU%7Q Sj 4!\5S P`00h |_o  ?gP X@ h & P ]/@\Q@\PPP$ LP `6'\xP 0p`dPhp@ e?4r5 pU%7Q S,Pl,)@ RQ@pp@X lDX p %QJD,A\QJ 0P >j@Pd$P8 P`p(@FύT@! S0! R !X  xPh ]PPDT,PLKX PJLp P2 PAP!8l+@QL!pPU:W:PP0J/qSL!0AV8P= 0p_^Ap~Pp0C7 0HJSP0pQwpq8 RPQ Qy1 `9RP 01 2 + _P]  PK dX)QD! !0)QHPE ++++7Q@+4+PET d  6Pp  EP '$P`\!08 818`VW$̷P1`P. \X0 p`  +h+Q $UQQPQPUp0hn0`Q`V:Q $%Q! !t / a| /Qx /ALs %/  ShP0 P · A(h 0@uM\P  E*P  < D+P 崐 |e|E p,pW:+U d  h`P%PDQ\T gP# XkP d $P\TQD  }D 8++:)+P Pf P0 `4QLpP\P @ P\ !P @T`VTP/:`D@3P`pQPP @ P\ ! P @T`VbPLp"Q\ Og8P: PP5 0,"P\QL  !T+d+H@%^ gPK  P D0<@`400 000( 0000$`,0 0(L(pP 謀0 *J|P   ߍ؍++h 0 |X++4+@++h+D+U +T++h+4+8 H+^X+++@+6UpK-Q PPpP`K`@K@T KP V:#O-Mr!n bR@1% P#  K*CCP 4d  ,  P P@P)  %, %*P 3  ^P[@U>T ЍЍO6P P P,++(@++h++. 0/P+L+/L+/T+ M@-M0 @   [ %'I:)G-p@Ԑ8QUP J`Q PJ <t-`JUP JUP @ $JHP+L+ X+|͢  MH-M    ЍH Ѝ/ MH-M   ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    HO-uMMرN p@ @, p ppJP-JPJn@  P*  P toD capP   p hpP' PZ'%8%<5" # hP Pp   P 8D4(l uߍۍT+3x"O \+ɾپH-M 孍P DD 000, 0 $Ѝ\+.=H-Q 1/ ܇+0H-0P0 @@P0+@-@G@O-MPO``(9pVڤP 0  P  P `pEPK P I尯o         ,@ ,`X` ,p ,PT WV!<N, H, EIߍzpڜ|3II P R `aT~p 8~LR> JpA@@PV )MPU/F+\P p)ʇP!" x  RYP9 %, %*VP  P HI tQ>Y< `PvH/H0DSm4`PhX PPb8 = N@pP= QP @ \cPI  @>+ ,0p0 lt`P\~<8P?@o_pA  #`pW.|4 R ( {Qd PdJ P; <zW`P AT* ر[^ `4P\ X[ QY 0p8 8Ė<\S$ P -@$PA` P9  @0X# *PEvT : H P h @X RQ!  @ %_ P0 < %  %*L  P  P:= P *-0  $ P ` <dQ:( P < *  P Aq P3Lq+ QQ%ڈG R hPHP*۽  P > P 0 Hq& F0 aRH P P*㫽( o  P  4 Lq& , o F4 aRL UP P*xC lP  PZ@唟唯F~ \4S) R& PQQ PUQ P8 ( K R  : XK QДtP DP | Pp .P*  P S Q,QS 0"!& 0C04eQ P P*$ P M ( (R xQ+<Q) xCx P< (%P P P*㵼Py DP  H8%<5#"( u8BH0/S8<%  YPP*ーG |P  @L@%D5#"G BlQL0/S@D% <&P0^P2*P P @ @ @ pP L++X++' L0N-H@?@@_!0/@QP,%R{PPF GT+++rX++P+h+@++Lq4 QQ-0N R PP*߻ P B +PL_Pz |.HPL0P4e00P@ XLPLTs *`%P  Dxl``PTp 0PpR 1@L/Q `V*Q:QsP hPX'P y q Qt  cP PPb W [9b@0p @p 0)P@@@`D  F? @D`P T P$"Q    YSPPT"2rRBpP@*BtpqtQ QLR@  B! !1`ppppp0 p0pWP!p01|A0 R  h!s0A`AP@P0UP ?X++T++@++,++T+h++d+x+++D+MK +<+8+4+^++(+ +++++++@++LBALzT#S+$+&+8+ +dv6,QjhEO- MPU to*  0@P Vp'ʈuppphh@ ?P` 0P 5P p WPCP PPP PP3W렓P `P @0Cps*xP D#D\Q8\  A$o h Y(*@ Ѝ嘂d 4pG1%[W!\b ? D PU! lRBF,PPq Q*+P _   _, @?!\5 S A 0Q ?9@PTP 8dAxq h @P *,!\Q\UzP P @h Q p耟aP0 R DT@P@pU:P@@]00o+@+T+8,+d++++h+;+8 TH+D+h+++5l+++L+R||   p \Q d Q\H\PQ 0 \Q , Q/\/+H+8 TT 8+! RV  0SP 0SL 0SH 0SD, ,0S@0 00S<4 40S88 80S4H H0S0L L0S,P P0S(T T0S$` `0S d d0Sh h0St t0Sx x0S 0S  0S 0S\\Q//-RJL%R-D+H-P` < @0X@\p< p X@@0\p?φu/ ܵh H1Zp@-P` @ @+ @-x  P  /**B R*"&0r <@3 0 @ R P q>h++aH-@P P <>U lPQ`pM\PU4P 8_>(Z> aX╮@PPNPup W  AQ N P  mWNW YWyWnW = pyQ0>+t+X+`++:)O- M@ @ 0`@ !Pb P @A !PV P X@\TT P(@kpoR h!obW[ X5:UV+ (DP@@ZP P p 0`(@p ?!W [oRob8@,@  Ѝ++++++H-MP@T d n<0> ^S>Q`p'`&p @T@T  @  0 00P@@ЍE++K-M@Pd p``2wp0P PpQ`S! 0 T(D D000 0r`Ѝ++X++T+O-MP PX `@V T p#X@!@1V< 0Lp pT9 R4젟0@`L3 BR@Q  8H$dPL @p e%705 U1Q S P  0@ `RЍ,+!@++h+X+O-M`@@P0r!p   7"P0 PS X0 @<TB4p   " R+ [Q W 0%@ / ' |W ?  p  00X@@d0\<P  `Z <Ѝ,+z0+ O- MPJp`0@Pᐢ!( !P Ѝ 0P <T P! P W 00 < P`U ЍO;,+t  P+G-PHP<4PJ,(PP? DP ,PP  ?ዾ 0ꬓFP$ P PJ V ? **thP ] }0SySsp@T TQB  PF rARP TbpNPpU @ U`P# P"  @P$T$X$*@˱P . @ PP wt!@@*㤱\hPP ׻ @PP DX0!00*ㅱIP ḻ P @dPV0 :3(;G8LA8++X+T+@++L++ %D++,++h++++C+++H+++++ZA-\%U?F;R-R#J + u??΀ CNLU 0`pp ,u p`0 P%0p`P%,0p` p@-`D@PP R:( 0Pp8+qO-MPD0p8^ R/P 2xNP`C YJ.@!2 @pS @000 R@0 TPUppP;U"\5 S !0_ 0 pb\B  ? ᵺ@@Q P QP  ' P PqPl `Yϊ0P @!p 0a"!o P `n q"P@T !DA `P\8p ? W L#`0r`Q#F`@0T00A 0\P  L$p  pG$p R? p G @*p||`P Hx P P PЍ, ++x++T+h+d+U +@++p@-@P@`@  (P  p@茻p++h+H-XM pP`X@P` @/XЍO-\M`"p&P@ m!Q@P*  XH$% 84 \ЍO=w& P' `D : @`@D - @K pDP/  T `X H P4& ?eH+R\Ѝ+S DS"3x"0H-@l P:\0P 3D D1S00 0눁++(+( 0H- Q$P@@HP TLP @8 P 0qO +/ᬁ+O-M@\PUFP PJUM PV P V.׮P P8 Lpq|Q `  ` Z pWQ  p̸W ׸ ¸ 80H  \ ?p  `h / C΄L0P_?q`0P Pߍ+d+h+.H-P|@paV Q PR O P  `@&+U< 0 0!R  R//&+O-M`PL:@Pp PE!% !3S 9 # "5 ! oQ,P( `40,(Q  R  tP 0 `pP Q D |  0pЍ+^F+++ + @-` 0!% L#R 9.$P% "  / #"o  +^FO-8PUp$尐q灰p> XxAa pWQ\ 5_P5_pPQ8PHhp@`WX`H-`0S&&&& 0 B A@o <$@H-`0S'@','X'   B o $LH-`0S''''00 B1 B $\H-`0SD(x(\((00 B1 B $iO-M$uW Őlp|hh79oNQ`vSvq$p p|0Wp!@4OW:0p P[N` A0VU P 0f PX@``PU0@B D  E`T.Q  `R   N` PP `FV0D R| !  P !! B!Y @2/P 2/ ! !2/ BY2/! |Y 0@0ЍG- MPpR `d@P< ~d@, P `Py  \p[ (`<ND 8 0`` $( `0 @x rl n` jT f`P 6`Y< , p6 p3 㻼p( 0( pW *⨠NTW  0 ꅽP ~-0 r*PP N Ns ݍ0 cvd@ 2edAzd@K-8MM8 ;PpPrR`p @0 P?pVW `2! 8ЍۍO-MMP`pl@PJ   P)  P/-P rQp#0@p [Pzp Ƞk≟ ۸P `pWiW~f Upଝl~<P `n  -@`PTSJOPNJ  !o ᨆP?J040 #DP6JP2JY"N 0㰐 @P!J̑P~  pLʠP!0ᔐ @PPZꌼ` P aV TJ@ߍڍ   P ` P _0hV@^`{F~PgZW@`s[ ⽫P \^/p P X FF F@A-M@)`PpP  0Jp0P  R VЍ0 0a lp0cS@ @*/@P c @h++$+@++O-MPpPlh@`T i 2|QTЀ  hP @0$" 0  ?  0 РP h j A0 Z)*?`@ `忩 @pTP` H1P  0XDP`@ 2V hh@P 0 0R@P) o# 8@V p` ! `Q 0 R-JXP 03?R! 1 R z pP d_\P pPT0pp+$++h+&+zd+K +O-Mr`V1( !V   墾P 0O0PP !V-XЍ`Hp 0Z ppPx `pW 0@ P X `ZpX  0@  0P P  Pp W@$++ ++yOy !hD++O-LMp@Xp`P 70 P⼶ ,pP p(PРP8`U d@p '0$ d ! Q pU+* # @" p> p $` p @p d$`d 0 P`,  `YP C}P d P `d(p Zd(p $ LЍh++K +0H-Q@!1 #R# @ @P @3@ @# # dP@L$@P 08$@P,+^F+"7O-M(`,@P 0V` 0pP @h`0P " Z cP`pUЍA-M`p@ẵ(,0'P\(P\pP 0Prp]0 Xpp!0,0?P(P 048<p@ЍF^^F :O-M@p 0P `R pc ~c yc tc nc p@A@Ѝp@-P@`(( XU 0Xp0H- @0PP* S30 S * S0(( P,$0 U0O-\Mp`W0 W1 3P1A2P1A2P1A2P@P  0 -@VYJ WW: Sp `y@PDp&Q:  PRPX]( DD @,p,p(D@ `p0$D @48<< 0$`@(84 ,@  DP 0   xB-O@W\Ѝ K;SSQ;D44 $80, (!-,DS;!SR00;S$PU:AU0 f@@<`E4Pc' &(@,TpP` $@ H,$ P0H`LpP,$QW Q QPD@ p4a"0SQ@<8p<< ? |400P P@TpX  # " P9@D@X p8P8D@P :@[48ppWqD@@ PPPTP PTP` T PPUW D@PpT`V !  ~PPp!TP=P:D` A "0SqW*P ? 40 0P 00#`(0 D08 R7 B8 Q   @D`PUYD`DH Hp'& ,(&'0@@B,O@`%GPp p0 p8D D0 j 0_d+LBAW.?AI\MBAWNBAWOBAW[@-@,P ` T ,,&8P0@ 0 4+{@-@,PTP @ 0 0H-0@PP 8 R B8 Q   04PU8P0(( ,0  0pO-M,P/ `p@0 QU    0"P  PPU@@4[VЍ 0I㲱O-MpQOP 0Р ``@`Z`Q` @FT* `:[0 P@[Q?Q P'PEР `:[0 P[Q?Q P p`PpVQ 0  Ѝ 03 PK H-,P @NQ CP\ @`P'`&P @TQ$$ (0> 0?  G-M,P+ `(pJ(W @P P # "  0EPP pG@ `WЍ$$ (0O 0Q ߰K-0<S 0@ pTppp@W@`LQIWPQ@P @ pQp࠳^0  0f 㮰 H-M@\$P p` DD 0*$ 0`Ѝ+X+H-M@\$P p` DD 0)$ 0`8Ѝ+T+H-P 7@rP YP'\PPQT`T@p  T )P pW++*+J@-,@P ,Q +H-M0P,^Ѝ Ѝ+0H-P@LpX Qdd Q 0 D`QaQ 0! 0D+h++H-MP +P, R@!h `Q a AR *7.` @-H5T8P ,$B `d# %ac, %*㰟tP  @!. p   0[P" ZhPQ \cTA 5d#, %*~4B(P ᱩA @d AR *a#BP(:RQ% Q &`P /@ d#a#*Ll`P <@ @Ѝ&+++w@++h++O-MP ` @(T P L H D @ < 8  DsP<@8 kPlP tP( bPH(   p   0 pTPЍ4cP( :CP( 0P$@P T0DP P p HLp$P8`< TP P0 S* ~8TPZp` `J8  pBP  gS 졟`&  pBP P`V:PVd P $$0r$ 0 pP pP$ 0  cPD ( (⌨0 PP 8$ _p^ ( pq  0 R0P 8$ FpE h \P(0- L   0 pP3/  4)(B  ! { ` # O-MP8PLHD@<`04u@@HD< aPLP bP iP cP)     n pp AP8P@`  P 0 P@ p DP \<^@\@ߍQ@ `04$ `HL0uP @HpLP4<@DP 0`,PP P J X -$p pT( /P壞@dd#e0p2ڔAT1 $v4P `@PJfp&  n $fp n/ P%`!t`4!l!Xn?!D`VY ,;80(`?"R10`@@rP? p oo4'@8P-`V* Z V, Y 8$ m0 ဪP!8P , !$  0 !( 4P , !$   pW75 ``$@F0*p, $ 0#p% 9p X ^@ X I4? 4)(zd@P"o * c  ~ g I K- @PPpW ` 0`W0 0 0KO-M`PHr@ pPpOPp AP4PP fP.pWppP"P` P [P  P  0@pM pI Y> @E$@@ 0@@ +  0@lP+  @ݬU   0\   0 @ upX DH>p@(@Ѝ 4)Ħ( G-`P@tq IfP p rP@@P  p  `P  U G5oP W`W $ k p VP$ ]  p Z `P$ N p '!4)ܦ($ ] A  Q/H-$ r0Q0#1"$# O-QM p`V pQ^@ ఠ?`p@>{6 W  pp?{7 Wp|@TpW&*P@LpW pW*`$c`?`@P ` \*$Vp$c PP?@PP@ ` V@:O-M0pWXP͠0@`pWT ?ps@TP5T P@0S6 @TP@&@TP@ @@TP@p@TPP1WP1U:@ℰp%7{p pp@0p0@S VS*B}ЍK-Mp($D` P f$P 0妤!  4 PЍK-MP$Dd' 0儤 !`   P`ЍO-M p@P p >P `t `Ѝ  Q 3 P`rQ "$  R($HP  .  0V qP PV " t 0pP`V0%1 # PP 8  0P `P $ 0X PkQ0$!0  $  0`@ `P [ a P`| [zP@`Tv T( Z+ =P/ pD 0 PPT $@ 0@P  A P P PA P@ PZ:9Q $ 0#'  }   O  q M0H-MP@ 0 0Ѝ0HЍ/M@-M@P 0 (" {"Ѝ@Ѝ/ G-MPpM`P1 @d`H <0@$LT8P,40$ ;4Ą(?p 88p @  P)$tЀW|p b "@+`p p~s@ЍpWP Ѐ X   0`pP 0P  0` Ppl 0L p   0ppqp  0pJp P2 V0>ꨄ嬔  0Ƥ  (B p pW' p Ѐ  pst P P $ R~*0pwl hd@d@ u ^  R F , 1 MH-M 0 0 ЍHЍ/O-M PP% @ UP!? "R R$ P PP 0 P `  0`P @  0P   0  0 @Pm P 1SS@[ prs,|` pPp| 0v pXP!D! ^1S SS@H L0  0 `p* 0 P P @ \ 03`A 0 @rP`Ѝ       q P/@-M@BBQ L ~p 8$  Ѝ@/d@9 X K-@`P pͨ ||PZ!  LLP!< p|T $ KC! K:) @-@`P ZP  TPQP((  K- @PT0S `pPu 0S"%T  0XS pp `rP0S`%a"$& @p ;q H    $$ 0H-@"ȠQPRPSQ@@0 T /$ T! /$  T! /O-M` @P T6 P؀p0 @T(  P㐀p0PPpp0 0q T :H`@D 04Pc @TЍ":)$ !8 B W H-(4$$,0SPO-$M@nPiP |P $Ѝ 0kP+ $tU` H0!p *S 0 U0P`pF0h pUppp R0W0 Q pPp\ 0R`_  0Pp $PT p 0` pPG pZ0  W 00#8 \    8p| $$p`2r"3,H0` R HRP `T p`}pa P`pV:LP PXRM 0.pF 0  0  0 GP  4$$  V $@ `m  PARTEFI 5     O-Mp@Q W PPB$qP `  0PPPP < $ PЍH m R p@-M|` @PRhuiPp 0r   cЍpQ0 s W 0H-hRLR aR bR*#iR sR tR! P 8@PP@0: RP2 ( Ep @$&@0 Q0  p@-MP@QL` PQ ЍpQ0s 0H-P@Q 0,zQ00Q08 A-M@`Pp+  P # 0RS sS bS SS pW bS S BS R OPJ $$2!PЍQ0O-M` oR r 0(Q0Qy @pPr Pn TPi P P^P[ (QQW R 0#"N R " 0#D$p@0 PT + p8$ m0e0 pLP- 7P   7P!@ @  9/$ p'   T 9/$  p 40 ` 9@PUpЍ@ r 7Pzp  A-`p@^PP  7/$|p  7/$ qp 4 P H- sR iR aR Y p A-M@ P $T`p 0Y  0P,(p 0`E XP 0`ЍW 0` N  O-M@P p儠刀P`tP `V    PP ЍQ0b"  H-0p0P@` 01`V  O-$M @>ZP`   PY YPU \ `:x8 P$Y Y$Ѝ!   O- M`Q 04@pP < ЍOP P0S* $0D  T0#+ 6P#   Sp $ 0 T0 У0  0 @p (       H-`PP S6@P 4pQP  @ Q0 p@-M`lP  @D4p8 0\P V Ѝp!J ͢ p@-MPP0($,4$A$$(,0@ 0sP ` "r *"#| P80hP\(Ѝp@&@N@Ѝp4)(O Z k  }   !   O-DM@P8`Pq弁< fP lP2 r6 /PO`` P L P=  ZP( , 0@#Z *  gvPp0S P t PZ *@ DDЍ  Q0,[:)  8 4)<( 8$ O-$M [ L p P@`Z` [ $ЍH` ` Q pHp  p "0# H  @ '0%  PPQ$ QU <2Q 4"!U(1$iP@Q QT H 0@ YTX@ $(``P_ TXpHPLP $ .' P 0@0R 00 P ``  $@00$ @T@` P`{(@PP$   Z@p@Hp 0 Lp p0`P00P`P T00Q  O Hn < X    P/@-@$P @O-,MX TP\0R, `Pp7 @P  0.TPTP  0@$ ` p 0@V 0  0 $X(F P=@T9(P5$P (PR`pᙏ  0ᒏW0 `P p  VV VX,ЍRḛV0 000PyO-MS9JP pF $-P $$ 0pl P pP pWth Y " # # T 0 0 B 0 0  0@!$ + !(PP$=p  [7pv $ Pn 4)t( s R "  O-TM(P`HLusH@ :sP  0dpHp qP+P%HL  0P Pe@p1 T  @ D$$0㾔Pp P  , D @0 PH L0 - ` < P   PTЍ0 4 P* P&  $ p,   QP D @0,'p! P `p  % 哒 Y8*`pT  ],P  V  Rp`8倐Y:D p@0RV _(P<pVZ`,pV࠳ t  V $V @`D  00Y PQ;08 |@`D <0tP(0  @`pT  0  V0 0 P  4$$  彑  h%d2p 20@D @  0 Y0@  `R\ $@0 `@P p 4P$ (0 r  #  R000 Pp0$ 4)(+  g    $ B  B     O-$Mq@`P   aP bP iPTN   TG TA  p;p NP7 lP160PSP  0S0S `p"`!p P 0T \P  0  VT$Ѝ `#(4)O-eMMpXp`@ 0a@ Q         pFp uPBP5 P44P P  0S@T `0"p!0 P@T P `Pb `VD  ``eߍۍF&  & P xPpdf @  0`pP @P` XX X `pP @P` XX X Q |  ~`@P`XX i @@i`@P`qXX gX  %E 0d 0\P XM960 .,$4`##t 'p,$4##,`@P`XX X 7@8$ m0+# ,PU>X `p@p (;    0̌rP@@ @$/ 0@S<L@  ,1   P0.ЍA  ЍA  PPtq0d W| ЍA  P8$ m0 P, 0  Ѝ F P !Z f % / !>"     ^ H-M0P@4ppb #  :&p8 0R P L   Ѝ! ͢ G-HM P@8`ᗔ8  ؍p4 6TP p lR& T pT  pT d8 'P \PP 80z<papHЍ O \ `#4)X( 㓍G- Mq@`P  aP bP iPT   T \T  dp ЍlPp PP  0S0S `p"`!p P0T 8P 0 `#(4)O-LM4嶀ᴐ `Pp8 0sP㰔00<0岄(PDP,`E`F <@ P 6'P Z48 {Jp+lP`p<@P 'P pW48 dJpJ`FG `(`H0Ip4 4800KP`,`$P `khLЍh G-8MP' PP# (L 00 `@Q0  ppJ P!0 QQ1"2(p40,( 0pc2P  0p P`8Ѝt@p`P pW1 00(pbRp`P0  h O-lMP$ 嘐p,P0  @ $ `@ @`` A @ @g :/pWlЍh H-0p0P@` 0 `Vh A-t A `pP@ `Pp @PP@TR 0 Ah A-MPP !4p `p @ p1 P0 W2:pW@ 0pc)04 $ 8, 0p?  ` P 0 P` @4? 0XgЍR# _# I# /# # A-8M P@8`ap4 p T pT lP` 0\P P 8 08Ѝx#  (4)@-@R_ 舊+@-@RR 8蘊+O-AMfvP@ oPpgPc`P $$rt@Py }P7 p @@P-$\$Pa 0 <P ePX ePp@pPPa P/  P' !HP! !BP !<P !6P !40P  !l*P !X$P !DP  , P r P   P s P WpP P @@T Wp @PP` tqP d  P% P #80[ ~P P rڼuP  LsP P $PW @P X  PP "`0& IPy "@ 0 <Pl  0Pe  x0 P^  `0PW @$ m0P ( PH VPC $ H@ T: P4 @ ԡ`P@ pWDP9 p4 jP#   P& P۳XU XAߍOM\ s @` @` 8Xἳ<` ?4AߍX HH H0㋏4h h0㆏ ` `0く,[# Q04)8(# c% # # { !s#$ j?"R!t !$ # $ $ $ $ $ s # 5# $ $ &$ 5$ >$ I$ V$ d$ s$ $ $ # :)O-AMp` \L iPp FP P$$(,0oPP`@pP  AߍOo  wP  @ ᨌ(P ePB P $$0.P:   P   P, s/ P& PU , 0嗇!  $$ $P $P @PV 8 0( $D`0t | \P |P8 | QP |$P$ P  P @ P , | 4P | $ ' ,jP !R$@ 4zPy$D0 $!  0$   P$8 4@!1#!  $ } P$ 0廍< 0$ , ,0(  08  P0 ( ,( `4 \ 8D @PH0T L`UX \Q$$0`ʆ! Y $$ :$PR,<`(4`8 \1$4#S#ᩆ! : $$ $P3p9pAߍ|h(<p| t0 ,[% Q04)P(%  % # H% # $ j% s $ $ % # $ s# j?"R!% & 5## { $ $ &$ 5$ >$ I$ V$ d$ s$ $ t !& EFI PART& v& X& <& #& & % % '% >h(O-$MMP @"P Y R`#ጉP QQ| 0o   )P H rC< S` PpgW $0P @o { `+P#  # / `  0 P T 5CP v` PpgWg #⧅$1P`  0 P  C  p8"V   Ya$Ѝۍ@@ 33H 8+<+!8 8 8 8 8 8 h8 v8 A-RMx`00P00 0D(0 00 00@00H40,0$000 00@0LPTpp<0!1X\h0\0d@8``l` \0X@ 3Rߍi@i8 8 8 p@-M `@Pʋ   zp < p Ѝp #3 3'i 9 9 9 O-M@`pZp PLP pVB RBDP P, PP PP P  dP PhQ @ ppb QP ohZ 0 S 1 pp P P P![ $ Q 1  [gU  ,0(S 1g0P Y  4Q 1  Y l|2HQ 40L S 1OPZ @ h[P 1P l 4P 0 S 15@ `Dp@ `=p p R 2/p 8 X/p Ѝ|p`` LDd <\ 52 )2J! A ?9 l_X9 x9 9 O 9 I9 09 h8 9 K-P! P VP p0P ` @ P BP K-M@ PP ` 0`p p PPUЍ c  8 ᴿp !0 `nP9 iH-M yPЍ @-M@p ( iQЍ H-@P;P pgP?` `e ]DH-@PP pIP *`O GD݊ڊ?`H-M, MP ˊЍCs#K-8M, P;PA $P      P n`&V q 0p@0 P PP O@D8Ѝ 0㶈9 9 : -@": i0H-Mx@P PP P ‚H ?p Ѝ0 0V㑈0: 9 : : iB: @-,@,@@ꨊ+(+DA-(MMA^@L p P(Ѝۍ @7`CP P|@P$P @CP 0P|@Piq: : : @-MX @iP L p4Ѝ 0A B< A -@"iA @-M\ @IP P p8Ѝ 0B B< A -@"iB p@-M@`P $P uPNP PP p `P kЍp88 80oLJ80( 0B B< B -@"A 8B B vA @-@8P , 8@ 0㤇A A B< A u#0H-M @Pp  X~P D @Ѝ0<, /(/ 0|?9 B< A u#^9 I9 p@-M@^P `AV*wP P 0,p l `PPЍp4(/ /= i= B B ~B H-MP `gpp7P @ pUpxj/QQPPp`W Up`W Kxi O EA A A O-4MR @T @`P0p l˼pa`(/ `0`Vv <oᠲ@ PpW`VdQ pWQ   @ 0"0 PP1/PQ 1/P W8P ~p p `0  ! P6W30`Vpo@崀PP00PP@ @ U0 P`t0 PP@ɏPP @`d@`$.@+P D+ɚ;6eʚ;j@ ̭(X#H p@-M`P@P  p {.[= 0H-P h@ t@P @qPJP 0 0V.J!vA B< lA u#0H-M @PQp `P H0Hw@Ѝ08, 5. 0ޅA A  B< A u#I9 p@- M@P `P P 0p l ``P`_p Qs` Ѝp(- -? i= eB PB p@-(M@ PֺP- ]Pp# $ p0   `q0 ``Q$` 7P P` @PD(Ѝp 0dd; B< @ -@"> 0H-M @ᕺP P p qڸ !0p@0 pЍ0 0.2; B< A -@"i0H-MX PcP  @p((؆@Ѝ0; O ^A p@-M`PP @ [p O-= ////00 /ᬭ(00 /ᴭ(00 /Ἥ(00 /ĭ(0 0/̭(0H-@|YPP zP00D PaD"P# *@PLy?Q:k ADPP*@0ԭ(H- p P+0@ Q:a@QW@ A@Q=@H-DH/O-M(  TlpW `f@  R 8 Q P <t ,04pW pt  pXe p8,@T u @TYoup%pptU`@0000  pVP BWCW NWDaG QsGP&    x    CAW Dl  l    P    \ wrWWT!   x $Q :p ,lW`W;CWI LW@ vW9mW; sWVV`chp!   Kx8#Q hifaW lWDcawW zW]V`XcV@`RbNQ   t20S0520S1020S 20S*$" R<" R  $Q  10 $ $00 I(0 Q PP !}+zpt o+$ @(` p$PP PP =PP0-`p` pPtP V  R 02/*̭(+((|(((8+6+7+(ԭ(Q0D+#?+@+>+=+<+;+:+9+; 4)+< !B< < .< h8 9 < ; (,((@ @ x@ K-MRPbP *`@mWpLW`尀W00 P   |pW 1/pmPP`  0PPP PPԭ(B :)qC wC !ĭ(}C ; B ( R/0S  /̭(0H-M P@1 P p7P o pp d|@ p,Ѝ0 00A J!iA B< A u#0H- M|@P P= PD P ;|L p Ѝ0 0g W*> B< @ @ ui @ H-従= 0H- M P@т, p Ѝ07*i= H-M,   PЍ&*i= H- WPԭ(O-MMQ x@vTP)*\`ԕP`Y   ^@0<88@4H0P,X(`$h pxtpXP TP[  #PLpQ PA  ᕸP8 pP5 P.P( PpP4` p pP LPP `PZ TVppYLp Q P  pX \ P ` |&p`  pX< 6p Q {  gX"pQ h DHP*\ pM PU * %:倥P p JaupP@D%:P p4KupP\pW   2/pW pf@X x ǶPZ P `X  ᯶p P X 䤍堶p  Xp\DP 0\ 3/^_ T$ P w뀃p <hhcXS P"( 8  $" 8  "  "  0{4T l"o$ ,  "\0  "N,  "@ `V_ 1/`\P`V 0 3/`VHLkP \`-ߍۍP '|| R'H i 9+:+>+=+<+:)̭(>> > i> > > > ? ? (? i? ? ? 6+7+M@ @ V"!P^;+ @ I@ @ 8@ C@ (? `E > 0> 9 > '> 0H-M P@#0 oAoЍ0iH- MP@`P T\ p NNNN $@ PXE Ѝ> vi 0H-MP P @P`ph A  vЍ0P"448@P,0PPPiЍ0?M@ e@ !P^Y@ p@-M@PP P|P lll P0 ``D `X p Ѝp$&!E !E F H+L+P+7i,E H-M@P9  V P le P XPXp ` Z  @P Q ЍO 9E F"b"BE K-M@P PRPp p`(< f뜂 ጴp8 PV P @ }p <4Q )z xP? ` 0SR+ R+ P~ pZ @TJ xP QRR T@ Pp}6P2!q 5mIP# p PP`! RQY W U+ `V UP:]Ѝ耏xPD&TT &8i(E iO"!F P2 #F"!E E E E ~lE i0 D F \E OE 9 l8 @-mP$@$@%E T+% 0H ::)G @-M@L ᴲPHH0 Ѝ 0g}JF E GF -@"L+H-(MP`P& @CP  p(+~ pP\ 'P D(ЍD |%8%  }% TF L+8i(E ^F {F F l8 H-@ P `@p>P0YP @P7 p,   0|!L+F E F 5"0H-M@Pm  0P.%F p@-M@~P @PP d`@  PLPau, Ѝp 0|E L+H+gE F 5"p@-M@JP @PP \`@  PDP-u$ I~Ѝp!E L+P+gA-@hP @pPP @Py p `,, ,02V| aF L+7!E F 5"H-`P ~@Pp 0p A @H-M`P P p@  0P P  0p @A}} ЍH- P Q   Q 1/pK-M`(P ( pv@Pp:}"Q P }Ѝ TP}"7P , 0 gp Aq} O-MQU$& Q P Q @PtH ΰ@PHpk|Tp@W Wf Wh W ?}@ЍW WlP kĄP@Q  /-sP@@(@ 2|0($0  ,pwP `P$@( [ ᗋP (QM VK( ( 0w`P$QD |@@``P`{Qp0 :R Rw a`Bv`VW B CRp0A`Bv`V7 B0 Br` VwSS0pSor0PxP:i|@ @ `V   Q Q@P:|@" ^TW T4=@ 03P3Q0 !P-P* P(  R$ *% `P@! CRp `PVP@P``P p@ t$PP v1` V  0@p PP @P `@T  PᐿU @D8 0@"( "Cs#b"#MG 8B tG B UG A-@T `PpnP:{ӷP  0p A{ O-$Mp@zP @UK H`pP#  0@`4/P( P+P 0zP #z pH`V 0{  PPUZ Z x{Yq{ P ze{$Ѝp@-$ PR p `@$@V PP QPQ 1/p `V@pO-M(PU$ $`V p@Q WP 0P -PvP vP `V{{Ѝ @(@Q 1QQ (Q R-07t7|7777 RP P0 0  0p 4 z L!G p@-MP P  0 `Ap $`@ @V P4P QPQ 1/p `V@ЍpH-P@$`p8P p`$@ 2 H-`P@p#P pP @B2 0H-@PP  R$ Q  0H/00Q /  Q /K-p@P`P QpU P `PUP QpA-p@(`P P@ @p P3 A-MpP,`P T @$ $0(0 0Pp@Ѝ 3 O- M0Y$ P 8P J 4Q44 Q Q((8YP Ѝ`P$P Q(`O- M@40PP)U' `@plK0X* @  04/PCPYU@A  iy@ 40 BpB!0 X!*U @Ap  ` 06/P@TD0X*PU D400 ЍK-R @P`V`V p6/᣼y P@T p@-@`PP BP V  P PT  |xxP pG-FM@PU`P` x@&;P8 R  pF`w pp P"qppPƘ q@ @p(Fߍ 1G G G JiH G G 0H-D@D4@4,P,0H\+0(d+Al+0BG-NMMP@Fp`)u(qw [V pp/ ) +E `P*(k) 0pn 1JO 0pn0P,0Q,* 1U(() *0Nߍۍ8+KiL H  072:)1H H- 1pIiG 0H-hP@P p T p @+T@ Xp@@0\(t+O-Mp@(Q0 0X t xQxAoᡢ@X8 `xPW TKP2Z    # V.*   W B V&*@ 0 HW@0@@`X `\ @p PFP@vP$k@ЍB)H B)H iH p@-P@QU 0PxQ  000  @UP ` XUQ p@&,$U `PUpB) B) Y GH A- M `Pp@gvW W# `@`Up@JV:U` Lv  R@wP P`  owP ЍH-p@Pp `P  U H{l8 9 H-M pP`@v @ЍO-MMMPc Pp` `K=p] @Fu ,`,\qXpYE @rP9 P5 pp o $ )p !@ !P 0 o" 000 3 ;*mP 3P t3 S``Y,\Mߍۍ<0$  9#H i8+ H H H 9 h8 H-M`@Bp pPu  pp nt ˪p ANv@+P HFv@1P Av/PtЍ8 iH t#H- RH<+I A-Q P`p@qP PP`V@- M  @p l ~P T q4u Ѝ z!I 9iEI 1I =I @- M  @kp&  &P   +P p FP T q8Lu Ѝ B*I !I 9iEI 9 tI 0H-D@D4@4,P,0Hx+(+L+4M@-M@ p  QR 0R@ AЍ~I I  0#;0:)I H-`@Pt8P ` pPLU, Rp8I B):iQI @-M\@ P L  pЍ0 0NnsI L )N -@"i3N @-MP @ᒨP  1pЍ( 0MPs밋"L M -@"M @-MT @uP IpЍ, 0A2sO L N -@" N 0H-(M P@!tT  0p < p(Ѝ0d X뙃"iM M M 0H- M| @@P tP p  p Ѝ04? 0qrN L N -@"irM SM K-M <pn \XH` 1P P,P> | \P XPT :Q00@\p@P`0  `XP0 @P TP 0 @DP AAq X \!PdH qH,tݍ(( I cN kN B)b"tN i8L EN XN @-0M| 0@p P L! p0Ѝ($$  I iI M M M p@-t@t1lP-31P@P)HPH#@`@#5*p@9ꐐ+(د(+S+X+XG-BMPP(r` pp `  t8r8r`!r p !R*dcW%  zp P P K gp P l\P X8  T)p |p Q$)P "I >p QP `8err 'pP  pZ PQ pOH!PPPP pm `V !RAqpP!0   :R P o[Ppta@T ,yEqSo@DP0 d$8P p$ $ p @ YP\P  HQ z >Q rBߍXnkx08i(iN iN 7+N N N O O O O i8O B)cN 'O i+O 7O S}!ii08 QO [O GO N / 0I-:)dO 0H-M P@q$ ZpЍ0iI 0H-8M@ P q$ Bp8Ѝ0i8L O-UMMd8 @2p*   " ≦p$P QPJ+.PJnP PiP +PZ !4  Pp3q|  nappڴ(Y:@ p!0(  P +PP@pG`'W[ :j*PzZ  `((Y:!0(!  `  0q04g2P8 P@T: 0% PPO 4^ |f @DpP `dPN  tPEp U ADQ) Pxp4 `@a``v\T DP 0  R@T >k4euP )P  06@@TPUUP ' @0P!@TP>P Q P=@QGhb e e e e e e e e e e e e e e edddddddddeT:%PP[ P P  P  @Q $e ecddHP| PxylD@kP( $ <P 0`<% S %*&S# %*/&S"""PE@ U$K @{PxPA 4~딲嘢@R 0 p   `'b 0 pp`g@T>(aLrth\ P D8, P  K[ ,I'Y.0<Q  20fp3HO Y  0 ` P/"88  0 ` P /S"P8 @-M< @RP  LЍ 0pl>M L ;M -@"@-M< @;P  5Ѝ 0YlN L GM -@"0H- M@ Pp t P  qD Ѝ04 0.lihM L cM -@"rM SM O-dM{pʼR pʬpGP p P < Apy <Q |T3Ph"hh  cX@` 0 P PV( 0ppM H40,( (@ 0 $Ps h<@l P !P t(jQ 8Q Q Mp@-M,,Q P`@Ao ``` `#lQЍp@ Ѝ/H- 0R0ܐ+@-@.eEᠠbP /t(/ MH-M@Q P`pA?Q:lP!0QЍH Ѝ/ MH-M   ЍH Ѝ/@-Mh@P  0 p @Ѝؐ+Q @-@L㼞㶞p [p$2-(P R R MH-M    uЍH Ѝ/ MH-M    ueDЍH Ѝ/O-MpfV尦@ 9fPl@ Q! Luu`{`{`{`{v`{`{\vP gFP RPP?PZ ` gPV#Q  nP P&  #Q  XP 'P  HP &  9P p[0 PN tD尔娴PU`P fPq q  ^P `XP PpGPG U*L@JQ @pP cP bP  XUp*Y GP*U5pj    PjP UZ'@[XUfP X Pp ZpP P !d  6/ R{  @Y @PʝW  0pp32jPUPR ᇞP `( `W HL` !(   bV  0ȝ Q P n<p%ڸ qr `pЍ.x {d llc@ g<(t,}R Q0S R R 4)++O T T 'S B)}S jS S GS 0H-i@<< P/, 0x$ &:)S S T H-M 0 ^P  \R  D 0NP ,Ѝx(m ++~@-P@  t0< 4 S 0 p00S$0000R R R H-M( 0  PЍ耱(~"eP Qp0q#4 S $$0 Q 0! 00/R R R @-P P$   #Q\:0|\! 0  sS Q :00@0 \! S! R "U 6U R R H-P pS Q $$0 Q0 00R R R P  S\:$0$\! /R R R @-P@ q 0$SQ:$ R R R P H  #Q\:(0(\! /R R R P H  #Q\:(0(\! /R R R O-qMM`\\Wdp 0@  -cPd@P\T\\\\\\\\d\\8\\@0% 0AP aP" 0@@p@@ 0P BZo 0phFPU Pd P^Y dP Pu앟쥟``(cP  cP  cP P P P)HcPP(7   P 0  000 000P` P `Zt"P dZ'&P=U  `P_ `P  `PU `P pfcP acP \cPpVcP U @P(;P( {P `U .`P((`P( Ȁ{X P P (cP p P`  P    A  z(P @P`Pk( P(P@T`bpp$gPm'P+/]PPYP qQ r'Ppp( tQl aP X( YPy YPaP:a@P !PQܙPPU 4 0 0`qߍۍd9 @ < 7 p + 8 / \ W W +W Q0+4)#X zd@+edAV O W 9HX W +:"W t 0H-MP0@U , vQЍ0Z H-MPf 0 IZ :)G-P@pnQoQ PppP \@nQ`oQ ``P @lPb"K-MPPp@Ȑ`KaP aP p`VЍO-AMM `p@x$P ,$ (IQ $uTsTM $g زPP/P$ yPL 0 PI @P( PP? FȰ `p ;ȀZ 5PY  ,P PU  ` $$@P   0pOp $ $ h$ t$hUZN G/pᨠ@P   P $LP%%B 0M9B$L4BT2 ` H|P, 堄Pp@@ゾDW@`P -P =Q8PU pQ UPPppp`4 `嘣oS`0` S0!P w |CV`ppV j[ (p0pL @Pu $ P 姷[P- , 8y֗ TdP\[n( `PG ᮗP(PE` ᥗPUP(  㙗P[\X 8p P P!p@T $ P ][{@Aߍۍ ,QP@[P F.p f n/ l )Pۘ[ ( ec, ,pG0Pp[n BN @78X 5dP  -0S*dPB 0!㥘4X ;#;`@"` %` T` j` O-Mp,P( 尰尀`@ _oP 0P pDEQ A O Q04)# Q0` d] H-T` O:)~` 0H-P@P /P0$&0H" U^ n^ @^ H-0H-M@AP" 04 0p c O-M,(帠帰`@pP oP 0xP lphDQ @ A +ЍO # Q0b d] 4)H- 03:)c 0H-P@]P /P0$ᯱ0H諱 lU^ n^ @^ 0H-P@wA-M@ PA> )$0upt 0E@ D `L,<\PPc_ e e o] O-MPp @0^bx HLPg@Q!|,<Tt9P GP8||||MP' UPw| ||| 0Pc ||u ppPQD0Z  S S  Z`PY[` Rp' [<pY@tZ (Z PPn#$||Ѝ h de Q0c d] 4)+!H-^ ?:)e 0H-MP @ RQ pЍ0  06^ @-@ᏩP@Oy @-@8P@!@-M @Q QpЍ *^ 0H-P@P /P0$B0H> U^ n^ @^ 0H-P@ 0G-JMM 4P@00 0 0Hpa4@PpE^KPVP S QP0 P Y0 0p 2@E P!ʎ;8P 0<p 00 ; pTP Xگ<0 h@D L0\`dpl`pPt@TX P$@`p QJލڍ0 0w T+h j j j o] p@-@ CMP PP p@訰(P`\`pTȑ+ #O- Mp`H@0\H V뀶嘆否 q@P@A@7P|ĭp 8DTḏܱ 02P/ 3P6PI$D]@ IT( RG a58 yltp l,gPvN4P a@]Y 0[P P    @B P  P  @           "   $      p $ L <  ( 8  x @  n , d0 @rd$ tW, wK xB0P }pGQQ0`+4R 7 ЍT-(i P(Q0L(p0p @0 0 P Z妵 ,,ZH<Ͽ Bߍ {l A-MP@` p$Z XPh 2/R1QP5_U @4OZ@Z 0 mЍH+l l (0P0/O-Mp jP `@ p{P`DH @0@3/p@|ZP;p@WP ` p@y)0 @ 3/ qZ㋐r ^P P YR*$$0?Z<Ѝl l O-M@[ @-P p:6PPo pP0`P :Y d,@8  0TP T < ٫$Bt`p PT P p  P 0  p8  YL@ P @!0x CR D  0zp PQ 1 UP ,P YQ @~P+Tt Pyqp` hD U 000  Pߍ蠒+ m \+X+T+l O-M-M`p(PXT 0 ؚ݊@C 00000   g@QldXXXXX|<`XXXXp  0Py z@@ P , P ph  @ 9 0SPb@ ] @ 8 0SPZ@ SI P  p GQ$A+@  p, 0(<S00 p@ Ppp 0ЍЍ)<` 8dXL (4 $H (Q04)hn Q0n n n o Bo Io to ?(m d] un n H-iX d:)*p 0H-8MMA.NP$ 0 (0"p. @' P@#  (;P ((x0,`P ` ,(L00@8Ѝۍ0, n n n o n -o o ;o n 0H-P@0H--MX 0@k9P  (   HЍo o 0H-MP @, RQ pЍ0  0w^ @-@ТP@Oy @-@yP@!@-M @Q QpЍ M*^ 0H-P@1P /P0$ჩ0H @U^ n^ @^ O-LMP8 @H 0N  @C E$S4<CE(S8HD9ⲟ9揄, !2/!A4q"X3\cs2/3?6o7"X3\cs ??j y p r p k, p d$ 0p ]( X1X\ 13?1 Br4 01Ѐ  ŕ$5(u,e<Ͽ3?76o ń$5(u,e5@ 8p .< Hp 'D`H%L5Pu2/3?7H%L5PuT0TX0X\0\LЍ0H-@P  !!0A-P   P<Ͽ2/3?> $(1 0 0$(XXdpd012/3?7pI-P0 @ `/o>3?<Ͽ `0 !""D`6oD`#@`6o@`#H`6oH`L`L2/3?6oLX8<\L01`\XM`Mpp` N}}p0"S/"!03?0 R/O-M 0` 2/13?: 0 $0$(0 !(,/0! ,02/10 044 p 01?71p13?1 R\Q LpS tx\ 012/tx\ d 2/TpXP`0l@hd p 75_3?94O2/TpXP`0hl@p D!Z 95_7$P  13?1$5 R\Q5 0S  13?10 RPP$ 0?0PT T0pa6oa`@P`@VO@p W,C0ЍTU  +0 BR!q p/G-MM`RQ:@ +M T+ 0P BR!(q!(0P p!pT P/3?5_70P p!rP  P,r!_T_] ЍۍLABLK-M,(pQ@Ppp  &PG`3T Vl# 5_ PS . 0AQ p ЍLABL Q 0P #:r/ Q 0P #:r/O-MMؿp[/@xT巡P PP PPpGPPlllo ,8 Q`40,( hB@4Q ||||<||||||||L|||,||||||D|<h4|||px|L|@;PPc 6PP @P+ 2 10  0#DlO k8P `D` 10   0 <-@Q  $$/0{PP o v 10   0 80  *0l4 TL 80   0 c00  0 @OP OP q#[ @Q ᤞP T 10   0  10   0 0>@`@ Ἇ@lOP@x  0^ 0 < 00  0J O 80  ,0<`@  10   0*K@@:&PX/&PSPf PJ<Py/10 1@@(.  T zi, sNP' NPe !  !  0 T X L Mi( F`  Ap8 @x P P D XUZ%#pP[otQQxB AG@P T@P UHH,H<+T '@   x00[?Lp+X zQQp& P\P T+| KP pp W,jp`T @ pt "Dz .Pz? J p$ zᖆppxPt @#@z *P;KPJzpᗆpm*l j ?LP@@[ot   zp PxpTf) ?xL|)@Pt@x$ P )P*   0kY$p64P$pBDI8Y$ R!Q ʨP~`, zPp}yP+pP*+pR j  P" P$i 1!#$p '$@qp Z0$Pl, p$ D[LP ɬPt pPH `q!'P  0P"$@V U   .`Vp V &po+ QʌPtfP  RL+P  Q(*fPPP[oQ,P VP &0٢Q 0Q 3,80(  @w W y P BP @p1W (+)r (r ,+-r Qr Q%0Bd$dރ܃ڃ姄%0 Tp txB@ [?jpPP,%B d0$@{ȀB_<`S tp- pLPZ P P)  $p! P< pP ;p0B/pP:PI@4B/XQ0  s y +x +T(+1y D+x @d  PT*[`Y p, KPrG @  LPm  LPh [`Fy pPV聟ܱPp [oPBt ?R   Jpd4"4++"$"0QSQ% @PP+z   k똳(!Oy $+8+ gP  0QQ[oXQ <$!@1H!0E[oy [oPu  0 H+r (:)r 4+% "<+%(+)r ,+Q0+qs +s B)G{ t P+cs Ms $++d] C!ͪ#"s 6s +s L+(H+6{ wy (+D+++&$+Rx @+r (8+0+4) t s X+X+p ffsۂt t p t t t Zt Ht u ku u u 1v uv v v v 3x"\+v v |X u u Pu t 2t t s A-P@2O T0xht @0p XX`P`P pPW ,+:)| Q| {| | p O-$MpO``   P@p0S$ P| PaSKC P0kC P0P PBS GSPbS gS x0Z(P` \  ` b R40rbpSjQ72VPNZƟQVQ"P) ()% @P W P%  p@nH0L S P  p`0]$Ѝ\ 0@ 0 <p@0p`0  0W{ v{ { 4+{ { O-M-]MMԠԠ1ᡂ P@ P< TU SA`@0: P`P P`pC 0p: P P`p ㅂ၂0 D: pp# Wp"  ikP @/M _P &M +P Px0 <0o (5,%(,D D R$, $ P @P  P @Z B0 4  P @4A } P @4D QqX P @0 Q*f, P @0Ql([ P @04 Q@P P ,`@TD ! / P*0\PB\C0\@PXP6U XQ`XN;͆PP$0 4@BN_ȟpbnRHpLP@0pS0P^T0QTR@P`@80pS0 P` D1P9 `4  (08Pp8 hpφW @ T t威 dQЀY48R T?QYQQP0Xd@Q4!U:8 P `4@8T<4 p01:3U?F;)\5<0@@D00@x@|pQ$P0LEPEXt 0\)$x !婡 H@Q1tpB?p G 0A0E HP? F !Mp@4!G0Ep/(50$u 噚z"@0S @!1R\Pu DP x@8P@G8<pPo!xpT@8P 2!0 0aq# 0Q0#Q0Sr8< #pPo 0F? A@pQ`1>: P PPP*!1FPP! !Q :APGPܑ` 0A.pN$!p!P 1!a1Q``@ 0`<Y0 P?QYQ?@0AQ0`@0p0S Fp0B0a91QpP!a!! 0`9PpWp#Xp1G 0F!0B@1FDᡞ@/X0^ 09a@/.!PV`0PT3_>QQ10Q0U@A!`? Ep 0p90a@ V㸀!` 1ؑT/ a!R, ,+8+P+@+\+d+h+p+(l+ +((| 4+| ++| ؑa Q @Pp$ x帀@8d<`P0MF GH ˌ0FP8p`Vß@p T%_`?.P>$U1!!0U08!L 0 0R,p0| p 4 r? 0:  _Бp 4I?@ so H44p0o0 /LP0@%X\V Qph? ~  P\% R\%R`d~ !} M} {} } } +UUUU3333+(+ ~ ~0: P`P P`p@J P  0P P`op HPDPl`F r0FTP R&0 댏`H pJP&E@T`VA P !1L%H +0`'$~ x Te~ >@ 딇Q L+0 P LEH +0j@PV.}AP f@ PJ #HBP%xYP , 0A'"\u W A0 0d/ 0`p130 P/0QpSp0_ ,Pz/K}#QPP\  P0R0CP0R1,@,@DTl @`XA0p@8<$Ϡᔆ P0QP\PZ! @Va dJ\j ~ L+4 `@L, Z !/@ ZJjiX Pf pz}GE h [$Q`0pP tx R !x H+ PJ,@P TX\`/$%R0Q@h$l` R/dPXT P  Pk P P P` <$P plQ>d&C4-QTT! !-QPeXPeV d! ! !C@pB!!G CB$N n8P Z:L^  0R NN^Q n4 (n|~4 d0P.4wE0P  UZ >4P   0x 0S0# !T P`\uWl`$+^F~  ++P\X @Tq/7"\5 S A0 dp0 g`6P0   pW0QSQ aP\PK`x 82RAPC@ 0p@ A尜DL`plP`PD !LlZ?#\Q @0`d0 80 0h93H A XaAQ 0SApTP尫Aa[ꐗ+d唫AP@ aPT@TK."DT@@CW q a<{T[?&#\uW Pp 0pd ? p``2w0 P`S0Q !`00@P`+PaP ,  PP% ټ@`,V:T ϼ PQ \D  R P _E EP: _I` :0+ _A Ey8y0 l dR 07E\@!U04@0vPLj @D5Lp0? dL :)ht@ny@`AL y_q10q/l0q|E0q p`GE04 0 , ( `U!p`43@P@$ d0@ŒDuL c`p4d 0STQ1{SpqP4 <  0`p 06S`V`pp hP@a  x U x0- AF0q Q0 ,Pp@X  ` @ PTP` <X  2/X v4  ݀ 0 XPq#P|QXp  \`@ UOFKEC\\%R/0 QO?d`\TXP 9t0}(qPLo @DeL / zxx dLA!QAqݯ4 0 , ( 0 1 qa  t 00CAq @DUL / !>xp w @l أd0 c4 0SSQ <O  0aȁCAspP@P PP40Q ?. ?{0p4 嬂@A*P`V.;VDVBP PP\(` PJ kB ?= 0AP 4 0AdpHd4 L g6P pWSQz0PP 4 0Tq4 daDfw4aw(KЍn Ǻ0S&%( ݸd+ڸ딳('׸ոh+q͸˸ɸǸŸø㿸㽸㻸 㹸8+,+@+\+d+h+((+Tt+x+|+++$++++0+iO"!o  ((<+8  x p@-M@P`P   0tPt!"$! PЍpBL, 0G$i8+,+@+\+p+Q M-MMԠԠ@`PSTQ LpW@@! 04#'p( P. P;T P*06 q`V 7Q  QW@_l>\ F0KMq*0hK8++d++@+P++q H-M@`P P "A!p_'"$" GP A峜T 0᮹"з(( !0Ѝ,+8+@+\+l++ `0S   $ @ 0/PP >B1 B/0 //:) p@-`t[@P\@TPC/EBp +(O-ME0d` p f7P `VSQgP 9倵 QMQN QG DT% 0P S` `` o b9B RUrQUQR  0 L `@1 .Ha@aV&`aV Q妹d\8 _Y0<LHQP Ѝ S`R  ( D `  0wH!0H 0`C`$P!0lp.0Hp`@(0@#0P@  ?  0 PLdp g?9 pWSQ'; QTT! B! QPuXPuW&d  R  b9 Q?S:먠 M  0 H? ᄡ: !?:A0 P9 4{@8.0 H  8 A ? $ $8A4  4 `8P `?@>p T`@`A~0o B0"  l `8 P`P  8`d@ p d7` `T0QS_d+h+0+U :) t+( J t O- M\T`0dP p e7@ PUSQDP sP Q OP Ao" 0R\ 0C 0!.0P 0dP p e7@ PUSQ@0$Q $A,X: 0bP @ث 0`-?ᐛ#"2++\%R !`0Ϡ|' r! xH:0 dp`@P 0d `T036QPVS `g0f WQ0S NAU/F+\Q%x 0p-SQE `z(1!2/pG w( X q13?A qX0/x 0 @[-TQ% @p`p H!p`Z`p@;!p@W   i7l,a78@P0 0 ЍO;մ Ӵd+h+0+U 4+t+ T+p@-t`P@P 77@P 0Ppp蔳(0+G- MPpR `Z@P< 8@, GqP `Py  sp[ (`<ND 8 0`` $(峊`0= qx ,rl (r` $rT  r`P `Y< , rp6 rp3 u=rp( 0( pW *⨠W  0 ?>P 80 r*PP   ݍ0 vd@ 2edAzd@K-8MM8 ;PpP,`p @0 P?pqW `2! 8Ѝۍ0H-P@^P /P0$ᰏ0H謏 mU^ n^ @^ O-M(`,@P 0+V` 0p+P @h`0P " Z P`pUЍA-M`p@<(,0'P\(P\pP 0Prp]0 Xpp!0,0?P(P 048<p@ЍF^^F :O-M@p 0P `R p   } w p@A@Ѝp@-P@`(( XU 0Xp0H- @0PP* S30 S * S0(( P,$0 U0O-MMP, ,j,@q $ ỤYPeP=f@QU/ 03 03 1 03 03 03 D1 0  +0rRP1D @ R0 03 D/ 03 03 1 03 03 03 03 1 l1  l)Qp R  R ZP] bP+0\>SPT VP 0Np0sPU vPdPP 09<< 00(c 0& 0i e p]hX$T,0p@F D 1&88p 6p.(`Eq&P#9;f4;X f ,pP T pW np"'D |P& ;fPJYpp @ &pOpp8 fPe np_ P P,@ u 036P@@th l @D 0#6@P@tP(P @D.P*  0Xz*$倄PzPh Q,R /\@6`PV6Ve0P64} # p, {R  h0`P!5@LPPL RF6VB( pL| +zHP0 P`UlkMȰ  P{ᐴPrJ p6P 6P I @YTbfA0n5  / mz Z mʰ4pላP< j@ b%dP  0p匲V W  m`V_pIᑍ.8aT?  ppL(!PpP (P @D 5V$ P P  0| 0ꤗ+ Q0+ t +s +z з(y +"+x +&$Rx +r %ȷ(+̷(݄ 4)+8"΁ t t t t t Ht u ku u u u Pu t 2t t O-M?:`` 8 @P@Q 0SU0aQ JQ 0KQ 0MQ SQ jQ 0kQ 0mQ sQ0pBQ GQ 0bQ gQ0`pP p`:"P 0''1`0'#Qw "0'  P 8p<0 W ЍH 0 0i$$  W{ v{ { { { @-9 44@C( 0\㧯:). | O-iMPP@mϟpo  G"1  "" ? @P",R*?`0F|?0V:@'T  W W O@尐TY R0@ C ! OPG oo g & f f   ! Rv$PVCo  `@wP WPӵ4< W $R,f f2! `VS&Q W01@( 4@d X X4$PY 4`40,0PDP U:T P QR !bPQR` ( @P, *$]4$Y4`,`($ @P@L4/M0C0 (ࢂ0 0`fR `$`8< dPN\ fbX(@DPHL \` $(0,04<pp?ml  T@<%<PGh@CPU +PB*x LY\`\ P0' 70@PV Kp` Y  d V:VK  0Q RS 1c!QRSTK\ 0 0 0 P30, VPE0V A0p 0`0V1 Lp㸟O pPh(d_`P!:!&{0;qa P8د 0 (@0"*ϯ $O0 : PUP 70@P rRp.0 n Pp GR pW  P@GP ,.    ^ ,P4 +l QPP PR00CP0xR0$2$TmT. X@Pp((,PLPd +㺵 oRp/ &#0/   0+'2,l6%A0sv |6@ P  P+" AR*1p71 @ `6p 'P`P:P `PX:P U:k 00 4(p =6VE 46[  P0   0 "6(P P$P pᗐ$$pdW:0 & 0(PU: P00@,P[j LPdK$P'\ Pb$PUZ.UEUPPR[8:[_ P1 Q R. !b P Q RN0@,P: 9U  dPP(` P!  T P^[:[ P Q R !b P Q R$ P[@U PLP \ {5jP rjV %"e%aq' 'd  `l(4miW5P\ gFv{P$ 0@uP  VGU $:5<U*0 UP*  6 d$S( ,p&:wP U Q:QP YX h PYXRM* @ tfQ 0PR*A4, 0v < (PGU0<*!!U:LD&^ꜗ+3333UUUUě++++ @5q0 ;003S ;B0#V@0%P %P@0@~,AU1P\ ȷ(̷(ț+++ 0p'U*$A4 Y$P  0Q  0ALP ``PFp{4 㰦'`i V `#P p l h dhi&ẗ" | $P V0P :@,pPFP PUCУ& 07V㴰$:,pF ` PV134  u-  0 ᴰX pⴰfHз(QS+` 0?04LpP`JPA\Vji @`Pd`plhh |GPPr &X2@` 0 Eob@U+-&0#- 00%A0hiߍ_+!     ; 8  0  0 8p   Ԑܐ ꜗ+V +~ +* e ț++φ +! ^ +++Ԋ  :)ht@+o iO"! D  ވ Q (Ї (ط(* x օ @-L(ƞP d Q:Q0 @S RT 0Ad!SRT\  ț+H-MP`PTp`H%G!  )PЍ b먗++ě+_  G-M@LPN TL8QpW,appP /`V5P P+02 q`V 7Q  QWLk/\ D0ۍG.+0ۍ託+,ț+++++l H-MPLp`@%G!  ᭐PЍ 묗++ ˇ G-`p e2W @ ` pP @  +PUB@D`Rq@ + ț++G-x`0FQR vWO:]PK P 0@  T 0Q0 pW S Q @p0 pW`! 70fF&0᫅0 A0 @ `  Dț+ ^#O-MlpVP} ` W%:( -@0Qx  0+u06&000A@`(`WO*@WP 0 p&!&T $&0f? #0(  h0" XQ S 0$&? LP5Q0ᒀ$ * P ((&d 0DЍO hT PH D4  00 ț+ ; ̷( ˉ G- MPpR `@P< @, dP `Py  hfp[ (`<ND 8 0`` $(~`00 Lex ~el ze` veT re`P Bu`Y< , +fp6 %fp3 0ep( 0( pW *⨠ZW  0 1P ኡ0 r*PP  Z ݍ0 vd@ 2edAzd@K-8MM8 ;PpP~`p @0 P?pbdW `2! 8ЍۍO-MMAn@PhJP Q7G@ Qg@ P1d De De De e Xe e De De Xe De De ,e d De De De e Xe e De De Xe De De ,e 'a 'k 'fkЍ 0u j H-@`pPf/ P  V  0j H-9/ XX@ǧL 0~00E#a00~#20~`Pp#<0$0`僠\0tጠP04pp0H0orl0G0ppp03pp080~pp100pn00pp`pX0 0e~p(@dpXp00< P00R<! Lp1 @UPT   P*V [aAi/K  p`p 0PP"&  `P 0AP& `p bP0 p[@e(QmP @ 젍P QZ rPPV ` Pp pFoR)Pv M)Pq  P@TPV젝q0(Q  @oow A 0  0%0($sU @$)P! D@TI@@P쿟`<8|0(,D,@ `T  "! 0@D  T, $  < ( V 8 @@`RQ08100<,|(PP /#P@0S  000A B0SR @A@ᶼT`Q P <P8P Q@NaQ:`PxPP`?pLP젍 tPeP r>lp d(G,w0gP n ap `/ [PT5 T@7*<?W?p#PW :x 6h 2X .H *8 @)$ :$ $*P[P000 Y< {<QuPsPqC   TpKp I @ eP P XPR ^A ZXPN8PXPI Q6@P AK( (@@ 8  P2 HPv  Q8! Q/GP- 8 PDfh T+SD^( V, `RMb@A{Gz???eAGQW7,  0PPZP H'z8![ZppZp PPLLg@@pq8P @   W!DppZF0SXf   W &Jf0 vD0g"Q"\P ؿFȕp  D0 jXpX;U D0 ZXp+ D0 KXp D0 0M(0   ,Ӣ Q0 H-1" ,:) H-DQ 8Q ,!(( R -@-$ -,H- Upأ-) O-M-Mfv @% $=; < #P!qE 0 VpLt 0< PTpL @ב0 PUp3U< $  D  1DP@#0H头<` R D0p0PpW d4!(q!( #H4  A<$0@  0qTP Pu 0Kszz C ,3`Sp 's  `ß `P pPdXs`P4 ZX 0B:   A 0A Z@   ? {A Z A pB `  Pdڨ2 ]  PptBp- Xtur $` PXH P  Z H A*  0I Jl| L%@ q  * P| x1PB$`##p3p@ A81BPp@  \  R 0Ap `D0g"Q"\P ЍЍPD)eA---,-,p,, ʡ Mb,ģ-,H, p, :)-- -0-Ȭ-(,--ɚ;6e5wK,--@=B'O-M-8MNTϛ@ k ˟   A 08˟I۟帍席]`sT@ M  A  0@:Q3@˵0  P8  A B* 0 @Pt M P  A B* 0@INH˴LN   1H @M  ~P  A B*  0@8H˴LN@ bRp  ( *RPUx<D.T |B|tRtlbQ `ݒP PHՒ @ w(+   +Sɒ ㍒Qh r,(b  * R + Z;K1+ B+4QR+ ; ;#K!|K$+S K핒6 (  0PwpWBAi$b l  3P xX0 V! P HX0 88 0M J  P hP X0  04H'ƴ <-' " --D-Q0((ȥ @ 8- (-$(,- (--$-t --@-: R 4)t :)H-X ,(4-X  P-c z "\ / J  0H-@XX PH < 0 $ r:)  d  O-MM/?@@`,, l`ll|<M∯\x``T奝@PP P LL7 @@  P ,P NQ/P5=ꈰ븎n~P  @ᢍ (  f  Q P@P<@P Q Q @̌Q-  ` -͎@0 @@ 0Gp%P,0]u u u h D` L < < 0  PP  ,@  P L喩a@Q?⌌ D  l D D D D D D D D  X D t D D @i Pb&P# % @ 嘰P x#   0 물 ꐋ?PY DPoP? ܍Pf[P} F@/, ̍PV(& P] ⺌@ ᶍP@}PN ᦌPt ᢍP,w  P H @@ ፍP * :$(,048<t th,a@ ]PV P: P P @1, d PP% @ P P @ `P `P Pp `P$ @(0P PK o ``\PXPLPt @1 0PP DPQP 0LP PX^0\ P  ϋ +  >`Pj P@@ ḌPBPD  嫋@  0@ ᠌P* P ᔌPVP% |0 @@D ဌP @ (uPe  k0 r` 2 |0 sM ` @PP @80 siP` 됕xV[ 4  OV` @H!A0 p @`  P RP ^ Q  3R V`1RH Y 0:/ooBRHP TL0x`% $#t |P@R QC 4Q0 Q   ?  d e 0@pQ QT@l@hPyppdhPn 㘷  @們Q p 半 d |P AQ  QD PB   Q4P AQ  Q/ P-   tP$* l` PP*l@AP @PѸ ڰPὊ@ThX 崊届 d[x弱夀P @ P:@D c zd`=  p` P @`)Ѝۍ聫 3x" в-0-г-Գ-:) Ȳ--l!P" " T -Z n O F &$-# 5 Q!  [ -o I"" \ Ŭ !ب  N ˪ u O & ҩ n 2 ;${! # ޲#4-$(X K-P_ P" `p匐@QQ Q  0B01F P 0p0  pL---س-0H-P @P hQ\ 0 B 1 <QP @ P0---G-`P P  \P /P../ pPP* p Q 0/S/Q Q P/R@P5 I@ P  B0QS/SpDr0.SA`pPp`FQ @P@ET@EPP/Q@@Ep@ Q   0#8V롆".:)  H-<iP0P$Y"PB㸘,-Գ-˫ в-A-@ R R P䀟`!R"R'Rp?o2QQ QQo2pS ᧈR R R  \RpQ  " 0:)P - A-@ 0P h pW \\!?0`V`p`p 0`pW!@ R  A0 % P *  ^ R$ @ H P $ P H P ` P h P @ P p q P / = #44( @%- B)--:)  H-MpP B` 0 d@P P P0QLX18< X0pV`Ѝ谲- (-ˬ :){ Ь K-pMll`@B 0 &P8iP0PA $吐P! d`PIY  0n .P*  Xⵇ$! P p  P  0 P  0 PYIT@pЍ (-,--$( -:)ڬ @-\\0 B@0 1 D P  R T@谲- (O-MQP  X0 P# @P pt X0dQd`pA 1 0"  @WP5:쀟@PXp P# `E 0P   PW  `$`VP@U:Ѝ-:)  ----$ -O- MPBa @6PT F `P7pVPpp 9 `P PP P`PV W  P  X⦆P@0  P P PU p < < $HP$H 0yW ] QDP nK `V  TZdU  TpP $PX $C(ppp X pP Bw0" p !d"X W> L  0< @ZpPu BP/ 0 ۅpf{ 8 0 @Z@=|pM@ZpPB 5 0 @pP1 F$ + 0`$ @ 0 @9\pP  \8 (0 X0r Ѝ谲-0 -:)H - - |NIL -έ l y |INOFNDJ 0H-@P |0x   `0\   D $0( 0H-|NIL|ONTAPE|INOFND  O-MP  X0j뀑P0:dpp@PXp}PQP@U: E 1 `V P P  9 `@T" `圀堐XP pW PP  P  Ȅ p$@TЍ-:)e --- - H-P  X0 P@T `p P $p$J `@TV4@T (P$@T-:) -֮ O-M  RRP  X0" P  X0 W D븁就P` R]*唑唡lp1P` U *@P  0G  7 %0&  @P *  " 0 PP 40 R:Ѝ,--:) 0- -X-' 7 N o O-MP  X0,Ԣ `PPp@`P pP P:8DR0  P *`byY:eS*P* P e R0  RKa T *P  PwU@ T$(P:P f- Q4@ `.Cp Ps` @   0p P v*Ѝ-:) X--0-0 7 G-MMP @8P ,, X0] @TP  X0 GȠP':P ^P `pV  .j@T@ `PU:Ѝۍ-:) ů -A-P  X0딀P8`@PP p RFP pWP@U:-:)Я - H-P`pZP @o"@/o"PPoR T 0RP P ,t  dP . :) O-cM@P  X0t$0``c rPT S0#?p 嗐딓P T @0x#0 rPTD1 @C0@#p tP s AP/ $  PuJ(8 ТZ`PI@/0`2x0aS0-  $ (,p(A@pp 8 0<,QDp4 p]ύJ` X8h̡刑HAQPF! 0P [eP P2@ PH  P P6Pc pP ΐP PcߍcߍOHX`XT$ H0 i-:)G -<-.(f ,-s -.(ư ԰ - X- -H (-<  $\ $- -(-- .( O-CM@(PP& UP`p㰐Y AP y gp py@T:]U[ ptXp `P 0<PP P `X:P*P  0 P  0 0SP lᵀP Z [:P Cߍ-p---:)γ H-$ 0S  P/-.(p@-P@`  P ll l0 a P  ``4)`p -$--(-.(H-M<wP,0 $0 $M}g <- :)ʹ @-H@:p `  UP p@`:Ѐ.(@-$@   PX-O- MM`@P/0 [ !  0 01/ Ѝۍ0 01/P ! @0vS댁P epP dFP TT pW 06P  rp` 0W @`尠0 P   +ܼ0 0} D`p 0|@`W(-I"-":)9  a p@-M@P 0`b@P `Fv\\ lP ?M  +9Ѝp:)$ O-MP `4,㰠Q +9P+Q!R 0KS p@TP T:P |  pP T  pP 8 0XpЍ3x"--:) O- MM@EfD/Q 8VpPC @P? `P/0젟 !EP. # "  G-PqP pU P cpP  PwVP @(0/Pp Ѝۍ3x"Mb(--H-P /0`@HHqW !  p@@@ (-@-@9@XO-Mp P  X0& rP#@0#0#P 0)e~먓P `K90 P` }@`@( p`@  xPU T TXxPRP@`@0T 1X@  z}@ $txPiPZO P@G $ TP@Z 0P4p lP 8h 8x0ST ! 0} $02   ۍ ؍P h0t x nt 80` }@v &u$ 0 TWЍ_ @} }) 0ЍOͿ|\utXDtP P 0᾿< 0-:) ,--<-.(ư  - Ͳ ߲ 4-(-A V 8-5)" m x C - K-MMP@`/0pP # "  0Pp ,7p(tA 8@PTD` Tp{ 7p# P l7p) KT77 @|~?_ |Ѝۍp P@|j+_l PTpL P@|[_ (|;z(-o -(-X- :) ij p@-/0@P`o8P # " `Vp(-@-4 T#P D@ 0sar8,#P@ 0ha@f8.(.(p@-`@ dPV*P ?2<P # " $@p踲---p@-P` U: 0 ? 0P  " , $P 0@0#@$0$0$  p 0p@긲- -- G-M@PP-:P ?qW!   $p P@`@`TV/VPW hP pV pWPۍ踲---O-MP0p`Р L@DZ: 0P " $U /dP$ T &Ѝ----3 O-Mq(@PT̡@P`P @@(@V($@@`Q(@A$(8 ]P `/ q ` @$ >  P  2( #P!: ?P " $ PPh @ \0@ ZЍ-H-J ---l A-/@/P PpPP `P PP O-MPt o딀 q`P O@Phc  BT0aP@U ЍO4b. -H-8 H-`@p V: 09| ?hh`1Q$0A$@T @P! $@T踲- ---- p@-@P P P  P ` PPU U PUP` R P{P400 P@$ p豵 ĵ  -- R /R  R/T< @-@ @-p@-@P`P>V  ` @/`PXP `|uxo p -O-tM@4PP $$ X0KPtЍP zP v7\ yL@P` @`GP p 0 @p@WPP`[*P9 @H  #P( p ||||HQ dQ\ `   Q 0h$Ql(ۻpWX@ T *P@,` Pq ``D@ 0QDᴻ`V `@ 0p@@ pp @0 08p噻@ [ (T@yL tЍO蜈-:)S (-m n ---@--P- G-MPdP XX X0kU[  3`p ʙZ[  yo5p ʉJ[ x_x0@ $Q@PU ᠀i3PJ0 c3p g([ D\xT=Pn3@RQ* rQ=4" `!P `8 Po0n  0nPP 0Ѝ1tt!`PQ`PHLP p 88` P 0C(AR`PqW qqq R( R*0`pS1100aS110 0aS11 0$0ppS11`$0( P0 㜺u-:)ն n , 6 X ij ,-X--P-- ׷ --- "0H-P(@(]ZP P@0Ф ] H-@!0S Kaq:p P P@2P tugPxPAZ P0wtxP lP\H1_h)Z44 0w-@--Ȳ-:)-,[S9 ] 4"--p@-dP@`@QpP`P "RLP @p$$ 0&u<(@--:)q G-M P  X0 DP  ypY0\#P  S刓嘣 00+|P0 `%`V Q %1 P "% P XJwB PbŸ"0Pp0CA00G0LP 0& zP d"pk0 <`rR pp1  R8"BP$tP } R ` 2p4ڈ  B? P B2 P2AP P t!( XvJaP"A|PЍ R13QY 00!p0=X Lv dd00{pv0 t-:) ---@(0-@----K k - 6 ----Ҹ -TI,-P--"D(  -A b --- #H-MP" QQ @P ЍHtt U2pX <LMvЍ$$ 0)㓸s0-((-:) -@(m O- O `  O-$MM"R匂P|Bb吒尠$p P *P #3"#AP+7 p8 H9 7 P9 d9  P eP Q [P #3"#t p 0sH d L,4P04T< X 0 \ `p$ "0尲hPP(pDP@ H L0  ``@ H,P R@ r$ЍۍX- -T --:)U - < O- MQ@̱( P ! Q  딡PP Gxx` =K 0`  PP pP Q:pCAW k Q*QW P 8PP  0@!0 $ dP D.P0 Ѝ谮-X-ž Tھ --  - O-,MMP t0x&00PPP D H`PP (P<<@(P rP`VY PP H% 0QepP  0PF: *p0 \ 0q, *pP U K(%5q( 0  0Q $K ( Q PNPP`\VF > q|* 0ll$q+ J ,< 㮋P. ( P tXP@P  c  ,p#uqDP PR n,#,ЍۍP`TT(P' 44 S4$s( p!`"pc@ p'`$p( $4 p@3q, -qP $", X"q 0jLq@B` #0 0Q a0 Xq(P%tPPW (P  PP(@PEUʐ[Ps x 㻀`U! V0pG V@Q  1T0Ѱ pT`G(@n`FVʴP``(@a`FVʧ- --0--,-X-:) 0"  & D Y Ȳ-ֺ  - -@(@--g -P- --Ȼ !P^-- A P @ P/AQ y +@(-H-h``PP QLLP o@ @0@P@P0 2X--m } - -O- M3p R cģCȓPXQ0 U0SWluP 5 P *P [Xڗ# R [ P 0 E[P[} Pl  pGWt"P{Bx px0$pP P P\ DHP o ,, o$ 0P5 Pj  RP B P ZU? pK [(lP 0 ݱP-lqPP<0p RPA P 5 ro+ +% 0  Ѝ  t%+ Ql Gol---@--@(--:)T -q X- -  -0- --O-M4@P,P0p $(`LPP<8H`@0P@ @(p 0, 0D*pP A  Py`@ J 4I J J J 4I J 0K J $M J ,N (P d XnP9PP * Z?*pK  ))ZI @   0 @x>PP D Xn<P(P *h)p:  ))ZU P@   0@ PDH 0'P LP  ,P   XknP :*P-(pԴP@P 1/T  `#) p") D@$rZ 0P 8[  (2/P pDXP`)0 npW`P @SP (8(P @ 0@C |8x# PP @P )@ `PU }8}  ((Z 0{Pr p 00P $ XmL `PP  Xm ЍOE`P=  Xm7O0|& P }8}dPD tt Up@8O0<O0 Zm `Ѝ/('( vU T}8Q}pP tp@ 0(X--:) D-(--$---(\ TW \ ѽ 8-~'" $\ F "X#_ --V W 9# $( ߼ ļ   4X-$\ pC-M`@ P *P OGAPhUP @PP L PPH؀P 040  PlЍpx-t-|-4 X-h :)O-,MMD A "Ph`pAU`lhQ \XTP A" PA 0" XP`P P 9 QHQ  A(2/A PXQ&Q  A(2/A q A"@9/A"@9/A  pAA P0 pAA APPPA 0" `PV },Q  A(2/A"9/@Q Q  hkQ Q  EPRPA P P< P P 0kPP!PPy P P`gQ8j@P!0n{P ,Ѝۍ갮-ž Tھ --D(- :)-X- E H-MT  P< ЍHS, 0(0P rkh--X- :)H-L`@HPpW0p$ pt-x- |-H-0P JkhX-- :)O-EMس@P P  X6kT 8c@XpP PPp 0 P @0@!4kX X' X 0B  B  0 L&"$ 0B  B  0 6&" 0B  B  0 &<"p 8P ,jP  ڄP  ԄP P  0 Y:XX X# X[ /8!!X% X- XL  8L!+  7!  7 pP   7   7 ptP 0| Y UjP X .DEߍ>-:)߽ G0( D 3 $ -U e x  !/p@-MP@P  0|3/xPl $p ЍpL@P`]L< 4 0` jxg$---(--X- :)p@-M@P  03/P x 0p ЍpL@P`f'L< 4 0`iBg$---(--X- :)H-4P4`4@pPP p谮-X-$\ MH-M(   JЍH Ѝ/:)Yui(qFqj)s8sr0H-MQ  13?  Q 1 Q <R 040,@P0|iЍ0p-IX- :)K-M/@/fP Pp/P Pp/`P\ 0`PЍ0H-PP NN@P%p `P TT X0H-i0@oK0  0Hi (--:)  0H-M@  h  PUPb,bۍ0y -0H-@  Ph h hP  h P  hP  h$P p h0d\` S h Lh<<0H:)   / = ? -R p@-MP@ P`P ``PPP8,@, ,0 `Ѝp - 0H-MP@P)#p \P PP X0Ѝ0H`hJ$ ( 0VhЍ0(--:) @-@P Q P K G@tPm#p XP LL X@(hmJ0 $ @h" 9 (--:)Y  @-@P  @pP#p TP HH X@gy:J0  @gi (--:)  H-M`@PR P"pYJ"VP"pڐpP x0x| V X0Pg@ 5I,, 0 gpЍ (- :)-  ' MH-Md   *HP<P ЍH Ѝ/ Pod:) -# 0H-PP 0@"p T@P DD X^gI0  Tg0(--:)T , @-@P O K@pP!p TP HH X@,gqI0  @!gh (--:) p@-X`@PU *PQP@ p踲-0H-PP@:hPQPU@u: @P00H-@P ;   2  )   t  P P@  , 0-|NIL ( 8 |NEW|KEEH 0H-@PPPDD f0  @0P 1갲-:)h A-@Ȁp` tf AQ  vpP U  AQ  v P   nU yU:)Ȳ-G-MP40`p@.PP/P << 0~$   0p`$fX1 0 k 0 b  f  f  f  el  teT  `e ?@Ѝ88-. ! b" A-MbP x pP d \\cP (:8P P| P@@0P Q !0  qpWcJpp_Q-Q\0Q0!|p ZqP?UBJp* Q%  r  * 0"!p@PLZ ` @ P  0!PJP * 0``!@ 0`  0` PЍH>bDN@4A-tp --!j B)i ` -@- #S 8 H-/ A-BM@< P`0  Bߍ -H-PL@`pc ]p\WHR-@-$@P -! H- Mp P0@\X PP ` 0   p  gP Xo   P`qE@-P*   P @PH @P\ \\- XIP2 @P$ 00--<`FP@:Pa0@3S) `@BK{ | | { | { z | $| <| | T| z { { d| || | | | | | | | | z | | } $} @} L} z X} z z d} z | z } | | | | | } } } | | } `R 0A@@ S3${ $~ $~ $~ $~ $~ $~ } $~ } } $~ } $~ ~  @< 0@K@< 0@K@ 0@K Q Q  @w s p@R < 0@R  0@R  0  @R  0 @R}  0 }HD 00 +  7@Rc  0 c X $@RS  S   | ",)      , @@ 0@ 8@  @ (@ @@xhP`0PPp |xS`   P9!X  aQ QP 7o/oP" Wt`Q pp@p aT gT cT\'  p(P ` p7  (@AP @R p pQx `xp@@P@ P PD  @ P@@  P P( @ P@@  (P P(t , @ P@@  P P, 4 @ P@@  u\P LP4  0 @ P@@  \P P0T`K`Q PP $`@P`XX X `hp@P_ p7P `P 7P P  P`L\\BT93PP 9p@PP2p@P- <P R' $0 0` `QV1AV0v QV  `T --p@gPD P@P2P " 0>_P  8_V3$DP TU 7U U--$ a_ ^L H ------4)- B4 _ :$:(:,:0:4:8:x4"-b`^--------"-!-v" #j --P-----(X--v :)P " < / 2 &"*"6 & ͢  S t#0H-0P@P PPP0P(O-4Mp`P@P,P!,0 $"00 (P PPPP倛p0P 4P P00 np0<P 0P `^0pPp UX*` P, R  PyPP `V::x  Ipk7P ,Q>8  PP M ^0@P  ^@99P 7P P|@t7p4ЍLX 㭌-- ~-  ---y 6"P " < / 2 O-\MM@`P QH 0@<$\ЍۍO]]]@P} t t t t t t t t t t t ( t 0]#\PztX`d~](\s z 8q]  z x5 8`]!p4,0,#W W\P oHzX  G]Q, Q-)"<]"\Pz0X\Ѝۍ']dAPč   L \ ]W]T] ] ] Q\ЍۍO68j@Q:g@P189 :0T;p<`=Pp`P\%8;=E4@APBpC`D9 :0<>?($ `pPP4\jP8 @0\ \ЍۍO}\\\ P\ - 8, `  :)   4 , '   ^ ;  $ Q ! O-DMMQ `XP\L"@Py4rX `@P`XX  ] 5 R00pRpa0ypCppSp` RQqA aV= ZX Y Y*C^hX qQ4^0 .pA~hXu pP  .0B 0 .A \ ZP@`@P`XX X &]X.DЍۍ :)-O -F"O-Mp@`V` ` GP  4 T < T T T D W W` ``P; V? "VA  Pp 0`B V0 a0BSWBA0BS7B0R00S`P X 4 @ L , ( ( "Pp p P@ P:0WW``- #Y( Y / P1 W/`P p!`Wx 0`Zp @`Ѝp 0  zЍOC/`P WP Ὓp.P Y>?P  x ]`P9`W  ?( ᵉ-(-T-B 3 p@-@`P R!P0U e1 E opㄉ ဉ-P -B H-XP0000 P<P<P<P<3?0> 0ASR   7S86S80 S :S40 S44 0< 0-0H-P@U U ?\ DX 0KZ0  DZX0H~ :)O-dM 4"p(0P$8,$<0 0p#p<P{ /P~ $<0 pv<@MTe @@pQUWyQQY NyQ pwd\1X @Y xp2 0`C`S``0p01 P@pP" H `0`bD 0`\ Y `@P`XX X Z@ T:4(dЍ@i(f (= S _ ,[:)% H-M8 ((0$  YЍ= S _ P P Q$lYjYe t n ~ 0H-P@Q  \0t4 0HOY$0HKY  0HFY"O p@-M@PQ`E[P .۴P ,BP `V V NT\,2 Ѝp@r0$$ 0B Ѝp--- -T@-M@T T Ѝ@Tq( 0%Ѝ- -H-(ML 0    R 0 Q: X(Ѝ p@-MP  <P @P.hP X`P@TZ@@ P,ЍpT--@-Q R R  RR@RW@V@0 㾴- p@-lh0 @Q   A.@R$B@@@@@P`@ BU:  p- 0H-M@Q P5_EU_oP4O T ,PQU ʠ $<P,VU$$| @<PT(<@Q3 P18E> 㯎p PP%  P| Q PP xQPpWP 80 T TH<00 07/P<AQ @  P 8 8  \ 8pW P 48 @<&P @P<  @0Xpn,  P@&@PP`00(EQ<@P @H 44 4QD#,QB Q@QPHppp$p \G GP,,GpppP hW,`,LGp  ,W,׎(,ӎGp  V,ʎ,ƎFp  V,Ἆ,㸎Fp  V,ᮎ,㪎hFp  PV,᠎h,㜎\0Fp  V,ᒎ8,㎎,Ep  U,ᄎ,『Ep  U,v,rEp  pU,h,dPEp 8U,Zx,VlEpW \%@P 0ᙬt,F,B$$$RPHQ MP(JP P[I8@ E> @@@;pt @ 0G8 @@PE>  PPP(pM P4 Pj8P@ E> @@@pN d@ 0!%8PH @E>  p; P$0H8@ E> @@@p+ @ 0@_0OPXT^ 8Pp 0`L PP_%P @E>  njp i7"tP18<@@[@T' *$4Y3*4匒@P@ hR8  QQ  <0  <4@`pT:,(TЍۍ $P@ 0 0\)8PP A PU:(QP 0 $$0 PP  0 PX4 R-?2 ^M--0""!(F"t(-- v"b [ V O  L @-g b"p z ) "| t-l-i p(: -)  O-MMp=㡪P @TT?QD@ᎍoP.PQQT o P 弿 (c$,,$ `( 0Hp+ , Tp oP  00@R   00 SP W, (`05 P( <PT=PD /PP; =PP4H=PppP `P`d00@D,dD`DDD,@pP _@ = @P  tNP W ,۩Pz @@ >P p@  6PI  1P^  ,Pb  'P  "P  PT @Pt hBQ0          aRm p p QrT t&P PP@{ @pQv U@TPY  @PW PV PU PR PO T 0& @Qo PlP8 gRi3T &PP P@PUTdP @ P @ Z NPL@ =PPF=P@P 0P0|c` X>FtM.᥇p ``Xh `p0 `d0`F> `p D`@P;!9Ut (`0wd NP` =PP[ =P  =〨P  P9 =w`0@P`0c <BM. Fp  FnX 0 A``P`d40 `嗉p hP@ , % P# `V ( ,0 `0  6/ ЍۍOK(0`P PЍۍGP ,(P  PTTTP $6P`ppd "P{ ۈp H`4 G 0@ .  =UO KJ(KB &&PW  @Q s0{ppP ppAy pP.` 堠 P  㕉 PJ 0pPI c 7M. 0-  q 5 q'  @P LQWP P T&  F0 ̔0pT@` A$ M> Pp @@_@PT!LC.  G @Q  -PP   `PP .t(`PP PP  R%  -(- ФZ PZPZQ)Z&PxtL 44@Px- P  B) #PP P |- > M `0 ሇp P P, PC 0VM.0(Z P |C 0= 0Ǒ 4C0 0,F.0% # D X `дpJ[ [*  ?3%": s# B#X 3d`Q PHP= \P9 > 6#PP P  6,3@)POUJTH TP@PU*%o , `d @ PP, @ PP4 #F @PG#-, tHu |@z H.# |----#_ B  t--- : L    j I %": A z  T  + L h M0H-M0@P00} 0P P AAЍ0HЍ/K-GMP AN` XpF` 0 @"p`PV`v  XQ:($X`Gލ Q( Q`O-$MPP/ᡤP tPt@` /pF   81Pⰰቤ`P$ЍO(1t(-0-O-\M@ `QqX: ,P 0m7P P  # " P@*Xp\Ѝ` @0<4` @0< 0Nw0- d Mp@-Mx`@Pd ,IX R LL0#I  廤,Ѝp@ Ѝ/p( x-- -@-@P @Q 0 %  B+ pp@P PP q2+ 80T(PKF-l- -#x-A-M`P @1P(p 0 WЍRWP& XW GЍA X0ЍA`P P# PE  X3 DW W G! G qX   G# eX  0G    0|G  l\\GWPЍAG ЍA`G--- x(F"->  7 8 !#y :)K-`pPP``1@ p 0 WRW P9 4PW 1GKd X0KdP WGU`PEP LGQ P DGU PE@W hK9GW W03G KF  +G--- x(F"-Y Y Gy :)A-PLP <P `@ZT*P, V   *0 @/0  %$ЍٍE"PW8P  p px-b" O ---A- Mr@P`P V P  +Q PP  >PX?``8 0`~p VP?Q qV<QQ  0to6) 1 "  0V PP  0T !!  0 Ѝx-R ---H-0 l 0@  @ @ \R $0@BR B)O-MĀ弐`Pp @` 0 T  0R Np 5@`VTD徸@P Ѝ o  ! O-dM`PP PZ8 p@ ^|]J 0!  0   0  .[0<P @Z P  dЍO@G Y B)L 0H-P @P08PU 4P 48`PU:XP0PQ4P8P:XP00,Q$/  --|(x -O-MMP` @P @u앟 F쥟 j0TP0U@%PP d d d d d d d d d d d  d  8 d X   d d   P   d  d   d d d d d  PAP DPYPwPr@Pi PaP[PS PMPG 8P1PspP#jppW  FP P:   L8W`V LP,P 2X WWP P PWGP;  \  \ \ \ 4 |PgFWڀWI  WV  WpBpRgPj `P P8 k?v W; @Wr!0 0  0=Wd A p[ A ]VP) n\P'ZIH D!00 0  0f8 '  p  \70P&<= rM  ?*p@?T 0 !$!6q0p>1= @-`-Q0-:"d-X-\-T-P-H-L-D-4)Q 9"X I O K-P@(a(q( .tPP>aPp'D Q Q`Q@@eP! @P:<Q@T tP dP@HH PD?8 @?< Њ `-Q04)Q \-:) , 0H-@ P*? &?| "?p ?d ?X ?L ?@ ?4 ?v<:): w  ; H-MM@P  RUP* P%J ; 5`pPP 7P ``P   `p4J6`Ѝۍ,<B g D-T-P-O 0H-M@  UP DPP 4  p%6Pۍ0P-\-O O-oMM 0@@@kP\ 0@^P5&P PpB ;[p $  .]pI @(,P $P* P: @$h  .Ep0P' P!1  `ḙP p,danXaP  i=,аX:z(P.  . P(P% @P 0a P `မX `7|`P X 2=@T: |(%PPk<oߍۍz iO"|dF"\- 8 edA"O-MM_eP1;`d D t PP P TP PY  5  PY T P -p4p0 P `P Pa ,hP P ]`, ;p*8  ` @ozPBp1 H`V P Y p"p2@`ǘ%P D )8$H 4 "2存@pPU o{o `A`qd`PTEY @Pm U ` 0C<<P_ U  6<  0<@p V >  0<l@lpP X%P PP *:(:8jX 9"[ \-e `-Q" &" o  8 :) ( O @-@pP dP   p , ;4P-% O-M-hML PH (0@Pp>P- `  wp(@W  U$` U U刈 h` LDP @@dP ᕶP( PoP`VT $` PpၶUB~P1`FV PP0'gǟw `S; `T4P$ċ@  P0`LP HpP /PV{ 8P<PD @@ V;$_` ` Tp ;$Z `Sp G; $UP`Sp _P0\4 ;zZ 8   :@D <0`8P 3d ?៽P04 :d,ʿ 0ᏽP G 0 ,兽z p   : @D <0`8P@DBTpP (P% ; $p$@Ph ZP ``PzSp ;$_`PoSp Z_ :Y@$PZ U P T;$ @_` p`NSp ;$Z`CSp [ ;$ sUpP2Sp  np` n A{F_ZP0tl#"   dPo 0 0  0ᡫ t `P; D @P_ 0Rp ;$ZP@Rp} D[$ ; UPRpm D_Z U0_PdaU fhd@Q$_ 0ᒼ  0ዼp 0ᄼ 0  3@ Qd`P$? H0pnL mm AKHP $0 Y@ 0RLP0 @49@hЍЍhQh|Y@    U ! >D  &   O = f w ~\ O-MM@Ppb W)fPpp RPqPk !Rc P`p GPP\ @@ P AP  a@P@ 3  P  P O@@ FP# < 8Pt`0P )1QHpl1 R< Ѝۍ $ g h-4) %  / O H- x96:): O-M@@PZ ,q_P! `P ǀ`H~A@U U @B ᰼P ᩼P `FpV0`ЍP@P `@`P(B.OP 7gl-p-t-O t H-P P P||| 9tL4hh h0LPd@dp`90 SD H T'. *..\ iO""F"PP 0H-@PEP PQ 8x0 RP\%H%P0< &v00 0\ "T'. .N Y *.P.L.H-P@P@T`p|T Q\ fTDP 80 %,%P@p".P.`'.\ 2 .N Y H-P H3 a .H-P H3 芑".H-P Hr3 h .H-P$$$ L83T'.n ..H-P$$$ :8z3T'. x..H-P$$$ (8h3T'. T..H-AM@P 6 DPL PTHAo"<@,0T@Pp0   `A 0V0aWp0U0R0\%C!T Tp X@P P H M@P PP 3Aލ .... O-lMR2 Q, dş@pP L` Q V`: R R Pt AP R S)  0R P: P ptP0C\ `@T P `VPV* BP \ $pW7 3H$ P$Q \Q Q *`1V:@W 0Q0PpW1FqQPpqp@W`PVPAp`WVP0#蒟H$ 0ZQ\Q2 [Q:$Q>pP@@6 0Q 1AAT,Q ]Q  $Q &$QP@p`$ 0T[Qc Q]pQppQlp Q_  p+Q\Q' $QP@`` 0T Q 1D!R A!T   !T Q ,Q]QPBp\Q Q$ P]QQP1D!R !AR @@pQ Q!AR @@DD8 lЍP  B)B)..*.*.T'. O-DMMP<@l P$ <>Pc @@.:xEP <<\ PT <@ AP 0 P3 <P. < 00< B@0Qo0TA0"PP <!@P@PQQ,AP> < P8 < ,0(<  < a0 o2@R@0P`"PP < @aP@< xQ@PQY 9DЍۍ ..0 x-'.(....". . P'.". H-8<P 0 ,,P SDP'.T'. x-A-XQPQ DPD`p@ Pp@.P'.".p.O- MMP@P\ |PXx`Vpqdp` 04<L0+'@PJ0?P 04 04 +0 @PZ0$@@04oPaP nP@pP qPt t@l8 @@ o4H0 H Ѝۍp.". T'. :)B)y .!a > . @- 0$ 0 @ذ.& @ G-KMp@P3`@PI 8"0P$0D@?oT@Q2P 0k@WT  P0 W2p@pCT Th!<P P @!z<P PP ./@3   0//v@+PA r( @ R @TQ  VTt 04)P@@@Kލ(2+@ .....ɾذ.T'.) Y @- 0$ 0 @Jذ.& O-MMP P"<P 2B  00$ضP P f7Px+CP t\r P/?Pt P6.0Ѝۍdh 0/u^ .k ذ...0 x-'.(.....ɾ".& Y P'.T'.r ) K-AMP-@2P) `P p+0Ѐ``>p pPJP  0`E+0>pA -8 42 Aލ. >"ذ.& T'.  P/6S}!H-P ,,, ,0a2-T'. .p@-P@P Po`t sP `nP -pU , `P$00 ,2p6S}!T'. H- 0 p. .H-P 0P $$HQ-".T'. .H- 0 p'. .H-P P!,$!A?o2Q@0!`@PP pP AP( 00 -@P 1h@P \h 1\PL  D  16S}!.#.T'.+ L b "..H- 0H ".x .H- 0> '. .@-(@(0 3  R". ..H- 0# ". .p@-MP P P h/o"Q ) @a/,F@PP aP<P@,n@@T P x` h0P t0@  T0$1LDL 06is(0Ѝp".6S}!|.L'.#.T'.  .H- 0 ". .H- 0 ".# .H-P PP@PP P @0pʨ 0,xo200pP`TT @S@p L`@``0`0Q `'.6S}!T'.? Y \'..H-MP) P'P  !9P P}Q xP llk\P PPP 000+Ѝs .".T'. ...0H-P P  P<P @p #<ll0P \T M0 0H+0<'($ r0H .'.T'.. H-MP PPL  8P 4RP$]+Ѝ  ..O- MPS PX!8PK HaHPP34?P  P ;P0 @pP P P  PPP pPpP ;pP3P* Ѝ^ ..0 x- .P'.".H-MP$ P   8P P|  8P PTP@P4P * Ѝ   ' ..G-M`PpJor@ɲP VF ²P㔑P* V7 tpAV(pZ\1P. PPDQ*,ᠲP`|P. ;`P `P#( 0,ЍGoqV@ V[*Pup:|` ol@d0  {$V ЍG\ Ѝ a g .\ ,[r .l T'./ O-$MP P" a7P{ P! X7Pr  @@ -P |P \;P^ PY @xqxPP2@`o>P  @P3 2PeP `P@K>P/2v4%m)@ЍۍPPU20PPP/㫫 P+skP ` @P   u.T`` 0} }4j%,N+ _!`'.T'.İ. .p@-MP  Pt! L6 @P:)tЍp8`P PSPPP@!P@GT PSPPP P@1`T @oP  @Tާ@}7$$O T'. (..0H-|@PllPPPM;P HH< N-00H( $ 0%0Ho...T'.1 0H-p@P`PP8P DD8 )-00Hf(  0$0Hko..T'.G H-MP# P!P  5P x5Pl}Q `P TTD$P8/(Ѝ\ .".T'.k .H-MP# P!P  U5P xPl}Q `P TTDP8'Ѝ\ .".T'. .H-M P P<  5P $ 'Ѝ .!K-M@P +iUppE`  +iV +i`U0 PgۍiO"O .H-M P P<  4P $'Ѝ . H-MP Pt  4P P T  4P P,TP a'Ѝ7!  .0H-P D@ PP 4<K'(03P0".  .0H- @R:9'L00@ PP  P0".8 . .0H-P D@ PP 4'(0P0".J E .@-PQ 'P<@P  %P )(..H-PQ &4P Hg6(.R .H-(@-M P  PP@ &L 4Q@P@$֥ЍW .H-PQ/@Pp%,,Ph%;".'.(..|.K-MP P!3P +P p\`&x&&HH!p P 8:P(#/@4% P P'%/ЍPtP `a@ ᶠP ZhP @2/LP$. .T'.u ` |.TW (. 0.. H- 0| . .H- 0r '. .0H-P PP U@  p%`0L @HH000 0h,U0 0Hg....T'. 0H-MP< P @  a3P,  2P( P%ʴP b@P  P  @V@d+g P L+gP %Ѝ0T'.. . İ.'.*.*.p@-P P!0PoobQP``@'`@U P PO P J P [%|| hP  \\ @HHP 88 0) p6S}!-:"".".T'. .H-,0, (0\ 0 ".,#.' .4#.H-,0, (0\ 0 ".0#.9 .8#.H-d`P` `0@P0jHpPD D0``P0]$`".,#.' .0#.9 4#.8#.H- 0M .K .H- 0C .X .O-MPPR@P$Ѝp` P  P p P`U 8PJ`U 8PY-U- U`T P 0 0p S p=) U`T pP x0dl `p0h`P S `#)- -h=">"C^# #.#.".g T'.S}!6(#.$#. H- w.H-P |3Pt}Q hP \\T$PHHH 000)$  .".T'.  ...@-MP P@ Q P NQJ R  (#Ѝp| 0/Ѝ@jL DD@0  0 Ѝ@( Ѝ@{.ذ.T'. M 2 ) .0H-P ,@,PP0#0".} .K-MP0 8RQ4LtP%" 0P! PP @ܑ eP !p p W'P #Jq p||AjP7pF p P  W2  WR3 pV@ AQ 7 P p AQ 7 P\lhЍpG$(. ".T'. .\.:) .0H-MP  PP| S0P 4@Pp @ 80't"Ѝ0 T'.C .0H-MP # P!P $0P 4p `@ PsR5L0 'q"Ѝ0 T'.L .H-P P"(HHR .W @-00 @P 0 @W'T'._ H-MP PP  /P 3P @(P PPPu"PᏡ`ጡ`2 pdP Sd Od,trЍ l iO".O-MP  PP  ~/P (P PPP1"$PK`2|@ Ed ll`l \\0PpGʿpP(Ѝ l .ذ.".Y & .0H-P!@PP P PPPP5p 0P h d&!`0D80<00( $& ݅" T'. t'.x'. .A-M─  RPx0S lpl@lP` Q_&0`SЍA! Ѝ.<(T'. !H-@`p&P PP 10@0PT,, H.& H(&".T'. p@-|`@P[&P PP v< 8 &pp@J! p@&.T'. 0H-P \P H@LP"P00!80   0,0H1h"..Z T'.- .0H- @R:!0`  R L@ PP @ 88 0,0HhP0".. T'._ .0H- R R l@0 PP ` @0@@ 0,0Hg P0"... T'. O-$MMpPQ %P $ -P XCP` i&P P@XPU  U%$Ѝٍt)b`\ A@T @D @ Sp$Q \Q Q> 00iRZ @)}b wP@P@0 0@ @ AQ`@)XbRPd%%P Pp  P P  T@pP Ha8 @P   -%` b` 2/PP )a%| @P  P $Y& Z2 (..0. B)D'.T'.u .` (. ".p.p.a O- MPl@4P LP PD( A(P Pp  ЍаАЀ:`P !P `P"pW p{P|P PP g`'.(.1 t1 X'..#.,[p@-MP @P  P `P ` ܓPU PP 0PЍpd%PPЍp@ 4 㾓P F0Q # G- M p` ap/  P/P:P" 5p P P  ЍPP `A`p:@cP'`PX؝p p1/ `  ` ` /pP p. P :P p`./ PPp,@cPP P C^#.x 3x"O-uMM@\p`xq|qtqpq`L```lq``````x`t`h|pp`d```fhp\``0`` ``2P |p |&xp x &tp t&pp p&P; 5= p`0 p p?.t\;.x`7.|Pp(UdhP&PQVxPQU` Ud\Q` .[ <_PG Plp l=PP 1/QP p \ P P P P uߍۍP /P--P P 刏刯H@@pPp P  T P  P|P$/  ?04P 4!P@ T P 4 pqP _  "  " P `Q\pQ P %p%O|QڈQ |_P :\-TtP@p t%t# P@P$  5P 8 ]cpeV +"P WJ@ Q;Q @ qQ QPW p@oPP  D R ? 0  R (` U/? (`l(` R 0<} S썢 Ρ0 E4P  P 0`( 0 p Wp  p #PP   wX`܋ PP $P P"@偐   [R 0E S3 H0ppT0);@P0t{ `# @P  P   R `@   Pe嫠P Pif #.а.ذ.. T ЕUYf $OP }[n U  00 0eP  [ [P P  07 p0Po2  */p k|j/i?#pk ".T'.l Yv 0< U`/x'. ..#.#. `P UU嬮U N፤P FUU @P 8P lalp1X!P^tQ<!8l0L/2!P<!MP H PP P. p0-x `p$pt \/~#.x /p|/t/ mH ` L/ <xx /\ P <,Q/ PtP  /.".,</됀P` h|YpQ`U P | <l j/ PV P D ,P4 Z/UP  O//p `!蛟`P( @>pP@@8@ P1 P :  wP p[ qQ 4+ @Dp  0P 0  HaD0 P>/(@p @[>CpP/ D0P `$ P P Q (P Q(h P\i\YpP@ `pW D`4PP 0p0<@@@p<`( ,P `]^u+P;H&PN@!P[0Pl P Pm ..# !,[PP Px[> 4P `c 'Q_J(,P P  0` VPY *Q3 p P 0(@K [ n,U夢)Pv PqjTPl- W' 0  (`gD LPI Va" Z`QJpP-Q K 0QkJ(@Pl pP /P *R ` :) ,0`Q?JP` 0 `  ,@p !!PP & 0(`,   @P 4[> P 0 p P ` 0  P"!0K@P  ,p PWP#@@)X44 G0Q; QA `   0( Q z  0(P@ B \0 1R*P < ,  p,P0 H$!!!  0(0!<P" <`D !#k!!=!P p, ,Pp  0(K<&@8#`  0(,P= p  0(e  0p_J! P   P  (0K  0E3x" 0pD  0  @#.(  0,P<`p8@ P0 @V U P `Wv Wk W#pt d"  p0 ,P<`{ P P ,,!,1 7а.ذ.".T'.T!!".(..- 0.!D'.p.f!;!| h'.& !!!!!! !!d'.F!Y!s!!! !!!!G~( B)!!!7!F!P!a c!!!!!!.p!]!=!!!!!o! 6!h!r!O-LMM@  P0P(P,PPPRPP  N%@PtP  40 ,0A%P:tP 7%P (0Pp ,P P PP*UP( LЍۍ`P@V= P@P8 /+ PQ# P* P#PQ ;P PP P P  4P V `PQ  @`P P `P`U P AWPTP 7W`P`` `cs@@P @嘠8 +V P8@<( @D\Cp8!pP P,0 !P X `X8 0"S JK8v`U. [,B尲8p `P /sP`` P P +6V@"#. #.".k !!x O-MPQ RS2F P   P   P (Q| P P P PP /rP @@`# pPU P@@O#@lI#p@rP PpQ  P:#@p:rP P1#@oPl:rP PPPpU  Q QP P* 0 P P P   @lPUTP"@P <Q"Ѝ !X'.!!".".3x"!0H-P@""" ! !00H-P0S0 %S S Q PP@@ ^00 PP  V060 /00 B)H-hM \P L 0drP 00<Ph&P'.!T'..H-hMp`P `P 0dsrP 40<PD&".P'.!T'..@-@P 7P 1P +0H-@P "PU [P 0p@-`P@:qP "`'P %qPx (` ( P P !PR! R (p@(;!2!!~H-Mp@`PP<W0 *O0SJ  0C @P 00S  P Ѝh'.!K-pថ@`E P AQ P #Q AR0Q  qQ  PO-lMMP@3   H   X$\$`$d$T$H L@PD0!P P`m.]D,@P,QASDYC ` @k (p ($p $ FPJ?,P4P ,41/0P 0 8Ѝ&p" P P@QQ*4 P4 0 PKLpU x hPX.00tPE 4eQ 4UQ (uP t#$p -$8dP  R P4 0 p@ HEP[<8U@Q*4 ,0t `P4000S0#0p nP 8cPmP(S#`4 40BR0 p p W w;UZ"  X @P  P `@ P 0!*0@,0 @P  P  0 @P  P w P  p Z% ` V  @P  P? # @P  ݗ` 4@ \0`@ ˗ P 0(,P ,41/400-PDr# 0+#."."..#.Vа.T'.b! !'.L.P. .|'..  ,[ Bm!c :)ذ. !& [ "O .t'.!!! . ..!!$#.#.A-MXt` PHP p   $P  pW  pPpQpCP P8 P7 P P{rP1 PlP|t@@`cP Q PPQ  0SPY * Yc^ rr   0P3 P-0pq   D0P0 P(B`FV B =O  0`7C 0B =P< o: P P6 o- P h P pH4P,"@P  P Ѝ P  PPP zY . L. ..P. !T'.z !(. !.. ذ.!" . .'.|'...\. ! ! !@-hM@0 @@rP sPxl@d L`d K PP0W(<"....!!8!T'. .!O-MM̨P 崘@  ;똈p>ڌ 0 P]TP2 HP.<x p00P `` pJP|xt4$q p1$P!~00p! P P4 偶`_ 000G~`pJpQ_` Qa Qb Q F@[@Ѝۍ <  @0pp@P>Pd"|x$t4q px0$P!~0p0". ..#.\'.,#.4#.`'.". !(.T'.\.. ! !". ! !.B !M !.( ! ! ! !7 ! ! !d ! !'. ! ! ! ! ![ !O-LMTLQ LЍO} @pD P p= (P(, С mP<=iP(,  00( S00@BSCC /p ^P Z#P ,TP @aLЍ  <XP@p< p:P 6#P   Fp P> P0p =P0 A @ #.".h'.Mb: ! !.] !O-LM`Ptpp̣ǿ[ǿS@0PW 0,@P}@   ppגP Ӓ#P  pPJW~ PP  @pʴP #Pe @PJpGPWppP  <# R z  0PQr" @P  P P ء ?$  R# Pa p#@Wx 0 08 (P4$p0SE/ppP r_ P=@A pFPP'  P #!P0  @P  P # @P    @0zoBPwLЍ# 0#.T'.O-AM` @P00/0 -复嬝 }匭|00p0Ǎxo" ,Q P(P%T PP2@   PP Pp" \P @3P[-P !% T |    'ph[ pD PH .PCaP= |P8/㊇pwP s PkW W /H+PpR`{P R PpP F P ${P  Q s 0 p/ P+ Q Pp ^PG \ YP @ P *, R   p o Y`p  g HJPJPP 1/P `AߍPh  TP P q 8 0mP$  fP P [ ? P (P |P  P 'tXh\'X`lP@p H  PxWQQ gP 8 ` P ' R P@Q(*P  XwP R'0p `P PP4! P !+ P( PPlvU#` 0BR0 ' Pd P pdz T[ Ѐ Xx P  E U& # @P  P `w   0- Ѐ X༄ YTP @0 @P  P  Y y Y   0BR00R p R 00rv P[y ` V  @P  P # @P \ X0 pP000ᰇqG܂GBȂS 0 PP.JP P` p 0BR0 K P p`pP`pU  0!pXz @  P H!@ (R P 1/WP DQ P-0 S R PW P @QP]0 !0  <8 @`p,`(p0P1ppAP8,S0 #1 03Ҍ#.Y ".".#.а..!".T'.b! !'.'. .|'..  ,[.!3x"" !P.L.ذ.!"O  Bc :)x'.! !r! . ..) !![ #.> !r ! ! #.G-/P/pgP @T`pU`v+ܠ+ D . V%@1dp1PpW u`9P PP0PPJu0QT.Q@DP 8 d3x"".T'. !!0H-hM@\a LPd C 8P*".g!T'. .A-MLQ@PC `lP    0P  @u %PP uʴPFT P+PPP`P ۍ@c0P(ۍA"`.g ! !\...E !@-郍,@ x@"..G-dd@PP LT Q88rPQ $r " BPP0PQ0 ,0CQ00 E?SSEA<<AIoQ$N@ (A@0,A4A4t@d!pA880`L!01<<8@@ DDRBR BAYP\ B Bl@ l!+B+B@W+BW+B Y P  G/. '. .X.(..\...`..L.|'.P.......*.*.0H-tP `P T P,P ㇿ88 80(@PP ".P'.T'. ....p@-M@P T 0S00U 0 `S0100 `P TU T@Ѝp@-P Q tt庮`H@ PJP M@\. !.T'. !噮T'. !O-4MM0,nO봮@ ,嘞~^.>@0@v^~.Q |^hnxx~x^t@p^pph@[(>P\8nP~ @T@,nP.@@>@@ @@ΟP>$~P .n@@@@@@uvP @ +A P/*v-fv-P  _vP$ @rP mP hP cP p  卋,ႇP  |Px #vP R Q P Q vP ZP@@lP\Pl}ll,X Pb}P T P 0 `0,P 9PE?p@9W+ @ 0 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 < 4 4 p 4 4 4 4 4 4 4 4 4 4 4 H h 4 4 4 4 4  X l t ( 4 <4P 6P( H   0   0 pz( xP( 0P + z +@ 0 Pt: xp @̹pp$$Pk Qr pWbX K\y( P ( 0P< L 7<? 0(l0 ,2b$(W 0P|"xx( P( 0P L xP  0 *0p $  04Ѝۍpsh@ 0@'7w0UA0,@@,  -h7 ᳄P\DWDwD@@tPQ )묥P @Pl@P P PQ PQ +?@ T||+z? P:?P \@QD P 0 @?$ _?=t&PP u2tP  u)tP  u tP  utP  xtt%tP `t\%\P HsD%P  ,s(P  6DD0PqY,:\RP ,Pf sPph ,@p\@P `p:Pb,,?Q  0`+>,tp崣r崳 DV@@0[ V P # R P 00@ SbP Y0,p.; 8    ?@v0 6/?m 0 // Pc0, ^@LP P pvl0 /!!".".".Y%"".j%"!".".#.!".".". #.".".".#. #.#.#.#.#.$#.A#.@#.,#.8#.(#.0#.4#.<#.!D'.ƴ H'.! ʅ" -:"!!5!!L'.!v">!:)P'.T'.C!Q0!!!Q0t'.x'.!m!b"!p'.l'.!h'.!,[ d'.\'.`'.(!X'.h!4)|'.'.'.'.'.A!'.'.r!a!i!3x"W!$X w! # - 8 D !l !J!!!M !U  (A @ '.1 t1 (.(.!(!O- M((B44R4bP  WP  oo )0 p  Q PSP pp W| P lPd#T! =$  2/PP P  @P  P    ЍP  @P  g xdP'.T'.(.,.E :)0.!p.D'.` u (. p.p.< 1 t1 p@-xPPlP `@`P PH-F(@( P p(.<(J!(.!!p@-@P 0`PP P @p<(p@-xPPlP `@`P PH-F(@( P p,.<(M ,.!!p@-d`dl0`` 0HP\@ @T pp.D'.p..p.0..H-P* PU& 0`p@S`P`V p`V V`Ap Vp `PUW(O-Mp@`ፂV, PPV( V)AtQ@\p1pdd!W X!P  `Q R t /`Pq ЍOЍO9V,ⴰp`P p| 0U 0\ HX ` 4< `2/ЍB T'.!g! '.0!_!'(@- $R!R!0S S|1|!Qd100 R R R8 0!0S S0100 0@ \T "T@T "T @ @T% @ @!TT T TR  0L Q Q$p...İ.((0H-P T@P PhP PP  @,0 ;,<(!!@-D@p0P@o(T'.O-M-Mp$ \WϹX'HD J ¹$Jǟ`@ R0`RWF`&W@Ѐ$ 0XP P  `fPPD $p P+(<8@ (PXN/ (P(MN/<@8 ĸP jP  u 0S %( Yp@T3 1 A 1  A<%( (  _dUdPj0X`Q-@AP w@D T$tdPp?DA( jX j X`@ pPj)0$  uK!uPP:S0:UP88$j( XP(10A,qS @D0 -T=IBJ P@   ApЀX0 0 A  Q0@ *P @Xs0( %k!%P@ :S0: ` (䂟r Fd0   ?#1BuA"e 0LX PR,H@X!@R  Ph" R?0`p:0 AkG   H 0 JT"eXP$P!eXP ,(P ލЍY@ P*p!eWTT!@Q5?eW4AQ%.v w,BD@b"(r02r 7"cA qdWP꺃 (@0`W dPា'50 .Ap.ذ.h..#.h'.!T'.'.".@ .O а.!Ȱ.Q! ! !!ų!gO"!! ! @- M @ @ 1 Ѝ0H-0MP@㟂 gPC0Ѝ0@-t@p@O-M-JMPP- F`㠷F?pPQ @Ca/ -T=IBJ   Ah@T0@`p J/ A  Q`/`pX p $ # 0W F=P9[ڼ#!HP1 e0W PK xP?@K P*8#eVPvw @#` pp7cDepVV0&+U'@`Up*S0`p:P ?|r#;p Bdplb#5'{AeL"G5B h0V`Z pX@"fV ZPlJߍЍ.A Y ! P@PPPP.@P. AKE4 H 0  Q%ᡏ,!p@Pf_V@ U: d0UV@vw @ ` pp7cGdpDVqQ`  W 0Pp Q0pSh f0V`".".p.#.+!.!P^E.>!ų!H! S!а.ذ.g!o!.y! T'.@-\@ RHP < 8,P ܴ@#.P'.T'. O-mM@pP `{딦Pv pӳ.LU\PPvPp\Pf  PP  P p`PR PP @P\   t ~P pL P| }P 0 lP w}P PPJ ?>[P p) P gPPJ ?#DP p P PQ AQ    Q  Q Q q 8$ R p(t @APQ ` p @ U P gpP PPd@ `P L D Y AQ  "  Q q Q  p q Q ||2  0Y 0YS P\ Qv0""IP` @\ p p^P>  UP7 .TpP JP  A  iP P .T R  . P B  h P  Pp nP g p @p巢8pmߍ\lPhhdX\ <A#. .!..'.T'.9!(.. B)X!\.! !!W!!!!A-PR@`  P,P AQ  ?P @Q:p '"P%a@ AQ  '\P p"P HQ p; F@Ddt08A`p AQ  [P \PQ  Q P ,P p D`Fdvx@DFX@@P HH8@P{P PP @q@o..! Tp@-MP) QQ  Pʌ! yQpap@l1 R0P0R LP R 8%ЍpP PP   ``'5 0` `5 ` 5 ` 5 ` 5 P  Ѝp@^(..T'.!.!#.".".L'. !".(!*."L.P.x.O!..#.T.~'"t..%#"..K-MpP`q뼐@? T* i ` ?,` B0pdd Q`Ѝ@+J $ 0ED0.T'.H!:)D'.p.!N!,!O-dMPp@`QP PPP `W P 4P V U x~  0ppW ̳̃ԓP `0S    P 0jpPVpP \P DqPAqP p<4 4 4P ,p`P: Q @P@$ qX}  P@qN}TQ d@P@p<}P4 $P@p/}`@T&QPP!@PvpWEQayP3 PpW:T@ xt1Up@P  PU p| P  PU p|P dЍ)3 P<P|| X'.W! T'.'.!!:)#.$X !.'.(.(..- 0.!D'.p....!V .A-ā`PPKV q@Re P.P Btt0Xd @eP L eP 888!P V  P啟 pP 0RP @@ 3V  @ :|pP  1s0b Br``'.".} \.Y!T'.^!{!T '. ..!!*.a L. .<#.P/ Z 0H-@Q @QPP  NeP t}P dxP TsP0 0 B)r!. w!"!@-@P  x0 t@Rdh0HT P t<Q,`. .X'.(..8#.4#..#.'.(.H-P@P 4 0,P L".P'.T'. '.H-@f|PaP pP P〯/pPJv\P |pP P`@qT%|P "(.`.#..!H-P kP""H!"!H-P`p @P n@ R* T 0pRpp`FPt` AQ  PpT,`T :)!!!@-@P L"!@-@:P.O-MMP`QQ P RP w@@P \@ R BeP{  NP@@{Q`@T``rp+P1P/P +1p+1pUr!1TpppUp Xo R 818a8p. 0R @dP:TU o P   e RT @@p@Ѝۍ(."....H'.3x"X!"."..'.g @ .\. .!f!p@-0MPP `,y 0@4 P L 0Ѝp@P @ 0Ѝp". A-M\aPTPAPpP 4[P0 N@P<   R0 00 @ @-@U)  0(W5"P}Pp@U PpPp՜ @P  @ cpЍ`'."..!.T'.\. B)!O-,M,rPbP@PB PGq `MP.MPmP` P a 2x0   ` ,Q V  R `Q   Ѝ(..,[...!/O-\MMp`@^ 0  ;7 lP HS +7A, <,P P R PUP rp8  Pp* P IpG <8HP r  6p0  *q(((7 0wvp0@   ; lP  ++u!@[Tu$P+8pP! &H0 m=iS00@,a@ SBCc / 㲀ɨpuP u#P #X!uAQ"P<`  P*T0ԩp ThV} `u`<7 \Ѝۍ"'.!h'.Mb+! X!mM 0H-@Pk0H袩p@-`XP@XqP @SqP P $l@@p #!H-WP!@-@lp !MO-DM@h h l0 (Qa 0}넱04|A `=p04P h(80 0 S0 0@BSCS /puP u#P "P u ٧P$ ptP t#P  Q  A<@t@t  DЍOЍ/ @h'.Mb/(/H-M$Q 0 Ѝ0H-@㼧P JP0aP @Pħ0p@-MP0``PP @$`P 㨧0+㿨@ЍpP @-@坧ca_@/O- QP Pp6P1` PmOP s? p0t V0lW8`8 P ЍO"L..,f .\..(.!.t.!!!Z!T..O-M`@ @1 [P) PR ֠LP ||p  [   6 㺠0PЍ.(.!@.A-MP  P ۍ@@P:ۍA}Qt`)P P`[0 @PP P A< ,ۍACq!d.D. (x!!!H!!H-m Dm .H-BM` 0BR`0p0R2 P0 X 0X0,PGxx *llT!@!DD 8 p`P. B@PpPPX#*}POP +p P0C  !llBߍd:ll@,:)8!L. .\...!!(!T..H-BM` 0BR`0p0R2 P0 X 0X0,BPG 姟^l[l`!@|!PP 嵟p`P. @Pp=PPX|POP p P0 n J!!llBߍp@c`l l@$,6X:)8!L. .\...!!(!T..0H-M`|kk"p @P PTCK|kkЍ0 0'tkkX/LA?bP _4   0&!:)~!(!!p@-M `GP @P tP^ ۞TT ֞H nP,Ѝp@ЍpL.#(T. \.!@-PMX @P MP @P 4\Aᷟp {PЍ!l.(! !@-@8ŞT }{ d.! !0H-D|ATP(P^ {D(.p@-M< ,PH A !00 ae GQY c? 0S$ {/x    ?0 0,S/܍p#!(L.?L S}!6.0H-0MP@^pgP \D0@  0Ѝ0.6.p@-0MH`@P]4f P  0Ѝp.60H-,P,@ sAD 0Hl.zt @-@YTi@0H-@PP EPP 00O-$MP]P@ԥp%5p ppQp %~`tQ; pOP0@ Q,* 0@$%$5`/ pa@Q4y y y y z z y (z y y y 8z y xx hz y y y z z EPw FP- Pz   Px  JfP PP`P>fPe @9fPe 04f죟`P PPFlP`/=P. `:P} B  `` ]0 0P \p\P*V  yIT`D~U QiQxA`eP @!00$B]iZiWiTiA0! =pA PA @XPd P p`oB@h! <A@PlP GPqPP=P $ЍI=| Xx|dPe !(...l....!!.Q0 ! ! R".T"j% !' zj ! !p.4)tP RQ P co#@: !P: P: l|Ph: ` PH: DP(: (P: , P: <P: <P: ٭P: ѭPh: @ɭPH: `PX: H幭P 4Q,(Q Q  Q Q  Q A QpA IpA Ap @@T ,:P |@Ѝ<0 4 u u u ..f$!}$!($!!!`". !..$!...I ...#(f# j"<"R|!""p5".x.(.(.!. .F#.-@"&%!.!.s" . %!$!$!$!$!k$!G-MP@j b`fbPED0P>,Y$$ @ @ ß g吚厚匚8fl#0S_fpQ PRU(C 喙PJ ㏙p<zXP dbhr`嬒 ;vP 0@ Q :p  3 0@EQQ@U+  'Y P : , =@a,P  @RXX!0@` %:DQeeeep P XP P  i@P PPP P@P  | p h l ....F%!..4) B)..%!e%! u!!f!!:)%!.(%.(%!%!R%!2%!...%!. ..L.T.\.Dm %!O %!d.!0H-e@(( P' #:)2&!W&!H- P  h.tA-,aPATP qP fT@`aP! ``XapP RaPP LaP GaP  ᰀaMXPpTT 00#000`V(.%t.j7H"T":)&!X(x.p@-0M`@PW% 0P  R l/ R R   ,B  c/r P0Ѝp..( .O-MQGP A>lallp@w l Z  &0p/oS"0 0Q Q Q P  P t oRQp\P R R P  L P '(..! B)B) L.O-M@0$!dp d ` 4:P@PPp p PUh  cc(P  @oЍ4 l..O p.:).@-@c@2t l. p.H-Mlpp=0 R `p@r R VQ  `RpPwP  Nw P:P \ pPP@ ? ^  4,PP1/Ѝ((.p.O .H-PQ (p  Q *:)t. P:P 4(@ P? ^  /p.@-d00S R P0@^@@@pȥcP @ t.x.s" &! Q0S S /H-PU( 0\^?@` pW p`WU@PPPPU `BlV U@`P  p.%!O-MP9 @` p^P WP)l P:P @P?P  W P:P @P? W0* P  QЍ%!(.(p.%!%!@-((@  @\..T.G-BM`  XPp@  Q UP:@`G 0 SP  XP^P yn$ 嚕BߍT.(.@ \.o /(O-MMP?b0Ѝp('!:).'! '!'!(!'!'!Q (!x"(!.O-Mట@Pp ` 48  ˓ R (R( D02PO2P K2P   㯓 㫓pW$`Ѝxt .(!f@.(!O- M@^p `P]P,   z   QP  XPP ^^p Ѝ踨 ..(.0H-MP@ W%8 QdmP 8\ 㥑0P3P tp8` 3T 㒑7@ &Ѝ0.xt 2(!8(!;(!R(!f@(!H- wH. H-Y '!..O-{MMPl^`aZP \ZP WZPfvppt@ 21@ Q*0@cP @dP lP nP @@@p VP PPhjap U@p-PP=  @ၒP" pYP %^PPPlP=  |V( d p P    P  P(  8@Y հ`VPXP pP?JUWPL l  % ѐp0 `PP $ 01 P%%P -㸐PpQ U.PPpP %' Kwpl 宐pL? X` +Ph  PPP]PPP@WYPJ PP  eP p52tP h;@] 0UPP -GP㥐PTqG P 0 hA, 0`mP2PtV +PD % " P `P p ptP PF 0 !P   5 GH  &|H.D.(!L.((4).gzl+!~T.F"+!,!:)+! +!+!+!+!J,!o,!%,!,!)!{+!+!P.H- )뤂:)(!@-0(, @\ 뤂:)(!,!0H-MpP    P 0=@P rp P @TP@dP p DЍ00 0L.(!(!)! MH-M  <QЍH Ѝ/P.K-MAP`P;l 0@T  @p  P p H   0LL@p 00P`T 0 RJT`f0d `@Vp@p:H0  }.=W@\ `0/H 0P<.pp@0@X M(ЍX.,!()!B)!Q)!X)!:)" MH-M  QЍH Ѝ/P.O-dM$@pP hP P(0Z8`4f (p p,@PLH,/o[ "QP X ( I$(h(PfP pA,@,X* Z ( l  P t  ( h  XXY (Q'H(, \ |(QQ.H,(q(QH,(g(H (,  P (H,( @ P u (H ,( C( ($H , P _(H,( @ +  P (H ,R    C (H  ,R ( P 2(H,( @ '( 80]P  (^p48P@ Y 9( 0 Q(X,  Y ^( 0 Qm(H,P ZeP $ , 4 8p ` ~  P^a  X(jg84YZ lf c Z:(KgPdЍTCtptthhx.`'\4Ll)!*! +!*!*!_*!I*!7*!%*!w*!*!*!*!)!)!)!P.)!)!^)! MH-M  H-rpq#@W P` ᕌp P pWPYO-lM $YPL0p88PX  CHH0 @ <0 0@ PtlP @PpD ,㣀,0`P@p(@P $ (P#P@<4P ,(RppP' ( ~4p@ pp(0qP:|P@p,  XPlЍ0h @qP*@<  p@$ Up P PT@`<0lP pP @ @(`$$4$,t@&x @p&Ds& w t v0,P$   p,P @P @Z (((!*!+!s"1+!@+!R+!c+!$}^)!G-@cS $$PXTP`Jl?G#1R# k:Q[.0TP0`vX$$ R$P N`DTp P-P+PPQPr p `T`FP N@DT`P P QP7"x$tBPP`w$$PPLp$HB$P<4P (1V@11@DTP S7)P)V)P|P P\P3U%gectAPhhSP1PhU`DAdfPe $0q  (P @P f1P6P0PuTT SESN\j!|.x.l..&/!gj!Y#lj!.~~sj!.|j!.j!&/.j!H&/(,[&/'/..&/,/j!j!@-pʈ@@x@t%,P nRTPDP <5R%#If{...t'/(@-@hJ2P @KH-+PH- TS  Q Q/@-0S R PaQ:{Q:A@AT 2[S@ @2@S@P@Q0SK-0M│ P Y! t PJp!\ŸQP TKPP'P8PM KPM P\X i!00_ P P!5 P5 P>:JPP5 2P51PKP$ P+ 'P P%! P K PKP nP K P       @ @ " t0tp`P  ,Bx`P (@岉 a 0Ѝ..H5/..H0...@-M4  P @"P l@PDP"P lP0 0@PT x"P l@|!@Pl@hj"P lPP @8P,PЍht@k!OS" . k!D(k!^w.k!@-@P @lP @@B<.@-M A @R@    $ 8 0 0 0 0 0 0 0 d (Q  |p"ЍXP<(P.=k!:k!7k!4k!1k!.k!+k!(k!%k!"k!0H-@POP0 Q 00H/B<.G-M$!!o" ! & F P00-APPT%%봕먅%%HuEPt%t5xU|exutEtTT  HP P<4,%,E,P%P{$u$P  m$4tPp pR P P\dV Rl0$ Pd \ CTPP@$4 6, R PP@ 'P P#̣P  PD 3cs  0@00||#|3 pS dh#h30P0L#L3<4#4PP PP PUP`Q  `nAZ `lG "" |"P `R PQPR L ` AHA4 `FG r " P!PzP@tP Q@@PЍ@k!H(v"<.<.#Sk! #@.Vk!D.Yk!H.ȍ#L."P.\k!T.f t.p.X.h.\.`.d.l.'/<. >"x.H0|.!X!._k!.bk!.nk!k!.l.&/k!k!.#. ..#.!.B!,%!.k!!..."#..y!/".. #..R.hз!.~#hk!.6"D( . .i.7="./@-@PP P0PQ@{?<.H- Pp@`P P,$P/"!G-@PQ P lph` > p>W@P$@@ .. .  ..O-\MPXC @p`XP9  PP0 P@?U- K >X  XnO X *P ? bPN(NX>&pPX u>\Ѝk!  ..0H-N4P$P.PAP P PP |P x s P H@P0P NPU0H0H[.&/'/ ...T... '/|.@'/.&/..G.B.@-@PPP|P pp ,dPLT #HP(8 .&/.@'/ .. '/.'/.P/...  ../H- ;?H.,P/ Q /&/. .P|M&/  ...@- P p@T ``` P @9000 P @,'/...L...@-|@ p X @ (|8!.....0H-P P!`@ l \ LP < P;@0(...X'/..H-MPP+ pP' +P@p%`~D-Q%vpm`v   .Qb  P VU`TЍXPqP(b@ Q6 x ( L L L 0 L L L P L 8 /QPB@ Q* l L L L T L L L \ L d /yP/wP/rP/RP /WP/ YP////-P// // / /0H-P@-P0 @MPJQ00 `/(0H- P:P @+PP+P00H00H|@-M@P LP!  +P PPJpP JX Q8U[QJ(~ЍЍ@w8!k!k!k!k!@-@@@   p P@(.< 0  !1``@o/( P LH(k!.H-@M@P `PU SLP P PECXp P 8 P@0T$dp@ЍH(. Q"k!   /.p@- M<` P @P06$@ ЍpL(P/0-!K-`Rp@N r P TPq Pp PpEUT T|KM t8/p pPw p PWpG8/p,PTP K-l!l! 4 8l!k!k!0H-$Pp@p L@0P(Ll!0H-@P!J R| 809 0  r \ MLPp  ǂ,P劢0@(..al!85/t.0H-lP@P Dp 0 )0 (<R   0 @ 0.O-MP3JԠ 0p`/)0S0"&᐀IP`pQ !0# "  WcLp .P`U Ѝ@(.sl!O-M<@pW% `PKVJ r P@ ɀ Р +0*  ( EPЍ , "0 S !  0 U Z4pZp  Q.85/` R L00S/ 8 //..dh!0H-|P@P   $ 809 r 0Ht$Pp  @0.85/@-\  0 S @ 0FI&0@P@@@T0 ^@E@.C-@=P \( ) R 0aЁ@`V p 0T!@@Ѓ.4P/( &)/.O-M4Z% ( PЀ P !) ( Q*) b@pF T  ! 5 @@ T  ! 0 hP  HPJ Q 㸞P @ 0  @@@ @Q*@ Ѐ   p@ @Pv)fp0!p 0S V PY)&   0 F !   `q    *b0GPp H8`DPpUpwpJE P PJW Q   0W )u 8 `Q XPOl!J02CH@P 8P)#P6$P5P  00  @ B  @ @0 PP:( Ѐ7 ?4JDЍ.(/&/T(l!P(-!l!|.@(.O ('//85/@-Q# (  R B@ PRPPY RP0<020Q @p@$p'p 㰀$.PJ Q/T(0H-M@P) P 8 PP R 0PP So" 09@@0@(@ @@ @D!  Ѝ0Ѝ0HI.l!H-M 0DPЍ0H-48 0s 0@@Q@0.K-M @PD&`P3@ p p(p,p P  0 P00  0D!     & q@ЍKad..A-P@T5 p "  `VP   ޞ   P  @py @V ÞA%.d.P//.H-PPp`@PUPP*P5jPuP# sP# kP)(Q  A^QQQ *PP Q P dP nPPPP.O-MZ댣 ZZsZXPT hch@P uP+P G-Q   uQ+P  GP TH :P KHbPP .P bP wP pP cP P@ Z Z,PP"ŸBp`Pp`aq0!001qQPp0P  A1 PP1 PЍd@PD 3ゥP8@P (@P@P ὗPḗP ᳗PᮗP yP 0p`P 0p` V!q!h.t...q!q!`.X.P.H.sq!q!q!q!q!o!l!o!o! B).Cq!.(Nq!Wq!.eq! Q p/..0H-p@PP\PPHP 8PP(PPP0H.X.(&/( p/.H-p0S :Q  9 h \  S@D4S@#   0...oq!ESC.@-MP&@PP tTQ @0$44    0 Ѝ..(.oq!.ESCH-! RQ 00 R0 ! P!R 0 !Ƃ 0? ! @ R 0 !ɂ 0?!  )q 0 !̂ 0?!  0 ! 0?!  ! 0000 ! 0000 ! 0000 00?. R R R R P/p@-P@P `PpP PU:` q U Q P@ RP@- \ *0 B @R/o"@SJ0H-P@@P:  H | ,?% ? ? ? 0 ?? ?0 P? ???P0H-@P`P QSpW`QU4 U1U uP Uu```.0H-p@PP\PPHP 8PP ( PPP0H.P.(&/(H-^Q R RA 10S* Q1S@-,@QP`.(4 1S10S/ R/!H-@P/ `P+ PQ p DP pQ`tQ pCP  pQU <@EV@P@T(X(q!O-MWP D T: DP.P bP cP$T*@z FЍ.q! r!0H-LL444 40<@PPPPPP0(///.//(( (0/(///O-M@`:PP- 帠帰p  `@pT*BP P PPPЍ.//p@-ML@@#:PP ` iPPЍp.K-M@P@=pQ0 P`  d 0Q B QQ P `HQrBQQPЍ//.G-MⰀpQڠ@堐 ` P 0 E=PA@P  AP( Ѝ///./p@-M`P@9   @0 ЍpO-Mℑ|A pW=P `p 0P G pPWa 0QqAQPI̐@8` p ARp@PЍP` ~0 I B ZY.////. 0P///K-P3 `P p PU @AP@ PpUp W AP ps pp<'/0H-8@P(P0 PP0(/.O- MPP xP Qx(x8PQdXoP\ ` @`P p$`P`AxPqP VG0o"0PP@Pb    $ |     (   \     4wPO[M P P  ЍPU pwʬ&pAp@嘆 [@@Ts ` ǾPvVp@P0FP e[ ^eP 7Ep  Q  p PY  P PY PXeU `E`HuPP חIr A?  @ QpP ``ᷗpPd:X ЍO&T[Z@U8T(4dP P Q P PD P?CP1 PZ 4/*|tT dCTP 4S$0cP P PPP P |PP PR  P P P X} P P2,,"0G0bP@PW P* ៽P T @P@@P PP@` V:`XaQE [,qH q \[ [ @P` RQQ 7PXPi PPP P\PS iI./////(////.((///"_r!3x"(/!p@-`P@w6 ,Q:Epd P:00@T0Q: Fp./(O-$M$q p0@ P1 0@` ` @SP @b@*PpW 00@C @RP p0@ P  0 ` @RpP  p.P  ;@$Ѝ.%r! Q///.P //  0  O-MM@PzP(8Po pLwPjJ  PfႻ`ʕV^  PV p rPO ᴔPI PpQ Q Q   UP  OP  IP mP "PX Z P@⨠℀ ⤠|   4/ jPj 4/Ѝۍ|. Er!mr!(ur!(Yr!Q  FR/2G-MPcQaPP2 fPX >5# 65 Q PQQ<Z  @ P? @ T@ vPJ  PuJP XPdP% dpPp Q@`@ Pxx ᘺp  0 T 22  Cu Ѝ|.`/((8r!Er! Yr!p@-Px @(P U p@lP=`P <=P p@T\`P p|r!,[4"p@-P@Q `P Pz`V V :U  p@3Up\P XD )8Y4P ,$ p@Mpmr!((ur!r!H-M@pRGPk4`pP`P T`P`ЍP 0 !P `P`.p@-M`Q.  P@0 PAPP <P @ PQʬ<PЍp//.G-Mࠟp BQ` @PQ [ 0` CVQ @PIP Q , @@Ѝ//../p@-xPx@`V ?F RH 8 @o/o"pp/.(/@-PP D@@88 @ .//(/H-P ;H/p@-MPx3@PP ` @PPPЍpA-@  `pP t P  PpBW<r  pP Ar!r!r!r!r!H-` R V`:zLpT" PHao@DTB ./H-P`P p@p庒TPP P P7P @WN@T @g@//@-@9  /@-@.( @ R  /@-P @P@-u@ /O-LM/_e00OoP}P KP PPQw>t/A8P P vPo P P dP~뜿PPF: CA`xHP :V P 2:K:':8nP@neT PeePapP6P=mP /PPP  P> W W=WOP ,KP P P.W 0G P:$ ,MeP. ԌmdPN RPp 7P iPP bP P \ QP `P miYiP iVPIcQ 3 D3 X3 t- - - 3 - . 3 3 04 D4 ,. 4 4 $5 5 H6 d6 3 6 6 3 H2 * D7 x7 7 7 8 48 P8 d, d, \. l8 3 8 8 9 (9 89 9 9 0/ 3 3 ,: T: x: : : d/ x; ; ; ; 3 3 ; H2 3 3 < < 3 * 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 (% P[oY`py艟j#P; W W PE #@Q+:IPP\PX p pPS `@<9P  `BP @P(34IP0 WMGQ  P- h0 + + + 82 X, + 82 / + + + x0 / + + + L0 plihP PP P6P aGP30@P6P 6`/E!W @W *WPmh'7Q  b  ,& wn P `Ćg\ T, |rˡE Pm%H P P P Q.``. Q`+P`%`m z堅EaE{5P 0T EH 50 @QV @*WVW !WQU0EP(. g/(@#0881@Q* @p P   P 7Q /! Q aOwȏoeQ OP PP P_W-W +WQ3D1P FP$  a@P3$ 5P  $Q .{Q @2 `QRfP$$@"pTNP {uUel Pe Pe Pe  Pe  Pe ?Y+1FIo?Epˡ>J7apm P>;7 $ P ! &>~>&7pˡs>7<Q& P"T p84l PX>s7 P v 7I>d6 p  ..///&/ lpp0>K6D//85/./? 9P@ Pe $ Pe  Pe  Pe  Pe >6*d.$//pe=6:{k ˟ 0` 0`<; /et=A6=),pˡ=26QM PEHpˡw=66/p=6$$ ( P 7 P44 P@@ pˡ Pe$ DiO"p0?=Z5lP] P ' P   rˡ@-=+51g plg p rˡc<5 p|P 4<5qac|.Ie`pPk ^Pj  Y(Q~" pˡiHP IT'/( pˡ{HP= `<N5/DPexG0 ! #ep x -rh><45 p ! D( "$s!.>0=xPe= \Pe7 @Pe1  Pe-  Pe) (..I<d4 ((/@<[4t +/0#@1e`ll.u/%<@4P 0C x'/b/<-4 N} (h6؂ (r! pˡk Pe 32P zP h"p| pB;4ts! pˡP Pe `"p P ^!/:eA,4P` P 6`jw;K48P&3(``/P4!`0V(0F`˱0/P p0p#t! 5eT>e;.(T(b./85//d.&/$// /...(/ t!!s!/( //.'/|.r!(~"s!s!s!s!&/s!ws!Ss!P : 0AS R 2@P ^P  P *Pp Q:Y@ P P აp /@P  JI Z P Y:HUq P@TA$Ѝ.H-, $ H0/4/8/</O-MP9 `pJP,@ PP P(PPP@P PPW@ppP@ W:PЍuu!@-~2FP @hlll 0OP \\\ 0H<PP 0CP ,<< 0@;((t!xQ t!t!@O t!t!t!u! u!u!0H-Q P@ P $  00 0HZ20/u!0H-Q P@ P $  00 0HC24/8u!A-@`PQ ?PT pP 5/@*PQp$PQ  pP4  p؇W]u!r!mu!K-MP@QAgP=J` pp4@㊅P.  0:-p"  gg$ 'WPMP+P PQ P@P M@዇g@ЍჇGP`@VEPVnPVdPUppPuP cP ePPU*6vP#PU*PU* @xP@|.</8/p@-``P@PC C  0C 04 Up@/</8/ 0/K-PG @`pAQ"* P0SSU5  S Q gR)  B R r R  Q:`VP gP DP @PdP fPddi 4/@-M@d PqPQ( QЍ8/</Po//p@-R @P `iP pp@0wu!H-M 0ЍO G-Mp|`PhPЍT`P D@`PQ hp p>iPU:P PVUTe`ЍG[ @R d 3  BP`d`3`dV P V)dppU PAEPQ`...4/p@-`Pe@V p#U `U aU`B@PC@HC@PB@( @Q!@#%"  ./@'/p@-M`6e@P-JP;P)-P%;P"&PV@U AU hB@PC@PC@PB@ mQ 0Q@#!Ѝp@'/ ./O-MPPp/w YXpP YP ! 0@@ wBPP Ѝ`wp 0G?@ BPp/w P ?wp@ UBP O-M@`o%pPi%PUP)GPWP* P Z P@T: <P PP @Ѝ((0H-@Q P0% R0(B R P#0Q 0 S*A qR Q 0rS Q /0H-@ P PE00H 0@-MP3 p Q, @T T pQ#  :, /ՄPPH  Tp <, .Ѝ'/v!w!&w!{#O @-0P(@P P @'/d.P H-5 Hd.O-M★P@P P  Z `z P 4U Z z @U Z @{ P  P``pPPJw#P @~.  0p@Z` @ L D  PN G 6 8. 0 p PPQ;t 3 0. r, `@ "~P $ZZ P 㟪P T :@T( PU ` PQ@,P KeP0,P (@ @P D0:,P / 4, ,P ,P @D ᥃,P ឃ@Ѝ,P ,`P  HP``P T,pPp`4z,P u,P p,P "P -bppptcpڈpPJ P*P X@- YP pc* d.h.j!u!,[O &/u!/u!..'/'/85/p-!bw!.t.//`. /(\'/@- @P  d.0H-MPP" n/p   P @ @ $$   Ѝ0d.//P/ H-@P`Q p ˂ ǂT,Hp@-M@BbOPP JbP@k-P``UAU DU+ OUaU dU$ oU W-P btP 0( qbiR(p@,Ѝpp.Gv!@(v!v!O-M∱@PP j @`@U W"P-*P@P U'*  pW @" P*p@P W *@PV `* '@V P ЍOz@@P  Ѝd.p@-`P  P@_P U  EP T  =P p@NpH-tP  H+Hd.H-8 P (+3\H)/v!d.,[ d. d. d.A-h@P`T%+pUP W PE` 85/0H-@P P PyP0H0@-,@P |@@g@fd.H-p )H)O-MP P7  R  P \P P:P A` @C!Zp ݧP `@V J2/ PP PЍgw!-!A-@ !QPP( P0PQ@Pt4p`P` pPP PW ᑧP@P(tw!@ (H- Ptw!@ O-MPP pWD ! P`P@W WV `P`p`\`@=  pRP@PWU P [: @/ P0 (@`@V 唐唰Pp @W pP ppP P@U`PV Ѝtw!@ (/(+x!9x!w!K-M@P& `P" PC p@ p~P XP 0! RX @M`p_` @ #Ѝ||#3x"@-@N @r!G-00P@`p#Q%QWWP P #Q %QP `Q `p`@#Q%QTTP P #Q %QP ῌ`Q @h.d.p@-`PPPWX 0@P`(PPp|.w!G-MP ЍP RP `P|qPp~ {`PPPHQn`@P!0C}YQP`V p@J ᒝ`VA ቝl`7V PTP +'|.tw!@ ,[w!w!/+x!9x!((w!w!fG-MP@P>  0@$p6 `,!_P/ĐĠ@P `P DP  @`P 7P  p=PPP `V:@U@ލ.&/H-M`@P ЍHdP P``PpLD 0!~ H@~Ѝ_ &"G-@dd3P EHP & `o ~Pp@Ppἳpw W 0H-@@f'PP ,`'P ['oR0,[j!u!p@-M@P  P ۍpO-M`,pP PscPw @PT|PPE-PD 'PI De  %R R   0%S sS4P-+@ `` 0p}!`}pV3 U @ T@ ]P`p(p4@P pp[ :P <@@Np}Ѝ|. '/&s!,[w!u!A-MP8P Ѝ`P @ %R R   0%S sSPЍA'Pzpw`tp 0`Pf}d}@_}T ЍA}|.w!w!H-M ^p   @o Ѝ0H-MP@P ^p&PP%  P! 2*Pt ^PJ  PP$Rp$PЍ0&/((@-M@^PJx| 0"ЍpC-M@P `d^P h  #D Ѐ # "q p RЍpd.///@-@Pp/Q@0H-$4 @0!P 00 00S 0Hs0H/&/p@-l@P pp `t(@P!$ %$oB@.@-@P ](P@3Q/~/O-MЁpWP@P`'P`iD$@TtP WSXPN@PH0PC,@P`T(P`%&) p 8  p W  08P`l :$@ b$@P`$@TfЍd'/h'/ .. /@.@-@ ,Q' @d'/O- M08p4P@P U P ڐQJQ@P P`p TP 22D 88`1Q`!0 `0 o,P` P`Z9BP @P &% '|'f6]'&%A(P 'k'P R"4P1PP #@XSWpW`P ,P` ! %P"' ! 9(P(P$ P`('ZP< % &P P O#P@X @'P`P @P 'P ЍOHX Z 5{4 ЍO/ .&/'/'//.&/(D(Ux!L&/l.H&//d'/G-M,@(P`Q Q p tP h@q  P T < P0Pp P 1 0  V0S0/Yp@m+_`P!&X &Z)-"@YT Z xЍGt//&/&/ .d'/'/'//HQ/8p/(Pq /@//&/&/ .G-MK P P uP ЍG& p 0=ЍpZ @&P P & Pl`@P% 0P@(% !0" ЍG8  ..85/A-MP`%p@p  0@ЍV %ЍAp@-TP@` R ` r `V V@p .P/@-@ R P R0 S   XQ 0 0C0R,  B yy@yd.(/, P0SQP/(P R/(P R/(//G-P8ap@T _"P2 @Wy8@ UP  @0 0$00PP0000040@    QdO '#Y*y yT (/P/P //H- P PH- P P// ////0/0/0H-P4@PP x4@04/O-$M 0 H%UeE(+5 P D/ P ?  . ) P p P Y   uY ) ` p 0P `pP@P U U`p P P @`Vp@@DTʀCV ' p ` F FoopP V Vv p  P0 P)P V VU PPB` @`PTP; lP< L@P 4BP`} Pp`PP`3P) V V{ P P A PsP P`xXP (+ PP`AWP  P0 &  P /( P`PP  0  #PW   P P p $ЍOS  $Ѝ'/'/./85/'/ /&/'/&/O-M D@<`8p@PP  Pp   0m(PpP  0`(@TU<=U>   0F(*ЍQ O 0H-M@P>4P  0Q  JЍ0 /O-,MDDHp`wP - 0W R V,WPSP {z@$# T T  P P p ip PPP P(` KP` $ `P`Bp P X r P0PP X XY `Z(I[ @TE(P@@PUPQP X X +&XZ`Z`A刱P P P P P  P P PZ('y P@$p `  &P$P@尰$p `P9 7  ,ЍDP B 0 P'/'//&/85/'/ /&/H-@p PP~p P P @P@PD@0`kp@P@TP8(0(p@-/P p@ `@P@!! p@Q! 0s B @!! pp@p@ex! .O- M`@"N"PJ@@T{! 000qP P ЍOtPb! !d0Pw  ЍO%PQ!M!  pq V  Pᴑ@XI% !0  @ *&`P T@XP)+ Y `@!& PXPp  0  @ 00 0 @ 0H9`@P `pp! 0@, Ѝ 0xy! .'///&/H-M ^!! r   3ЍH-VP 8H  P  P  BHx! .p@-@P`Pp P@{`P(P  p@'/H-M@P;`p pP u9P x P@ЍTP < ЍHB ЍH'/&/x!x!A-P@p|`p!&  0E0V< P`P@p@T AAx!&/x!O-$MM@PP(P``P0(`{0<0,`v0w堇``P n#P tљPP` sP 8W8w8,   ᳳP  㭳P  P   㤳P   㞳 `P0 S S  rP&0g"0<S !S <SFP=Q P=S >S<P=Q P P=QP=Q P P B  d V Q`U`u`Q/ Q2 Q$Q:ڱL U u Q) Q, QQ* C^P4tД`$`t娔1tQ`Q LQ{8QwVt` Q Q q"Q#Q P Q\Q Q Q Q PT PP[ =dP pP+P/PTpsp0Q Pqe/QTPP P=P PR/r蒟PU P PP=PTKB/P P P TP Q Pq,/QpdQ Pq/QdP P P /`P U U U rQq唑kEPU U UP pP pP<QdP U UPU" p.p̐P \Q Pq.QP.\P| p. P$$Ѝۍu!/@(P(///(,[:) |!|!#env|!"|!|!!|!|!R|!|!+|!A-MM@Phhh `0F Q ` 0=(Ѝۍ//~|!/H-Pp^P$ \P30 aR>0BPz*0s01 00C `@0TP:Q s P0 P0r0 SQ 0P0" SQpp0kB P0`縧 x x x x x x Q- `0TS8bCPE 爩 $ D D $ $ L T $ $ \ $ $ $ $ $ d $ l t $ $ | NbR eRPR000thlCSDS LS RS *1S BS $US! XS   C^P$0#   h         ,0 O(P``/(|!|!!`# ~#0H-L@iPD@aP KpP d\ @@-P>-LP@:- @$T40|!/ R }!/}!//d/p/|//P3///p@-  | 0 0  0 R @ `P``@@ @@P@ pppp0@@P@ @@@@@@,h,dP, @$TPp/d///////////////p/|//K-M p`PP/ PA5 g P 0s  W  R !Q |q!P|0p a@0|@(p |P 0pa@|@0(p|PP7    @ 0.AQ 0p|`QQ@`|@0(pP 0<|pPPa@p|@P(0P|0!|0 ((0|Ѝ&/`'/'/0(8(//P'/L'//000 00 SR/'/L'/P'/&/p@-\P` VH@!R', `V`| `p/d//H-pP0O H`XPPVv@)@PFyPAeaP@@ P P 4@P' P Pxx |pt0 @@ @@ ,P *@P@@./d.l.X.t.H-f@@0/88 0 `.h.p.\. 0 ///// 0 /////Q/H-PH//0H-@P P4P @P@0//p@-@P` KP*P p@-@Q T3 Q \T,QJ  R  R DoQQ P T  OP2}!/Q/H- JH/nA-$b@PP  Td p  P\p TPAP   P C P<taP, TqP! Q@QH!@ Q(("P8 A_ A4  P @  0*0 S P P P L P$/'/&/////./O-MXLfLF pRP P -P' P$   PP= P^ @Pd @P[Pw(*PW|PK TQPF 0 0S S CQ= e Pd b @P"mT@w@)d=*)Q@tTttQd8*@PqDP w?P P4#@3#Q pp P  QPA)Jm@@ PQ_W  P_p_W PpP_PP W$P& QP! 2 |q`0RFNQL Bp1Q0BR @EXPW]i _p CpW p!0 2lPQ> PoSk 5ܑPp P^@ )`  0PPAJt!A@Dp\aP@  PPEU6@4 _pPPPwyP  0ЍOPP  =P   0C@P@pp@ЍPE//&///.'/&/(//(iO"'// //d/p//|/VUUU/A-\PPL`@p/2 0PpW@//@-(@P//G-`B`PH8PY( VP(BRr R! } @R a   @R |`aQdqQ88!   A Q 0 0S  v  QPP YPQ PX  S   KxX@ PPP////4'/./////8'//`'/@.D.&//0H-PmP lP@ p@TDP08P@ p @T0&//k!/7}!A-`xpp@ PP ʟP`88 0QT$0 pp/////@-< 0RA ^01 0 R/ (//H- R  R P @ P X |0S1(00 P  B! ~ //'/ ///G- p`r) P%\p" `p堠@P@UP@PF@t T}`pYXPo`Pp85///G-餐pPvh@rh`TV V jPT jH !jjPPP//O-M Pp` >PQP8@P@ P" ذ`v+ UpP 0@Q: QBQ* PBPE`s` P`pZYЍ`p//85/G-M`VQ &p@  lPP  㵿  @P@@@  j 0C`F@ VR:BA ЍH-P@`pP 0DpP @8@ pP+P` ///G-鄀`l R@ 0!  Lp`P| 0R`UP 0!  V. ./p@-@PPJ`  PP  P zvPp(P, '/ 2S/Q/2S Pl"R PH"R P$"R P/X'/(H-PC(A-M@P`p: P P p P@"PPЍp@-L 0 S < <0<@ P` F P p&///.O-MPD@` p U  0 #0SPQ0P) | R6 @ @``Q@D P p PCpW@T "P@0 p$ # * p) T @U r@ P  P@ 0@aP V  -`q`豟Qp # "qP @ @T$ @xx!0QTH1`q 008pX@ @T`Q0U q$ Q%PR 0ppp0pqq0 R A Q x@` @PЍ/`'//////VUUU|// ///d////8'/0H-MP P@QP@p2 0QЍ0&/H-l cR:TH0P Dc 0>:0   (/,/(/0/K-`V @@TP@@ PЀ)P( PU `V@<P`V pp q`` VP P` 0 p  pPpT P P U V RtP0A `pVp0 `0 R A 00/(/,/O-MP|P@%$UDrP 4r `R`P|`p !Ѐop!p1VU0R`0^0.PXЀРXdap  0 D(!@ [X  0+U ZP  & P&ЀРp U `  0B*! X* U   00  Ѝ&/0/P/X/85/4p/(P    X/&//?}!@-X@PJdP 0  0PX/P/W}!O-MPPpp@Q ` 0pRp!# " p.P4 pS"p# pKp R0UPpFPЀpU 1`  0p + ! XU ЀpXx`  0"p + ! X  0B Ѝ0/85/O-M@P`Dpot[J Q@`p!&o T@P` p| P`& p'0pЍ .K-@P뀀倐`PpP 0 0@p`x! /85/0 R/$ P  R/l'/d'/O- M`-P`]  Uٿ =EpEo!pEHP% PP! P uP I@ F @q  0Z 6eȺ@TP@Rs&e\EEXE@Y H 3 k 0@ ЍO[~" _&"?p}!/G-MP`p p ! @p@.U T  ! @ 0 0ЍK-pP`P @mdP8 @$ 墿Q O M "( ㆺ cp p  Y `Pp pPwP w P  ppᡊpw W p pPwPw P  pႊpᆡ @P0^ P}!~" /~X K-逐Pp@4T 5T'#T'a3  `pppP /d@ P6Th/H-o0H--P$P 'P!jN>.P ^P@PPPP [P @PoP cPIP @pt@TPD@ HP 00P c@0h/(&/d.ex! .}!0H-MPP @ 4p D0P0P&0 c ꈾЍ0d.`/H-Ma@QdA@QLN@<'P #P j  Ѝh/}!H-P  q  HP`/@-M  r @@@0 k΄0P6 ccЍh/d.`/p@-3P5 P@jTp `f fP& ?cfP P`0c`<P`@P Pp p@kph/d.&/0H-@P 0 R < PA0d.}!0H-l0d 4 0 S@0%@$0 :p05Qa#3Q'h/d.H-(0N A R qh/G-\P@rJP z` Pbb@D6th/O-$MP&   O@唐唀` P r 0I pWp  P  0 p/ ` V$ЍH'/h/,[}!p@-MPmPH PP``P= @ P Q `@ P-JPUP UP R Q @ ` QJ 0 S  0 S  B0`S`# =b `ηЍp .0H-M@Q Ѝ0HW P P PᶷcPJp ڄ 9 Ѝ0pd᯷LP@P a\@a3Ѝ0H莿|.}!@(t.H~!<~! ~!!~! 00p.@- MP P P=.P(1  R& "0s" @ P DP0@0S |  @t Q \<8 Ѝ 008(~!~!&/~!4#l~!V~!H-M< R J0 ==90 Ѝ8( .&/@- MP P P=.P(1 3 R& "0s" @ vSP DP0@0S |  @t Q \<8^ Ѝ 00<(~!!'/~!Q~!~!H-M< R J0 ==90Ѝ<(.'/@-MP @/P  @* Ѝ=!@-MP @P  @ ЍZ!p@-P Pvp|P pp@ ံ)@P p@Pp ` p@ |.~!&/H&/0H-MP P PDpV\P@PTP `@{Ѝ0H`  Ѝ0(!(@-PH@P 0,$ @&/`.L&/3x"0H-M@P P P,PlP=P MP hPP|  mP wP sP@ XP@@P0@P(P@@`ӵЍ0&/,/O (((P/&/P/@Q*P/@-@| plPxPPLHD@<8@g!(!!!!+!O!!!!*!@-MP` cRA0BSA@ T  T  *mRnR sR uR+dR kR%       1BPhd R, PЍ@ @p,@  Ѝ Y!X'/v!!O-MP!@pP`T* P@W@ T*`0@ P ? : 0Ao?B `W@` XP`T* P@WT ,PVV 0 `@Ѝ/((K-MM@P P P9ߍۍKȐ@ 0 S `Pp,W:ఀ!E}pWP w< < 4}0 @ ߍۍ(@!/!P!(!O H-MP P P*P  R Q ЍHxx l0 0  00 D< (( 0 Ѝ!((ǁ!0H-MP P P(0@ PPݿ@|P lX0R>  <P S$P Ѝ04'/,[!XK 8'/@Q*P/. !P/P Q@'/@-P@PpD'/@-MP ,@P  eЍL'/!@-MP ,@P  QЍP'/K!H-P0P(PBpHN\'/d.H-MP P P D^R Q  Ѝ@(z!0H-0MP, P P+@P,P0,, AQ  @0d@X, *Q @0Ѝ0,,P d'/h'/ !Ƃ! !!@-MP Pb P0QSSEC ^:   p p p p  p p dSeC ^/   p p p p  p p C ^&   p p p p  p p  #RS WS ^S   S -S rS wS S SD 1 CR C 07 E  F   K    N    R    W   0 >0@@ 0RQ-,0Ѝx'/!!<<< 0 PQR0/h'/'/d'/$ 0AP/d'/ .&/@-鱿@ {P&/U!O-MP H@P Q Q 2/P d@@P EQ h X X X h X X X X X X | X X X P P P P P P P P P P zP@ T  pPaGQ3Q Q =QU QQ D zaEP3P@U @PA\ p < < < < o  PP[P~   Q Qp U nUzPPnP Q @0 PO  @R 2/T \QS?@+پ4 Gz 0P. @+PP [|-Q @ @@SXD+Q@ @ +QR !\ 6Ѝ @PD< P @t&/x&/&/L&/P&/U!`.!t!;!H-M0S8< 0*ЍH *Ѝx&/Y!T!H-M`P@6p-W0A Q:UT h pU-W` U T  @Ѝ!!A-M`P) @pXPQ$ pP \Q`P \$Q T `P `Q,  [``Ѝ0'/d!A-MP @pP`@W @ h ЍA9W  Yhh -QQW W!  @PN<|W4 W/ W>oQ4W) W W. Q QV$WV W W  &QAP,  o  P PV R X2/@PX U@Q *p|P X ,Ѝ Xx&/΃!!!!9!/!P/So/Q  /"H-oP ~! P/t&/H-M  cЍt&/x&/d!H-MPp`կ 0B PW# &`0a@ S``3S0D0@B` T:V S     b RWV  `&Ѝ蘄!  RQ/&/&/@-h8P\TQ @P T 2/$@P贄!&/D(@ 0S/ S  C Q $0/D(O-M`Q0S@ ` pW) OP@AAQ:-P X T T Do᠂P p  p$PZ  RQ   Q P   ЍD(H-P Pߖ!(/O-M4\`@pPLP`pP/  pp@P Q@  Q P 99 ?PJ |QpQ Q? C  9PP 0!U QZu P #P UQ      8\P P 8Ѝ'/'/H5/85/(/('/ /((/@(|'/.'/H-ɾ'/H-M uH-M@`P``0 0pPЍ 0H-@v`PPP v0(/!O-M(,P 0`p@ !W 0!u(  &*9#Wu(":#%"0p  0j`VPP3UЍK-P@p`%"Wd$!y (0$5# 4!0 W0 0dp W2O-M@p 0Pf` = @$ U!'  % 0T$7#z4#j& D@0[pTpp3WЍH-MDQA#| "B -=)/ 7ЍMbH-M |pP `@P&VI `@PЍ85//(/0H-@XQ 冲@P@P: $ @0,/((/,/@-4 4@P ( |7P((/(/@-@@(Q/O,/@-P @PG-M h!O`P 0 Gp  E y-P%dЍ!G-M h!O`P 0 Gp  E y-PdЍ!K-Mh@Y p`piB PPGpEy-PcЍ!O-$M¿P`p@0@ Ya@QW@A@Q7@2YJY 0@  0@G@P PPT$ЍO-M¿P`p0@ Ya@QW@A@Q7@2YJY @?@ @o @@? PPPXЍO-MŸ@`Pp@0@ Xa@QW@A@Q7@2XJX 0@ @9 p 0 @pPPPWЍK-M@Pp%P PG pPPmP%P cP dP 3nP xP- sPP `ypP%rP `ipP 0P `[P p@pЍ@-M@ P @@PЍH- @Q 0% pH2H-P@mP' PDְ며 `n@|P PdPdp@`댰Q<HR H,/,'/X.p}!.\./H-M0 0Ѝ !!H-@P`pᗰj 㼰1P PPPP @PP @Pv,/0H-M@P P 8,00( (0 0Ѝ0@(#!)! !!0H-@P߯P !^@֯P 8P0՟ ~QT㊪0./K-M@jPPPV p㧪 0PppV"㛪`o"Q ]pP TX TP T`WpU TЍ&/l.05/A!@-@P ̹To/O-|Mⰰ夀堐P@ ;/Q00PP 0  0`LhoP  #` 0V pB `CR JS0@  S pwp`pppp@@P0S 2<`{U,0 [Q0 02@Q0R0s0Z0PU p[W 2@WRp0pqQ 0S @PE T:000    @0+t`` '`# (; 1q0WQ|Ѝ&//#p p p@@0@@/ .,/N-DD p0SC P Q 堎,/ .K-pDD0 Q 1PC010CSPʁ蠋,/ .H- P   .,/O-MpP1PQ Р +0* 0 P Р@+0`* ` BSH@@P@ *+@Ѝ .,/,/A- R*AQA 1 0# "  l0`0AP 0$ p%0 @1a^ @ p%` $ @P@ .,/0H-\ @0\0H0^00N @@\@ 0^0,/ .0H-HQ 0 @0P0s0: Q00,/ . @- R <0A01$ P r :0Q ,/ P@PP@/ .@-|嗨xx@x 0tS፨`ቨTᅨH Hဨ< <{0i!&/,/Qi!i!i!hh!(h!( i!(O-M`P V p9P:P ?P \P@P  `%P6 .P P  @T `OTgaDQ} 8&T&\&|$h&%%&&&&|$p&&&&&&%&&&&&Q O@T k`bDQ (%' '&P'X'&x'&&''&&'&&% (&&&L(BDQ, %&d(((&&&&&(&&&$)s !0  0BT DTLTLPH a! @p):TT? P80qPT5)2 K P .P#\ P Po!  'p PmPP`H P $#0 #P RRwP0 X@@%Q P  ^_w PIp)P@!%pWo P0ja  c"2Pu@ Qp@PjP/ v꺯 Z  r' P6 p !!1P 0  ?FtWꚯ 0 R : p P1 eP ᅯ 0 R : p0  /  pPQPG#  | 0v= Q Ѝ4/,/!d."I ~'".d'/ . /.&/,[0H-@b AR0P;PQ0P iRjR tR mR BR bR0&/ 0>S:S Q\S 0SS/.SQ?S/(p@-@@@P@`@oPBa p&/&/,/(.(H-@@pP<` Q P  ]4/,/p@-@`0P C/o"sT J@`@T @O !0  /o"Rpp@螮 ./4/H-@P dPT`VxP lpP@" r &n@@T렪@`/4/. .O- M@q B ((!P8 P P'@P`p ! &@  [  0!   R᭪ժ@Ts Ѝ ЍO ЍOD0(8(./ .@-@PLT !P 0o@a@4/5/4/Q!@-@P O@5/p@-P@U `OOPV,,     p5/5/ 5/p@-@`ҰP , 0 P PVPp 5/H- P BR Q9 bR4Q& ^ R N Q P@pR @pR Q Q PPPP P0H-P@u < 0P !T @0 5/0H-P@]P 0P  0T00 @R P@P0 5/K-$P Y@pP0`#( P%`$ % `U0"0^Q  %0$  ! R (QYD 00 R 0 PR8(0('/5/'/4/H-$  PH5/'/4/0H-M @ Pp q 0+Ѝ0@-,@ P @4/&/05/0H-Pd@^|P D 0@APJ0P P @0(4/4/'/O-,MQP@P@@P:   3 TP Q SPP ) 1 PJcs lljQ Po HP P8bP `p[0`p!&TFP'P PP P@'  P"P@`ppP`p&')`p!& PU`p 0`p ! ȑPU`p!&P & ' `$ps[! P 00  0P" AoPPZ/  P P  ,Ѝ0  !   $ 0  !  T 0P P 4/'/'/4/5/p!&/ .&/!Q!H-, loP4/G-M`Q ` P@pP f1TPQ:PP  P PQ00P00 0PJP LpVp ㄢYpЍ&/05/O-M`4P84@p`yP  0 P Po? 0 0pD I4@Р08ؐ`@+(oP LH$` &@P p D, (0HL !y  W` HTLY  ` HPLY YIV  0@@ [ ` ,@ J<048pA 0( Z p V*W(P*PPP%  /", @AP< `@p X` Vpp`,JJP @< r. .&/p'/d'/85/&/h'/05/'/&/'/&/45/5/5/ 5/4/'/5/ //O- 0 7 0|E W ) @(pWQ p< 000  00B P4PЍ4/O-Mp 0 \@@T5 P @\ @Р @\ @ (@`VZ 0&@T @Z@(@T  @TР(p@ `\ `T9 " p.*0~ ЍT@p% `$p Q p` "p. 0bp Pp p Q p` '0&@Kp P   pp}} P `X00SP  p XWX W @ @;p@XDp ЍW O$O4p@-P@U Q``㽝P0㹝 RP`P p0 R P000\ 0/@-0@ T P000R@0 O-$MP`CLpH_p ppp@ ppLP^    QY ?L Z   Y I$Ѝ5/H-0a,$ Q  HO85/'/H-P M PElB?XH;852/H+P|.,QOtQH-@<!4P HP85/'/H-0 ,$ Q  H,Q85/'/㬜A-@T<  P뤡(Q'(@P xxpP`uQP P00PAj85/,Q/ ...$'/0H-TP@T   FFF 00000(@5/<5/D5/0H-P@P" P P tP dP &P J&@@@@@0(!!!!,[O-MM@P `pP T |VN|||  EP  HP P @ Q_ Pp R} 0 p @ 0pRm Ri Pp`@0p@p W P0@`P@  pW 0`0@ 00RC `@` R< @ 0 0S/ 0p0@0S' 0 0@ BQ QQ P 0<40   DPkX P  `kPEU l` DPv p!P  clP  DPd P P^Q `Q Q Q@LP   P,  ^R  R R 0 \R0Q  $ 404 RR0 s$P$@o0 0?+10 RzPA ppp!7p;0yPᗾP5`FpV1cp94Wp`/ɚ 0`ppcW EEXP  p00pGPd2Ѝۍ0pX D5/!@j!! ((:)85/ B)(@5/<5/Pj!O-M`PY   ЍOmP@pHH  0 p @P@P'*1 P  0PG`LI ` 0M 0D`D 0X , Ѝ<5/85/&/&/!@-P\\\ 0S @T 0@0000 BR<5/(@5/@-P\\\ 0S @T 0@0C000 BR<5/(@5//D5//@5/P/卿<5/H-P p`˙@)řQPaU 㷙QG-t`P@p jQQ  QQ  <5/H-uzP  $p$PCS9H-H5///H-MXp@G p P`p-VUPPЍH5//@-@P C/p@-P@P`Q/ ! R:3+`Q   C`@pH-M 0*PЍp@-R@P`@TpQ/ A/p@-@PU`PUp/@-@ R Q Q! R * Q QS@SJ@0K-M,`(S@Žx0V"@^QpP` 0000040 00P0ЍO-OMM 8봿P  p{P  @ @;PP#P    LP u  ZL pR 0``@D  Rpp`V /`P {0S 0 S@W R  R 0 @  " `V R`0dPW`VP Oߍۍ!0 p0 PhthPTH0@ `R\!U FT0 ?L5|pdXLd 0$H<$ T5/P5/ B)G/G/!k!\!X?/9!!hG/O .!ȝ!!J!!lX=/{!V!O!B!!8!x!!p?)ݛ!!!!!!j!/!!!m!O/O/P/P/O-MPC HP@qP{P tP rP 2aP bP.`V P p0"pS pX PP  =@TЍ(0 $p0 p`剑X=/G/G/O!O/A-MM@0 A R * `;PЍۍ.Q$Q +Q(/Q \Q  `NP P IQPR IAo`AP,,0 $0 9G/G/!H P" 0?#n>P:.AoRy\`nX>PsPQn\,0n(>PV;P ?0  &K=mP PPQKQPPEPPAP l>0  KH=Hm<PP, PfP( Pg >P0PP P JPP&vP@-@?PP+@ p`pPQ Q - @p ЍPㆂv"#!!O-M젟@`/pԐTPP`T   UT 0᝖ -P  <PPQP@T Ѝ   .Q:)С!!XP/O-MP lpt2 ğ :p/P  @/6PpW% xxğxQ `p-QW-Q0eCQ Q  `eS kS iS` ``Wc೟@p  CPPa@Q%pȶض0\l|@DPEP IPH-P<@QP5 SP <p^WP p?Pp^ZP ?P^YP ?P<{ pEQ`T"AQ聟 (  <QPPQ ! '-P  oP, +mP OP  SP  L H D P P PQ@NP00 *RLPXQ/Q/H0 B)}#Q/(((!Q0*!#!!4)M0Q/Q/ht@gt:)4!J!P!U!_A!x!_!!!||#!H-' R"P:)!p@-@0PPUp00 `RP UP UU@ %t0p@RUT D p@{R,  0p@ÔQ/XQ/!O":)!M0!ߢ!բ!¢!!O-TMPRPbpP  AuPP}p GP gPwPPUl@X ^&P p^ Z u@pY P@ dQP`@)P Q WA ap a| p  p !W 4 pZ  pX  pP  @P@0d ᑡ H, -!Q04)o!b"4!"[!e! O _l!!H-- Q(O:)!@-M@!$P   p Ѝ 끣!0H-M@P$ ӹP P Ѝ0"Pp H-P@P Q `6CP x<P`P $CP rQ `<`V@-@P !t P 奦  oۖH-aq1S  @ P PU  @S*QQ0Drr0S  0qq R q0Cx)@-K@L@p@- `!R 0@T 0RpQt@tQ  tt 0Rp Bpx)H-H@-M@L@H- 0CN:) !0H-@Q0aqP0 뗺P  Hy7Pǟ ğ  ql@@(XP L  B<*r000Q/H0Q/Q/Q/Q/x)O-,M@PQT(J< P$0 AT ! PP !rQ 0p 0R l帼㰠$͌P , R P 2/0 R  2/Pp pR  P0( 0p0P 0$ PPP `P  P` @`Y pPOP Y pPP auPe P P0S 0 0 @sR Q1D@_ @r  1 `Vʰa@ r R @P\pdjxPSP P'P XPU PPN(0 ,sQ  Q0@@0R A (0oP7 oUP Hx (0 W 壧 Q 姤$ @p|PᾂPPḂvQ/P!AQ2SP RPF@Q @88=P P. <Pg>P) ?Pt ; (88a 2pPF R1Q U 0!0CQpaC_ `SVpP|fQ.P !?0S@8"P0A@0 B0!ARP !@ B/!jq*$pW e廝P庝 0㉢P PӦ(P٣SepPU$ pP X PQ X3qH5  0 ׼Gʁ PPpP<P! >P& dP$ &QPAQ:P wPuP qP#RP SP U PQ  'xP EPPAqP(P׎)ᕓp cpp|r0S! B  ' 'Dcp| xPQ zPaPxP@a@(P(@P  't 'bmQp P ԣU4Rpf 1 R  2/p[ P!PU   M Vp `P ٢  `夣`aA7 >p P ¢吣P 'Q P`P ' P`qV4 R  2/ݒ PPP ג P,ЍΉ 0 ĉ (0  깉D 1`P p M~JUQ/Q/Q/Q/H0 B):)H0%!B)ĸ!!.!O-M@QopR'P- `P@Ug 0|UP` p` ͧP@U 0fUQ  1`p@VpG s\ 0RA0PUp`FU``vPUڶav0|Pv00C?s`P10YsPUY `  0`PE !VPrU V!   P ( 0q- `PqUP T0  1o!A кЍO>! /Q/Q/A R /Q/Q/O-MPp*@0 T` $P3 `  늠`P   @<9$P 0H 000R0,0(80(00@0404<<1D0 Pp 岑$0, 8@ЍQ/Q/P!@-PJ@Q 4A P n<qQ/Q/Q/Q//0H-@LLP@U U,U0d///bf H-S0 cH|=ꖶ!@- Q0@,8DThP` A2,+ ( % B# +| P d ,P P0SP  C @///ftp///H-M  f=Ѝ.tgzQ/ `lxH A8 (   B////B/g Q/ L F8 $ Q  ///n/H-M  h=Ѝ.tgzQ/ 8 F$  Bz v///P/H-M  o<Ѝ.tgzQ/ (4@LXhX FXH 8 (  K BH////$//H-M  p{<Ѝ.tgzQ/ 8 $  B$  ////) = @-Q$@l Qa A, . + | h P ,@0 40SP  C/!ftp/I @-Q@,8TQa A, ,% +  J| 0SP  CL  < P  @D///ftpD/[긃Q Q Q/, Aw cs o갺//B/0H-Q@8H\Qa A"0  ,P` PP , + % C0H3Y%"/m R Q Q Q/( F% " 갺/$//aL@!L/aL!L/aL!L/aL!L/aL!L/aL!L/aL !L/aL!L/H-H-H-H-1^!H-aYH-1n!H-s7H-R/H-㧄蜬/H-.H-1|!H-;:H-5:H-/:H-):////H-,!*Wd/H-,! Wd/H-,!@Wd/H-, Wd///@-@|0@-@@-@@-@9@-@/@-@q1@-@1///H-.H-.H-.H-.1H-MD P`00 A 0 Ѝ/H-M@     0 Ѝ/H-M8    0s Ѝ/H-M8    0` Ѝ/H-M4 B 0N Ѝ/0H-MD@    0PP9 SЍ0/H-Mhh"R \,C0+   d 0 Ѝ/ftp!0H-M|P  K  0@ P < 㯄0 㫄//Ѝ0/# - H-M8    0 Ѝ/H-W5/H-R//p@-P@`0  p@eꊶ!H-M4 A 0 ЍB/H-M8    0 Ѝ/H-M8    0 Ѝ/H-M8    0o Ѝ/H-M4 B 0] Ѝ/H-R//////// //_ //`@"H-M4 e 0 Ѝn/H-M8    0 Ѝ/H-~4//H-M4 e 0ЍP/H-M8    0Ѝ/H-M8    0Ѝ/H-M4 B 0Ѝ///H-M4 e 0Ѝ蠬/H-M4 q 0Ѝ$/H-M8    0pЍ/H-M8    0]Ѝ/H-M8    0JЍ/H-M4 B 08Ѝ//H-M8<    0!Ѝ/H-M8<    0Ѝ/H-M8<    0Ѝ/H-M4< B 0Ѝ////////!/3!/z0d/p@-T`P)Q  ,@  @|A*z 0}pd/p@-d`P)Q +@  @|Az 0} W}pd/p@-\`P)Q +@  @|Ay 0u}{pd/H-}d/0H-HP@ |! y)Q ~ 0U}0d//////᭷!/ᵷ!/ί!/Ʒ!/ӷ!/ݷ!/!/!/!/!/!/!/%/"/ /$ /`@"/%!////////H-M4 A 0ЍB/H-M8    0yЍ/H-M8 e   0fЍ谺//H-M 00 QaA 0KЍH-M4  0:Ѝ谺/0H-M@    0PP%SЍ0@-M@` ,P DC0  d 0ЍY%"!0H-MP  K  0@P 8 ~, ~))Ѝ0# - /H-M4 e 0Ѝ蠬/H-M4 q 0Ѝ$/H-M4  0Ѝ谺//K-@`!PpR "  "r  Q0щ堎0ˉQ P_x Q Ua rwQb ( dr _Y `U80S  3/PK胎iO"P! !gO"A-PU@" P `xpPUPWP:@p`P !P`$$ Q/Q/Q/Q/Q/A-M`Pp @U@,  p"p& P 0}눀 0p pPp!Pu LP W@@^@ЍH)Q/s("Q/0H-@ &P\PuTPA04P:?P P*@Q/H)Q/)H- c Q/Q/Q/Q/֍Q/@-@4 c,, @Q/Q/Q/O MH-M    $ЍH Ѝ/M0H-MP`@ 0bLL " Ѝ0HЍ/Q/Q/Q/O-M@S0 `T @P ܢbRܒܲ 0@ @@ 0@0S 0p0@ @ P P0PlP P wP wWPΎP w w   BQ<QY `D pᰎW 嫎HPZ Ywa Y`p LwpGW ἈT Ȱ!@pP32PnP|@qP *wX均T@ 88 ЍO&Q/Q/ B)Q/Q/Q/Q/Q/VUUU @H-HO M@-M@ 0! Ѝ@Ѝ/H-M Ѝ!H-Mpd`@PaPP , }(!  0`ЍQ/Q/Q/O-4MXop"oP`뼤@`_\ U`W,@p P  dL, |4 `,@Pʍ(ɍ`΍$` D@@ 0`0Ps1I P@I [@I[PP P tP@QP@@sKQ,$`(@0 囍U 3  @ݬM@ `qP~PZZ@ Z`z똖kAZ1Z7 AZYYIb`Z ZP\Y  AR0 B00@PPPAP @ @ P, `K  ̳` Z  Z#`w Y&, K AⶳPIK`l[Y [P ,P M{HP`Y Z [  ` P G,P K ∳ P`=0P $( 0 @|u  P QP ,    {,4ЍOQ/("]kE" B):)Q/Q/p@-M(0@,4PP `pЍp!O-MH@p`᲌孌H<8PW @ WPQ!&L@8 0 ט<p QPDp W  p  ꭷDP3Kyu 0PP  *PPUPH/V` R` 0@@P7 rᑐP s6fe΄σ _E G0P`fe`峄ᴃ_  0@y[PL jHD 0 < T _X &b][ЍD P^p XQ/H0Q/Q/{("H-M Ѝ!p@-M`$@P - n  0@ЍpH-M Ѝ!H-Mpd`@PW_PP , (H  0`ЍQ/Q/Q/!M@-M@ 0. cЍ@Ѝ/0H-Px@y0Q/O-OMp7ǟ W@&@b@00 @ bFPP P  ycPP&V6@EE E %P} hFlft8P,  R+ePoP pPP rP gCPN DP_0fPU@<PH  CP@ @ PxE5p  UP @T`V p~=Q @Tpq(p  y$0y K40pDdmP,pWHU8eP@  PPpzP @PiP  PPU:ǢĢ   xP T喊@啊 D@ 0cCP JP ql,k!:Ca^[|4|@@@D@P8@U<K p`PH ,P 8DD@T 8>D@T88D@]T+9P& `8"1P2T    0p P<y`?8`<TpP75@T1/]P @ wN"J媤PxP Uv>tT<Oߍ8@/8 %@ :7< 0,|7p 0|//_/ ///!P/v"//D//("/Q0(" ~)"-":)F0P , 2AjAP  2aA \P  VP @< @ @   <  D<P @<P @匁hY)3< DQ)ht@H0."btL/l)~#f@/H/4"."#."/."."."/h"."~$}(^":) G]."`."H."iO"-"H-MLaP@{T㍄{r딇- pz%y(! z~OyPPw婀P 0ApoP @OeP ZVZ*y+x ZЍ$$ 0+s.H0O B!:)g."O-oM M Q8 /p⊯ P`D<PB @ᐫU<*|Oᕠ (nጠLPH<v@ 2PpW<⊯< i]nY3⊯Y iD I G Y 8P  P X.`@ 0lPp0Y o   u 0,@̽̍,p80@tu8@?[@pq `DT @ @ nPa  1P P@0 0-@ @0  ( +0\pP0' `\P  @  (0Ap !@sP }\lP , A|\0 ⪁P<@P T/ 4F40`x O ,mx 0|w 0w ჳPL V<` 0PP VUt`uv (P㪶 K!㦶 p  PP J0 BP J0 PS /P ?:   | t lD* P{ T  yy0 V z 4cx t*QhP:?QX TP m,*{0}  0 | 0>9yɟ Ph9 QR @V iY 0pl)S0` 0Wp pV lD9p8ip 0 S0 0W  8p㘘8P h ` X  >H @ 6P  P~  0  ?IP5   9IP/  3IP)   -IP#   'IP   !IP P P  0P h' 0yPS 4 4 $4WP GP & 0P?& OFP ,l &  㹉P& ;xFP l   㥉P<<& P P k P % P k  {PPt/P4P <`4 $@ 0PJ[n4`#P#rBR$ /0&pe  pa*P=P\o&PWH8P,8J,p$4P 㩝P<P) 00,.P $@ [%$0P #P t# xQ=dPV W `"@3xxß  F0=#eP  0.50P2rP) !2p' @ S MuP B_ (`P`gP (N}lL!2P A(C0P P }!y0QTpooߍ ۍ0S " ot 0o*P@T 1,,R/3" B)E4"@!d4"v4"xR/h!4"F"4"3x"nfsiZ5"_X/_Z/&6"@ s5"5"#5"5"5"5"5"5"5"5"1"5"5"_V/1"TX6"a6"I %h6"6"S/?6"L6"."S/g/"//"T/q0"U/^Y/V/AV/0"0" 1"#V/ 1";1"L1"i1"1"1"1"/:)1"P^"`W/h^"iO"1"2"!2"<2"Z2"/ 4"-4"H-MHA0 PDP . Ij0 PDP . ;j p. P@(o ,j PYUAx jQAP `X@\pP` i iAAPPЍ!iV/AV/R/8i(_V/E b"0H-BM-PP .PQ~P @0 Pi  iBߍ0U/T/H-@ҦpPΦ` ,iP EPQ.P@P 4@P0\ i HiU/T/^Y/"P/!x!K-!MP<|ᙯPPC 1@ ``C: 0`;@`0p /P P/Q/pI/P |0@ P\1L0P`@ r!ލY%"z2"2"!x!2"G-PB@U% 堀嘠`pW Y /W P EQ 0M@  ᷆P p`T: B)5"H-MAQ DD6<8 4 0/S 0Ѝ/V/H/P" vD/p@-M@P3  @ Q ||| E 5pPt@0h` /Q50</Q PP߆ЍpR///W//P"5"V5"E U/N3"[3"S/3"3"H-pP@ p `˰8 pg @R/G-BM@`pPP hp> P LLL X    0@PBߍpY%"5"!/ 5"/ PP  P|/ ,P  ,PX/PQ !PDD/Q QcV S)r r#!H-M, 0 0 QЍ0_H-MP@ 0 pppep% rP! ` 0 pppep dGP Pp4/P <PpЍ$!iO"p@-@D `HSPPf fUPp6"@ 0H-@PP Q P P *SoP P0!!H- p)O-M`V! @Pᓣp /*P P PP `VЍH- |)K-Mpp$ag0< P:FP H@L! 0 p4/P pP 1/$qp 8 @1/pЍ6"O-lMP P< 8p@ L03/P' H$  0` 6/P  0 3/o Q 8 <01/P   pW:lЍO-QMMz@L@%"lXl/ @PDH`pIib~0@V@w@P#^4@4@LTN/ W䇟g0^ N/*P  ᥫP P0 }PTX\ e "e8  e @0!pK`048q00[,aH!L1`A [@[R$()!( H!L!,!0!4!8!(d` V< hV"aXfPYb(b儮4@$ $(!0P,qP,q048!HLQP0 5P`V'#EG pP@pP?he$;$BP?@P H!L1  '@$)p$#B :0q<8<<P P4l8 kP Y P P $1/$@Q() Z}P $}PK? @$܃LPLPX @$48!LHATY0H Y `#0?0. 0#Y=  D)QB ^ P Fo P x  yP 쩝䙝Z DP 0uPJm@U @`PF^  T:]0S h ex P TLPP@T: (P P P$TT 0^ x`   H 0 0 ;6/`PV<u `QppP P ȣ yx\x\x\x\x\xxxlx3P+`3D YP  P sZDTO<p\P$@p<ၦPH - < q 0P@`TpD8p rŸ@㬒B@ b`RP"  < P( H l, 8 @0$`@PLPp[N: r0D ,^  &b 蹍䉍Qy/ P`V XD^.먁P FD@|qtnlkP X@!dLPFP 0``h1q(Q4s 0 !P O---P --?1}ߍۍd/8"a8"/8"9"L9"c9"_`@"!\9"9"P8"9"9"9"9"A"3x"L 9:"2:"*:"%:"]:"B:"I:"U:"9"P/0_e:"~:":":"o<":"Q;";" ;";";"1"8"O-$MMP $ЍۍLLD`p P!P`pGw$ @P`@:P `s@pCS帣@p P# 4@8 $(PDPP@<@`TLcP p P D Ƙ( @ {Ộ4@ $(8PEuB P iyP  P `|᠘b ` @Tdᔘ4` $(@8Pp KAPz@+P- 00<.P $1.P "B-p>@/-  03 @@pW > RP 4|)Q l! @0| [#P0 @P+P@pPT:  &$ ,T*d0`48 xP 0 ;`5/P WLL L0ڦ,!%;"P8"4;"F;"e!`@"@!X;"j;"~;"m۶;";";"Н/d/ R"8"aO 0u0s0H-P0 @^P0. 0H,`@" !@-@  p8@`[/0H-M Q 8 P Qp  0@xP@ 0 0;5/P @ PPPЍ0`[/0H-$@P  PP0`[/O-MP PV@fPI  PDJ@ TA q`BI P R  :P  :P   P @DPPP  fpH  @T Ѝ B)@-M@ (Q Q P 0 Z^Ѝ蔄0H-*JTR0G-MM@08T<4,[ Q'P0 `$P P0A`T4`0 P{ ,Pg ,T8Tr 00<Ÿ`A@T   0pa8+ R^ P4Ql @0R 0pW PpRaPVW:( R1/4@TP* \O@pp@P@TBP0< `Y P K? 9P 0P4PP 0`4``N@TV  } P4Q @0( R1/4@T:0 ߍڍ`_/ )xH-  !//O-tM@R,0 0 @, q P$ `P 0QUQPU Q003P  L03/P P `V:0Z &`Po  Pj (0$`P4 ($`,q P( P 0QUQPU Q003P@ L03/P P  X:0`V( < 0`H m  0```qp <`8`$`4P4`-8P  ,P 8 <0p!0$` PtЍ\xO-MpPCPE ` Q7 pp @p  L0 3/P! ppt`0 KP 0D! #dP P j[ `e[pY: `Ѝ蘬/<"0H-@P P 0H0p@-P @`Q0  p@< A-@ P" Q ` 熁(0S `V:0S P0QqPWS:1/A8K-0MPP @ `p L0 3/ p 0P@`W:@`0Ѝ8/G-MMPx` ;p@p p6/P  ;x` @p p6/P ( 0oBЍۍ <"G-vM`L@HpP LGP PN Z%  Q Qm xP! ab'Pbp$`Q a$qU(1,!04# @` ZP P%`0@굤PC P?Q; @BP7 P 2 p^ `p$P  T $@0APU?@\& P5 &P2@4P- (P) b/P$ K?t # np4q, G0PPA@# 0`:x@Yt\ QboMH  Q唑tP P1 JJP8@p T4KXq D0 H @  `P\`TRP P K?tb # `4\"pru{AP1 p/67NPEQ* FPXQ&g !0&p A0y 0sK?a # ^`\4! p; ,70@` pP(Q0030SP'Q 0W'pQp0p 0WP07@&P: Q@ RQK? #p ^p4 ` 0rwPPPNvߍ!6"p)|)ffs1<"9}Dғߓ<<"s#! B)F<"`_/QQ`z `<"T<"H-S P`V VVPU  0B `SV VV U E0\0@P`pw` V :w\VQ Q `&c``a0````0``Q `0RO-dMMpQ:P P dЍۍ ў`P ˞P  _JV7 +X|/+X(P \R R 0S   @PU2 $P  R 2/phQUc+TX+/KXPu`@PaUj:{2aPf+:X$$P  R 2/p pP0 _R9rP[AP K? ]4P ` R 2/p1/4rN_[p$aV| /x;@@ "7>"O D//[>"da/@-4@rP 4 QI"H/"O-MM(00 0}QQQ 00 0}PPP b堢 p0@%  PO$ԴdZ PR[ <jD b"c OP z 05GP DO`>EQ  ^6i QPJ P'^ Pa4 P  00|Q8Q5Q3 ztPU P P  P Pd  00c|PPPd@TyЍۍa>"*D"gC"B!/C"D/!6D""u>"O-WM$@ @0S  U밴 *ZXꌄ 0S   R *R*Z@Xk 8DDHtHTQ` Q]` PE `fcT`iP `0 0a V`XP P P+ P `0+S ,S *S$Q AP` `$PX @D`   @*Z$[ P p pWsP0X` `Gc0hX% AP  P& g-P P + r)d  l{| QPh(KP( ,0"# 4\0P $^yTP@P R(( 0@@'{X  Qo P T6 #Wߍ@B"H/>"/@)da/H0H0 / @">"/>"D/>">"(?"T?"p?"3x"?"?"?"?"?"a>"u>"H-M Ѝ M0H-MtP@dqP P\D  S! Ѝ0H Ѝ/=@"@ @"1"p@-PU |@ `P aP  PUQppp)O 0H-MhJP OP@ ,PJ<  /l܍0@"h/@"@"/H-M'A Nh`}XqXQX!0m@ NS0㔘<nC   H0 0   0 ` @ P`03P!JP@vLCm0 *@l)P N3CTߍ@"i/j//j/j/F" $@" )@"@"A-M`BO /]P @ |N  lP`00U0($ @ލj//" H-f<HBO-M☒@T@tP`TP Hr@TP@9@T y` 0PU U!00 Va PX @epeTK .PH  N |p@ PPP U7P: " 7,P/ 0 ! +  P  Pp   MpP[lpNPw4pL0  NЍt/<%)t/t/i/j/3x"X@-M@P   kP kЍH/MH-M  0 ЍHЍ/O-MM@  ⌧PsJ ℧PkJ|l |pc2pgژHPa 2pm(PZPk p HP`P ᝦ`A P `=P  ` )P (&VJ yP * @P!FP6  eQ' _P& PK&P P -  %AePЍڍ  RP- Pd I =@"O A"#A"& D/H-M Ѝ M0H-MtP@dP PD   Ѝ0H Ѝ/;A"@ LA"1"8=@"lA"@-8@P ( P @P@A"A"A"O- MM-P/ P/ P! PĠ p`@+gL P* +1L T  ++L TP P H o᠂ Ѝۍ <H}3x"@-@5 R@ (oĔ!@-4@%P  QI"D///0H-PPP#@Q@U xP ut z\@7PP7]UZU$@mOPjOd0HdH0D/0H-M@}QP @$  0u Ѝ0A":)A"@-M@  Ѝp@-PX@*Q `Q ᮑP `*Q@T@p@)K- M@$/iP pP` pp pVQQP:$iP ЍMH-M$ 00 0ЍHЍ/(A-pP`.P @V ! P P8/LAIMH-M$ 00 0ЍHЍ/H-P| p pd dX XL L@ @4k/]B"/eB"/oB"/!/$ /N/0H-@8PC@ 00H-@8P7@ 0HO-DM @`P pP L03/` PU:pP K ` PVF pK L03/P2 剁i(PQ "0P  J PPP$P 04@P@8p,PU000, U X040T \ [2Y1:PDЍO-M8@ồp@W[ Ѝ4 0pS RP p-P P`4Pi p ٌ U*p`pP/A-HM@Q9 0<S8D@ @8 3/P P P`p L03/P `V:  <0@D8 8<P@ D01/HЍ0H-@P= R 0H@-@ (@A-@PA pag0 hPUptpW * 0 SpPW:P pag4PU Q 1/pW * 0 SpPpW:AK-MD p8 P`p@ w0 @ n' h! 0U@T  @ PЍPP DP @T9}DғߓyB"!B"O-MtPB ! c0y uPU p`Kk Pa@PP! @PU! @+p t p@PP P @,T & ߍ0P r@ Q R@T: Q2`!~Pa0 0 p0p  eslQ+`/p  h%PP k Y 0T a0$(^O  N q Qp @X0  P0 0tQ zB" R"d@edAgK"l/C"z P0@ S 0  0Q00A B r   " /da/H-7M(@P`*パ 0 hh0 0000000` PP `咾@T۾7ލa/D0+S ,SQ/A   da/D0+S ,SQ/A  da/G-Mpj W`@`P``D (ki W;#WJ  c W&@Q(:Pa P)PP P PP ŸP lT2 \H"H2kPQ@Lbo g  `:(㲹 PPg !PPQP[ !PP0`KoRIdPf  4'~PP3 P, PP& [P 0 { 0PP 0` PUPލP tC"C"C"C"C"/C"$//x^"P"D"R/B!/B/C"F"F" )5"ftp!C"H-MP" @pbPP uP `xP| 0B`dh F BLP*@T >J[_Ѝj/j/j/`."i/  )@-,000$0 @@!1j/i/ t/t/@-H0 @<0 cF((!10 j/i/t/ t/勌H-MM`p ;@@%p  Pp @ꕐ`두`ЍۍA-錀@P@@@ @ `P p P P  PF@|d zd@H-MM@ ;`P`y%p p 0V@]`tE`@Ѝۍ edAO-AM@ PPAߍ`P L03/P  P@U: АԠ,( X*$  L03/P  X: аp  [ ,[( YY @ 0 ]`,( 0V@P $d ‐0 P`c0@  >p  07@PT `E@ p0@Ppc 0n꘬/@/E"O-SMPP@(崎p1hXP@T嘰fJ `Vc:T 40@ YVp@$pPi (Ɵ0p8`(P<@@YP @ RRpP8  ,NARX=|ş 0<@H1/ pP0dp0@ ppp3/ P@0p, 80 3/|PPP@%!$Q l$ Q P<4  8L0 d3/P@P] P p C 0 7  ßP0 00F 0PPҶ W@p8 <`PU 8Qn4P@ PP0 3/q8r L0 3/, p@D0@ 0| x@T0 XpH, \ _\<@T!a8 RK B!a"p|(PT!B"|A@x8pQ9 p7d 0@ 3/P2 T `Q4P- 0 pW2  0S$ d@0p 7/P ,PA P p 㐆@ (pSߍ@ `2P <  `Q d!PQ9 P P9P-  ,P  J0`03/P ,P Pa0  Q Q Q HPPpZpQJpQ  q" 0  QЍd|PT G-`MFPpWy ~Pz ~P{ `x~P_Dp~PŦ $g~PG_~PHW~PIO~PJyG~P} p>~P~ gt5~P ^T,~P$ R p`(L~ p`P$ V:pp0  Y4Qq$ Q $Q$QzY H48PQ Q`$ Q\ T$Qj L$Q D$Q <$Q 4$Q P 0"HL !HL !HL !HL !HL !HL  !HL@ p!HLR X`ЍG!PB 0 0(2)( @P 3"Q 2 `ЍG!HP"@PP!h@0 2D@0 1(b 0Pb# H!@PPx 0{!`ЍH \ @H x` 0 Hd0S< ! J^ V (P 0<PT!@Q*  P`pdp``I 7/(10  (Pp 0\@P 8H 0\ / ////,// /$/(/0/4/8/ TAE"!/@/PE"GE"Pd|DdgE"nE"uE"~E"E"E"E"E"E"#^E"O-4MPp PD P9 `  L03/PPP` V:&p@P$0# " H  %  0  "^ T ^ ,0S PpfRp 8`q 4Ѝ 4ЍO\/A-@P> P\1/0 ` 1`0F?o2SP) p aP+ 1 `wP! pbH"Pwk h P 1  C0"uw@A`TO-$M@\1/Pp`Q `V` YP( pW H3 0P  (0Y0 01k0<0  08 1V0 010<0  B 0o ŸPCP\P Epp`rPC" ppJ0`PŸP\(P0pp p,g< 0 @ɰ0Pd (`pPV pPP Yp`Vp 8I yPpuY  PW`PW:uʞ`lp0 pP 6P xpP R 2/pW,0l0Pp(1p(p p(+,(Wp,$Ѝ(( (0t/Tl( BD"D"D"ht/8 \ 3x"K-@Pap @`P6 pp Q h`"pPvhp4 (P bI"p=v`  p(p崁Rd`A-M@P `03/P ! 0P ` 2/ލO-EM@$$B-PP~ B@@La`p`Pq WT.E @ P2P @ P*0 簀GCp0@P\ @ pPT00@D00 $0 PX 00Pp PñWn/"SȀ SssssA ⸴  o  0 婳k 3P J 8PP P Lp,TH1/PD `'@@LL X4P0PPl hp@PHD<8a L0 3/ 0`6/PN H  `R L X6/P; X\ 0l h0 3/p-  L03/DPh k Hh 4pl0 0p0<80`  0T@4PAVD@hpL<8 PU:@PD`Pd Tp!@ a@(@!PU  AL " tiPB U Efa"t BAa0  YC۽0  Y-ҽ0ɐ   YDȽ Ľp xPPPPx܀@Ux`- 㿄PxP T- 㴄@ x0PY.P`嗽\\ 00P `p@{Y,Ѝ!@/z }PW P0@ 0R @尠V@Pp*,  (0@ @BPJ(Pቪ@Uߍ藀p+ 0 0R RH <\H @`/O-LMMHQ h!0Q *1S$QLU )P ILЍۍpW P!T17/@P@@ P& PHLp L03/P ,P0PP  ;x`  6/P pW:HLd/T/X/p@-8M@`040 0PPP!2PJ8yPTJJ4 0 0 2P UP@PoQRQP8Ѝp0H-P H@yPP 4yP $ yoRP03x"M*"zF"H-H P!Н/@-M0P /P P@/P@ 4,@0 P /P PЍ\/F"P"p@-@`PPPp@Н/!@-@ ( (P @Q!Н/G"K-M@qPPᬰ@p|@ؐP  7d`P  dT|ЍPppg㭴 #@LL P 0 lv!Н//$G"H/.G":)0H-@P, ,Pa0 0H!Н/F"@-@P@H-M@Pt`tpPCP 72}P`7@ ,2 0῿܍!Н/F"G-MP`cp@P` 2UPp 2㔰pX  0㏿܍!Н/F"0H-@P5 P0H!Н/A-M`pnPGP @ Vt` P`0X0 0^P P P$P@Ѝ!F"Н/P/0H-T@P P 0800P0  P8P0P0P/F"!Н/K-鰀@T& p`wP P@T `~wPPP0PPL  0 PTPe P/!F"Н/H-P`@P 4"Dp` P1 L1`HP/L/A-MM@ ;}PJ`Pqz .1 ¯\Ѝۍ{dЀG-騀Pp@T 删P`YP   0᣾@THP@T \/P/!F"Н/L/p@-@P`3, ,P0 p@!Н/O 0H-@P@ @P@ P 4o0!Н/F"   H- oH- oH- o P/P/H-MP ` 0pppu/ @ 0ppk/DP0PuЍ\!5G"BG"`/H-zHH-Ma@(P<)P9$p 9P6 P1 $1/$P  0@ P P@H!L1 @ 01/P !PRP$HQ@PRP @ RQЍ@d/$@-Q @T R Q p0S@@P@3 @@P@3 f0/H-M(P@U `  0j1/P B@ Ѝ/H-hMP; a!1P@pPPP  P P P 0PPp 0 0@dpMP d -pPhЍ 㺡P/3x"VG"_G"nG"`/hG"G"G"Н/G"G"/H- HG"n3"///p@-`Q  0@RPU @T00Q0SR p 㯱p@s0H-0M@l    ,($RP Pt  PZ 0Ѝ0`///H-R p`@PTPQ uP `Vp@8$ PR P{tXPhG"`/0H-PR00@s@Q" % %!$#0蘬/@/H-@@P`tP $( p. Hd/H- P SR/0H-@P0謺/0H-P@٠( ;P0G"0H-P@P ('2 ,P. 0G"O-GM  wƿP @젟P`쀟p圠P# P   Pp |P h G 56  Gߍ/WH"//H"H"H"H"H"K-M6P`p\- ` P @P SP@T 5P\`PЍI"I"G-!M`P@30q<!P㬁M?Q0P/ p P d 6Pj` vP=P%  P  VPP2  0Y_+@w0[ 86j @0K X@P L 1_4 /!ލ =@" Q! I"/ ( 01 YP 0 0P"\.rdPP 0` ^@L PoЍyJ"K"J"*K"/J"J"J"J"!"//0H-PP@PI !T0,"D Q0(4  (0蔙///@-@$P/ DQ @ꔙ/ !Z0H-@P@o0@-M@ 2Q T n ЍЍ@7@-@P x蔙/!/K-P`P P 0Ap QPP R 0 RR8p@DQ0t  0PIW# (  Q$0X, @!$ % Q 蔙/(K-0M`@ PrP$Ѐ P0X0$ 0S!*    PPPP QP P  R 2S  PP0Ѝ/K-M⺛Y80,(P`BpW@T V `VPY P\apHPW :X X *^PqH^0,q 0H ЍB"B"gK"bK"@-0M@   @ @00( P, 0ЍO-MpP P ! voP0APP S @0SSP`RЍȰU  P0p 0  H((Q $o,PQQX  ;*  PP Q 0er딙/lK"K"K"O-TM@p$<0 4 `e8 @ `Pg $p@pD` 0 R ,@XXiH L08 @R @@@pT \  0@RP WPWtrQ` P P(P8  @,Ġ⺛Y# <0` Q BTPPQQS S S p 8S:pQpp2T2 0`Y8P P  *WY  㽫T$@`TP u 㴫Kr/ @(n(HTL W0 H  @DL 8P @ R<^( (Q $n  @ 0QP  v J) 4p s(p R0Q0  TЍ/G-A\5[@U$ `p R2SRRW W W 0 EW:0R00?S? p`U`\ p"( (Q $gn`X u  QPv (   PPP/0H-@Pq  P0O- M0p4`pppQp@ ppapb@Q w1 Q, w* @TPPPUPPPXPPPUP PP@(P  @   TPD" P%@0@P00@0 pGY ЍH-@+R 2  `PpWpW V ` SPT | RPT ^p  p`" G PL"O-DMM@XP \P `P dP hP 0PH (0P 8pWQ r 80`PPPQ PV`:pWp rjSp9 0:W` pQp S0pPPy D` P^ `D 5 1\`0d *0h 0#X  P( Q圱圡!0ap  p PP p0 @X  X: 0D@0PoRDЍۍ 0 0 0boll p0XX X0o^" B)!M"&M"5M"YM"pM"M"P!M"M"M" 1"M"M"lK"~L"L"L"L"L"L"O-$MMPP @$ ;ppgp p0 `ᶥpTHL$pQPP`PLUXPHh$PpPPp p PF v P P  P'q P  % 0P P  & Q  0P0P pZ: PEP$ Q:P a0rD`V `VpWs0CQΰp$ЍۍpedAM"O-Cm ` `GD @ @02C(@`EЍ蔙///#ZK"0H-tP@PtD  Q "PDQ , (0D S Q4 p0蔙///O-$M H L rX0`0P\pS YQPpST@0Q^ 0  0Wi Pp  0LiYp [Pp   ^ T  Y P `  PRT r 2H`VPU BZG`@d0P`@@& @ @S@@Y@@Y@ 0VP`Y```@S@@@` PZp^TT@ p 0 `hPTp ^P  pY8 P  P   p  p^TT` @0 PphPTp ^Pp Y\q:p $Ѝp@-d`@PP`0rRv+Piv@ 00  S@ p/O-M 0QA q` P . DP@UP U Z 娰 @ 0`;/PwKoo @P  @0` p1/Ѝ/h!G-@P# Q 80 Q3/P41/P D0/P@41/@K-ƺ묀@p Q` 0/P``pWV X`嬺LP  TR!HA  qK'$!//p@-P@Q DP`! R 2/`V: p@ //H- M7p40 @P UUT 0@U@@P` VVU@V 0PPDR0 @0$`P0 ЍN"F"O-|M1/H1/4l0P1T!sP 0Y[, (0H4p0`0 (8 , `3/pPoHP k80pHL4T0P!0 0P X01/\ 0p3/pR H L03/PJ QE H L0pp1/>H@$ $p4 80 ( ,7/P\ 8<RHLdh 803/\  p0 @3/p 0[zpp|Ѝd/O-M@P )`Qc(P`TP%5mjPUR Qn ,0<ᔅ 0 0RpFP0pşp R0```Vp &0PHpTPPP@H@Q>@ LPLPJ=P `P TPQ `" R pQ 2 !0PpW:T`V:P Q @TP :@PP8T@PT:P(弣$幣嶣c&3pP"0 @A@.`!09$(0  ` $口$剣H`@PPj0S @8 3/P PTH`He/ pŸ p2R0 :HP ,o `AH  0` `````偗p^ Pp,=ėPR P`NKP ᵗLob@P P  P+ pPH` L03/P PU:X\P P`=V +`P wP R 2/@`Ѝ `5T0S H2 %d//!B!/$44/0//N"%N"rN"N"O-LM@ PpPD@( 00p6@000Ap- 0@pᇓȹpP 0h Q* ,0p 7/P, qP lP0@屹||0  PoᠹPЍ&)ԏ40/O-MH`@PHeHVP X(P 0Ÿ,@H1/p`00PT ez@@TP41/d 0 `WQT8p pp3/PI H8P0`<(p,p@  60  0吒p) H@PO֒P H4 03/p4|PH@1(0H  PPPЍ萫!@!d//ԏ40/O-CMH@pP l`P  P `"  `8 @ e pȐW3 ㋶P @X,P<   Ro n/ " A0    0pp ˍRᓸPZ,PH 1/D@P`p L0 3/ PA Pp`V:pL@38P 8s DP4@T@0X hP<Ha L0 3/ h0` 6/P> <DP `R@ p@# X @6/P( X\0lh h 3/8Pq  h L0 3/< h4pl 0p`D @0_Vp@PL[:`@B &,  PH≿`Cߍ<0//O-MPQ `$@@`(噵P `"pN]U $Q 8 Q "?]@p@Ѝ@!H-@8pq X R 2/P Q8q5 1S ` R   `0SP P $0S ``0 3/< 0 2 PQ`$PPVP*88G-M0PPWCwEWPo=WPy f4WPz ]+WP{ T"WP_LlWPŦ CLWP$ R p`(2W p`P$ V:< 0 RZf ȓ$!|qQ0 pq|R8`pdp``J 7/ $@P(0  9@0 \^ @0 S^ ` 0 P0F^ xpP0` pPL `p 0Q $0ppލ,/(/0/4/8/ 7Pf -P\@+T0 PJ( @+y0Pz P,r PP.묰 +^`ܠ@唐`p  0k5BP  0ܤPE u P % Ѝۍ&4P"=P"HP"ZP"NP"dP"CP"nP"wP"G"P"5P"P"P"P"P"8"P"P"P"&)P"O- Mp`B@T: PY Y4PHP, pQ:  P  0 qp|{HPP Y Y 40xڳ@ ЍP"P"P" O-MM@p/PP PpX`P` P "0@4+ PS*A@/VPP `P FQ Q/R ╔P8JP  P) P Xh  ᖓP&J/Pt!0@4+m`+h PfP J P+\ P:y`?v``@႔ᄓo`@PЍۍP /PP) @P`P 4SP1S PT x+ P*+ P*QpQP:`>7`@@Pꡆ"P"F"3x"H-Ip@-M Pu@PJ  @PJ P `$ V P: 1,qQ0OЍpO-M080 ` 00z @(8pD DD DP 8P 0T 3/P[ P. 8phAg"80s" 80` 0S ФP L03/P hl ! PU:P8(P"8PpW: p0@p` `%0000 ,`Zp5d%XupX3@&T  R q p5@`TP7 K50 `0-` R4@$ X,`c30P4$@,p0@Tw  00`Xh`P:D00L`,!<HHAC ` [P4<xP@[P;8Z CZP p Z 8,p0@ [*!k8q  0 .0, 4 0@p0^0 0 0 ,pk0CVJ9#X 0 0h@@P™  `P H 00@ PXv@VSJr%PoBd{J:$(8<H1/@HpL 00 /o" +6 0  PQ`YU`C0   S 0 (0Z( 080S 8 0 0Sp 0 p @  @p `P0`0@ pt P @ R0 0 x R8ЍC(8!z P"/@/F"d/="3x" B)0H-0MP   !0RLd @2P6U7C @" @$P 0Ѝ0蘬/ @/H/H-(MP@Rt,(P⡮(p,p10 (0R0< 0F0P0 000```Pp'p, 0,l(孰0bP`(奰(`(ЍH0̭PH/I/G-0M@(@ \P(p U d1`0 p  0`Qp@810 5! 1,0 " R Q P ` L03/P  P U:PU  0`Xp PU@P2,p(EAᔉ(E@0Ѝ!p@-M)@ᑕP7 P 0`000S0P`pP %+?@,< P0'1  ,+* P |p*" di-0TT Z@F1.44 40 00Ѝpv" B!@/z I/P"!G-pMQJ@PPe : 0 ` V " 2p 0PW":0 r`T Pv#Д|"p` \0 6WL":0 w<"J&0 ,Pa 㲔p0"(H0  R P5 ` p=TX!p!0 Q 4 t R8qT TX`  P  ~@!p(0i0 p s `p  i p( 0T0 p`+0 0@0 J p\V UpЍ8=0p 0h` ?p@ (02/`P ꘬/W P"VE"Q"z Q"Q" Q"Q"O-M)$qQ `W W PQ% P!T11/PPP(0`o"P Pp`H!L1 ` 01/P p$qP P `pp@ L03/P P P@ `V:@V?@ Q<@pR  7p0S P1Ta(h lP`0 0S h 3/,}$P JP L `00<Oߍۍ//x/H-P0S@`0'@&0 ^3^/G-0MP$PY qX R" R Ÿ0@p R  @`VD`Vi @H0T:! R !Π p0S `P@TT@TD ,p! W0Z.:\PL HΠp ʌ@@ 0` V P$P, 8 0SW @p:0. Q p @ L03/P  $p W:XP XX @ 0Ѝ茺/\//8///@-PM$!@ * N88 8088L @PЍL/G-(MPp`W1 VPYI 0`0SU 0,"C5 ( 00  0{@w|^ (ЍG/X RTpLHP0@T  @Ppΰ(Ѝ p :0 0S O +&0PU  nFP QU}QU/e  +PPQTQXQ\Q})<, K "F P a/Qb㦗bsIdZ [ `tP }AQ  Q  Qa/@T[V  0@X p j  qP)1  P#S  8儁`Xw$Po pP`〰 8 U6*L0 3/P, 'P$ _Z& 0    j Q$80   V P 0$1/``$PPV. pP P L03/P P _Z j   Q  8 @  PU: p| @ TP xtlzhp| h0 |XT\| T0 @d@`@$P  D ,@  0 ,, , P H4| @0 L@<@8@P (${ | 0 | 0<`20 `00 (Pd` `00QARQaߍ蘝//S"//P"////PLp;`| l f8P@T8!(0S )  8 ,S8(@$P!,0S d)  8 ,A88p!00S )   ,08  0;P,p@0`L8P  R8(,40y0Pn0 0`V  T(y0\Pn0 H  ((8(P 0 9  'y0lPn0 +  ` P  7P '  0  0@7 PP P' 0  ,@P0LS'   T0S&   X0S&   `0S&   |d0SP&   oh0S &   b%   V8   0400`0`Vxp)(@$PS8   08Sqpq R  R   Qx(@$P,8P,Q@|P 䄟8p;P84AP 0P`VF $ Q?  L0 3/P HPXP$ Z:)  7 P/P 7/ P 7  ᝽P{8P 48` 6P46UaV{V 8h<P4PP 8`x Q64# 0Pc 9P ᮣP 0 T0P市P(80448!0Y| <\b% P  .P 0P0PPUOPQ 9 9Q Io0F0F PQ @P +PPPP x < P@P < PP t ߍۍP///S"/8/T"&M"DT"ZT"hT"vT"T"1"T"T"T"T":)%T"S"/\/T"8U"S"//jU"U"U"U"U"U"U"U"U" G"U"Q6"PH"U"U"U"V" V"V"V"!V"pP//P" !P"4V"vV"V"@-@ĭ P P @菆踾/R"p@-MP& @$PP" 0PP `HP L  05/PP 8!$QH`R UPPЍpd/H-8MP8P= 8@AT5 P1 $qB$Q P ^`P``V Q  P ᗭ  { P A ᔮ 34|8Ѝ 0m @R"R"<_/G-Mp8Q 8A`Y rP $A1/Q  01/P P1/P$QPH1/`@0AW* 803/P <0S  3/0X `````3/PppX000  3/pb h L03/g @  p PA @` L03/P |Qzp `V:W$:P" `p㘀 L03/P  |Q h l0"#v` pW:v ` ``C  [T|Ѝ$$ $0m 0 ?R"R"<_R"!/p@-@`PQ  D@ Tpp@<P PWpp蘝/O-$M\)ĀĠ@`p\  0 PU PPU 0P 0`oPU I=P Q` V$ЍOŢ`$Ѝ0"/H-M!bAP8 @Q`V P  ypQP_ q`P x ⫹@PPQDt-iAxhh!h1lq`Pa Pp paWP@ 0 P`I& 0p`Pa PppP`a 0 Pp \`XPp@88 80 `P#PЍ蘝//d/S"1D4d66L $P P>0G-(M⬂`p-W BpPv1PPpG wppV''(X((()P)) @v0 { @v`QP !0 69! p@Z@v`Qvt g0SP  QvD!0 p@: P P!$1 p@+ P P (1 tp@ P P ,1 ep@ P PL 01 Vp@ _v(0 ga(Ѝ訝/!!sF"O / K-MP P@X***<+T+x++++t,   0 `P`` y /P @ !00@/QPPgPoaPP]0,!<  0POPoIPPE o @ PP< P9Io PP2 P/Jo PP' P$Ko PP Pn0\ p 0Pp x TPWPPލ!d/2"@-@Q v0P p$$ PUX~/@-@C<P < $1(!,048<G-MVP`pu @VI-.8.`..a@p@PP   8p@T@)$* @Hu 0!(0S /@+,0Sd %@ 00S4 @- %u 0)܍;S"1S"!iO"K-JMhAPpo L  0  0pp>iQ /`l(@/////D0dP,P* .  0PPw#n,@1`l0@0d )p 0Pp wSPWPPJߍ<')')!O-4Mp`8` P`fA`P $$ L0 3/P`8@ V V 4Ѝ@-@$;(,04+;$Q"d  @@苭Q?S"A-BM@VP`et 5 V2(2T2p2222383\33333 @Lt 0m@Et  0 Gs5 @9t`0c6 @2t`4\7 @+t8P`.PV#tPd 0RX0SH! @4; @t`d99 @t \0)`0S :h0S @l0S =p0St >@ sP 0 ? @st`Qs0 Bߍ1S"c!!;S"RS"FS"K-MP Pk@ C`lXp4455455l55555646L6P P!0,!< A 0A0Po0;4Po458P BP  0Qv'dPod!o\p E`l`pF`lhpG`llp0 N 0P  ,vQPWލpP PptPotPP P!d/@-@ Q.QH-@ P`ppp p/:@`gᇟ$Q"d  @H+Q\S"p@-@MP@PJDP R ,@! p``P T X0P @Ѝp蘝//O-MM?xhX0(P pW pW rebq(@@BP   ,0RoU  0    0``fp pb#ghPJP`,吁!(Q !C A ,R㐁 `  `ߍۍ褝/xO-P{J( @jp< $i( P@Z% Z pZ`DPW 2E (\p```@\PppPl"(0C~ 0P6 <";{ P""035Pja$ >jpV PY$  P * ΆP$D $ #jp: T!0 pwߍۍY' @$% 0@T T@c1P@Bo4 X@ i [:$IT( iPS xh@@ @0,, ,03L!oW"yd|d{dЀ7"U"V"BW"VW" R" B)h@-0M@   @ @00( P, 0ЍG-P0@p `P `Q `` V R:RKVI    P PP8# 0 0)" p 0'"㛅P  P-  40pP ЀX $0vpX/O-lM([ 0  pX  0p\P+ 8P+*`0 d40 P  ±EP& (p;0$0 IP   C" $p R0 "[ p[ u l[PpGplЍP PW"0H-@ PU  Po0H- 0pS7 0P@Q U `PQ V*`UU U P Rl040pP "c  0p@ " X"O-GMM@8 ;P4PP#P!J4 `rhp  g0P# P 0ypp PpW pW` uWPPPDP 4` V s#4wP商`U04X 8008,D$( 0`8p P#w؀Xk8P2 PPZ 0 #",  #"M(<8P h vP>$D B/P 4 vP1x@pW W   iP"  aP vP 8 R |8]8d08 vP PJD[0`V: <@P1 DP 8 <880p W P p8 Pp8 pnv@    `9`V0   ᖹPGߍۍd@fX"mX"~X"X" Y"%Y"TT!BY"X"X"X"O-_MMP|P pP 5v@P _ߍۍH@'`Z0u@PHQP GDh(PӒpϒPd T 0,`@f$<YOp84PpHLP\e`ᬂPG P [ [( [TP*T  `/\  P \%eXePP    PX  ғP d! 0  Ǔ `T`p  eP P  P  P \P8PdZ 4 @ $8H@W$,L 0HPp<4eP X\s㈂HLP6 Y P0D` T0T `PP0XԐ84\< P -T P  Q <p<(ݑPd)HLPp <@84,0DP<h 40p8@<8@c0`v?E( D_/;` W/ ,0`0 R 4P @  PPPQ088P`8pZ0W PP0@,0a[/ 0pleP<t}~Ppql0 [/ `e`P(x\% Dp0X  !`Ъ040 0#8@ 0#  R `xp W:҃ dD@7$$ $0 D0(/V"Y"Y"/Y"/Y" iO"    ?!|dY"G-0M@( m`P HrP PX`TP|8`P&&q% 8Z`0  $00Ѝ 0.V"Z"#!/ /H-0`@V PpDo,P j,P `pV@p@-P 0P@U  O`LPVGp@D 0.V"*Z"3Z"@- @s@AZ"A-PP`@pW P'%"O- M0 >,0LQHA04q8aF&W X   ?V   T0`  R Q  0 p?`\p`  ЍO/ Ѝd/UO-\M RV sdLA p0P  P0VgA`@>PQ @0P y P0DgAp@P@P?HL P PU@P % 0%/%$X P@10`d5/p`\Ѝ!d/@-@P. /0H-|P@Q$ Q0XT D 0"!Q@ PRUR0 0/p/H-@P*p- 02 H?  0E>)뼵!Z"D["<_0H-P@P |T T TEU P *P0T T 00 0 0/p/Ե!0H-MP@P  8{PPT  bP @"QQ Ѝ0QЍ0H /p/Q /^ p//0  S :H-M 0  ЍH /ᜬH-M @0 Ѝ 0 ꐭ0H-0MB"0T00    000&P0Ѝ0H-M0 0 Ѝ̭@-M, $@0 0 @ Ѝ(H-M0 0 Ѝ褮H-M 0 Ѝ$O-WMM"XP0`p @P t"$0 P$`VWߍۍ刵P AP*[P ,"@Q[ " " 0G0P QD∠ 娰X\`@dPp( !0@0 ;@@@PJP P?^p\w  $`刵P!1 '  @(`@(P L03/P X( \,0"# #" 0@ T:$`0 0xp 7/@j@oW"yd7"U" R"Z"^["r["p@-M4  ?0PBT T TT bRPU 0 Q T TT @  0O PCЍpO-R R@> 2 pTЍp/Z"<\"<_L\"["["O-tM8^Pj 40@ SD0AQ0R^C0` p@S[ PPTTT  rp 0`:T X0W0-0Q0*0@`@VD`CS0`T 0@`@VD`CS0`T @0`SD0@P0V^ Q @ P`P ``P`  T1^ [ :^ q0<w?02 `PS0p pl 40lpp0 PJlPU4 R8<`[,P  Q [  0Q0pf 8@< 0RD AQ 0pS @0 SD0AQ0R @ RD @P QmB`0Dp  W T `V`@<`8@@D40  P8PP!@ "L8 PQ o PQ yP  85 `p0p LQ Q= `V@  @0D (  T, @% @0DP$00(PP0Q01Q U, $0"[  PP(PP^  P $040vP 00U 0D@ ̌pP T" PpPP P0H`Q V Q QQ S p`@VP  RtЍ`@OPwPUw4 R$; 0$#p//\"Z"\\"i\"A-8R4`U @w@TwR @#2".H-(M`Pp @# 0 @p-PP  "0P p0`0p`007/TT (Ѝij\"G-`MP@`U0P0pWk40  F P UEq0` pl`P1/P0= (@K1/pUK  y# 0Q000S 00     p`H p P/ 0p0 0`D p  P 0P8P<`U`0 40p @P1/P0 p2"p7/0p`Ѝpp/h!O-MMRU ` pZ %P'+ 0s @ S 0/; @PJ| -XXp UX,p4p@`<  0P`@ @",B&T(@P P $p qWP< <P@ ,`@ P1@őPH)0U84 1@( PG  8@`E?4A@?@[(P 0D{ 兔rU Z, 裀P,Z1 p@PT8*  P呀p P @,   P~pǏv '@`$prWV8 .V8@oߍۍ@@ @0O!(0 40  0D!d@Z"]"<_]"Z#]"O-,0`ĢP4`@!8 ;PJ4dD(pPp@,P P PP P! )PPP P  `p$0 !R RR.R@0K# " ? 400O@"@B R R R (0"r" " 09 0YR0pW ,@$`PBrP T `p W,4,tpmoP" @0g 4c pP,| jt `0 W UPD (pX OPtPUt4PJTz%  P-"P(8 L03/PLP  @RD @P Q1/  @ U tp<Ѝۍ$`(p 0Z"]"Y"p/K-0M8ArP/ @P`TPV ppW? " `p>,0Ra V0  "P 0τt@0Ѝ 09Z" ^"Y"!O-TM $H0$P L0uPHJ0H 4LP`P0 4<($D @0^P.J(< ?P@ˇs#,W'(t(@p;)_,! 0!Dp_G%"@T'"p\    03P'"X$! `VQZu  吵" ?g@Lp?`HL Q pWp  S 0P%L1!#*P 'P\ H0$ 0PJPPL4p 1!H0  0 "`V  Q @TЍd//p@-8MP HQ2"d@A` p 8 P2  L03/P*  ,# +"+p  @0 0@# A0" 0 t`#2 d""0   #<",R*" P&0;8Ѝpd/UUUU3333O-M4@pPo? FFPP Z QPکPW   pP pP JzPP PBPTW Ѝ3x"G- 4pq>pW(PT \ (0 ?@`RU U UU R, @"0R Y W P  GP:Y W ᯉP?6"R 22  Gd/4GO-MMPP TQ4pAn 县 @P w  ;㙴pp  L S@XpZw oR0P 1/ BT _`)r`V$rOP rPUr rЍۍ 0k u{dЀZ"^"3Z"H-MM@0P 1/ ;Bp `PoP p Qq!RzЍۍO-M@吰px| Q94`0`H pG0w@0P@PЍ0!p/#ĝ//Q QR 0+ /Q/ AR/1Q/Q//@-@<P T$Q @/p/K-M─ Q @4` 0m Vh p0(@DD0  p"!@@@@Ѝp/#ZK"ĝ//K-M⾀4 pRAT W* TpTY `P@T U T TT W pP`UT ^ D0 08Q 4PU" pRUUO`@n`V;n4W  4 ]@@PXRU PPO`n`Vn8]"O-M⾀@p_`EfPP V QPکP"0@LKQ RY ( "  `FpvPP P[Ѝ @- P0r0222R0+09 R  @ " >,Q " 0Z"]"]"p@-ρ BP  P`QP?@0P`QP?@ `@ 0$b #b0P 0pO-KM`P;㤕Eu  LpPePfP lP zP6bP eP  0}$ 0}ppW @T  CMp / Z8 X6T4 <F !*,宨Pl NP$   P #`@p kPI $ x#p]plZ' IMpʔPp|KP(M M$L(L#0P 5$ M$L(L bŸ2 pRp@ Xpf@ p PF/3Npt!P  gPt pIMpTsp<4$[ AzM$L(L !L  ~Lp@P P( VLpxQ P 0@T kP 8$(rL@^Y `   R0q0 P0R0v 1DP V V A Y  lP@p0x0_"Q0_"š 4)_" N`"D`"ht@:)00000`"`"~`"i`"`"S`"6`",`"`"_"O @-M@ 0   y`":)!H- qM HK@-D@p7L0PRw@o@')0O-M-RMp VM&| ^Md~XƟ`@ R0`RW,F`0&W@A X ``eP= p P. 408 6L P.rx P .g480 LP  zP u 0S $ \@T2 b A^  A$ @ ( _dUdPh0>`pQ-pAP  pGW<<$P`@*p! 0 @dpll0< p D0 @PpЍp ys"y"O-lM K @oP `2p- @ p BI Ip UHp hP dIh" HHp Hp  [ 1 4 G I lЍ - 0 |0 x0H-@P q 8GPpPPq (G1 p000H-P@@Hp@P@0p@-pM`0 @p PR Gp @GpЍpO- M@ w`p jvp tl0Tlp0pPZX0TPZPT@ @Ph0P; Ѝ!s"s"!"s"Hp!G-MMQ-7QPp@ ` V} PZp` FЍۍH-MR @PpP `V  R: `QP 5d`P.`P  QQ*dP  P 4  pp `pH0   P`@ffЍLA-MM@ P|| 6 P1`    dFp* P ` `P  0 @pl ,`FP pp^ P Z9P H<V bЍۍs"s"Lys"t"t"s"p@-xMP`@S  j  HFp/  `6Fp$  0Fp  *Fp  $Fp  P ! P0 Ap 8, F ~xЍps"s"Lys"p@- % P ( DZj$$ TPV  QpP$%%pH-8qEp,qE,ЍpЍp@ P P P H  84@Ѝp@v Ѝp@o F 4 z"Gt"T^t"{"p@-@p8xPU L` Pc-PUp@0$ p@tX#{"A-HM@pPP M0@$2p` 0P ptU @ | =l Up  HD1HЍot"t"t"A-@`5p$   11 1  6  rD Q 0>P :&P jP P U e0A-(MpP@`R6HP$pP8 Vs P !U LP pPM` ?6pP P P bh5D PK DH!C H|,(ЍAd P9 P6PXP6P tL'(ЍA[, gU,CP $P  LpP 4yU(ЍA (ЍA8t"t"O{"t""{"={"t"t"'!@-M@pM0$n1p   ) SЍh{"V{"H-MP@p8P= + 0 + );P  0 `xQ Q RQ 0 0 R\  PRTP IЍ ЍHu",u"{"@-M@pP Q  pP t 0Ѝ{"@-M@ P Ѝ HD  X P Ѝ@#@-@:d+LP POHP P@j+{"t"'!p@-@`HPp P$  PX: !$P p,sA 8p kp@{"K-M@q & ` 0 pP2 PP0 px P3 @ P  > $> >$QE **AxP @ P | t\PK JH"Kp7pA@ Q   x@ Rpx DH!@@ 0@pV A PHQ   WP:b Wx!IpЍou"u"Xu"8u"Ou"H-@P `pxt , ,B`UP{* 0P P:H {"g{"O-MM` *0=Cp $$@P+A` !p@Zcv7P  PP@ `Z P\!`1 pPO PxP `@P T`V* @Px  0Px` xQ@ DH! 0 ` `VoaxZxP ^xЍۍu"u"u"Mbu"0x@-@ xmP HH R$ @]@-@@?A-@Mp@PR `_P V :Q07  @ЍAP"R P 0r>pWU# * ĠP P `* <0C \ pw <09 8nX>P * x@Ѝ v"'v"Wv"tv"H-M@`8!QQQ)Q7 Qp P[ЍH QT , @pN||ЍH_Q" Q/ QQXtt!(0 Q< QF,,,!@p0ЍHB  ! 0P AD!\H1Bq P0pP  5 Ѝ@LL x@T B@HЍHs"v"v"v"v" w"v"v"v""v"v"v"v"v"0w"p@-M@ 0OP* `HD1 B8!@ 08P0@00ȌP 080  P 090 00 Ѝp@`ЍpO- MxpWB 0@ P [ ` P P PY P [ U) PP! `S(   0? U    ZQpW Ѝ{"K-PP&x@T P Y ` PP PWPY &p @8888Ѝ P* Y2x@T B@Y xt P Q W 0 *0  Y@  0$@ xO PYGw"Xw"hw"xw"w"4)w"a"Qw"@-@ P   P@:O-MPP4P0P @P P" 8@*9 ?/8" h0,d4R">pl >pe>p & [& NOo借0P   0Peo?PMPp] 4P- 6PN@Qf@ Q&H(8h$  xP$  xf]x  t`d~@K,P 5 x; 8P K| 0:`P- 8 0.P)`VO DP8@ ` 0P P8 04 ,( *P Q <,8+00 P' 8 弁 @  ZQ V * `  @ 8P =p Q P_ ^ ; PrOpe PP 8ⓊpP:   @<PI  @PN8= p0 !/q ,@T5 dPP0P`:v`zVpV*pʟpp8+0`m Pj4  Po#PfH0 a 8 3@ $PR P @,@8p  849 P Q R000 # \8 LP [$[8W[q (<8P, ]P [P@1 W @dp  x[[ߍ, ;pD xj p8%z9=pP p4d(X d+=pP 84(J 8P po8  $ H@8P{ - ],p!/,p /p,F @,8p  WP(  6  pp ,6 pp$0S ' pB 2PB p]<hTT] L8 @j,.8 MP $PERQN P ; P L@,Ep 8p !:$(d1;d5 Npl;p ڷP p @,@!8娒($ Ad!;d4 ,p qP0{P@t$ 4 08pp[ Y+&pxLl4 pp$A!1R84 P< @PPcs P P*!PUp,PW  0S& QP  p<8\ ,T @@*;w"!pW P P   PPcpW!84` P! H p4p@8 @`V p P Pp`V`10 Q `VGw"` @D')w"` @ ( W!1 R  1` a"w"w"Q0p8a8 `V P PR t<`0p`> *>@p耼H-M@pP tq^$"PF(P pPpPOP QP@!U8 >pQ: `l!R pP 0DP 00.'p$$lP >P p *P> i>'VptqЍ jx`V >P`lP x[>P p *`> @>p@ F ""O B"e""9""/K-PE S `X!1Rq@p ,PU Q P P Q   PPP U Pp@ `崑U 0G΁"}s"""H-P q R 0S gd U B  0΁"<""H-`?@_?PSP*@S0p0Gs p $pP00R0ʚ;H-M\J8 ^ 0Ѝʚ;G-PM PUO @`SO*$(p`W P P p0pW P 4 PU Uj7gV)@T @`Q T TPUA @>@P@ <0c 8 z> "P> *@XЍpς"@-@T -C@A-M`V @P P  TP Q  0R p 8C`VЍ 9Q/@-@T C@@-Q 0s0\?o B/o 0 Q 0Oo0C?oB2 0^0R030O-aM0@p`FP @KPm pi UZg  NRpR$P  PP aP ZM@T rP @U @hP @U@Tu  T@PY( PX ŸP TP UT\X @` 籟P \@T\X,LP P 真P L[LDo,  U( Q [PI"P $PR$PRPLPH (MP @` , X$, 0 @  pp a0  @Dk1pA@ 0@S/,CP !5SO S1 >,TP5TdA(ThQP P@Tn!P( $P,SʇCP#:SS S (XPp X (@L TLT@, 帒*> @RX p !D Y!pDL}D /! 00H ` K D@)Oaߍ !"iR"x" z""H A- MP `P @ P P P:'` Ѝ:P `  p8W p8  P  !00:P PPA`p ``0`P iQ.Q  ` ``Q4 B)H-@MP @P`R ~p `V pT P P `V`@Ѝ xQ/$ /p@-M `@P  gT0( 0@/pЍpi~iH- M@0 P:`V 0 PpP P R: R #0`P`VxP Q F Ѝ.p@-@ N PP ` `,PV:P N($P`P` ` (`,PV:$PM$(pO-P  P P 0 s\P 4P S  ` P`Ap` @R `,@V:@Mg@ pP ``,@V:@LA `0 l2p0<@  8p0 @` R ,P00 oP (,8@p80P4 H4J4`Q P @A P P2@P@4@@[ U  *BP P0 P: P@ $PM WKxP [F 4uP  P P  @r\P 4@ R @PT Q1 WPPT KP $PT $@PPx Pt[p, (0@Jd` dhLP @4hAdhP dJ$P W L&pP0! R *B <Ѝ؍g"0"h"a "Q" ""G- P@p`P `fV?@ QZ 0  GGma"'"kfQ/K-P xP Q @K@QKP Q @K@QKx؀P@TS PK@KTKd`UP ]d,PPd`UrKlhUP Ol,PPlhUdKtpUP At,PPtpUVK|Q @OKP|IKUP &,PPU;KX9K K6K` P T PT@PH- x0\ 8%Aˌxq   0+":+ 9!Q 0\ RH@r0 O-MS pPQ`  @+N@0 \p 0 P @@0pU   `p` Ѝ4)a"w"w"Q0O-4M@1C`~PpX` \0X@FffLFfXFffffffffff`FtFF GGGH$H0HxHHHH]H]hIfI]]]LJJf8KfffffffdKpK L,L]]LLLLLMdM]MDN]PNNNOPs hP\ )EB?\ ?;eRBp 0  P 0 P 0 0 P qgf $\b [` PPUP P P0E`A  p!V0PP \{ꐊ""`VP P PF : P@P p0!p  pp pU0P  se"6"\  0^p i s" Q  Q QQm%T#w"|""@TP~ P PD0  p`pp` p U0P h JPQa Q Q@@@QZ  Q QiQR=P p0    @rU0 R0  0P[P* ' P  "1N4'"g?8 gd k / `@P /P@ T `/P8 `P0 )h`P qT P P P.Pz PD')y"l""e#"pPLP LPP @LP LP LPH  LP  LP  L@P  LPt  zLPPo  tLPq  nL Pd hLPr cLP{ ^LPy YLP TLP OLP JLP pELP `@LP PL:L \UP. 02LP -LP (LP #LP LP LP uVQ  Q QVQVQ<†"1`B@ P> a6 VQ8@@ Bp ;P 娥 %q .VP0 9 A 0{p hކ"9ƒ""`@p jPA \ jPL H zjPm 4 tjPD  njP>  hjP8  bjP2  \jPR  VjP5  PjP/  JjP o " VJ Q Z`P>V &V P8h * C`wVP .3EI", `h1PY:7V  %`P`q Q QQL VPUP P PEQ  Q QQ@P` Q QQ@@ P+P &P !P !cꞈ"!cT` P Pq`l 0p pP:, :>   7@`h)A;A  0dp P @h<h Lj"Q Q QP$` P P;P@Y`P` P P2P1Qr Q QX\fh;0,A;  @:0A; 90A;h^A[FQj Q QZF@,0 ?p$ ( 8p EP ,P| 0y 8(v  /@P     E@`Y`T`^<P  0,LQT"R @P Y Pl  P   84 @ W V PQ  Q Q Q0P@t"Q Q Q@IP P`4ЍB P $:ފ"$ QP `0S0S  ,PQe"RU, ,PP $ % $( X AW @` +d`0\pKPe  P^PP[FP P PVFF=VI 0-  ?0uQ0,Q9 ":"V3 , #`pp Pl P0`0da8,^ P    P P P\FkS}x  PpV /P @ "Pbꛇ"P_$"" х" PRꆆ"@x JPT" 0 ``` `P0(Q  "TD @P$ꥉ"(X{ `Db U Ub" [ m"\ WǑ W\\ꞑ"V we@ y"̊"Ɗ",+"$Ԋ"l"x""A""7">"D"L"S"[" ""!""0""""g""!"?<" # W"݉"lj""""‡"χ""""""!"+"?"m"L"0"" 4"O- MP`pr@"Py"PP p U [VQ UP X` ~*`VU\P @mPsPnP9 rPWUY UUPTPR 0P. bPHUJ FtP> xP@ p 0pp  0@  P5 U 3  S].U!   0RP P  9]U P U U P X: PpPPU [7 Ѝ B)O-MP`<P6 =@<P5 U ``V p=*@W /fP! `V? P @ 㨢P5  A ЍЍO 'P P p_? q\p Y=P      ЍO=?" "H-M@PR `P /ĿP p   5Q &UT `` pU P W /G`T -PT`U 0-`Ѝ"0"G-M`PvP B<P jP p P @ q +<PPP<e 0b ^>>Ѝ G"K-@M @P  `  p  )P t t@ЍG-p` V1`@P/P X FGZ : J 0pQ00@T*H Q3/K-T`V0 TpW1 @HH Q Pbqp ||PPPP DDPQPQP3P/PPP)Y $0 0~N"i""z"@-@c g@h"(h"@-@P @H-Q# P" gPP# @ P ` TpP`W9P $$ (03 052N""""H-P TP gHH= 0N""l"0H-P @ PRP T 0H0@-P @c g@ 0[N"""0H- @2P P}= &PP00H-P g_ P @e7@P 0@ 0[뿋"N""H-P QT$$ $0 0N"Nj""l"@-P @PT@ 0N"Ћ""@-@OP XE@H-T R H 0tN"׋""H-P @ c_P ` pTP(`Wp@- MQ @T R R! PcoP Pl ` 0 Ѝp<< D0(( ,0& 0 !"N"" ""l"O-MPF pQH H< @ 8P < uQ`TtPP PGP CP V  VH0t00V td\ 0 ЍHH L0 44 40 붌"Ռ""="!E"%" ""N""l""O-4M@P$dp P XX$8`aO+P $ |bP Ġ$`  pT Q  P P T8pPP9PPP [YTc|X P|TTQ88pP3  P P P P \`P TT R8 8=PYP XX4PxxQDpVP 6c_ 4P; ` p(`PP*9PP&m EPT P   p P {P V P p@`:gP _`l pP$yv4Ѝh"h"0">"G"U"""k0Q03Q/K-Q TPp Q 8P @PnW>W+ | |TTQvPttlP88gPM `q p/P+ @l)P" `tt TTQ88EPxx@Q o᠒I pP D`; pP @Y D,@xx@`$$ $0w"B#"""N"d"k"H-P Q/ 0;"""H-P Qz/ 0Q"""H-P Q Qo_/ 0}"$""@-P @Q QoBD/ 0|"6""@-P @Q Q@@oB(/ 0`"D""H- MP6 @PP 0@_oP!PU ` eP `/PpP `WP ` Ѝ(( ,0 0'0"S"_""K-PP~@.`DT ǁ /Yi T dD`QP 00"w""0H-P2 @Q4 PP QP P 0Q QQ0s/P@o!R1 AR #P 0Hx@0$$ (0 0""Ŏ""p@-Q( PR* `@P P pQ  0p@M 0 p@wDH 0"Pp(( ,0m 0nV """i#H-P Q!. $$ $0B 0"ю"s#"0H-  @P]Q08h"a ܎"O-TM @PP@tpR P P0>tp@@@@KtPU A`@?P: @PUPU @`@?P: @PU pt  0PPsU PP TЍ@Z8@VD*p^ [A @@@ .Z:p WA @'*^^@NY `Z:`^ ^ N V"`Q V`FЍtq7nO-Mp@QPh2 @`X2y[ PkJQp a Q @YQ& \Y PJ /\Y!V< WW\pG`5V/ WLH! pG)" `( P /Y Y V W50 )\0!00 0000pG` V W! pG``0@ U:@`V W  P P@7@Ѝ B)A-P9 pPW5  e0`.Wp@`.W&,W W* W Up\ 0 -W_W  >Q0p P pXp H"p B)H-M`P @P pRW LP p-M0# 9<8 W 0IIЍߑ""O-,MP0 @ \pP(P  0p P P( `p P   0 p0P"L~  pG ,`Y:(PW} $`    08/P(,`Y:( $0p8/PX (P $`  R 6 Q $S 0p(,`Y:$( $0pG(p8/P'$!p 0!pth 0,ЍOL@W 0( N0,Ѝ-""a"5""""O-GMMPD@`p, pAHpZ  UpQ T  UpI =/pD W  @   * Q+3V42 0<p' P {/p!  3 OP      @  0ppAG GߍۍmoW R@ p W B/p )+15 =@@C e  .0;P  DUp P PdH%7Up p.   +Up p"p  p Up p  2/ 2/AV Up pW:bpx@P`TP0PPEuS 2 .ppnlO  #!%p @- @  QZT  7D03Q Qp@-@ ``P P `,PV:(P $P`(`,PV:p 0 `A-M `P+p@ Pۍ@@AP `H)P 8@///p@-MP 0)`P: @"3 p1 0)``pH0@ `ptl: 0" p@/ `p $Ѝpq""""ϒ"0H-Q@p n.x0Hi.G-FM@>P+ pF`   [" P `hp F?`> * F?Z`Fߍi0H-@M@Q@8 @P oQ Q@Ѝ0N q"H-Q  RRL` 0d"'"2"$ /Ho/0H-@MP  P p 0H-(M `Pp!@\ 0cPP pT !W:7 OP(ЍiH-M `P@( 㹐 Mp  Q(`!Pp 㟐( ``2PЍ8i(iH-M P@` p ゐ$ (PPqЍ:iA-M P`p@ h @ЍO-QMMQ PTP @T HJtp8\ `KPT`PpP @*`PT`  P T`T`XP3`T`ZU| px Pp{PpPH x|hH 0`xPT`T@Gp  GWxP Z " - P p l` gFVPT p ` XFVTP 0  CT P  X  ;@PPEq  pQߍۍ88 @0$$ (0 0"B" ""l"G-M" 0 `````\p< P: &P6 `0 Kp) pPP-pxPבP"   'P\ P  @ kP tpW:7,`ЍV.,`W`4"A-(M P @`Q <Pp(Ѝ0'x Bp LpWtP   QF P   RQ|@|  8i  Q& X`0Qx xR pPTPP8xPT 0"f"p"X4"A-@Mp @`P@  㟎 !U4 P$! U @0@Ѝi@iA-p@0G0|x"PWP`R*)P |bx `EpV ||p@-M|`Q H 99p |x2" Ѝpx"G-]M@ p+M Pp Ui U`i`gU``Q`QR AR]*PT(Q `ZQ $` M xPH   Ek? p> P$  RRyRppuQ  RQ  RQn@ P ڍ@!." $uj pc Q n AR:QwP`]ލQ QPP1 P .0`PQ {p P " ( QPxP , RRLa ,V`P` `RP QN 5 *P 1P llP/,i?Z.0  0jpH Ki@|""H-M 0Ѝp@- @0 Q*P`E``U`@ Tp;pp@-MQ @P P R xЍp@$4PPP' @)/$PU ` ox@PU x@T `>P* iP @T@ЍpQ/@-P@@@V@-P@@@VP/  Mi r"O-Mp(@@$@W'P\ @t PpTpp`  0ᕪ ppP :pP   p- Q'P$ (`  V p )  p  7/P$  p $#P 8p d *)@Ѝ誓""fB@lB"O-M`P    , Q4:  0Qp@T W pPP hP   u 00 R :   q Ѝ r"H-M0 f ЍgB@- M^ *@ @  0 Ѝ@-@ (@(@-@p  p . p~B G-ZMP  x Y    D   d`!. Zߍ(r""gBr"r"K-Pp@`.MQ™\ r崀`T 0R ,0TQ M{™`,p V:T 4` Ml,P@Tr"̗"ߓ""O-MR.pЍ@PU.* U u'p `p!W*P%W Q  lPPN  0wMpp N  nMpH'ppp"7"F"G-MMRp @`0GP P Pp  EpPPЍۍ PgNt -MPp XpG`W 'p TN MpGp&O @-M (@T tЍ @R S 000|P Q:@OO-,M`P$  h  @  _@  y0WP 4ou 0GPk PP*?P`JP=`p  Z8PP6@P4 Z( Q(  j0$p t$ ( $8  P`X@: ` P"P ` @v hXp T`Y@ !0PP pLPJP `Q( # VPm ( Q   Q  Q$ t ($8  ZP`pW:0p QQ 0p$t@P- 0oP$ p P$($ P P( H E8 B P`W:`,Ѝ!""O-M P崀P"@40$4P$Q``pW pWJ L0l  p P" 0P` $Q:` %`L0  p 0  yp P" 0P$P L0  ep L0x  [`p 0lP p$`,b$ 0 `Cp 0,P ,@$`%K  0-p @Q b@k,`@T:A{f R @`X,`@T:pQ lbpJ,`ppW: Q F B`0 P1 ,@`V:6Q pW Q, P" ZP X!(p   0@ }P(P:05P (" B0("   0P! @`p㊿0P0P"  P ("h0 0  0@`,@V: ߍ"""$"<"Q"`"dO-$MQR @cPPSP Vp$ЍcP,H Pl  0 p YU*`V VB Z  X4VQS0V   `W 0 Q"P  BR    pP   H  0 0\P rWo~0H-@T Pb PPPPPP@P*U"02S @"PU 0S, 0 00H-PU @L0@-@\Q \\\@-@`q `1`H-M`# -@p4 P0 pp/p% 0 p'p 0)p   V  p @Ѝp@-M`@P3 0:hh P l0 @ P L0DH   [J $ Ѝp@`r""" "p@-@`hP >P:&lTx R RQ TQ  p >P:  p@&"@-@AV@蔿 p@-`V @@PpPX 0$I 8~L p@p>"pG-MP@p `$PH` # 0 `` 0  0J  *@0`PHvH V  `w0`8PG PK:jd @   *g@$I`(0  >$I  6H0:HP[P hI RNH ЍGb$48nI p j@   4P 8P   @  * @  PdQ Ph $>I 00 P<PPH0p 4 p2@8 \2@0 H2@<4 80 48@Pi`  0.-phNoH垼 _P hdP  Ѝ 0sU?P P P dp` 0 @9pЍG|zЍGH 00@ %<n??"ݔ""""+"K""˕""""""""*"@"Gt"8ys"S"A-MR{ @`  0Q 8p0 0S  R-  . 0P Q :  PT  0P Q:3 P 0 P:P 0 P;P 0 P  60XP Q:Ѝ(( ,0r 0a뿖"W" "a"H-@ P`08 l Ah\ 0080L<c u`Hqo""p0H-@P P Hi$ rhhL0H꬘"Ԙ"O{"p@-M`P@\P Ѝp @)P\ 0 PphhWP TT]@  B@$%ys"" T+)"  K-P`p @Q$   P":A  P  @  P  06   P d &P 0$ ` KL :4 HK Kꘖ""" "h]""p@-P`K@P D 0Q 0 pKpcSc hQ0S/080 dQ Q/ O{"A-`@VP 0ArP ,1 P i fP P<P $F 5C 2 0pE p pp HPpp hpdp $  #5 Ah"O-]MP`@R L@p@Qp1P}pLpi @P  Y/$P  Y/#// R 0 S d R 0 S z8T0D`@   T0D`P`pwH W pp H@pGK pP dP IQ* Y( RQ cR R SRcQh (> BP* _H  P YY" p^< F  ((!Q YY <P ` pT0H@ @$0,@S4 pDPUPY Y d\ hPP PSP p4P4AP* p 2 $ p0AS*  zD00500$0`(S D0S0Io (<Q CQ:6( `<Y0PAP'8 4`Y    HPxPmYH0P AP:2H `0PY Y Q BQ:30`AP: 7 QA 0P#!0pPpP0pU P Y :R P4p W pV PP p,0P:APF+ ,4`HP$M HP `5P pr`W P: p-! 0` ``! ` p `p0p P  pYp:P 4 `P H$  ` $P,0U:0@p 04WAP:9,p04HPwP  0Y BPM` 4``0P`0P((P AP=(`(  (4 `Y     WHP`DP pBPdpup0P`Z :  ZAPa:P`Yq    Q L PHCP U HG 4U( @ppAP>@p24 0AR+QU$ HC  ` 4`0P)< 40Pp` `0P0P4 `  `@p0P4Z8 H ^AP:t`Y     HpPyP ` B8P p <P 4P _ A pP*8< P p8 `E&JPKK9 R* YP( k 0Ѝi"0H-@PU  (@xP P QQq p 00H-M@H PX P  R (>P: ' P 0+' P P0    }cPZL @  +S00 @Ѝ0Ѝ0HzD"O-M Mᴐ @(P8p; pG PU&P P`i`H 0pPp@ J(8(q- `EQ% P(  0.p 6 @wp3 PpЍ ۍO  L>@ttP(Y @(((> *~ (P >Q * 0%  0  5pF+ @L@ @@ S! ` iP'   0 ; (ta(P( (((1pt!G4 Ѝ ۍOA +PPp U$ ;PP   ";@  50P   $ P PP    cQ0S0SS 0 PcQP 0$P @Qi cQQSQcQ0p i 4P Py cQQtSQcPo l@TP LP P * `EP PP cQQ}SQcPx$> L a o 0<t@Qf k2c \( P `P<P  Lh dPhg{0cSceSPcPhe   .Hd@4 r 0 `0 P0R  $@ @@480 BAC0 48\ $P>  Ѝ ۍl0 X %ys""{"М"" "8"!":)f"N" ڜ"u"q""&4$̜"0H-@0 0PUhP00HO-MP@pWQЍP PdP(  0 d7  wP@Q P,`P   Q $'<HHUP P TP= 5`h <{P P  0 Q 00S A AR:   "ݔ""O{"K-M@`p P P$PQ6[= 7i@P-  PP  0UP |H<8(! 80 @Ѝ "O{" p0H-M@0P ZQ  R:U 1Ѝ0 RQ:0AQQp,| Rp/O-M@ᴀPPT1P> R *UP   0ЍO P ( Q e0 q W 0S: @< @k|Q  0u a V[ 0S:  50PQp p WPP P x t$ PLP`p0   0PPu`VW6p@s   60PPh_ @<< ЍOP`0 0   0uPPW6V@`V` l 0PPP0%`#JPK?0O 0`QP VN 0i) 0娿 `5@冿8 0^Ѝd 0V  P P(   P :iP 4@VPP < <Q 1P PQ % PPX  P `4W QK Q`PW`@`$QDW   60PN QK:<I 0  P P|  ~( 0W   02 Z]P'   P0}PQV QpF<`:   P0cP   7  03 0 Q*' P >  姹:;!0᪾WL (p p1@倾X!}  RP* hP   w 0@{ p` H `9叾\PPP:"b"""ǚ""""1"l""ٛ""""""#4$ț"O{"["!""""O-IM XpP 垼HLaP p` X! e:!PIߍO. P @Ⴓa Pi ,0+r 60$@@$ oR003p 40@}P$ 'R ", R QP ,@$`%0 P:Z   `W @@ ` P9Z x@dX A P@0 IߍIߍO "" !""""H-M0080PP@UЍ`P b P  pr@0H-0M@: 0nP P ,,P    ,9 l 8 0P 00Ѝ0O"0H-@, P5 L 0H/"  4$G-hM M TX pPP0`0@žP  XV@p XX #U `{p T hЍ ۍs""G-AMM`@Q\P   p !p 0 M`V\PU  P $ ѿ Aލڍs""  H-p@`PQ ^P P P( P H vHHb]""0H-@0 Pi hLh0H2꧝"0@Pop/A-`@ P:P qP@P fP/1q/P /Q/H-0S ^ Q 0 SR 0 S QQ/ ,03?#R/Q/@-x^ 0S\ 0Q @T 0S @-x\ R0S @ " 0S@-x\ R0S@ @$ 0SQ h R/dP/0S Q/SQ /   R \/\hh0QQ R\/cQQ cPPSPcP/SQcQ SPcPcQQSQcQO-\MxPUp ؀@  P ĐY PhP dPa  ᓪd P }PS `d|Hp |Hd H 9 HP$  AP" p8IPP%  `1 | e %pP #p  $  *P Hp`Hwtd8pdXl 9p  P ` B|xp |dXSfP o+  ګ`P$ ؀PUOH ƫP P. P* 8 P% 㱫p @oW W  P P < 0  # P  PĀX  ㋫P$p <`5$Sh0`O Pc pttXX 8 `X`DdxQ XSh06 Y` LP `ᗪH~ VyH :P `Hpᄪk ,`P5  < Q t 5  < F D\Ѝ 0*ĺh"̞"""*"R"p@-P  ⬼@po1P kP gP cP  ܼ`V  R 0S `Vp0QP   U dPdh " ("@-Q @{ P  夼5"G-M`@pP# PPPU4U P P p  PQxU`q@MT  R PP 500@ Po @ʏ$  `p㠠ps5  0p  PP@ ꬻP 88'@ |Ѝ7"P"g ?9 o"C"H-MpPWn @P $`P R2( ,0bP  h d JlPFPP4 =hP FH1Q R` R `V( Q,Q  md R Rhd`PHj冨PЍP  Rꁞ""dP   / Q /PP    Q/G-MPPU @ `xqb 00  0 PTЍO- M0@< Rx!R ỼP PP p`PP!Y Y V& P P@ 0꨺ꥺ ЍV P PP1T= 0S; Q4P5 ` P` ` %400@ Po g[P: `Y ЍO. `` ЍO˺7""@-P@TQ    P@ p@-P= ` ${\< 1 Q(  P:Q0`Q 0@PP@\Q @ @CQ:Q`VQ`C`Qp8@P p p00 B)0p@-0S# P:S`@T V P 0`@TVET@V :RV :VV@PppH-M0  0ЍO- P 0D@4,`V -w4pZ@(pPP `l` SP ,(p04 P  = 0 P~ @d(P :PH8< 0-`<8V vev :h= @P`VD L@0S@:S0A0`Q4:V:0(0 AR (`40 Ak  Pc 0(04 A` H A F  `ἦ Ḧ8[ L= K4@Pr@K n@! ,P w = (0,P m$ HA[ i P ) L ` Z `<Ѝۍ , @P J  ,P B800X+)#/X+)H-0 R ^  R:R |R S 0C R:R 0|R p@-H`P@P ?((( 0000p@000 0@-8@P ?  0000000 0O-MM``CP P R4S0 Pq sP 0SA  "0SBP   AQ 2 000@:R#RP\@o"t `P @Oc?  Pq 0Pq P Q ` QjPPpQ\Q PQA:Q @,? T\ `@: P90 ?+  R :R|R   0v`P P >` d`PЍۍ00S\S00000%"00 B) 0K-= P{ pd7Px Pd]Q\Q R:Rd 0Q0@0AT&  @ `0V  p^Q Q:QK pQ:QE ppaRMRB0BS `|HHHI IpqP%mRb0BS`|HHHI I:NR RR TR nR rR tR     @Ed P P EP P l  ~P  < PA-= wP- `dP* Pcpd R:R pd :@@ZP d`dP@` wd  eGP  & dp@-`# 8P  0Q  xR p 0/@0PC U:aPCV@U:APC6@U0S2 pH-<P P  P00@-<@< P M_.P0(0ܱ" O-M8P R`$$r UZ  PK oA쑟` P( p[ vPP  P J Q   P Q  @P= Pp=PZЍp0 p+P ,P S 00P P P S0RS0(00)090,0H-pS 8@ P ll@p@-@8P  PG@DP8`8PP <Tpp$00(000H- @ PPP <P00(0p@-@ P  P@DP8`8PP <Tpp$00(00H-P$0@-@P@$0O- M`p[ pPP[@ @P! X P qP P[ X Q UP0@0``P P<`P Ѝ$00(0//////@-MPPP <4@ 0PЍP0X00@-<@< P ,PP0!0" O-M`Q<@8p P[ V``P 8bo }P8 0p$BZ ۯP(84P  dPJ Q@oP P  MPJ Q  @P; PpP) P P P P P P$ :PPЍ!0P09}H-MP`@`pP0P  0p`=PPoPЍP0H-M(( 00;PЍX00K-M`p@PP  0p(`pPPooP@@pP ;U@@Ѝ!0P0!00H- @ PPP :P0P0!0H-M(( 00;PЍX00K-M`p@PP  0p(`pPPooP@@pP :U@@Ѝ!0P0!0H-P!0@-@P@!0H-@P`pᤥ ឥ ᘥ ᒥ H0H-M@6PT PP P Ѝ0 P@T@P @@P P (@g$ 04/!0!0!0~\+)"!O-,MM@P ,ЍۍhlE0,(( gpWb  %$5@ 8E,e$U/oP b(  P P P+)p X( 巜P pP (((H@2Q6 [[[[[[[[[[[ \[(\0\[\[\[[[[[[8\[[[[[[\[@\H\[[[[\\[d\[\x\[\[\OAPL PN p徱3 7/B\?P;88AP2AP+(&!P@P@x P@XH`q(PI(  Qj 2pR R0Pb0P@@`ņ`1 0`apAp 1`p`q1@qP pP  P@P Ѝ`PV@U \ P@<@ޮ8 004/`!0!0!0!0"0"0!0!0~\+)"!O-MP@Q T `P *Pp**!%ZP:P^EF ! ! ! ! 2!"!" 2/o?o! bQ 3!0cP03S7 @P<PJ0PFPi pU  1P 3Q*Q*P PQ: 02!0R dPt XPw p@8P[ P/ U`1p ᾦ.# @   0 [p p  p>PH tPK WtP) * pdP Ѝ0 "~PP5T HPP/P p "@ 04/fU*FZ UE U*KZ UE!0!0!0!0!0d+)!0!0!0!0!0"0"0!0!0!0\+)²"!!0~A-M`lP \ F 2!1 pWQUk  BA( PpPt $GFW!!$Q`N@oPa @;~W     Wh'Q0Ө R!p0 PP Q 7Q Q Q T*P X@Ѝ  AP  ЍALЍA>Z P Z KZ F!0!0!0""!0"0@-M@@P TNЍ   @/!0~@-MxQ h  @2> RNT C , ៙Ѝ!0!0!0///O-M4P Ѝ $Cp 07/   #p07/ # 3c@ P2Rr"T` 2U06/"2b@ 0bPS2Rr"T` 2U06/rRbR PB1/! @6 1 A葟ءL 0#>#"R RRK<0 VQ<`J 0V QP0 @` >3S0 @R   <Q:8@TP<`X P, X >3S P: <` X PUP P P,H AqPV pP8X @X @Q, 0 BP *PH0`V a1V`!aS:0CRA 1S0!1 ARP *QQ:Q: 0aaPVP1`Q A` <0 8 `p _ pU  R0 >#R R0S0CRS0 00 pE0He<0@0  LP   R SZ``ЍTUUtHP,"0A-M@``>Q$A QA ܙxT * (  (b]Q?Q! [Q \Q V:fP`>Q( <Q+&%^Q {Q |QP;8P6 3V:Pl @` V@`$ P*)P )  V LP*`)P P`Q$**0@SpPv{P0S*dt 000,R Q ,VQ >P *PU +P0@ ]?P^ {P`0P*0,Q < 0VP 0 Q* }R X g. `A $  $ zPh 0 @-0  @&0@ | @P!A>#" P>  BQ_`%p] ^#  x 'Q`QP   P  }RP P P* *0BS p`v P D {R P*$Ѝ,"0 B)K-M @\Y  P:PH```JY0JIPA,,,,,,,,,ȢԢ/y`qPLP  O$ l F*YU .Yv [Y[$yP( Dn{ YIP2 / @` V@`$ P *Q*\P)P \) ' V LP2Q1* \R)Q P$0&+ (P bP ``QFV x'Q`Qy y  P#*0*SPh 0 @0   @Q*\S{Q $YЍ`0Q* 0,R<Q*X 0VP   RQ1*0\S0}S/ R *Q * Q\R }R P P] ^%`PxP (n ,"0 B)@-@P*^Q  $  $ @-@P  @ (  (p@-`PpP@P:(P    !pO-M@o R  2/Q**t0uS P P*0\S|PP P *Q  P|P P |  2/0 R  2/ P QPtPn u0QPP3S Qp2W1*`P\V`p|V Q*`pP|VPP/o, P  0@   AO  R0@0 @1>3 " <^P P\PP  1 B>3 ! A Ѝ,"0O-,MP@Q * P2  P/ @  'TP  00@2 <P* ^R 8 P*]Q -Q- P &  ] '4  0  $  Q v*W0]Sr  R*-S]P$b-S! [S'R%* =R9 :R Q:PPP ]R-RPPPP PPK-pPA*0-S=Q;* ]R8 -Q/-`.Q:PPP]P-PPPP=3 P*Q* =R]Q P`W Qw:pP[:WPPP WW w | ppQ PWP 2SP T!p`Q*40 `@V:P  kpp@ޘP> p WPP PPMJp`T}PPPP pB}P `8}Py @@P  APp,Ѝ,PP  H@#,ЍOP<P(ꝴ"","0 B)|"p?)p@-(M@     pdrP(Ѝp@`] `(Ѝp B)B)B)p@-PPp@`a!EA(0S0"(0%P0S0"P0% q 0 !׉app@- S* @`PPP Q PP@ 0A U R  Q R    p B),"0K-P@ S@SpP@ WW`P   ZPpGP Pз   (طF 0v @ P!A># " P>   Pp  PpG0H S@@X@P =F 08  0 @ P!A># " P>  PF 0  @ K ,"0H-q`@PPQڥ  ,( PP) ,( ,P<P 0Q< Sr1`` Q  Pr0P  p?),"0B)B)@-@ P*Q* [R .R. Q 2R1:QPP00.S ]R,"0A-@X 2R1 :P`q0pSWp]W `00S:llpP PP pPWVP,"0ܮ""H-@pR P` P 0!Qp@-@PP* `OP `PP  p,"0K-qG `p@P># RR: -'R:0p >Q>"P P P Q`qQ` O-lM`e ,@Q 0EP  lЍ,0PQ : `  5,0  X:  ` > $,0 = @Z:,pQ$[ 4Q8Pp R0*$P PJ@p P< [:$+,0P pKZ-p`P0 ,0 . @Z:, pP$  4Q8Pp X*$pJp@P< X:$w+,0P pHZ @P$i:,PP 4Q8P$PR*p(` `@@pPP< [:H+,0P $PKP#RR>p&A Q ,R p>#p!>3 S 0@@'`8 0  FPP @  0 @pPZZp  0u 0 `8 0@ FP@ @  0pP  0puO > J?"0I > J? A p 0p`  0 FP  >P@p 0P p0!>#@ >"P@  PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#Sp hx2 Q@  0p@ @P> @ X:} P7`(((4>S 0ph `Rd\cA^^ p @ $0PR@[ >># R0^=* _Q3^ ^*^%_Q",0^ 0^ ^*%0  pp_S0^0 0^0^ _S^   0^* Q(_Q 0^^_P ^r ^  ^0_ B/o_0C?oP"2P 0^ rQ| ^u 0^^*^ ^ f 0^* Q]^ X0^ ># `S R P 8010 @p <@T3 P,P!  @+_P" Q@P`X}:> ^z_RwP  @0P+ @`PX`:!P@P^  @p>0Jp@ `:Pn@D @D`@pZ<:^0Ѝ>S0 N/@`   00P`>Sp  B N?@`   00P` 0>P@  0P 0P0 @!># R p!>#`q@>s"W` 0`0PP 00 B)p?)B)B)*"O-,MP`TQX PX p00'$@  D | @(@p-+R0d $4D\l|   8   8    000>Q !0 >s W  >3 01>s W >000 0!># R~  y\o sppg$Pf jPbf( Q `q PX \pT X ~QO S\LZP\NJP!>  s(R P 8 5  000>0HpW0qQ@* B#RR>p&A Q \|R p>#p!>3 S 0@@M`8 0 E FPP @  0 @p6PZZp  0u 0  `8 0@ FP@ @  0p P  0puO > J?"0I > J? A p 0p`  0 FP  >P@p 0P p0!>#@ >"P@  PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#SpxDdT2 Q@  0p@ @P> @ X:} P7<pp>S 0ph `Rd\cA^^ p @ 0PR@[ >># R0^=* _Q3^ ^*^%_Q",0^ 0^ ^*%0  pp_S0^0 0^0^ _S^   0^* Q(_Q 0^^_P ^r ^  ^0_ B/o_0C?oP"2P 0^ rQ| ^u 0^^*^ ^ f 0^* Q]^ X0^ ># `S R P 8010 @p <@T3 P,P!  @+_P" Q@P`X}:> ^z_RwP  @0P+ @`PX`:!P@P^  @p>0Jp@ `:Pn@D @D`@pZ<:^0Ѝ>S0 N/@`   00P`>Sp  B N?@`   00P` 0>P@  0P 0P0 @!># R p!>#`q@>s"W` 0`0PP 00 B)p?)B)B)*"O-,MPp`T@ QV,ЍX0 0($P  " ~(p -+Rr0(tLLLLLLLLL(<`M> AHF !0 > Q  > 1> Q@5>  @> PA+^$ %p"P$P P( Q qP p  zQ ^J @ሀ`Va^J !>  (R P 8 0 >03@88Q ` <@Y PPp( 3PPL( )PPPP @ p?)B)B)O-DM,(`0 4$m   Dh  0lP\P  坁 8P P X8l@Q$ ! ̌X <<(l@P  p P@8,@p0 S S@  @$@@<qp W W  (@pPS4p@Whp00@T {B  0@T0<{p Q40\! 0^ hp,4*48p _^ \ <_\p ^hp,8 r  hp ,_^ @qQ0<@0p s0RtB  0,@@P p4, pP^\ ^ @< r _\1\ 8 r _ ^ o"pP&<@8p^t w0  wp ot0 Qr?o24hp QqB  0o@poP  pP5$@ P@Q) (@[%P [ V<@h 0tB D@P8@ @@@\\_ < r Y_\eVlP h@P DЍ B)O-M8@S*P`  >#RR>p&A Q xxxxxx0PpR p>#p!>3 S 0@@'`8 0  FPP @  0 @pPZZp  0u 0 `8 0@ FP@ @  0pP  0puO > J?"0I > J? A p 0p`  0 FP  >P@p 0P p0!>#@ >"P@  PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#Sp `` L T t   ````````` 8 t   `````(2 Q@  0p@ @P> @ X:} P7 DXD>S 0ph `Rd\cA^^ p @ 0PR@[ >># R0^=* _Q3^ ^*^%_Q",0^ 0^ ^*%0  pp_S0^0 0^0^ _S^   0^* Q(_Q 0^^_P ^r ^  ^0_ B/o_0C?oP"2P 0^ rQ| ^u 0^^*^ ^ f 0^* Q]^ X0^ ># `S R P 8010 @p <@3T3 P,)P!  @+_P" Q@P`X}:> ^z_RwP  @0P+ @`PX`:!P@P^  @p>0Jp@ `:Pn@D @D`@pZ<:^0Ѝ>S0 N/@`   00P`>Sp  B N?@`   00P` 0>P@  0P 0P0 @!># R p!>#`q@>s"W` 0`0PP 00 B)p?)B)B)*"O-,MP`TQX PX p00'$@  D | @(@p-+R0d ,@L    000>Q !0 >s W  >3 01>s W >000 0!># R~  y\o sppg$Pf jPbf( Q `q PX \pT X ~QO S\LZP\NJP!>  s(R P 8 5  000>0HpW0qQ@* B<Y PBP(vPPp(kPPBPP  @T$ ,Ѝp?)B)B)///H-y // //0H-"P P/O-,MQw PQqT/PoϑX@ࣟÿ"Ï&T 0DS0#pd` bqpQd`p$ (O,. 0q[* !(  0 q@ ( 0@PE 0 pXP! d 0p`p  0p@ P吶P'v!h $ 0Y   000  V(-Q ,Ѝ O-$MPQ  AQ#`dP p W1`Q`dP 0L@Hpp[* !* 0pp@ 0p0  pX d 0pP`  0p@ᐅp&\T e!0[  0$  @7V$Ѝ& T@-M@(2<FPZdЍ@q 7  *4>HQT 7D 7 , 7 7  7 7  7 7  7 }7  v7| q7 d j7T e7 qЍ R "b z›2 \ b˫ 2O-MPQ`@T P p P P nPoPoPa@PThhhhhhhhhhhhhhLh  1}P  +}PZ U }PZ T }PZ Uhp }PZj UZ< |PE ( |P?  |P  |P  |PhZV U4 |P'  |P!  |P | |P h |PBZ6 UZ UZ UT13TTTT TTU  Ѝ萚pZ  b r"  iYj 3 ܗp@-`M`@048<@D F?P@@@@:g2 0P <p$ 0H =p .p  ,@p@@@@PH &:P8P  2P`ЍpO-DMMp@|"0B{ @ @!y=@PB  " 0! <R5:0V/ `vt`TV}FM xI$g'T# Q "2q`pG`Vp4 @MPJ"2"2pqapRp U{TR{@P3/H%?P  B?P  SPCq@a?0!Ba.PHrT2LbWp 0!  @4PꟆ)\P ף(\*vɻnO-MT2PXPPM@P" p GP. T@ $  ( 0 8 8 @ @ H H L P D X < ` 4  0pCp  ,@Z aV$zXP `P P& P Q QaVQ 4V e F3P9l|h 4$ 0 8 P ( d x 4 p  `` ddp  hpx"0 "K p  02p;0s0{ 0p3@P p0`4?;L0h@@0\Pğ?d 0H0l@DŸ Ÿ 0P 0 qt< L  APm "eQ QQ  1 pZ  00;@r@T<@L@ @0BSS 0$CR R/  (1 p8 @00; t 2 2pPp P9P P 0P @PPP`PpPPP P# dstdayminsec@NlL~@z0 z#y$zzl%&8 (z`(yx@'( uxx1  d ''xyyM * | ]zFz1z%0H-PX @ȧp +(%U:U00at T0T0 P <  Q/0P  Q/ /}0H-|0|0 @ R@ P  0P @PU UPP@T0 0J}H-H  P 0S !  Pp@-t0h0Q L F P0Q P`VP  pXH-PP @p PP `Q\P`H-d`@`P p `P PQ@PPH-d`@`P p `P PQ#PPO-M`aP6 PP5 @p`P  P QP{  `ypPY W e n``P Y```Ѝ]L^]H-P@Q p`P `Q,Q  F0yK-MP@Q p`P `QQ4 Ѝ FQU& q pPp```qYp!"PpW |Ql 07/Ѝ4Q$ =4wlxx??Lx@-@ @~O- M`pPP PPQ߾PX @`PP -P F H `PC `nPoPo@o`=DP PPQ P Q0  HQP S hu`P@P @ Ѝ 6ZduNYO-MMpP@!q` YP:DPq  YP /P P p cGPk ,<0 ppp%pe 4P| p0 %pT `P{ `尒  `Pn  ;P 0p  &pv ᾣ lP$Z }&E 0S%p#  ;&2p` c&!p`p Z&xpP/fs L&jp`ep` ?&p@7 5Xp`Ѝۍ 0op ]6`P    05D`4pX  0+D `>zd@u]\ ssuR u{s t q T/ 6t rH-M   0$pЍH-M>   0$pЍH-M?   0$ p ЍH-M8  0 Q pЍp P  / H-0H-@%PP :o? $  0(4 8 0BS4  @P4*# 4 4 R*004  Q* <004 @ PFP4    44 R 0Q: Q*=  4 P4 0@@ @ "AP4 @4(P< RP 4080CSK:04 R*>(4 8 0BS4  @P4*# 4 4 R*004 P*< 4@ 4  44 R 0P: (Q<0S 8 @P * @ @ P&p4p%40S*>(408 0@S4 0@P4*# 44PX*pp4SP9J(P< RPQ @D80GS:R4 *>(4 8 0BS4  @P4*# 4 4 RX*004 S0@ P@0<08 4 0@@@ G@ @P03p Q@p,  ?P4@ 4Pp Py@@1 @4Q <P*4  PAP5745@P 4 !PA*(0S0 Yk04 R*#004  4 (P: 80pBW  @P4* #004 4 R*004  0R@0<08 4 *04  PR!4  #  @P:4 R   @P 4 R*004  PR!4 P R   @4 QBLЍ #  @4 P%#jo%juH-M00fЍH-MPЍ<#O-MR @ `pPJP/<2>aP D  0Mp4 ЍjjЍܠ P8 PPP   0P p-pjP  0pjP }jP8  0 Ѝ] YD | ]  p@-MP @0`0Q> 5/ЍpK-MMp `@,Bp P/P /R`P @ Q$  P ` iX b`W yPp   PP00 PPPjPjOЍۍj[ O-dMMp {P / ` R: rRP;Kd`+X *`P7 Mp  0H0O-M`aR@|pPD@P@p T T @ 0@T TZ, tP 7 0U E 0}EP' L"AT T?  Pj 0f LPP @ 0X L TAT  0I 0 @CPPH LPHP JZ@  0 @& P @A  0 @ @L@ 0 @  @L@ P t  0P@@ 0   0r@ЍT X O- M@P H?Ap, pW`DP0 Q?!p` p P    ?Q Q# v, A@ P| 0  (0  LBp. 0 p P:pv p,p C@ppW,0+ Ѝ Ѝ0 @-4 @}AQ8@8 @-@pAQ8@8H-M0     0!ЍH-M0     0Ѝp@-M ,,`(p@0p 0Ѝp4 O-WM?I .e" B `". K 00PBK   a  ?" j  儡 +" j a  " p  匡 h" $h h ha @ ! !@B @  @  @h 00 B/0pp Wߍ@PO-kM`Q pP > >>>V dK V P VVK ajY ˽P BBqV 嶽P >>>>||||QW 塽P ^^^^` aU 勽P   QV uP U B U ^P hh |?@ hȠHČ pp`p P@ P @0, 0 000h 0 00P00

Pp\0` f`V2 A1 p P PAU,P\0  V 封LP:8@4p㞯P#  pW   Pp\0 H`D! p!rAD |  ?p , @!PJ(j,PC PH!X[F  PAqT   P PݴUX,  [  A$P:P`7P  `V    H` KX D PXP ` 0'ACHPA`D | !  ?p ,H PE U @D d(Z\(4`V`CPC8ڻPpUPCԻ@pH ϻPCT@C H U\pp$pVp@ PLT`k\@DW,APG`D |  >p3 ,H P@a \U8pXH PLWPL PpX`Rd,PBAD |  >p d,H PU@Ⰱ Q XQX800P TP X䰝p,`KY TpB APXY@,`PeP U5  ` P @彳T,` U఑PP: @P  [   X$ pWBgTpW A4<   P PyUX,` WT[:@ P׭P\  PU  48a8p DA`$YFX,Pdh  X9 d a P @/TX,Pd  Xd ఑`P:D@$㉭P d Z     @L pW\H`0YI `X弰 q, PK\IPU6 A  P `زVXH`, Y [:`@\3P  Z   08PK X唰p,`K xdg8pW6 dA(   P P凲UX,`d Wd8[:@ PPh d PU   PHXYh Xlq,PK`\ tdH`HPUA dA,   P `3VX,d XdH`[: @`㋬P d Y     \PkߍXPh p@-M ,,`(p@0p 0TЍpXp RD <  ,000S?@H/P0tq RD @  80($0 0S ?AH/p@-@t RXTD   0 0?#B0S \H 0 Q ^,@PA@@`0D```PUh``@Pp|`p@-q RD  XT P 0P 0?#B0SP \H 0 Q ^,@PA@@`0D```PUh``@p|H-H L0?A00S 00ȠČ0 0̠ȌS DLO-,MPg ჸPb |80Ip$p 2;`qP D V hPD `Q: PpA pW ` PNP* V ;P ! 0p ?c00D |LW0H0 /;:P ,ЍQ``VP,@PqP@U  : a,ЍTp@-P@P 8`PYJ@pp@-@PP `ַPD5PpH ?30000S x00840 SP0  D0| Q 0 Q 0  R/4pH ?30000S t00840 SP0  D0| P 0 P 0  R/d /yO-M$P`@T4 " !  !  !  10! qp 0qp p$pqpX\0`ph iTpj`PPD\ 8pЂT X0 0p`hij Q (   LЍHt<0``X(D$D A-MpPPGPP J`P @ H  ``   /*p㗩`㩏zPX i pT cpO pQhPG  0PPPPP4(P:  0PPP)(P/ p+ ?$p'  0(P  e'QI1P P P (^PpW Wp屮ᯮ@Ѝm up@-@ PP ^(`V (V`@吮\厮Qp@腮A-MHQP+P- #v*' !: !^ <0 | >@00_`oaf`!pS@qa R 0@T rpWxSqW 0RQ  00 0El!!QЍs l 11Q/qG-M`pP+l`(P Upǵ WPྵ3Ƶ˵넕P ^ >N<K^HvE8#B:?0'<#9 #4H#/p-*-%_ |opbr vy/z{M|}9  H  %!,+&.0p*&!?@ABCFDHG/ + I%I/ + JM/ + K*K/ + L %, M  Sb #, Ev/* G//* Ne ", OM- P&.* Q9 R   R 0S  0 S pW" sPUJ1P1p80Q  d0 0D0?C 0( Pl Ѝ|sCq f C qH-0 0 ( Qdm(      /,O-FZ `PQ "P !?>`APQ.F P Px p @`@@ KQ d p  `!>0@!Q QJ q" R R !0`Qs  0Q`Q} 0 ٰpvAT `Ta  0 ư`pbQ_ @ K. A9Z Q "P  P P p7 @D`@V@ KQ p(  `` ?>0 B!0 vp;@!0`Q I`BPp( @,!A`l ?>0 BR!! 8`p P@`PЍ`/. @PLDD 0!Q$|`d,xd(O-M8f@  P`R`P Yp|0 R K Z 0 R KPm E( $ x!R  Dlh<p$(AP  KTAP  PC XR$0Tp |$ t@0h0pPQ\pPPP QoPHP QLQdSTq倱,VP `p PS Wm LATj HYPd P``p$V <P>i)PVH9P P`@`p$V <P>K)@PV 忢@ ᧨ ᥨT [  QPEQ QP E W QP~? @ pA `pP _P \[ P TP#  ZЍ\[  \QPP@YTQPPPV KQPQ AQPP @Y 9QPP P PV .QP( $@ F  L0H-L@QPJ 8 QPD HQ08 QP@Q8 P  P+mQ,P P PmQ! 0 A R:;Ao0Q 1 A R:;Ao@;Q 0A P3@@00t @-"TXh@000  |@ ,0d@@0XX00H<0 0@VHmmtmhm(Q/  X/hp@-@P`` V PJpQ PP[PUUp@RO-MM@PP㻡PU J,P AqDD!D1 0prppp P 0 "pPU) aV G W ,  GpPHX`  0"`VpЍۍ Pl l l lLi \O-M@PQ PsPp8$Q  BQ   BQQ9&# P U"P  0 P 0`0Q 0`01`N  ojQ @8LЍ Q  A AP ̡P op8<Q q A Q) q-(p  P@ x!@@; iSP7P3 L'hp  <PJp <P  XYH X PO@`!{d @- (@:p @ @-@:p @H-M0< R    ЍO-M(`p@PP U PJpQ Q 0Q[ЍK-Q1Q+ ZY# Ep@P@DT P` 0"`Vp 0 "K-P`p Pp W PJpAP P QO-M`$P@ `QPLU VQ"V Pp ṽppp@ .RPhP LDf8|  @[ mp] w  !>qP( PU YpD tp P wd U Hp8 @ !>0qBH" @" Q5! !@10q! PQ p RJr0"1pW UpB0S 10Sp02\Xa ?#>0 BD1`R0 q0 p@ QPPojPP xp|`Ѝ|| 0 & DQTc\`4b$baaaal,ccbbaa a```4aap@-Pὼ@p p@@ 0QPLPojPP 0(hLptH-PPQ oj@0 R pP0   A>   C#? @H-PPQ oj@0 R pP0   A>   C> @LH-M@ R  0 Ѝx(Q/  T/,@A-`q@P qpp厡PB 㿝PG      papUqP U㟝P , Aq@ll0L 440  l  ꤷO-M, 1!a1sqaq P PעU GP i V*  0` V: VPD0H |.-p Q` V 0@ -ЍЍ@- (@6p @4@-@6p @0H-(M$ P@ \(Ѝ0̵0H-(M P@ O(Ѝ0p@-(MP D@6p `| :(Ѝp(Ѝp\p@-(MP@t6p `h &(Ѝp(ЍpH-M   ЍH-M@  ,00   Ѝ脴H-M ,0 0 1 00 0 Ѝ0H-MP `@*6p  ,0 00 P Ѝ0Ѝ00H-MP@6p  ,0 00 P Ѝ0Ѝ0(=Q/ ꘳@-D@@p hi$  hԲO-M3 *  @LP AP  P|AP Ѝ*0hi0hFp 0  P, 2PЍ4$P@-@ @P l 0 \  *.*4 ` 01SPP|@-@ @ P  l*>:X01S ` PP԰\@-@ @ P c t= Q* 0OS*` PP,pA-,Az@ P 8 =^ZQ8 ``: P ! P  08 PzQ  *0po8PQ*P8` aP耯@-@ @P = R  "+ 8 P;P<p@-@@PP%` ` P  = P * 0oS*` P P p(P8<@8p蘭ܬlA-PojPQ =~z@Q$  "+ 8 PP Q j@Q  ,-  @-`@@Q O=Q  ,-  ܫA-PojPQ 3=~z@Q$ @BK@8 PP Q @Q  ,-  l@-P@@Q =Q   航G-`P`Q =@ Q+  @0p,@-PP@P@8 0pP-P Q  @Q  ,-  $H-4P $pH-4P ܨ(J-@ @P }= R㰊:HP@ PH  Lpt PpLpp pP蔨J-@ @P G= R㰊 DP@0@pP>0H-MP@ P,P ]}p PQ \  TLPP  Ѝ01/Ѝ0ht@D>H-M\P ЍHH    HЍ===H-M\P H<  Q, yHЍ=@=(=0=H-L R ,P8;PԙH-8  PPpH-4 ,3 P;P(@-lQ |@Px@P 4  3(/*@/0`p@-p_Z`@@Q |`P 8  `3`p@0x`PpXPؖ0H-P QP @ Q Q00tQt0QL0Q 00  %3/0ЗX|@-@ @P P P tPl P L  2@/$ PȖ`<H-p8  8P, (@0`P0``` 0CV@`V0PpW0H-P ^, 0( P@PPP 0UPAU^00 S/,/H-0QJ`VRJFP R,!(P@p`@ppp @DWPPU@ QH-Q;JPU8R6JEP R0@@@Q(S,P(@ Q  Bp`pppW@ @PU , (@!P`VppVp(@ P`VppV@H-0QJ`VRJFP R,!(P@p`@ppp @DWPPU@ QQ/,0/0Q   S/0H-^, 0( P@PPP 0UPAU^000H-^, 0( P@PPP 0UPAU^000H-\,  \ 0(@TPPTP( @TPPT00p@-QQ,0 (@0`P ``` V@`PF`VPQpH-(, 0P Q00H-Q\( ^,0 @^ A @ ^, 0( P@PPP 0UPAU^0P/   \(P/0H-PX@tQT X0,P ?.*P / ,P ?>:P E/᠎,P ?.*P /d ,P ?>:P 4/$,P ?.*P / 0P ?>:P 0//ᤍ@-xP JpP @pQ L6@t0tP "t@d0P ?.*P -/܌@ R Q/*0S/ 0/ᜌ,P ?P /PP ?P /H-<P ?P p HH-@T' jpP @tQ 5H0tP |Q pPpp|PUw tH?蠋0 ԊO- MPE ZCz P=S;p0R@P @pQ  Kr7`p 0ᣝPJiP  `FPG P  J0  Ѝ ,,P ?P /|O-MPpW!  K`  0* ᗑP  0`崝p   0zPP Ѝ4p@-? ZP ?|P @`|`0@Vpx& @P@|0㱔P Q @XPPpD X|$pp@pAp !!Tp@-@? P P P`箖`0PVp@視G-P @zPP  X `@ P R R' A0ɠ ,   BL\0!저|X/0, 0 F`00`R`` B0SXP PUPP`opP `VO-M   Bp T P  [.6`p 0^PBJ吝 [`Fp P bP P P(@ PJ JP Q P@U  7BJ@W  w; J@Z   %B @ЍO-TM +` R TЍZp!R @ 0 t03TЍO.tATW |! BR8   P,`5 0TЍ € 1,p pWS@4`  ipʀYpt 0@ 00 0Sp ` t1 Q 0 0*` ڜ Y`G-` PPp ќ@AAP@Y ZXT  P@P ἜQ K-P pP2@rP+`P:匜P$J刜pP $UA`V(NAV QX !`:papPV ZpPV SpP4H-?Lp0 S @ 1  0  PL 0H-@yP  R"4尔P PUX P R P 0S0 0S  叔0協,勔`Q Q QP yvt0H/~D  R/P@0?30Q/@ 0<( /}P/0Q@?R/@0</Q/ |R/Q/ <|R/7R/p@-@@P?`+ph|S/p@-P?`@pH-`Q/X0*@ 80 @ 80S84@{H-P/X0*@ 80 @ 80S84@S{Qz0H-@PU XTP@? @<8P@@(0z{0H-@PP XTP@? @88P@@0pzH-Px o@XjPpTQG  Q@@ Q@@ Q@@  Q@@ Q@@ Q@@Q@@4Q@@ Q@ @@Q@@@Q@@@Q@@  (QP   8QP 2  X0@ (p0 @ 080S@0H-PQ P@XTP/  @ @ @ @ @ @ @ @ @ @ @ @@@@@ @ @@@@@@@@@     08Q@ @00wP@/H-TP 0 R S !\ R! ^ R (!R !R 8!R !R  R LQvH-TP& 0 S0 R !^1 R! S0 R4! S0R!S R@!@\R(!R !R 8!R !R  R LQu0H-@ P2 0HPt0H-@PR J 0 P  S 2 0H0H-P@1 0H0H-@PQP J P  Q 1 0Hs0H-@ 8P%p 1 0H0$s0H-@P%p P J Q  P01 0H0H-@P%p 1 0H0p@-@ l`P%p V J P  V p1 p@{$rO-MP@`p,=T'  㔀= 0 ᠀ @D PT  0ၗpڔX ЍqO-Mp` 0Pq=U(@ 㔀g=  0᠀ PE `U  0CpڔX ЍO-Mp P@5=T'㔀)= 0 ᜠ堀 @D PT ` 0pڔX ЍH-M 0 0ЍnO-M@$p2 p`<V) 㔀< 0  ᠀S `F @VP 0἖pڔX ЍO-Mp`0P<U' 㜐< 0 ᤀ娐 PE `U @ 0~pڜY ЍO-4MP, A\pXaQ  @QB \$YIPꅗPK X@PzvPX @X`   T@U8`F  PV p pc `VTU8P   $QP X@ T P8P  p aX@T P*P' 0 @T (0 pQ 0 Q  0hPPf @Uq, D0|@0縐p H LPEpG @U(0@   X@Q֖ZCAZNTQ8P % (0  p0S0 RPD|p HLP`P ( 0A@p Q0@ TP,X@` (0 P P  @ xtH0HSD#P0ᰡpP:Xp@@ PQPN @pW@ X@ZPpG pG?PW P i Q%Q{ `Vj,@pQp_D|pp HL `!PVMP[PT R 8P R P P@( 0@ pP0@ ]TP,0( A % 0PPP Q `E@(0F  Q  & P4Ѝ,, a eO-M@pP H`Pk\8 Q A ЍVrXTXP EP8  P  ,P:Bp@㤰: 0ⰰ pG @W ڤ 0 `pڤ[xj @Q _ T P 8 O Ѝ, X? @`xt0  pl(Php`0S0 p `S00Dp X1P  W H`! 0Q!!` 0p00 GQЍЍ Q H@48!R!RQ@@/at`48!R!RQ@@/`4P @@/`_$Q@@/<`D/*X(!R!RQ@@/x_/X*(!R!RQ@@/@/^@/A-P8@  `@Q yxPp fZ <P  P P@@D]T^] R/A 000SQP T/]Q/A0SRPT /0Q Q// ^0Q Q//]]O-MQ @pP\PHX P\T \ ARA `PhVTV[Z KQ`K V @ Y+ [  0@K[ʔ P 0!!1F VPE`,0p!W,!I YQP`,D | p   KpM `PVᰁH P PHV 0!!>1`V,0 !pSppppp!, Y!PUPp`,D | 少  p `pVЍPU 0@gPXP Ѝ(\[H-^ a^ 0S,@ Q( ,APapP0SQPQ RA/Q R  A//// ///pXO-M@P H?A,0DP   p@Y*  Xaq | Pip pW:0@  hЍЍHW@-T0 0SQR,,r@  @ A( R/,0\  R0/Q\ @@O- MP5,`p@䠟 @T)Q PPaBQH0 0A  P !(Rp (X! 2/p < 0 Ѝ Ѝ0V UTDA-@(P $Pp(pWa,Q 0QaB8pP,p0 p,Pp@-@(P 0P`(`VpH-H  R <0Q0 R(G-P pP%  0 @ QB `P V ``0BV` V `QB   P BPPPC: ` P>`PTPHP@ U P` V `UPV`%P `P R  0S`AV` V`Q R @R RP p h $P Pp pp $,RSRSTS S|RQ\RO- M@.ZX'PQV Z0A(0N01 ,PP`,PaE`a ZpP`Q` pP4, ဇPPl j,0xPe ,Q4lPY 0 H0p4,PP P4Pp 0ZPJTPP*`pPY, PPDp`@| `ap 就PZPPQ P ЍPU  `pR G 0p PGQ QpPG p$ p0S GR R /PU  RQ/$0$\/ P/Np@-`@/P`*P0T0p$ R Q P8U}PpNLG-P@Q謡 $ Q P P0  @$ ` V`V QIR H@p 8  0$`p WpWPQIUPH p PkI p$  `0S0 SPR HU P@p |@hT @T :@p@ML0MhLdLK0H-P0S 0@@T@PU8P @^Vtx 8P,0 00@ PU @P@U@S 0A-PQJ@Xp0$`SRJ p`V` p`ApBX 0S0P P ZPU   OPUPY0 P >8 Q@ @ 8 /0H-M @0P@0Ѝ0K-MP Pp@Q G0 U `E `V PЍ`Y` ^`4@@P `$P0PD H0P pD H0` 0 R  PB(p,0 Q@, ! 00  0pW(P,I0H-M @0P@0Ѝ00H-M@`PTPE_o0  RPP PP Ѝ0\GGO-MS8UPYSZЍ@<@`PP p @p< V p(@  0A[ 0cP DQ HHP `P$p(PPX`@p ]pW ,[D 0`@P"0S  PFPFdEDH-M  @ 0ЍEP Q/H-M$000kЍLEO- MQ@R ЍPᗀP @厀P, `P0x 4PP# 4<LP0 `0H 8|@Q`  $H* \`dhlp8㰃P4D pOP= 0@0(Q@ 0Q8 ^ X9 0p@8p pW$0Rp@S8pV @08  R  R| !Rx$Ru RdQ8oᚅ ᘅᖅᔅ@e8(^ 00   `4 X` x P4p` , G04 !P# 0` XaH-MPЍA- @@(Q0`p,0 Pa B,0 !00  0+pW(`p@-_X Z80P\E @` P8`Q p$0 TR80Q08Q Q !Rp$R RdQ8p:/p@-M 0 @ P0C B 0 L0N````ЍpO-DMlpS@pG@`h0tR0C@VFWL@`_ L pS PE@pRQop0 pER0B pp^0V0DЍ x b 1p 0PV`P , P YPuP YZ x@  $P  0!P 0  Q:H>p=H-Mp@pQo :  tx 0P`a'Q<9 D 0` FA/   Ѝ=;H-M 0  ЍO-\MX0P8  P0( G  `PRR0J J0pR  0pPP CJ 0P@  8 @ 8 8@88 ,8 80 8 : `v q`R 0z S,0spqs p8E R :[,@``v@[P Pp,0PPE1PPP0PP 0P,p00C1@@@000~`P8@ 8,@t 0SO(,p,@ ,08q0 (,p`(0Q pR ppW8` p@(p@W@ ppW8`,@" p BR`p@@ F`0 V (0  B0s`Tq t@A@T00T@0p 0sP<@P@0$X04 X <0@P X T @q Sx!Ttq0L  P@D0Hp  Q`Q@ptPUHPD @Q PD@DpQT:P @Xp0@$@wPP@pQAP0@@u@T @Pq@pEPEq@UPD4P@LUHDLp|P00p* pw : $X`D0 !vPQ|Lp 1q  pyb p$ 0 `( AR  p(@p`GT`:p@ p Pဠ(p p`GP`@0(@ 0@T@P0:,@  (0 R (0`V0 `V(RVʛ\ЍK-M4\008P?SŸPEP` p@ @D`FTpG0`Qp 0ЍЍO-P9X /  Q.,  ! ! B0S0 S0BR @ P L/@ @aa$8 V0` P  QX@ PQ P8 0p  q` RQ(X3_P \H/ Z PD (Xc P^ !qQQ@Q 0  Q`XT@`+, 0 |d[T/  R0`@X,0D[     0A(Xڣ, ? :X  ] _Ph8 8̯    W G, Q PPPZ,aСV\ VPPdPQ D  0u  0p$   0D g ,pV P / 넯 0`x_PP lX @($ $ {p00  0PBUPp R%P $P1@L +T**d*$`0,pC(QК,` ($0 `V1V  Q1Q/J V- 0l ,PQpVP$ Q pAPP pW P ' ,&*)) PU :q  , PE |GU!  8   0A > 0,V `,QP ZI ,,pw(h'((&'&Pp ,R,`  0`P (  R P e( zxp$`0 BP{ edT&P -@L$  0)' NK`$ 0P Z%P H' 5UT 0 ,W@P '@TEl%&$R$R$RgH%R $ f`   0@@ p 0@P} & T&PY @u$`,$$($%$R$R$R3LQ? $` q뼅 , 0@@ p 0@P eR% $8%%#Pw $  0sd@` @TFP tup$ X 0嬴@  |@TH($ tU 0  d@` Hf@T`0 A# U  0 pg# FXZ 0S@Pc`, 6@T$`S#"HP $P  0b@` H@T!" !uL"  * 0R@P L@Th`0 AD" $ 0p, "  0 LP?  Q9qupO! XI 0失@  L@T:!$ R 0  S_ $ R 0  S((!(1e 0$%D H ,`,TȾLhx \(,dL \hD@xpPR R R O-M@ÿd0D0@`H[p\` \pl0h`Ѝ_0&P ` 0CIS ApHQp  0pP`Pp94@  A@4 0H-P  oRPlAU@@, T@! 4@ @,0$#P%   @ @~ ?+ /o" T  @ @ |Lh  @@Po00H  <    p  0  @   @-P @ @Tp@-P@Q iP3 P"\ <PU(($ `V `V`U PPPp 00Bp PpH AA!HQʯg `(  ppt <  d   p@-U@P@ ~ ?+?c XTQ @% ,@ ` @   Q $ @ ` @   Q $ @ ` @  tLQ \$ @@<Q ($ @@  (PQ  8PQ # @@ # ~@@ tc`TQ  P  @# f@@  P # W@@  P " H@@   P " 9@@  P `" *@@  P (" @@ 4P ! @@ P ! @@  P ! @ @@ P H! @@@ P ! @@ @P  @@pPLQp  @@p,  ,  <  |l  $ Ptpx<L\0G-( P H?A``P3DpX+Q,PAP ?P P  |pZp PU:p P    0S 0S 0 #  QR00/R Q RQ /R Q 0S QR00,/H-0 0 H0H-@ T PPT  PoP  @P T0P P@_uT 0P  @SuT00@-P @GuTA-@PXQ,p`p`W P P'uUQ 0"2,,#Q/H-Q? \5 0@""< """<P """<` """<@ """<@ """<@ """<@ ""BR 0$,%S @P""L """L` """Lp ""0BR0H-888@8P P@ 00XPPXp@-<<@ 8up4@P9$e`  a @pPUG/@TPP PCA| }8tpD@,ZdddT P `@XdpppK$WG,$ 0!S!`q 30S0@?3S P  P HPCA $WV D@# G @ P    Ѝ@PT~P D" 4P ( PCA  @T(QapP` qpWMGxPP PCApp1Tp<(L l thPD ,phtdT`(ȣ<,آ̢4$LhL84$l` ܞHT4(p$t,Ġld\H-LP @R88 PC B*D<$x8 RDQ/lP h%R!R/!Rt%RQ/ P/O-Mⴤ 80SDPU Ѝ lPhPP dğd` S @<pHV`L`@10(TPP\0`@@ $  P # v  0@p @lP h0P0P0P /*0/*00ϠT/ʌ 0*q p|T|xpWHJ\@nlTơW?TơW8TơW1T&ơW+T2ơW$T>ơWTJWTV W |`@@@@` pVpW ':p`@0Q1P0#1qa0(t!p`Z PP# PqD ' Z% PP H 1\0 H P,@@ T !U``` `  R00PtPP P t0P(PT0$p A-0P Jpa``VPS Xa``VV<1oj00`V%`AVPa4 (40`BVPa4 (40    1'njOJ Pn`"qpWpr`V  0`O-p! XS T(D$<XE @ T T' Q0,[S qP0PU00S0000`VP 0`VP[@,`` V T1p00PQ 0pWT@-^:J00`0S4?:00?:0S0C^@1,0 0(0AS@1,0 0((p@-M@P*J\ R!ڐP r`P!lP0gnj Pn`l R /*P 0 0 @ 8Ѝp8@-\JP\@ T،n@L@@grHH-  0S h0/+0 #'/*8P , {,pH-8!?: 0S%0@S 14 (400AS 14 (40 0 00S `0/+0#'? :8P , ,zP$/G-x" R d" @  " Lb?:@`X 0S9 S|n"QJpP p! V @1@qP ڟ ql|! ? QFZ8ꛟQJn0"<p$P p!  @1@qP ڟ q   n"Q ]?:  q d  X@ @x pT@t$@-@dPPDP ,   @@h8/0H-h@ Q pP QpP U  KPR0p0H-@ Q pP QpP U  0P700H-$@rP+00H-@rP"0@-Q PSZd000\^@, T@@@!\@@@@ @-R0QSZ\^@,0T@@@1\ @@@@0p@-0S( P ^0@@@@0S `0 0@0SUPPQPJ^@ T`,VA```pO-M#P Y  rPCZ `p@P1DWGP ЍO6P. E@P PpPTV8P  w,!A!W1Ru@ @PZ0 (p00P 0S0jp@p" W P P @kT D|upS H pGW `[: |KpG|[*p?P p尡 : @P@`GeP1 pPUp Z 0p`!pp 0p B Q( 0A pQ 0@0PPPЍP8 0 p0H-@ ,Pp 0H0$0H-@Pp 0H0   O-TM`Qo pqPC[ dP @P G PPR0@[HjTЍP$0 @ pR> 0` L  qp  WpCI 吇(+$P @ P TU8  P PP P P PXppH$ptqPCK $iqPC P  Q$`$P@$V`FLqPCYIKP3 @Q! ||h 4q@D$pPT@CEt!)+ $$`qPC  APQ J $ ,Q1(p@P0W1P@u pW1pP.  b@QpQq[@D| pl H !K[ PEKU*Y$ p(`P@ $P ,@ 0,0P0(  0`Yp  0@` P$ P@T @PPT P( A Q PQ phTЍ 00H-@ 0Pp  0Hq0t0H-@Pp  0Hc0p@-P 4@`p  p@Pp0H-@Pp  0HB0Q 0H-M@ P UQ U PQ, 0 Ѝ0H/ P@$PUPp@T@O-MS `p  "p01Pp0.P 0P000pE`/P *P@`p|qUh HD 2/`P$U<P,.Z@>P [ ! D.Z  0  0C AHDp/Z *Z@`` `Q PQ`Q'qr P P@7/@DT PH`DpP PPЍP qpħP@7/@DT 00`B/P[^  ,Q H-M0 R!R Q L ЍH/ $ R p\H-M<<000 0ЍxxH-M0@@ (Ѝ6x0x(0H-MP@PQ PQ  * P Ѝ0dQ\QD  <x 400 Ѝ0wwpwdw4w4wA-M@Q,@PA P0 @) 2"!1K`p@pA% a!a @ paP `V $Pp`Vp fPP@ @Ѝ赁N 4 A-M @ R  $ P? P0 ]) 2" 0C`p@pA ?> @paP `V $Pp`Vp nPPOЍkLX  A-MPQA@PPX `a0 )H!2" @ pA0p$4|q@Ap " a@q9P* aV$ @T $P pp@T WsP !P`V X PU r`PЍ-?L*S 0 O-DM4lPi`Pw $34:p3pP@ @4:P8 P Q9 21=QA #Qz Q/1  80q(84U<%%!1KP@%A % a!a@pQ `P =2P P4pq`o1 804(84T<%% @ 0A0P$\4@$A #" a@QfP8  P01 T  80'8PS<%% 0CP@<#A ?>@pQ 2`P g `  P2   PP.  P*   P& | P" h P T  P @  P ,  P P   ! Y P P PbP=T ,@ q @Y  q@V d@ ,=pG w P`Q6@~qP@vq@DЍV |dDЍ-?L*SkLNL  ; h V @ q <  W  38    l O- M` ^P @0p    00.R A*R0Se p%+\P p  00S@   RW%S ,S  RP p00P000+0AGS`1  << 4  R P    p   0  dQ00  00p  d [  Q`P`p0\Ph        c p@0iQpp0ppp!p3 QPp0p0000c00h PnHH"0  ` + %~!\P  p PA` 0\Pp P.H% -,Hp@0 W:P\Q P^P  P \[$ `@ Pb @ $<p 'o/> Ѝ%p0%p0%?%>%t%+%;p0%{2}%*| 0H-0 ^^ \^& 00NS* 000 0 ^\00@ P Q 0E  C ~0 % ,  P P,S 'S\S/{ dS :)Pa0 !  S :@b%aB 0   b0%! NP0 P 00}0:S ' 0000 0TO-Mp@`PDpQ$ %QpPp1@ Q:"PsPplP T TX  @0@@T`ЍMH-M 00 0ЍHЍ/O-sMpQ `PP T [ 8\<[ 00@4@Pp(\P, 0pp$P  PJ PQ$ %QpPP1@ Q:sPPlP Z Zگ 0@Z @8PH  T p@T` Q R c ,Pd  4 @ `@%T TP`%V `40 P:,P_PI 4,0P% P0 T-`@ `0P`@@Q* 0F@XSe qP0d.Z00 0 AqR Pl00P`0Z \ !F]P?xxTxxxxxxxxxXxX4`xXxXxx P @ qP @  M  pPF &FVQ \888,48<8D888888888888\l|888888888888888888888888888888888888888888888888888888888p4 P @ A P @ ~V !Vo @ Z4 0 pP*,P W,`]P 4,0` 0pp 4P4( PP*   P 'PP'PI P @  P @ A  ;R ?R%Q Q P- @a@Q OQFI/P88P@@ P @@ APP (PT*1@P OQ!80!0! !P  P @ P`V  P4 10 P*,P P @ P 0 0p 0@  PQ*   P +@p>p@<W9 Ṟp6Ppp2@or.Ppp*PWpp$pp!p W ሶppP}P}PA ~V OQ  p OPq  P %A@Q" OQ} a ARI/A AR @40 P*,P _,`\PY 4,0`T @4 @l  APT:e ^ %Q Q    ;R ?R eRP P @Z ,pP\P 4,0p  0,p444,  ,p psߍaaԧ MH-M  0  0 ЍH Ѝ/ MH-M  0  0ЍH Ѝ//<K-Mp`PQ`s`P# P WpPp}[P  @TpT Q# X+kX)=X!5 T tXX' P XE X9 X6 Ѝ >pP Q  (P P  zp(P  zpXЍ<4ܰ, װht@9 3 5 , 4 Q  h :q q @-M0S H@P - ЍA-P`P p N@\T  DpWP P P P P |P 0A~ J S A /  O- MM VpP /P  0 ЍۍOEP= Q/Q9 P6 @`\V.`P& @u\T  Pp  0`a\M V Wg@? P$ @P`t@:PUppGTP:PW g U g  0PF]P P9 P 0 >P 0FP% @P@`t@:PppGTP:PW g U g  0PF"P P Ѝۍ M ? Z L ; t R O-MR `@P pP %%YP P  !YP  P  zYP  GP YP  " rPp R p P pP 0<@p  p `[ `Q'pQ Q , p`[PAq 0Xp`pQ pQ [ ̌`P 0VvpA  !P 岐$ Q$P o $P`P PR #[$PO [$ XP$E `YC [ PP0 0Ss0   r0P, psP nP fP2Ppp1[p p2Xpp[ `ЍG-MtPp!` 0 P4@PpP+୽ Q@P  0p pR/Ѝ P 0wP  0pP  Pp pEC `E,E E8Zd rSc #0P< P @ppp Z <8,P < R  0 S P6@ arP@PP <  0f4P8080 PS*W$P  @P@U@ p R@Ua pPU;< f0@@ @DO80P. 8PP  Q @Q p\Q P UP @PU p\Q<0QV0PE 0R  , 0 0 0 p0PA0Q , 0 0 00P@UPP%^T ^URPu , 0 0 p 0pu?QQ Qd PEE/QD (4@LXF  , 0 0 k 0 5P2 /, ) & #  @Lp W :<P 0 $C84Px4PP <p 0 38i( Qt<p s08PVuu,p Up pP< Qupp~<,80Q <  0S Q p<0PP Yz0R < Q Pp\pP@ ppW <4P80<Q < 0 0S 0Q  p<0PP84 PUR <0Q @pPePPЍ0kLn B 0!S/ 0H-M@0 % 2" @ PA0P$4\lP@APH " aP@0XPPЍ0-?L*S  0H-0M@PR0P 0Ѝ0]P PJP&KP> nP> PPM P P 7 K P7 PPBKP2 P2 KP P9 P- P+ PP.P, 2PP(P! K P P"P PP P PPPP P P P PPP PPPR0Ѝ0H-qPpU@@P1 Q|``,ƳP | p` `Q  ḳW|`pQ  ᫳P|37`2`F``!(n!nH? 9`0P  Pp2"TpH0?? 4Pg:\P `9N? /`PXVU[ PE`  A? ԏGpP8X?|pp 0PTX \0 0 P`@ ```L9 `C Q? 婑`FGQ?XTp``0D  0 B R{ X0 PpASk  jP`yPv ? sP 0 % |SH`Q`dph` :L Q? `E?l`/ 0p࣑p`F0Ql7*VU 0PE6`$P)  ;6? `U  EV*R  EVR  EVR PEP$P ~7? `Ud  EV*R PEP$P)y     ` $`P`P  Uy V00E *S_  PE$gP$`DQ  `P9?  `P`PPP `U $ RQ `@A`P`P:? $P$`0S PP`PVS $`QP R25`7 V0C`0LP`p;? $P$"`0S PP`PVS $`Q$P (R25`7 MV0C`0LP` \ X P$XV`PU 0EV *S  `PE`PP`  HY`P P`$Q ,0  zH0Tp?? `PHp  \eT\`0pV aHp  \UT\`0Vd V)dHPed `pBTp P00C\ Q  LeTp HP)ed d `p!Tp`T H` TpL` . ))()4dHPgf d e0 `pTp Pjpdh T0\0Bt0BP <\Q?TpP`P` Y( P(`P `XHPedd 5? Tp`D$XQ 0  )$`pXP:P ? Tp0P  P 0PH`DO? Q P V+`0Sc 0CV*S  `0V 0CS  `0V 0C S  ``@`i ``0 YU \4 Q?`PXb Q?\DG? <8\P`P  `Q!P#*XP Pe@p00 \Q(*`0% pS 0C` Q:XD <@`n??PP <@`@ \  p`0 aV# ! ,2 Q `V ,``P \  `PLP ` 2 Q PU P P@ Z P`1@ 9F`T0 X9 ALVc \ 0`e@ITp?  LP` P@ J? \T P 1pV*`0ZS J 0pS:\\`0P @P:  2'a`PP`V%P` PP  `P@P ` 2'QP^M? Tp`^?? 1 5 `@9岀0F9`C@ \K? HL R V*0  PQ A0S:,L Q P?XTp#` P 0@``HpH9`CLTp ^ DHAP0 `PX@P@Q \PNp X `PH4P, 80@B8 A PP B 0 R0N\QH Q? P( )R ( PQ`P<4L Q?0 )`FTpQ?R  `PE)dHPed `pvTp PL0PQ?Py=P? ?\ ?P  LTp `0PSLQ ?,P PPXTp`Q R !`a``a$` `a a U ) { Z D H PEE A-@P8P ( ` 0( 3/P83 , R R40HpBWp ]PU 8H W,4P0( !, 04RHG,`4`04 ,0 0R0P`04005@-@T Q$0SQ R@ R8 R (3/$0(3/p@-PQ @ R $ R`Vp R` Qp0PU 480 @04 8@T0pH-PU ` Q $QpWQ@  R R > ?,Q>? Q    Q 2P R?  R 0S/$0S\ 0S/$ 0 R 0$/A-MP R $ R\ PЍPk R,2 0S0S@@T:S@?LRl/@ <@00<  0bP !d0P @l@PE0``,@pV003WfST*@`Q: l,0@ S Q `Qpp3VPPaWP R*U:PlP0@0U D Pr OPQ 00?K? M@,P0P4P PY PP`<@$`P pPTh?Q R/$ R R 0S/,00SA0?<Q@o/K-pQ 0`S @$PPUP8PT (.*3/pP 8P ( 0( 3/P$ (2/8 .*MP  R@ :o=RTp B0pG 0P T0p YBp ( 8 c8Q R/$ R R 0S$0Q/ / R 0S/$0S\ 0S8 0 R/ Q P /Q R/$ R R 0SX00S/;Ƞ Q C? 0QD0D0A /Q R/$ R R 0S$0Q/p@@/O-|M000RX0\0`0d0h0l0p0t04, XP0p`pW@```Z 0=0P5 P1 P- P) P% P!PPPPP P PP 0e X V XV6P/P+P'P#PPP P P P  P PP X 1UpPJugPLJnPHJFdPDJaP@J$aP(:JaP 5JaP0JaP+JaP&JaP!JaP JaPJjPJP ,op$(,@ 0Rc3  4p80pR `V P`P``0T T Xp@L`@,$To@ X0pP0 $@, 0(`Q :T``@ `,@0K: S( q!0`B @K  X @@ PD  P $@$@ [B 4ర[ R UPpK [*X0pI `@P`0 V:pFQ0#%S0, 010Cq! xZ @ 00  |Ѝ0p- 00 T O-  0@   ,QP @0S 0  pWpW  y 0  LQP. IpY  X, QP @0 0 IPH  P- , R P0 @0  0pWpW  % 0  LQQ0 p 0 00Q ,P P [$PF  P- , R P0 @0  0mpWpW   0  LQQ0 p $0 00Q ,P Pg,P7   R!+pWpW   0  LQPI0 00 0  00 8 0q pWpW  _ 0  LQPPtPg P^ Qg QDP tPtP? l80 ` 00 1pp t l Bt lQ\ 0R8UP @Cl\ pWpW   0  LQ2$Vi PcP! t P*tPV P P`l3`lX. 80 pSW* W W% WgWfWeWdWc Wb Wc  W^ Z 800 00 1pp t l Bt lQ\ 0R8UP @C_ l\ pWpW~  L 0  LQh      B B , R R` :u Br0p0pppp1pq  `lb t ` Bt T 2/4VA V \l 0P8U BP l\e pWpW   0  LQQQ P<V V[  0p V LD  pRtP\l pWpW   0  QLP: VQ:0Q: 000  00#00 3 00  00   00 00  00 (Ѝ Ѝ  <pp0  000  4pp0 00` pWpW   0  LQP`oЍ  @0 07 @0 0P+ \PJ8l 0 B l\U pWpW   0  LQPQ(Ѝ@-\ @T$@T^ @ T9@L8T;A@L\*\0| p@-!!$2T3P%0 PU $PU^S p@T9@@8TGAP, P P%l@ T#*P @LP@T PPU `V$PU `V,@T0@PPTU T0p!&!'pO- M , AQkZPPY  @*R:1\lp` BpGQ``1V` V *0I?oV 2  RgYe Vc&)o ᠒  0 &$`@ @@ !@P @T@T  C 0  LQW 8\ W p '\`F P,\  C0V  y 0  B0s@ `R' , V&*<l@P 80Al0 lPP8 0 C, l@V`l l 08C,l\`P5T   P\`Q <@@< @BP,0\pW8 AG\l l P,R@ T@T 8  , l@T@l  0* !CP,p5R\1XApQ*0I?oQ 2  `R?Y=  R9Q7Q@@`Y Q00 o`8 0 p\P\@T@T  K 0  LQV` ЍA-PQ ` P $P@TP9 @8R;! ,P*PV 8  0(/+3/PP p/+p 0(, `3/( 0,8 3/( 0L@ 3/( 0D 3/8P@ R D RQ, 8 , @@ L DD   0 b $ 0 BP`kO-MKP tP "tQQ P P:8 lX@H` TP Dp$"4 p@00H Q , @ Ps`Pu:lp t@Ap0p` A0p@@p!Tr  Rl# ``PpXd1` `` `Pt b 0U` @Bt*P(:0E`080` E@DH`lTX4P @@0l0 pk'`p`  BrH`0  KPl r6l 8p `pl pX0THpV Ha%`P*l80 pp 00p 1pp t l B t l P:\0P8U BPCl`\"pWpW!   0 PAU PЍlP#Q.\ 0R8UP @ChplP\`V`V  U 0 @ATPPPQ/ \ 0PR8UP @C5`l@\pWpW  " 0  LQPPPPO- M lt lBPt; tP tQQ. P0 P08l`X@pTP!p4p0 P` d`Qx Hp` 0R#*l0, p|G 0CSP`Q `` px `dR *ePlp@ Qx RZ:PXd0lt B0rpP0pp0`C#0v`ppX5 VLc 0 Q0``  bOKx`Pt0Fxl 0C@pF0t0xppGw_ `@ Vl`8XH0T!D@4P 0@ P PHP`hP~ 8l0 pPp 00p 1pp   P%\l 0P8U BPC `l\ pWpW   0 PAU`@l h Q\ 0R8U@P @Cl`\ppWpW   0 PAUPlt lAh tP ЍhP 8l0 P0 pp0 q`` h lP#Q.\ 0R8UP @CplP\`V`V  z 0 @ATPPPQ/ \ 0PR8UP @CZ`l@\pWpW  G 0  LQPPvPthO- M,@`x @D|0RlDl@4@#1!PTt`8pP3`P` P P P\ P PX@TT@TP@T%@T#@T!@T@T@T @T @ P`U@T:  ` P@H P p P  U*0SR  Ѝ p@-P@P@T `@ P P 0 0 F0p/| Q/O- MR: p~P`4`%0a.&`RP ~p`R'p.  ~p`R'p.  $4`3'21'R@cUg 1C@೟ 0PP#%3 u`a0%G %[`#;@P@$`% P P%%C u q@ p$%G @%[p$P@%p&'S w`aP`%'W '{Pp`%@'@@p 'S w`aP@`%'W '{Pp`%P' PU c ppq`p& k  ` &00p!`P DB'@ppq 'ppq 'ppq 'ppqp'p' '`ppq 'ppq 'ppq 'ppqp'p' 'ppq 'ppq 'ppq 'ppq p' 0' #pp01 #p01 #p01 #p010#0# #p01 #p01 #p01 #p01 #R-:10p~` P@.  Bppp'Rq 'ppp'q 'ppp'q 'pp`p&q 'pp`p&q 'pp`p&q 'pp`p&q 'R \00~p R'.  Ѝ~p' B. p|  z x (x G-QR Q0Y   0 aq0P@.@`0 @FP% 0.0 0L "" 혋 G-QR Q0Y   0 aq0P@.@`0 @FP% 0.0 0L "" H-P! 0  @^   @`AQp#pP` pE  H-P! 0  @^   @`AQp#pP` pE  H @-<0@.@ @L0## O- pR .*@P A xQ8xQ R*R p R ~zP , @ BK[>:RL:LL p`@vpGP0@P 00@P@ P@P@ @ P@ @0 P `@ @```0 W997w  [njK0<@RRG R5:0`P0` 0@p`Pp`@p`Pp`@p`Pp` @p` Pp` @p` P 0p`p`0pp0  BRR 0 R 0!0'<K@ Pq5RC/Ap@-p` <7!q B@<7XP DN 0JS,BP0U``AV`SpqRC/Ap@-p` <7!q B@<7XP DN 0JS,BP0U``AV`Spq/Xb U/ `/ሷ$)XX X080b$0 ;0,+  ꬷh`H-ˁb ;, R $ (  H-P @  Rp"` ` p`  ` s0pb3Ǡ 0B S S0 ppp‡0 S0 pp0 p``pp0  @ $4pp0 T0000 #4pp0   vH- R0  0  R0   B@-/+ 0S# 0@@ 0@  @0 c 0C<" 0 S0@00 0@  @0 0C0S0@00 0@  @S@00  BO- M@/+P ,0 ̌S8p`0`V  PPU p p0;S;S<S p,p @  +嶉̌R<JXPP0`pp0`V/  ᰀ@TR TR R  WʶpX RPPP( 1 P=J`RPP`0@@0S/  pWP WaPppP P q```sps Tʶspssps@R P`P`P`P NQ;Q7Q3Q/Q+ Q' Q# Q Q QQQQ QQQ",0 0q@ W0<0S100/+ RQ  0 WR+p0   0pp0p a0 AR0Pp"0 0 0 pPPp q0b pB1 " 0p+( W<pPp@@pP@@Pps0g pG3p8 Wpp0PP0pPPpyp0a73 pA7p WpP7p@0@0p0P@@P0qpc PC1Pp1~0 ̌PP0PP @UA@pP``p`PP`pg PG4p b[    r Z  P  00  P 00  ЍE?`ppW`p V} O-DMTp=0{< 0E>:pp? @;X Ϡ0+ˌT 0@ p0 ``0T PSU YP!Y\k `差y 00W @X 姠  W\ 6P 0P\{y0W'Up!@`XV @* ` Q   `\{V:P`V  Z\+yJ 0  \;Q !pAy\;`+0`;0Q 9X0;!`A\{ @`yW(Qp1A @PU*0 X@K@0 @T000@\{T:X@K@T0 @P`;!AQqA1@ papX +p0PUP100 @`9Sp!\;9 pSQ0QaA!@ R @* P`V  \;R`:X + RW``;p APPP10)pppp pppp!P0!pITp@pT- 0 ` P ! Y`P[`? ;000 [ 0 K `0>#0 R  ` 10 0." =̌W7 >0 \?;0 `R BV @`F`B`` pW`B`Y /+ pv0S apGVPA`PY @PI啬%P尐0CY 0{` @^  0p0p``PP "! 0p21`r0qcpaP` 0p`S#3tdJ$ Q !0S p0`PPp@`Pp0C`SʰPDЍ  差 @ @yW `R00pyqQ\;XP[pl{R pGYl{ 1p00G0O-Mj>:kp?;W`  @$@p^*p`PĆ\# P`kA$p嶐b@`dWᰂ3p` p!``$` pf@9専@D q@$PbpE`gUB`PP@P!`@@`$@PdpP P L@ppp@-@`P P 8@ppp@-@`P P $@ppp@-@`pP P @ppp@-@`\P P @ppp@-@`HP P @ppp@-@`4P P @ppp@-@` P P @xppp@-@` P P @dppp@-@`P P @Pppp@-@`P P @<ppp@-@`$PPPPpgntsp@-`PP @ `Pppp@-`PP @ MPppH-@`p<PP P PT atadp@-@`[P P !@ ppp@-@`,P P @ ppA-d`c\@PPzP p P pgntsp@-@E`D$PPPPpgntsp@-`PP @ P ppp@-`PaP @ Po ppp@-@!` P$Uoploobp@-`PP @ !PI ppR/0H-@!P< 00H-PP @K"P- 00Q/0H-@>"P 0@-@!@M@-@!@m@-@!@@-@y!@@-@s!@@-@m!@@-@g!@@-@a!@#@-@[!@G@-@U!@h@-@O!@w@-@I!@@-@C!@@-@=!@@-@7!@@-@1!@@-@+!@@-@%!@1@-@!@Q@-@!@lp@-@`P P 2!@ pp0H- @P P!@ 00p@-@`P P !@o pp0H- @P Pz!@\ 00p@-@`P P @H pp0H- @nP PS!@5 00p@-@`[P P @! pp0H- @GP P,!@ 00p@-@`4P P @ pp0H-P!P @!P 00p@-@`P P p @ pp0H- @ P P @ 00p@-@` P P I @ pp0H- @ P P @ 00p@-@` P P " @ pp0H- @ P P @s 00p@-@` P P @_ pp0H- @ P Pj @L 00p@-@`r P P @8 pp0H-P_ P @D P& 00p@-@` P P @ pp0H-@ P P @ 00p@-@` P P @ pp0H-@ P P@ 00p@-@`n P P b@ pp0H-@[ P P@ 00p@-@`H P P <@ pp0H-@5 P P@ 00p@-@`" P P @z pp0H-P P @Ph 00p@-@` P P @T pp0H-@ P P`@B 00p@-@` P P @. pp0H-@ P P:@ 00p@-@` P P @ pp0H-@ P P@ 00p@-@` P P ~@ pp0H-@w P P@ 00p@-@`d P P X@ pp0H-PQ P @P 00p@-@`H $PPPPpgntsp@-`PP @ "P pp0H-PP @Pu 00p@-`PTP @ Pb pp0H-PBP @oPQ 00H-@`p <PP "P PT atadp@-@`P P @% ppp@-@`xP P @ pp0H-PP @P000H-PSP @ P00A-V` \@PPP p P p!gntsp@-@7`l $PPPPpgntsp@-`P$P @ FPpp0H-PP @P00p@-`PxP @ "Ppp0H-PfP @Pu00@- 5@P $ pA-P! @ P Py`` `塷pP $ p< 0 0oPF F F @-P @} @U 0m 0E F BF @-P @g @? 0m 0E 2F E MK-M$P @$ 0p\PJ` P  0PN pЍK Ѝ/ 0E 0D 5E GE H-P`pU" P @`P!.T `C h!@$!!4 pm;;;<;C p@-P @Q p p P<P `pP#\\! +P @@` Pppl h kH-@P PQ  pP `pPv#\\! P @@O`v@k $kQ/ 0 S /jQ/8 0 S //Q/j H-^ L0 SQ 00S P !#@jt Q  0 S//ip@-@P PTQ p P ` P"@pi Q $ 0 S/Q/$ip K-M@P, P`Q%V# Q  MP ` p0TP S0@ Pp Ѝhp/  K-M@P' P`Q V!   p婵P x0x p0 P0`帖@ Pp Ѝ(( (0+ 0g . H> > ? P 0(  SQ 0S / gH- R 00 S R_of  H- R 00 S RJolf P 0L  SQ 0S  @/  PQ-$fP P ,00R  @/ Re H-M$@P PP  P0PP, 0 P# pdP `0 P  PL  P ЍPev H-$N22TdH-P Q H赽88 80 0a$$ $0 0b: ; ; : ; ; H-P H蘽 0 0ot: ; ; @-@lP XHp<P mk111\10H-@ P PT1P P 00H00Ht ct t H-P 0 S 4  PQ6o"t  //p@-@ PP ` P `V:<P P Pp P P>p@p0H- R PP @Q/P  ,  @00XX X0 0CDD D0 0;00 00 03G9 9 9 '9 b9 9 9 B9 9 0H- R @PrP  R000H-P<@P /P P PpP P>P  0H0p@-@ PP ` P" `V:<{P P PprP P/jP >eP  p@_pp@-@PQ@ UP> @;Q <Q >Q&H`P, g&Q&=`P! a7P m2P p &*`P l$P tP ;Ppp`p0H-@P<pP| P P P Pp PU:<Pg pPb lP] iPX sPS tPN  PI vPD eP? rP: sP5 iP0 oP+ nP& =P! "P 1P .P 0P "P >P  0H06 @-<@P+ /}P& pxP! lsP inP siP tdP >_P  ZP @T0H- @P  \ P P 0A0>K-`@Q 7p0 PCU pP<Sp0!S0-S0-SV000S ppS   0-R-S >RppS /SFPPQ PpP` p(`>PX` P\ PQP/Q PY $>Q; $>Q5 Q PQz  Q&  Q@  =R(  P R0!$PP"Q qR  PR "R  PP>Q  0 0^- / / p@-@P&U U[ <UT `Q TT*P@PaPEUL`QD(((((x((((((((PpU% mU3PpUP;U.&P`PtUP;U&>P`PtUP;UR``<pP >P `\ Ѝ`) ) \) O-GM  bEF T 1/  0PQ aVk Q 1/P@hP pf T 4/ 2/pT 4/W hW WqWq) @h@pP Q 1/P`hP P  2/P V 6/p V 6/Gߍ 0 0C 0 0: 0  01ll l0; 0(TT T0E 0TT T0 0BG% n' " $ & $ r& ~& $ &' & #% J' `' $ &  G-Mr@PP`P?. pᐮ  Q:?F꫻B!1 X 0$Vpw4  pP%p! P p  qz@SP @Q/Q l@} f@ۍ/Q @P*T @T P/Q Ap|Pp1  ᨳistX/.plXXXXG-M`jhPP @,-p pp E0e `V`*1 @Ѝ   0pcx  VZ0 : cp B@-@ ;9@ H-7gP 0 0 )" 4" P/ O-KMp( P@$UQ TFGo  0PE5/P  JI/ 0`P $A(qP P7 1$!( PP qA $A(qQ U JI/0P @J_Io($  2/ 0PKߍ 0 0 l //@-@@# H-M  Ѝp@-P  P P `Jp(qP @NN¦P `,z pplPXkpHH H0 03ETHj   H-M  ЍH-M   ЍH-M  Ѝ@-@T  RD /Q 0 S / !@ ! Q/ q3/@S"# Qr3/CP ,0 S0! 0/CP ,0 S0! 0/BP ,0 S0! 0/BP ,0 S0! 0/\B0H- R x0P0U0A  t 30t00 0 T    t :@0Bp@- R! 0P0UpA 0t'P0``R  0T0   '('R@p|A0H- R |0P0U0A ! R 30t000!T   ! R :@0@0H- R |0P0U0A ! R 30t000!T   ! R :@08@0H- R 40P0U 0A  U0H@0?0H- R |0P0U0A ! R 30t000!T   ! R :@0H?0H- R x0P0U0A  t 30t00 0 T    t :@0>p@- R! 0P0UpA 0t'P0``R  0T0   '('R@p>0H- R |0P0U0A ! R 30t000!T   ! R :@0l=0H- R 40P0U 0A  U0H@0<0H- R l0P0U0A   t  30t000UJ   t :@0|<0H- R x0P0U0A $0t%(000R U J  $((%(R@0;0H- R d0P0U0A  U  0t000UJ  U@0X;0H- R d0P0U0A  U  0t000UJ  U@0:0H- R 40P0U 0A U0H@0P:0H- R d0P0U0A  U  0t000UJ  U@090H- R l0P0U0A   t  30t000UJ   t :@0x90H- R x0P0U0A $0t%(000R U J  $((%(R@080H- R d0P0U0A  U  0t000UJ  U@0T80H- R 40P0U 0A U0H@07P 0(  SQ 0S /70H-Q DP@PT0A  USSZ0$%o0<70H-Q DP@PT0A  USSZ0$%o060H-Q DP@PT0A USSZ0$%o0t60H-Q DP@PT0A USSZ0$%o060H-M@ QV$PPR0Q -Q  p/:"P+9xP   p:"P  #pݵ"P , hP Ѝ0 H-$!c(040H- @0  Q@ PRP0 TQ @ R*0T300H- @0Q@ 0PTP0 R Q @$0T*0R30@-@7<0H-(M@|0P p   (KPPP YP $dP(Ѝ0 6 z J PH-P 0 0@TP0T`Q URSZPP!&oPH-+H}X@dwH0H-@S@P 4P,P0P4P8PoH-M$PjP@P* !0 FP P\   c`p "PL  PF"P 00!01 0 0 BP1 `pP+ `0 2P Q OP P` pPP \N` puЍV nPm . = ȭ0 O-Mp(` P@pW=Q@1, A 㕚Qg U P V T/* A U UP V P* A3! P V P* A2!0 V T7* AP z-* pGZ@X$ pЍ R U:05p `BV  =R p0`5 p AR<Q ЍS @-@P G-M Pd P `Pf  PU%:p@`* xPT $  pPL & hPD ? bP> PEUU+  00U@p` `$GP& ' ?P =U ( 4P =/P L ЍGu8 ЍG`@Ѝ踩  @(H-0S RR <oP P88 80 0^$$ $0 0V u U c 0H-@44!((PTPP0p@-@T  R Q  0 S/P/\Q  0 S/P/$P 0(  SQ 0S /0H-P 0$PP @  0 P xPP h 0 P TPPPPP000 00 0Χm $X  ( p@-@@@P@P*,``#p|h/ 0 SI R 00 SQ 0 S/Bo/80H-@@P } Y P 0(  SQ 0S /0H-PiP @P  2/P &P PPg00K-P @P@ P hpc`l$,`0`P4`8`<`p  KA-MPU& @`p -P  0 P (pP d  0ppoPpЍ$$ $0B 0੤j{ QzH-Pp@P+ `P  2/P P pW  zP 1P -P0H-P (@P100yp@-M@004 R5P,S Q R `V1 P#  0Q 4`@4ЍpQ 0 0f*Ѝp`ЍpDD D0 0d00 00 0u  E R % H-4QA4 0 09 i G-@P`s4P WpP  xP 䑟 P ]YG4P ` PH < J*p P,< P4W/,ppQ 2/Pp P p` *P `V:np 0B 0} 0G 0tPP P0 0Zl<< <0 0dwT4fvw } N U 1  K-P! PpW1@W U1U144`P`P , $! ,DD D0 0 0 0 _ @-@@p@-@P ``QPzP Q < `R4 Q ,adphh h0Z 0ӢPP P0B 0ʢ88 80G 0 B  e D p@-@P ``QP0P Q< p@#<< <0 0]㕢(( (0 0Z㍢  N  . K-S' p@W PU `P P U  K 0 0S } /A-`@PpP NP P @*QrP@ LL L0 0B# 0 0A   0 [ @-AT \ T'@QARS ^ DQ B@R S ^   0 0Z١ j v G-(M@RPU tP0  ` p  8P fPT(ЍT p     /     / 2/ / /     / 2/ / /     /K-(M@PP `P Tו$P-P (Ѝ(ЍK* 0  B0  ppoY P QPT T (ЍU Q   /@-@T p#0$0%E@-@P @-@PH-P sH-P hH-P ]H-P RhH-P G<H-P <H-P 1H-P &H-P H-P `@-?^ ʎ ! 0@T 0 @S^ 0@T 0 ^# O$-A(? b  @0<4  /| /`/H@-@P 1/p@-`H@PP 㯡 P ȡpp/CH-㝡-H-H-P 㐡`@o//0H-MP@p88 80 0; P Ѝ0vt @-M@pLL L0 0;( qpЍwt@ 0H-MP@p U U U dd d0 0:ŸU, Ѝ0NЍ0tQ @-@p00 00 08㠟  @^t @ r 0H-@PP(( (0 07㊟$@(@0 -  0H-@PP$$ $0 07v(@0 & 0H-@PP$$ $0 07c$@0 $ | @-@PXX X0 0;Q4 A    $ 4 @-@P ( 0 070( @-@P $ 0 07$ d R/-ptx` P RjJP5W   RGJP_ P?e0 3??o+0⃑ iP5I@ 038P?e0 3??oP 0CP)H RJ@> 5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@e P//-ptx` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@Pῒ800 @  0  /UUUU3333  0H-@PQ!1 09!  @  Q d8@HHPHXHtH|Hpc? b Aa-lswr  - w-! Q -QxsSr - w-  Q -QxsSr - w-  Q -QxtT    0 ; G G-P$$!$1 0>㧝 #P) p㾋P6  p《P.*̀@'`qPqP`@pW   P =PUp@qPT_ > 0H-M4"424R 0PPHD@P< 80*  ɞ@po  žp ttd PP|PxPp \PXPPTPPP P\,oBK 㛞 㗞?@QP,P-d-0,8 0  P,U P L@ rp}P L _ [d PL@Ѝ0pN L </L 00$O-MP@PDD"D2 0?㵜 T D "P FpXsЍ`xP+V -V `0V  p0VpTp xP0@ Qa@"Q#O*p`? P0;@I" 0 0`0PF/ U:aPFVU:APF6UPSJ0Z0: 0!`"0 PP7e!`"/0P`S`q p`pX SЍA@Qھ % 0 `00O-MP@PDD"D2 0? T D "P pXsЍ`՗P+V -V `0V  p0VpTp xP0@ Qa@"Q#O*p`? P0嘋@I" 0_ 0`0PF/ U:aPFVU:APF6UPSJ0Z0: 0!`"0 PP7e!`"/0P`S`q p`pX SЍA@QN `p@-M($`P4@`P 08PpЍpO- M 8 0p<4R *hh!h1 0K`@XHH!H1 0MUZ@P W`P D0@5~@pۜ؜` RQ 0T :8<P*R" RV Q W0T  :80< S3Pp@  Ѝ L W ֹ A-MdP`dp@|@@` R |0RЍ  Cd;I p@-M(0@,4PP`pЍpO-MP@PPP#P3 0ɚHU00#03 0㾚P[#3 0㳚LX"  `E@: 3pP1"P -"*x" oPi b ARE0!X    t            $w t!'/w '%w u'*w z wTp'!w qPQ( xQ*Q@  D  0L R0 Q'! P! ` L0oЍ P p  @pD0 W T  0 Ѝ C M  .   M+ е ( 9  /mNAh\/<O-MP`Q Z U Y Z + @T@@t llP VP`< xd \+ @@@@P `V 00T QP-P`V p ࣅ`P+P -P j  `@v/ x z PJ @ E Q EQ`@-X\ P p0 R ``e 0SAA@ )9_ 00Z^(8 0&UV(8a 0YM(8 0ZE(8 0<h`眨 z Y(8 0J @@ CEQ =EQ@J-X\ P 0Q R``k 0SqQPq`PfG@' 眇圷B  ``S0q q@-VPPPB =mPPz `@{:V p+@oPm P WV;Q :Q& Q PP:PE`?`v````Ѝ耦 z tFY@hh&h6 0GJ pE DQ DQE,X^\Y P 0Q R``k 0SAQPAdፌ`PUz @ppPU  PrP@ t  0S 0S Q@Z- PU :PQ  <K40$ Bp``d`hPN P^@00t RP)S'  @P:POQ -P+P_ZP :P x?`( @R]SI \0Q:P @T@@@T|t"P :P\`W <4P:PL `-P+P:`:Q :P?`P!(20 P P  `P`@`P@ `P:P sQ 10! A-P+PW]Xꅲ ² ] 1 i | q J I 5 ~~|~~td {{ ұ zzzz\f }x}p~`~,~zxz" <|] `(] H0^ b (yy Y " wwvv  (tT(X Lɬ K-@PQ1 T9 4P> ,,00 P!-Q ``pWp8 -W2 -pR<"2 0 \\"\2 0D[T@@"@2 0EQ,pW @@"` p`::W 1b-p``-DkP p>kP! :Q1Q `:P  P>a! 1 `0PHH8?PP:P  P q 0:P:P ?PP P 0i r A t x Hq0rqY q Z qTY $ppoo topopplpLppX ,p(pToW ,o @-@P,, ,0 0/㗕 @\  0 @-@P(( (0 0/フ@Х   H-MP`QP3@P PP p 0PP 0PP PP0P ` PP`Pޖ`Pז`Ѝ\A-@ ` 0Q pS P1Q*P pEԕ Pp pAWp   Q! H-Q Q Q+s$ 0 0̔sAQT 0 0㶔Ϡq  0 R1 R010 aԣ   | ʣ H-0 Xcj@0 Xx p@-@P`P88 80 04㜔o 0p@Lۢ  C @-@P00 00 0Aㅔ 0@L 0H-@PP88 80 06oo ;0HLu @-M@PDD D0 00W 00PЍR 0 H-P@P`` `0 0/9p0UaU V`q& W A-@`pQ PTPPT )P  0 }PWR Z[ Yd t@ ;hUP9tP6 0 pUT x0 pLxBpJPPN ]T |Y Cf@ 0@@njPЍۍq ll @$$#$3z 0Z#3{ 0xY"2 0_n@PJpڄTp|pPL_x|Ap P$t`P!࣍P" ឍPt$AQ@@/Ň!0P0 @ 02,tp l/P/ᭇPPT LL *GX X,! (! 1 0   07 n@ j  ~ P  d V ] x s 8 ٚ l P  Y  љ = "  ; #" \ F2   O-tMMF`@pXp W V TY U P @@0 DHLp A $p,$p,{ @@pT! ` ,pPJ  pY0P ,@,#P`ِ=PQ4 ѐ p h 0h`UP  F뼐@ 0h  =P  F   @[ Ti@@p,圤@Z,j , $T@T(J,0$`  ud R  L` KVX@崅PpfP \PZP pq"2 0㳎W"2 0㩎V"2 0㟎 "2 0㖎U"2 0㌎pK $T,@ @  ` P`P `@ P  ` P,P pA0 @pPtЍۍ h( xiPP(h 0HP`l P yu,@埏`t0  Ի А g ?  ̐ \ * 4ה } + = 9 x:  ; O ; d@-M@@PЍG-PḾ`PpVL; UC pZ!1 0㸍x@Y!1 0㭍x!w,pp0  ;c $(  0@܉P @崉 @' 0 0きU 0 0wt@Q p,pDp 0@@匉LPPЍ7딴0 Z  m @ q T E ĵ Mk@-@P,, ,0 0~> @$ K-M⸑@Pp T!1 0! ֍W W&U```U` 0 pP:JWPW ᥁p ڲp)ꋎ/$ꆎ@낎@ pp pt0P @ P~i#vPЍ  7 $ K-(M@PP' U/ T8 Dp$p pppp 0 ppP3`V-  0@6P# `Vp 0 0ㆌUtt t0] 0{TTT T0^ 0ppᖈ(ЍD ݈  O-MMR@P`X"2 0IYg [p TcP  0@pWi lP` < ;epPq<Pn  @+C+YC(P< R< <H(P2 @@p/H  P0@p-\P <P)H< `%!1 0Ջ[ 0 0ʋpp pp( PPPЍۍ 03pĮP  # K ' T  h 9 HZ 8 + e, 9 B @- MX@ @ !0 0 Q ЍHhO-M t tZPP%P5 0RBX2 T:  - 0P PU  PRK  - 0P 5`P  0` p Ppp@@K B@[ TpQ880p PK R R`rQrQ  @@ T-P +P.!P/ @P/P  P  0 !!PQ @PQP  Pp  0 `   /-P +P&TP- @P,T"` 0*TP! @P3T"` 0` Ӈo `ćoXP p x XP5 - 0P媇P `K@X Pߍ`` `0 01TDD D0 0  t |~  5 P~  ~ x@- MT@@    ! 0 0{ Q Ѝ<O-U.:W$ P p?0.P V*pW:V'B71@4P1*p@@V *p`Qpp:,?V35\[[z [Zp@-<`P@`(00 @p踝h0H-M@P`` `0 03χ0P4@4 P@ PW]Ѝ0y y M mZp@-(M`P 0 0B㫇 00 0 @PP@?Q @`$P @N 0`@P(Ѝpy Ky ] /y YO-dMRXP` Y"2 0Yr0p`@" F `@\Z  0@@Po ,P` p ވ  0@h`PV ૄP. X!1 0(  0 J?P,0@@pP p 0`p0Ѝ'0Ѝll l0 0うTPP P0 0wX44 40 0mgt ,u P40HP@Dp pp@ 0PcP0P,p0 0 P4 O 4,G,PBAPP;]PP PRUߍ(( (0 0㱅Yd[ܖ'q q q s 3t 9 t ! r r `s I ,s h/QA-MЀPpU W 0 04ㄅW!hpP `3h @"2  0P  PЍ@p괓bq q q G-GMdPU lHH!H1 0NJ ,۹P7J\+`ιpP P\@ +pPĆ@չW@JY!P \@Ҕl p"2  0P  lPGލzp p p YA-pM䀟`pPVl 0 0h@ᩑ ‘W!pP \PᏔh @"2  0P  lPpЍp8n Do Io M\;[;@-M8@8@ %< 0Ѝ9Nkn 0,Q p$/A-MЀPpU W 0 0FツW)gpP `xh V@"2  0d@p (PЍ?p갏m n m O-EMMR@P@PjJ<8u` NpZ xp|X 0/~qG W+  RUP⠰ W+  RLᱸ@P  WpW PẸ륅PPT@P(JY)P @ T p"2  0g@p  @( ᔸLP@PᎸ0PP@PEߍۍ븎H-M  0kЍA-xM䀟`pPVt 0 0㲃@F aW)pP `Ph U@"2  0d@p (tPxЍgpdj j uj yO-MPQ U ! T 1X  f'9  \PPPppfc >f  @L``bc <pdc gPb!5_|Pb!cQ fQH00gQ%P3?gQ%b!0`1 Pf1#0-5_f1#gq 0=pa1`1#PP0`1#5_fa0=`b1a1#P P0a1#5_`g1b1#$P0b1#5_a f1P(Pg1#05_g1#b! -,0PP`!f!" 3?0f!"g1 -00pa!`!" 3?0f1`!" e1a1#4`0a1#6o`-g1t`8`e1# 06oe1#a b1<@g1#0`4og1#eA0@=@.P`1b1# @$` `$0OgAb1#0pp`=`p)@a1`1#p' p'0xϠ`1#b! - |`pp e1`+a1#`&p&0oa1#` 0c h p p"p'4`da'ea&`pea&a@p't  p'/'.od `dq8` `.`&&hqdq'/eap'p /}@ xaq` cq'`&o&Ph!p' -0Ppp P`n!p'_'opPPl"d!a!"`c1`%o&& " ?-o D`da0(`xl1d1#@&dP0#O$$Oa|l0@bA` nA$o&o&l@$ @tp`p`p!d''i cb 쿠nq ~ p$`'o&&caP(h pmvmzA-MhP@? @p !R/0M0H-MP @vuP*JDU ?P :u?P:}up  P0 D  P0  IuЍ0LL/ Mp@-M@8u`0T` P P DIP J 0` 00IPP  4I@@`Q Ѝp@ Ѝ/dP] L0H-@PP!1 0b|sI \ @QX @R#0!,,,,,,,,,,,,,,x,,,,,,,,,,,,+P -P&@$0QP U  @@@U @@ 0, B, G, O-LMPP @<8400 ᇧ,`* ~D Dd@t@tPD00@7` ppPaIQ  pppppTpppppppppppp`8 ' p +IP =YP|@ @ ` 0DP`X@ PI[p  @\* p- p @2I GP#GP#|#꒰IPpH H ocssPDH @D  0{D=Y@+Y @V \*p,H  H>cssPDH@Dp\ %5] 0 @rWXD\E:H H`c@s@sPDH @D/ @[p=YT=Y@\*pH Hpb[sXsPDH @D  0DV \*p0H Hb /s-sPQDH @Dp\   # 3] 0 zq WXD07`Y] ,YPr) rH !PH@rT "PP : U*D@T* r@ r@LЍr  Nb`r`rPD @@D@TXX!X1 0]q+ - PZ  ! 1 0opX+- 0 p P 0UP0V`0@+TXTP`@@`@+T XT -T@`P@@`P@-T AAT Iu" " " %& h& k& $ T$ W$ " s" c" H-P`p@P!1 0]pWW/XGQQ <<<<<<<<<<<<<<x<<<<<<<x<<<<<xVp & +W-WVp=U -U +U=W  ,V-  @+p ! ! 0H-M@PPTT T0 0:?p  0P@&pЍ0  C P/H-0pP//// /  / ,  //// /   0/   $0(,/A-M@PP% T- `pP@ ԁ@P ]Op" PP P]rP. : `,HH!H1 0oT,,!,1 0o=qP]P  EC.qPЍ  p3 P@Q Ѝ \PPP P0 0 `p69ゥ  . k  [ 8<8 7 xH-`P@eXDp+TDP W 0`gPZrfpp WpP   xp  PpP̣ʣpP`zƺvp@-`P@`V 幣`VrP屣P x媣+Ppp@o塣P hp@虣pG-M@pP 0# T+ P `P= @ P Sp! PN `rP-? P+$$!$1 0nT!1 0nBpPP KI4pPЍ p9 `@Q `Ѝ b  㐤  *   o D8DH-MPP00!01 0Xna`P XA@T P p@T P P CoЍp WR l.P  C`poP vЍ3 q q H6HLH-HMP`P 0 0>m@0 ׺p p1P" @0 ɺpp$PpvoPP PPPT ?PHЍ M U O- PU:$ `PY DTxx&x6E 0f 00   Pj%5 0fV%5 0f @0⩜괐Y ,QGP# (,0 p eP6"$ 02/Q-8 Q)DT%5/ 0fP    Q 00+ @qI 1/pP @p :/P H` P, :/DP   d 0R0*  .RK   .R R .R R (@ Y RY$P P3 (, P I@P/31!@  0 P(@d, P I 0 P , .RP"2E 0e0    0 S @0⿛P|$ 02/Pv8 Pr PU#   "  PJ` @GV 1/V6gP7  2 -'g5/Q%  ( P0G0 PI(ob$g( /`$QЍۍ5`D`D } s . 0 C  I w   E {   O- MP \ R "2 0 @!e P\:U Ѝ]* p `@ 00T@3PAuPT PFV:Ud? T [ T &   QP =P==8Psl @P =P =,8Pb ^ 10P! vT P M J @G D A#PP P P P P7P Ѝ> TD(X @~y[0   H-4P <$0P H-pPP,,!,1 0b@!P0"S S, Q\S `  "P `Q`P@P `CV: S #S P@P00 0CS   T#P Ynw& H-RM@a` %P hPRލ+ P  0 ppp x PP 07\YPDR%PQRލ4. } O-MH`@PY U (8 0_bU VcPX  H8p@<8a x( @BVp4` $H ǟT T P!p`,Pp(P2$x, pbY .V  (@4pU {㔰P) ,`0 @  `  GG@`,Pp(PUpw@8< 4,$`Mx ,p pG@GP) P 0 ALHHp0 P$  P(} GRRQ RRQ RRQ RRQ RRQ RRQ RRQZ RRQS RRQ RRQ RRQ RRQ RRQ R RG@Q P G@Q RRQ RRQGY :U V^GP^Y\ I,p PYgP, 4plpP; PGGP GL 4GPG G G GP QQ G@"   ,p pP @ ݔY IP  ϔa` ǔY `P  ด4p$p(P`pa<aY$4p`pp(P ax GrG@a@V +U aG徔G@a@V ,P@@,` @[  yaa4`T@P@hPЍ\ [U0 W 7 K $`L` /h 9DH-M;0Ѝp@-MP@Q@ ``+  0P@ЍpFx`<v` ፮ QlHO-MPP!1 0<_P  `p. Q  p 尰@K   RQ ֳppE`P  p``Ѝ Q Y |pp@-hD`@@PPPJ4@T@@-p@-@P ``PpjpT~S"`P<a``` p脔0H-,   G-MP  KLP. `P*  PJ00P Q- ,q@pqApSڀ0  TdL<pU DD! p:4Z@$ЍG@&Ppp@T T p<P pP5 //pPp.p@X  q`V 0  P/VP  p/P Pp$Ѝq 4 I z  p,@-@P PT TyKP T 0oKP [L JB 0H-@lPWP XWP [0T 0T 0L A O-MBp`@ 0 ᚏPP u[`-Pc``PP `  0ဏpQ  PM PPG p p  `  <   0@hp) XᚬPP1   0pTp @  09P  `Z:p@@ `L@@`1/ P ߍ@tO-MBp`@ 0  PP u2[`-Pc``vPP `  0pQ  hPM PPG p p  `  <{   0@׎p) X PP1   0pÎp @  0ᨎP  `Z:p@@ `L@@`ᣭᡭ P ߍ<XO-MBp`@ 0 xPP uZ`-Pc``PP `  0^pQ  ڧPM PPG p p  `  <   0@Fp) X~PP1   0p2p @  0P  `Z:p@@ `L@@` P ߍt p@-X`@P`R JP` RP p p@-X`@P`R P` R~P p p@-X`@P`R 2P` RdP p   PMH-MPP@ 00 @ 0 @@@ @ T  @MР 0  00S! QKHЍ/PMH-MPP@ 0 0@  @@@ @0T 00@MР0    R    QKHЍ/MH-M 0 00P-MH-M  0 MH-M  0 Q R /PwO-,MZ@TP(| |*|: 0hWh zP8JPjf`\X R :R|R  P :     PJ @TP TP pMxX X۫`: PX@ X8,p ,(  p 0p ,p 4PJ PU(8 0)WoHP@ tfhxPp ^P XP RP tLP `FP L@P| 8:Px $4Pt .Pp (Pl "Ph Pd P` P\  PX PT pPP \PL HPH 4PD P@ d: n7<  P2(& $"  $(,048< @ DHLPTX@@X%  ŪH , 00p(p 8p4 80pp @p T&p VH@U ppd @Wp P@2/,U\pɉ믪 Lf -M Ѝp@-@ P` !LNQ !@ApA-  /o 0Q?o?#'S @c\" \ 0- (CHSS!& c pb0BPcGp00SgwsQ`SU1EQ1"U S !0#   A-  /o 0Q?o?#'S @c\# \ 0/  (CHSS!& c pb0BPcGp00SgwsQ`SU1EQ1"U S !0#    K-   P/!?/o @SOoϠ?d'T @dQ Q  @/2 (DHTS@ & d pb0R`dp0@TWwtQPSV3Q3"V S@$0 #B! ` !   K-   P/!?/o @SOoϠ?d'T @dQ Q @/4  (DHTS@ & d pb0R`dp0@TWwtQPSV3Q3"V S@$0 #B! ` !     3 A   0 0/A0 3 A   0 0 Q/A0@ ZH-@ Ap= A@ ZH-@ 6p2@ ZH-@ p @ ZH-@ pPH-S`ⱆ?0/R//R/?0S/R/P/R/H-R@-MP /@T   KЍpp :@@ D<@P@@T0$ 9똝D8pl Q + ⠇개H-(zSPH.00O-MϟpW  0  pW PU} @l%Uq@ P%EUPj0aHHHHHHHHHHHHHHHHHHHHHHHHHHHX(0 HHHDHdHHXtHHHHHH H0 H $ 4 H H\ |  H L @@1pG@~@TUw "`B8h@dEP :P @ZEP :P @PEP :P @FEP :P @pO  `  ` 0@ Q !0`/SPP<V``3 :S003`00Lp ;Q t  `P` 0@ Q!0`/SPP>V``3 :S003`00Lp =Q N  `P:0@ QI 0/RPP6S003`:R  30 0FpA4Q-4 `P0 @ R{ `P 0@ Q 0/RPPdS003`:R  30 p0FcQ 00@ SQ@n` lR0T: :T*0 A1P@T0U:9U0 A 0@ Q!0`/SPPV``3 :S003`00Lp Q   5 0@ P 0/RPP S003`:R`3  0Ap@ Qp0 0@ Q!0` /S  V``3P:SP3  0L Ap Rp0 C0 `@BP q8P @BP g8  P|M  `P80`@ V1p` 00Fs Q1 FR0 %pr0c#tBwpp#4#11C 0r  0 @ RR Bp ` P8?0 lp/ 0@ P 0/RPPdS003`:R`3  0ApcPp P @0Prdp@+0A/S<@!`0`p`0@ V:T@`  @V0A`@ T T. 0/RPPdS003`:R`3  0ApcPp(.d! R P.0Rb/CaP 0'̌ S0U::U*0 AaP0 S0U:9U 0 AaP0 S0U:9U0 A R{p4-0  @p @$ `0 0C P\ pPU \!0C0@0S0 $ 0`0pC W@A (P@p P V   0 Sʁ0A@EQd 8P 0 MR`0 TR RS K@@@@@CR 0 RF Pk`` @? R6 ,;00``@/Q 00@R @  R @ R @ `Q ` 00@ P*QA0A S *@0A8  p $(L`AVK*MQM0a a0p$( ,($  pɟ      d phɟ B  } xR3 800``@h JQ. eꤽ 0B0S 0 B  p\4(R2?d A;Q<.a(Q50\ a $( pBQ JQ, axꫢ `   P pP@ P$(PpzUH0 DY 4 5PP  5PK ( @5PE  5P? ` u5PA  n5P<  @f5P6  _5P0 @? S5P6 @? I5P.  @@@A.a p$(@@@A>a 0 $(p  <0 p 0!a(Qr  Q, Q3> B)0GK/;!`lqp'qqpWQq ""q R3$$40` # pA@q? `/{0Q"d  G 3cc#scb0V03R0!r`PpfAB `r B% I,pb8/!bB(3qRB1/0!B1c C AQA"R3/>0pA )`G?Kk;6#@LsP%Q7sP0UQ>sp'r6sp0W03b4Pp`eA W B R:4 b0 G B 4 i8Q Q3> B)0GK/;!`lqp'qqpWQq ""q R3!40p #`F 5p0Q"d  G 0`c#pcb0V03R0!r`PpfAB r B% I,b8/1B qRJ 0Q0 R00 "QߍQQ )\P ף$I XI,Э0<k > Α PL & `O-4My0 [   0 0:I[ 0 0;I P P P H@4 ~K0 Q4Ѝ?t, O :o '  0H-@PP T PP@P0@0DD D0 07?IT(( (0 085I E H  + K-PP( X0 pW! =@`@DU QF 8@DQ F 0S  SQ``DD D0 0HHX(( (0 0IHF z   R g @-R 0@T@ 0R@B@QIO-M@PP' T/ A5P5 `p6P4  5pM (=D [% X< n5P 0 0 0CHT 0 0DH 5"JpЍ 85P |pp P 5  oB= hB6p6% X 0 4 8@-MQRЍ@t9TP @PЍI I@ЍO-uMM‑p `w W I@F88!81 0D"H |@p7 @P:I/P@$E EUO0W dE`E\E9~0 C pxp  0E匥EE ,@PJW1P@PuߍۍL ҆ zi l0 PMH-M  0 ЍHЍ/MH-M 0 009ЍHЍ/O- M@P Z   " 2 0?GZ `Zn[lJw:{10P @ P 0P` aa``  PZCA 9[  P`X QP7 `P [[Zpp{p 0 0RG {ʠ 0 0@Gktp: Ѝ` [ `P % k Ճ ك Z 0@-M@9(P 0 "( 01/`p) p 0`VP <`VE:H`p eP @`1:ЍЀ`):p@-M@9(P 0 ( 01/`p, p 0`VP <`V9?HeP @`9 +HT`ЍЀ90H-PP<3X`_L__x!_ _"8A-qPpW1 @EaV P $QPXHP* V(ސ`01/P- V;  $P`@`@`PpWpQ 1/|tV@V X   0$PMX@迿|^]x]^D]8]< \G-@Pa `6P\ qPpW  U` "= ,@ QU Z>PC HP U' $ P1= 㯓pWpQ 1/U(:PP   1/P $@Z $81/P />3\\[\[|[@G-@P_ `5PZ qPpW  U` x @ QU Zt>PB DP U& P0/pWpQ 1/U(㺏PP   C1/P $@Z $81/P 꿿ZZY ZYYDG-R`SPP 0/`p{G`V @@ P ``@@T p P l``` `0`p`@ 0p@``PTXX X XWWWK-R@SPP 0/``V ppGw P ``ppW `Fv P l`` `0`p```0p`  P@|WVVVVDVXVO-MMP `Q ώP P/P P sAoA dupv B4P PPj ``p/P PZ @@/QQ.P`T T.P  PX P/ 9 upC  P /Q P J P [ { P/P PB  e , tP$J @P3  P2 p d9p'p/P  P [ /. Ɠ Ѝۍ@? [/ @e@>b@?_p@-P Q @tp@p @TC tpp@9@"P/ǑPP- tppȤ@"P 㶑`P tppȓ@"P㥑@P tpX@pp@-PE `Q3\⾍H\E 88 Q,  Q' P:Q0`Q 0@@CQ PP@\Q@:Q`VQ`C`Qp@P 00  p"@ pPPxPQQQ(yA-PpP( U0 @R5 Q `p:Q 0S R p 0SRpGS@R :XR :R\\ \0 0G>U@@ @0 0=>@Pbi i _F :i ji oi p@-M`@PP T V   0`'Ѝpll l0 0>TPP P0 0 >V44 40 0=h h E jh h h Bh h z O-LMMP`UH  Z ptY )9  0=tDW )9  0= TT)I@T% Wl l)l9 0= R 0S Q:Q |Q P @Q:Q |Q @ᄌP 0PS @@ ,VJ 07(H`  0P r`VJ(H` p$0P4``Jp [ :H+Pq@PeH P6W4 @0P@ppP 0#P pTU'7 09=0 R 0S Q:Qc |Qa P@Q:Q |QpW4``9P P P :P \PpVp ``p,Z:0P,@K᫏Pa ,J0$pW q(t4@0PP `pt`0SLQ%5 0<Ztt%t5 0B<4($4`l @ ⣋P @Pl`,DP (4Ut @PP `@:PtPp  0pSR@S@Rq =R @R @Ri @:R  RD( 40@@H $0sH@[ {{$:d 0[  F B 0S:S 0A0pQ:W:,0` AV` A 0pP , D@0 A I` I @p+  +@呐@F$= ,@\ 4p  T K ᴎP t=  XpHP LЍۍǶ=@0[|=@`RW!1 0;@pE0@8P pD 07/p P 8p@T <@p@1/'0PᕊP  w+1/pDoᠲ 1/ $ @P ;p%=@!=@$P 4.p 4$P #p@s uc c c bc c %d g g g ~g g y `M2g g y ?<!<t?l?d@g>t>$>$>,ed=4= =K-pPP W Y U W @`P 0P:P R Q 0 RQPCR@Q =Q@@T ddp P `]T\T P:P 0Q-0@ 00Sd 0@00S_0@Pp@ ^T P:P @PT:T P@pW@FdᵋP `dp@]TB@P2QE @:@Pp@@ @ @ @ @@  ! 1 08WA!1 08Y8 0 08U0 0 08W( 0 0}8FW : P ܌R hS / R O O O A-PpP4 U= XF WO UW @Qr `p:Q 0S R p 0SRpGS@R[ #R @RU 0R< xP64((!(1q 0b7U!1r 0W7X 0s 0L7W 0 0B7U 0 087 0/p0`C V:a`CVpV:A`C6pV0S0" M N * M TN M vM (N )N NM ~M K* &M VM [M O-MMp@PW$ "2 0E6P l+( / P,D 0t  b4 `I#bKP``$pN4 ($@VQ:QX@`P@F` P0 8k 4k /k=K$N ;K$N/0 0K,D$N `Y  Ak28P @PFLdL:P `  P ؀ `AР Bpc0 k($:P4 ~ 4P 7 7P7H$PK YM FM ^ )E kL PL VH-  !VMH-MPP@ 0 0@  @@@ @0T 00@MР0    R0 j QKHЍ/ݰVtUO-$M`xxrp ` ࡕTP"  0 `币{LPP U: @ P  E p  p&AP\ qp X#p &Q!&H@v00 F P"3q"  Q$ЍE8 P9$ P2 @P QX" 0# " !  P PHP  P* H "[ c/,pp P $Ѝ8h@U.RTp1VH @L ,>xG H-8J, , 2F x+q`/@-M$@;0@03P@Ѝ0+@ /  + A! 0  /= @ /  + A! 0  /=@ /  + A! 0  /= A@ /  + A! 0  /=@-0M@Q 0  !   0 T B6PT ,0 0#0ЍH- M %iP ЍH- M iP ЍH-M iЍ *j 1j0)jG-M8pPW2 U: `@$A AajO㓓dA`A\Aqpq(pp 0 0NU4   0qtq@P!Qލ!HH H0 0G<4U,, ,0 0H24\OB B Đ jB B B B )C )B /0 Np@-P@`&( 0@d'pTNH-`@Pp& 0@Q'O-M࿟P@p UL WT 0 @Q@,$8p`V\  /@P Q AQ᣽P /P%Vp@` p@WzP1!d  ,p,|8DP0`@py@pv@ps lKpkKphJpeJpbpPPVA%LQ AQμP .P%`@ @x@u(``-^[ ` @3[ p)0<0<- 4 p-Q*-0][ 4oO `@PJpp W  pp pP<-Q ]Q0  $$    I II 8PBP  0. ).P @P)PYi \PV`_Pu  0 㭫P iV`Wt -΍ DQ %  0A D`V P @PRQ  0 @BD D `VD @Qv ,V`!S @ D@ -P0A``D ``SD P᧻P DDH,,FPϐl# MD`V +@MQ l`l``LLLLLLL```````888888`````````````````````````888888`````````````````8 QFM+8 M8#@: @@8  BR.:M  +  0$(D Q$L88QL M8 MD D @PjPi  @@F⽋ Tl#ϰ@04  (( T<@D*<@`+Vd -Vb Y| $4< <+VPIF%P:$$4  ,P 7,P0VK0V_ xP<( 4<@( @8Qʐ V VQQ @(@( }P?4P aQMdVEV PV" M + @ P_< < @ UpV eV74 @PV 5( <4 @8 <~ <( 9( @ )V  ~+P@ _V i  @ nQ b(V( @]4 @  +P < 4 4M +PC < `@P`̹P2(`T<@:- pFp @弹 @ (`nP4a  <a(  4  <@Vk`F@哹P T%-Q.  R| @V0A s QvP c+@Pa@` Y+@`PVY0A  QUP @<V7 ᎊ[ AH` @ 0< 0 p `P p4 ` 4P<4P< `F<,@PP [4 @,@ Y@<4VB E[ AH@`  /<0 0‰p P px <@ `<@<@ ‰p Ὁ-P 4 ` 4(`IP@<@P¸P [P4@T_ (̵P ,< @< *P6 4P<,,h X .%(%(`@K(`V*TRV:@V  * y bD  aD }Y@ ᳉T AH(` ` 7/<@ 0/p (`P p <(`< P4`FP<@<P9P )*PV@q ʄ#3 0@.@@D | TPDP,,  T@,Q[? 0`@`V@T5T ,,<8Dq XRD,D 8 0F)8 0     0 0 0 0,0 0,D H$$ @T @i`Vg@T T * 尀 D Q%    0 0-W 0 0-@x $P, QADQ t , RߍMu.r( ( 3& J( }( ( <3:+ E+ `+ 8L8X87 6  p4 7$H3O-M@Q- y5 P# 0PPc  P]0PpyW `P EHH!H1 0`-yB  RQ8@<B,@W PP) p  &0pP pR {P   JJ, Ѝ' :' G$ 30H-@P @ 0H-MPp$lVPdd d0 08,@0 4/P @:.@Ѝ@T% % % H-MPp$lVPhh h0 08,@0 4/P @.@Ѝ@TH0$ % "% A-M`P$|WPll l0 0pX,$@ 04/P @-@Ѝ$@T1$ $ $ A-M`P$|WPpp p0 0p+,$@ 04/P @-@Ѝ$@T.}# # $ A-M`P$|WPll l0 0y+(@ 04/P @-@Ѝ(@T" # # A-M`P$|WPpp p0 0y+(@ 04/P @^-@Ѝ(@T-" " " A-M`P$|WPll l0 0+4@ 04/P @2-@Ѝ4@Ti! " " A-M`P$|WPpp p0 0y+4@ 04/P @-@Ѝ4@T$, ! ! G-M<&`;@RB    "@\d$` ` `X @  6/P X@ P P$Y:*(D`@p } }} {}y}(PKߍڣ*C`@ ()@Y P W p$0Q+* @\ LpRp( Ⓝ`P W Pg* " PpvN QZ* 0Q:  PN*!p p QC* p5 4P0*00 Q2* (P *   Q%*      H- Mlp8`yލڍ XPPZO-MPPb  Uj*0vP Z(,#3 0K$P@LU `pPpP Pp@PP@U   !@1wP , @@`^sP P`Le TU \`0`e$```` XW `"2 0N$ U:%Z@pp`Q`U; P3 ,@`sPg `\`p XX     0@@EL@@@@`$@aPY  %8Y V:  `,@`PrP% e0U \0$% X P    lXp ,,V?xZ @7xT 2x/x -x Ѝl  ? _ =pO-M`@PP& T. ,XP P- YP7 -%`YP(&% `( `U$ :$ hh!h1 0:w#TLL!L1 0l#`YP $`$`$ `Ѝp P/  P/  P/Р@` 0`\P8H`.U ]P`U .U^PU P`L\ZPLp؃ #"@+*P` ```  )  d o) A-P@`P T $P"*( 0p$p$P  0 0"T 0 0?"$T @@T(0 /U@ U 0Q0   '    p@-@P!1  0"P  (bWLQJPUP"wLpPwP PwUP w w,;XP`p&$`7WvV $P`pvp( _ & A-@PPP%P5U 0m"`PV@ , = %P P P R P, P%R+PAP&@ @ 0Dp"0'5P  0 P #P$U RPU4 vLPH P`U #3 0! (VP pjvWP 8P, PPvLp] , LP\ c20 U,iWP`0\`, /^P P]Q p  u0 P ,P vUPPG-` Vp(& u#PP@,BWP=P%,6(WP2 "`( V"`, ,"$ Up(" cP0 , @/Q/0 \ P(U$PP"$> * % 0 r t |SH-M,`0@pPrUPp$ W`p 8  "! @  "!V`"tʀ"@U|"@`ЍO-RPJ  ೰P  pPp Q p$p>P P PPP (q{(p pp@PPЍۍ5nfs | 0H-M P]R@p   P  Pp  @Ѝ0O-M`$p@ KP Y  PP@kP Y pPP pp`P`&Y P nP= `E 0  Qp `FPPP Up 0ePPuP }PePp   pM YP^@ p` Z*` pp W * IQ  Tq`Tj@P&0 0r`V `V P P  QQouXX X0 0k` PG pP$pPЍ` 0H-@ o P PoU 00H-@PP T  0HDD D0 0:4T(( (0 0;*" U \ - ? O-LMP@P\ \,\< 0wUHP [LЍ ,< 0x[X  0iP PHP +;" 0T @@P9 XLHP +;o 0PXk$  @PU $` X@H p2/P  [$ @`W`H FJ*:#@ 0*:n 0 @X:HDK$HPL L*L:o 0k `[<@$@ [:*D 8/P5@ [1*D 8/P,@ [(*D 8/P#@ [*D 8/4 PG@D@WW< PH 2/P@ѧPp:H(@,p4 ,4 $Hp WD8/4 P p@@<YDIoH t% 2/PpY(@,p4 H  (@,pD P 08PP  Z:UF@T? Z:@T408PP  U:ZF@T  U:@T`FJQ 0P U:U:P 04 P Z:Z:V `zlLЍ (   > % #   O A   9  p@-@8P! (v `V PPU 0# "  0S/fP* P!` P 0" `V PPU 0# "  0SpfP P!` P 0pP(vppH- P@U !P `'p&pWlfP !P  0p@-MP@P 0 0ij ``VVV  0P#" PPQPP P QЍp O-M@PQQ$ $ / 0`"  LP ` p0pGpW`0T 0S$0``Ѝ0H-@DP (uP(u00HA-@Pp{y``P (u`P  (u P p `SP VMVPHP`p@-MP@P 0 0< P/` 0 PPPp#P PP`Ѝp  p@-(M $ 0S, @T0 `      Q`PQP1P`01@V0S A000SA $ Q(Ѝp@  RRA$ Q(ЍpP< H-p0PP<   H-p0\P L@ <~4,, @ lLxd TH-pP`P U W  @0QR pW`TT T0 0?U88 80 0@sqA 3 c 0H-@PP00 00 01 0H p@-@P P@`P U =Q@p=Q @pa@-@PTT T0 0\@P @(@g ff0H-@,bP P$ @00`f0H-@PPLL L0 0(8mP Q#00 !  fO-M⼑@ ZpWpXa ZP fxZh! Q*PM XKP`@q@W   P=P8 P UZ Ng   `d`bP!   `S`QP Eh@@ P pЍȦ`XK-8p ,p R  Q A@PpQ P @P@PV  `P fdQ fXX  4  cXc@c(K-t@TpWP`q`FW   BP=PV<K-pP PP `=P P@TpApT  P=PWJpp@-$Iq@P ~@o$a@-$0HrLL L0 0W2 U00 00 0X( 0蠦 Ҧ  x  0H-@PP T  0HrDD D0 0g T(( (0 0h  G e ܥ  * H-P@P# U+ T3 U; q`PG  >6rP@ pqP: P. `P4 H/ 0 0w U 0 0x T 0 0W Ull l0 0X ;oP H5o [ ] Ԥ 3 ޤ ( 0H-P@P U IqP P PoP 0H o0TT T0 0o U88 80 0e 0H qꔣ  l ߣ p@-MP@P$ U 0 0J nP `qP P p00 \rЍpЍp$$ $0 0' Ut  ա H-P@P U p`P 0 0 U 0 0nP pP nP znP Htn E i r p@-@PP! T) P0 P:`V< T!1 0FPF(DP\p@@!@1 0IT$$!$1% 0 `T V Vppp 0  0Vp`p  p p p p脠 K ; X  % ܠ ̠ @-/ 0SAS/0- Č Ȍ$(0Oc?S_c00 P @ P 444P 5_0U0P5_oPT 0/H-p`@Q W T 0 0:W 0 0;T@T!  0S  Q@Q  0PU 0UR  @ >   O-MM(Z`pPQ00PߍڍKP*\*X t`P`[Z\Q:XZ^pY iYi# XZu(q0   @TJ P T*0S; (I PRJ P Z0: Q:XZPQQ Qj QQ~: 0S ( p[q'p BPh X`2I Z' p/0P8||`2 0|P p P0"'00p @wp P P20 qt&w00p a PVpP Q:`&6 0 h P`J P^*P&P6@pI 0X PPOJWM & 6@pG 0G PP>JW<%5@pG 06 PP-JW+%5@pG 0% PPJWl%l5@pG 0 PP JW 0%05@pG 0 PPJW$4 0@G PPJpTpp[ `@` H4Z@$00  pPJYI`p [f0pSa #? Ip s0P|J P PO:x0 ጽo ᅽ0(S`2PP P%0"R0p0P01P PP P p PP0 Q0P0^pY 0*000 0  @I[P' @3pP P -PpS@[A0  0PPp PpX YpPW W WEp[9   0]pPPp!0  0  @ PJp P:p0 <`JeP 0P Qp pP0 ʼP  02ePP p|ꠜD ׷ \ ;jM |Q  ݚ  {yu M { [{ř { z= z WzG-1MpP@ `W % V- T6 C/4-P PQ4 @  f P < @0P* PVV `P V8< @03 < @0P' P0 `Z0`V ,,P$ `V PpW +;u 0,P P P P  P o,B SgPP P 8VGP @`[PG8P 6,(帪<0 P px P `< P9Q QQ   QP0 S p SRQPSR   @0@FP 0O 8)9B 0v0@P" ||||A< @00P2@T PPP<AT < U@U PP U <0V `V`h`f X,R 4Q 46P R[ `)SP @B? 2PJP OP \B?  p0@@`P H pp@W3 HP U0POpPP( Q @@UQ@U R R RAQPQ;P 7TB( 58 4[% @80偢 @<y4@P P?B Q   ,  +!AܐY& S Y @<`,Pp00P@pU*P  RP pqʀ0P<  @PdP_ 0Q @0 5PxJ P4PpJ  5pf $PP PE B<<,     +!A R) ꊎ ͎ Kf T R <`,Pp@@PpU*Q 00 SQ q0sʁ@Q< R Rp 0,p 0 BaP@P40pRP PP$PPBO >_4 ^5PA D 810@`0 ㇷ( P`V S,P Q @@SQJ SS,Q UQ SNPL@xSIi tPs`t oov pO-Mp W  PP @@G@ N`@PP PVZCP: 8Mtplhd`\XX@P3 hH 0X@P' 0@ PJ !  0jP t@P@TbX@ PP( H 0MP 0|  PJ !  07P P Pd1St@*Xx@d1#^*t R qZ?[X` P @P R P P `t@TLPF 0000000p0l0h0d0`0\0X000X  S S S&0pd00 `0\Xp00p0pX  0@Px@|@@@@@@< dQU*@7n=h@T3 @Ѝxp,dQ%Y*P Z[O 0p00P `V`0P`0S ,@@6Th@Q507Ѝ?1t qes q K-XM,PyP @p8pP0V\5 $R2 R1 dV.U@(V%h lP QPo PPph   RP Q[ 3P ph+@Pa[ !@PW XRp0< 奐   0% P8Q4:Zp Z.  ᥇ P&P# pp Wpp Q  p WY ᆇP 0 \ppDpp PߍnPMT =T RR J(KJK@-@PPP P0 0.$ 0#EgܺvT2ZQ Q O) K-@`PP( V0 !>?p㠑@piW   *)P*#@pP: D DD D0 0V(( (0 0:P P /( P ^P eP O-M B T0$p`P@pdh|p @R T  (X080 0 0 8\p`` b*Dp0p0p0xPL07ppPphXd,pguPPDX@h P P Xl4 b*0P0P0Wp(07pPpPpWtpgppw<xἎ  '|Pa*0 0OA)A7ppHw`0au`P `` W匀`\`  ` f0 bj@0@0F 0Gp00p0v 08pc5PpPpPv`4P]p`p`pv@L`kp@p@Pv0@@dIp0p00vPP0c6pPpPv` P]p`p`u@< `kp@p@u0H@dIp0p0uP0c6pPpPu`DP]p`p`pu@`kp@p@Pu0@dIp0p00uP0c6pPpPu`HP]p`p`t@`kp@p@t0@dIp0p0tP0c6p#' PaP'`Pd@8PZ`!`&@ld0 @dH`%`&0PdLp04`$`&4dPa`#`&Pd@PZ`!`&@c0H@dH`%`&0c04`$`&cPDa`#`&Pc@PPZ`!`&@c0@dH`%`&0tc 04`$`&XcPa`#`&P@c@PZ`!`&@(c0@dH`%`&0cs04```&bP a```&Pb BPe[```&  4`(@@0@$0B`05@@@$appp'p`b :D D S D tD  E H-MPЍO- MLŸP @200 ` R 00V ` @xT=` Ppv RJ0 8 B/o"4i"00B prr`چ @ Z   ` @  2 .V  p.VP^*S0`  PpV WPP Ѝ/ $0 H-M@p/ ` p PU 0@@ @`ʔpw <00 @P3 @ЍO-M(Q:px P`_~P @Ѝ<(9 @$Z  $ (*PR,"P(P-Q(  KQXᐋ ` pP:P P!*g>PY& Y P1 3P1A2P1A2P1A2PP` US @ 0U08`PEU8PPE9P R R P1 3P1A2P1A2P1A2PP` US@0nU4:`PEU:PPE;Pk.  /@- @T ,@T  T  Q*! @ Q*  Q:@Q  A G-MP$PU (@0 y 4@: dI`J0;p62A@A4"0$372'- A@J0IR@ 0 R 0 "00008 090`@61@R ,0S SQ*#Q*Q: QЍ0 0AЍ@-0@S 3/@T=H-Lß) QN: @p`P p`P`Ef&PpGt'P B&"P`F"f&PpGx'P B""P`F&`pG' P B'" @D T( QO: @ p`P`Ef&PpGt'P B&"P`F"f&PpGx'P B""P`F&`pG' P B'" @D T,@  T: T T     MT/: DR@!(  ̌ Ȍ Č 6@  T :@! !0$  'T:! !@   DR@!(    T  ! N  L$"pA!p@! p B("pA!p@ p B%"pA!y7' X' & @-@P,, ,0 0/ @Y0& a& _ O-lM0@< )pIXTP8@Pd)XP`TPdhPH  0o_H`q n8| 8W`ll2  0+@岰Y*[[ [ [ <[ [  Wa1` 0+PL8H`P 3pP 0አQP-PQVP!4P 0a `P 0dЍۍOg_@ ^pPPW m8`PdЍۍ^J@  # & %  \  6$ qa<B  Rc  R  tN% # $ |" )yr" # xcR# @ A  H-AMp@`Pp 0  WOPJ` P .^ $QAލt^H H-AMp@P p 0   /OPJ` P o.6 $QAލL^ A-MP0 @ 0 O`PJpP Q.Q Q.`ЍK-AMⰐ@  0   N`PJ PpP Q.Q  P.T ` PAލ] p@-`P@Q \ZP  @QUpH-@`p(PU Q PU R( \ UTp@-@P`(Q  R  R<l UTpTp見0H-M@(TPP   PU RX kU$P @PP8P80P0 @)Ѝ0zW  > 0H-M@|(TT T TPP$T T PPPPPPdPPt   .U$P TPP4P40P0 @)Ѝ0[  ^ 5 0H-@=( TLT`D?QrR P0T  TA  TB  TX0"T= T> T80T:  T 0 T6  T0 T2 T0T01\ T000000000p0P0H0H0   7  K [ N Q K O I   c a 5 j  0H-@z'Y\ x'p0 >T0 Mp@-8M`HP`@I4@PH .0MAd00. (@U PE =B04P8Ѝp@Ѝ/(\4U O-MP`PP@p0 RQS QS 0@-T@0+T@0@ P.T )P@pQ10p0PC00A.T@pp @ p!p5 p @ !.Bd0X#"0 p0@` Q *PP@00@`UP:A) Q 3V Q*``@V 0 30@ V`:AR 0P @0P1`0`00C@d`.UP`` Q ``e   @ Q  P*l P „ `V  30@PV:IU V * Y 0 30@ Y:@R  0@.T P+ @0@1``00Ad.TP`` P ``x ` !.B!.AP` Q  P* P P@T  30@`T:EV T *PU 0 30@ UP:@R  0p.W p% @60p1``00Ad.Wp`` p `` !.ApP@ Q  P*p P B )T)P)\` $ 8 |`+ ++d PP@  `  0pЍ X O- (40`00pppPq@p`0pG`rg``p@@@ @PAp@`0@D``R PP@ BEPF2U<`q prgqoq' 2U c prg|`qbFaq& G2UX`QpTTTTTTTTXTTTTXTTTTTTTTTTTTTTTTTTTTTTTTXTTTTXTTTp PR q`p0F` `.UPu``( `dPpp`e PPBpp@  @ iPaT`p pP0EP E`PP@ 4 `PP@.@` O-lMD Q@@R l h  Ͱh   c!51 B(4r 0! c51Aq(Rd `Ad`\ X TP LHD  @<%$p 0P a@\p) b%!AqbdP@$p 0P a@p* bd%!AqRd`@#p 0Pp`W4Z Y ,<0@ D!HϠ0R0PQb$ 0C(01L001P T 0Xp1 0cEPW@#o  C @!bU`F(VFWobUaFaQA: \h0`0d0q!aN0PS00@7SR?2c1@P@SRR/"bQ@ RABj/P+PY 1Z 1W 1lЍQigMbsEYJ  $    ]lXw 0H-@P  0 .SP Q0* B/o"0 PAP P.PPu00$$ $0 00   K- MP#P忣0 ?;@@04 P_ `咲P% Ѝ| H-M@P8TPK 2TxaP`F t*TPB `$TP> LTP: 8TP6 $TP2  `pP,$ Mpp .`EPV3opP $0<H`pTpvЍE  4 zP? H-M`@PSP( Q PwpP pp f.PP U3opPpTpuЍ n>k p@-P@Pu`Pu` V PV`wp 0R0p0Rp \ 0 /V0H-M@tPx 0Q vPCЍ00H-!Q  Q  P@@PP P0@@P!0X D 0 $ @-@@p $,X0@  X 0H-P<@p ,00H0, p@-`@@Pp  0p@p H-M`p@P|p 0@<8 40 p< 0dЍGЍt  H-M`lp@PRp p8 0ЍGЍ | /X /D f, H-M`Tp@P p p( 0LЍЍ  H-M`lp@Pp p8 0%ЍlGЍ 4 L H-M`tp@Pp ,(p< 0wЍGGЍ H-M0  0kЍ` H-<p H;$GD $  0 ;a G- MPD`tP@@, P    H0 Pp@ ЍO-M M` PK⨫⤻ {Pd k!PT  D p$` $``P `[  O!PrP `\P P .PP`FP Va V*  p  @DK[P=P.P T p T.@DK`⨛VB*TP(:fa P P嬻[ ` pDD?07/K `FV P*UK 㨛T Dp TuD  㨛 {K  PbJP[` W *?0 06/ @pG W . P*K 㨻T   P =0 p7/ @  圻t}k pFP@T<4<4"<4 ll l'<4TL $<4L3&<4<41<4,(l(<48<4,,4T L T T <4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4.<   /$; P Z.P P PP`V`F[ : HDd 0 p7/ @   [ : D@ p D`  `?0+ d `@ P$+  M P*?0 p7/ @  @ Pj : C \?+ 0d e@ P+   P*?0 p7/ @   Cx?+ 0d .@ P+   P*((?(0 p7/ @   UCd >0+ @ P{+   P*``>`0 p7/ @    /$;PMJ> :P J P P<:  Pdd?d0 p7/ 0o@  `  / ?PJ~py +R    P>0 P5/ @V   P< / ? PJ@? s@ [7 : B + p+?0+ d -@ P+   P*00?00 p7/ @>   :P JM@P JP  P}:  P?0 p7/ o@  ` C< } 4  d ?0+ @ P;+  d P*>0 p7/ @d   h>0+ @ P+  0 P*?0 p7/ @    Ad ?0+ K@ P+   P*?0 p7/ @p  p Xz ʰ +l @X  p  d  0@ P   P*pP?  05/   P* ʰO _p  @   P*  00PJJ7  P * P   Px  `dd?06/ 돎 _ /$@pk0 kPJ P   P?0 + 0d @@ P+   P* =0 p7/ @ V  ʀ 儭+\ @`V    d  0p P:  c P*  @ <04/ [SL ], J1R/0 SP PyJP  P:  P?0 p7/ o@  ` c\  x8 $` [c  d ?0+ ?P P+   P*>0 p7/ @   pW- wP J P# *P@  j\XTP+;2["@ P*LL?L0 P5/[ @W  A < 3T   /$;PDJ P=   PPP>P0 p7/ @`  `  > > K > D [ @ P *\ \=\0`p  / ?PJM  ; | [A: >d <0+ =@ P+   P*x x@  0+ d @ P=+  f P*PP>P0 p7/ @`  `  P *+\ :h [u;+1[@ P*HH?H0p 7/[ @  @ kp  =@  = +`?0(( @9@ P(   P*  ? 0 p7/ @"   J1R/0 S[U:xK  E@2   /$;PmJ Q*`+\  Q$L  ,$ Y? P  - T=d 0p P6  _ P * @?04/ @  Z     $Q:c X kf VUUU 럎 _ /$@pk0 9PJ P   P>0 + 0d @ P +   P*?0 p7/ @   I9l?+ 0d @ Pi +   P*?0 p7/ @   9@  9P  8?00ꜿ C< [: 8@  8P  82 ?0P0~@ P P  * P*?0 p7/ @    /$;& P1Z x P@ ~k@ P P   P*>0 p7/ @    @ WP [s*~p>+[J0+ d P P{ ` +L  P* =0 p7/ @   P'*ܿ ̻ e p@    P *t?d 0+lPJZ Z  >Y@ @PY p    >pPTPE P   7` P *P `p88?07/ @Z  `x P )  P  `p>07/ @.U  `K⬋/*X:.eQ   P  `p?07/ @PE U `( P*n$ X   P  `p?07/ @  `?+Ld 0ZY0` 0  PP .pp0S PupWZ.pH `P@QC   l P* p?07/   @+ 嬋 K" $P Q L[|: @✻yhض P PJP P :  P?0 p7/ o@  ` P* @K  `牐  [ P .@  `d 0p P    P* `@?04/ t  M  Pv : 0Ѝ@  㴠 P  & P(JP PY P   P*?0 p7/ @`  ` Q"* _  OP% :@ ⴠ`$;pPg P J  Q:P :Yf|o`ʰ PT =\@0 0PE Y dᎽp P   P *  @>04/ @0U   @0@PP   P*  pxx?07/ YdXo`ʰ PC< a[g` @0 0PE Y  +p P   P *  @>04/ @0U   @0@PZP   P*  p>07/  Ak P8:)  P =0 p7/ @  wp[~:P L L/0 [m:?0+ d p@ P+   P*dd?d0 p7/ @d   >0+ <@ P+   P*?0 p7/ @d   l?0+ @ P+   P*?0 p7/ @   PP @ 0/' PT:.  P?0 p7/ @  D@p h߾d ԽK P$-  P>0 p7/ @   3P`  P  Q?0 p7/A+ϟ++ @K0=+,p`==Sx*@K0SrP!h H !  ! , P!  !%#       " t | P!  !%#      P "%"      U^@ P!  !%#      P "%"   P  #   "!    ! -Ч @ P!  !%#      P "%"   P  #   "!   P !"      *[U*Р+JPEK[ZS+H:*@K0CSHYhn`ʰ P< 3 @0 0PE Y gᑺp P   P *  @ =04/ @0U   @0@PP   P*  p?07/ 0 @ Q2* P:  @ Ptt?t0 p7/ @    /;~p갷' Y% P`:  P>0 p7/ @  <>00~ @p ~@p"@YJ n`ʰ P}WT ĵ;@0 0PE Y ᷹p P   5 P *  @?04/ @0U   @0@PP   P*4  p  ?07/ 긡 (UȠ 8, 0 U   P>0 p7/ @   PD. @8>  @0 @W1+R= B0 00+@ PtJ@ P* =0 p7/ P@T[⨫*U@:8ʰdA `  ` P p <  07/ @@D T  P*ꕲT*+\   R$ K @ \ $ @T< P  - i?d 0m p P   P * `?06/ @  Z   $@KT: H ;+#[W@ P*?0 p7/[ @  +x ;+#[*@ P*  ? 0 p7/[ @   ꠯ vWP   /;POJ P*J`-1R/0 SP @PJPU P4:  P =0 p7/ m@  `0< Yk P:  P <0 p7/ @  D====YAl`ʰ P 7@0 0PE Y Dnp P   P *  @ <04/ @0U   @0@PP  ż P*  pt t;07/ Y P: Q :0 p7/A  K` ЩGUZ   P 90 p7/ @   P6  @)  /+@ @.+R8 B0 00+@0PJ@ P*80 p7/ `@Tkp{C*V*:ʰdA   P   P705/ @@D T < P*k {ĕ 43, b̧C< ~HV   P70 p7/ @  Q\6+A @0@+B.+Rk5 B0 00+@P_J@ P*50 p7/ P@T[⨫?*U+:ʰdA `  ` P p\\5  07/ @@D T 8 P* hߦ\ ̥CPǥ ; serial  $ lߣU   Pxx4x0 p7/ @   P# @3  @0 @-+R83 B0 00+@PJ@ P*``3`0 p7/  @R+  P20 p7/ @T  娛[2*U*:ʠdA `  ` P p<<2  07/ @@D T + P*[U5   P10 p7/ @   P: 0 @ m ,0 a9 4dPߍ ۍ:넎 kVUUU ; refrestry ; expiry; minimu3,  g` ` ЙG̗C< D Ѓ    ( ȓ;d۞Ԋ H  l܌  >ԉ D8  ~ O-M(`,@ P0x+P:J@ pQ pU `Pj Q p\Q Q .QQ pG0`,@Q W UQDQ.Q  R.p Q*)p+@p  R *00 P5/ Bwhh h0 0^Ѝ.Q Q Q pWpGꨏ| HO-M`P@V:"pP TT2T0 ĺZdd!d1 0?㺺LQ*0pP@`qP  Q8q\JPqP    0PK` U "V PPP`|`PP |PP 0`F V``3 `Q `  X:Ѝ~;~~~h g g g A-P`JpU 0 0gPX Vx@0VP`. Q p`07@V0@3&b``7@` V0@3```@V@ õ}W}D}/eo/e///t p xh0 @Q ` $P` H0T  `PP@ 0T  1`D VP`$:10D P*0T ^D P  aAP pp P0PEUD   `P0P Ѐ℀@ $PpEW?VR D```@+T -T``@0pD W 0T< ``0^ `F0ZS㄀1pNWpp PP0N$0pE W q@0PD U0NP:L@D`<V :VPPQ U@  / !B+ ! 0 W0 IVZ Z Z@[@+ "%z @[@@+ % fZ  FD``, R [ (P U ( R 8 V'P / ! ! +WPUG MUP(P V>:&Bo` T`P@4  ! +W4 v< f@ / !  W@,T <  vo+,Rj@/` <  X`P   ! W4/5vGfb |p! P  +W/ `V/4V: x &" B@OPpL`N\^NlpW4DPPtA4DPQᆫPP FQ(PP DQ ,P) ᐬP  p8DPQ%@ppP[  p;I Q J Y&"O@O@?5?55??AA5?@pp L;K @KNN  @ @  Q @<P |jPR<B0k2@ DP9 6 P4 4,DP. 4,DP),& #x|4jP:PP֪P 1PTʛPP8P_ Y <4P |jP*RBk@x= ( 1 x|#Y' Q8`k !:BjfQ`c1<0x S `R'620CPr x|4T 4DPk fp"x qx 4|<Q jP*7P9Q 1Y/xP|<Q jP4|U x xYH <P\ |4 jPV@j @ N$U T 4 FD B @><P o 0 !  Q"04,DPLT K f`"|  @  |x8@pPxSxS <P |4 jP@j @ @x|4 0 4S 4@ 1@  |xY$4 ?jȩP #$P4tR P9||~hP A-P@pW `P P y,PA-Pi`fV)bP- ^P1  QQ 0`p@Wp@T p @TrBTr2S QXX X0 0CDD D0 0D00 00 0EX5Y>YXY=YXX@Y0 0 Ki0H-P@P P Q080QQ R:0088 80 0e㲰$$ $0 0f㪰WXXWkXX@-@! oO- Rc p@`0S00CSSP1DDDDDDDDDDDDDDDDDDDDDDDDDDW.p!W)0V S$`pWpW0T S@pWp p R[Z^\H-Q 0P*r-w--xձ  0vS-S rS  wS xS S //H-\:  P/P/ Q Q/@-@P pAQ @ R RP///o@o"/ /o@o"/H-/RR 0 0p㞯TTTH-4 /RR 0 0p㋯TTTTP/P PQ/Q /H- AR*Q *QQ 0 0p[SSSH-PQ0H- VP @ ㆠPPP PP@0p@-MP@P 0 0ZE AP ]`Ѱ`ϰP ЍpQЍpSBSFSP/0H-@P QQ P:PPU:z0HwH-@PP\\ \0 0`V pPdP p`VQRRO-M[# Pp@aIP @[X = P*K! !@PK ЍH-\$ (xLd(3Ơ* 3&!%  G-0MPR   `$0 0i* P+ Q$ (xL`( 0 3vq:& 3&!%   0Ѝ8P$P Q A a Q1 A/3` Q3 A/H-`pP V P 0P@T PT S00DD D0 0LV(( (0 0MlNNDNN005 O-Mp@P!1 0?ݭ PT D P"PnX]`ᣩP+V -V `0V p0VpTp xP0@ Qa@"Q#;*Pp`ᗪ@PE" 5 `00F/ S:a0FVS:A0F6S P RJQ Pʑ! `0R`SX RЍЍA@Qz)Ny003 O-M`PpP"2 0?SU E"P  XЍ@P+T -T @0T `0T`U` xP0@ Qa@"Q#o*`@P?U  p 0"UK[ [ @pI" ꏮ!@0PD/0 U:aPDV0U:APD60U.0S+QJQ X P" S @T "/P  P" S\! @T "Q/@X QppЍA@Q{L^L? rQJQ H-' MH-M  lЍH Ѝ/G-`P+ Y3 ]0@FQ`V X6P>`pPVPt.  aPF  ]@T' 0 0BSY 0 0CIP@F > խ @Z ㄟrHHJH{H p@-@P៭@ <`+&U   p@?. p@-P@Pu`Pu` V P&`Dp@-@PPP P0 06㸞 `@(FGSH-M?  w ЍG-MP`0gP& @V 0 0౫   0 P pa 0 PWЍpЍbFFb1O-MMCp`P@WX0xx#x3B 0w`Z Z PPPP\U /q. PdP 0 <㠺Ppఀ Y .YQ  .Q P.PF :Y  :0P:Y Y  :Y.Y Y Ⰰ  P.P%`Q `,P\($ w!1q 0 p h lAQ@0!QMߍ% A\`@ Ps:\pQ\ Xj ` AXXab:  1 P! H`X `Xa2PXN:  ᳤`X   H V+ zEoFz0 + (  ^D $) K-M@`p46P P0 0@@>ЍЍK- Mp`PPhh!h1 0gHWV W /@W 1P 0S, R*PP( p@P 0D@@ 0 @Q  Ѝë@ Ѝp P`pP P :AA  b@O-$MM쒟`[ "2 0 PN Pkp0" pyP_ pᄫPY ` 0p@XpZ--  0`c8XU P p@GP:p  ᮣPW T QCa#`q`@Pp 0D*P `V *PEu +`P   $Q$ЍۍP$- @' QQ  % ?@??>^>G-HMDPX D((!(1 03`PPJ'P!  .0 P `p`U@`p ≝0 P'Q |   @sT D QHЍ#h" j<#=<''<<L'O-,MP@Px P(p `P}  0p `Pi p < 0 pPY  `P  @P4 POP ` @!QXCXX3M@ 083N 0  @0 0 0 8`PP PPP P PP` P` p ,Ѝ4V`P% ` ` P P P Z:  P8 J `4``P  R @*P@`  B `JR:BT    @HqT@*P@` @F@ V Y @@ aTPX:  աH@Z` P< :r 9(; K-MP@P@@!@1 0஧Q `Q6 P( pAP" P  0p`ӵp   0P <X  `P`P` `Ѝ%`V666O-KMM`Lp`@Y(< <,<< 0MTUV ,< 0B\WWP( P H`Xe X`zDppP@P \P p  0LPJ@P @1/P L RDP4 DHp0P ptLPT 0p`0*p@TPT$P R*<@@D ppP0@JD`4AooP8PLPHP<@4 P$ L@1/LP 8` P<@,HP8p5@2P RLT,GoTe<@P( &,P8   '02P|J@ 0p@'1/Pl (LPZP `V*L#0pHP<@D PWA DWmWWP 0 % P @P F`L@ `廚P4@'@pGಚP0`P-' P]TL0pHP<@( ,P8   '0`PJ@ 0p'P (P'}P@ GT'w]PL( @LHPGP09X@D#` ` 0% @Q( L0p P/W ,P,P,p 4@0pP@3@$ Q*RX*,@$  ᩟ LHP@wL0pHP( J WTHP00pP \ %L( 88, G /@PEJ` @P= ,(LPW4P7  Q : `  P A`L ",L HP<@ZDTB8R?*0`G p @@`@DP|Z3, L T``ᩙP@L( 44L0pHP( WSPL lC@L4 PLL04P `$dPV:4QSDQP4 b 0Pp0pS QhAlQPT  V Q S PRQ& 4Q#P @4Q Q0` pPP @2`@pG0CPW P0 `TUP `PO@ JTJ\ `   @k F J@Q* @@   `p$ 00@PB@ JQ*`(P Kߍۍ0P0M.K 44l   -/L M2 O-MPp@P88%85^ 0%Wp W (`P ` `\P ` fP P P ` P P`<[P @ @oᠢ@P NP Q : zP  A  ` `ZMTY ` P%H`Q*  -P  @``{[P ` `!P#XO#`P  R:0 BpC0R* ۤ ߍB@Xp` pP` R?& JAP@XPpᏗ`Z*PP E U@ X@JPqv`Z: JAP@[b PP ` 2()aK-MPP 0  0ɢ`PppW P( pp@U@@ '0   Q   f@ T ЍЍ"#.#     p@-M@P`,0,)0 Ѝp  @-M@   9Ѝ  H-M@PpP P0`L0 @ ЍЍ\ l 0H-M@@Txູp@@T dPP D  9>Ѝ0Ѝ0LLK  O-M@P`P U T P P Ѝ!1 06Udd!d1a 0TDD!D1b 0  R 帐 P  D `QK``pW [ 0M 0ඡ[`` `0N 0ૡЍ  r  F` lvJPO-$MS@PQ  Z T Tn P $ЍOTT#T3 0IuZ88#83 0JkTYT Z\ @``T``` :T:P rPp` BP 9P VI@ `@T5:TZV P `Pe +` `P  Tꯢ`/Q!1 0 Z!1 0V `@T4 +`Q`P- @P T- DP  A0ppB0P.T  @TP`P `T0` 0 PP P$ЍP`PpP`P `PLP`P 8TX0z( 4 D l A-MPP: XB @ `Ѝ  00T @ xP `9T pP 0D P p@q`p` 0D P:.TQ*p@p`Ѝ 0 0mIX 0 0n?T @ A Q  ` V3VX  0ЍT,k O-|MV@`PQx V$ T, T[ V 0p& :uPrPp*: iW~&6 0HV%5 0IݟT[%5 0џV`%5 0ş 0t 0PD  0 P 0 PąW 0 0Pp,044 or0T5 @s7 P_oPR0pY/t=/` hh$h4 0hvVqLL$L4 0ilhW pTs@@0Y t P_o PR  @pZq00@Z 0q P_o PR  pXsPPX Ps @Oo PB  0p^u0^ u @Oo PB  PpP `\ q 0?o P2  p q/o"0P0q pWqJP. X:[C x [ [[ @ TX*[:XW W W ,P4PP 1!@J HtP8P6P 0pD! :8tP% JP"*:V Px Y P*: Q* JAP ` JUPPxP`PxP|ЍF G{\S[XEy, T O-MpP@P%5 0GBP׏(Y$ `V$ V, VU  + 09/p ! 0XP <Xꨟ6w2P`PpPpPPTPaPpwPp`PPy Y  pP P   PL U PP  Z   09/ p 0 0P@%0p,pRP <X8 0 BS0< @X0 pP ) U& 0 U  EPA0u0 "2 0SPP @P  ^La? pp9/p 0p P @ P U ? 'PP'*P jPЍ 0`9/p 0P @ P u0P! J@p XX X0 0@5PJ \   O-MP@pP#3 0hœU` 㑏p@Z xX]p@Z[V Zl T Pb PXYX H QX 0S H R6V  AR:0S BR* X P* RV 0@S : pW0C S*@ oᠢp @ PZ  <@pppZ㈏@> @V[; 3qP6 p@  W)  0WPpp_oRWWUPU U@@ U@U @ U UQpP PpW h@@P@ Ѝ;XЍ  i p@-`@PP T 0 0GFp 0ap|| |0 06㿛T`` `0 07㵛``@ GTPCp     H-M  2/Ѝ/p@-M@PP T 0 0ㅛ`P" P P 2/`\\ \0 0lT 2/P `Ѝp ( k p p@-M@PP T 0 0E`P" P P 2/`\\ \0 0,T 2/P `Ѝp(0H-@PP T 0 0P P P LL L0 0T0 0H/0Q , 0H-@PP T 0 0ҚP P P LL L0 0T0 0H/09\p@-M@PP T 0 0`P# P P 2/``` `0 0T 2/P `Ѝp=)p@-M@PP T 0& 0Z`P# P P 2/``` `0% 0@T 2/P `Ѝp5|p@-M@PP T 0F 0`P# P P 2/``` `0E 0T 2/P `Ѝp -t1Bp@-M@PP T 0e 0֙`P" P P 2/`\\ \0 0Y㽙T 2/P `Ѝp-l49p@-M@PP T 0 0`P" P P 2/`\\ \0 0a|T 2/P `Ѝp)hI_p@-M@PP T 0 0iU`P# P P 2/``` `0 0;T 2/P `Ѝp!hVap@-M@PP$ T 0 0q`U 0 0 P P P  2/P `dd d0 0T` 2/P `ЍpЍpds8{]p@-M@PP% T!1 0Ę`U 0 0㹘P P P  2/P `dd d0 0࠘T` 2/P `ЍpЍp$=UOp@-M@PP T 0 0t`P' P P"Q 2/`hh h0 0XT 2/P P`Ѝpt p@-M@PP T 0  0.`P" P P 2/`\\ \0 0T 2/P `ЍphEA-`p@P!1* 0V4 W 0 0#PPeP P# P  03/P U 0p  03/P U  08 A/ D""K-M`@PP T" V+ U1 V9 P? PF P 2/Py :!1^ 0T!1_ 0wV!1 0&m!1 0dVpp!p1 0Z 2/P; p` WP5"P P P.W$ X`}P  3V Q`P```X  ``XX`Ѝa=58  |0H-@PP T  ;0HDLL L0 0T,, ,0 0ޖ"uH-M`@pPP# W, T5 V= UF W"2  0༖PC PJ P_ 2/PX >\\!\1 0࢖W<Q Z:h0@D?P* C P $`pW?  RW4$R$p$ALPAK 2^ 2 [p R$ PR@PJAp P.*@ ω(`W @(p`pPP Q* H P(P}  ( u@pE XY<(,ЍH,Ѝ P*!H,ЍA-Ml`@P`0 100 0Pp (!P +pPP PލJ 넻 H-BMhp`@Pp 0'p  0!QBߍ+ Q*0S/S*Q://0H-0S* @T P0S:@U R*AT 0PS!0S:U0S(00S00H- Q 0S AQ:Q B薐ꓐ(G-@pTWo᠂P` P0 P1*T`P xP@pTWfc(H-@QSP`p R xPpGP`W@A-PA@T  <QQ*3(Ap`PJPQ`@?@-Q 0S  AQ:Q @(@@ MH-M  ЍH Ѝ/@-M@ 0p TЍЍH-R 0Sb 00S0 0s 00Զ O-M`PP(("(2 0?! @U E @"PXЍpP+W -W p0W `0W`U` xP0@ Qa@"Q#M*@`pQZQP"ZPEUP@@D"np00G/ S:a0GV S:A0G6 S RQJZ PRʐ& PRJ@pX QЍA@QLgG-MpPW# U+ `@$A AaO  |x 0dA`A\Aqpq4cp@!QލFLL L0 0FaU00 00 0GW  X80 0 MH-M 0 00ЍHЍ/MH-M00 0 ЍHЍ/в O-MS !1 0@Z@Y@@`ЍpP0Q  ApU/W P%p@ }P@Up`T@*VJV:@V@3D    @P @`@V PPCH-`p@P 0P0H-|@P@ ppNd<PP |P P<) @0舯 T tp ( 0H-@P  0HH-`p@h dPuW  b8 0H Ha Z,H-CMs@PTp,d Um @ PR  `0!P0G 20" 00@P8($ }@P- PLPH @" ,0a P>,⼍P7 `ํP- 0  3/$P Q]P@,PCލXX!X1~ 0ҋU88!81 0Njᅍ,a`(QP hP aP` }{U 0 0PC@P ( R $2/xP MQ D0 0Cx >rwFإ( R  D4 P O-M@Pxx!x1 0]`q`1 Xp0R0PD 4Q4a4q444P`p X0*P    } v o h ЍO)j-nvV 9nnH-@Ptt!t1 0\P P`Pqp+P* 0` PV:  ` ~P  !0p`P0PP`p PP Q `ApP V p  TlH0O-TM`R  #3 0&{xX+ Y4 pPX xP5 @p`,pnTQ4 @T PQ$$$$$  (WT("2a 0CY"2b 08p Q t"t$0 0$( ,d\ 0LH" PM ZR P@p@ [J VAQ@@0! PQ  0400P  (P QHH0S  | 3/@x Q@Z@tpP $Q(( AWpTЍ L K K J \40(8I ģ DžpP/ `vP+  @,OPJP]Hppp  h00`\Xpp@$0 p(,   02{pЍȸ Д p@-@P@@ @0 0;{PRx`x&pp@-@PQ!1 0<a0QQ vP p @QnQp 00 B Pu`Q  VnQppkWH-똿A-RM(P@΅D@,  (  `べH  0 $` `````xkH-H- RC/A 0\R#R! R/p@-`@Ptt t0 0?τPV P PVP`P  ~p豾H-M/Ѝ@-MP =P:=@ @@@ @0Ѝ0H-MP@P\\ \0 0;㄄  0 P:pЍ0ƽ0H-@ 00: P:PWzP P! Q~z@0000 0S P/!C/H-P@Qbtz$z@P `Q PQpAG ȄGV f1O-M-MP@`0`pox` t p l d@Y JR:*Z Z Z +Z -Z  xZd0x!I x0Z\ 0 0xSM$` xl0Pd\00x  0 XH 0 C RPP ! 0PB 0x000 C R *XX! 0BP `` TDS R p`@@T  `R0Lp@d x 00S S B0 x 0X p@@p@LJ0S @0pxp0@0S @1 Cp R@L:20 C R*0S  \` ph@1AV VPpGࠡ`Wh@ ` `@pVPVЁx0 @@L `pEQ[T  x0p+S -Spx00C Q0Sdp0x0 0R C d70Z d`xpx, 1BpQxh@@0pB@`0D Q `x`0 0C0pB@ Q:`F0 `0O@ F`NLRNlpQdph@Qpg@`T[ \0h0T PS 0P0aPTPX0Z @LP IC%Px' P x@xx Px@`xT`P-0ZhP@@X@ T B+ ! 0 PX Gp5Qd0L hhpQdR$ R4R;ʸ[ &p xL 5 [  (A6Pdp pT3`  p  0 `,Pp/`PXHpr(@ hp%`Rh|`!L !B pp  p0` 0P PX\0 `h@0S*   ! p#Wg ϟ#SG@0Ltp A ``t`'jP +W `@00psEc /    p!W8 lϟp0!|vU@PGU* XPPP>@P`0U% II0P R `AvPvUG8TP@@l|@P|IIslwPls |@DP@|0, uu0Pk| PPX4ph<@*,Q' J+( ? (BJ@@ 9@ZP ;D0w.P"lgp@0@"t@!* tpP?  0 !R1`\` pl@H|`P ` @PilPX\0` `PA@[P4pBU@P!<T U!0@PP4U28<Q0 xvP pvP$ xU @Q l0q0pS*`v 4pl8|PhUXPQ lUAvPlj ܄ P e6|@|P@`P|LDt Bt @t >t<Q Q` ` P~  !  `2`zZ V @` `fs P Z  `t@PX @p QA [ P PP PPڣ }"  `'PK[Z8`  `[6 @`R `s`]rЍlZPK-P RPqPF @` 0pPw0%uP'%8p Q!8PpW:W*`qp'8!!8q`Q:S \qP P! urP O-$MP@`0PP  (P0A S:@0Q0q 0xS P0  p0p@\7 PYP  ^` YN Q#\*[0 Q@ q @ T2' 0: 0[ "\ pA0q 0 0A1 !P:F0P xP Pp  P7 \ :)Y. P+ \*[ ` @ 1 P pW1 `P :\  p@0 0S PY )Y`$Ѝ pP ` 2QT 7Q $Ѝ$Ѝk j O-MD@ fT `0P@  0R 0S@ 0 PR P RS Q S==0@S R 0pPU p0Q  P( R 0p@@T pR R  0Q0Q  /o0PC R C pQ+Q -Q p0 4    @0DQp $0p `DK\p0@aQ @0#`BDV:@pG0@ `Rd P@pI^p ЍS pR ] @Pd PO[Ma Q QoLP  P U0b`p\ uRP U V ` U  `PEpp`PP4@@ Po D `0g `Td `P`^Pf P( P([&_[ o #{"b@{`;pE q@ Pq  Bp8P![9Pr`bV: Q\o@ U`:Wp zX h 2 @=@ ` r @ R oz"@)@Y!@IU4VD` `T  `p L PE7X p@ `@V P P P @ P> PB PUAU9E P49aQ `qY"@@U !@0"@PP" o eP Z!@p@ @Q @Q nDz"P@!@g K-`p@ R  P0Q ʉnP(  YppA PI`V0 A oP PUpGpH p Y @D` 0 @ oP `@Tp980H--M@Pgq @cq ACPR @R B@ Ѝ0H- ^  A0BS 2R H-A 0S10 R: P(PࠁNx0S " R10\  R/ R /0H-P9PP8PP7PP6PP5PP4PP3PP2PP0 @1PPfed0cb a@0PFED0CB A@0謥H-0S $ B1 !R1*PQ n@`rp6@`V:0 pppW: 0 Q  RA@-MQ @ R @P:@ m@ЍH-M@Pp U y@H((!(1 0ElwP3 ` @P3JpQ Q& ap%   P`hP @`  lhP`  \00@$ 0( ,@xxOЍ:&|[ hZ <[ Z 0H-@Pll l0 0=wi@PPPVj0.L@-@PLL L0 0Iv@P@RKp@-`PP00!01 0>vaP rP wP9,/ < 0e@CT0APx5 S +S4 ; p)xp QVp@-@P!1 08}vP3 Ri 0P QQ O`P Q 1/pPӼ 0P @ P 00`aai ``pw pII@-@P`` `0 0;2v0Q QA (XH0H-@P!1 0JvPgP Hw @H0P @ P h0<PPP 80 _P%Phg PP/z*!$P  5/PP0 @ P0HV $U @-@P<< <0 0;u P@w_LGFH-M0 #wЍ0\ \ \P LЍ4 Ѝ Ѝ6@  //O-OM`Pv<PwpP3 @VQ   'P vPvPvV 0 , p x|Z zҰ pDp4,  0P8P0  uV P P m X P e Q P4P PQ *Q Q4@qP3E  P0!! P$00〢P0 p|@P73(, 0<0 &  R5PX QN V0 XA/Q $12307p 3P7 25< $1$(1(,1,010414818<1<@1@ D03?D0 <@Q?<OPAP p0uP-uP3Q&@P"l ! 2/@P(SP !D 0@0!Nu˨uuP@uP Oߍ4$$P  p`0 P  p`0P @uP9uPa8Q 4O ~T0A-@PP UQ `pP U  &1!!UTuPPuPH-4!@f P DuPPP @P  @! P U(uPQ NoppWP p (U uPP/0H-@P0@-@R * 0 0@\tt,H-Q pt@-@S t,  0@4@-@ t,  S 0@tO- M@Sp0 $PJW $(RbP`YPs Z WW)(Q9$ ($($[  0PR  P([([$d(p2 (Y1 0rZ1 0r(Q 0XP  (Q P$ $  R(Z t, Ѝ(p`pQ   PP嘣Q  !R 0 VPPP:pW $ Ѝ `p|VppGp C P(Q Ѝyz;,0H-Q s0@P P4P  P 00ZP@0A0O-M@(0!P5R(P%p5Xaꇑ P.  pؑ ` a r |paEP !( !j PD  , U , 0 ЍO{Ѝ@- 1@3/, (P0G-M4P @@ 1  3/ 0  `@   ``! 00'  (P0)` 0* `+#  ,"PP-!` `. 00/'0&  1%02$`P3+`4*P05)$ 6(E 7/"`#8.%0&P9-:,;3<2=1>0?7@6A5B4C;D:E9F8G?H>I=J<KCLBMAN@O`FpDPE@G`pp `G`@0`Pp@Q0` A/p APP`P@U 8Q 0,`/P ލrOr,ލatO-MP@ ! `2/,( 0<V`Q0 0 P{  尀@X_:@ `YVZ :FW P,Z 0 p冠P!y@ǠP3   0RP  `@㲀V `Y ) Q] QA0 Ạ P;@ @P  R  Ѝ ᓘ P 驚 P  ი P(@Y TP ( B  ($ @$2qO-Mp`@ S [9p P`W  $80p` " (12/ Q, P   A P,  zpO@T Op I@Ѝ$p( 2q"a8*_p\pP`Wp ` d)P ` ])P pP Vo * {b1= P> 0> = < ; ,< ; x; X< jlBkxkzk9 9 0H-@Q P*P 0 p0A-M@`pQ Pq*PW oPЍ EP ` P r 0 P!@ H*P B*G- Q  D Ƞ " @!D!Ƞ! #@#h#L0"8 "$ ! @ @BT 0 `:"2 0bm rQ~ QP P Q"40A Q0Pp` @p`P @  0@ p`@Ppp``P`p `0p P0p` P 0  0 0 @0 0   00  0 0 @  0P. P) Q"4 0A0Q `@P``0p@P`p0 0 P p ` 0 0@ p ` P 0@{fffG- Q_ @@T:#3 0b.m rQ~ QP  QP"4 0A QP "x"4pp00`@"`@ @P p`Ppp```p `0p @0p` @ 0  0 0 P0 0   00  0 @0 P @  0P.  QP"4 0A% 0Q 0`00P@pP@`p 0 P p ` 0 0@ p ` P 0@ t h \" p!t`!h! P#Tp#x`#l0"8 "$  0P p `Gc{ccp@-P@Q `S(`'`p" Q(p P  P P aˠ`P`pp@-MP@Q `(`T mЍp "    'P @ !pb1   `[ ' (P Ѝp  Ѝpb1R0</ B$0A00 0P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/@-Rq0 @Ml@-@ / ?!BCh @ @R*R/0Q:/H-Q   !0(|pdXL@4 0"0"0"0"0"0"0"^O-MPR pW+ Pp(!;@a @V``#`3 0-kp0oW  q pYpo@`W@@T 00 0  `pW; p`W:B0pP- )P$ TDY ā o2   HPppYp1Ѝ` 0pp՗P0S  @!4@qW!1 0j0 Q  ![( @p@ v Q0S0`S 0p嗗P@ @  R `z[[[KYYYH- 0A1Π\1>-1!!K-M`qWWЍ@P ᧾ppW R T T  0@P U P j冾ЍЍ 00 !     /p@-`፞@p PV p pk`ᑞ|k`pA-CMLaP@`,彟Q$U!1,P00 P\? P:[k?-$  3,Pp ,◟p  Mp T ᰟp   3k@ @+k@P,PCލf$ R?OV(O-DMp` @@Q P%P XXw P0S@PP%j@ QDЍ4X(P j #p ,00 ( 040 P(p0S p $0 8 8 <0 P `PX  $P 1 03pC 0oPQ  $P< 0! ⰱ BRᴰ2:Q+Q,@P :#3 0bhp P PJ   $i䱄 P[   $   PT 0XP  $HP    !   BR *0  0  @P +g@P0 : "2 0b{h 0pS*@ ?X0! A 0 q! P +X'X( PQP"!@P P PR P@U: 0 0b/h pQ!  .$ X W   NPI $o Md# RORUR| T  {PPP KOOOO-M`PQ @#@ U U P P hp0  P  P@@T:44'47b 0gpU*  P ᴐ @@ Z:&6b 0gqIoR@P  P 0  p @PP@@T:<<&<6b 0wg   #U  Pt  UP Pah(h Ѝ "P `p@W:PP%P5 0b9gDP @ ># @P `QW .# "D`P 1  2p@W:$4 0bg. QP  #Y  `@V:#3 0bf   " (Po"", P"Uc YM 2! C"P` `pY@@T:#3b 0fpP  "뼑Y Y Z㴀  pJx !01   " "P# `W pG z" !P `Q;i JP `@QY+  Z"qW  2! !P `WP  E"qW @Z㴀  2"  !`P奀Zⴀp x p" !P `P@U:tt t0b 0eJGJMJ{MMMMGMMMkLLLsKKK+I[IaIJJJsFFFO-M(p Q R QZ @P  p   p  p EU`P@L @Q01`@X:#3 0be   @R 0 A(@ Q R QAˁЍ ( UWd Z J  Pk @@T:"2 0bUep P  Py ZS @@T:00"02 0b9ep PQ P P2 @ QdPX  ,!W㰡  갡    0P((7   0ᰡ P Ѝ((1Q w P @ @P@U: 0 0bd P  (( ( ( CDDA/B5BsCCCDEEO- MPp,AT~  2! ( P T`@ p? @Y:!1b 0d P P% oPcP ] p5T@[  AR 0 1  # U 6@Z: 0 0b8d  0@S000B @ 1 P * p pP5pPp Ѝ@@@o???p@-P@Q P     Q `yP    ppp@-M@PLL L0 05c 0PЍ>>uO-MM`p@PV"2 0?cTUP WJ@ PJ P-e? F @Y:@/8P e@P ЍۍW @XP>*IY*F  @;qYFG    U -p JT$ 8pDdP P p尀? .TP P0PpPP! Pd /P HX/P   P d{yd@oᠲsP ?>r>=<t @-R@QPTP\H-XMppT&P `LHD@@ } \@ @B < U TPXЍ ȭ H-MBr@pAQ FPPC Ui Pj PЍqAP.PpP `|`x`t`p`l`h`d```\`X`T`P`.LU PQ0F?v`QE   ! DP<P6Ae%P" F_P0 : p  P3p(PU: P 00cp  :< O-|Ms@ Qpx fP(`tplhh  \   \@   UEP(h  tplh  [  @ \  U| J` F[ D*S? $Utplh!1u 0aY!1v 0a? P !1w 0a[*[ p@Z*%LL!L1 0^a(@h B php[@Z:@Peph 1Tph@lpP@@`:Y (@h " k[p p (@  xP|Ѝ8`~ 0 ( 7^7k7627X766(7c667 O-TMȠ@ Pd^`p @  LpHpDp@p  '[ @ P U:H V ^P PTЍh D  @-Y @  T @Ԧ O-M l@Q  l P ppppp  Z \\\\@ O  0 pp p'  P$@  Y  @  P@`) h ,  Z $  PЍxa8 p@-@PqTT T0 0` `( Vpp@脿32g2u2Ф @-@@z ! @ ꔤ ql m\ H-@+P(`%p! D]H<O-dM(0@Ÿ, Pp0 HL "$@X@ @0,THbP\PP`` 0 pPp "`X %Ha`h!T fP"e< `z8e' PXD %a8 #i aX @`\e<P@,d(i#nʌ k a("i `a 4`dH,`i *d,n "|fl'f8T#afx.g`lO-$M@PpQ `` UJ EP*(pEpP=$44PPSc[p#p  0p p P !0! 0 6pP `UU U UO U, !Px $$gܖP `p 01   PP p@W:b 0rY \ p@W:b 0bY@  PZ:<b 0OY, pP ص؅圥P `@V:b 03Y  w 1崐  ` 0 PPwpuZp pjUX U](]@Y:$4 0bXxpQGU`dd, PpuQQ U E  bP1 `PU@Z:b 0XPP@U:#3 0bXpqP(PV @⼁`(`pW%Q`P  ( Q(`  r=U p!@ $Ѝ 0p0u P1 P  p `P  Q`U-,`QUE E T P `UP @4 ` P=U$  `Pz P.U  Pu `P@U:  ! 1 0b X㥀\pcp  !Pq000P!  qP@ `P@U: b 0WociwSOwp@-@`PP - (aP(pO- Mp @PP~ `PE  dp@Q  @崀X  QP R   PR p@W:\\!\1b 0fW@  P) 崀@@T: 0 0bKWpX @PT  PP! P Q  7ᴀ@ ЍQ &' W ]    O-MPp,  @P} ` q0t @1 @    q`P_ `@@T:%5b 0V  z@ @ P JP㪠 Z y@T@I  * 0 @@T:TT$T4 0bVypQQ @$P  AQ0  뼐 @ЍQ P @@T:``#`3 0bjV Q9  j @e 㼱 [s 2! P `p[@@@T:"2b 05VpP/ :@弱0@[/ p/ A Tu  2! Pp `TP6 ApT5[@ 0T㴠 1 pDz ! @ᴰ@ nPV `W pG1 @P @Wⴐ ( ذ ppWⴐ@ y @ <P `@Y:XX b 0U @   7kq S Y Gc0H-M ,@P( @ @|Ѝ000/y P @-0 @rO(@)V $@/\O-0M$ `pP@  (,V0 pPD$@g#%"A4O`P,"q`pq (p,pi A p( p p'p p  (@0 p  @S,@@0A$((" ! $%)@@PsA`y''  cqAv'eCE$L$   $`c'@p@  (p  @' @$@ p 0Q ` pP@0 ` 0Ѝ A-RE ` P?@Q @pa(W0 N(LP@D @T:(p@ N>@P@@D ?T @T :0@P@@D ?TT ( NH- K-@P6 `P? q<W (7W (7g)7U( ?W (?'U  8U@D((P ( 2/ PhTP @-0 @9N(@T $@/H-\H- P @-8@ @NPT@DHL@/HO-Mh $X T pP<,`@8 H4\ 0LT0@D@(<@ P4P@0(0 P`L|0 0\Xl ` 8$pxp,PP t `p h圐堰 P p@` ᐰl` G)I +) i)g`&KD`&+G; ' I4 $@ "0 @ 00p` t`0d@匀` @ ` ` 0 to0! 0#2%>'aက0#lc@(0#`@'.`$O%A" "LC "t@ 0|0|x x0@t@`@Z@td dhl @ppp圐 0xP!p0S |@L̅"tP`bp/#D "ࣣ"0@0@P 1Qp'@ p'1FI>0$%CqY"3#M~&P@ "pP "Q 0tP堰吰0 Y0 w)y)Wp%[T+Gp'+Y W IP$K DP% @   P@p P pd@P t P@ p xP| 0OpP%P%R(^&Ap hP%LC p"% @p&^p'O(AR@%\S@$P@ p@@P@@PP0x@^P|PpPሠ[ @P$Pc@P 9xPPU 0/PUX0+DPPU 0/PU$g0] \] $] ] \ \ H-MP Ѝ    0p LP@@ @0 0A=N,ЍЍ`,A-M@(Rp) `PX!@   0Q/ RᵠP?  = `V $PX!@   0Q Ѝ QP   =ЍЍp@-M@0PSP  0 Q  s ro 0;Q Ѝp!2/Ѝp@-0\ 01S  @T0SLD0H-  0 P01S @PUS P200G- PpP`P*@P% `P AP pD U @@1 = D PU  p`PO- M@ APP- Dp@ X PP1  <W   X X  `)pP  ЍA- @p nP  Pa`FW \P PpGW G-xMb儒@`R `tPb8PPbp4Q  剛PP8V `04`PKM8 p 0PP PE U 8  8 P:N N P*8P6 H!T1"0` 04 4PB  P80 0P`80ppW08800`XP40R:MPtPxЍM@8尠M@8 PP8 ` 0P PM@8嗠M@8P8ꫪV < L@/O-M0  4Q 8Q  PP{ QPs 8P |X``4r(pLy(@Xᾚ`  0*peM P(PW*9p7` !0 `U48:YY  0@pT(0( R`PYd@`UC:^= @ T4*Z2* 0Sp8p"pPU(p(PUS4p4p0P0P8P8W PPpP 0P`pU:@ T: T: T *I8 800S P`Z*B PN}`@PU048`᪟ @X@A:P.QBXc/jy[P  " P `J V  0t  ~!P*L@@ $ E`LPP p$ pP ! R PP3P@@3P8`V( p 8`V 4@T U P @ PL@|PߍH X@ pP T !(YD4b@V P p0BPTT y>`+P ` P:D@P@8@ yPK0BPT$T& y>!0BPT%T? y0BPT*T, y>'0BPT)T+ |>& yzP K"~ y0BPTT yb> y`P{Kf VPqK?\ yL@PUꫪ S S R R R (P >tM 4 0H-P @P08PU 4P 48`PU:80O-MbP`0 00SYpp@Qp( pgX  Q{@`Rx@ p 0Rv 0ЍO|P`@~Tn U `W:` fC`pG`PX @PT:`RR p衟p ` P`~Y; JX P  ( X Q  =@ @U  'C XPX@R@-@P   0`[` p  @X J@ QЍ~ P pQ @Q0U@ W  1BY U[}J  \ Ė @- 2A! "@ @0H-P@Q PP  " 00Hp@-@P` VP$p0-P@  P 0S RP0/P *0?c0 3??oPP0/0/R00< B-ptx` PP5}  R l  ` RSJPQ P?e0 3??o80⃑ i`P5I 0 038P?e0 3??oP 0C"P1H RJ@, 5IP?e0 3??oH0 SP RZ 0P@ 5 0S015Y,R0<PR4@@PPrR TP @0!2P4@@@ P5`P_eP 5__oA/A-M Q$ 0S) @ 0A  Q `rPV*`V@@T Pr`U*PU"Pߍ 2RߍA$ O-4MPPZXY((((8 0lGo X(`h$ PZ( ,`<*PښX 0P00Y*Y0 @T p@2/,`P(P $ !1!1[Z WG J@V 0P 8D 0P,`P:ZX$ J)ZX&:`a X) 2/ p 2/q P0P9/PpA IPJ0P9/PpQpD P9/p 9/w P@ P9/PPA@PJ@ P9/P@Af`PFp9/9/qP 9/P`APJ9/P`Q`9/p9/w 0PP@9/P0P`A@ 0PPJ@9/P0P@A(P $ `   0Q 0  ` 0P 0JX* @ p0PpW,6/P (0PP $ !![   Xp0PWO,00P@WJ6/P#J(0P,0P $ !![   X@W!(P $0P,0 !![   X0P,0@pI G P P $ G  0`P0` W0 0GP@JX&FT1P $ F  0P 0V  FPY :Y*TB 0F TY B 0 PFB ,`oZ($]*4Ѝ$$ $0 0kEYzr H-R Q0SP0SHoA-MP @{`P!  P(㷗P p  Q pt 0 DTvA`FЍ $$4/p@-@p$ `P+P V $ A !0Q00  0pp 0%&F H-M@t W *VP PG`V  `VP;P' ) 4S  $3/$0P FP!P(ɣP4S  $3/  B !  PP  Ѝ0H-@p! PP  A !040Q00  000 0%E H-00S     B ! 00 S   0G-M@PA‡ p`P  R Q<PP] $6P* ETEPO Q    Q 0 pS   0 00 P-P(P`PEO Q  p 4 S  $3/PЍPPDQ A/@-@P  Q   RPMp@-MP@U% `PU  4S  $3/$0PH螢P4S  $3/IxPЍp@) G?+;2#mps Q"!'p0#2n0pP<| r p1Rp P Y:I P@! P`堰gQ VQ, Hp!0   Y%*P p [PE<7P Y: P Y: )@P"d 0Aspg@G'v Cr r0 0`P"d @pJ0F0{p{gi``f CpqRd 0`P"d pJ0F0{p{gibCq@tP@d@ `5 Hp0  Y*P p [ P$ Y*Q  [$h Y*Q{  [Qp|GQ0R0d Br Yd* - Q 0 Y0P P  0 ppP `P F>P >T>"PǛЍ8p n p o G-M@p緛`=0   0Pp PpP `P F=P=T="P玛ЍPo n n @-0Sg.)@RT@ @0S\ = H-\ ; R0\p=@-@@T@O O-MBPP@ [0 Pt3P `Q9PЍtPJT 㴊@T@ P X,%A@1̡0T  T L PUJ\g>l 00 {S(qap Q R PUR& `V# R 2pUppq00c00 S5 R `V  RXX0 # Ѝ-00,\ܶH4< D\H- ['HA @-$@@ኚP'7@胚l ݧ0H-P @P  P Pᆏ<@P0K-随pQ `P'   P P:P   1P  PP `@\FTV/@PTP PtPPPP PP PQ UPV0@_@E +Pp`VUTC+)0 O-$MРP) `pP Z Q.  P R (Z p0 +R  06 h 0%'-x"@ P \\"@ ?;R0(0P $Z( <!0o6Q1@ %'0 0p P p !!RA;@XP ppqApZpppW RBr P F P g@ X (( P #`@ 0@IP .0"@0pZp S@ 1@ @$ЍY`\Ա 0H-LP@P5<%0000 @'0 8p@-L`P@`8%, 0@ p ЮH-P@ppP よ`V`  sP x `X 0 P <<  ?;R0(0H `̤ l@-@L  P 4440 0/+S T ( 萭lܬH-P@ࣘppP #`V`  P  gtl0l 0 E P PP P0 0{SpTp(p PP \\A-`P@[ЀP ۇpWp  P  pN/8Pp@0S0`Vb`` `V 0pP@`%9P8Pߍ`\`,@$/+7`  PU Tp pp  0oBC,/7`8P+ @Q T /+o, 0 B(P p  0`& @7P 7  0 @7P 4`0PTPTP@`-00] Y Y K-0M `,C $, C $ RJ0Ѝ0H- X\ @LA@RP R0H-P@<P"|P "X +Q `A B0U0PUO 0 xT O-pXB `Q ЀA`FPR Pnjo `Q ЀA`FP\ P^Z`\PVP @P\_`Q`*PQ@`\APE `RPR @\OR `\P @QРA@DZB!% \ !$ R 0H-Pd@XPLY"@@P  0vP@ 0 L O-TM⒟@ P4 ( T@:Q@/P v*I?PP   I . P PP/Q.QQ/Q @kPs7P @ljpڮ/5+ @_j+PPp`7PqjHmjPJ < uF  h  g > L-3,$P"B!`%0Q&`0p"`x4'p`ć#p2)`*`s1+`,ptr @HuP$` T!@s084@Qr0@ daW 1Qz\xJ\v^tJ}^rPpJ1PnVlJVjUhJUf@04#8@@08#0H@p,0TY0H?o2  $H K 0 H R,PJ X:FV VAU U>^@ 0P4`l Pp PP 1pP^@= 0PX@s 0PH`P4pP0DzAğ0PH`P4pP0HPD`P @xdpPT84`@&Dz1L0U`0` P0E1`0pV pPT0L0PP P^pP0P4`咟\ <00S ok0p4` R p\$꒟@0P4` @\ 0pPX4`04p100SS00B 0P0\0P4` Pp0`0S`4`?;  P(\ 0` P BP8 D( `0RE @ X pD p(P$@ p@(P$p HDP @xTpT($p@'p@p X T t \D  <0P@ 咟V R P 0( P @4` P 02 P V 0SS0P 00 P U 0S S0u5P NTЍPHP Q PA PP5  DP [H @Q5Pp8HH@@pWH)Dg `XP `1P `X`@@'@1T8@H`PHPv PPp@>L 0 0 R @PP 5 Q>mX >˂` UNJ00@!0OKP0p`V# APp@2U PE WP0C 20p_/$0$ RJP!! R }PHQϠ ˌ p`2 P @ pQ`P @PP  PR"<0S  R</+ Q </+20S ?;QrAWP 2S P-00|O-tM@pPQ <Q ` Rg >R `0 A R+A"Q#:Q`@PF@QpXP W AP@@8h0"0,4@ @^P 4@@4A8@ <@Q@ X +@ 0㰡0Q <Q1  R >R5 @p@ `张张@  {*,@Zw P !, p0 A R+A"Q#:Q,@,J@Q] (Q ,Q;QNpAl 4p WRP& ;P,PBX$0P; ,Q8DP3 P0@(0p@ $ lpd@gF밠p >"d0Ao R % /,0,Q J8pQ<0N S,@0 ,,,% `Q %`3P 04F/+0+40QJj8P< aS ,@ X0@ D0 44$!!04a"R(4a  3Q$P F-)࠱ @,@0@^A T?0@LS @ @1+@0+ 0SJ800T<0 0/P@+00@01 @O+0+0SJ80,@P< @/+@,@^040 a   + +QJ 0pSm@Pxj@P@Ϡ㛟ˌ$0 0@@ @T  0S l$0r($0PtЍp2/+ apP)@< p@ @pR/+aP @  0SK t0Sx4. Q`4!a  3SD3`H @PH @P@᠟m P2 ɏpZPzd 0'@Q.0@Pzp z Oc 0*@.0*@P[p{}d 0%`Q.0 & (J/0 !# F[ BQA! A@ `p{ d 0v(PA.0n=/T$Ѝ{p(_d 0]PE.0Wp @"{Š. Jr0pAAjWGQ:@qG!BPBrpPW P0Prp PYp`"1A "#"0`#  !"q/&n`V>0003 P @pp30 0Tp p P1@DPT $p P$ЍE.=k9:Y`bu(\)\°Q(\\ףp= ףSc$IųwsO-M$00, ($p" 0  Sp 7 @|CTbo302(j2C7`qcVBo302@jPtUEa_lgPf'RjX`WP`@rpjoXz^.TЍ@aV[M CEĆVFn 1 Kj[p0#crc1Wpp3S000l!pa2aS003Q?o20021[K0 V` `zj<\#*+ [ HRj pple` ``r`\WXpp3XEP;L P;{jpAf `/00b  P 圀Wp@,$ (Ph05/P |PxPt PpPlPhP 4 q  0!P"0 ( '    0!P"0 $ W p@ 0W0Pp@іP6 q0FSQ- 0S(CP%ʘ0@ ?" " RJ0,$ (p84007/P XQ \PLPHPD P} PJ P (p8,$ < 07/P 0  Ѝ,PX ,PS,(@ UKP, ER,Q/+ ppGHW Q  0P8,$ <8h04/P |PxPt PpPlPhP P8<,R@P}<Py8Pu04h@kꉈ*UUU)\P ף(\rpq  0S S/P/ Č Ȍ$(0c03?c00 R  0 0 3??oP//O-sM0p `Q W!1 0P*[" v*@P$Q QA変O͉Vp|  0`FdQ`Q\QqpqaxaUpP \\ \0 0Q*v,T!QsߍXx( \jjjiiH-M0 0 Ѝ' MH- M 0  0 ЍHЍ/|' H-MЍp@-P@`$( 0@p' O-MM诟P` @X0 V" 0Q΄pPgP +  /?3 0 *V/? 0* PpJPE ↀV/? 0)Qp,v(v娖߈Olvhvdv*pv΍, D0p&6H 0ƍxƍˠƍƍpPJUPX@B p@= Qtc(dH <,p垟0pd4@l$`hp@@DPZU%UT+ `[ J dBQ :X P P  /? 0^)P➟0pU JPۀ``@v P *@`0@@0F P:$Vtv @ZPVP P P P P P P hP lP P P P P P P P P P P P P P P P P P $,<T\P P P P P P P P P P 0P P tP P P P P P P P P 0<T\0P P P 4P P P  `*V 0FP@ QP`P0F Q:xl@Prxt$ ` pl@g# P a_4@ `RMQPKdKP0@ @ Q"p!P0@ Q:+975 @@@/ʌ- ' %ˌ#ˌ!p$PQ xt$ ` p8 Q  PQ l  ddP ̆l  P l `xh@0 A R1@0 A R: $QR xt$ Pg p R PR l0l0 0l0P  php   P l phpP l llY  @  P lPl  l =P ll尰l/ aVX0Pp ppx0Q0Pp l PPPCppUPpFUPC P l  0Ppp'PW h@P {tPh D<@U     P  [@F  P1 l1 P  r   n Q l@1 hP {\@P l =  [  W Q lp @TP&P lP l @P l`p   5  1 P l'Py lyV( TPPep`P@QXFP l  _ 0P& pU@PAq<hP {Ph 0P-lslhTPNP@@/`V  X LGP@0< (psU=P `VX@(pP0) @ +0RBb- PT cPQA110@000 B0 PIB`@@  C @< @<& A_Q dTPP QPB QP D@P`pd0PE R0 `pPd07 U44hih hAh[EQ 00 @U A TP0 Pp`g!h@9  P l@3  P l@-  P lQ lQ lP lP lP l@Tf upUP&`40P.`TQ:`P$xpʌ PXeeG40Q.#p Pll@Qp`sP lDP l =P lE\@X8P lP lP lP l qp -~pPPp`p`@P @PhPXRp^@%4 0`Pp= sP8 @N`t%4 0p' 'Pl llPl llPm l x`\@PVh`X`C U JX uP X@[ Xpʜ/?& 0f$lTPlP@p`PO IR.7 1: p? p6# p-`p# p  R  `P ` 00>u:\TP 0 U `L Q" R R R0."0.!b!0@V+  0^^HR!HS `L 0dHp P \HRH0Q l pd` H \HX @e[nlp`lP@TP @ U QR` XLJD``H\@`V^ V?0P0 ;:p\@P< QE p P?  D T@/  P :pPxx/x? 04#➟Q p P f\@0\[/? 0#Q➟P*    Q  :pQ P p| P 2/? 0"P➟P.     0 Q  :pQ P pL P {Z{ZLL/L? 0"P➟X8pOphpV` V?0P0 ?:\@X? QH  PB ZZ D T@/  P :X/? 0n"➟Q  P gfffphp\@/? 0M"Q➟ ERHTPR?0P0 L:\@X Q  P c D T@/  P :XXX/X? 0 "➟Q  P :TP X  Q6:`X P\@  P, `UZXX 0  S 0:X/? 0!OQ` B 0P00[ o`p`P<X @P@@T@TP8Q:pQ/? 0!P p P UXp 0,00QS0A:X/? 0e!OPw  0P00p pp/p? 0N!Q➟ M `/? 0;!P  P @@D/0  S 03:X/? 0!Qp  0P00j 8@ !^ q0  @WS0Ra 0]pqP`HL0< SAp :X/? 0 O pQ N P  @ p <EP/P3`@E U.P R :X/? 0 OQ   P ! 0`*QQQ`?R0000:X/? 0n OQ 0P00 *0@0S:X/? 0G \@P P \@ 0P! Ep0 s%d X \ 0 R : 0P`3! F00 p0bT X0\0S W  0V0 P  kX p0S pX ➟ ERRR%?0P0 F:p\@P/? 0Qi p]Pc > D T@ /  P :pP.> 0➟Q p4P \@5\@200➟ X@`,X@ S :X -= 0QC  P = K=x ➟XXdP DPPPXP  LPM\@D0Hd0CD0SX0PPX0DX0Pd@p @DR :pP ,< 0-Q pP \LL#➟ d@X0P@@DT@TR:pP ,< 0Q p{P \@ KLk JTK➟ d@PP&; 0R0 u:p\@PP P+P; 0Q6 pB P 0 #p D T@  R :pP *: 0➟Q p P  ➟+ XPPXI8JdTPphpPX@ꄢ p`(ꔣ 6ꨦ tBB;pP X tt#t3 0P #P,  phpphp A8Bpp 儡 W p@PxP pP ߍۍG$ LX    ء $AAp@ᬠ `꜡ ꄡ p `p@p ( P 8 P 蠟 P hp\ %h L \ l   >> 7L8 l883  >\? ??G<4=;p< t::;L ;;L99 6h7@ X t55; $66( l 4 | h h33/ @44H 3<4 23c H-`@Pp 0@O-4M`Pp000@0 $(, `VP$ %P@p Q * 0 @ R0A :$Pnp AZQn   l , , ,   ` H L , ,,,  d0  8L L @*P2 0@ ` Q0@ Q:p}p0A P3@!p0A P:$QDW+:i @@@ca [ YWUpp0A P?!p0A` P:$QOW6:f$Q@ W : `00p 0W` p)YJ* pY : p p00p 0Wp$Q W :  00p 0W`ppW* W : `00pg 0Wp `@W* W : p p00pI 0W@W* W : p p00p3 0W  /  s@W* W : pt p00p 0WoW* W : @_00p W0Y > P b  @W* W : p> p00p 0W  / A @Wj* W : p p00p 0WWU* W : @ 00p W0WA* W : @00p W0W-* W : @00p~ W0 W* W : @00ph 0WW* W : @00pT 0W h   @ W* W\:wW* W : @00p+ W0W* W : @x00p W0rW* W : @d00p W0^@PpW* W : @L00p W0 FW* W*@$W|* W : @000p W0 *Wh* W: @@00p 0Wp@'WP* W : @00p W0@@pW8* W*@W0* W : p p00p 0WJW* W*W* W*W * W*W* W*T*0@PTTX:RgPI X; 0 0P10 !R0!hhhh00P p0p000 P 0@P0@l4Ѝ@H-R R RQ 0p bp Spa A`q0`Q`BS0V0 P0a0p  "!1@0a0$ @ PU:PR0^Ba/a`E0p`pf pSW U0a`V0gfffK-M@`V`PT p?p=Q Ѝ p0p.P *@l&@Ѝ F8`ЍO-MP Y p PE Q  P  #3 0GYY#3 0HOЍp`@+V`pV ,0v !# 3/P`FQЍVP1  AP`FP V`pV PBB QU*PA PU:iP 0    EPPP PVV*  P   nP _Q J Fr!# ,0 3/PPN`FPH V Q `pV    @P!VPP1P@U   +P U  @A,P  5/@PX P @ Ѝ(7p@-P$ @9 * P`U) P`AV ,0 3/PP`VDQ 1/`h@@u\ZPup ` p`@` \p@-@P 0 0VPUpP`@V ,0 3/PP`VDQ p@/@pp'Yp@-@`PX  RUP TPpߐ@-R@אG--@ VP@7 P(0 &,B0`L ' "( Q!UP Upp8 P `UG@ X G: `GWP!"+G@Q '"00@0r pPu @Q P USPO P P# PH P1:ZP5E QH  APP *w4zPE Q%  APP W$JzP E Q  APP PP J PX@P}:  `A"O-M-PMp@P@`P P? PA P`@;Qq  ;H VR R ' @ PD0 qV`@  PЍЍOS@`@@V@H HL P (*( P,p  ,B @D LHD0APA  +3@@ +QA+A ; 0p 0+ " 0 1@ A  C0 PA0U0 @0EBL `q ap S4@08@Jp@ B@c0 VQQA`Q0( $Pp<@ 4X8\@ p`@Q@p `@p CPN 4 BoWR< P0PR P  Y h  !)H Y @> i0 "Q (# "2. ` Q 0   Q -0 +`!S  $Q:8A  ZW Q1 I    *+R 1 S 5C C*  U/ ;; A0B 300 0@GZ,p@`(?aCoc?yPD??$@@?@ 0B E,p;! ;C 000 0@ R #+ ;:;C 00`0`@  S0+;1C (,p3>+=;R  BAK2@KJR& !  BK:KD1000@Z@,pXBA Z,pH `A2A Z,p@T@D0P AHP6JY4 <` @pW= @,p A8@+0BNAB0@;  R +!;;;; C1@;0CNAB000@  R@UP# L36`aQk P (@ W,p{J @v @1`t8 (@TZ T  J@DK Q(@R  P 8 P @88@8 @P  P Q P 8p<0pSD0`'4p  S4@0PWP o  pPQ `S  `  `PP:@ (@@` @jPj VV b`b(@P  @Q+P= 8PP$MV4 RI R 1@@@> @p9Q\013D/@-8Y  P! $(P*< 8P <^ p_ 8P ( P#P6 Tn (`Ph@8 T@0W@ PЍЍ[[ 0PJ 2@8" ,pP` @P`@8pi0PPDPPV   8(@`FP  8 (P @P   ( P`W`CP @! < n (P 8@P@  P pD4$PQ D @ @ 8P  @0PS< Y BoD [JR $P PPRm4P f YXPD6  P: P  x8PV Z.  mPZ(! 8P@ Q (d pH@ `P`40 (P ,pP@ 8P 8(/ P4/0(,pi,p@T@D0P f`,p0(`4P: Y8 P 8( P-@* 9U @1P%9U9D,p0 (t9QR1@@1@[1PPD4P 9U @1DH ,p0(PD \ 8 h < H-Mw  0ЍP/0@ 0A0S' *Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R*0R/q Q/ R0/p@-@PPP P0 0:aP]`P  pH-MP`@opVUDcPPP Q:RtaP PUpЍPPTP@-@P 0 0<P< 0 P @0P c0 $0 P    a8o O-Mlc@T`TT#T3 0|\P ^DPJ p @oᡒW  PLp(P{TPQxPMژ"p0 @PJOPhJPy FA/Q^ ppppp\pppppppphppppppppppppppppppppp\pppppppph'P\PA XuP!  <Ѝ)^[A3wH-MP`@P 0 0iP  pP || |0 0jD P 0p7 0s *0<  Ѝ8@-@P`` `0 0{ P @@ @0 0| P@>p6DH- a@`P i TQU  tXPU P h xxPtPEQLUPP $h `K 4K @ 0H-P @!P:0H!^dPPQ ThH0!S A ,0Hh ! A0蘣 P  lH-   "!rQ"(?or0S"$0""0"!0S    G-?Y ϠP q @a @@P0^U Y `I:P `! 4!P : ]7!P: ]Q& )h0!S  hPPQ h0`!S `hd! P$! 8 4  D  P13P1"0"1P1 3P1 3PA/A /0H-@PPP@0O-M` @R@` [¬P4 P[ PA@Y Z   @P ^*`V p00p60 Q:p[ Q[ЍO-M@` P P@P &Pr r&apW" RPP \gqpWHPa pqpP Bg똡 猁PP$ fPG pT !P:\Q  g1 0RA g  A@[ p`WP gpW3P pPP HPQP LfPЍ\  4 ̝ h@< K-` rW WPF  V:RUPj 1` fP@VPPR5Q:UPR:LY! !P: \lPPQ \fP0!S 4f$!  ؛   0P/00 R @ PA/3/G-P @R !0p`VpAQ B:PI   @@3TAPA+P0 /A 0 Pp``pPpVpp PpW: @` V*p```PVP0Pp0 P:@ @R p@- P0`3P@H1P3TD1""1TB1 3TA1 3TJ  @b R@P SP b 0A5 S>0 R N+b S 1@2@@pK--@P kRT2"pQvV  GH&a@N# 0[C'q0Vv ?oRR0&8Bs R#4B #2@ #1@! R, `@T)w ?oR '(br@T"$2P2`""0`"!0`V" p0 `T @` `@pp0 @ d"7t `W`p`Q 3AA5d# 0` @`pQ2 D+B 0pQ103Q1""1Q1 3Q21 3QJ pppC R /  R/<@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A00ē O-M`PpP"2 0?]U E"P  XЍ@ P+T -T @0T `0T`U` xP0@ Qa@"Q#o*`@P?U  p 0,UK[ [ @pI" !@0PD/0 U:aPDV0U:APD60U.0S+QJQ X P" S @T "/P  P" Sf! @T "Q/@X QppЍA@Q{<a?/ᤐ //l / /4  // //ď //ጏ //T / /  / /  /@/ᬎ @//t / /<  //ᐍ //h / @/ /H-M 0ЍH-@P`p%4#@ W5#0 p@-MP P!`/"/R?#?@@//" !PЍpO-M(@Q [ Z# oo A R>:TZ. T Z7 XB JMT  o `9{xK#T  [n o `  98cT    ^  b*QooA! ^ 0`)T  >7ooAP*`!a9>8.^ nrb9>8.@n pN18g9'0p0@?/P@ P PO ` o R 0^_(㆐Q  ЍQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /W@- 0@ Q<9/ / 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00////Q/R Q/U/Q R Q/R S Q R   //H-Q0S QP Q0S 0Q@-Q0@S Q^ Q0S@@R SU/Q \  \/ R#%U#/!00Q /0H-@Q0S PUQ PP0CU U @SU@0@Q@0@-Q0S AT Q@0CT SUQ/RU / Q#/ Q#/0H-QSPQ00C@QPPPU QPPS P@p@-@Q@S T 0C`PUQ PP@DUU PS `TPUPPpPQPp   ///H-pP@Q`T`` `0 0 W   Q8Ks R US  R/ /p@-P`@Rhh h0 0vQ U T  Qp$ S#%U#/!R  Q0///-R/p@-Md`@ Px`L6L6F6H6PЍp{\~ 0H-MMdd@ddPRP  @P#  @@p |4 v>wH-0 G-M pPdpKXBX`@`PA`` AB+Q8 `````R000!01U0P0 PP0  0  0 Pp$ 3 @- 40 0\TPލ9zaL} % % z*$ Q# ?p# 0 K0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/H-M   j3`QP  Q 1/W  T3N4Py @-0M@ $(,D?P:\ D   1, 6PC0Ѝ@-0M@, $(D?P:5  0 PC0Ѝ@-@4@4/lx H-M00 004Ѝv MH-M 0 00ЍHЍ/P /v v H-@-D@@4@@p j@////// //O-4M@`QPPY`@xP!1 0yx뤑失qAaހ p@`P x @lPP: 0@PQ  0S0 0@ 0R:/`+,($ p dX (4/4ЍTP8///O-M⴪@pP `Q T *: 0U v(PUPp %P T4` 0pxZP8l@H$$P t(0*X? 0H Q 0H Q: P Q 0A0@ Q:~ 0z`xyui`r@`p`n `lljlh0fkd0lQ 0`0PX/UX p(`$`n  c l < C pc( p(t  i 0`0x`|QRpAJ`poP p@WpY  N 0`m\  P `Z<  0 p 7@p4p?o#0Q -0C$AppDD%D5V 0, @zp0`#  @zp` @zp`0000rpRP P P- PW 0  * &2&b @S 09$ . 10a@S `9 0Q00 $ Z:p 0 $  0u! J0  Gc z `:$ 00ap@`R $ p0 $p `s 0$  Y+ I 0 00P` T4`FVZ `  T04 T4  00Zء T `5`4` YP T04 BR  BR T04 BR0W T 4 4pW p$ P T4@Pʩ @ pppyp0p TK \\ \0 0vsʎTP Ѝus  ӹ7^oLaka7KCj j A-@P 0 0:lPX P`ppGX`WڼP 4/Pd h K-@Q" QL QI 0 Q0C pW pBqW s`V`PUpW`W, qW( `V%P 㥎P pP`V QPP R R R RQ O-MM pP( @t@ PIY!  0eQJ`PUff XP  EAP $QЍۍtf e O-MMTa@ PU`p Q RЍۍt ' 2 ' 2- qpqpQ'`0HX'  0ePJ`PUkfhf   0 `oP`` ``e \d Ld O-MM⤏`Pxt  T PP7 P0d `a || Xp0  0 U\ďh@Tu PhpPX` R 0RYR R!RQQ L!RG šP? p. J.s/̌P2JP P  Q%Q Q QQ  QX ǍP  @PZdPh+ ď̏h 0S PQpb!pW 1pP@`sP@ ` 0d0`  PIQ `XU  dp0VpJ΍TpqPpuf【 K P AK.,!J!တ XGQp U A `FU  TJ~d@PP`T̏hX\QP\P,dJ(<$ x_P H L Qp @ Q Q l!1v/0< Q 2 QD 0 18p4qpl@x`W )Pt 07/PU qPE_PPc`  l00 ;NP4 X0/r\D`<@PQ@pP8pPsxt`P\PPPPq `@\ 0AsP P``s GT0 / i\ 0pP],PHX`a8P ;`J (V`J 0ЀTt$4 0J 0\X`T夤XPPdPpЀXP 0Tpd 0d/|@QA)@ (/"|,P PuJh&0+P Ph`P\p% aL  _PX01  JP 0 \h ,0&P`aL  T_PLX0 aL x ^PX0 xhX0Y Le! ,p`  +PJ`  X0R P 0o+@P ~ vPt``儍h -S0 dd- pb`\T\`'LFRPP``8  S0 - .` Xp \L($!  X0L "P `` R0 PP, p` \hYJ \\PP  P t$P``刋h R0 hh+ [p`\h x " XPh 0 0Y ; 8 \LhP% hZPP4  `  XP 0d0ZY P  `P \`L  L v\L X0 9 L\`P 4PYd @P8PcxtX$HTPPP@ꅴd @p $|X66PPgP5J. |J| +PJPP PPP P(@ 㘉P z PJ o  ;+Pu> )WpPQT@ptaJ^ : X2d  )PPp@DhP`q )PmPA ha Y`@ a \a  @X0`hPq R:q )PPA  ,T hI q  R,#Jj)PڴA Xh1 `a   XP0h0Y I$FPDp` Q0 xx$ nUP_ D` $@\`p`!! QX0 `a  p X0 R ` "\ R   y qW )P6t xl0p00 07/PU qPEP P _ $@SP<_ $Pp` P0 # Inp B RP笂h`$Pp` zP0 PP" +@Pd ` Pp` aP0 ! np$$  0 Ǯ`QP Xm ($D@Y$@|htQP=H  RH Z \$@PLP Z<'P#p$ <@U M@J=FEPC`` OXX 0  m4`< &QߍۍknC/$K S {&,O $N KT xR ߢN zhQ L M X _V W@Z <`(W X W۩XX [ ֬Z TW U U V V TV [ P X O G-8MMp`P4@, X0  ;3 ]P 3+T3 /xOPH30 %m@4P8ЍۍmJ МJ / /0H-@ P8 0 Q 0P 0 0ʚ;6eH-(p@ P$Q`` R 0PR@QP@FP@ʚ;P  QC/Rq/0H- M@ (P P(p  ? Ѝ0 Ѝ0PPP Ѝ0 /0H- M@ a(P Pm(p  ? Ѝ0 Ѝ0PPP Ѝ0 \L/MbO-$MM@HPp   T 0k  0  X`PK L ;`P8   ; *`P(L  0f`p%  !P4 , ^ P$ЍۍlPȐ А 0!(/<  |  0t#x s0/?r s0wpp)kPPP`2`$G 8E c|E &ME $E O-4MMp0F`` ;^ R 0.R S@` QQ.AobP0;/ P@ X 0\ Pd(ppP# R($ X 0\ $PPp$ T @ @ p@ pVY (`U DPO $ @H P .PP@X 0\` P^=Pe Q Q Q  X1 R 04S  R PH$P PI T @RT@(P X 0\ PU q [ l]P0P4ЍۍkpPPP Y] U]<P0$ R 0D @ h@ \@ pA O- MMAp`@ &P P Ѝۍrk4P $jP `d+0CPQ1 P@Q$ `E7P  @Q ER @ R``PK  3Q` `y@ ? ? K-AM(@0P `p  V  0iV ` ` 0 P P\P 0@.Pl  ` p`84 0 $QAލjX> WxB/O-TM`刀xp A M P   01i@X YPPPPp W@/P WB WmYk `PP I0 PY[P`JPxp?\z`;\W|PPL A QI A0;[PBJ@ #\ \p \\ P @"` I Q'x p pp\z\\v[@PLV | IPpL   @ETЍP< dA-P`@p p@ Q)``[ Xp[``Pi[P[ qE gA- Pp@` ` A0Rp RQ$[[` P`EV:44 40= 0Gvm[E}YO-MMLP  E[ cU  =  R `@@ lVA@lF5 p@@@m=P P6pBA<̟<`8 … `,(@ Zd d  PQ `` ?O\ H@0_D`S`@0`P)*p WPq0 0 pCWS `4@ @4 /hP `v+0XAP , \8H` @0($$+09AP #P;P  P&  PO  Px  P  P P P,p)   P PX,p P0  P PX,p P (@@@@@@@@(@@@@@@@@@@@@@@@@@@@@@ P P(QPp P P Y Y{0 PO Y% ((;Y$ P  P ;Y yPJ@Y@!P( 0@ P h0 P  Y;Y yQJ@ @P @ ᠥ 08Px  1P,qH l0 P0hP P v @H54  03 @ <0PI X PA PM_oP& 4 y PA >M _^P `D Q 0 Q Q0S 0Q 8PP:4T Q Q QB4E< ,R >P (0< R(P2(P<6P(P%(0P x|8dd  P |du@|!p 0rapφA"x!|3x#%5v 0UUUP" P`P v*gPv.P M4P1 `pHpPP a .PpRW :P@.PPV*GWp 'DQ PH@PdQP   &QߍۍFfarpaip6.intD8 a Lw2P1(/ - 2 0`0 X1 / AL4 K-䁙PJ `Q vP@PU*p AX xp C;!Tx|p ?P ?0H-MA  4PTPP!Ѝ0p@-pM|``lQ  `@@U@ P l QpЍpe<) xG-`PJx pQ v_@@T*p cX" r3P@ 0@ PQP# R!R 0sP@ 0s 0@P O- M`@ܡ X cP  ,t,Pp  P P  }ePr   wePu  peP  ieP  beP  [eP  TeP x MeP ` FeP H ?eP 0 8eP{  1ePw  *ePs  #eP  eP P eP   eP0PdPj 9cfdd` .c[ PQ  cMId cHK:    Z& P ?P? ! uJZ P ?P? ! aJ(PP P P  Ѝ|{|yy{zya|Vyy{7X{o{V{'77{? z zzA-M\aP`@l3h##<10 "=p Q9xq, sMW qixD|0x#T0%0P00L0H\X`H 0Vxp 0 xKP T T000Ѝ?T  pppЍyyxxxH-@PJPQ vO`p`V*p q Q/Pv Q/tK- \R 0pP P U0pUa@V@@TÁV C `@ `@ `@ `@-0@@P @<b  @-@P @<b豪 @-@@P q @-@P q/d O-QMP@P$4 0|IpWll$l4 0=XXbbP P`7P  , P$(`#X:zP(`U#Xt* P P(?Px U_P PP `K_P PX $ P$8 b P U:$`  E Z #P P `L V:   F ZHPQx* Ru ,(`PE$ P$#X:q9 @q @_ qX`   0W G:1pGWB:`GPpR;v `FQpPX V(: bPP FP `Y:  PIPP ;Qߍ(p ; @Qߍ @;|tt29Ltt# p@-M`@P 0 0P   3aP ` >P ${PlpЍp Ѝpap ЍpooZ4$ O-M||x|| p@T ,X@@0(@|Ta TudDPdpHHHHD$D885T pU U X`VDQL PQ Q4' !R6 (Pm PPm pAhV@F5 T&2 /oAo"VT`F`A@DfHy V*P U*'D<P0+[pE  XPE& 0B85,%!~%Q t dTH@8P DR(T섟pʱt@Pp$o0S !<34010StpaVqtq X(:`P 'Pq Qူ1Ȱ@ a:8P PH@A 08P ! B гR @@s娃pQ  ',Qq  Rၰ1P/ 'Pq.*Qpp1%Ȱ 7Pz DAPa`7Pq ! B @@r@Q p@@`^p 7PS @ E@ Q07PI ! Bp  ddqd pXA@P8P,P@-ЍP 'PqnjQ`1`Qp3P @@7P A` PpPp$ЍЍ\{4#$Hp<AЍ753P) @P P p匁 p`hV *PDЍЍ @BЍPR= Ѝ\d\e`eDe,eeeH dd$ ddddddddkmm>nn,ddDaccnpclckXc3@;3QPPtP33H-P)   0  , 0xQp  !R`!X0 P 00<< 0 OOOOOO|OOP/@-@=  R  1S 001l000dA0\00HH @ @@/ 㸓pP4 <@@T:XX!X1b 0  @q000r@0qPU P @TQ@ q0[1 [ [ [P@qW Pp FЍ`[` 2! eP W!000 ۓqWC#)G-pPP G`R  QE@AYt  @tstQ!ڰ 0@? T: 0 08 00EB8  00B00B Qʲ`0V0B0AB BO-dMP 0p $l[@P~ ` 0lPv @`   RG:0p$p`lP(,Z A8 4 <4 :Pⴰ Y.*PMZ{ H0@ <E?L?H??U@A-p@ P`R 0 0l PEu pPuR 0 0r PEu p`pPuW@@ @0 0zEP,;;;:;;|:J;q;O-MpPP$ Q *QPN  R Q  ꀠQ @ `Q< P 02jPP/ pQ: Q pP PQ: 0  Ra  0Pq\ YWph | R pp!l1 073 @p pR  ! 1 0 @p 0@ 0 @T 0 00sFᴠ 8 Q8 (4@RipP ЍObЍp8998j98789O-M4PP34 $ 0`2S D @  A2s2U$ @Z @H XZ允` PY 8P` P P @t#P 0, `PP@`P Y  0!Y $0?=2Qa0s `Qڻ` p`R pR  ?=2 q@"! $p @h# P$ TDp aP T R @C P+0<R !0D0 C P \ WG1 y`:/-"1p@@ `( 0thP ` pᰠ  PᲐY HH!H1 0 㱀I`@ Ѝ "P) `K @d %,D  1X8aZ  D B`` '`4293@3G-MP p|Ppx@(Q`P` 00"# $20e @P n`S <V g@< Y g@ / 0aa03! Q`S!Q  `2`p9 P P O1,P `P& ` V" P!$!8!| 0p@`P  +Q  PQ"4 0@Ѝ `P 5 v<111//O-MM8R`@PLp P@{hpm P, 88PoU Q QP   P"4"x"\ 0pP  PQ/ @QPY <Z p f@< pW f@  / 0aq03! QpS!Q  pC1qQ O QЍ؍%M R/ G-` %!P  JpAP  A  !㴌8qK-MPQ ,@$ p@P $p7`A8PP$ P 0,pPP /-"1pЍKgO& 0V 0*++O-MPy 0p,$,4 0b@`t$4 0e@p@W:#3 0kYPu @@`@Yl wY  p@w[qp`pwAPAU:44#43y 0upP P Y)`ಐY  Q R@pP p@wFp PP B  App@W:"2 0*`@p@W:!1 0TЍu`TV wPTPT Pu@ `p@wqp`pwAAX:!1 0Ypᲀ  P ` @p@W: 0 0ЍЍ,S,\,+,C,++)*3+))*'))'((&"(W(4&K-@P`pPV% W Q! Qp  RpQ R  P0 &e`U Pp Q: P00 ,P  BABX : 0 0J q PV㲀 UU 8@8R&&d$O-Mp (R B@pP U `" `ተP 9dP$ 0dP p 0 P<@@`FpP UV dP ЍЍЍp@- @P0P`d P 0SQ 0`V 0S `Q`! p pO-M(`P@Q  0P]d`PbQ 0PNdPV 张`Ა# 0S 0p[0G ) R-$p q(9 ᲀ᱐R 0㼠'dP/  Hp 0,pp% P /pQ 0pdP  (P$p q$pЍO-M`p @ Q P@Q'PP@P #e!P> [+ (P  P0cP . P$ $ 0PcP   0PP@P P  ᵾ{ Ѝp@-M`@ PpPЍpO- M`pP  Q @0P0P &#  @P. 0  0P% 0PLc@P 0 0P P  Q @@ ЍO-M@P 0 `p  @<\p P0 cpP  RQ 0S R Q Q  0bP{pP !1f 0)Y 0@00``V ||!|1 00s0 `08v@ 0NY` :!1} 0@岐P :฀ ᴐ@?R : 0 0pᴐᲠ`P pḀ<`QpЍW[n{nA-MP`pQ @㰉@!P VY,\\,\\\/H!R*1 PD I0"A&(/ $p``pW`ppW! `WC `pW W4! !2/p W'!  ЍBP " @@W 0"P ! !G 0P Ѝ V Vp$p   0cЍO-$MXBP@p wQ p  p  U U  P 3 `P_ @pU Up `T P  pR   PA w`Q*  0p,mA`P@6`1p@W: 0 0bpV*@ _1 C 0q @O "   ト`D@@ P$ЍHG  uP  '-4 H-4QPW  H-<Q $P8W Ю W H-tQ\P PP  R 4  fizHRHlV ( k/0H-Ml  P\\00 @  0PP,, 0PЍ0ՓȅA-0S  ppp2  P@`p@`p@ R *PU U`PT @-M @***ЍL@-MlP ЍXX@  @ 0 p P ЍX/$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b*/}*/z*/w*/ct*/2q*/n*/k*/9h*/e*/b*/8_*/\*/Y*/V*/S*/ P*/M*/J*/0G*/QD*/A*/)>*/{;*/|8*/#5*/2*/)/*/=,*/)*/&*/"#*/ */*/*/*/////^*/ */*/<*/*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/HB */*/ */~*/{*/x*/Ku*/+/jp*/Om*/hj*/ig*/vd*/a*/ ^*/[*/X*/U*/R*/O*/p/J*/G*/1/ B*/?*/I<*/9*/6*/3*/0*/-*/**/'*Q/"*/!*/*/6*/*///*//7 */>*/ 4T*/@-@h@*/*/*/*/ps_strings missing %s: %s not compiled in ramdiskbinUsage: %s ..., where is one of: chmodmkdirmvpaxrmdir-shchownchgrpdkctlfdiskfsck_msdosifconfigmknodmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfsrrestoreslattachswapctlcugzcatgunzipmoretsetchroot% jM"1Z E#~k#h[ + 1X 4\L#\ d88 ?>{P 7"BH"N6>HT,QP@"Zl[@"0j$ e - kn uG*"<t$v@" pp8". 08"^ Z X y T T    t ##< ı  l 8 E " Y%"$ !X X N`"   !  ?d\="#y"PB:beflnstuvUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] %6d %6s %s: not a regular filemalloc, using %zu bufferHLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected./home/source/ab/HEAD-llvm/src/bin/cp/cp.cpushdnednesp < MAXPATHLENpopdnednesp >= 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written h--).(.!|.@@.. (/28/@@8L/>//"/ E 0K 0@@#d0S2 0@@QL/unblock and -DNO_CONV?lH<0@unable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdout%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input100 0abcfGgHhiklmNnPt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs arrayWarning: %s is not a local %sWarning: %s mounted as a %s %sCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/HEAD-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclnW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted onUsage: %s [-] [-ESsx] [-p string] [name] cannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input file%lu newline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxEScrypt unavailable ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s number out of rangeinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandno matchfilename too longshell access restrictedinvalid mark charactered.hupno previous patterntrailing backslash (\)infinite substitution loopnothing to undoFLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s -> out of memory!usage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory ././@LongLinkFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-c-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'TAPE/dev/nrst0usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tableUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.Link%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*///dev/ttyFatal error, cannot open %spaxXXXXXXXXXX/./usage: %s [-LP] dfiPRrvWxfts_open failedremove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... usage: %s [-p] directory ... bI nI IIIII II :IIIEJZJ1JKJaJ#kJ kJ_}J^}JF}J<}J>J?JJPATH=}-+?=###%%%} ͪ#C"t~'"f" SdSSsY cSSmSSlSSr x"OpSBNnSSv Sb    )!!UUUUUUUUUU2W!UUV VVV!V)V/V4V;V?VCVJVQV UVZV_VPdVjV3MR 6"QP!P~"EOF reading here (<<) document}-+?=P!Pk!PPPP[[n"7"@7"^ZgZmZsZyZZZZ@abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'X+0\l+1 \+1&\+80\+0>\`t+0m\+0t\+0{\(+0\,u# ! # %!e!!  j!J$ W"B##  P^ Z# #8   #u "s ?x!gp5"!k!9!P!]                  H\/_x#@%2_@%h0}_8_<_0`B_tE_?"z XM_h#e)PO_#<)#h -$}U_@g]_ȝ͐"8`s#Xwd_j_@Ll_r_""!"HhȨy_TG !d] d]"]_7#X\x"|]Oؖ!_!_9 @`ˆ#hp}8`TTAlias count botchalias %s=alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionexpecting end of expressionexpecting ':'expecting ')'incr/decr require var nameexpecting primarytoken errordivision by zerodivide errorvariable contains non-numeric valuearithmetic expression: %s: "%s"PeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sOLDPWDunexpected argumentUnable to find current directorystdout: %sCannot determine current working directorygetcwd() failed: %swrite errorinterruptedno execute permissionpermission deniedI/O errorfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too longNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failed: %sPipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss %.4fbcefqrsuvhash: I/O error writing to standard output Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %svVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... [-p] [-v|-V] is a shell keyword is an alias (multiline)... for: is%s a tracked alias for is a shell function is a shell builtin is a special shell builtin : not found %.*s: parameter %snot setnull or %.*s: parameter not set:]not compiled with history supportCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: turning off NDELAY mode sh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dNo current jobsjob not created under job control[%d] %s | %sJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processeslpZnp:more than one -p unsupportedinvalid name: -p '%s'%s readonlygjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d No such job: %sNo current jobNo previous job%s: ambiguousCannot fork (%s)You have stopped jobs. && || ! | if ; then ; else ; fiuntil ; do case ;& ;; esac() { ... }>|>>>&<&<><<...${#LINENO${LINENO${#${(...)$(...)"(([%d] %c %ld Done(%d)Done (core dumped)you have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)too many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadthreadsnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-Current option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c option";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelseelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Bad substitutionno modifiers allowed with ${#var}Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltiodirectnosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALL!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %sbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bgchdirletfalsefcinputrcgetoptsfdflagssetvarumaskunaliasulimitwordexpevalshiftPPIDNETBSD_SHELL20220122 SMALL#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complex%s: invalid field width%s: expected numeric value%s: not completely convertedUsage: %s format [arg ...] : file changed@fHf T!NfRf "Д!HhWf#l! ]fj?" >" If ͪ#)iief:h="gg!g@ug]i gx$h#$^"iLP"g#g_ !"g0g@ P%h#hX9.jjjj j@ @&j6j?jGjgghh h# h3h#h3h2h3 h3h#iiiiimi |i@iuii'!i&hii .h-hhh6h?hhiEh&ih ii@Mh@i Uh hh1i9i@AiIi Qi_hC$^hCdhC$chCM khiiiii i@vhuh~h}hgghhdiscarddsuspeoleol2lnextreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflaglflagillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcolscookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8tandem-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...] HLPRdfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... owner:group|owner|:group ł̂ۂ#)ݦ "~~! $(04!:ET`pvvv@v@v@v@v@w@ w@w@w@w@w @#w@)w@2w@:w@AwGwOwTwZwawiwowuwzwwwwwwwwww@w@wwwwwwwwx xxxx%x/x5xCw;xBxJxQxXx`xexjxxvxxxxxxxxx`xexxxxxxwxxyxy yyy&y/y:yCyuwNyUyZyaywjyryAwGw#U~Y~^~ťf~k~q~w~}~~~~~"!!~!! ~k!~y!,=M~Ɓ/BMR m"pJ 'dz!~'( )u#&B &c&rL l!q!&'#U~Y~^~ťf~k~q~w~}~~~~~"!!~!! ~k!~y! ł̂ۂ#)ݦ "~~! $(04!:ET`p#U~Y~^~ťf~k~q~w~}~~~~~"!!~!! ~k!~y! ł̂ۂ#)ݦ "~~! $(04!:ET`pMACHINEAB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgoralphaluna68kmac68knews68knewsmipspmaxsun2sun68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipsi386ia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%hhu:b%c#%llu:SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyccdvndATAPIjfsflashrumpdEdDk.aXXXXXXre-edit the label? [y]: EDITOR/usr/bin/vimalloc# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zu line %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSApple UFSUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSEnter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' reallocarrLabel name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not written# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] 8؍:.^#TFEOXG5unknown command: %saddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgekeeplabelyes | nosetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. rw%s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Usage: %s device %s device command [arg [...]] Available commands: QRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSdrvctl-commandget-propertiesdevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': unknown command `%c'Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device Select neither dict nor array with `%s' Unhandled type %dDRVLISTDEVDRVLISTDEV: number of children grewArray:=1DZ{ܝ 6 U   Ξ{,fʟ ! # # # $*& # 1 # 223 # 4 # 5N6 # 8Y9_9f:;<=Ϡ@ޠAB.CZDEFGHJ¡LߡMNOPQ)R>SXTaUiVW\acʢde'f;gNhNiNpUq # s # t # ukv # wqxܣ,>_Ӥ"@Riʥ?_gXțצ # # # #  $;N[mԧԧԧ #+CXuƨ0Pk # #  Z"3ǩM # ` # Ԫ)Y0123FSafgiIluvA:b:c:E:r:s:w:z:Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.bad disktabInvalid sector size %zdPartition data not specified-s flag requires a partition selected.Cannot allocate %zd bufferExtended partition %d is not defined.Which partition do you want to change?Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalidMalloc failed%*s%s: "%s" %s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsThe data for partition %s%d is: sysidExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] gbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorscannot opendisk %s%s: bad disktype%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry:"+ ł̂ۂ#)ݦ "~~! $(04!:ET`pn8"`@"_A"8"`@"[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]returning to single-user after filesystem check dfl:nPpqT:t:vx:y/dev/rq%s has unknown file system type./usr/sbinstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!returning to single-user after filesystem check pPqynfx:Cannot use -x without -ncan't take snapshot of %s%s? %s %s? [yn] Usage: %s [-fnpy] [-x snap_backup] filesystem ... FIXED** %sCan't open `%s'Update FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEANMARKING FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** ***** FILE SYSTEM WAS MODIFIED ***** ** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost Files** Phase 1 - Read and Compare FATsInvalid sector size %u could not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockInvalid signature in fsinfo block Unable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors No space for FAT clusters (%zu)%s (%02x%02x%02x%02x%02x%02x%02x%02x) FAT starts with odd byte sequence%s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctas EOFCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Clear chain starting at %uNo space for FAT sectors (%zu)Unable to write FATLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read FATCluster %u in FAT %u continues with %s cluster number %u TruncateCluster %u is marked %s with different indicators, Cluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u No space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectNo %s directory No space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRUnable to read directory%s has entries after end of directory Extend/home/source/ab/HEAD-llvm/src/sbin/fsck_msdos/dir.creadDosDirSectionq != NULLlong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain RemoveDirectory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label size of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clusters%.*s/%s%s/XXXXXXXXXX/dev/rfss%dreturning to single-user after filesystem check  ?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@untitledlost+foundwrong type to dirscan %dNAME=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d bufferscache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblockunknown disk type `%s'DIOCGDINFO on %s failedgeometryPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/HEAD-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z- J e l       ##   x       (8((Ħ(ܦ(((((@(\(t((P((ħ((( ( =1DZ{ܝ 6 U   Ξ{,fʟ ! # # # $*& # 1 # 223 # 4 # 5N6 # 8Y9_9f:;<=Ϡ@ޠAB.CZDEFGHJ¡LߡMNOPQ)R>SXTaUiVW\acʢde'f;gNhNiNpUq # s # t # ukv # wqxܣ,>_Ӥ"@Riʥ?_gXțצ # # # #  $;N[mԧԧԧ #+CXuƨ0Pk # #  Z"3ǩM # ` # Ԫ)Y ł̂ۂ#)ݦ "~~! $(04!:ET`pSFH0eC! צSFU0eC! Hah!IdontNeedEFI)! .! (s*K>;G"8! |nQn- q+C! O! |nQn- q+^! h! |nQn- q+u! ~! |nQn- q+! ! |nQn- q+! p=rGy=iG}! ! ;Mt?! ! mWC 3KOO! ! yD<#*=(! ! 3Dh&" " \ M}-" ." @Mjy֬?" P" -чH~a" -чH!v" ZIчH`@"" IчHA"" IчH! " 2IчH" S'@ )Ѹ" " *1@ )Ѹ" T1x )Ѹ" # [-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Bad number `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedCan't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vUnknown command: %sCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-aglu] [-i index]gi:b:lua %*s %*llu%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: UnusedExtended Pri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?] (active)GPT part %lsUnknown %#xCould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapvmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuUUID changed[-o outfile]o:/home/source/ab/HEAD-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u P: ^: m: < < < < < < <  = @= != -= 5= >= 0G= @P= Y= ^= "#c= n= t= z= @!t" > ziT(#yil_l_l_(?9 ({!l_l_(A ب(B (A (A J!h(B 8(= (? ܪ(= 4(= (= (= (= (D GE D c%  E ʅ"#!E E !JF H(OF E !JF H(!E !E x(E E E E (E E !E !(7!E 7!̮(E ʅ" D ʅ"`F F @F F E ʅ"c% E *T+,X,,\-,`3,35,68G PB(G (8I `(*I !I ()I *I K!I ,(I Y(I 0(I I M(O (O O N* ("H(I (I (I lY("`( O "|N* ("(N ( YK K K K >M >M jN N ljhM hM jK K K "K K K K K 9L K K %s: getifnamein_status inet %s -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %sSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR%s: getsockin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s SIOCZIFDATA input: multicastqueue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sbyteclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediasubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s RATES:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s%s%d%s<%c%c%c %u-%u,%u %u,%uBEBKVOVI: or @ speccan't get net id for host "%s": %sH"x] ] 9H-:"Y  *"#`:"] ;# Y Y kX jY 4X @Y Y g:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point %s: can't read disk label; disk type must be specified%s partition type is not `%s'v w Dw |w w w Gx ^x tx x x x x y Uy hy y y y y z Oz z z z z {  WTWTbSS-mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %s%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]where fsoptions are: illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic number%s: can't read disk label%s partition type is not `%s' (or use -I) -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file SSSWTWTbD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:@я B C F I L N- OÑ SY aj bz c e f h i k m n) o8 rG sX ui 1м|^t0 Non-system disk Press any key to reboot i @@ @h  p p  p p (!`   @   $create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%s%s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: Offset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track -%c %s Cannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d %s: writing sector %u of %u (%u%%) %s: can't read sector %uNO NAME%s: can't write sector %u%s: unknown standard format180320360640720123214402880Can't get disk size for `%s'%s: no default %s%s: illegal %sbps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs="*+,./:;<=>?[\]|Cannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizepollrecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dstpoweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] ] `^ d^ h^ a l^ p^ t^ f x^ |^ ^ ./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NILExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent listcannot open %s: %s Cannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolichardwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |NEW|KEEP%s is not on the tape dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.shell/tcp: unknown servicewho are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). |NAMEFND|MODECHG|REMOVED|TMPNAME|EXTRACT|EXISTEDdfLnqSsTtvG Z s 3 S s  A a MTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGUGHRBD M@dmCLS1@2plbatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowCannot allocate memoryold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad valueprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s DestinationFlagsInternetEncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%daf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspecPFPF0* XXX,,x<<%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY %s by %s: %s/sbin/reboot/sbin/halt-v-x-z-dCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname H 8  8   8 /#) 8  6 8 D V 8 c i x  0 8 8 L L  8  % 8  9 8  I 8  [ 8 g z t 8 g 8 8 8 8  8 ) 0 8 I _ 8 } 8 } 8 } 8 } 8 " 8 4 9 8 G N  _ p p ~ 8 8 8 8 v"O V [ b = secondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfthAabdef:Mnqrwxmalloc regex%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zu, flags 0x%x<%s>, func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! STRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx%07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description)hw.disknamesswaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)KBytesMBytesGBytes%-*s %*s %8s %8s %8s %s DeviceCapacityPriority%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %8s %8s %5.0f%% Total%-*s %*ld %8ld %8ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node "J a ~'u ~' z!h u#. ! ! !***************************************************************************************************************************************************************************************************************************************!!!!!!!TV '!"= ! Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20230516%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. (none)GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdic%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'/home/source/ab/HEAD-llvm/src/usr.bin/ftp/fetch.cfetch_urlrcvbuf_size > 0Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lld/home/source/ab/HEAD-llvm/src/usr.bin/ftp/ftp.csendrequestsndbuf_size > 0Reading `%s'Writing to networkCan't access `%s'Can't chmod `%s'recvrequestReading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. LPSVwrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. FTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumb:46Aab:defginN:o:pP:q:r:Rs:tT:u:vVx:INET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d:%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4K macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longmachineAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-print Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16K)T"%j`")%!,%!x h[#F#/%!!~ -@"%"ww................unknown ACU typecan't open phone number fileunrecognizable host name disconnecting... call abortedhayesminutehourLocal file name? %s: cannot create List command for remote system? [take] cat %s;echo  %d lines transferred in Local command? %s: cannot open chars transferred in [put] cat>%s stty -echo;cat>%s;stty echo  timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcmdimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf %s: unknown variable %s=%-5daccess denied out of core beautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... NetBSD gzip 20240203123456789cdhlVn(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.13failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directory%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] compressed uncompressed ratio uncompressed_name" $#!%Z^\`[_]aOw!Uw!Zw!^w!gw! kw! SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. :?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t! P^!Ǘ!!LESSSECURELESSVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000ltiso|^LESS_TERMCAP_%s$<[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0seek errorread error8bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bUTF-8utf8UTF8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFinvalid charset nameinvalid chardefchardef longer than 256Integer is too bigLESSHISTSIZE.less-history-file:.markLESSSEPARATOR.search.shellLESSHISTFILEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOME"%s less %sExamine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):!done#done|doneNon-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/Pattern not found(P)/usr/bin/.syslessLESSKEYIN_SYSTEM/etc/syslesskeyLESSKEY_SYSTEM/etc/syslessLESSKEYIN.lesskeyLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledXDG_CONFIG_HOME.configWarning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"Input preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xless:vim:vi:ex:set ts=tabstop=LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%sLESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},...skipping... Cannot seek to end of fileCannot seek to end of buffersCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisualback-completeforw-completehomekill-lineliteralword-backspaceword-deleteword-leftword-right#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version line%s: line %d: \x%02xmissing = in variable definitioninvalid escape sequence "\k%s"missing actionunknown action: "%s"LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8;]8;;\Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionMark not in current filem %c %d %s %s Mark not setInvalid mark letter %clog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber too large in '%s'Number is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Msearch-skip-screenauto-buffersclear-screenquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filelesskey-srcquit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollquotesno-keypadold-botfollow-nameuse-backslashrscrollno-histdupsmousewheel-linessave-marksline-num-widthstatus-col-widthincsearchuse-colorfile-sizestatus-lineno-number-headersno-search-headersredraw-on-quitsearch-optionsexit-follow-on-closeno-vbellwordwrapshow-preproc-errorsproc-backspaceproc-tabproc-returnLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %sD"D#D%D'Tab stops and then {}abcdDgGhHilnNpPqrs tw xy !:#=\ %lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c command%lu: %s: filename expectedw commandread commandbranch%lu: %s: empty label%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: extra text at the end of a transform command%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: whitespace after %s%lu: %s: duplicate label '%s'%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: RE error: %s%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: undefined label '%s'%lu: %s: unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] malloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty%lu: %s: \%u not defined in the RE\%c\abfrtv\%03o><@=!:illegal -m option format: %swrite to stderrterminal type %s is hardcopyterminal type %s is unknownTerminal type? [%s] Terminal type? standard error-a:d:e:EIi:k:m:np:QSrsarpanetdialupplugboardTerminal type is %s. EraseKillInterruptset noglob; setenv TERM ; unset noglob; TERM=; export TERM; %s %s set tobackspace. delete. control-%c (^%c). . %c. usage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] G:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] )")"!xh/)")"/%)"!/-)"!  Pd|Dd1L_4oD   ł̂ۂ#)ݦ "~~! $(04!:ET`pcdtK,KKKK LhLLLNNP\P`l`P,RUWWXY]`aabc(c@ccDd ł̂ۂ#)ݦ "~~! $(04!:ET`pSCSIfictioush!,@!!xP1o----------------------------------- - --------------------/boot@//tmp/usr/var!d@@@\AABhBBCCtDDEFGHHMDN`lHNOQQRW_```aaa`@"" " G"G")! A" ! ! ~!! " " " ! !8W" e     # Details for index GPT part -  H x|W"W"W"`@"_A"W"W"z)Z W"Z 8"Z !~W"! Z P8"Z Z !W"L" W"! SFH0eC! צSFU0eC! Hah!IdontNeedEFI)! .! (s*K>;G"8! |nQn- q+C! O! |nQn- q+^! h! |nQn- q+u! ~! |nQn- q+! ! |nQn- q+! p=rGy=iG}! ! ;Mt?! ! mWC 3KOO! ! yD<#*=(! ! 3Dh&" " \ M}-" ." @Mjy֬?" P" -чH~a" -чH!v" ZIчH`@"" IчHA"" IчH! " 2IчH" S'@ )Ѹ" " *1@ )Ѹ" T1x )Ѹ" # X PZ"cZ"{Z"_! Z"AZ"Z"Z"Z" Z"Z"h!!!$vHvv4wwxxxxy@yPyyy(zXzz\}<~`l (̠ԠPdФؤX ///\//(/Could not initialize menu system, please check your terminal type. ExitZeroconf/sbin/reboot -q/bin/sh -i -E/sbin/halt -q%-35s %.50s.tgzgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)/bin/ksh/bin/cshrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdmdnsd+nsswitchNoAdditional packagesaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" <: page up, >: page down%c: Help: exit: x, page up: u <, page down: d >Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 10.99.10 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6FS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.99.10 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.99.10 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.99.10 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.99.10 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media typeWi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesMiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-10.99.10 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.99.10 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed [sysinst: environment variable TERM not set. Dr:f:C:m:p%u:%usysinst: screen too small 10.99.10xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv6hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv6hf/10.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/usr/share/sysinst/catalogsysinstmsgs.usage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Log ended at: %s # Script ended at: %s sysinst terminated. /etc/openssl/cert.pem/etc/openssl/certs/usr/X11R6/usr/X11R7/bin/XDynamic menu creation failed. /tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s %s: failed to open %s collect%s: failed for %s vasprintf(&scmd, "%s", ...)/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filerealloc(argv) for %s:%%.*s%ssysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect failure: %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up/sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5https-_.+!,-_.+!,/%s://%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.greipipgiffaithlo0ppptunnet.inet.ip.stats/sbin/route get -inet defaultiwi/libdata/firmware/if_iwi/LICENSE.ipw2200-fwipw/libdata/firmware/if_ipw/LICENSEhw.%s.accept_eula%s=1%%%02X-a /usr/bin/ftp %s%s/%s%s# Added by NetBSD sysinst 127.0.0.1 localhost.%s %s /usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.conf/sbin/dhcpcd%s -d -n %smanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; donecd*fd*xbd/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-tffs -o async-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-tffs -o log-b %u/sbin/newfs_lfs %s-tlfs/sbin/newfs_msdos-tmsdos/sbin/newfs_sysvbfs-tsysvbfs/sbin/newfs_v7fs-tv7fs/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-text2fs/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /mnt,dp%s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d ,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuidkernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto %stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disks.cmount_disks(size_t)(l - fstabbuf) == num_entriesprogress -f %s -b 1m dd bs=1m of=%s%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)hw.usermem64/sbin/fsck_%s%s -p -q %s%s -p -b 16 -c 4 %s%s -p -c 3 %s -o %s [%llu @ %llu] %s [%llu @ %llu] kern-GENERICdtbgamesgpufwrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug%-30s %s/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %skern.entropy.needed/etc/rc.d/random_seed stopmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/sbin/umount /mnt2/sbin/init/etc/rc/etc/rc.subr/etc/rc.conf/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/etc/localtimeUTCzoneinfo/usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%scat <>%s/etc/rc.conf /etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfsCan't convert to localtime 0x%jx (%s) preposterous clock time /home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../util.cstr_arg_subst(size_t)(t-out) == lenraidctlvndconfigcgdconfigdevice-parentsdmmc/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'get_available_cdsm >= 0 && m <= n/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2 dd if=/dev/random bs=32 count=1 | openssl base64 rndctl -L %s/tmp/entr.%06x %s rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %smount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %sdd if=%s of=/dev/random/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../label.cedit_and_check_labelcnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%llu - %llu %s, %sedit_fs_type_extndx == cnt%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s/altroot/bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /bin/mkdir -p %scd to %s cd %s raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES ntpdatepasswd -l rootchpass -s %s root/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %s/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgin/usr/pkg/etc/pkgin/repositories.confs,^[^#].*$,%s,/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %ssource for 3rd-party packagess,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s /etc/nsswitch.confs/^hosts:.*/hosts: %s/chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu %-50s %-10s/tmp/checkrc.shchroot %s /bin/sh %s 2>&1var %s is %s Could not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi %s (%u)/dev/%s%c/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cdisklabel_set_part_infoinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal errordisklabel_write_to_diskparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:%s -f %s %s '%s' '%s'disklabel -w -rdisklabel -r %sdisklabel_change_geomdisklabel_freedisklabel -D %s%s. %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.cedit_outer_partsparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]select_part_schemestrlen(ms) < totalouter_fill_part_menu_opts(op - opts) >= 0 && (size_t)(op - opts) == num_opts%s(%s) %13s %13s %-4s %13llu %13llu %-4slibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/usr/lib/emul/aout/emulmv -f %s %s/emul.oldmkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/libmv -f %s %s/%s%llu%s %-37.37s %s %s%llu%%%s <%s>%zu %s%-35.35s %c %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.creplace_by_defaultparts->num_part == 0normalize_clones(target-ui) >= 0 && (size_t)(target-ui) == *num (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../partman.cpm_whole_diskpm_from_pe%-15s: %s%-15s: %dpartmanPartman device: %s %s: %u%-20s: %s%dMvg%.2d%-20s: %lli%-20s: %dlvol%.2d%-43.42s %25.24s%s (%s) %s %-56s (%s) %-56s %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llipartitining error %s RAIDframe configuring error #%d CGD configuring error #%d /tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dcgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.conflvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %sdd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt_get_uuid_part_typegpt_get_part_alignmentparts->disk_size > 0gpt_get_part_devicep->gp_flags & GPEF_WEDGE%s_%lli@%llisysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sgpt %s %s -b %llu %sgpt -r show -b %llu %s 2>/dev/nullStart:Size:Type:TypeID:GUID:Label:Attributes:gpt_read_from_diskstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt_create_newgpt_freeparts != NULLgpt destroy %sWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cmbr_get_generic_part_typembr_get_part_devicewedge_dev[0] != 0/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinside_ext_partadjust_ext_partmbr_add_partinfo->nat_type != NULL/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errormbr_write_to_diskparts->geo_sec != 0write_mbrmbr_read_from_diskmbr_init_default_alignmentsparts->dp.disk_size > 0mbr_create_newmbr_freeselect(2) failed but no child died?-s 115200 -l /dev/tty00/sbin/slattach /tmp/ent-mnt.XXXXXXfictious------------- ------------- ----***************************************************************************************************************************************************************************************************************************************!!!!!!!b:ef:l:p:zinput sizegzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipeusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...]  Copyright (c) 2006-2023 Roy Marples@|"bE'!c#d|!eK"f"g}"h"ikl!j)"k"lA m"ngo"p !q r"s"#tƒ"u ṽ"wx"xӃ"zy y"A"B"CɁ"D"E"F "G"H "I?9 J)"K0"LcM9"N?"OH"PU"Q S""T]"Ug"Vq"W{"X"ZVt"1"4"6W!""|g ~"}Ʉ"DŽ"Є""""""" """"%"+" *"C:":":"C"0""K"S"]"j"t"""""""u!>"""""ȅ"х"؅""" u u(u(u  a /@ o"""A "P9 "Q"9#"2"#"ې"define 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt N K"Q"U""Z"a"PT@P HEPT$ @CDHD̗"ח""y "n"ӛ"w""˒"""" "%s: no terminatorcontrol_recvdata%s: no arg buffer%s: no args%s: eloop_event_add%s: unexpected event 0x%04xcontrol_handle1.unprivunpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_handle_data%s: writecontrol_handle_writecontrol_handle_read/libexec/dhcpcd-run-hooksexiting due to oneshotdhcpcd_daemonisedhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: carrier lostNOCARRIERdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquired%s: waiting for carrier%s: IAID %s%s: interface departedDEPARTEDdhcpcd_handleinterface%s: interface updated%s: interface added%s: getsockoptdhcpcd_linkoverflowroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlehwaddr%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %sdhcpcd_signal_cbreceived %s, %sSIGINTstoppingSIGTERMSIGALRMreleasingSIGHUPSIGUSR1renewingSIGUSR2reopening loglogopenreceived signal %d but don't know what to do with it--version10.0.6--getconfigfile--getinterfaces--listencontrol command: %s--helpdhcpcd 10.0.6 %s /etc/dhcpcd.conf:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.0.6 starting%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start[manager] [ip4] [ip6]%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited%s: waiting for an %s addressSTOPPED%s: carrier lost - roamingNOCARRIER_ROAMINGEXPIREdhcpcd_reportssid%s: connected to Access Point: %sDUID %s%s: IAID conflicts with one assigned to %sPREINITdhcpcd_prestartinterface%s: removing interfaceRECONFIGUREdup2 %dpid %d failed to exitdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2dhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to backgrounddhcpcd_handlelink%s: config file changed, expiring leasesInterface options: DHCPv4 options:Compiled in features: INETusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]/var/db/dhcpcd/duidDUID too big (max %u): %sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/eloop.celoop != NULLcb != NULL && cb_arg != NULLeloop_event_deleteeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_q_timeout_addcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initreconfigurevendorclassidleasetimerebindpersistentinform6userclasswaitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrclientidnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrarpingfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivemudurllink_rcvbufnoconfigureread_config%s: embedded config too bigdefault_configunknown option: %s%s: per interface scripts are no longer supportedparse_option%s: hostnamehostname cannot begin with .failed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %sinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundstableprivatetemporaryoption %d requires an argumentadd_environ%s: no assignment: %sinvalid CIDR: %sinvalid IP address: %ssplitv/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/route.crt_headclear0&ctx->froutes != rtsrt_disposert_new0rt_setifrt_newrt_proto_addrt->rt_ifp != NULLrt_freert_recvrtrt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtrt_buildif_missfilterif_missfilter_applyrt_compare_protort1->rt_ifp != NULLrt2->rt_ifp != NULLrt_desccmd != NULL(null)%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d reject%s: %s%s route to %s/%d via %srt_addnrt != NULLchangingif_route (CHG)if_route (DEL)if_route (ADD)deletingrt_delete/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/sa.csa_addroffsetsa != NULLsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_toprefixsa_cmp(sa, &ss.sa) == 0sa_fromprefixsa_toprefix(sa) == prefixsa_addrtoplen > 0sa_cmpsa1 != NULLsa2 != NULLsa_in_init - %s /home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/script.cscript_buftoenv*(bufp + 1) != '\0'*(bufp - 1) == '\0'new_script_runreasonDUMP%s: executing: %s %s%s: control_queueifcarrierifwirelessinterface_orderPATH=%s/usr/bin:/usr/sbin:/bin:/sbinpid=%dreason=%sTESTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truemake_envstatic6%s_%sscript_run%s: %s: WEXITSTATUS %dscript_status%s: %s: %slocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %ddhcp_envoption%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zu%s: SO_RERRORif_opensockets_os%s: SO_USELOOPBACK%s: socket(PF_LINK)/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/if-bsd.cif_carrierifadata != NULLif_routeepairfwefwipvetherxvifif_copysasrc != NULL%s: SIOCGIFALIASif_ifaBerkley Packet Filter/dev/bpf/dev/bpf%dBPF version mismatch - recompile %s %03d %s%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_broadcast_address=%s%s_network_number=%s%s_filename=%s%s_server_name=%s%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s leaseBOOTP%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %sdhcp_bind%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/dhcp.cdhcp_informia != NULL%s: releasing lease of %s%s: %s: short frame header %zudhcp_packet%s: checksum failure from %sdhcp_recvmsg%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sip_addresssubnet_cidrnetwork_numberserver_nameMS %s: using %sClassless Static Routes%s: duplicate xid on %s%s: renewing lease of %sget_leasebootp != NULL%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: if_getmtu%s: if_setmtu%s: VIVCO option too big%s: DHCP message too big%s: truncated packet (%zu) from %s%s: packet exceeded frame length (%zu) from %s%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAK:%s: message: %sIPv6-Only Preferred received (%u seconds)no address givenreject invalid addressdeclined duplicate addressoffereddhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledgedlog_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%s: failed to request the lease%s: waiting for DAD on %s%s: redirecting DHCP message to %sdhcp_readudp%s not founddhcp_openbpfdhcp_readbpfdhcp_start1%s: dhcp_init%s: discarding expired lease%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseread_lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DAD completed for %s%s: DAD detected %s%s: deleting IP address %sipv4_deladdripv4_getstateipv4_addaddr%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifa/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/ipv4.cinet_dhcproutesstate->addr%s: forcing router %s through interface%s: router %s requires a host route( Duplicate address detectedpwpwxxxxVUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B="v܉"C" <I"\c"|S!O"C!܊l"U"BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~\"B)`"Х"ح"i"Щ""="v"C" I"c"S!O" C!@l"U"###=" v8 "p C"  I" c"P S! O" C! l"0 U"h """"""˒"طô"ɴ"!D" ϖ! M ! ̴" ϴ" ܴ" ߴ" " " "ǥ4 """"" """t!"" "-$"!("6x!,"p!C! 0"!A""P"#\"$h"%u"&"'"(")"*"+",Ƶ"-͵"-ڵ".".!/"/7H0"1"2"3"4"5)6"7"8 "9":";"<)"=5">G"?U"@c"[!\w"\"]"^"^"_Ķ"_Ͷ"`ڶ"{"{"|"}"}'}#~&"/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena alnumcntrlgraphpunctxdigit646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d %ju%s%0*jusnap ,archivedsappendschangesimmutableuappenduchangeuimmutable/dev/XtyXX/dev/ptmpqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pid/var/run/,2/ +0-*1. )#'"%56!  !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444   +: UO+Gc9ca.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdaygmtutcwetwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetTokenRingFDDIIEEE802.11CARP10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmesh-o %s: option not supportedMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdskinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZE[ sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Could not malloc for key entry add_new_key: bad type passed inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!/home/source/ab/HEAD-llvm/src/lib/libcurses/refresh.cmakechcsp != &blank 5MS7) bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws acS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9#$ !     rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb n^Gkbskcub1kcud1^M^J%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-TERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdbansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>c_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxonbitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswslacscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczerom  # "  !""$  b A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe     `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @incorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check inflate 1.2.13 Copyright 1995-2022 Mark Adler  #+3;CScsA !1Aa  0@`@@ deflate 1.2.13 Copyright 1995-2022 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,need dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version   L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c             (08@P`p  0@`  0@`/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_object.c_prop_object_externalize_append_charctx->poec_capacity != 0ctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity _prop_object_internalize_find_tag!((*cp) == '\0')?xml !DOCTYPE plist